2CGEA

Crystal structure of an hsp90-sba1 closed chaperone complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEYEPLTKALKEILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKLLYETALLTSGFSLDEPTSFASRINRLISLGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
total genus 115
structure length 405
sequence length 405
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2006-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2cgeA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2cgeA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cgeA02
5FWKA 2O1WA 2O1VA 2IOPA 2CG9A 1USVA 1HK7A 2O1TA 1Y6ZA 2O1UA 1SF8A 2GQ0A 3PRYA 1USUA 3Q6NA 1Y4SA 1Y4UA 2IOQA 3Q6MA 3HJCA 2CGEA
chains in the Genus database with same CATH superfamily
4D3DA 2YJTD 3ORQA 1O0CA 4Q24A 4DR1I 2Q21A 2W6JD 3L41A 3P4XA 3VNRA 3L82B 4P80A 4XSVA 4ZVNA 2ZYTX 1YOVA 1HYBA 1LS4A 2W2XA 3ND7A 1Q0PA 2XYHA 4YXWA 1G3RA 2FWPA 4ZLDA 3WIDA 4D9HA 4F93B 4KEAA 5JEDA 4G0ZA 4YMUA 1AGRA 3DTNA 1KYXA 1KYZA 3CX3A 1VFNA 2DXIA 1XDSA 3A9SA 4KK4A 2IX9A 3IBCA 4MLDA 1BVRA 1R8SA 3FDQA 2IBMA 1G8FA 2ORWA 2YDXA 3CLTD 4MKZA 3RFXA 3ZYCA 4F3KA 2I6FA 5IC4A 4J3DA 3N05A 4J7UA 3BBPA 4CSAA 1VYVA 4LLCA 2AVDA 2LR0A 2QSYA 4ZOLA 3U0VA 2REQB 1ST6A 5DQZA 1D2GA 3RF7A 5C0XB 1OLUB 1NQUA 2P9HA 1XD9A 1JXQA 2QR5A 4GKAA 4JI5B 4N5HX 2YZMA 2YDYA 4BWGA 2EFEB 4DCSA 5COAA 1NJGA 1BU8A 1MNEA 1FP7A 1P1BA 2COEA 1VDMA 5FPHA 4EL5A 1ZM7A 3NHMA 1GXSA 5CIWA 3SP1A 3QBTA 1BRMA 5E6SB 1OV4A 1P18A 4NJMB 5HKOA 1GNLA 1AZTA 4JJGA 1NBAA 1KDOA 2EL9A 2Y77A 4RXUA 4NAVA 2NTJA 4TZTA 3K0HA 2HZBA 2OAQ1 2QTVA 4UBJA 3D4LA 1G5HA 1RP7A 3C8ZA 3AHIA 4JIGA 2DKNA 3IIJA 2WFAA 1XELA 1T36A 1R6LA 2IUTA 1HV8A 3NIWA 1G7CA 1RXIA 2B34A 2GZ3A 3O1IC 3EIFA 3PP8A 4B3IA 9LDTA 3ZDDA 2R6ZA 4YWJA 4H3VA 2ZAOA 1H7UA 1IFXA 1E9DA 1Z5VA 2DSNA 2F3QA 2IYAA 5CM2Z 1GYQA 1NXQA 3O03A 4Q12A 4XM0A 4ND7A 3MCVA 3R23A 3M85D 2WIFA 4E5SA 1TQ4A 5KAMA 4TVSA 1CUBA 3ZIDA 3A1SA 1VYIA 4DR6B 4DR4E 4I55F 4JCOA 4QHSA 4L4YA 4D44A 4G1EB 5JY1A 3BMCA 4FWTA 4NH0A 2GYUA 5F78A 1RADA 3KKOA 2JFUA 4LY6A 2ZCVA 2UYQA 3LAYA 5EERA 4RKRA 2IZ6A 4X6YA 2CXQA 4ZOLF 1OZ0A 2AG1A 2PGDA 2YIMA 4CLOB 3OI7A 1EGAA 1G8YA 2MYTA 1P0QA 1WAMA 3IQZA 4KKVA 5DM1A 2XLVA 3ZOZA 3DGFC 4DVJA 5DTIA 1E2PA 4BP1A 3IPMO 2ECOA 2IITA 2R86A 3BCUA 3IP1A 4MX8A 3RBVA 2OK7A 3UJCA 1PR9A 4DJ5X 2PQ0A 5BW8A 3HU1A 4MV8A 4X00A 1NSTA 4X6XA 2IU6A 5DIFA 1XK7A 4CQNA 3QA9A 3T0GA 4Z3OA 2O8FB 4KNVA 2J5QA 3NVDA 3FUWA 2W2QA 5HG0A 2GN6A 4NC3A 4JBWA 1G21A 3RREA 3V4LA 2E4ZA 3ISJA 5DHTA 4DBVO 1TWAA 5FL3A 3F1KA 1Z5CA 3K0AB 3A4TA 4ZI7B 3EGOA 2ZP1A 1WPRA 4IYRA 3FVRA 1ZD5A 3EJWA 3OHPA 2XBMA 1R8XA 1BW9A 3NB0A 4EO4A 4HXEB 4GXTA 3SI7A 2Q07A 3ANMA 4Q9HA 2OHVA 1FFSA 2XUZA 3EG9A 2E9SA 3UXHA 4TN1A 3RHTA 4NG5A 1H8HA 4ATNA 1BX3A 1MC8A 1Y3CE 4U8GA 3UMSA 5CLIA 1DG1G 2M6SA 3JSAA 4YIKA 4F4UA 4PBSA 1QRUA 3ROZA 4PWZA 2NADA 3J7TA 3LX5A 3QWHA 2PFSA 1QE3A 1LI5A 2QTMA 4LAFA 3M15A 4OI4A 4DRZA 1QZTA 2OLKA 4PSAA 5U4XA 4ZCIA 2F22A 1YIDA 1NHJA 3QVZA 1RZUA 3JQFA 3TX6A 3ASVA 1N6OA 1U8TA 2J30A 1YULA 3INGA 1ZQ9A 5IM4A 3S1LA 4UU1A 3DJYA 1D6TA 4C4PA 1AUPA 1KMQA 1H73A 2FPIA 2QUKA 1SPXA 1UINA 5JS2A 1TYCA 3U0CA 3NBXX 1A9YA 4A82A 4P0PB 1FIUA 5K2MA 4GKJB 2GZ1A 4ACBA 1R5OA 1P75A 1E9FA 2D2FA 2BSXA 4NBUA 4ZN6A 1IL0A 1I2CA 1JMWA 1GVHA 5T4EA 2WU0A 1Q0FA 3ZU6A 1CUSA 1GGJA 3C5HA 1QHHA 4E12A 1XEFA 3GV0A 3KZKA 4OXQA 2PUFA 4WZAE 3NRJA 2XQVA 1OFVA 1TEVA 1TJ3A 2FW1A 1SIOA 2W58A 2ZPTX 4MLPA 1DIAA 4DA7A 5IDWA 5G4KA 3BB1A 4F9EA 3BCHA 1B0UA 2OZPA 1KZHA 1YDIA 4TVBA 2AQHA 1B4DA 1Y6QA 1ZJ6A 3K1TA 4LDJA 2R48A 3E9MA 3GEBA 4S2UA 4IFDC 3ZE8A 1P9OA 3N5CA 3ORFA 2BC9A 1XRQA 2V8BA 4BVEA 2Y27A 4NBQA 4HDOB 5F98A 5MGNA 2JJ1D 1X94A 2X9LA 2VHYA 4GE0A 4MR9A 4QYMA 3EDMA 2AQIA 4X94A 3I61A 1FYVA 4R5MA 4GRAA 3RKSA 1DCTA 3TFOA 3H11B 4OO3A 2IYYA 3H83A 1GYPA 3U3DA 2GDCA 1S2MA 1RTKA 4AIMA 1CQXA 4YACA 4YRCA 2UUCE 2O2CA 2RAPA 3MQ4A 2WD7B 5LQMA 1W25A 3TK1A 4GKJI 4CS8A 3LDHA 1E1MA 3G7NA 2GKSA 4AJLA 5H0IA 5D01A 4LNAA 4L22A 1PV2A 3DJFA 5EJMA 4BVJA 5IX8A 2F9MA 4TWRA 3EFOB 4LZNA 3FOEC 2RONA 3L0PA 3PPWA 2KM1A 4G4SO 5G02A 3VHLB 3PNBA 3KKEA 4EVSA 4UBLA 2ZWIA 6ADHA 3U4HA 4D42A 5JSZA 5SV2A 1VYKA 3D9QX 1PX0A 4JBXA 4J3JA 3PGLA 4J91A 3KR2A 4KLCA 4J49A 4P33A 3RRFA 3GORA 5JSLA 1ZXNA 3GGJA 2YQ4A 3N24A 1EWYA 4CU5A 1NASA 1TQ8A 1ZP6A 4AKSA 1MLDA 4LCHA 5JRAA 1CRWG 3FNFA 4TVKA 3O2JA 3VPSA 2ZRMA 4ZQCB 1L5LA 4W5TA 1U4OA 4U0KA 2Q8NA 3L0CA 4X3PA 3V48A 5LXTA 4DC1A 4C08A 5A6BA 1CY7A 1RCTE 2IY8A 1U2ZA 2IU3A 3CX8A 3GDOA 4PZ9A 4X8LA 4B3SE 2XXBA 4TL7A 3BTSA 5I9BA 3WGNA 4UXHA 2D5RB 1A88A 4IR7A 5BUQA 3T5DA 2PIAA 4MR7A 4WKCA 4MWSA 4KZPA 3SD7A 5AVXA 5KX5B 1ZD1A 1GUDA 1B0AA 1NC1A 1CIPA 1NBMD 2FPXA 4GVLA 4MQUA 4P82A 4PYLA 4RVFA 2GJ8A 4TLLB 4BNHA 4FCVA 4QWWA 3O83A 4PQGA 2RH4A 3JSEO 2E4XA 5BUZA 1Q22A 1Y6DA 3HYTA 4J90A 4RADA 4AJ1A 1ETUA 1GGVA 3NHUA 1RIFA 3ZCTA 1NYQA 1EWTA 1XI2A 3H9UA 2IP4A 4Q4DA 1XKQA 1GFSA 3UV6A 1EFUA 1XB2A 1ZS9A 1Z5BA 1LGYA 2Q45A 9LDBA 1V9SA 1PP4A 1N5DA 3LBIA 2OHOA 3OZVA 3K6RA 3V4ZA 4IJJA 2JHFA 3ZI7A 1M1XB 1YK1A 2ZWVA 3FFWA 1M57C 3E22B 5TT0A 3T4UA 1LSSA 1P0CA 3EMKA 4EYEA 2COKA 4MQFB 4TQGA 5T3WA 3E5RA 3HN2A 2JJMA 1UKAA 2HC9A 4D45A 2WKWA 3OJFA 4IFDD 3PD1A 4RNCA 4YJHB 1X87A 1EX7A 1E0JA 4C7OB 2HQ1A 3A37A 4G1CA 4MUGA 3Q0EA 5FPSA 3K70D 4F91B 2C8LA 2FPUA 3PBKA 5AI9A 3Q87B 2R5FA 3B89A 4GR5A 1Z6GA 1T2CA 4D7AA 3AP1A 3ONFA 2DBQA 5LMUI 3EVBA 4JI2I 4AJPA 4OLJA 3DWFA 4CMHA 3SK0A 1N6LA 1PDWA 2HWUA 3WMFA 5GPGB 4F21A 1ONPA 1P81A 3WB1A 5LP6B 1DAKA 2V74B 5KJEA 4GKKB 1YLMA 3C1OA 3ZIAD 4I55B 1KDPA 3MHPA 4GM1A 2C4MA 2LPMA 3HJAA 2VH3A 2QMOA 3O9VA 3VTAA 6GPBA 3FB1A 4EUKB 3ENKA 5DNEA 5M34A 4N76A 5K3BA 1G0OA 4XQ9A 4WECA 4N48A 1GDDA 3CXUA 4W5WA 3WZLA 4PSVA 3MUFA 9MHTA 3CNOA 5ALWA 2Q6TA 2ZIGA 3CNBA 3C3BA 1CG6A 1J9GA 1GVNB 1NW6A 4L5YA 4MQEA 3T7IA 4EB8A 5KQSA 2IODA 4A73A 3K9GA 4B7UA 4M9QA 1XQXA 4Q15A 5IWAI 1FC0A 4TPKA 2IOFA 3Q98A 1PTKA 1PJ4A 4BGIA 2BDEA 2D8MA 2DT8A 4A8JB 1AKWA 2CUTA 5AKEA 1JRLA 4NYIR 3R8CA 3COWA 4XJVA 2DCUA 3AF6A 4DARA 1BE0A 2QIPA 1OYOA 1OR8A 1XAJA 2QJOA 3OF2A 6AT1A 3FSRA 3WISA 3KNZA 1B1CA 3P27A 4RVDA 1XO1A 4C4YA 1SCDA 4JVSB 4WVLA 5IMSA 2FMTA 3R2JA 2I2AA 3QYPA 1KMCA 3WFJA 5D7NA 1BFDA 1DL5A 2XYGA 2Z58A 1B43A 3EHDA 5AP9A 4ZHQB 1HYEA 1XAIA 4BP8A 1LF0A 1M2GA 3QFRA 3TG2A 1XVVA 2H16A 4K26A 1T8PA 1YJQA 2PWBA 2WLTA 2P1RA 3L8ZA 4NENA 2UUAI 3UYLA 1L4LA 1QPBA 3ZBPA 5C35A 1DDGA 4G5RA 5CDSA 3MHTA 3F5DA 3M1AA 4YL3A 4K9OA 1XCJA 1A9OA 3ZQ4A 1BMFD 2IZ0A 1HSOA 4HWSA 4KYTA 5C2JB 2HY7A 2VJPA 2J85A 2O0KA 4QOFA 3V1MA 1ZIYA 5B6IA 3EZXA 2PP4A 3PVZA 1TK3A 1B3BA 1GEEA 2ZREA 3ITDA 4UM5A 5IUKC 3O39A 1MJGA 3LVRE 3DFKA 4I46A 3L8DA 3QIVA 3QTTA 2ICWG 1E4VA 2C5AA 2JAOA 2R96A 3NKEA 1K08A 3ZQ6A 4WUCA 1QR2A 4U5DE 1ND6A 4H3SA 1APCA 1TE2A 2R9VA 2IH2A 4TZ6A 3P5BA 4X65B 4P4UA 4XVUA 2A1UA 3R0IA 3HYNA 4AS1A 4YJDA 2JJ2D 1QQ6A 1XT6A 3KDSE 3NVAA 3U7JA 2CMKA 3HR7A 4TV8A 4UHJA 3NALA 4IEFB 2C20A 3QY9A 1MT0A 1NWCA 4R2XA 3RT1A 1YCGA 1SCBA 3C6XA 3S29A 4AIRA 4NJMA 4YR7A 3RYCA 4WOBA 4Q7KA 4PO8A 1OROA 3K30A 1D6JA 2Q6IA 4RZQA 1RZRA 3DYIA 5HM6A 1J21A 2UU9B 4QPCA 5HF8A 2Q9UA 4FGUA 4P34A 1S2IA 3OETA 3E9CA 3VI4B 4BE4A 5KHLB 2XCRB 3TXAA 3G8AA 4BNGA 1F7UA 1S4MA 1L2TA 1HYHA 1DQSA 3ZH9B 4DN6A 1HH4A 2J4DA 4DJJA 3HN6A 3TVYA 4F2GA 1FQWA 2QVZX 3RS3A 1JRAA 4CW7A 4E5NA 3RS0A 3VSCA 2AI3A 4GLJA 5CDUA 2YW2A 2VS1A 5J1SB 4N4WA 1ZINA 1DKQA 3G2IA 1ULSA 1A5BB 5TX7A 2VSQA 4WLOA 4R2KA 3ZWKA 4O6NA 4NMLA 1LLDA 4PFSA 3TTSA 2GM9A 1YJ8A 3L1IA 3KETA 2HTEA 4M99A 4U3BA 4JEAA 2BFWA 1X38A 2IRWA 4HFRA 4LE0A 3WC4A 4MS3A 4Y7DA 4PG5A 1HR0I 1GSIA 5HGXA 5IVHA 4Q34A 5DQTA 5DHPA 5DHQA 3U3MA 1ISMA 2CNWD 2AW3A 4YMIA 3SFVA 4UU7A 5FOVA 3Q8MA 3WIBA 2MYPA 4G1BA 3GF4A 4WOPA 4GH5A 4EMSA 3TRHA 5G3YA 3VU8A 3ETGA 1E6EA 4YJGA 5TS2A 2OHFA 1F17A 1SUDA 1W96A 2HUJA 5H1YA 1E7RA 4CCWA 1JSLA 3LUCA 4BE9A 1BTOA 3G5AA 4YWQA 4IVRA 1YZCA 4MVSA 1TB4A 4USKA 4ZPJA 1F5NA 1C1DA 2PNFA 5E7JA 5AVJA 4YC7A 3V9AA 5I4BA 4HQLA 5KNDD 1XEWX 1KAMA 1Q7EA 5AW7A 1LTKA 3G2LA 5BPFA 4IIXA 3FOOA 3I1FA 3DZFA 4JC4A 4LGVA 3TAHA 1IXZA 2I4NA 3RARA 2AP3A 4RAQA 1U0LA 3IO5A 3VO8A 1NJ5A 3QV2A 2CLMB 4ZVPA 3QPWA 3DO6A 4AO6A 4N0QA 4NE9A 3U40A 1X6VA 5AKXA 4N5IX 2CYBA 5IWCA 3KKKA 3FKJA 1I6KA 4Q1FA 2QXYA 2JFGA 5THXA 4OLFA 2IW1A 1JL3A 4GLLA 3ZZMA 2ZYIA 2Y1EA 5HZHA 2H2HA 4GXQA 2O8VA 4JS0A 1AS3A 2VNSA 1W1IA 2C4UA 2F48A 3IE2A 3U6KA 2IEYA 3KEOA 4G4IA 2V7QD 4DCUA 4F06A 5E3HA 3NOOA 1K3FA 2DUMA 1KRHA 3RHFA 1DTWB 4ZOCA 2GCOA 4HLUC 3RCBA 2XL4A 1Q0ZA 3UANA 2AS0A 1RZVA 2IE0A 4V02A 3KQPA 3V1NA 2I0FA 2F3RA 4N12A 2R6FA 2I99A 2UXBE 3EXEA 3GFPA 4GX0A 3AWIA 3B48A 4YMGA 3DTVA 2PKRA 1GD1O 4BO9A 5DDIP 1OR3A 2P6UA 4ARCA 1Z6YA 4NTFA 2XGGA 2VCHA 4HEHA 1T1SA 3CKYA 1XZMA 5BSRA 1EUCB 4MUFA 2OCBA 3BDIA 1M0EA 3P4UA 3URMA 4FHDA 4CDVA 1SHTX 3DZJA 4JL8A 1T3ZA 2H57A 3K4PA 5D3ZA 2PSHA 4CSAC 4NEHB 1QDLB 1KZ6A 4PNPA 5LA6A 1USWA 4MW2A 1P0PA 1Q0QA 3OZIA 2RGXA 1IAQA 1KBQA 3BMNA 4KWCA 4OMFG 1MA0A 1WY5A 5HBRA 2Q29A 1YAJA 5AM5A 1I0IA 3ETNA 4BHTA 4EHFA 2XXAB 4BWYA 3W3ZB 4QO8A 3TCXB 4YJ2F 3TTWA 2RG1A 5IDXA 3EQ7A 3O4FA 3CF6R 1U31A 4P3XA 3B1WA 2DFDA 2MSWA 4M53A 4TS1A 4LY3A 3GUZA 1XN1A 1NN0A 2A2CA 1NI4A 1T5DX 1Z7EA 2WF8A 2H08A 1QDUA 3P3GA 1BW9B 1N3IA 2YWXA 2HLDA 1X7XB 1XJQA 2CNDA 2J3LA 4B7XA 2BHRA 3AL3A 4P31A 4FWVA 4W9NC 1ZC4A 2O3SA 4JI3B 4JIOA 1RABA 2PXAA 2ZB2A 2QG6A 3OO1A 4RFVA 4WA7A 1H2FA 4AIDA 2VWHA 1LKXA 4P7BA 2O57A 2J9UA 4DJEC 1SVIA 4M86A 4DS3A 1CV2A 4BGDA 3HEMA 2Q4RA 3E5HA 3GH3A 1POWA 1KMNA 1DNPA 4DVZA 3KSUA 3GY0A 2QI9C 3QF7A 3NAGA 3RFCA 5HQ3B 5BYKA 3AF2A 3AYXB 3AG4C 1EP9A 1XRNA 2WP8A 3DD1A 3GDHA 1P8JA 4YQEA 2CGEA 2Q6LA 4FBGA 3VO1A 4F5ZA 2YXNA 3KSRA 3OEEA 3PKZA 5KNCA 1RWBA 2PLNA 1Y5MA 1JQKA 3RS8A 4AICA 1FEZA 1P2UA 4Y1EA 5DJ5A 5PGMA 4JTDB 4ZDWA 8MHTA 3UMVA 4ZDJA 4GMXA 1K0UA 1TU0A 2Z4TA 1M75A 4WK2B 4II3A 2E87A 3KJQA 3PGJA 4Z0TA 2IOFK 2PZBA 3JWHA 5B1IA 8GPBA 4MKIA 3LUHA 4GYWA 2CKDA 1X1CA 5I47A 1LWOA 1FFEA 2Z5BB 5JASA 1N4AA 4R8SA 2E37A 3DMRA 4KQWA 5TQJA 4DPXA 4YJFB 5JWHA 1XQWA 4ESEA 2GN1A 1XZCA 5B4VA 3NTQA 1ADGA 1E66A 1TLFA 2DRIA 3FYTA 3K8OE 2L6GA 3KLNA 2J6BA 4G8JA 3DSRA 3TW0A 1WABA 3PZRA 1VCMA 4QFDA 3CF2A 5EZ6B 2YRXA 3AEKB 4U8HA 4P92A 5FEUA 5JSYA 4ZVVA 5B3SC 1GTZA 3G2JA 3MBGA 2WFLA 3KBBA 4HAXA 3S2SA 3FHCB 5DROA 1K3UB 4FFOA 1KKLA 3BWMA 2CB0A 3AUAA 3DVRX 4GOKA 3WY9A 2X0EA 1E3EA 1CK4A 1KYVA 2MSDB 1E6MA 2YFKA 4NE2A 3KR0A 1IEQA 1D2CA 1FU7A 3LD9A 1CVLA 1F20A 4KTTE 3HZOA 3BDVA 3EQ9A 3E61A 3PIIA 3QVMA 4MW4A 3T6JA 5AW0A 1QIDA 5KCZA 1NNI1 3BJIC 3KPYA 4EWCA 3TQCA 1VCIA 3NHLA 1G2PA 1YRLA 3R4CA 4C0JA 4ECAA 3QW0A 1B2LA 1EKXA 2Z98A 4B8ZA 3T95A 2B35A 3DE7X 3NI2A 3KQYA 4GXNA 1IEVA 4W7HA 4TMKA 1L7QA 1WLYA 4X62E 2JARA 2JHGA 2ZYUX 4LC1A 5KVCA 4K3VA 3EB9A 2ZRLA 5CAEA 1MO4A 2Q4OA 3H65A 2B7LA 3NP7A 2CF6A 5BORA 1CEEA 1YVIA 3NNSA 1RC8A 3O55A 1RYYA 4IIJF 1L8AA 2HQSA 3DNPA 1V8DA 3VKFA 3QBJA 2AFIA 4DFDA 3QF4B 9ABPA 2XB6A 7REQB 3FZNA 1M6TA 5FTKA 2ZXFA 2CJYA 3PCVA 2W6JA 3OEHD 3T9AA 1QC5A 5HX7A 1HZZA 4RTQA 3I2YX 2JBAA 3JARA 1WZNA 2J6IA 1V1RB 4MV0A 4E21A 1GAEO 2V7TA 4RMIA 3BE6A 2I4LA 1YF3A 5KOIA 3WKCA 1VIDA 2PT9A 1XC7A 3VYVA 4Y6QA 4E7SA 4V2UA 3ABOB 3GFVA 3MUNA 5I51A 2DB4A 4OCZA 2QRPA 1RI3A 2JCSA 2P2YA 3KVOA 4A8HA 4CFYA 2FPPA 3HDYA 5LLSA 1QMPA 2VTDA 4C4OA 3F98A 4DGQA 4C14A 4J03A 4IINA 2PAFA 1DWOA 2BGWA 4DV5I 2EQAA 4IG9A 2ES4A 5H9WA 1E1QD 2FOXA 3HL0A 3KZMA 1JKJA 2HU7A 4AO8A 4E2FA 3O4RA 3LPLA 3OJCA 5FWYB 2ERXA 2CHFA 1SU7A 2O2JA 2XA1A 4LG1A 2Q4BA 2MTBA 3PX3A 1RC0A 3J80Q 1HE1C 3IDSA 3I2HA 1QIHA 5COQA 1RJ9B 3DXJF 2Z0MA 4JMLA 5AJXA 4DQXA 3W34A 1A41A 1L7BA 4JYAI 3VZCA 2GSWA 1UIRA 1ZK3A 4L2IA 1SF8A 4LUCA 4JLMA 4TL8A 2NG1A 1FXUA 4JB8A 1EK6A 4WJ0A 1UBEA 1AUVA 4GOMD 4Z1MD 2XF2A 4Y3UA 4YT8A 2UU9E 1AO0A 1N3BA 2JD2A 4JLOA 3FHTA 4WFIA 1OXKB 1NLFA 3KU1A 4KR2A 1XDWA 5D8DA 3FTCA 2XQFA 3T7RA 1ZITA 4D5GA 5KINB 5LZ7A 5CHEA 2QGFA 3IEIA 4BECA 4G5GA 3HP1A 5EE0A 5HS6A 1DBWA 1O5HA 1VJ1A 3FUXA 3ZV4A 2G17A 3A6KA 2Q4TA 4ZQEA 4DPMA 1CQPA 3BCRA 1SCKA 1FYDA 2VHWA 2AYZA 1I3OA 2R8YA 2XSZA 3BYZA 4LF9I 4JU8A 4M8IA 4X65E 4W8GA 2A1DD 4GHWA 1R6TA 3OPYI 4NOMA 5DXJA 4EJSB 5BW4A 4RIFA 4AQYB 3UUGA 1U3CA 4PAQA 4QREA 1EE1A 2QLMA 1Y7TA 4Q3NA 5CTJA 5P8WA 5MN6A 1QP0A 3KPJA 2VLIA 3N0VA 3QX9A 3LM8A 2HO5A 4LFCB 1L3CA 1ZK0A 4LYEA 1H23A 1UFRA 4ZJUA 2IERA 4YK5A 2PSEA 1F60A 1ZGZA 4J4HA 2X9VA 1ZNYA 1QCYA 1G8GA 3BIJA 4GD3Q 4NICA 3WYAA 4CWAA 2WVAA 3Q3HA 4PIPA 4MWGA 4CTOA 4MZXA 2PMCA 4MULA 1FPMA 3D3QA 3INNA 4TVOA 5LMNB 1M34B 2UZAA 5C32A 2ZRFA 3FGNA 4N82A 4Q1CA 4MAAA 5CA0B 2WB7A 4YAIA 3FETA 2QYHA 3UFBA 3ZZNA 3NIGB 5JYDA 4JSRA 4F4CA 5TVGA 3HDVA 3KLOA 3W8NA 3KP1A 4CGZA 2O8DA 4XTRA 3RK0A 1CQIA 4KPUB 1WHSA 2V7EA 2YN2A 3LX8A 5B6JA 1E2BA 2YL3A 4R4JA 3AJRA 3FM9A 1E1CB 2O2GA 2CV2A 4X20A 5HNKA 4X6UA 3ICWA 2HV6A 3VVCA 2BUCA 1YR6A 3C4JA 4ZVKA 4G1UC 2AN4A 3A4YA 3A32A 2YWGA 4CIPA 3Q2KA 2J0QA 2EFHB 2B36A 3Q9UA 1FSZA 1X8LA 3AFMA 3QOXA 4OO1D 2XWBF 4LXUA 3O3OB 4DY6A 1H6GA 5DXAA 3GWNA 1DO8A 5JFOA 2FGKA 2VPZA 5A1TA 2BGRA 2DUNA 5M04A 3NXSA 1RMVA 4YR9A 1GOTA 4W1PA 3ZY5A 4FYJA 2QL5A 3EVZA 2H07A 2R751 2ISQA 3DZKA 3R7AA 3RNOA 4OO1B 1DIGA 3DZDA 3R7WB 3RFUA 3FVYA 1VCOA 3JRNA 1TCAA 2GEUA 3QW2A 2PD6A 1RQGA 2G76A 1SK9A 3MYIA 3GWGA 1OI2A 3WO0A 2POQX 1KDTA 2ZIFA 3N1UA 1KVKA 4QFBA 3TOCA 2Q1WA 3KXLA 3LDUA 4XX0A 1OCOC 1UWKA 3D4PA 2CXNA 4PTLA 2Y9PB 4N3OA 1NM5A 2J3DA 1YHZA 1WOLA 3ICVA 1DKOA 2XMZA 3AHHA 1QYIA 2PVCA 4LNUB 4DR5B 5A03A 4X66E 3KT6A 1BGXT 1CDEA 1PT8A 2B4RO 4I9HA 1U2EA 1I32A 3ESYA 4HAYA 3VR2D 1E60A 2ZXOA 2BP7A 2C4KA 2QZ4A 3QITA 2MDTA 4JBIA 5AVQA 5AC5A 1JEYA 3LS1A 3JSXA 3MLAA 1Z0TA 1I6WA 1JHRA 3GB9A 3A27A 3L6CA 3OT1A 1S7ZA 3UMIA 1VIVA 2B8TA 5DRYA 4Y2QA 4PFJA 1DEOA 5HWSA 3NX4A 3ZY2A 3PPYA 4QELA 3SICE 5B30A 3T7KA 1D0SA 2W22A 1TQ2A 3EA0A 3NKLA 5DVWA 1SFRA 5EXSA 2XE4A 3WGJA 5A3JA 4LOHA 2NYAA 2GM5A 2I6XA 3FJ1A 4Q9AA 5WRFA 1DKMA 5HE8A 3VOTA 1OLOA 5JVDF 1VLHA 2OD2A 1X74A 3QTBA 3GP3A 4LRWA 1L1FA 2JEAB 4XIJA 1IJEA 3QA3E 4B33A 1LK7A 5F23A 1UM8A 3CN9A 1TU3A 3EARA 1GGFA 2ZM6E 3GEPA 4CDAA 5CT4A 3FUVA 1ZIPA 3I92A 3IEUA 4MNDA 5EIBD 3A2KA 4WXHA 4FCWA 1QWOA 1EGMB 2NQ8A 5BR1A 4CQMD 3HYRA 4MGKR 2C07A 4L51A 1UG7A 1K5DA 3TLMA 2VTBB 5DW3A 2PH3A 1N2EA 4A8JA 4CEIB 2BEVA 2H7XA 1Z7Qc 2ZBFA 4ZQFA 4IRUA 4MPDA 5KTTA 3ZS9A 1RKCA 2ZWPA 4B80A 4JCZA 4C5AA 4ED4A 2XXAA 3ROTA 1TK9A 1VSUA 3HG7A 3CINA 4DPWA 3NRBA 4KIFA 1OU4A 1R18A 2FMXA 3NDIA 3ATPA 4FS3A 3MT8A 3HTXA 4HNSA 4MDTA 1Y5LA 2GZSA 3W7AA 4E1BA 2ZK7A 4FS8A 2D1TA 1P72A 1Z3IX 3CVXA 3P45A 3IKTA 2X8WA 2MMGA 4FT2A 3OCXA 1DKPA 5E6RA 5ECGC 1GG5A 1ZXBA 1JUDA 1XNRB 4KXXA 3V55A 1I13A 2JBWA 4DL9A 5L0FA 3RIEA 3VNBA 3DE1X 4NOKA 3IOMA 4UUAA 3C8GD 2XCTB 2AXPA 4ZAYA 2X13A 3JATB 3ZLVA 2QE7D 2ZROA 2W2PA 4A91A 2VTEA 3SLKA 4D4KA 3ORRA 1OW6A 4MV1A 1XMIA 3CRW1 2J4CA 4I8XA 5DRQA 1V1RA 4TLEA 2DQ4A 4AMUA 4ZYUA 4LYYA 4JWTA 5TPWB 3I8OA 2KW3C 1NT4A 3IP8A 1JVBA 1KIAA 4G0NA 4AKIA 2Z2YA 4FC6A 9GPBA 1ESDA 3KR1A 3LQ4A 4HAOA 3V8MA 3AKDA 4X1YB 4UBNA 5T4BA 1R37A 4MI6A 4PPFA 5HCNA 4BRUA 2ID4A 2RGEA 4RA9B 1KNYA 2DE0X 3FUCA 2W7TA 1K89A 2E48A 3F8TA 1V9CA 5DS4A 2ODAA 2PMKA 1VKRA 3R0JA 4HNGA 5BVHB 5AW6A 4IGFA 5JNSA 4C21A 3DP9A 5E2IA 2QK4A 1QCZA 3EW7A 2WYUA 1G4US 1QS0B 1KEUA 2PX0A 1I7PA 1KYQA 1T1JA 4U2FA 5AKZA 3HKEB 4V0OA 1QH0A 3VU9B 3W5UA 3FOPA 1P3JA 4GMGA 2JFOA 2A33A 5A6AA 1MX3A 1CJTC 1TU4A 1YRQA 2VI5A 1Z8FA 1J8VA 2AC4A 3FXHA 3D1JA 1KQNA 4F4FA 4GDFA 4Q3KA 3BORA 4NULA 4Q82A 3BICA 4BL5A 2OYCA 3ZBUA 4E6PA 3VVMA 3HYCA 3LGSA 1WV1A 4Y0AA 3RLIA 1D1TA 1ZZPA 1JSCA 2FMFA 2JLAA 4RMGA 4IAOA 3NZKA 1P61B 2AA3A 2JLQA 5H59A 4P9TA 2ZJ8A 3NFYA 3I6IA 4U63A 3QBVA 4RQBA 4ILEA 1FK8A 2QMQA 3O31A 4Q9JA 3VDNB 4FLEA 1FJXA 4R1FA 4AB1A 1E20A 1I51A 4HN9A 4YCAA 1HK7A 2JGFA 1X7XA 3F9RA 2PWZA 2Z57A 4GR9A 4QWMA 1J33A 2IQIA 2YVLA 3JYOA 3LC0A 3MWKA 3WNBA 1AXEA 4N06A 1N6RA 2V1XA 3BXGA 1YARO 5CNJA 4JOQA 3O6XA 4GRDA 3IILA 4B6EA 6CHYA 2AYYA 5I5EA 2XBUA 4TKZA 3IB3A 4N47A 2A5GA 5EMJA 2CUZA 2Y69C 3ZU4A 1SBTA 3OE4A 4ZGBA 1CEXA 2I2CA 2O0MA 1YZTA 2YWFA 5I7AA 4HWOA 2HMUA 1VYUA 4QUGA 3EAQA 1G64A 4F0JA 4ENQA 3K32A 4G2NA 5C7LO 5LMZA 1L4HA 5BSVA 1R88A 1MPXA 5GONA 1LC0A 1JAIA 1H74A 3KALA 3TG8A 5DZSA 2P5UA 5JY6A 3GLFB 4XUCA 5ALPA 2ZDQA 4FZJA 2H51A 2OO7A 1T91A 1RRPA 1EHIA 2P0EA 2TMVP 1RJWA 1IBMB 3GJ6A 2XLMA 1YZQA 4WLEA 1IBKB 1EA7A 3ZQKA 5A9SB 4WDQA 1TT5B 5DHRA 4DCCA 2O1EA 2R6GA 3MMNA 1J1ZA 3LWNA 4D56A 4MINA 4P86A 2OZLB 5E0KB 5H68A 3S0JA 4EYGA 2YY5A 2ODEA 2B1QA 2CK3D 3N2YA 4X3CA 4RYDA 1YBAA 2DY0A 1H4SA 1C2TA 3GFBA 2ZSDA 3T3NA 4O5OA 3L34A 2IYOA 4AQYI 1R0LA 2Z9DA 2B7CA 4MYRA 5K6AC 2Q3CA 5KHOC 5KWSA 2CXPA 3EC7A 3FGZA 1SUEA 1YO6A 3G2KA 1TXGA 2SBTA 2OGSA 2XJ4A 4LISA 1NUSA 3UT0A 3VR5D 1MC5A 5BR7A 3AOUA 1SURA 2O0JA 4OM8A 1VPTA 1IG0A 1XTKA 4I5IA 1YDMA 1YFKA 3VOAA 1E7SA 5LP6F 3WMGA 1SCAA 3LWDA 5A2QA 5AVVA 1XNQB 2PJZA 2UZ1B 3W7BA 4CCSA 1O96B 4AVYA 4Q4CA 2J4FA 1TEXA 4NV0A 4RHYA 4NDAA 3V8QA 4TRMA 3G1TA 5FBZA 4JQSA 3DVQX 1JFTA 2CVFA 4OQEA 1CHDA 1AMNA 1U3FA 1UBJS 3SQLA 2XM4A 2EYUA 5FOSA 4QZVA 1HTWA 4FNOA 2C9DA 4YUXA 1PJZA 2Q0SA 2W90A 4KV9A 1XV5A 4Q7LA 1DKUA 4I4CA 1SG6A 1A82A 2UAGA 5ED4A 1P6UA 1AHHA 2I54A 1XRLA 3D7RA 5LL6R 2Y3DA 3FYUC 4K0DA 1J0EA 2APJA 3NHFA 5D86A 4U0JA 3QKUA 1ZM4A 1JJIA 3L5OA 1XX6A 3DF9A 3QF4A 4WZZA 1H93A 2IVFA 4LHXA 2IX3A 4CGYA 5COBA 3VR4A 4B6JA 2PH1A 3C63A 1QX3A 4MYDA 4AW9A 3DWEX 3ZJUA 3C5WP 2D3WA 4NQFA 2CMDA 3OKAA 2YKZA 4KX5A 5A71A 1ECFA 4RKQA 1NYLA 2LFDA 2A58A 1YR1A 4L5CA 1YA8A 4CMIB 2GO1A 3GONA 4URXR 2GWHA 1U4NA 1DT3A 4UHKA 4INZA 1A4UA 2GBLC 4LJKA 2OV3A 1EEXB 2C4VA 2J67A 2OV2A 4KN6A 2NSJA 1WW8A 2JK0A 3FKQA 1XZAA 3ICOA 4FOSA 3DOCA 4XGRA 3HUUA 1BGWA 5ALDA 4JV5B 1M3SA 4CQMB 2RGWA 1L8XA 4J30B 3DE0X 3OWOA 4BO2A 3D8RA 2Y67A 3H9BA 2FCAA 4QICA 3P4YA 3LG2A 3M1YA 1OYSA 2WUWE 3GFRA 3B3GA 2XEXA 1AKNA 2A1TR 3CC8A 2O0LA 4HYEA 4JEIA 4TXLA 1DELA 3GT7A 5FFFA 1BA3A 1NQ5A 2O8DB 2QQGA 1N2CE 1L7XA 4RF2A 3H4VA 1VL6A 2IYQA 1TOAA 1FUEA 5CA0A 2HMVA 1EEHA 4M1EA 3BL6A 3U19A 2P41A 2NVUA 3PHIA 4UOEA 2RH9B 2FQXA 1Z0JA 2HSWA 3ZC3A 3GLKA 1XDGA 3GD7A 2W2LA 1GCUA 2CHVA 4OYYA 4EKIA 2AG0A 3ZDQA 1NR1A 5BV7A 2VA8A 1O95A 3NT2A 2H5IA 3NC1C 4HX5A 4EF5A 3VH4A 5KVVA 1DCMA 2HJSA 2B94A 3MTBA 4N40A 3ROKA 1J2JA 3HUEA 3O7WA 1EJ6A 4OH7A 3BT7A 1KTVA 3IA2A 4LF4I 1VE9A 2ACKA 2BFCB 3JQBC 4TMZA 4PICA 3VPAA 5I7WA 5AM1A 2ODNA 1C9YA 2GH1A 3A3PA 4I1VA 1NG1A 3Q1LA 4QA9A 1KKHA 4V0ME 5NLLA 3RUCA 1C9KA 4IEIA 4AO7A 3GZTB 3WU3A 1GZHB 4WKOA 4DIDA 4H35A 4EVRA 1ORRA 2FSVC 4O8ZA 2I1VB 2GJ9A 2J3QA 3WA6A 1Y7IA 2UUCI 2VSFA 4EG6A 1C1YA 4XD7D 4AUMA 3DMFA 2HO4A 4BYGA 2QX6A 4J7AA 5IN4A 1JS1X 1YC2A 3D4BA 3E9DA 3P8ZA 1RRGA 3A3OA 2OCYC 2AD5A 4V0NA 4YCBA 2YFYA 4PQYA 4ILKA 4KPEC 2AXQA 3SEOA 3Q6MA 4BJ5C 2ATCA 4C06A 3SHQA 4CKEB 4GGOA 2ZM5A 2EFJA 1N5OX 3QPVA 2ZIXB 1CQJA 4JGGA 4LFCE 4AZTA 1XBTA 4PXSA 5F3WB 1SU8A 3C4VA 3ADBA 3IEMA 3U16A 3UB3A 2LXNA 1ZEMA 1W4LA 3N9IA 4PLYA 3V4VB 3M0EA 1N36E 1TJ4A 2AC2A 2BLLA 3D3KA 3EZ9A 1EQ1A 1RWKA 2HT6A 4DRYA 5K6RA 2DZDA 1GTG1 2F1RA 4PYKA 1QHXA 2JLYA 4UREA 3OECA 1KE1A 4AYTA 3HADA 3U4QB 3CE6A 3QUCA 4AZ0B 5ILQA 3BRWD 3BA1A 3A26A 3T1YE 2F3PA 5DOVA 2OO5A 3MRSA 4JJ8A 4HACA 2IIQA 1GUYA 2HSGA 4BA1B 1TM4E 1VBNA 2JF0A 3TD7A 4HO1X 4K28A 4K9LA 5BSTA 5TR9A 4Q4HA 3A05A 3NCHA 2XITA 4IUBS 1PZEA 1RM0A 1F2UB 3ZXYA 1VPWA 2IXOA 1Y42X 4DSNA 1WW2A 4GU5A 2Q2QA 5F5XA 4BMXA 4XQ0A 3PEEA 2QLNA 2RGNC 3FI0A 4MIYA 3X2EA 3L1JA 1PTJA 3DE9A 1Y9ZA 2PGXA 3G0GA 3K0BA 5K45A 4JMPA 2EV9A 3CBGA 4OUDB 1C0IA 4XWYA 5LDDC 5IKXA 1DAMA 1YI8A 2VHJA 2UU9I 1TW3A 5ELWA 4HTFB 1OJLA 4QXRA 4LF6B 1R2QA 3QVXA 3TNJA 1KVTA 2VHUA 1HLGA 7MDHA 4CLOA 4RPGA 1ZOIA 2AZDA 3BGOS 3TQQA 2O1UA 4KPGA 5DLQC 4HWPA 4JP5A 1CS0A 1FNNA 3ILSA 3GT0A 5J63A 4CR8A 2H4XA 4YGXB 5I3ZA 2RC5A 3PHGA 1HNZI 1UKEA 3CH5A 3NEJA 1H2WA 4TS9A 1B23P 3NKDA 2R7SA 2F3UA 2PSSA 4PHGA 3MLGA 1G19A 1JX6A 1U3GA 3QMWA 1E3IA 1ZG3A 2L2QA 3IPRA 1I3CA 5CNMA 2C8JA 3REOA 3KAPA 5K3CA 3M4NA 4C2AA 4FCCA 2JJ1A 3IUSA 4Q9LA 4YV1A 1QF9A 2H8KA 1YOVB 2QJRA 4HGRA 4XRRA 3VZSA 1GIAA 2JFVA 2HGSA 1RWWA 4UASA 2R4QA 3SHTA 4ZVRA 3OZDA 1NLMA 3TMAA 4GYTA 2EPNA 2QAGC 3KEGA 2QW1A 2R7MA 1WDWB 2V3CC 3QFFA 5T41A 1BX0A 4KPFC 4MR8B 3TSWA 3U9LA 4A9AA 1FB5A 2AK3A 3MTIA 1JMVA 3R0XA 4CEHA 4WEQA 3Q72A 5AVWA 1KK1A 2CZGA 3VF0A 1N2SA 1T5SA 2HIMA 3PUJA 4GKVA 3WMXA 3UG7A 4Z4FA 1NF2A 2WTAA 3OZCA 1SIWA 2GGSA 4BN4A 1BHJA 4FYKA 4PG6A 3ZWVA 2BGMA 4DCJA 5BVHA 4DCPA 5LYJA 4E2WA 2C59A 3MYFA 4EPYA 3PTZA 1WCXA 4YJ3F 4U5EE 5UKDA 1I6LA 2L6FA 3F5SA 5IARA 3NV7A 3W9BA 4UZFA 1W85B 1N7HA 1JG3A 1LPNA 1E9CA 3IDZA 2O3ZA 5AT1A 5IVIA 3ZHCA 1ZYUA 4BWFB 4NPHA 2BCGY 1DXOA 4DUGA 3PC7A 4E22A 2I78A 3DHEA 4JWKA 4BO5A 2C98A 2P67A 1M33A 2F1JA 4GSYA 4KWIA 4UXJA 1QHHB 1CFZA 3L7DA 1QH1B 4KQ9A 4W1QA 3SLGA 3VR3D 1R6UA 3NANA 7REQA 2P2CA 1YQEA 2QOEA 4ZT2A 4WVFA 3T94A 2R68A 1JFLA 3PWKA 1SC4A 4U2KA 1Z5UA 3DNMA 4A4AA 1N8KA 4V0RA 3I6ZA 3WL4A 2Z6UA 1XD8A 5JEAD 1QFSA 1YMVA 2V45A 2ZIEA 4EG3A 4ER0A 4JKIA 1IBKI 1X7YA 1L7RA 2EGGA 2YKGA 4MAMA 3TZ6A 5E6RB 4HFFB 2JZNA 3KXKA 2AB0A 4MHSA 3O8RA 2Y93A 3EIQA 3U5TA 3GJ4A 3R2PA 2XLOA 3M49A 3V8PA 4E17A 4TV9F 2H2FA 1ID1A 1QFMA 3W06A 3B1JA 3KJIA 4DV4B 3M34A 5GJVC 4RV9A 2ZJ6A 4J8PA 5H3HA 1RBZA 4K9SA 1I7NA 5GV7A 1I30A 3WWCA 2UYGA 1M83A 3TRDA 4FN5A 2JGDA 2VF3A 1ZD2P 2QV7A 2R47A 3QFTA 1NHHA 4LDRA 3RG2A 3WLOA 1EDZA 2VH5R 3IHTA 1QBGA 3N53A 4AMGA 4UDNA 4YRMA 2YXEA 2Q8PA 4YFVA 2JD0A 4EW2A 4GQIA 1EWQA 4BVKA 3T6GB 4B3RE 1MAHA 4XX0B 3B1XA 4GC9A 3ZV7A 2V7XA 4JP3A 4M83A 3KYDA 5DH9A 4PAOA 1VSBA 2RCNA 3FKSA 4IHJA 1JAFA 4IGEA 4JI3E 1T01A 1ZVQA 1QHEA 1DO0A 2PBRA 3BFJA 4H7EA 1L5MA 4NNOA 5GV8A 4KO3S 4AJ9A 4JFAA 1ZRMA 3ZVNA 4JRZA 4D9FA 2HXSA 2DEJA 1EDDA 2FW9A 3ZJ4A 1JPJA 2D1QA 4OB8A 2WQZA 3HKEA 4J7CA 2VZLA 1G9TA 3UT5A 3PF9A 4B3BA 1EFRA 1PK7A 5U9CA 2LUOA 1UPCA 4P38A 2WM3A 1NI3A 4CKCA 3HEAA 1UZUA 2MJLA 1V11B 1Q6ZA 3BGSA 3ZVKA 3H4IA 1Z47A 2Q3HA 4H7HA 5A9SA 1P2VA 4FGLA 1AY0A 3Q3EA 2NU9A 2JZOA 1TF2A 3FVTA 4HG2A 3M4JA 1Z0DA 5FYDA 4DM3A 3P0IA 3DW1X 1UT5A 2YOHA 2D3TA 3S8MA 4DR2E 3GA0A 4AE4A 2X4IA 1JBKA 3AZPA 2DYRC 2Q3FA 4MEJA 4RAOA 4GVXA 5FFNA 1ZGGA 4P93A 5FLXQ 4LF7E 3B1KA 3BMOB 5CBPA 1XOIA 2IYLD 1HY5A 1G8PA 1HE4A 4C3OB 5AK6A 1SHLA 1F8YA 4DOMA 2HNKA 4M21A 2MSEB 2FSVA 4XLLA 2ECKA 3TUJC 3WXMA 2VBGA 1V5FA 4JUCA 4CKYA 5BUOA 2H1FA 4Q5SF 3H04A 1II9A 2XCLA 4LVUA 2QYTA 4TTIA 4ZAZA 1UOEA 4FFWA 4RIGA 4Q1VA 4EQ6B 1VBKA 2P7IA 4LHYA 1THZA 1GTL1 2OBNA 3OZGA 3AQ4A 3T15A 5A7FA 4KQKA 4DMRA 1ES9A 2QMUA 3RDPA 4ZDIA 4WPGA 1HXHA 3ZI4A 1LD3A 3PXBA 1VLVA 2R7AA 4XPYA 1LDBA 2IYUA 4BP3A 2IIPA 1UPFA 1XCGB 1J5EI 5B3AA 1XQ1A 1L8OA 4A7PA 1FYFA 5F4BA 1IUKA 5TQ2B 3VDRA 4YRZA 2X3FA 3ZWNA 1Z0KA 1N8NA 3K92A 1OWLA 4L0CA 2WNRB 4CM9A 2J48A 1F06A 1U99A 1UPXA 2A5LA 3CX4A 3IUJA 3NHAA 3O9ZA 4B6RA 4DADA 1WBJB 3A06A 3H97A 4DNXA 2R0QC 1RHKA 3KEQA 4UUPA 1A8QA 2MT9A 4KU4A 4BGVA 1I14A 1IIBA 3DP7A 5LC1A 2NVOA 2G83A 2H8AA 1KBOA 3AY6A 1DUIA 4LE2A 4KDCA 4RVSA 3RVPA 221PA 5LN1A 3NVMB 2AVNA 1XNQI 1OREA 2OBYA 4I55A 2LZ0A 1BG6A 3JQFC 4FDMA 3IRVA 2PZMA 2C03A 5EQFA 5C0XC 5DEOA 2BEWA 4YRJA 4C89A 1TM7E 2VF7A 3BXPA 1G7SA 4Y2HA 5CLLA 4XRGA 5HUQA 1HFEL 2NXCA 5L0IA 4RA9A 5KAPA 1D7AA 1OGJA 3ZEIA 3PICA 1IRIA 4LI3X 3ABQB 4RQTA 4QPNA 3E27A 1CETA 2CSXA 4M9SA 3PWTA 1FJ2A 3WLTA 5KKCA 1Q3HA 3VZBA 1EBBA 2J9BA 4NXMB 4XQ1A 3H13A 1PYGA 4FW4A 3ZTMA 5EWMA 4YHHB 3S27A 1EE9A 1FUKA 1SCIA 3TQIA 2AWOA 4DWVA 1LB1B 2EW2A 4MEBA 4OATA 4D9BA 2R6DA 3E82A 2M6LA 2D0DA 4GOOD 2BKLA 4E31A 2ONKA 2B69A 2CHQA 3FOBA 3GT3A 4E51A 1Q95A 3IUPA 1WXDA 1UQTA 3CRVA 4G5QA 1VCNA 2NOAA 3HXOA 1DADA 3P3EA 1QANA 2AX3A 2AFHB 4DDVA 2PO1B 5BN5A 4P7JA 2FUCA 1XDBA 4P3KA 4EHHA 4CEJA 1RCPA 3CQZA 2VRBA 2IKQA 1FW6A 4IRXA 2HN9A 2DPGA 3MWGA 2DWCA 3KMIA 1E5VA 3EZ2A 3PNKA 3EMDA 4JB0A 4H1WA 1P2DA 5CDTA 1PBNA 1QYDA 1ZLXA 2ZFUA 3OFVA 2I4TA 1JA1A 4OH1A 1ZJJA 3IXQA 1VSVA 4R6WA 1FL9A 2QV0A 2QR2A 4PX3A 4EGCB 2CCYA 3H99A 3IAS1 4PR9A 2WBLC 4G4JA 1L5OA 4OFWA 2ZBGA 4DR3I 3PQ7A 2IXEA 2ZTVA 4Z86A 2PKYX 4CS8C 4BA2B 3HB4X 3QNWA 3CSKA 3PHJA 4H1UA 4RGYA 1NQVA 1JVNA 2QPTA 3PFGA 1OYWA 3P9RA 1GAXA 2G3KA 4OEHA 4TL6A 3T7DA 1JW9B 1ZI6A 3G9XA 4O63O 4RSGA 1YVRA 3W6ZA 3W8EA 1FZTA 3IBGA 1B0ZA 1G8XA 4KUGA 5FTWA 1AE1A 1NXSA 1XZLA 2XMRA 2VK1A 3DZCA 2ZAIA 3H5OA 2ETSA 4FW8A 4RQUA 5LVAA 2NACA 4DKXA 2C37B 5LYJB 4LCBA 3VQTA 4FHZA 4EGQA 1TFOB 4C2UA 4B5LA 2B4KA 4PLGA 1FWLA 4UARA 1NSGB 1NV9A 2C5HA 4JZYA 4P3OA 3ADPA 1FFXA 3B60A 4OK3A 4PG7A 4ITRC 3BILA 2BR3A 3DR5A 1LZKA 2HA6A 2HNAA 2JGKA 2OKUA 5AXBA 3W5BA 4RWZA 4I1OB 1NFNA 5FTJA 3BH0A 2HMYB 4OLBA 3GFOA 1MX9A 1OILA 2AX4A 1PT6A 2FUG6 4Z8YA 1S7GA 1WXIA 1WX1A 2WJGA 1DOVA 4ZJPA 3Q40A 5KU7A 4EIYA 4YCNA 1QLWA 4GBMA 3EZ7A 3GNSA 3LYLA 4EFNA 4CLHA 3NEAA 4D79A 2EGUA 1JWBB 3DEYX 1KL7A 5CT9A 4F6RB 4EAAA 4OHXA 3DB1A 4EB0A 1DTSA 1P6QA 2C57A 5EXDA 4CIDA 3OQMA 3JRTA 2WFMA 3IPAA 2ZIUB 3TSYA 1PD0A 4KRXA 4LRYA 1BVHA 2WA2A 3FGPA 5J23A 2FX2A 3O84A 4KLZA 1SEPA 1BD4A 1MAUA 2IP2A 2ZRDA 2XA2A 5I7HA 2RHRA 2XMCA 4DXLA 2O48X 3W3AA 3L8IA 1M0WA 2PFDA 5FQNA 3W6NA 3J81k 4CTNA 2RHGB 4X61A 4TQ9A 2Z5GA 3EOAI 4PNZA 3TCKA 2V3VA 1J42A 1R6XA 2GESA 5B36A 4BU0A 3LZDA 4AJEA 3II6X 3ZDYB 1IN6A 5F3RA 1HNWB 5LU8A 1II8A 5DULA 3VSDA 2HJVA 3UCEA 4NTAA 3U8PA 3UW3A 3ETEA 4E5PA 1R8QA 4JIMA 3W9UA 1S89A 4RHTA 4ZREA 4I9FA 4N6OA 4BCBA 2DFTA 4YN3A 1A5SB 3IEEA 4MVJF 1DPGA 2FKNA 1E2MA 2VQEB 2H7VC 1Q0KA 1T4BA 3T1HE 3CCCA 4QI2A 4HWKA 2BA1D 5EJ4A 2GXSA 1C3LA 4GKKI 1XUOA 3OKFA 4XX1A 5CLFA 4QQNA 3R24A 3C8HA 4S1PA 2VJKA 2XEDA 2IXAA 1BIFA 1Z73A 4FB5A 5A4IS 2WEKA 1IZZA 4IP0A 2X5KO 2I8CA 5K3AA 3EK2A 4FLFA 1E5TA 3AJ8A 4I9GA 4NXNE 1PW5A 2O3TA 2O7SA 4JYPA 4DPLA 4F7WA 1T13A 2WHXA 5M3BA 3V4RA 1CGNA 3MGAA 1G5QA 4HX2A 5CK5A 3OIYA 5C5IA 1L5FA 2VUUA 4Y2XA 4BFWA 4CI0B 2Z08A 4YMHA 2EJTA 3P2EA 2ODWA 1DGQA 3LKDA 2M64A 4GZ5A 2LDBA 4UEWA 3UAGA 3M6LA 5L3RA 3STYA 4KYUA 3VDMA 1UXHA 3KDPA 4KSYA 3I83A 3CONA 3MTAA 4BNDB 1UEXC 2BCJQ 5B3JA 5ULLA 1XYGA 1KPHA 3CLSC 3DLBA 1TFUA 3KELA 1TVEA 3FMOB 3LHKA 3K9WA 1ZYRF 1EINA 1S2NA 2O8BB 4RTKA 1R9JA 2QW8A 5AVYA 4YO7A 4B31A 4F5EA 2C4NA 2OA0A 1NM5C 1XSEA 3K85A 2N1MA 5JBIA 1MDBA 3ZDCA 4PTYA 4UZEA 3PYFA 3LOUA 3NONA 4F86A 3IHUA 5CB6A 4AYXA 4BATA 3SXMA 2AZTA 2J32A 1MB9A 5IRCD 3BMNB 5FL7A 1G6Q1 5NULA 1BMDA 1IG3A 1NFRA 4BUJA 1FAPB 4NS4A 4BVAA 4YPVA 2D1YA 2O8NA 2QMEA 4DV6B 4E5YA 1E2JA 2QI9F 2VOEA 1QFZA 3WSTA 1YFJA 1U1EA 3WZ2A 1NW5A 1PK9A 1BKYA 2HMTA 4WAUA 1E89A 4X84A 3VUFA 1IQ0A 3DFZA 4CKWB 2I66A 2QAJA 3OX2A 3STXA 4LPSA 2VZEA 5LXTF 1YA4A 2ETXA 1XMOB 2QVCA 1OB5A 2CMGA 2FUKA 4E4YA 4B73A 3OTOI 1RAFA 1SBCA 4AY2A 3VKGA 3IEPA 1UPAA 1PW7A 3UMJA 3H4TA 1WOMA 3UK1A 1RPAA 5COMA 4Q4JB 4E7OA 3TR5A 1EP2B 4ZANA 4F2WA 2GD1O 1P4AA 3LOQA 4IQ8A 2FB9A 4OI2A 4NCHA 5DWDA 4KE8A 2PBLA 3I9V6 4CMEA 3UHAA 1KR2A 4R9RA 1K4KA 1Z4LA 3TLZA 2ZU0C 3WJ2A 3W3AH 2UUCB 3BSYA 1LPOA 1ZCJA 1YQUA 1BCSB 1GPLA 1E4EA 1Q7CA 3G8YA 4PC2A 1UODA 3AP2A 2ZQZA 4OHRA 3W8FA 4AM8A 5KCMA 5K0JA 1JEEA 1G6KA 3A3NA 5BN3B 2QENA 2NTVA 3E7WA 2DM6A 3QVKA 4NU5A 2Z5BA 3T54A 3J06A 3HGMA 3JYLA 4WUVA 5DHFA 3UK6A 4N3BA 2JGRA 2XI4A 5CVUA 1SNYA 5KQMA 4B4WA 1E8DA 4FSHA 4D2IA 1T10A 2OWEA 1YDGA 1C29B 1W5BA 4QAQA 2CHGA 2XUHA 5FBQB 5BP7A 1Q0RA 5TMPA 3DJNB 2YIDA 3PJGA 3IQFA 1AKTA 1AUEA 1C1XB 1M7GA 2Y1KA 3DKKA 4ZARA 5A4MS 1A6FA 1BFUA 4MVZA 4LWOA 4C0AC 1VTKA 1M8KA 4NATA 5AHWA 5JAQA 4Y2GA 3IBYA 4ON9A 2HJWA 2X9NA 2ZTLA 3BWXA 1CY2A 4MUBA 2B61A 5FLKA 5A06A 4US2R 1C17M 1ZKMA 2UXBB 1IZ7A 1LPSA 3MWLA 4N0MA 4AURA 3M6MD 4H15A 4Y1RA 1B7GO 1XTPA 3UN1A 4XTJA 2X40A 4GBJA 4DR1B 3W2GA 1VG8A 3DFMA 4OFXA 1U28C 3GIWA 1FXSA 1NZEA 3OU2A 1XKTA 4ZCSA 4WBNF 4RULA 3IULA 5C7OO 1OIWA 4MV7A 2Q5HA 3UJ9A 3A1NA 2JJ2A 1Z8HA 2FJ0A 3HUFA 2EWVA 3E48A 4ENWA 2DQKA 2UUAB 2XY4A 5FB3A 3RFFA 2VATA 4BJTA 3P76A 1JJAA 3OZ7A 1EK1A 5HKKA 1A4XA 2YLGA 1Z5OA 1UBKS 3MIZA 4B43A 4NY3A 4LVOA 2EXXA 4J4TA 3W77A 1NUQA 4BB9A 1FRFS 5F73A 1F8XA 5JZVA 2XSZD 3AF3A 2YQ5A 2YUIA 4R2HA 1YRYE 2WQ6A 3J81A 3WRYC 3KXDA 2HGZA 3K33A 1M72A 8ABPA 5JDIA 2MU1A 1XRSB 2PTGA 3QI7A 2RHHA 1AKVA 1CR0A 3GR6A 3SJUA 3MS2A 3LP5A 1QPZA 2JLBA 2JASA 1DCKA 2Y6UA 3SXPA 3RIHA 3QT5A 3PUHA 2FN7A 3DQPA 4P98A 4MQ9F 4CT0A 1C1HA 5CNKA 4HTAA 5T6MA 2UUIA 2WWHA 5CYOA 3HB0A 4P6VF 4F84A 5KPDA 1KWGA 4ISCA 1E1QA 3R7BA 3D8HA 2J07A 4TRNA 4QEKA 1NAHA 4WX2B 4E08A 2PDAA 3DMGA 3I01M 4N7BA 3VAZA 3QKRB 1YDFA 2R02A 1ZY2A 2DFNA 1RWOA 2EJUA 2WNIA 2XUDA 1G9XA 1SZPA 4WJKB 2EKLA 1KOFA 4E4RA 3EDRA 2FWAA 5GMEA 2HLHA 3OZXA 2OR3A 3CMMA 4U6SA 5JVDB 3UATA 2Y0EA 3WAJA 2GA0A 1P1FA 3R41A 4JYBA 2HA2A 2QVXX 3T5PA 3MXOA 4LJ8A 2RHJA 1MORA 3P2YA 1QF7A 1T2UA 2IF0A 2QYSA 3LL4A 3GOQA 4FYWA 5F33A 4ER3A 5KEIA 3QYAA 2DKOA 4KPYA 1Z6XA 3HKDB 4QKQA 1ZR4A 1OGIA 5C1PA 5LDHA 2MWMA 1MVNA 2W5UA 2YV1A 4EEKA 3JTMA 2Y3IA 4A27A 3E5NA 2H7YA 1NR7A 2GEVA 2R6HA 4X71A 5IVPA 4DR5I 5LBTA 2BKUA 3A6PC 2CEKA 3K1AB 3KVNA 4MWTA 1DQNA 1HW1A 2D8AA 2PRIA 4O2AA 4PNHA 1N6NA 3O7MA 4PN7A 1BAPA 2ZUFA 4UTOA 1TYZA 1IE3A 2J08A 2ZXWC 4PJJA 1G98A 5FAXA 5CFQA 3PTLA 4BUCA 3KSAC 1W6RA 3WQRA 1W1UA 2P27A 3JPWA 3EJNA 4I3HA 1PUJA 2ZAMA 5D5QA 1O0SA 2I03A 4AX4A 2AHRA 2G82A 3EUFA 2FDCA 1MJHA 4BYMA 2HZ8A 4HVCA 4P8RA 4ENPA 3U44A 2FLVA 1FLAA 1Z13A 4W1RA 3B6IA 5AW5A 1NL3A 3B36A 1M2OA 1Z26A 1OPRA 4H16A 4KFSA 3RRNA 3BB3A 2BJVA 1HMPA 2A5FA 3C97A 5DNDA 1V6AA 1Z2OX 3SQXA 4ME6A 1DXHA 3I04M 4O6VA 2EPOA 1PG5A 1W49A 4FWIB 3AB7A 3EGDA 1NMZA 4C0SA 2R11A 1YZVA 1KI8A 3EWSA 1MUUA 3ONNA 4Q3CA 4JBYA 3JYNA 3HXLA 4ND2A 5D51S 4J9UE 1Z59A 3QUQA 4IOLA 4PHHA 2E89A 3PEUA 4ZT5A 4AY5A 5IAAA 4RTOA 2HCFA 2PA3A 3GLIE 2XVZA 1U7OA 3FW1A 1B42A 2ZKIA 3MMSA 2K87A 4MTLA 5LJLA 5C51B 1R4MB 1JDUA 4D8VA 5TIIA 1VB5A 4YUWA 1HMOA 4DCTA 5I8WA 3AG3C 1T3GA 4RH1A 3IH5A 5CLGA 4R7GA 4P32A 5SZIA 3ZHZA 4DCOA 5FAKA 2WMOB 2FP4B 2JAPA 5I7EA 1N75A 3I2IA 4M3NA 4R2IA 1L6RA 3TZHA 3R5TA 4XKJA 4BXOB 1QTQA 4NI5A 1RFGE 3LNUA 3OHMA 5EZYA 2ZJ2A 3FF1A 3D5QA 5IT9Q 1BKDR 2CLLB 1N5LA 1VJCA 4LGYA 1LSJA 3JY6A 2I1WA 4K81B 2I9KA 5G0VA 3V5XA 1HQYE 1O6ZA 4R9NA 3ZG6A 1FNBA 4NIMA 4A0GA 4CV2A 1TTHA 1E5LA 1Q92A 4S0ZA 3WRVA 4E1AA 1UQRA 1UKYA 1Z82A 5BN1A 1IUPA 2Z9CA 4BEJA 1U2DC 4BO3A 5IJWA 3CRMA 3PDIB 1B26A 4DA6A 4GVPA 5JAOA 5DS6A 1ULTA 4QQRA 2RGDA 3W4KA 1Y3AA 1QQAA 4MDFA 8LDHA 1ULUA 3I2KA 5EJEA 3VR6A 5EP2A 3FDZA 4R54A 2J6CA 3EODA 4G4GA 1N5RA 1NNUA 3L2OB 3P9PA 4OJYA 3WOHA 4EEXA 3BERA 4CMEC 1NBWB 3FTEA 2FPMA 3CUYA 4OX9B 4YRLA 1DC3A 4OK6A 2YVQA 3L7IA 4E0BA 1DE0A 1SOAA 2VXBA 4MW9A 4I4TF 1RMTA 4L7QA 1FLDA 1X80A 4HMQA 1RYEA 4R8VA 4U2CA 1KO1A 3AR5A 4GNRA 2QTWB 2GLUA 4QQ8A 3TIVA 5EXPA 2V6FA 4JVNA 5IAKA 3AIIA 3THYA 4BIMA 1DG9A 4QGGA 5EE9A 5IPFA 2Z2IA 1GQ2A 5AHOA 4X44A 4MO9A 2PX3A 3AHFA 1LSUA 5B2ZA 3DMNA 3NHPA 5IFKA 4HMOA 4INOA 3KX2A 3L8FA 4WBSA 3RVLA 2NVBA 1YS1X 1M10A 3G23A 4Y2JA 1XVUA 3REQA 1JQ5A 3DBHA 4E5UA 5FUXA 1D4OA 3P3CA 2VK2A 2WWGA 2X4GA 2HMAA 4N5MA 3JQRA 4BNDA 4EJ0A 4M1WA 3PNYA 2BM8A 4MPTA 1FU8A 4L0DA 4UC0A 5E3IA 2ZDGA 4FW3A 2WT9A 4MUHA 5TJ9A 1Z6TA 3K1JA 3S2UA 4JI8E 3U3XA 2P2DA 3T5CA 4RWEA 1SUAA 1Z16A 4CMJA 1KMIY 3THRA 3SIXA 1DIBA 2WIGA 4WFJA 3PJDA 3AUTA 4HBGA 3T4RA 1QP7A 3PQ8A 5HOQA 4CDRA 4JUIA 4O4HF 4AJJA 2AR0A 4ALNA 3IT1A 1IK4A 3AFHA 2YRFA 2ZUUA 4UT4A 3H11A 4MMZB 3V2UC 2DHCA 2R5WA 2G5CA 1GO2A 1CNMA 4F46A 2QIOA 1KI7A 5AVTA 4IIUA 2RE8A 4OIQF 1UFVA 1AIPA 2SECE 1Y37A 1CHNA 2F43B 3N2KA 4B81A 1KY3A 2PRZA 3A9TA 3O1HB 4KGDA 4OAQA 5DRPA 1JFFB 3C8MA 2JNWA 2FMIA 2O7NA 4TTSA 4WOJA 3KKMA 2VBCA 5IW8A 5H3CA 4RZIA 3HRKA 3TTTA 2F1IA 5GADl 2B2CA 2GNOA 1XQ6A 3OZBA 3R5FA 1DAIA 3PHHA 1DAHA 1H8HD 1FS6A 1UFKA 5F1OA 4ZCPA 3ZCRA 1F1BA 1SD1A 1QORA 2YV4A 4HDMA 1WTCA 4OIMA 1MJNA 1W76A 2OZVA 4AG3A 4CHTA 4HUTA 3LESA 2B21A 1DOAA 3EVFA 4DXAA 2V9PA 4HDNA 3DT9A 2IVZA 3IUBA 5YASA 3TSZA 3FJYA 4BX3A 4WT7A 3F6PA 2F9LA 2R25B 4PF1A 5KOJB 1PGPA 4U39A 2CUNA 1FKAE 5A6SB 3MOIA 1EG2A 3HSKA 3K9HA 2WG0A 1T2NA 3C98A 1NG9A 2GAJA 4X7PA 1A7AA 1KJYA 3O2NA 3O3CA 4MGEA 4M89A 4XGIA 4E18A 3FNEA 5JCOA 3MGKA 1PWHA 1N1CA 3PKJA 1P45A 1KJQA 1MTOA 1Y4AE 2PBZA 1HFJA 1Z56C 1GUZA 3VU9A 2YVUA 1LPEA 4Q66C 4FYPA 3EXFA 4Q4HB 2WSIA 3IIEA 3ZE1B 3S8YA 4C3EA 1IRXA 1ZVJA 4B6GA 1BDIA 5T3TA 1UQUA 2CK3A 4ZPXA 2IYZA 5LM3A 2I6GA 2EOAA 4FSDA 5TDHA 3ZVMA 1NQTA 3SS7X 4DR6I 1PUXA 1V3VA 2AI2A 2V58A 3PFWO 1SHJA 1J5EB 3FAPB 3KM0A 1BROA 1P2BA 5EE3A 1NXXA 2GK3A 5KOYA 3O8OA 3IQEA 4GUDA 3RU2A 4ZI7F 1F0NA 5KYKA 1J5EE 5T67A 2WWXA 1JN0A 1U1IA 5EJ6A 3SJZA 4A0SA 1Y98A 4E5KA 1HEIA 4Q47A 1GITA 1XHEA 2VC2B 4WI1A 3PD0A 3KLMX 5E4TA 1HG1A 1PF7E 1ZUWA 2Q7OE 1DBSA 3S2YA 4C7JA 3A9VA 3PUWA 3K73O 5EVCA 1IHUA 1KERA 4LV5B 1EUQA 2DR3A 4P3NA 3RYTC 2F8SA 2YHIB 5CT8A 4F12A 3VNSA 4X8HA 4GQAA 3BK7A 2OV1A 1E62A 4E13A 2HQOA 4PINA 1PIWA 2ILVA 4WDRA 1P77A 1U2QA 3B9BA 5G0TA 5IT9A 3QE9Y 1CRPA 2EFCB 2HKJA 2A57A 3WGIA 2P69A 2QN2A 1BDJA 4DNQA 1IHYA 2CV0A 4YJWA 2X6RA 3QP9A 1SVMA 4ULVA 4LDZA 1C3EA 4XUEA 2O8CA 1IBLB 3ILHA 5KQLA 4OHMA 1Y5NA 1KJZA 5FCDA 4EWLA 1FS5A 2A67A 4KKXB 3VR4D 4W1SA 2O6HA 4DDWA 1PD1A 2Z5VA 1IQRA 3OE5A 1SQ6A 2XD4A 5JDIC 1Y8AA 4HDSB 2WUFA 4O4IF 1Y3HA 4FFRA 2ORIA 2EZUA 4Z3KA 3DQQA 3I42A 2I4IA 5BPHA 2ZSIA 3TLBA 3AV0B 4LHVA 1AHPA 1SVLA 4MVJD 1YJCA 2V7QA 1XMPA 5FPKA 1PDOA 3NJ8A 4NJEB 3KAJA 1V8PA 3AF0A 3DT8A 3M81A 4LIPD 4HMPA 3H0KA 4BB0A 4QX6A 2IL1A 4Y2SA 5ECYA 3JSZA 3S2ZA 3ZDEA 1ZM2A 3ZUGA 2JFFA 4W8KA 2V0GA 3OIVA 1JDNA 1Z38A 1MEEA 3DF7A 5EOVA 4UM8B 1MH1A 4UVGA 3HPRA 3VPXA 2VDRB 4BOYA 2LGJA 2LW7A 3CO0S 4QRHA 4DLTA 1N57A 1QG6A 3T8YA 4DCVA 4IZIA 1DBPA 3K8YA 2PLWA 3BK2A 2XWJI 2ZSEA 1KRXA 1F8UA 2QPOA 3MSXA 4BLPA 4UU8A 5ANRB 1E6LA 4Q39A 1KDYA 3VR3A 2IH5A 4MR7B 4UE2A 3EVCA 3BS4A 3U1TA 2DU8A 3KJFA 5DBEX 2NXEA 1OW3B 3ZM7A 1F8GA 3KD2A 4L50A 2EZ8A 2O50A 2C3UA 4B3TI 1IB0A 2YXBA 1JHMA 2AEEA 3UYKA 1U7WA 5I45A 1X9HA 3CA8A 3E3MA 1NT2A 5EL0A 3WGGA 4K88A 2GPJA 1FQJA 1WZIA 2X23A 2Z4RA 5FLXC 1E69A 3IKLA 5C31A 4RM3A 5ALOA 3OLWA 4JJKA 3TL6A 3VYRB 3Q3CA 1ZKDA 4RH0A 2NWQA 3K1IC 4EUFA 5L6MB 3G50A 1JQJC 1NBOA 5C5DA 3HCAA 4C1BA 1RXEA 3FTNA 4XM1A 2VDWA 1DARA 3ERCA 2WKSA 1L7PA 3RANA 1TLLA 2I2BA 4XUDA 4BNXA 5K8LA 2ZI7A 1PSDA 5J2TA 2PXXA 4BC1A 3FCXA 3FI9A 4FBMA 4EGFA 1ZN9A 3DBVO 4COKA 2X5XA 3JVDA 3PTAA 3QK7A 4FJ1A 2NN6C 4WCFC 2BM1A 1P74A 2I7XA 5F7JA 2CLOB 2ZJ5A 1JH8A 1NVWQ 1VFPA 1Z33A 5L3SB 4P52A 3UC9A 3VPBA 3P7MA 1AGNA 2H1VA 1JIUA 3FNQA 4TS4A 3CVWA 3PYMA 3ES9A 4U7FA 5IAGA 4FYIA 4NNJA 1FFHA 3W8IA 4REMA 1XRMA 2ZRBA 1BH6A 2B5OA 3WB2A 5D92A 1XJWA 3KLPX 2J0XA 2ZT8A 4HQKA 4HH3C 5ESDA 1GWNA 1ADYA 3ZWXA 3BBLA 2VDJA 5EIAA 2LRHA 2D5AA 3LBFA 1GR1A 1QE0A 2E85A 1J99A 3AFIA 5KKAA 5C4GB 3SR3A 5GVRA 4P3YA 5B6PA 1YTLA 3R44A 2KC3A 2JIZD 2ZRIA 3FX2A 3IS3A 4HP8A 3MBIA 4RK4A 2VZ0A 2ZLBA 5IJAA 2PZKA 4DDTA 4ODIA 4O2BF 5KNCD 2QTAA 4LCEA 2AZ4A 1Z0IA 3AIKA 3D6FA 4REQB 2OXCA 3SJAA 4IUCS 1QP4A 2FZEA 1X39A 5AW1A 1IN5A 2Y9MB 4DPYA 2C8KA 1P4SA 3PYLA 4PBRA 1HA3A 2FUEA 2QUIA 4LF6I 1E5QA 2W37A 1J9EA 1XQYA 3AR4A 2RB4A 1Y34E 3AI3A 2GKGA 1M1YE 3ANNA 5IK2A 2D0OB 3DE8A 3N8HA 4TTAA 5JFGA 3STTA 3HBLA 3QVWA 1P31A 4ZAXA 3U1YA 1JFSA 1KEKA 1AD2A 2F59A 1XKLA 1Z62A 5CLHA 3DKAA 1FDRA 1NTRA 5ALSA 3H2SA 5CDFE 2I3DA 1GA1A 1QLEC 5ALUA 5GMOA 1OH7A 4B3CA 4G37A 1LV8A 1R9GA 1T3HA 2AKAB 1WXGA 2CVPA 2MSKA 3B7WA 3JWGA 4DYVA 4IO0A 1VHJA 1SA0A 4WD3A 3R7WA 2VYQA 3GEHA 4QDTA 4OQNA 1TYAE 2Z5EA 2FEOA 2HD4A 4TUYF 3UKOA 1FCJA 4LN1A 1YAHA 2WM2A 4OQLA 4YV2A 1ECGA 4BLOA 4BNKA 4ZAGA 1XZFA 3ROEA 4BO7A 1ZHHA 1CB0A 3BGIA 2A9QA 2XNKA 2ZD9A 1JECA 1TECE 2EP5A 2ZE7A 3DXXA 4LA4A 5LL6P 6LDHA 2OD7A 1R64A 3EGVA 4PX2A 5C81A 4IIBA 4Q7EA 3ED1A 2QR3A 2WOJA 5DK6A 4F9GA 1LDGA 1SXJE 2FVXA 2GYYA 4GPTA 4Q3OA 3BFXA 4ARSA 2IP1A 4YRFA 4E14A 4Z7CA 4HYTA 5JD5A 2IS4A 3WL5A 3WTBA 3GM2A 2E21A 1WY7A 4JENA 3U3JA 3EMBA 4P4LA 4NFHA 4Q5IA 4ISAA 3PPVA 3AEQA 4IG4A 3T41A 1N78A 2G6BA 3GG9A 4TTJA 4DQLA 4MVJM 1DHTA 2C7PA 3AZOA 5HFJA 2WINI 2A6HF 1A5AB 1Z5ZA 1RQ7A 1S2DA 1P1IA 1XPJA 3MA0A 1USUA 3MGBA 4O29A 3H6GA 4IFDB 4FK8A 1EFPB 2IOQA 1PG0A 4D92A 4Y2PA 1OT5A 5EFOA 2ASVA 2JVIA 3CNEA 1W5SA 4MCAA 2HHHE 4CDMA 2WZQA 4JYMA 4GWLA 1PGNA 3BTVA 1PV3A 4OKGA 1XRPA 2BFFB 4TLAA 1PJBA 5DSXA 4BJ3A 4JOCA 4JA0A 2WPNA 3EEFA 5BSMA 2Y3HA 3UW1A 1WL8A 3COYA 4MQYA 3NHZA 3HY4A 3RF3A 4E2YA 2YWHA 2JLWA 1NVEA 2DLDA 5C3MA 2W2NA 3E4DA 2ZB7A 4FZRA 4Y0NA 2P3SA 3PX2A 3ONWA 4GGMX 3WR5A 4BX2A 4CXMA 4EKDA 2VN8A 1JIKA 2C82A 4HLCA 4B4DA 4ZVIA 4BNUA 1NW3A 2IUEA 3F67A 4PRYA 3HRIA 1PYOA 3HWX1 1UKZA 2H31A 4GQUA 3C39A 5JCXA 1M1YA 5LD2C 2E4UA 4RF5A 5A3RA 1XMQB 1D04A 1KOGA 3EWIA 1K6MA 3E2MA 2Q3TA 5KTYA 1BCRB 1LNQA 3EUWA 1P2SA 1GSAA 3PRJA 2PCLA 1LTHR 2XUOA 2CFIA 2YYZA 5LMNI 3MTQA 4M1YA 3WHPA 3GU3A 1ZD9A 3CUVA 3L4BA 2G63A 3ZDLA 3L8JA 2TRSB 5JTTA 3A9RA 3WDKA 4BZZA 4E94A 1INLA 2CY0A 2OKGA 1ML4A 1H69A 5BVGA 3SAJA 4FW9A 3B78A 4Y6OA 2GLTA 3HDTA 1E1RD 4O02B 4MV9A 4AJOA 1QC5B 4H17A 4HWTA 3P9CA 4HHEA 4XPIB 4EPXA 1W46A 2IDZA 4Y6SA 1UEKA 4PXYA 5DMHA 1Q0UA 4F71A 1YE3A 3K5WA 1ESZA 1MC1A 2YWEA 1TKRA 2C54A 1RYZA 1ZJYA 3O10A 1T29A 2ZI6A 2VQ6A 3AM4A 4HL6A 4MPJA 2VUIB 1R12A 1Z4PX 1B14A 2JD1A 4ETWA 3RG8A 3FKSD 1YR8A 2FWMX 1MP0A 1SXGA 2P79A 3DVAB 3HCWA 3OX3A 1O3YA 1U5BB 2CN1A 1W47A 1RJGA 5FI5A 1P1KA 3T0FA 4MOWA 3OWTA 3LK7A 3KT0A 3FPCA 3FYUA 3O8CA 4PU9A 1ZGBA 2YYYA 5GM2A 2WIJA 3JQAA 4IDCA 4NQZA 5JXIA 1HWYA 1LLFA 3FWZA 3K31A 3LA8A 1X0XA 2BKVA 2JC3A 3FLMA 1TA4A 4M9UA 3MWDA 4ZGWA 2CZCA 1FTSA 3ANTA 3L79A 1RCFA 3BWBA 3BZBA 3KQWA 4WASA 3AC0A 2X0KA 3ON5A 3M6XA 5BSUA 2FDRA 3N6RA 2NSLA 4C1NA 4GEGA 4BA1A 3ACDA 2GS8A 4K40A 2XR1A 3TVTA 3I12A 1TO2E 2QTBA 3LUFA 2IOYA 5DN6D 1QH1A 3PKIA 1YZNA 1C50A 4YUAA 5IEJA 1EUCA 5FI1B 3V7WA 4DM4A 1YU6A 1JR3A 3P9XA 3VHXB 2IV3A 5FOQA 1CUHA 2D4AA 2H4YA 2WYOA 2GEKA 2R7WA 1WR8A 3R3VA 4RPKA 4DIKA 5HR5A 4GXRA 2E6KA 1T6UA 2QXTA 5JDCC 3AR8A 2ATVA 1Z4JA 3SXUA 5IDYA 3UK7A 3VA7A 4D57A 3CKLA 4R3NA 1LUAA 4JUDX 3NGMA 3D6TB 1T8WA 4EGSA 4NE7A 4DV1E 5D5HA 1BA2A 4UQPA 3OJXA 1RJEA 4PCAA 3TNYA 3RUEA 4G0OA 4XPZA 3E03A 4C5CA 1QP8A 4KQGA 4MDHA 4PCUA 3A1FA 2FWNA 4KQVA 1IM2A 1L4NA 3KOZA 2KYHA 3N6VA 4HB0A 1YGPA 4HDNB 2GF9A 4B2IA 4BU1A 4EX7A 2FHSA 2C5SA 5FUVA 5DO9A 3L8CA 2XOXA 3MX3A 5CB0A 2JAUA 2O9XA 5KYWA 2ZBDA 3KQTA 1A1SA 4U9EA 1VCHA 2QAGB 4O4LB 5FKJA 3ZBTA 4Z4GA 1FMCA 1NJ8A 1V71A 1VXOA 2AZMA 2FQ1A 3FHOA 5L0GA 2XT6A 4N5LA 5HQ3A 2QVGA 3SEAA 5JXWA 3LBAA 1TA9A 3PXGA 4UTPA 1AA9A 4US0R 3OEOA 1LK0A 1J6UA 2VP6A 2GO4A 3AQIA 1G2QA 1PQUA 3TLCA 2JGMA 1ZHYA 1MMDA 2ACVA 4EFMA 2AUMA 4NZMA 1YA7O 1CZHA 2NXNA 2R5NA 1MBZA 3RS7A 3MAGA 2DHRA 2FZ5A 3QU7A 4CIXA 3WU6A 4IMJB 3EJ6A 4I50A 4TMTA 2ODBA 3RC3A 1PG2A 3H87A 4DBLE 5K6TA 3TQOA 1H2HA 1NIPA 1II0A 1U7UA 1UJ2A 2IYFA 2Q99A 2QUAA 4LQCA 1DKNA 4GZ3A 3VRHA 4BAZA 5HE9A 5AXCA 3QEKA 3UJPA 3ASUA 1TZJA 3BXZA 1RC1A 1B8VA 3LUKA 4ZV7A 3TMKA 1DX6A 2W4IA 5BQPA 3WYBA 4WW0A 5LQJA 1O94C 4IMRA 4KVGA 4PGHA 5H82A 2QD5A 3TTVA 1WCYA 3CX6A 5DV9A 1YACA 3BQNB 1G4HA 3GARA 2A94A 2QP3A 3VOSA 4DLAA 1N7IA 4EMTA 3LCJA 2ID8A 3GXBA 4C7BA 5CFNA 3HYLA 3L18A 1R16A 4KN8A 4INAA 1OKKD 4IM7A 5MFZA 1ZUNB 4X62I 4OA8A 5K0ZA 5DHSA 2D2IA 5EHQA 1Z7YA 4EKEA 1TNDA 1LPAB 2KE5A 5HS4A 3OEYA 1C3VA 4NFYA 4DC9A 2ICAA 3OOJA 3PFCA 3K1IA 1YKGA 3VXKA 2DYSC 1CDDA 4ZIRB 1E0DA 1H3FA 5G4KB 3NBKA 1NZFA 3TR0A 4DUZI 5LSAA 2X2EA 2JI8A 4CMAA 2JGLA 2G9QA 4Q7JB 4R41A 4JUFA 2JD3A 4RU1A 1RNLA 1J24A 1M6VA 4NZNA 3K5HA 2WKRA 2G6TA 1GGQA 1GCGA 1MRNA 1XZ8A 2CL7X 2XWPA 3CZRA 4Y98A 3DAGA 3AGTA 1KFJB 4K3UA 1AQ6A 1SUCA 3U2LA 4K7BA 4DR5E 5E3JA 4S05A 1LDEA 4LE1A 5LDGA 1CBUA 2EZ4A 5IBCA 4MSUA 3LP8A 2NN6A 1ITZA 3NHSA 5CXSA 4D99A 1MNDA 2XB4A 1NDHA 2IHTA 4P5DA 1QU3A 4JURI 1ZK2A 1IVNA 2OAGA 3NEYA 1XLTA 3OF3A 1QKIA 3OT1B 4BQNA 2ZJ4A 1ECCA 3LNCA 2JAQA 5FRDA 5L3SA 2V2VA 4FJ2A 1ZUHA 1X1BA 3SDZA 4TSFD 1SXJD 2P6OA 2Y0CA 4AROA 2XRZA 1TGVA 3OMXA 4Q1EA 2AOWA 1GZDA 4UXIA 1RIIA 1MX0A 4MH0R 5JJBA 3QIAA 3TSCA 5K36F 2K2QB 4IDDA 3C85A 4G01B 4DRXA 3H4MA 1UJNA 1XTTA 5HCIA 1ZCZA 3FDJA 3HJTA 4OJTA 4BTLA 3AVOA 4AUKA 5LB2A 1LNSA 3RJ9A 4MQMA 3WLIA 3ZY4A 4R81A 3C2QA 2XLWA 1WEHA 2RBKA 4KXFB 1GS9A 4OXKA 5AMXA 2NO5A 5HRCA 2XLBA 1E2IA 4UQLA 1FTYA 2DH5A 2ILTA 3O38A 3TQRA 2FMKA 3EUEA 2EG9A 2HXGA 2X14A 1MN6A 2BMEA 4NC9A 4YMSA 1EB8A 4L08A 2L17A 5DWVA 5MFPA 4QVGA 3R6GA 2JKYA 3ANSA 2CJFA 4RY0A 1H0RA 1ZGCA 1KR5A 2AN5A 2VAPA 2FI1A 1JDSA 1KMMA 2B25A 3ORHA 1L5KA 1UAAA 5LJIA 3WRXC 4EHNA 3ISTA 1WBDA 4M9XA 1U81A 5FTNA 1R4TA 5CJJA 2QM3A 3GNQA 1R0KA 4IDGA 2YHAA 4HGYA 3L0OA 1FI4A 1G63A 4BNMA 1UK9A 1RRKA 2EX0A 3KHUA 1J1UA 3RHSA 4XWKA 2I33A 3UENA 1OZGA 2OQIA 3DYVA 3K2EA 3PC8C 4AJHA 1M8PA 3C1AA 3ESRA 4KMMA 1T8TA 4WY5A 1FP2A 3V46A 3ZD8A 3K9LA 3IVMA 3GBPA 3LIIA 1A7DA 3AXTA 3RLFA 4NDNE 4HPJB 1L3IA 2ECPA 1NHGA 1TUBA 1T8YA 3QEJA 3X0DA 3C4QA 5HRUA 2IHNA 1E4YA 2Q41A 2RI1A 3FMPB 3BWEA 1R74A 2ET6A 3F9IA 5G4LA 2RJ3A 4YJHA 3VR5H 4IZJB 2OGWA 2ZIWB 3NZEA 4IWXA 1LCIA 2I7DA 4P7KA 1XPUA 1XCBA 3UJDA 4A36A 1I3LA 2IHJA 3UMYA 3MMPA 3HY6A 1TQDA 2VYCA 4Z9HA 5HZKA 2YQZA 4H9GA 3ZLBA 1I4DD 1MO3A 3KAQA 3SXYA 1PWXA 1C30B 2R8RA 2O7QA 2PKQP 2VF2A 3JALB 4NYMQ 3DL7A 1KJNA 5LQAA 1IXKA 1N2GA 4U5QA 3IDFA 1IXSB 1CF9A 1NDQA 3B70A 2LSEA 1JHOA 2HMWA 3QELA 5CIVA 4IDEA 3K0KA 2L81A 3SZMA 1JGTA 1V45E 2AOXA 1HNXI 3EQ8A 1YOBA 4CMKA 1AKMA 1OU0A 4IGIA 2DTDA 1YQTA 3LC1O 3VHXA 3BEDA 4P81A 2FE1A 1IYZA 3OZSA 5KWEA 1VIYA 3IP7A