2CGEA

Crystal structure of an hsp90-sba1 closed chaperone complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEYEPLTKALKEILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKLLYETALLTSGFSLDEPTSFASRINRLISLGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
publication title Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 115
structure length 405
sequence length 405
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2006-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2cgeA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2cgeA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cgeA02
2O1TA 3PRYA 1USUA 1Y4UA 1HK7A 2O1VA 1USVA 5FWKA 2IOQA 2GQ0A 1SF8A 1Y6ZA 3Q6MA 2CG9A 1Y4SA 2CGEA 2IOPA 2O1UA 3Q6NA 2O1WA 3HJCA
chains in the Genus database with same CATH superfamily
1FUUA 1T6YA 3P71T 3GFFA 3L5OA 1IC6A 1EX9A 1YR3A 2ZYTX 1SULA 1XCPA 4BJ5A 3CZ4A 2Q0QA 3ED5A 4B7UA 3G82C 2IPLA 3DW1X 1RLIA 5SZIA 1IN5A 4MYDA 3MX3A 3FPLA 3ESDA 3J81k 3G5MA 3FGPA 1CVRA 4AMZA 4KQEA 3D2LA 4N5DA 1U31A 4QWWA 4NK5A 1CJSA 1XLVA 1EE1A 2BI4A 3VU9B 3VYUB 2LIVA 4E1AA 3DD5A 1FRVA 1LTHR 3GFTA 2PBZA 3GVXA 4AJNA 3UENA 3Q6MA 3FNQA 1TW2A 3BZUA 3RKRA 4ZI7B 5AI0A 1VJGA 3BMQA 1JAHA 4YMGA 1JV2B 3UGOA 3CF2A 2JVIA 1A04A 1GZ4A 3HYSA 4LJSA 4ER7A 1OQCA 4QYMA 1XLUA 4PRKA 5KHLB 3ECAA 2NW6A 1L7AA 3F1LA 1XZPA 2P1RA 1QHYA 2Z6VA 3LF1A 1H9GA 3B6IA 4EYOA 4WY5A 2ZTHA 1HMOA 3CUTA 1ZQ9A 2VJCA 4JOCA 4ZIRA 1PT9A 4A27A 4MQFB 3HCAA 2EIXA 4UHCA 4DLYA 3K6KA 4J0KA 1JG6A 4L4RA 1G42A 2V7WA 4A6EA 1F2VA 4CIDA 3ONNA 2DYSC 4TV9B 4JI4I 3W5VA 4F3NA 3I6MA 4FMCF 4OK3A 4FT2A 4PFPA 2ZIEA 1BRTA 1EZ1A 2GUWA 4R8KA 3R7NA 2FUG1 4H1VA 1VLSA 1R0LA 3RIYA 3N59A 1G4UR 4BYMA 2QL5A 4PG4A 2VP4A 1Q91A 2HU2A 2IYLD 1HUQA 4J6FA 1W25A 3K9BA 1YA8A 3L1KA 1YZQA 2OBMA 3RNLA 4I5DA 4LYFA 2PZGA 3OWOA 2GAOA 2IPMA 3QWFA 1RQGA 1QPZA 3VU8A 4H3SA 3K70B 1CPRA 2FOXA 1UBUS 2I1WA 4B3XA 4YL3A 5LB4A 4GPIB 5M04A 3NONA 1PJLA 4MAAA 1Q0GA 1UWKA 2D00A 3QBVA 5HWSA 2PT7A 3EVEA 2CVEA 5FZTA 4LF9I 1XMQB 4LRSB 4HDAA 2XB8A 1V3UA 3C8DA 3WHPA 1XCGB 5JC8A 2PNZB 2NN6F 2HMUA 4JSYA 1R8YA 4BECA 4JLJA 1UODA 2B9EA 1UK9A 1PVDA 2R85A 1UWVA 2ERXA 4I36A 1W73A 5FPHA 4WOKA 3FLAA 3GWGA 4ENWA 2F1RA 3CHYA 3F3KA 3FCOA 4I55F 3FM9A 4GX5A 4ZGGA 4YJHB 4XWGA 3K20A 3ZDBA 4NKRA 3W7AA 4NCKA 3ZY5A 2IOFK 3I5QA 1Z0KA 1A9YA 2JEBA 1EXVA 3SMVA 1TM4E 2O7QA 1EFLA 2REXB 1OU4A 3UAWA 3N2ZB 2QP3A 3MEQA 3DMFA 2X4GA 4MGKR 3DDHA 4YY3B 3VJMA 2H08A 3ZE6A 3L82B 2H29A 4D02A 1I1NA 2REBA 3L05A 1JHRA 3I0MA 5DYGA 3P9CA 2ZIWB 1RP1A 2CMKA 3BWBA 1R4ZA 2J9RA 4A1OA 5FLXA 2PS3A 5G0TA 2CXUA 1K5HA 3UJ9A 2MHRA 5IEJA 3T4RA 1Z2NX 2EINC 1MT3A 2CL7X 4CMCA 4PF1A 1F4LA 4M9UA 2H0QA 4NLLA 3SSOA 1QLEC 1EFTA 4C0XA 5B1EA 2OV1A 4UDOA 5LMNI 4KFSA 4CKCA 1C4KA 2O2XA 1QRAA 2JD0A 2VQEB 3NX4A 1QG0A 1PV1A 4IEEA 4TMYA 5FNVB 3RRXA 5TF4A 1Q92A 1P31A 1NATA 3JZMA 3VSEA 1X1BA 1PWZA 3A4TA 1XFDA 4UVGA 2XLEA 1GYPA 4UBNA 4BQEA 1GEGA 2VTBB 2FAPB 3EFHA 3QPWA 2D5IA 5IRCD 1OI4A 4X6LA 1VIYA 1UMDB 2NZWA 5DHSA 3TUZC 2VTKA 4XYGA 2OHJA 4DV0B 2EJTA 5SZHB 2PXXA 2OAGA 4FGJA 3A25A 4QHSA 4B7XA 1EGQA 2ZJOA 3TN7A 4F4HA 2CLDX 2NQ8A 4OFWA 3WL3A 3L8ZA 1Q0UA 2ABWA 1E1QD 2FPUA 2XUGA 4KRGA 4H4KC 2IU4A 1IQ0A 1XTZA 5EMLA 5LYJA 5THXA 3AVQA 2QXYA 1W0JA 5KNLA 1X7XA 4YCDA 1YRQA 5KC8A 1VIVA 1O94C 2FJUA 1Y8AA 2OCLA 5KVQA 4LNHA 5IYZF 4JY7A 4Z49A 3INRA 5LC1A 1X7ZB 3KJQA 2LIGA 2XDYA 4IGIA 4HXEB 1X7WB 2O8VA 4CS8C 2QL6A 5I6DA 1MABA 1QTIA 1FRQA 3B0VC 3PLRA 1WXIA 4RIEA 3SDSA 3KZMA 1E2XA 5HDBB 3K17A 2R65A 5EKDA 1R9NA 3S2IA 1TVMA 3OPVA 3T4UA 2P2LA 4DWOA 1KTMA 2ZD9A 5DM60 1D7OA 4IJKA 1P0FA 2DUWA 2WD7A 3R9XB 3V2GA 2RHWA 4DVJA 2R7UA 3H11B 5CBPA 1YS4A 2XTZA 4CKXA 4MVWA 4FCVA 2EYUA 3C5HA 3EZ6A 5ENVA 3E5NA 4DPMA 2EBUA 1KYWA 3GLHA 3RQGA 2IH4A 5DHQA 3AJRA 2HT6A 5GOTA 2XLVA 2PUJA 4M6WA 3UQYS 4URUR 3URKA 1IIBA 1CZHA 1SPBS 3QVLA 1FRNA 4JL6A 1XQVA 3WS7A 4YMHA 4XVCA 3F7TA 4FHZA 4TL9A 3KHKA 2ZB7A 1R8QA 3SVZA 2R05A 4MUMA 1JB9A 2YL1A 3UC5A 3C8GD 4M89A 1E1KA 1JAFA 4WASA 5CR9A 4Z2YA 3J81C 4J0HA 4BO2A 4BVHA 3L4BC 3VO1A 4ZT6A 4MPTA 1K47A 1RRVA 5FOUA 4K87A 4K8RB 4FW3A 1EXDA 2GO3A 1I1HA 4V2UA 3JYLA 2OAP1 3P0HA 4CMAA 2HFKA 3TE6A 4U7FA 4N0MA 3AL3A 2JJQA 2KI5A 3C4JA 3BMNB 3DE5X 2QAGB 3FMOB 2BJHA 4G23A 3WGVA 1JAYA 3PIRA 1ZUNB 3M2TA 2OT3B 1XDBA 3R3YA 4MU3A 1LDNA 1TW3A 5FKJA 1SB8A 2HRZA 4OBBA 3L1JA 4GPTA 3BF8A 1ZD9A 2L6HA 1KEEA 5B57C 4PX3A 5B1DA 1QFJA 4D98A 1GHTA 1DBWA 3NPMA 1UF9A 5FT9A 5JADA 2LDBA 4B17A 2D1QA 1WCIA 3EJ6A 2PVSA 2RHGB 3OU7A 3PHGA 1U89A 5JXGA 4HWTA 4OYHA 1NU8A 3ITFA 2OCGA 3KTDA 4L4SA 2H00A 5DBIA 1ILWA 2XOKA 3RANA 4MUIA 3V00A 4IRUA 2GEBA 3BSYA 1GSAA 4NJEA 4NSNA 3QA9A 1NU9C 2R4QA 2R6JA 1DCKA 1NF2A 3L4SO 1V55C 4Y7DA 1U3UA 1MNDA 1QFMA 1V4NA 1RR9A 3K1IA 5C0XD 4M1QA 3M9XA 3KL4A 2B0CA 4EHPA 3SC2A 2B7BA 1XXHA 4LFBE 2BIFA 3ZDLA 4EY3A 4HUQA 2L2QA 1OYYA 4CR8A 3UNXA 2VJAA 1EFCA 1O57A 4KK4A 5CDFA 1QQTA 2PS1A 4FW8A 4ZTBA 3ZQ6A 1C41A 1N0IA 5F98A 4QLAA 3DUFB 4ZAXA 5GONB 4OKGA 3YASA 2WUWE 1YZYA 1XMQE 5ALPA 1KDRA 3GCGA 2YLGA 2GJAA 4OHZA 4Y2TA 4TSFD 2XBMA 4QFDA 1ZM7A 4V1CB 3DQZA 4BATA 3HDGA 1IXKA 2GHIA 1FA9A 3A9TA 4LDRA 1S2GA 3U7QA 2N42A 1V5FA 1SQ5A 3KT0A 4REQB 1GG5A 1P5ZB 3ZZ0A 1WKVA 1UCFA 2H9YA 4KYUA 1J2RA 2K2WA 3IB6A 5AVVA 4K28A 2RKBA 2XSZD 4K6OA 4KR9A 2Y0BA 2AZTA 3PIIA 4RENA 3N0VA 2JH9A 3MGKA 5AK6A 4FC7A 2GJ4A 1RHYA 2R8BA 4I4NA 4DJJA 5FAXA 3QH4A 1ZVQA 1JE1A 3TCXB 3DA8A 4HWSA 1WDTA 4M22A 2GN9A 5GM1A 2HA0A 3R09A 3W6NA 3T9CA 1EHCA 1QOPB 2VR1A 2BCJQ 4IWXA 3TQSA 1HX7A 1SUCA 2AFRA 4Q4AA 5HRUA 3MNFA 3CX6A 1D0YA 1I2BA 4DVYP 1AA9A 1UDSA 1AZTA 5HKBA 4AWBA 3ZVLA 1KYXA 2QTHA 2QBYA 1I4ZA 1GRVA 1YDGA 5SY6A 1QTRA 2FLWA 4FVTA 3ZUPA 2AFHB 4X65B 2VCAA 2GJKA 3KFVA 4YGYA 2XEDA 1W46A 2AV6A 4XPIA 1O95A 3KAPA 2Q8PA 3DR3A 3K0FA 1WOLA 3HBJA 1M83A 5K4HA 3KOWA 2QYHA 3JSEO 1UUFA 3FY4A 4OQ4A 4IRMA 3LKVA 1AQ6A 3EN0A 3GN2A 1X80A 2GI4A 2X9QA 3BHIA 1XK7A 2X2OA 1E6EA 1PJSA 1ZUD1 3AJMA 4H15A 2Q4BA 4XPXA 4RJLA 2O6HA 3K6SB 1PJTA 5I7HA 3L1MA 2ATXA 2BH2A 4ARVA 1A9TA 4DOMA 5DVWA 4A6PA 4CM9D 1DMSA 3AFOA 3EULA 1EK2A 1Q0ZA 3GRCA 4RD9A 4N4WA 2UZ3A 1FF9A 1DZIA 5J2TF 2W8ZA 4KJZA 4I1VA 3JCZA 3WYCA 3OWHA 4EBBA 2Y3BA 4X62E 3RSQA 3MGBA 1W5TA 3U0VA 2ZWOA 4MKHA 3ROKA 3DT6A 5TS2A 3EB9A 3QW2A 3MWKA 4JC7A 1J90A 5DTEA 4GYYA 3C7AA 4YP9A 4TN1A 5IZ4A 3T7CA 2C4KA 2R03A 4J1TC 1M66A 1NMQA 4LC9A 1TJPB 5K36F 3FWZA 1P7YA 5K8LA 4G9GA 4OPMA 3OQOA 4JKVA 3P0RA 4GR5A 1KS9A 2WIBA 2PGLA 3OEEA 4N7JA 4F8YA 5BR8B 3QPAA 1EFVB 4D9HA 4DMLA 1UDCA 4ZI5A 4TL7A 4XQ0A 5H4HA 5HF6A 3NHUA 3QM1A 1S3SA 2OK7A 4QDLA 1D1SA 3IQXA 3H87A 5CFRA 1QRTA 1JKFA 5K3FA 2VJMA 5EINA 1U94A 1T1JA 3R3ZA 4UU7A 3FB1A 1KO1A 5I9MA 2ZIAA 3RK1A 2HV8A 4DMCA 2R7QA 2QRPA 3RK4A 3KWMA 3FWPA 4LSMA 2QM3A 1N25A 1Z38A 3ZBUA 1LM3B 2H85A 4R2WA 3LX4A 4RK1A 4PJJA 2DKFA 4H16A 4KVGA 5D3ZA 1ZXNA 4M9QA 3V9AA 1P9LA 1AUOA 4DJAA 1M2JA 2A3RA 2WD9A 5LQRA 3SXMA 3RIMA 1W2HA 1J0DA 2O14A 4Y9TA 1Z0GA 4BC1A 3A3NA 1I2AA 5EHGA 3TMAA 3C87A 1T1IA 4ETWA 5AD1A 4GOJA 2BLLA 1UFRA 5HR5A 5C5DA 1E2UA 2BEVA 1FFGA 4NMMA 4AZ3A 2ASVA 3PWTA 4BNIA 3AY6A 3KT8A 4WOJA 1PR4A 1YU9A 3P4XA 2HRCA 4RZXA 1G0OA 2BHLA 2IE8A 1GADO 4LJAA 5I7VA 3P0FA 4MQLA 3PC8C 3ZOZA 4LOHA 3T95A 1ODSA 4U7HA 1ZG3A 2HHHB 3OTOB 2XQIA 5B6JA 1KP9A 2PXAA 3ELWA 3KPVA 1TU4A 2L42A 3V2IA 3ROTA 1HDIA 4FW7A 1RAAA 1NI3A 3W5JA 2NSGA 1U3FA 4UMVA 1WBDA 3DF9A 2KYHA 2QLJA 2GWWA 4P0TA 5KYTA 1KK2A 3IRVA 1MC4A 3ZDXB 4E32A 1ZS9A 3IUQA 2CLMB 2H0AA 3U7EB 1KZ7B 2Y6UA 3UWKA 1EFKA 1OFUA 1RWPA 2KC3A 1GV1A 4Q39A 2MTBA 1FDOA 1KZ6A 1V48A 3QQPA 4WINA 3PLAE 1Q1NA 4QGAA 1QH1B 3JALB 2OHOA 3E3OA 3TLBA 2NN3C 2VT7A 1VCIA 3ER9A 1NDHA 4X1KA 3D4JA 1QFXA 3OF5A 4BDTA 2GTHA 2R96A 1UC9A 1W0CA 4UUQA 5F5LA 1DC7A 3ZX5A 2D2VA 2WU3A 5FL7A 1XWWA 3R5XA 3PWZA 2YOHA 3LUGA 2Q00A 3U4DA 3KCQA 2NO7A 3K1AA 5CK5A 2JLWA 1EQ2A 4UEWA 4KXFB 1W36D 4F56A 1G5PA 4QUAA 3KLPX 3L5KA 1XZGA 3HY3A 2FLKA 5FULA 5LXTB 4CS9C 2JCGA 2VJNA 4W8OA 3W2WA 3PTAA 4C20A 4G97A 4DQXA 1K8QA 3K73O 4MS1A 2PRZA 5CA0F 2WAYA 1EGAA 5AJWA 4S04A 4XQEA 3L8MA 3MJCA 2ZANA 4NPHA 4NECA 3GVIA 5IG2A 4BFCA 3BPSA 4I3GA 2Q6OA 1J33A 4DT1A 3NBUA 2WWTA 3GLKA 4YCCA 3TSZA 3I28A 4LY0A 1G1MA 3UVEA 4WLVA 3MINA 5LLTA 1RJFA 3P52A 3P19A 3ZK8A 5BYKA 2AIRA 4I9HA 1OLUB 3WHIA 2ZS9A 2ID8A 2EOAA 1N1DA 2CLKB 4LYAA 1MENA 3WDKA 4GUAA 3QX9A 1JHAA 1X19A 2PP4A 1PNQA 1GSIA 2E7ZA 4A23A 3X3HA 4QDJA 3HDQA 3B0PA 4R8SA 2OD2A 2PGJA 4KQ9A 3VHRA 4OIQF 2G07A 2R1VA 1CHNA 3WBKA 1VBNA 2W6CX 3I9V6 3DNMA 2FFQA 5A5DA 3LZDA 1EFAA 2RE8A 3O83A 1EJBA 1CUWA 3OZCA 1R0BA 4EMSA 2QY9A 4DR3E 2RSLA 4UM5A 3V7UA 2O4CA 2IKSA 5EQJB 3M15A 2PAAA 1VG0B 2C94A 4CQLB 3K9QO 1MAAA 4WFKA 3H6GA 3CX8A 3IV7A 3TDKA 3KRNA 4R3UC 1PD0A 3P2MA 1XMOI 2W00A 4D9CA 4RIGA 2GRJA 1PNVA 3PA6A 3AHEA 5GGYA 2WABA 2QMOA 3CB2A 4USMA 4JA0A 5M34A 1P42A 3DE0X 2BR5A 3EBPA 4DCGA 2G4VA 4K0RA 3DVAA 1JFFB 2OI2A 1EI7A 4DR2E 4X65E 2WICA 1QZTA 3DPSA 1QGUA 2JFNA 5L7TA 2YVLA 4JLPA 3U48A 3QI2A 5E2BA 1RZRD 2F1IA 3EG9A 2ZAIA 5GONF 3AFHA 4GXTA 2H1HA 3E9ZA 3LVFO 3RVKA 4FLEA 5D2CA 5DGXA 3ME5A 4L27A 2ASRA 5AJUA 3T6JA 3AEKA 1PLLA 2VF5X 4JXZA 5HJ5A 1P7PA 1GOTA 3OP4A 2QOEA 3G8CA 1Y80A 1QC5A 3MHPA 3OZVA 4PLHA 4ZHSA 4RULA 4BVKA 4O2AA 4JC8A 3W90A 5JMWA 2JLCA 1W88A 2FWJA 1MLDA 4QTTB 4G5SA 1L6RA 4V3BA 3DF7A 5G40A 3VR4D 1U90A 3H65A 5LQNA 4HYTA 3FDFA 2XZTA 1Y6JA 5CFQA 5ETJA 4BFSA 3KETA 5ELWA 9LDTA 4KXXA 4FFBA 2CVZA 4FJ2A 1ICEA 4ABYA 3T3HA 5EYPB 3FOAA 1XZAA 2WWVD 4B2IA 2WUVA 1RLMA 4X94A 3KT3A 1E1RA 2H4YA 4FHEA 4AS3A 2NO0A 2YC2C 3KYBA 3WGHA 1WPRA 4CDVA 1UIRA 2BSQA 3K09C 4EG4A 1R6MA 3PNMA 1IHXA 2EATA 3OE7A 5L3VA 3O2NA 4IY1A 5U4XA 2MDTA 1VMAA 2C04A 4XX0A 1CP2A 3PFKA 3B1WA 3LGSA 2PKRA 3S8EA 3M6XA 1ZCJA 2G70A 4AY2A 2YV2A 3KZXA 1GA6A 2A7XA 3OFNA 3W5BA 4DRIB 5BR8E 3QPDA 3VV3A 3RQIA 4DXWA 3CR7A 1PO7A 3AHCA 4F5EA 4KGDA 1AKUA 4M0KA 3R8CA 3T1QA 3OP1A 4L3OA 3WGTA 3PLNA 4ZGWA 3IULA 1U28C 2B25A 1G5TA 4ZYWA 4F1KA 4I3MA 2Z5FA 4YQYA 4TVKA 2EDAA 4ZVNA 4Y1RA 4P86A 4UHKA 1N78A 3G2JA 4HHEA 1GCGA 2A0WA 1N0WA 4RKWA 1A97A 1GAWA 3TRHA 4PLPA 4N9QA 1VI5A 4WXYB 2YL3A 3K72B 2OQ2A 1Y8RA 3O75A 3JARA 3N2LA 1VMDA 2KBEA 3PU6A 4N12A 2QM0A 4QOFA 4PC7A 2CDNA 4CKBA 4HAYA 5JTUA 1G3MA 4H1UA 1FFXB 3A8TA 1WBJB 2NAPA 2ZREA 3KU1A 5ADUS 3MLBA 2WTMA 5FRDA 1L3IA 3CT6A 3WLRA 3IUMA 2Y3HA 1T8RA 2JJYA 2ZI5A 1HNWE 3LQKA 3CZMA 3NRHA 2HHHE 3OTOE 5IDXA 3OFJA 4S2UA 4DRYA 3HKCA 3MJSA 4B4WA 1EI9A 1GGJA 1B0PA 4OHYA 1CVIA 3E7WA 2B37A 4KU4A 4JGBA 4DL9A 4ZJUA 4MVZA 5F7XA 4MQBA 4AX4A 1BTOA 1B73A 3BXXA 3R41A 3UJAA 2OORA 4JWKA 3D8HA 1MW9X 3GQBA 3HCNA 5EJ6A 4V39A 4HTAA 1ZD3A 1U6KA 2Q2OA 5CB4B 4E30A 3SC6A 1C9KA 3NMIA 3LPLA 3P2IA 4N0PA 3SN6A 2PVPA 2H11A 1FW8A 4HRAA 1SM4A 2K7ZA 3VYTB 1RS0A 3DFZA 1AK2A 2C8KA 4RBNA 2VF2A 1FJ2A 3ZIDA 2GESA 4O02B 2HV9A 4EFDA 1U9YA 5IAOA 4JI7E 1JLLB 2A33A 4P08A 1WUUA 2NT4A 4EMDA 3G0HA 2JW5A 2FB9A 3LLCA 5C5CA 2HM7A 4UEQA 5K1ZA 1ORHA 3IQCA 1LRLA 3FCUB 4TLAA 4CMEA 3HNRA 3L1HA 5H3CA 2AMYA 4DNOA 4IEFB 3KKOA 4QDOA 1G6OA 6CHYA 4IJQA 5CEEA 2C38B 4D0SA 3WG7C 4DKJA 1W94A 2QQ5A 1D4ZA 3CXRA 1S7ZA 5I7FA 4JI2E 1BKNA 1OZAA 1E2NA 4E1VA 4RETA 3JD4A 3GY0A 4GL2A 1P9OA 3LLMA 2CXQA 2YFQA 4FFRA 4WFQA 2ZJBA 1GU7A 1NUTA 4WZAA 3A9WA 4GF5A 1VBKA 2H2FA 5ENDA 3KUDA 4KR3A 3LUJA 3TR0A 2Z6QA 1YJBA 4PSUA 2YYYA 3LQYA 4B6GA 5AKHA 5DT9A 2Z04A 2BGJA 1AKTA 5PGMA 1V1JA 3IDOA 5LBIA 2OQRA 5EJGA 3FDJA 4NZPA 1GFSA 4WZBB 1L8OA 1N2GA 4FMCB 1JMKC 1U3VA 2BMDA 3OQJA 4J7TA 1UMBA 2CV0A 1N6LA 1PFQA 4G4SO 3VTFA 1BXZA 4M0FA 4JQOA 1Z5VA 1S16A 2ID4A 3F90A 1VP9A 3F3YA 3THWA 4WBNB 1W4LA 3IQIX 4MRPA 3U19A 1QOZA 3QMVA 1H9BA 2NSJA 2W2OA 4XWTA 1NA5A 5JFTA 4UUOA 2JFUA 2VPQA 2ZRLA 3CNOA 1Z26A 2XLMA 2WM3A 9GPBA 4H7IA 5IUNC 1F3LA 4JURI 3KLMX 1EE2A 2SKDA 3LXUX 1W35A 3QFHA 1ESNA 2C29D 3MBIA 1LH0A 1V39A 2QN9A 2RH9B 5TJ5E 1V7QA 3RTBA 3VZSA 5IXSA 1ECLA 3OZFA 4A7PA 5LXTF 2WDZA 2A5JA 1XRPA 3W5CA 1RMTA 4XJVA 3QT6A 1N3IA 4JTCB 3IQ5A 2J0EA 3CSUA 1FX1A 4KQMA 3IT2A 2DP4E 4BNHA 1PNOA 5ADHA 2C39A 4NCXA 4QNNA 4HYYA 3L7KA 5ECYA 3L77A 1BHQ1 4PCLA 4GI5A 4DR6I 1A7AA 1X1EA 3DCYA 1VL1A 4UAVA 4AO8A 2YWXA 1ACJA 4NU0A 4KBGA 1V4BA 4MRRA 4QJIA 3OMXA 1M1ZA 2HXGA 2ERCA 1GLVA 5HBGA 2R87A 3HK2A 3WK4A 1YQGA 2C2HA 4O2LA 3OQ1A 3NHPA 4DG9A 1S2MA 1ULTA 2BEWB 5J58A 1Q77A 4MUHA 4LVCA 3FN4A 1KDTA 5JPCA 2VYVA 4BN4A 2C3MA 1YB1A 5ISMA 2RCYA 2DLCX 4JJ7A 2WFZA 2GERA 2XD4A 3PHHA 1E2JA 2HBZA 2ZQYA 1NKVA 3HDYA 3EPJA 4G2TA 5A4KA 1WB5A 1M1YB 1H6CA 4CGZA 3HB9A 1TCVA 4G1MB 1R0CA 4INZA 5J59A 2PA3A 4C30A 4K7BA 5JUWA 5BXQC 4L28A 1A9XB 1REQB 4I3FA 4D9BA 1IVSA 3PTLA 5IT9A 1ISRA 4HMPA 1OJ7A 2M1XA 3STUA 1QAMA 3FKSD 1BMFA 3REQA 4Q9IA 1E99A 3S29A 1U3CA 3K2EA 2MOKA 4HADA 2EBWA 2BCEA 3D7RA 2NO1A 5B1IA 1T5OA 3KQKA 1L1RA 2CVQA 4HPJB 2NTEA 3EVGA 4XEHA 1YHNA 1ZHFA 1GSOA 3EVTA 4UXIA 1V9LA 2BOVA 2C97A 3WMWA 5KKNB 1QP7A 2P0NA 2ZAGA 2K6GA 2QRKA 2WB7A 2A5DA 3A58B 2GBLC 4JI8B 3M1YA 2EFHB 3NIFB 3OQ6A 5ALZA 4LF4B 4RV5A 3OQIA 5KWEA 2VPIA 4HDSB 3FWYA 5I7RA 1PYOA 2G6BA 4NZOA 2WWGA 2F1DA 4NBQA 1KYTA 2Z3WA 4CSAA 2FP3A 2QVCA 2VHZA 3K70D 4K1XA 4Y2VA 4KPFC 4BMVA 3QTHA 5I8PA 1OV6A 4N06A 3TMYA 4JI1I 2ZBVA 5JD3A 3ELBA 4JC0A 2EIMC 1FFWA 1M7BA 1U1FA 4GKBA 3KEQA 4NENB 4IO0A 1VQ1A 4XOUA 2WNHA 1YZUA 4L6RA 1T9ZA 5F4BA 1B6SA 5JSZA 2VSNA 2H1LA 2I2WA 3EF3A 2IOHA 2XW6A 4C3UA 1I94E 1GVHA 1PWEA 1R3DA 1OFTA 5JDCC 2HQBA 1KGSA 4Q05A 2PT6A 2XL4A 2I3GA 4GQHA 2XKJE 1Z7GA 3EXFB 3DAOA 3V1YA 1JXAA 3CV3A 2YZMA 2DKOA 3M6LA 1WHTA 1R10A 4KAAA 1TQ8A 3EW9A 3TNJA 3DKKA 1MGOA 4PYOA 4Y9SA 4NYJR 3T0FA 3GBPA 4LHEA 4D9IA 1R5BA 4HUTA 2EZTA 3EFEA 1N2CB 4L0CA 4DV5B 4IILA 1W9HA 3A4LA 3A11A 1ULBA 2MINB 3PQDA 1XO1A 4G0ZA 3VSDA 3PYFA 4R1TA 1FP2A 2W43A 2KX7A 4EPXA 2OO3A 2DBYA 4LRUA 1J5EE 2BT4A 1ADYA 1JAZA 1W4ZA 4Y2QA 2FN9A 4ZYLA 2Y1CA 2C4VA 3I04M 1B1CA 1DKUA 1UMCB 5HZKA 4DBQA 2ZBKB 2O8DA 1JHYA 2QHXA 1FFEA 2XH8A 4I4LA 5IBQA 4LLCA 4DNXA 4IMIB 4PYIA 4F3RA 3ATPA 2PUAA 2AQIA 2JFBA 3DT9A 4ZYXA 2L6FA 4E33A 3BGOS 5E4TA 4I9UA 1W87A 5E0OA 1NFFA 4KWEA 1TX4B 2QZ9A 1UZUA 4DN6A 1H3NA 3MWYW 2JAPA 5GVRA 1RI3A 2YY6A 3EEBA 4HLUC 3E7FA 1U9JA 3VZQA 5L0JA 1RXCA 5IZCC 2ZTVA 1YDHA 4E03A 3ITDA 3AKZA 2ZJ2A 5DBGA 3V4LA 2G5PA 1WAMA 3IAM1 3J7AC 5HILA 1U0OC 3PXGA 1DPFA 1N7GA 4UTRA 4FYMA 2NQ2C 1MX0A 2V6FA 5ALVA 1MIOB 2ZRMA 1FWLA 1FSSA 4FDVA 3PMRA 3FMIA 5JNTA 4Z9JA 1I4YA 4BWYA 3HJHA 3KQWA 3X1OA 1Z28A 5AVJA 2HA4A 2R25A 4U39A 4URZR 1AQYA 4AKTA 4TXMA 4P9FA 3ZBPA 3C5WP 3QMWA 2J0SA 4BO8A 3NYMA 1DRVA 3HGTA 2Y8EA 4GBED 2C9BA 2A8YA 2HDWA 4IOLA 2G1PA 4ZCQA 2LUOA 1JJAA 3HABA 4DY4A 1L8QA 5IVDA 4CT0A 3K1ZA 3N7TA 3FJ1A 2BBTA 1VHLA 3QA3E 4FWDA 2NN6E 2HLDD 3ZEAA 2CL6X 1VHTA 3TGPA 1WU7A 1DDIA 4PAGA 1CQPA 1XZJA 1U7HA 3JAMQ 1JEAA 1NYQA 1VOTA 1U0TA 2GRUA 2Y9MB 1HE1A 7ADHA 3RHFA 3PXUA 2K7FA 3WZ2A 3KOZA 3ENNA 2BMFA 4FQ7A 3G2LA 3RUHA 4Q7KA 4UBMA 2XLBA 1Q11A 2BMEA 3GJRA 1DCMA 1FX0A 3TTXA 2P4SA 1SOVA 2Y69C 3L34A 1JR3D 3MYFA 3KYDA 1AV7A 3K1YA 4HFNA 1IN8A 3PGMA 3PWSA 1OYRA 4Z4IA 1Z0DA 2RI6A 5G41A 4IJVA 5JI2E 1NBEA 4XTJA 1Z4QA 4GOMD 5IC5A 1SJ9A 4H35A 2GD2A 3G1UA 2DY0A 3HJUA 1W59A 2VK8A 2XMSA 3GFSA 4QFBA 4QT4A 4FBLA 1HF3A 4GOKA 5C8ZA 1X94A 3K2IA 1FLNA 1T26A 5AVXA 1HMYA 3W5UA 2WWYA 2G0AA 2VG8A 4FD3A 3POVA 2G0NA 3C6YA 3JQGA 1QH9A 4MPRA 5CW1A 1Z5AA 1LUAA 3A36A 3AVWA 3VUFA 5JSHA 4M1WA 4GM0A 1VG8A 2ILVA 2XEXA 1YVDA 4D9MA 5A6BA 1VJDA 4WBNF 1GEEA 1E3WA 3HV0A 2PZAA 2IQIA 5FWKA 4DCNA 2UUCE 4UEKA 5IT5A 5BSEA 4GX1A 2HMQA 1L7OA 2P9CA 2VPZA 3E9NA 2AG5A 5J5VA 2ACEA 2Q6LA 2IX9A 1G5HA 5KSWB 4ZYZA 4K7JA 4JBXA 2IUUA 3VPGA 3LZCA 2AA3A 1DQPA 3VX3A 1ZI8A 3AESB 1UBEA 3PCXA 1YS7A 2DRIA 4RTKA 1YBAA 1E6MA 4AE4B 1WY5A 2Z5CB 1HA3A 4P32A 1B16A 3QEAZ 3B6JA 3EXEA 2P4UA 2DQKA 1F2TB 1WTCA 1SWVA 2WVGA 2QUIA 1XRQA 5ES3A 1P3Y1 1F8UA 3ZY2A 5J2TB 4LZLA 4HDNA 4JI8E 4YL0A 1JSLA 1S3GA 2PMBA 4OOEA 2Q1SA 4NNJA 1VXOA 1NLYA 1UH5A 2YW2A 3SQMA 3A1UA 4QX6A 4XEKA 4A91A 1XZKA 4GE0A 1CB7A 3JAKB 2CXXA 5KQPA 3WYFA 1F0PA 2GLTA 1GUFA 5D3MA 4EEZA 1CZKA 3H2VA 2HFSA 2DM6A 2BR3A 2P9TA 3SZOA 5TS3A 5AW2A 4PZCA 3WK9A 4LZOA 1P77A 5K36B 3IBYA 4Y2YA 2Y0PA 2JGFA 2QG4A 2XUIA 3I4CA 1GKKA 4JJAA 4MLZA 3FZEA 4PZ0A 4CYMA 3DE2X 3AETB 4RJKA 3JSXA 3G59A 1XLTC 2FKAA 4MB0A 1SRRA 2WTBA 5AXCA 3TQTA 5KEIA 1C80A 2VYCA 1K2WA 5FI1B 4EATA 2Q3LA 4D56A 3H5OA 3BS4A 3TKAA 2BR2A 1FRZA 2WB4A 2ZDGA 2B4QA 3NOQA 2HJSA 3TXXA 1ZFNA 3U7HB 2F4VI 3PS9A 2WSIA 1N6HA 3LCUA 5A04A 1TJYA 2QYOA 1XKXA 1IM2A 4YT5A 2ZR8A 2PANA 3JD3A 5AI8A 3RJ5A 4RLSA 1ORRA 3KOXA 4PSVA 3EGOA 1TYZA 1T2NA 5FLKA 4NC3A 1WL8A 2OZPA 2Q27A 2H5EA 1KVKA 3ED1A 2FSGA 4E0HA 4XTKA 3WA7A 1N2CE 3BA6A 4DV5E 3HA3A 5KWJA 4YGXB 2EW8A 3V5XA 3ZIAA 4TMKA 1ZJ4A 1F8XA 1F0KA 3OOSA 4BZWA 1ZN2A 1P0MA 4YJFB 1U5AA 3KEMA 1VBMA 3EH1A 4R81A 3PE6A 4PN3A 1QE3A 3L04A 4IZKA 2JAHA 2B2NA 3HDTA 1HL3A 2R4UA 5CDUA 4KB5A 4MW8A 4OEHA 2PNJA 1BDBA 2GCEA 3JQ9C 1VSTA 2PL1A 3AILA 4HNGA 3ZJYA 2Q6IA 5J2UB 4BX9A 2ES4A 2C3YA 2C5HA 1AN9A 2EJVA 1L4LA 3WBJA 4UASA 4P53A 3PKJA 1GNPA 3WIBA 4IFDC 1DC3A 5CVTA 1CR4A 3M3HA 1RRGA 2RG1A 5CH3A 1SY7A 1Q1GA 3GLGA 4GGMX 1FFAA 4DIDA 2BUBA 3MTGA 1MT0A 2BE9A 1GZUA 5EMNA 1KGDA 5G1NA 2UU9B 3GA7A 2WIDA 2FSHA 4RSGA 2O48X 1ST6A 1Y9ZA 2O8FB 4BCCA 1Z6PA 2C31A 2W6OA 1Z3CA 3RROA 5DHRA 4CLOA 1ZU5A 4UPVA 5H3LA 2JE6A 4L95C 2FOLA 3H3JA 1JIUA 2IUEA 2YJTD 4GYJA 3OE5A 4HY3A 1FJGB 1WZEA 4UHFA 1L9XA 5BNTA 3PQEA 4IDCA 3FE2A 3OQHA 4CV3A 3LCCA 3N0TA 5K09A 4M54A 2CXSA 4C43A 2AF4C 4B3BA 1YQ9A 2PZLA 3IR6A 4R9RA 2M32A 1EQUA 2ACWA 1XNGA 4G01B 1FXUA 4PM4A 3EARA 2QKYA 1SA0B 2Z4RA 1LIHA 1GGEA 4CKYA 5JD6A 3KSRA 1Q0HA 1J20A 3C5CA 3VR0A 3QENA 1G21B 3CLTD 1H2XA 4RTQA 4CV2A 5CA0B 4LJ9A 3N0XA 1I36A 4LQCA 5KYGA 1I1QB 1Y3BE 1U8EA 5JH7A 3BRSA 3ZCXA 2CZCA 3OHSX 3TG8A 4TQ9A 4J3FA 1GQFA 4JB8A 1FTGA 3SZRA 4E09A 1G4HA 2P7IA 2G5CA 3DEHA 2FUNB 1IULA 4BB9A 2DY1A 5JNUA 4Q66C 4I6GA 5TMDA 5G1PA 1EKYA 2Y4OA 1YRHA 2BV3A 1Z88A 2WV7A 3CE6A 1BKDR 1M34B 3DVQX 2G77B 3ORRA 1T3ZA 3LC2O 1GAXA 1V45E 4BQOA 4G26A 3AKEA 3CDJA 1GM5A 1AE1A 2XKKA 1M8JA 1WZ2A 2FX3A 4E12A 2SCUA 3UF0A 1X8XA 3SSAA 2ODWA 4OO1A 1AF7A 3LFUA 1GITA 3GG9A 3GBVA 3LHFA 4QQ8A 1LX7A 1XI2A 1S7CA 2I2AA 5IP5A 1E0JA 2B3DA 3ZLTA 5FUXA 5EUBA 3UW3A 5DULA 3KLOA 2ZDQA 3O3NB 2DJ5A 3U61B 2HMWA 2PL5A 1WUHS 2ZI3A 3TFWA 1K6IA 4UKDA 3RR2A 4IV8A 4BNGA 2HYDA 1QO9A 3FYHA 2R9VA 4JR2A 1GZ3A 3ICPA 1DKLA 3FCXA 2KW3C 2Z5EA 1FNMA 3VJRA 3LMKA 4D25A 3W8EA 4YECA 2X0JA 4FWGA 4XVUA 2XB2A 5FTNA 2YKZA 2JIRA 4RZHA 5C9ZA 4M37A 5FA8A 2M64A 1QRRA 2P1ZA 4X85A 4TRRA 3E48A 3NTQA 4WKGA 3K0CA 5A5EA 1WDWB 1GRNA 4IHAA 3F5MA 4O59O 1PJZA 1LJUA 1CUBA 1HZJA 2ORED 1GPJA 3P32A 1J6UA 4DRHB 3AB8A 5DNEA 1U2DC 3N8IA 1GQAA 4LF5B 2AXNA 2H16A 1WXEA 1NRIA 2R79A 3HB4X 3TZEA 4TWAA 3DZCA 3IIJA 3UR3C 2BFEA 2ENUA 4ZQIA 5BW4A 4ZI3A 2Z8ZA 4U8GA 4N40A 4JENA 1EVLA 4QUKA 4HNRA 2VHUA 1H93A 2F67A 4EG6A 5JWHA 1KTIA 2CWWA 4J2OA 5L7WA 4F8JA 5BQOA 4YS6A 1KJWA 1I9CA 3D9QX 4F5DA 2E4YA 1SBIA 4YY3E 1E7WA 4JELA 4PSKA 3ZHCA 1CUYA 2EZ4A 1E79D 3LT2A 3OIWA 1Z6GA 4EGSA 2RHBA 3BXPA 3D1VA 2CW5A 2PZEA 4TT3D 1EQ1A 2WJ3A 1ADGA 3TW4A 1FP7A 4G4SP 3V3TA 2GN2A 4FW4A 2ZI4A 3O21A 4LIPD 2Q50A 3TZLA 4DC1A 5K36E 1PDVA 2VUTA 1KJZA 3NNNA 2OSVA 4BYGA 1OXSC 5FUYA 4WFIA 5JNSA 3WIEA 5JNLA 4HYMA 1YE3A 2GAIA 2JEBB 3QVGA 4A0FA 5JRZA 1KIFA 1MH1A 1F60A 2FR1A 1G4AE 3RWMB 3AJ8A 4KBLA 1CD5A 4DR5B 4LUCA 2GBPA 1V6CA 1HYGA 4L85A 2I4IA 4WGGA 2WZGA 1HT3A 5CLGA 2PZBA 4G8BA 2VQEE 1WEKA 4W7HA 4B87A 5AKLA 1TNDA 1HR0I 2C03A 2VK1A 4PNPA 1JYFA 1PVGA 1CR6A 5KYVA 3ET4A 3QJ5A 4DDVA 2X8AA 1G38A 3M6AA 1GT91 1GTRA 4PO3X 1YB4A 4KHPB 4ND5A 4C76A 2GN8A 3MBGA 3ZNNA 4J30B 2ZSJA 3MOGA 4V0QA 1RAGA 4LQDA 1RPNA 1JT9A 3E1GA 4RQTA 4C0QC 4DV0E 5EJ7A 4J03A 5DIZA 3GR6A 4PTLA 3HR7A 2PGDA 3V6LA 1IL0A 2EX0A 5K3DA 5DEIA 1DXOA 4CKCB 5CCDA 4YAIA 2D0DA 3Q8MA 5IJXA 1SHLA 1R6TA 5E6SB 4HI0E 5CDYA 1IHPA 4NV1A 1HETA 5I7AA 1ISPA 2WJAA 1IU9A 1CUAA 3TLXA 4K6CA 1GDHA 4KH0A 2WVQA 4J0CA 4IB4A 3TJMA 3ENWA 4OQDA 5JAQA 4P7FA 5IVIA 1D2RA 5AW9A 1T9HA 3TRIA 3NBKA 5D8DA 1PYGA 2ZKIA 1Z2PX 2Q41A 1RKUA 3R3SA 1L4NA 3R6GA 3ABQB 3L79A 2PG3A 3WK6A 4DILA 2QLMA 1BN6A 3ADOA 4NNPA 5KNDH 3N2EA 2J5BA 1QIEA 1Q0SA 2Q5EA 5DLJA 4FILA 2CXHA 3AM3A 1IN4A 3RVLA 1R4NB 4UUNA 3IEVA 1ZRNA 3SJCA 1ESDA 3KV1A 1ATZA 2EKPA 1DJPA 3TZQA 4OQZA 5LYJB 1I2MA 4N6HA 1Z5UA 2ZUFA 4ZT3A 2VDKB 2IPOA 4BQFA 1X7XB 2RAVA 3GVPA 4YDHB 3TW6A 2F22A 5GY7A 1M10A 4Y98A 3H7AA 4MEAA 3RUAA 2ZRHA 1Q3TA 2VXBA 5EPOA 5A7GA 3S2ZA 3U3DA 4ETMA 4AFNA 1H2YA 2A14A 5BORA 1VE1A 1EP3B 2NV0A 2Q5QA 2ZSIA 1DLJA 4R7GA 1ZHTA 1NUSA 1MABB 2XKBA 1TLTA 1E2PA 4YRPA 2NSYA 3FFBA 3ZG6A 1P9RA 1L5GB 4QUBA 5JDIC 2VAWA 4QYTA 1AM4D 1JR3E 1E2MA 2XTAA 1TUGA 3MWLA 4WNIA 4G36A 1E3EA 5IVKA 3I6YA 5EZ5A 3IMGA 4G8DA 2B8EA 4MR9A 3D6HA 4GXQA 2WD7B 5A4JA 2RGUA 2HMYB 2QN8A 3O90A 2A0YA 3GB9A 5CBPB 1YLMA 2CUTA 2VK4A 4MRMA 3AY0A 4PLTA 5EJEA 1J24A 2WJYA 3WLNA 4RZ2A 4R1NA 3GLHB 3O8CA 2DFPA 2V1XA 1YL6A 1GWNA 1SUBA 4M6WB 4DDWA 4FYXA 1NW9B 3UBMA 1GSHA 2FHPA 2ONJA 4WVLA 4M49A 3R0QA 3CRMA 3KB8A 3DZHA 3OWXA 1JE0A 2R1TA 5J2UF 3RBVA 3BCHA 4FGKA 5D5PA 3IP5A 2O2ZA 4RPGA 4A5OA 1LY1A 2BEJA 5AM3A 3N05A 1ZW2A 1NZ0A 1I7NA 4M8NE 4YIKA 3NM4A 2NVUA 3LUHA 3QSYA 1F4PA 3FDXA 1YUBA 1HDRA 5CG1A 4YAJA 2GM4A 4OQPA 4LDAA 3AHFA 2JIOA 1R7RA 3G23A 2QPLA 3VAZA 3E18A 4PZZA 3W9SA 3HBAA 4OHXA 5ALYA 4KQHA 3T5DA 4CLRA 3H9JA 1ONSA 4ALNA 3A9RA 4U5QA 1SC9A 3EVCA 1KEEB 3IMEA 4PG7A 4QICA 4TXJA 1JH9A 1EB9A 3GH1A 3T5TA 4CUZA 4F4BA 3ZHQA 1WCIB 3GT3A 1UAGA 2HB6A 1RC8A 5GJBA 1P2UA 3ECSA 3WLIA 4WOCA 1W19A 1FXWA 4MAFA 3LLUA 3KRTA 4DUPA 1C03A 3ZI7A 4Z7JA 3UWPA 3VR5A 4XD2A 3WTBA 1RCTE 4IRUB 3VNSA 3F7NA 4ARCA 2IP1A 2IOYA 4NJEB 3OZSA 3TI9A 1DZ3A 2JARA 3GRUA 1Q2XA 4UBLA 3DCJA 3UEOA 1M8GA 1D9XA 4QQKA 2FPWA 4ECEA 4OSOA 1HW1A 3CWQA 5JUAA 2PM8A 4EKEA 4L16A 1JALA 2OSBA 3AZOA 4YCAA 4AG3A 4X7RA 1AHNA 5C51B 3SC2B 4KKVA 1XXHB 3CNBA 3DXJF 5FLXQ 4RNDB 1IIRA 2H2AA 2C2XA 3WSVA 1OASA 4DJTA 5JJ5A 1QQ3A 4HUQB 1PF7E 4X24A 1W30A 5COMA 3MWDA 1P4SA 3EUAA 4ZGBA 4IVNA 3ONFA 1E59A 5BY2A 3PGJA 2WHPA 4DIOA 3ZKBA 2DWUA 3I52A 4F92B 3THXA 1NQWA 4QQNA 3GN1A 2VUHB 2WPDA 5GV8A 4RSMA 3G50A 3GFQA 3H16A 3IH5A 1CY2A 2IK8A 5B2ZA 3IAHA 4D46A 5C31A 4RL4A 1CR2A 2O6LA 1MX5A 4B8YA 1EUYA 3TOXA 1I9GA 5JHGB 1Z4JA 2H4WA 2ZRKA 4EDHA 2XNDA 3AJEA 1LW7A 1Q20A 3QELA 2Q5CA 4DSAA 1NYRA 2HTEA 4Y2PA 1D5WA 1HE3A 3U7QB 1DEKA 5G2OA 4GOXA 4ZVSA 1C3VA 4FP9A 2J32A 4F4CA 1GPLA 2OB2A 2R7VA 4GR9A 1FIUA 4JITA 1T2AA 3ASYA 2X3FA 3E5MA 3RJTA 5HYVA 5A7HA 5TVGA 2AFHE 1E3IA 3SVTA 2QQFA 3VO2A 2Q3DA 2WUEA 3FPKA 2GZHA 4Z0PA 4AICA 3PTZA 4ULVA 2PX2A 2R66A 3IAAA 3JRMO 2V97A 2EQ5A 4YMWA 5A03A 2OCPA 4KHPE 3N07A 1ZRMA 3VPSA 2HNAA 4IDEA 4S2EA 2N1MA 3CH6A 3RIEA 1MOSA 4KC0A 4Z86A 4Q4AB 2ISQA 4S1PA 3C70A 3EXG1 4MQ6A 1SHKA 1OFVA 4F4DA 3NTOA 2XXJA 4IUDS 5GP1A 3AHIA 2PFKA 2BC5A 3NP7A 2B6HA 3CW8X 2QBYB 2F8TA 4IX1A 3QV2A 2VC2B 1A1SA 3W06A 1NX6A 5AW3A 4ZZ0A 2H1VA 5EL0A 2VOJA 5B2EA 3FDZA 1QFZA 4CM6A 4XPIB 5IAGA 4BP1A 2ZCUA 1NXPA 4XIGS 3W4JA 3K0FB 4YXWA 1JRAA 1P7VA 1DL5A 4N01A 4EA7A 4EMTA 2FMHA 4OXKA 4EGFA 2YWGA 3DGEC 5AKJA 5AI4A 5B4VA 4P92A 1H1LA 3FOOA 4MVYA 2Z9BA 1X80B 3B7PA 4DRJB 4LE1A 2AH5A 3UHFA 4B3JA 1XQ9A 2NN6D 2WTAA 4OREX 1FYEA 1TAUA 1UKEA 3H05A 2QVZX 2JB9A 1MVLA 4NAHA 5H7XA 3ZHTA 1B0ZA 4MIKA 1ZGAA 4MUBA 4J0EA 1E94E 3B1VA 4GFDA 3TR6A 4MW7A 4IP0A 1T6QA 2DT8A 4NV3A 4AF7A 1X1DA 3QYAA 4K9OA 2G80A 4M1OA 4EYKA 2G63A 1VPWA 3VR2D 1ZITA 4MH0R 1E2DA 4P98A 5AIBA 1PHPA 3T1YB 2AQKA 2C2KA 4WUTA 3I42A 2B1QA 3AR3A 1UM8A 3GCDA 1U2SA 4RPJA 5A3QA 3MGAA 4XW2A 3S81A 4WN3A 3UOWA 4KRFA 1T1RA 1K7FB 3U3FA 3ANYB 2ZUBA 4UD6A 2O1EA 5KNDA 1G5RA 1B8UA 3LJKA 1W85A 2VRCA 1EMDA 1LPAB 1B93A 2JIZA 3ASVA 2G1UA 4NE2A 2HLPA 1G2OA 5C37A 3L06A 3B3JA 5C32A 1OXKA 4MYRA 3PL5A 2EPOA 3WNZA 4I1OA 3AVTA 3IDZA 3LEVA 4HEHA 3SQLA 3W7VA 2DFNA 2D1SA 3NWJA 2NU6A 5L3QA 1UDOA 2N3ZA 3WX0A 2AMLA 2GD0A 4CMJA 1BXGA 1N5IA 5K3FB 2VJMB 4RCYA 2GB4A 5AI5A 4BP8A 4AO7A 2XQJA 1TJNA 4MXDA 3UT5A 1RXYA 1OZHA 4E2XA 4J0QA 3UG7A 1PV2A 3P5SA 3IERA 3PG5A 3BOSA 5EHQA 2LJPA 3FUCA 3EA0A 3G0BA 4P52A 3MUOA 4KJXA 1MJ5A 2G09A 3GI1A 1O6FA 3HCPA 3EZFA 3S44A 1ZVKA 3PVCA 2P0YA 4HE8D 1VSUA 4R1PA 2VB6A 1GRCA 4ZK2A 5JMPA 4RHFA 3WIOA 2WSYB 1UBSB 2BEVB 2REQA 3HN6A 4AZ3B 5LYJF 1YS2X 4DDMA 1HH4A 2O2HA 1XQ1A 1N2OA 2NIPA 5REQA 5KNBH 4JSTA 4JLSA 3PNQA 3NBXX 5DRQA 1U4OA 3RJMA 4J3DA 2I8CA 3RSCA 3GGJA 3PEEA 3TSAA 4RMIA 4H17A 4WUDA 5EKWA 4MV1A 3N8HA 4MQEA 3MUFA 4YJKA 4ZZ3A 3ANTA 2D13A 1S8NA 3NW9A 1B14A 2D0PB 1X6VA 3PQ4A 2RHHA 4PQRA 1F2DA 1U04A 4V0RA 1WXXA 3IDQA 4A15A 4L72A 5CNJA 1CQWA 4LX0A 4UVIA 2JNWA 2W7TA 4D74A 2D8AA 2VAMA 4JFAA 3O2QB 1JU9A 4TTAA 4X1KB 3DH0A 3LPCA 4UJ3A 1TI7A 1KEZA 2HIHA 3GJZA 4TN5A 3HKDA 1EIWA 2C2BA 1F0YA 4C7KA 2I55A 1RTTA 2OY0A 4MVQA 2H4JA 4DIUA 3AFNA 1DJNA 4JI3I 4BFXA 1WF3A 1Z36A 3K1AB 3EQZA 3LDHA 1L1QA 3WLMA 2R6AA 1E9BA 5LMUI 1UQUA 3BT7A 5H80A 3IUSA 4UBJA 1XTBA 5EMJA 5CDGA 4QOSA 3KJXA 4BGEA 1CUDA 4EVIA 1VYKA 3KHTA 1QKRA 4D9NA 2ZRDA 1T13A 1JVSA 3RVBA 1JG3A 2R62A 4MS1B 1BDMA 4KQFA 4B0PA 4M46A 2CMGA 5JYEA 3REGA 5JH7F 1QYIA 1JF8A 1Q22A 2B35A 1MZVA 3HI4A 1C7JA 4RADA 1I6MA 3VPFA 3ZHXA 5I3CA 1OJLA 5IS2A 5A5FA 3P3GA 5EWJA 4Y2JA 3MINB 4HZGA 4HG2A 3ZHYA 3AL0C 3BL8A 1CVLA 2CYBA 3WQSB 2PNMA 3TBHA 4OJYA 2BKVA 4Q9JA 2WF9A 1RJWA 1S8OA 4JBLA 1LS1A 3PPYA 5D3QA 3F6PA 3N2KA 2V98A 5BW8A 5BMVA 4FE4A 2QG9A 3NYJA 5ERGB 5T4BA 5FOQA 2XRHA 1RWXA 1I32A 1FDRA 1V37A 2R1VB 3QPUA 1MMGA 1NIJA 4R31A 3QPCA 2OQVA 2ZVJA 2Z15A 4IARA 3RSZA 1P2BA 5DHTA 3GHYA 1S4MA 9ATCA 3AGPA 1A7VA 3VH2A 4R98A 1S9DA 4QXPA 4JC4A 1DPGA 1VISA 1VSVA 1QG6A 2XL8A 3FDQA 2FRDA 3I6ZA 4NCIA 4OY3A 5F1OA 4K81B 1NRJB 3ZOKA 1NP6A 4O8ZA 3KJGA 2PKYX 4FNMA 3OE4A 5JCOA 2HWUA 2WLSA 2KK1A 4DIKA 4KI2A 1XAJA 2ATIA 3H5LA 5JD5A 2J5KA 1H2FA 5FEUA 4DJ9A 5HGJA 3CX3A 2JL1A 4B6OA 1NW8A 1QKIA 3RRYA 1MRZA 1OBOA 3H86A 3BORA 1N34I 1F5SA 3DVAB 2OB1A 3OIYA 3O8QB 5FO0A 4EJ6A 4M9SA 4R6WA 3T7EA 2CL0X 1E7SA 3IALA 1QGUB 3CONA 2XA1A 4FAPB 1O96A 4KREA 1R4TA 5CFPA 4AY6A 3EG9B 4AKIA 4Y9DA 4ZYUA 4QT0A 2XQGA 1GQOA 4A16A 2FWAA 3LD9A 1H0SA 4IZ6A 5T4HA 2GYUA 8MHTA 3BULA 1LLCA 1U0JA 3I1FA 3UY4A 2UAGA 1HKUA 2H51A 2HWXA 1EVKA 3FF4A 3TULA 4AECA 4XYMA 5I7UA 2JPDA 2H5IA 1QC5B 4E2WA 3ABZA 4KX3A 4ZAZA 5JISA 2XA2A 3REOA 2W4BA 1DMRA 1QV7A 4W9RA 3CVOA 4OQFA 1W88B 2KLBA 2BSAA 1UXJA 3ZPXA 3WV4A 1PG0A 3OBIA 4JV5B 1FUKA 4JBYA 5KKCA 1UBHS 1SR8A 3O8LA 3DG9A 1HLGA 2FZCA 1QDUA 3GL9A 4FFBB 2VWHA 3MN1A 2QEQA 4DA4A 1K63A 3U2LA 3GEIA 3GDOA 1H72C 2NZVG 1T5SA 4MYTA 5JBNA 1HNZI 4MZDA 1KAQA 5E8JA 4BO1A 3T1YE 4FD2A 5TLSA 5EAIA 1OLSA 1OH7A 2YTZA 3C3BA 3GBSA 3UJ8A 5LWHA 4PZAA 2EEZA 4YUWA 4MLPA 1JHXA 5T3UA 5CFMA 3R44A 2AC4A 5B37A 4B80A 5TQ2A 4XX0B 3C3JA 3WAKA 4BP9A 2ZS7A 3F3MA 1O3YA 3DXXA 3QOWA 3QNUA 5THKA 1Z4OA 1Z0CA 3B53X 3F71A 3NLLA 3HNIA 4GQIA 3BICA 3ZKWA 4ZVIA 2WJ4A 1MTOA 1VJ1A 2DR2A 4CIHA 2PZKA 2UUHA 4Q4HA 1O5TA 4DSNA 1RLOA 4L08A 1P75A 2RAUA 5IM4A 1SO8A 1XZQA 1NN5A 4QJ3A 4UDXX 2QN6A 3TPFA 3KXLA 4OHFA 4DV4B 2AJ8A 1XN4A 2WBLC 4IFTA 1MXHA 4FZJA 3QVZA 4I50A 5JAHA 2XWQA 4DEVA 4Q82A 1X15A 4V0LA 4Y1RB 4H1TA 2TMYA 1KZ4A 1NHJA 3NATA 5GIPE 4MI1A 2PZMA 1I3LA 4YV1A 2ZXRA 4KRYA 1DBIA 4DA6A 2WMYA 4NCNA 1DIGA 3AUAA 1Y8CA 4Z4GA 3VVBA 3M5DA 2WNRA 3ZKAA 3FNHA 1MW8X 4J3NA 3PFHA 1Y8RB 4RY9A 3JARB 4WJLA 3DV9A 1QMPA 3UXHA 1RYMA 3B4TA 4B35A 2WI8A 2G4LA 3O31A 4DUGA 4CKBB 4E5NA 2HO4A 3JSAA 3IA2A 5C4MA 2VCYA 4IICA 1X1AA 3NAZA 1EAYA 4YV7A 1J1ZA 4OGLA 2DE0X 1WZIA 5KOYA 1AA6A 1TXGA 3B3AA 3DOUA 1UJ5A 3BIXA 3UAXA 4ANJA 3O3CA 3BK1A 4ZO7A 1B2LA 2GTIA 4MWOA 1EX6A 4HQKA 5LKRA 1QQ6A 1KARA 2QRUA 4ZOLA 1YU6A 2BRUC 3P94A 4LY6A 1SH7A 3ANMA 3B7WA 4C06A 5FOXA 3OLCX 4PAOA 1VL8A 4JBGA 3LCMA 5JBQA 3NIGB 2ZUDA 3QLUC 2ZE8A 2O2CA 1QB7A 1V71A 1D0IA 2K4MA 3EDYA 4QTZA 1HQDA 2A57A 1U8CB 5K36D 3IAFA 2GS8A 3NALA 3FR7A 1WSDA 1MQ9A 3G0GA 4BV2A 2QMQA 3ZXSA 2JS7A 3GQBB 4HPWA 3VC2A 5LMZA 4JI0B 2JD2A 1OPRA 2VHYA 3P96A 4B40A 3IXLA 2X51A 3ZV3A 4KBYA 2Q9AA 1E8DA 1Q7TA 5G0UA 5K0CA 2WFLA 2Q5FA 4DCMA 1VDZA 4CDMA 1CDEA 3HEAA 2F59A 2NX2A 5DX0A 3KQOA 1KI8A 5CURA 3H4IA 5KNBA 3G8YA 1BQ4A 2FSIA 3HVRA 4HLCA 1E7QA 1H66A 5CW2A 3OFKA 3ROQA 5BV1A 4QU8A 4JJ6A 2MYSA 3PRJA 4TKUB 1RBQA 4HNTA 3GARA 1B7GO 4CCSA 1ZYUA 4NFYA 4G9EA 3RFCA 5AVZA 3MJVA 3RH0A 2WRZA 2BJVA 5EP1A 3LC0A 3I39X 3MTIA 3O8NA 4AIDA 2FDRA 3VM6A 3DEFA 5H0IA 3M5PA 4HEQA 1WOYA 2J08A 2J4DA 4QOHA 5ALKA 1N5LA 4WZBE 3SZ3A 5K0LA 1I33A 1QPGA 4K03A 1L7DA 2QD5A 1A1VA 5I8ZA 1T1SA 3VNUA 5B55A 1NG1A 1QHGA 3NORA 3GANA 2HA2A 2F2TA 1PJCA 1RHQA 2MSNA 4ISAA 1I3NA 5FP0A 4BA1A 4WZAB 2J59A 1GQ2A 2JATA 1JFSA 3GELA 1H5QA 1ZGZA 3LQ2A 4AF8A 3O4HA 3H9QA 4U6SA 3E7XA 3W8NA 2CYAA 2WYHA 5AW1A 3G5LA 3S27A 1PGOA 4NP6A 1JI3A 5LQMA 4EQ6A 5LDHA 1E9AA 1FC0A 2ICWG 4B85A 4K40A 4E5VA 4OI4A 2WIKA 1H2RS 3WRYC 3THOA 1VB3A 5DOVA 1EP1B 2ZAMA 3TB6A 4LBZA 3N5KA 5C1DA 4Q7LA 1NQXA 2XCSB 4FI3C 1D6NA 3N74A 3NZKA 5JRAA 1RJGA 1ZGGA 1UMBB 4BO4A 4Q1BA 3PC4A 3SXJA 1BDJA 1G8GA 2GXUA 3VHXA 1NF9A 4NDNE 3KKPA 2O0KA 2JA1A 2GK3A 3Q2KA 3T38A 1SPXA 3OEYA 2VTVA 1VLLA 2ZJYA 3D3WA 2XUZA 1VG1A 2VSOA 4LQLA 4UNIA 1NZDA 2QYTA 4L74A 3D6AA 1BMQA 1RD4A 4N5IX 1T25A 4NOKA 2XWJI 1O2DA 3VGPA 3FZNA 1HNNA 4G8JA 3H1FA 4YV2A 3QY0A 3FYSA 2AL7A 2DPYA 4KMMA 1V2GA 1RYNA 4MKXA 1XRJA 1LSJA 2YVKA 2E2WA 1Z2DA 3IEPA 5AW6A 3GM1A 4WUBA 2PT5A 1FXWF 2ROQA 5L6LB 5H82A 2V2VA 3PNLA 2OQMA 4MU4A 3V5YA 1LE2A 1EU1A 4QUDA 3FW1A 4M7WA 4W4TA 3L8YA 3G2IA 1VPDA 3OTIA 1UFQA 1AQJA 4M3NA 1CY7A 4PAMA 5KOHA 3N24A 3J80C 1U6HA 5DNLA 2G9QA 4TS4A 2O2IA 1QHIA 2C39B 2H4ZA 5EP2A 2OD9A 2JI4A 5LU8A 4HFMA 1JEOA 3NTUA 4DLBA 2WJIA 3DLCA 3IT1A 1E2BA 5HZMA 4RK5A 1K8XB 3RO7A 3PF8A 4M76B 4K3UA 3KOYA 2NVBA 5AOAA 4JV5E 1M1YE 3ZU6A 1PR9A 3OCJA 3I2HA 2NO6A 2W2QA 4H7JA 1U2PA 6NULA 1HYHA 4TS1A 1KF0A 3KLBA 2BZGA 4DV7I 3GGGA 5EWMA 4YPVA 2YJ4A 1ZAYA 4YJ3A 2WOOA 1XKTA 4C3DA 5G02A 5EE1A 5HKKD 3RAEC 5ED0A 3EVZA 1U6JA 2BL4A 2Z83A 5EHNA 2OO7A 4MYUA 2QRGA 1S2DA 1APCA 2ZUWA 5BXYA 1QF7A 4R5HA 5ER6A 1AQNA 3R77A 3R76A 2OR3A 3HYLA 4CTMA 1QVVA 4ZV9A 1XB2A 3TNYA 1C8VB 3DZAA 4RD6A 4ES6A 4QG3A 4LF4E 2YOFA 4D3ZA 1SUSA 4L15A 1ZH6A 1BJTA 4AZTA 1R0YA 2Z2YA 4D0NA 3ZDQA 3CW9A 1EVQA 4CGYA 4AY4A 4F9FA 3REQB 5JLAA 1H8HD 2ARKA 1DEOA 2F48A 5JZMA 2NV6A 3HMKA 3CQZA 1YZFA 4Q03A 1X3LA 3M1AA 1YKGA 4NQZA 2PHZA 3OURA 2D7JA 3OM8A 4HSGA 4ID9A 3ESAA 5KREA 3RKUA 1H2HA 4X6YA 1O0SA 1CYEA 1A4XA 3FAPB 1Z8DA 2CLLB 1E3PA 1FVOA 3BREA 3A2NA 2GD1O 3TXYA 1RYYA 3TLCA 4QUEA 4IKPA 4MJ7A 3H4MA 4O2AF 3OQIB 2ZFUA 4I1SA 3L8JA 2DHEA 2QORA 1Y6DA 3OLYA 2YMPA 2Q5JA 1MG7A 3WYAA 3OE1A 2G83A 3AR7A 2H7OA 1LE4A 2BHSA 2YN2A 4DBVO 4MB6A 1LXCA 3K0AB 4OLHA 4YJ2A 2XOEA 3DKRA 3FOFC 1K7CA 1HWYA 4LOKA 2XNCA 3VNVA 2I67A 1MB0A 1U8FO 3WHLA 3I61A 1OAOA 3ZD6A 5TQJA 5JSZB 1RNLA 2GA8A 3HCOA 2YC4C 3TL3A 3BWMA 3LJBA 3MM4A 3RYHA 3FROA 4BRSA 2NADA 1N7HA 2P5UA 2W9YA 2H4XA 4Y1FA 1DFHA 2QE9A 3VDMA 4JI0E 3P9KA 4G1BA 1VGRA 2JGDA 1YCFA 1KC1A 4ROSA 4D4IA 5GVSA 1OCRC 2Q45A 5HFAA 2F55A 5DYNA 1ZMTA 4CX9A 3DXFA 4X1IA 3HFJA 1N8NA 1QYVA 2SICE 1A95A 1HK7A 4UM7A 5JNVA 3H8SA 3N1UA 1F14A 1WHTB 1L4YA 5IXJA 1QP0A 5LPNA 1ZC4A 3BWXA 2E4UA 4DIFA 1W44A 1XVLA 3DAHA 1RKQA 2OUIA 2GPNA 3EIEA 3DDUA 2LE0A 3ICWA 3PDJA 3QLVC 4X8LA 2QAIA 4JKIA 1LS4A 1N7IA 1TRKA 3DMTC 1ULUA 2XZOA 2AFVA 2RAFA 3UKOA 2J5XA 1Z4IA 4U9IS 5DXFA 1O8BA 4OLFA 3G1TA 3KXPA 2WJHA 4KO1S 1ZW1A 2O8DB 4KOEC 4D2IA 2G3YA 2V4ZA 2ATCA 3Q9UA 4Z7QB 2C58A 1U1DA 3NDPA 5ER9A 1P5HA 3STHA 1I0LA 5TPZA 1LK7A 2AQ8A 3NU1A 4XWWA 3S0XA 1UT8A 2QV7A 3ZI0A 4WK6A 4KMSA 5DX8A 4WK0B 4EB3A 4YH1A 3DFIA 1RQ7A 3QHQA 3RUFA 3QWIA 4HNSA 1BBHA 1AUQA 4ZYTA 5DYTA 3KMIA 1YZHA 2QTZA 2I76A 2FEAA 2JLAA 3U1YA 3OPQA 2B20A 1AMNA 2C57A 3STXA 1LQTA 5FFFA 3EDQA 3G7NA 2I6GA 4B4OA 3A1TA 3QU9A 4ZC8A 2PRJA 1UKZA 1IW7F 1QO0D 3MWFA 4L75A 4RAQA 1XWJA 1GGVA 1NVXQ 4PCUA 4GKJB 2XUPA 3LESA 1IUNA 4F6RA 3NBMA 3G0CA 5SYNA 3LC7O 3RM3A 2YQYA 2GBCA 1KZHA 1J2TA 2R25B 3AIKA 1YFLA 2J7PA 2OFPA 3NYRA 4OQQA 2NSDA 5IN5A 1IBLI 4D4LA 3H2SA 1QCDA 5KZMB 2BMAA 3VNRA 3LO8A 1KEWA 4MUAA 1FJXA 5KYNA 2R5FA 3EPPA 3LAWA 5IWAB 1T4GA 3Q7GA 5HSGA 3CUUA 1T6IA 3D6VA 1H7SA 4F4JA 3CIFA 1IY9A 4GX0A 4FYYA 4PPQA 3KDAA 3PDCA 4MWEA 5LYYA 2NV2B 1TFKB 1VRCA 3OCYA 2HF2A 1IY2A 3VR5H 2WUFA 1E3LA 3AF5A 1NZFA 3SYNA 1WGWA 1RZVA 3K33A 4B3RB 3CVUA 3NH9A 3FMPB 1H85A 4YRZA 3VDXA 1E5XA 4XEVA 1Y42X 3B38A 5IT9Q 4R4JA 3EDOA 1M0EA 3MZ0A 4HX9A 3Q72A 5FH9A 4Q3CA 3BMQB 3MD9A 1AC5A 4O6VA 1IHDA 4IDNA 4U5FE 2OYCA 4GLFA 1AUVA 1WG8A 2YVQA 4JP5A 1VP3A 1FX0B 1MAWA 4YN3A 3KYDB 2YHIA 3GMSA 3BBLA 4ZIRB 3EEQA 3DHYA 3AYXB 3H2BA 3IAXA 2NUPA 1E6WA 4CLEA 2A1UA 3PGA1 1SVUA 1PZHA 3VAAA 2IEYA 1Y6ZA 2JEAA 1OMOA 1SQ6A 2O19A 2CB9A 5DIFA 1ZHZA 1KMHA 3OQBA 4Y0VA 1N6PA 1ZJYA 4J3JA 3OMLA 3B3FA 3PC7A 2UVQA 2MSEB 4TQGA 3JQGB 1NQOA 5A9SA 3ENZA 1G7RA 3W5AA 1Z13A 2AJBA 1JIKA 1R0SA 2C9DA 4CIYA 3T1HI 4C22A 1IQRA 2ZR7A 1YA7O 3LUPA 3HSYA 5F78A 4YMUA 1IXRC 2IEDA 3Q15C 4LK3A 1JDBB 1KHTA 4BNWA 1T4BA 1E3WB 4MEBA 4DLLA 4GVPA 3UAGA 1A71A 4WXHA 5FAKA 2DEUA 4J9UE 4XI9A 4K86A 3SOPA 2LD4A 4A9AA 2WZLA 4NYMR 4B6FA 1SZDA 3B9QA 5BMVF 2EERA 4ZOEA 4OJQA 1FQWA 3EHMA 3I09A 1K40A 5EE5B 1U0EA 2RBKA 1W29A 4QAJA 4X66I 3RADC 4KFUA 1NWCA 4EB0A 4D9EA 2W6MA 4JP2A 1BEZA 2FX2A 3RG8A 4TYYA 1N77A 1Y6QA 4A26A 2O1SA 1W581 3MS2A 3NHSA 4F46A 2IP2A 3EXEB 1RADA 1NTRA 3A14A 1GPBA 3Q8LA 2DHQA 4G25A 5F7ZA 2C88A 2YYZA 4HDNB 4H1WA 5JEAC 1K7SN 4QD3A 4YASA 2XCRB 3ZTWA 2HPAA 3H2GA 2C2ZA 1RIIA 5CYFA 1GU1A 1CDOA 5IKOA 1CUFA 5CRIA 3K71B 1GIAA 4G6ZA 1VHQA 2Q1XA 3GRRA 3IESA 1PEYA 2A9PA 3GYGA 1G7TA 3IO3A 1EDBA 2OZVA 3KJFA 5D3MB 3B5JA 3WKDA 4MJLA 3IPRA 2O3SA 4HAVA 3M3PA 3F5FA 5ULLA 5D51S 1TT7A 4L8FA 1RKCA 3NKLA 4TTIA 5T8KA 2WTEA 5B7GA 1T5LA 4Q0MA 4D1YA 1J09A 3QLJA 2GAQA 4TPKA 1AQUA 4G4GA 3ROGA 4JLKA 3WMXA 2JKYA 1CR0A 4G0MA 2V0GA 1E77A 1M5RA 5FPSA 2QU8A 2XJ4A 1VPEA 2BF7A 3DTYA 4E5PA 1DC5A 1KI3A 5HMMA 2SHKA 4H59A 2J46A 5JCJA 2BFCA 4LVUA 4N65A 3UPDA 4EGJA 1PX2A 4GH5A 1UBCA 3ERCA 3L7LA 4GMDA 2RFLA 2BR2B 4MWTA 1MKYA 3LA8A 2HK3A 4MV6A 2RGEA 1JJIA 2PX6A 3CZAA 5G3YA 3BZWA 2IWHA 3WGUA 3BGIA 4YQFA 4EJMA 4PHFA 2PUGA 4XTCS 2YZ7A 3T5BA 3BQ9A 4NVRA 1U2RA 3C6KA 4QOIA 1ZL2A 4AZ0A 1XTKA 3TNDA 4C01A 2UUBB 3TJ5A 1SXJA 3NNSA 4EWCA 3WLTA 4ZO4A 5C80A 3PUXA 1UPXA 3L84A 1A9OA 4AS2A 4H7HA 5GWXA 1G2IA 1KXJA 1ISIA 3GLRA 5DXAA 3KVRA 1YS9A 1GPH1 1UR5A 3WRVA 4D8VA 2UU9E 1LVKA 2FSVC 4XWOA 4IZKB 5LQSA 4EHIA 4L6IA 3IB3A 4O4HA 4LDPA 1NVEA 4W5HA 2L19A 5IUKC 5P8WA 3WHNA 4ZYVA 5DH9A 3CF4A 2DQSA 3TDNA 1WPGA 3ACCA 3HJNA 1USVA 4QGSA 4EUNA 1O95D 3E70C 2GNAA 1Y9DA 1FJGE 1E20A 1JZTA 1CC1S 4GI3A 3E4CA 1T8UA 3NTRA 3KYIA 1T1GA 3BWVA 1D4AA 3USES 4R69A 2X3UA 4MO9A 1HYEA 1QX3A 2Z56A 3B13B 4H31A 3GLGB 3WWZA 1FOEB 1TVCA 3AOEA 3F8TA 1OT3A 4G0HA 4DCSA 1JA9A 5JS5A 4HB0A 1JP7A 4C3OB 4V3CA 1G21E 1ZD2P 3ICCA 1Z2OX 1L3PA 4BX8A 1YC2A 4JT2A 1E4OA 1KVTA 1MF7A 1NBAA 3R1IA 1NDUA 1O5IA 4CLOB 4DUYI 2JE6B 4W5QA 4Z6KA 2JGEA 3OD5A 5FPYA 2C7OA 2C2WA 4QXMA 4JCOA 5FUMA 4AJ1A 1SBHA 1M34E 3CFYA 3DLIA 4UTGA 3LPSA 2AEJA 2QQEA 1H2WA 2P1DA 2RH5A 3L7JA 3B6MA 3M6IA 2H2GA 4TXNA 3H0KA 1ZXLA 1E83A 4CLDA 1YZVA 5IWAE 1S05A 4EI2A 1DKPA 2WM2A 1XCOA 1CQJA 1XZBA 3ETGA 3PUHA 3KSAC 4G5OA 4CJGA 4CUJA 3G8AA 2RB4A 5CLLA 3HNLA 4WNCA 3IQFA 1Y4SA 3MFYA 3V8PA 5JH7B 3PK0A 2CT8A 3KYCA 3RPEA 3MRXA 4DANA 3WGNA 3E0XA 3OEED 3WIUA 3QGMA 1DWPA 2HJ3A 1OGYA 1WABA 2IOFA 4EYQA 4A3SA 2PLRA 1CULC 5DQTA 4B3RE 2I22A 4IL5A 5I9LA 4XASA 3MTJA 1DBRA 2Q7XA 4I5FA 1T4CA 1ZOIA 3Q1KA 7ABPA 5ALQA 3VMFA 4GM1A 2FN4A 2IGTA 2XQKA 4CM7A 3K2BA 5IVHA 1IBKB 3CISA 1YC5A 4TLEA 1Y9EA 1ULHA 4GMFA 3KTAA 1XKLA 1FBTA 1KFEB 5LP6C 2VPWA 3E03A 3AQBA 3FHLA 2SCUB 4G5XA 1ZZEA 1I5RA 3MRVA 4BVGA 4OHOA 2H3EA 1Q1AA 4OO1B 3C7JA 2XMGA 9MHTA 2OL4A 1DS6A 1L7QA 2FW9A 1UXGA 1ST3A 2H92A 3QUSA 3TSCA 3VSCA 4OQLA 1YB2A 5SICE 3SQWA 3IXQA 4TWIA 3AV3A 1QGED 1Y37A 5CT8A 1B00A 4B6JA 3T0IA 1ISJA 2H57A 2OV8A 5B1AC 3OZBA 2V4MA 1X9HA 3KCNA 3GFBA 4X84A 1C81A 3BG5A 2XWPA 3FHOA 1E63A 4LF5E 3TTYA 4FYJA 1RJ9A 4LZJA 5DS6A 2PGNA 3WC4A 4A4DA 1DC4A 2VC9A 3SR4A 1BH6A 3LBAA 2I2BA 2C1EA 4FU0A 1FTWA 1TWCA 4CNBA 1TE2A 1DINA 3S7TA 1PI3A 2YWJA 3NJ4A 3ZTMA 4GMGA 1UEKA 3QTTA 3PQ5A 1FTNA 4QECA 3SQDA 5JSUA 1PNTA 4OHRA 4KO2S 3A6HA 1CGNA 4GRIA 4P33A 3H0EA 1R16A 4UBKA 3BILA 2YNMC 3RBZA 3AM5A 3IAEA 2K2QB 2XTJA 4C5AA 1MXFA 1KU2A 2CK3A 4MYSA 3L2OB 3ITKA 1HY3A 1NXVA 4HSEA 2A5FA 2WE7A 4KSYA 3WB0A 2BFEB 2PWYA 3L3BA 3EODA 2FR8C 3W1VA 4L07A 4BLVA 5LDDC 1II8A 3PHJA 1RWNA 3GJQA 2GZ3A 4FGZA 2PH1A 3V8RA 1PV4A 4ZOAA 3OJ0A 5GZ1A 3WL6A 5EL9A 3RTEA 4DR5E 2X9NA 3IEKA 2GJ9A 4YHHB 2OOCA 2G3VA 3D3KA 3HP4A 1WXDA 3L6RA 2WP8A 1U2GA 1GRRA 3VC3A 1N2IA 5HTKA 4ANFA 1LPEA 5TGDA 2PGIA 3F6BX 1V96A 4B6SA 5JSKA 1H0KA 4E3ZA 4AN4A 1O87A 5DO9A 1QANA 4URYR 3V46A 3Q3HA 3I8SA 3FCCA 4J2TA 2QTVA 1WPQA 4DF3A 4ITUA 2OO5C 2Q07A 3AQIA 4NS4A 1XZLA 3D7SA 4QODA 1N0UA 6PFKA 1DQZA 5LB2A 3SKVA 1M7GA 4PRLA 3VVMA 2YASA 3BWDD 3MWEA 5E33A 1C7IA 3QVGB 3A9CA 2E6KA 2FPIA 3QZCA 4A5SA 3WQQA 2KJGA 5CNIA 3MTEA 5L3ZA 1YZKA 1DHRA 3H1CA 2HK7A 5D1HA 3FPCA 2YL7A 1Q0PA 1JDNA 1E1YA 5D5HA 2B4RO 4NESA 256BA 3EWAA 3KJZA 3CEXA 2YWHA 1J06A 4JI5B 2R7MA 1AB5A 3IKTA 3TZKA 1DQYA 4YJ3F 3Q9LA 3ETLA 2FXVA 1S8AA 4U5BE 1Q17A 1PJ4A 2PUCA 1G5QA 3W8DA 3FPSA 3L18A 4BMSA 1M0TA 3HCWA 3GRPA 1OW6A 2ZT8A 1YFJA 2UUBE 4HDKA 3CKKA 5KCZA 3LXRA 3CZ5A 3EGXA 1V11A 3V6MA 3PR2B 4RA9A 4PJNA 4XB1A 2B5WA 1W1WA 4Q34A 2WW4A 1NYTA 1C9DB 3E5RA 2HIMA 4WXEA 2NU7A 3AGUA 1Y7HA 4L8GA 2OUKA 3EF1A 4YAEA 2ZEJA 2YWBA 1V3VA 4F4UA 3MT8A 4KXMA 1X8JA 2FCRA 4GAEA 1DWOA 4C2BA 3CVYA 1C9JA 1BD3A 1O5HA 3S2GA 3ZNOA 3ABMC 1TCBA 3NEYA 5IMSA 2EF0A 4AUKA 4B83A 4RK4A 3O7MA 2AZ4A 4W8HA 3NHMA 1N2BA 3QT8A 4C7BA 2Q2VA 4EG3A 1GTSA 4PWYA 1V8OA 2ZYGA 5CTJA 4HGYA 5AOVA 2C4HA 4N76A 3OOYA 3L7MA 3GDWA 2BKXA 1U81A 2V5AA 1P7ZA 5DS5A 2ECOA 2BH9A 3L8HA 4CG3A 5GV7A 4Q1EA 1HTBA 4MI9A 4UPDA 3E3AA 1N4DA 5FYDA 1G291 4IF4A 1FY2A 3CZCA 3TZBA 3IP6A 5BSUA 1YVPA 4MQ9F 2JGMA 1WQ3A 2ZM6I 1RQRA 2I78A 5L0GA 1NF8A 2B9VA 4AIRA 2BTQA 2J3IA 5F64A 3X2QC 5EKXA 2FJ0A 4F04A 1MOPA 2X8WA 3N3BC 1G8PA 2O5EA 3BEOA 3DLPX 3GLHE 3ZC3A 4G5YA 3UXMA 2OP0A 2GZMA 3DDWA 4EJSC 3QVVA 2IZZA 1E1RD 3I0NA 2AD5A 2YS6A 1ZHXA 3VRHA 3DE3X 3ES9A 4JEBA 1OXUA 4BB0A 1YVEI 2J3QA 2EP7A 3FUWA 4MVJH 4MR9B 1Z6ZA 3G79A 4CS7A 1CYDA 5D87A 3KL2A 4P22A 4ZT4A 3HH8A 4DA8A 5LR6A 4IFBA 5CYGA 1XRNA 2E1PA 5LL6P 1U5BA 4MRMB 1O6GA 4E22A 3DOOA 3OG9A 3NYWA 1P9WA 1ZOLA 1N6NA 5DM4A 5E3IA 1TQ4A 2O3RA 3U3BA 1OU0A 3U4HA 2A3NA 3PGKA 2EFYA 2C92A 2ZDHA 3DMHA 1RVV1 4UDNA 2Q6KA 4CZ2A 1FMJA 2IBSA 1SIBE 3H83A 4C07A 1U7XA 2HJGA 1IBKE 4IIJA 4NTFA 2R1TB 2CDAA 3T15A 4FYHA 2PKXA 4YUAA 4DIMA 1KR5A 5EVJA 2BUAA 1W76A 3RSSA 2GPSA 2P40A 1GTVA 1BD4A 3DFUA 2AE2A 3BERA 1TZBA 2ZJ0A 9ABPA 5ITZA 3CLSC 5AP9A 2JDIA 1YFKA 4K9DA 4Q4DA 1VL6A 2AG1A 2NVUB 3T54A 8ADHA 1SZPA 3QXCA 4PZYA 3UB2A 2FGYA 1Q0LA 2OBYA 1Y6GA 4C7VA 4Q1VA 4MTFA 1LBQA 1MTZA 2QG6A 3F8WA 2Y05A 4MGEA 3LNUA 1MX9A 4KC9A 4U9EA 2BFOA 4BTEA 4CLRB 4M1MA 3A6GA 4K6FA 1X9GA 1X2BA 2HHLA 5B1YA 4JLWA 5CVEA 2PWBA 4CE6A 3G0DA 2FW7A 1XXHE 2NLOA 3QT5A 4I6JA 4FEYA 3L0IA 1EH5A 3WK7A 5CDFE 4HS9A 4DTIA 4NOMA 1Z16A 1BZ4A 2AYXA 1JHVA 3CJTA 1QYCA 1U4SA 3WODF 4NXNB 1SXPA 4II3A 3NCHA 2NZYA 2B36A 2OKGA 3CC8A 3DULA 2AR9A 4NH0A 2H1CA 3IEUA 1XK6A 1OZ0A 5IHXA 2WTUA 4PVCA 4DT1B 4BJ6C 1VI7A 1SEVA 1KFBB 3MBOA 4YCJA 4H54A 3DDSA 3ILSA 2Z30A 4BJ1A 2Z08A 4UVDA 4OSPA 1IXZA 3CRW1 3IODA 3SEQA 2YXEA 1Q3HA 4GXRA 1QK3A 3MWDB 3CLUC 1UPCA 4RPCA 1ENZA 2G9ZA 1N57A 3ZN2A 4RVHA 4IM7A 4FMDF 3TBKA 2GZDA 4IKOA 4F6CA 2VS1A 1DG1G 3US6A 2WHPB 4IH1A 4YHHE 1GZ6A 4YRBA 2ZKLA 3THXB 1JIIA 1EESA 1EZZA 2MR6A 3FWKA 4CL3A 4OO1F 4ZKDA 1SKBA 1EXNA 2AN4A 3MYRA 3SM3A 2UYCA 4ZV4A 3P8ZA 3L07A 3PBKA 1LCIA 4W1RA 4OA8A 2XCLA 3AEYA 1P3JA 1NZEA 3D31A 3QELB 1RWQA 2FRXA 4ZA2A 2DULA 3FCYA 1Z08A 4BX2A 4RS4A 3IQTA 4QLOA 3TX6A 4YL1A 4RHEA 2BMWA 4PANA 3IEMA 5DTQA 3FKJA 3T5AA 1J97A 1A2OA 2DCUA 2HJHA 2FPOA 4ODIA 2M98A 4QGHA 2O2EA 3RHTA 3WLPA 1SVSA 3AXSA 3VSBA 5BNWA 3MK31 1SCUA 4FDAA 4EOGA 4WW0A 2HRQA 4N18A 4YMSA 3HVKA 4S1VA 2ZBFA 4N03A 3ASOC 2X14A 3RS2A 1G8SA 1HKHA 2NXCA 3WU5A 2DU8A 1ZUHA 1YZCA 4UATA 4LYHA 2DOKA 4MYHA 4CFZA 4IVPA 1SEPA 3P45A 2D2XA 3LPMA 5C3MA 3UTCA 2OV6A 4KDEA 2BGRA 5JXWA 1YT5A 1EP9A 3TQQA 4B3TB 4G24A 1E3SA 3HYNA 1WXFA 3AEKB 2WYUA 2B1GA 4JQYA 2XCIA 3TMKA 3LUKA 4EB6A 1I3MA 1YDFA 4XQ1A 3KUXA 3D6FA 1SCKA 5J9FA 2ZK7A 4O2AB 2YUIA 2GMWA 2QE7A 5B3KA 2A78A 2GZRA 5E95A 2YX1A 3G6WA 2WR8A 5EZQA 4ENPA 4OMFG 3TSWA 1N1GA 4UDVA 4GDMA 3TRFA 1I4OA 4E4TA 2PNFA 5KNCD 4LXXA 3W5DA 4C0SA 1CG6A 3GIWA 2EKQA 1H1LB 4IAQA 4ZCLA 4EA8A 4NARA 3SIPA 4LNAA 5K0IA 1Q1ZA 1RXUA 3AKDA 1TCCA 1P29A 4RK7A 1GKUB 3ACBA 2HADA 5IBCA 3OY7A 4BZQA 3GT0A 1UBRS 4NMLA 4CM5A 3EDMA 3LV8A 3B6ZA 4YC7A 3H5NA 1YCDA 3DBOB 2YWEA 2RMKA 3I4UA 1N6IA 1GZHB 3FMGA 1VE3A 3LRPA 4C7MA 3NIDB 4N8SA 3ZD8A 2IDZA 2A1DD 3MJRA 1SUPA 1SVNA 3OZXA 4KI0A 1W5FA 1KL7A 3ROPA 3VYRB 3GRKA 2IXDA 4LJKA 4XKJA 5HM8A 4JG4A 1BS2A 2Q8QA 3FPGA 4DR1I 4PYRA 1CUHA 1NM5A 1Z7Qc 2LP4Y 1T35A 5BWMA 2C99A 3U31A 1UXKA 3RVYA 1P19A 1SIUA 3L0SA 4LS3A 5A5VA 2GF9A 1I6KA 4QXOA 2AVKA 5AUQA 2VYVD 1Z7YA 2QLBA 2R00C 1DO2A 1U2ZA 2GZ2A 2RHCA 3HRIA 4U6QA 5A06A 4OHUA 5CMLA 4NBSA 1OY1A 2WJPA 4O2RA 1W85B 4JP8A 2IW3A 2HGSA 4GRAA 2HJWA 4UFNA 2QQ0A 1XPJA 4EHNA 2YHUA