2CGEA

Crystal structure of an hsp90-sba1 closed chaperone complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
b'TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEYEPLTKALKEILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKLLYETALLTSGFSLDEPTSFASRINRLISLGLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
publication title Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 115
structure length 405
sequence length 405
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2006-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2cgeA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2cgeA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cgeA02
2IOPA 1HK7A 2GQ0A 1USUA 1Y6ZA 5FWKA 2O1WA 3Q6MA 2O1VA 1SF8A 2CG9A 2O1TA 1USVA 3Q6NA 2IOQA 1Y4UA 1Y4SA 2O1UA 3HJCA 2CGEA 3PRYA
chains in the Genus database with same CATH superfamily
5DNDA 4YAJA 1XZCA 5EHHA 3O8DA 3DOUA 4GECA 3RAFC 2BE9A 2AOTA 2UUBI 1TDJA 4H15A 4JI0B 4LJAA 2ZRQA 4R2KA 1KZ9A 1VE5A 1S4QA 4YA6A 4D6XA 3O31A 1LRKA 2JF0A 2FFAA 4NBTA 4I9HA 1U5BA 3Q7EA 2QRMA 3E2IA 5GZ3A 3HEBA 4FIDA 2H4WA 3LW8A 2H1LA 1MMFB 2WG0A 2WWRA 3QVTA 4L9AA 4WZ6A 4N6CA 3F3KA 1N33B 3KUCA 1DUIA 3WYAA 3OPMA 5CAEA 3EFHA 5E6RB 4DLNA 4FZVA 4EGAA 1T4CA 1O96B 4UHEA 4B3MI 4PSVA 3QKUA 1TZKA 4OXKA 5FPPA 1QX4A 2YVLA 4LFAE 3GIWA 1I2BA 2C2HA 3L07A 1G2QA 4UJ5A 1JG7A 2WP8B 2FDCA 2GFQA 2VNAA 2VTKA 4PLWA 1SUEA 1PKPA 3EH2A 3FGZA 3HCDA 3UJHA 1U1GA 1WLYA 4BLVA 4GWKA 5IHPA 3DLAA 1PZNA 1T9HA 3DB2A 1J06A 5IAEA 5CP8A 4DG8A 1TIBA 1HORA 1FE8A 1VG9B 2Z3VA 3OOJA 2D7DA 3N2YA 1KMQA 4LRUA 3L92A 4I08A 5BSMA 5CJ2A 2PU7A 4RH3A 1X7DA 1CUBA 4JUDX 1C1XB 1W4CA 1ZSVA 1GS9A 2LCQA 3GI1A 1NFNA 3ZWCA 3I3SR 3BKWA 2Q0XA 2IXFA 3E7WA 5KB3A 1U0LA 2D62A 3GLGA 2GCPA 3LI2A 2AZ4A 4ES6A 3B6EA 1DADA 2DM6A 3V4RA 1M0SA 1VYHA 5EIOA 3IRUA 1OE0A 4Y6GB 2VNKA 1EXMA 4URYR 1UZAA 3D5QA 1JJBA 2C59A 4RU1A 3NHYA 1DEXA 3SC6A 1WCIA 4QD3A 2O2YA 3RGGA 3JARB 4WESB 5A6KA 2HQSA 2C42A 2IS4A 3KXPA 5KBYA 4XASA 3A36A 4XSGA 1ZL2A 2RIRA 4UU8A 2G5PA 1RR9A 4U39A 1W0CA 1AHNA 1AO0A 1JQDA 1ORIA 1Z45A 4D46A 3QI2A 2C54A 1M8PA 4MA5A 1YA7O 4IWBA 4B34A 1VKHA 4FSHA 1R5OA 1J5EB 1EHYA 1M6EX 1MG0A 4GX2A 3ZK9A 2C98A 5B5SA 1XT6A 9ABPA 2O50A 1DX9A 1EINA 3E0QA 3BS4A 1NE2A 1L3IA 4UU7A 4G86A 1B6RA 3OAAD 3E5RA 4O3MA 5LJLA 2CD9A 5KAPA 3WL4A 4LHXA 3OC6A 5LMUB 1OJ7A 1A71A 5EHNA 3AEZA 4K0KI 4J1SA 3WV4A 2N47A 1RPAA 1AUEA 5FH9A 5AW8A 3ZYCA 1MORA 3FUUA 1GOTA 1KBQA 1KIAA 4FYVA 2XB2A 3WDLA 3VYTB 3G0HA 4DV3B 4UBIA 4UAUA 1PZGA 4CJOA 1Q0MA 1WBBA 4DUGD 1SC1A 2FSFA 3L8GA 5FTLA 1JDZA 4BZXA 4ZOEA 1ZWLA 4E3WA 2OHXA 1TJYA 1FTGA 2IHBA 4U9DA 4F9GA 1C9YA 4DMKA 2OU6A 2AK2A 2PGJA 1YMUA 4JI5E 1E4OA 1JALA 1BYUA 1QRSA 2CLDX 1ZRHA 1USKA 4XGKA 3LUDA 3ZQJA 1IY8A 3HCWA 2QL7A 3RFFA 1G64A 1YFLA 3W0LB 3F6PA 3EIFA 4UTPA 4KO1S 2XYVA 5HNKA 2ZYRA 2ODEA 3T7TA 1N92A 3T99A 3NOQA 3TULA 5ALPA 4J7TA 4N0EA 3HCFA 1WXGA 4QUAA 3HTXA 2A0YA 2EG9A 3TOXA 3GPCA 4OM7A 1SCIA 3NRCA 5EQJB 2HBQA 5EIEA 2PFSA 3VHXB 3V4VB 3F73A 1AXRA 2XXAA 2NN6B 1H2RS 2GRJA 4KO8A 2UDPA 2QVBA 1D0ZA 3I9LA 3OIDA 1SBZA 4V0NA 3A4TA 4G81A 3WTBA 3WZLA 3WU4A 9LDBA 3M85G 1Q57A 4WXMA 3L8JA 4XQ1A 5E8JA 2XTZA 1Z88A 4I3FA 4RYLA 4RLHA 1XF1A 3BZUA 3LCUA 1E2HA 1J56A 1Y3AA 1WCWA 4KR2A 4OJQA 1N3YA 3RVNA 3IA2A 1Z82A 2Y99A 2GHQA 1J2EA 1GPWB 2BGWA 1A4IA 1QIGA 4E11A 4E1VA 1NV9A 5LZ9A 1XTUA 4IX9A 1FNTc 1FL9A 3GMTA 5EGYA 3HO1A 2YQZA 5K0NA 1OU0A 1BQ4A 1L5YA 4RK1A 3IEMA 3ANYB 1O7JA 2P2YA 2XBMA 4WY8A 5DHQA 5FUVA 3DWEX 1KI4A 4WKNA 3NETA 2ICWG 4PU9A 1SFRA 4NZOA 2NVWA 4MOWA 1KFCB 3EF1A 4M0LA 3FJOA 3SBXA 1PV3A 4GI3A 4CUZA 2BGNA 4RBNA 3HXKA 3G2PA 1GYQA 2HSGA 3G89A 4BS9A 1VECA 4DLPA 1FJHA 5HPYB 1NUPA 4PIPA 4RQTA 3TS1A 3VF0A 4XSHA 1WCYA 8ADHA 2VF8A 4MRMB 6ADHA 1E2LA 3I01M 1DJMA 3E23A 3KQSA 3I42A 3A11A 3V8RA 2H0RA 4AMVA 1QDUA 1PL8A 1X1SA 4G5QA 2QHXA 1BAPA 4NESA 2QJOA 4TSRA 3ZK8A 2P4HX 1XD2B 4DZRA 4TTTS 4LHZA 4HDNB 5J43A 2HDNB 5T6BA 5EY5B 2PS1A 4PE5B 2ZI5A 2YV2A 4ANJA 5IP5A 1ZMRA 4P4SB 1TVCA 3MB8A 4Q93A 1B2RA 3ICWA 1XWFA 3P2EA 1Z38A 3SK0A 3CCBA 4WKOA 1Z6QA 3C98A 5GJVC 3TM5A 3Q7LA 4KXLA 3ZNNA 3IVCA 2ZSEA 4K26A 2VTBA 4LMAA 5FR1A 1YI1A 4HWPA 3LBNA 1YO6A 1F5NA 2X8JA 2O8BA 2A1UA 2ZS7A 5BSRA 5KX5B 3RVYA 3HJCA 1REQB 4P86A 4P34A 1M2HA 4PLYA 3BXZA 2EINC 4PAGA 1TJPB 1GO2A 4MS4B 1OKKD 4DPTA 3KX2A 2O8DA 1MH1A 3A6GA 1J5EE 3RVRA 1KVSA 2RCNA 5IG2A 2VP6A 2M9MA 5IVIA 2PLAA 3KIPA 1CS4C 2J9BA 4FOLA 4OHYA 3C43A 3AFGA 2CDNA 1GV0A 4EUKB 1DELA 3SP1A 3ECAA 1KJYA 4EPWA 3VX3A 5HKKA 2EFJA 2OK7A 1RAEA 3C8GB 2YZNA 3NBKA 4DPYA 1JKIA 5IZ4A 5JTTA 4I44A 4X95A 2OD7A 3TD2A 2VQFE 4KGXA 4HF7A 3R6WA 2QGFA 3X1MA 2UXCB 3THXB 3G79A 1ODIA 1RDFA 1PZXA 1FMVA 3H3XA 1WJGA 4B3XA 3T1YB 3GJQA 2CMHA 1ZUHA 3GQVA 3OIWA 1CUDA 2A9FA 4NS4A 1YQGA 2JLCA 3V2UA 5CDHA 3DONA 4KW7A 4AY2A 4P3XA 4D92A 1KE1A 5KUTA 2OCAA 5L7WA 1XLTA 1DZIA 4K2HA 1KJZA 3X1OA 4F2PA 1MIOB 5C0XF 5DULA 4YJ2F 2VHUA 5K7SA 4HNAB 4GZLA 2HDWA 1KDPA 5IJ9A 1V16A 4DU7A 2VSFA 1OPXA 3OT4A 4OB7A 3MJEA 2VYQA 3GVXA 2YRFA 2FGKA 3AOGA 4NOLA 1ZGJA 5A9TA 4CT5A 1JSRA 4RCZA 4EG0A 1MPXA 2DECA 3BXFA 3GONA 4CTJA 1SR8A 1TADA 4MARA 4Q6BA 5H83A 4W5TA 1JNXX 3RFYA 4M0CA 3DTVA 1GNLA 2ODWA 4A5SA 5ELXA 4N39A 1SCDA 3O94A 2RKWA 1F38A 4QNJA 3IBTA 3H2UA 1E3WB 1P0QA 2JFYA 3LBAA 3O55A 3LNUA 4RIEA 1P5FA 2P9QA 4LDNA 2JJMA 3ICVA 2IGTA 1HE4A 1H2HA 3TIFA 2IFTA 4A2NB 3LT0A 5EE9A 1W19A 5H02A 5FPKA 3ELYA 3PGMA 5A5GA 2O1EA 3DZCA 3EA0A 4CMIA 3RG2A 1Y5YA 1CDDA 1W96A 4DM3A 1B6GA 1N8SA 1SXPA 3VYVA 2W2XA 1U8FO 3ZLJA 5C0XD 4NTAA 1SUBA 3K0CA 1NU6A 3A1TA 4F71A 3ND7A 1HR0B 2UXBB 1B63A 1CP2A 4B7AA 3PGLA 1H6AA 4ZOLB 2ZRFA 4G78A 2I2CA 4DC1A 5BPFA 4QXRA 1XZMA 1C7JA 5BVGA 3F8WA 2VJLA 2ETSA 1VL8A 1E9DA 1EVZA 3LTOA 3ENZA 1JXAA 1L4GA 3BB1A 1U2ZA 4GMGA 3N58A 1PQYA 4U5GA 2FE1A 5C80A 2Z5VA 3OJWA 2O3JA 5GJBA 2G82A 1AKMA 3KC2A 1Z83A 1E32A 2C38B 3O4GA 4JAVC 3HXMA 4JHLA 1RWNA 2I54A 3NYQA 4GZ5A 3H9QA 2DFVA 1FX0A 4PG4A 4EGFA 2XLVA 2CHEA 3VZPA 2EIMC 3OA0A 4EELA 2L69A 2JFUA 3LJKA 1WVMA 3C4VA 5KYYA 3P9XA 4EBFA 2CNWD 3FZNA 4R9VA 5DYGA 3L7LA 3NT4A 5CDTA 2I99A 3LHDA 4JQYA 3ROPA 2ZANA 3KB8A 4J1TC 2R3VA 4KR0A 3GXBA 3L7ZA 2IW3A 1HE8B 3I6QA 3X1KA 4UD6A 3TTYA 3RDPA 3USCS 1OASA 3DAPA 1WBDA 2HA5A 3ZCRA 1OR2A 3OJOA 1WU7A 1G21A 1YK1A 2MSWA 3VU9B 1WTCA 2UZ1B 3AU8A 4YAGA 4IEIA 2JGNA 5JS8A 4ZEWA 2IP2A 3K9NA 1A9XA 5KYWB 2XDWA 2HDHA 2VSQA 4AY4A 4L5CA 4C5CA 3DEKA 4AUMA 1J49A 2C39A 4AM3A 3B2EA 5M3BA 2HADA 3MUFA 5CFQA 5JNSA 1HY5A 1KEWA 1E2IA 2XODA 3DA8A 4WSOA 1B8PA 4NYIQ 3LLMA 1GPKA 1IOVA 4DARA 4TMKA 4JN6B 4UEQA 4PVCA 4C05A 1IZ7A 1USWA 3VDQA 2VUSA 2ERYA 2BN4A 1U7DA 3N8HA 4YQYA 4CG2A 3HULA 4D8YA 4HPWA 1L4BA 1A4UA 5I7SA 3QXSA 1OI4A 1NZ0A 3H2JA 1OWLA 2WSLA 5IMSA 4ZJYA 2JIDA 4MO9A 3EFEA 4MQFB 1IAQA 2QRLA 4OI0A 2R66A 5LXTF 4HEHA 3HCEA 3C6XA 1DOAA 4JGGA 3QHPA 3QT6A 1ZH4A 4YMWA 2JLAA 1WX1A 3NAMA 1UOEA 4RPGA 4MNDA 5SZHB 2XYRA 1YTLA 1M6YA 2ZJ3A 1H22A 5HIAA 3T1YE 4Z4IA 2HA0A 2NO1A 2A33A 4BQNA 3A1DA 4FYHA 4FE7A 2IYPA 1MV5A 3BB3A 3EZNA 3VVBA 2A68F 3ZK7A 4DFDA 1T3GA 5JH7B 5DQZA 2IYLD 4C4PA 3CJTA 5AVSA 4Y7CA 2FMIA 3M79A 4G7HF 4JI3B 2NWQA 2B8TA 1QHIA 2FPGB 2VJDA 3Q8XB 1VBFA 2GO1A 4WK4B 3L8DA 3OIVA 1QCDA 4G4SP 1DKLA 4Z1OA 4M1EA 3RK0A 4BMPB 1OXSC 5JATA 1K9SA 2FETA 1OBVA 2W2KA 2W2QA 3CNQS 1E1LA 1R8SA 3I2FA 1NQTA 4DTCA 3DFZA 3MBKA 1LPEA 4M0DA 1QV9A 3CMCO 3ESBA 1HLDA 4P3OA 3GAMA 4I50A 5TT0A 4UCXA 4BBAA 3FOAA 2OO7A 3TRFA 1UBKS 3PXDA 4CQNA 4KUHA 1YIDA 2XDYA 1T1SA 2RK3A 1TJ5A 4RTKA 2GCGA 1IVYA 3LDUA 3MRTA 5JVEA 4RKFA 2CDBA 2RI1A 2QTWB 4QGHA 3M3HA 3PKIA 3FSGA 5C8YF 1UFRA 3IHTA 3BQ9A 3WL6A 1PS9A 1KA9H 4FT2A 4QEKA 2VI5A 3F74A 2XA9A 3K1JA 1E9VA 1EKXA 3IP8A 4AJPA 1Z16A 3C6YA 2CF5A 2V7QA 3I9V6 1FVHA 4IV5A 4HNQA 2VT3A 3IQ5A 4H3HB 3TSZA 1HR0E 1A96A 3D43A 1FZTA 5LIPA 4TGLA 4JHXA 1GUZA 3NG1A 1ZO8A 2FR8A 1JQBA 2OV6A 4GP6A 3UNXA 4ZO9A 5TRTA 2AYYA 3WXBA 2IPXA 5IZCC 3JQFC 1E2KA 1NBWB 3COPA 1V1RB 2GHTA 2A57A 4WA8A 1VXRA 4KRYA 4OIPF 3C7DB 1D2AA 1D6TA 1OZ0A 5L3RA 4TS4A 4D8XA 4EUNA 3FZYA 2HL6A 3MT0A 4OI4A 1CC1S 4UMVA 2OAP1 2VTVA 4PN7A 1HDCA 2EHDA 3N24A 3GLHB 2OCBA 1Y1TA 4FE4A 1GFZA 1H65A 3CUUA 3E4CA 1NLMA 1ILWA 3VH1A 4NBNA 1I5OA 2IJGX 4C29A 3CF6R 4RIHA 4Z4EA 2FP4B 1RMVA 1MOQA 5AVOA 2ZM6B 3E35A 1OUMA 3TW8A 4Q00A 2Z5BA 2AF4C 2GHIA 2IPNA 3O84A 1ZJJA 3IUNA 1BU5A 2VJCA 5AJZA 2J09A 3GFGA 4WJLA 2XUFA 1QYDA 5HM8A 4NMWA 3B71A 3FMPB 1YE5A 3SM9A 3FWPA 1QP0A 4MUNA 1JEYB 1SUSA 4WVLA 3QOXA 1A1SA 3B9BA 1U9YA 2PMWB 4PX2A 3IMFA 1JSZA 3ZQ6A 1W5FA 2WAXA 2WYUA 2AMFA 2GAQA 5AUNB 4NXMI 1N5LA 2ZIFA 4MGHA 1GADO 1VMDA 3C39A 4AG3A 1IJBA 4FI3C 2JVIA 5CVTA 4YRRA 4QU0A 2X4GA 1AUPA 3WIOA 3CWCA 4J16A 3OOHA 4ZAGA 3RIYA 2KYRA 3M15A 1NNI1 1MVLA 4PHGA 3OPNA 4UDYX 4H59A 4WLUA 1T35A 2O6HA 2VT6A 1HLPA 1MEOA 1RJGA 1IHPA 1LC0A 1U3UA 1ESNA 3LGAA 3FB1A 3JYLA 1UM8A 1LPNA 4FMCB 1O6FA 3RH0A 3K6SA 4WLNA 3E70C 2NXNA 2ZJ5A 4FGJA 2RE8A 1AB5A 3BHJA 4LQDA 2WP0A 1IN5A 1EK1A 3BX1A 3Q8LA 2BL2A 2GN0A 3PVZA 3IVXA 3MXTA 5FKJA 5LLDA 3J7AC 4AKSA 4ZOQI 5A6SB 1GJRA 1FQJA 4PQEA 4AVYA 1IXZA 3U4DA 2CE7A 2AYXA 2VC2B 3M3PA 1N4DA 1QIMA 4NTZA 1U5AA 4JI3E 1PI3A 4QAQA 5B3JA 1PL7A 5KDDA 1S16A 2CBZA 4MLZA 1Z6TA 4PPQA 1J8DA 4DV1E 4ZT3A 4U7GA 3ZV5A 2VL7A 4LFCI 1YRLA 1B3RA 2QMOA 1DBSA 4FHGA 1JEDA 4R2IA 4UHFA 1QE3A 1R4MA 3ZY4A 5BWNA 2BGUA 4BWYA 4OX9B 4MYTA 1V96A 3NPAA 4E1AA 4WXEA 2X8LA 1YRBA 1FMLA 4DXWA 2QRJA 2WT8A 3D59A 3ET5A 2WU4A 1G3QA 3VKUA 1YFJA 1RIFA 3WWZA 4FWHA 3LAWA 5E3HA 3L7AA 1J1ZA 3ASOC 1Q1NA 2IYAA 2SCUA 3VZDA 2CJFA 4G5YA 3NOVA 5EEGA 2FSVA 2SHKA 1H4TA 4YT4A 1WVGA 4UE6A 1C2YA 3WAJA 3SXYA 1KDVA 4EKNB 1U0GA 4XLPF 4UTVA 3I4LA 4PTLA 3S8MA 3BE6A 2BM8A 2XQIA 1D3AA 4P7AA 4OHZA 3I58A 3AG6A 2XMQA 2GDCA 4RLSA 4QDTA 3HZZA 3PD7A 1VIDA 2N46A 2YWBA 3FFXA 5AUOB 3DKRA 4FS8A 1P3Y1 2JA2A 1GN9A 4BY9E 1C41A 3KV3O 2PRIA 3L8YA 4DUZB 4YCJA 5AW3A 4PO8A 1WETA 2RI6A 4M2LA 3UQYS 2WY2D 2XWBF 3LEVA 3TRIA 4E2YA 2JX0A 2JASA 3TDNA 4B0PA 3K70B 4RDAA 2LIGA 3C1AA 1Z36A 1TA9A 4O6MA 2XUJA 4E5PA 2ZT5A 4L2IB 3WK7A 1VCNA 1KTMA 3HR4A 1BMFA 4DABA 1GCUA 1TQ2A 2Q5EA 3PJGA 2D6FA 2VDVE 1RWKA 3GLHE 4YCSA 4IZOA 5CA0A 1YAHA 3NI2A 4PCVA 1BCSA 4DLZA 1E7SA 3ZDYB 2ZG6A 5AVRA 4P0PB 1FP7A 4GYTA 4LLCA 4IIDA 3PV0A 4JFAA 4A92A 5KQGA 4N0DA 4OUDB 1RBYA 3OFJA 4LXUA 4N18A 1JFSA 3NLLA 3W2IA 4XCXA 4TMFA 2RIPA 5CVCA 2BVNA 1GQFA 3T3DA 2P7VA 3IUQA 3EZ6A 5F1OA 3C8DA 1BR2A 2NQTA 2YVQA 4WNAA 3U39A 3IAS1 3ZGXA 4GEHA 2VH3A 621PA 2DOKA 2HK6A 1WVIA 4W82A 3ISJA 4WVFA 3EIHA 3C3PA 4UC0A 4CEHA 3SHOA 1QQBA 1YQTA 1HMPA 4LWZA 4S2UA 1MNEA 4BU0A 1DEAA 4X60A 5CXSA 3AVTA 1YLMA 5JNWA 4W8KA 1DE0A 4Q5IA 4LXGA 1P91A 5EIWA 2C8LA 3KDSE 4KOAA 1C3LA 4HGYA 2B21A 2F00A 2UZ3A 3PUXA 3ZWAA 2ZUTA 2Q8NA 3ZTZA 2BHLA 3TDKA 4OG2A 1N34E 4G23A 4ZQBA 2IDJA 1EZ1A 4KFSA 3ASZA 3CWZA 5E2QA 3CEMA 3IEVA 4I1IA 1O6CA 4YS6A 2YWAA 5JSFA 1N25A 4WA7A 1KI8A 3DF9A 2V8BA 2ASVA 3AKEA 4AROA 3RLFA 4BN0A 2AWOA 1FNNA 3Q0EA 3QVUA 3PXCX 4F5DA 4LZJA 2R7VA 1KEZA 3HCOA 2BZ0A 1U99A 3AB8A 3EXIA 4FINA 2JAHA 4NPAA 5KWSA 4H1VA 1E92A 1XCBA 1TVKB 2A0BA 3BD6A 5J5VA 2J7KA 1VSUA 5IC6A 2ZYDA 1KH1A 1TF5A 2A88A 3KB6A 2GF9A 4GXTA 1WD7A 3MGCA 4TTQA 2Q3HA 4QPNA 2J9ZB 3HNPA 4U3JB 3K7DA 1XLTC 1EFDN 3ZZUA 2AFHB 1RMQA 3KYJB 1W88A 1ADBA 1N5KA 5E95A 3W5IA 2EJVA 1A9PA 1M2KA 1KK3A 2FQWA 2W6MA 2DR0A 3RT1A 1YL7A 2FWPA 3PX7A 2WVQA 3I0ZA 4FOTA 1TLTA 2JJYA 2IOYA 4OX9E 3ZHBA 4RC9A 3UMFA 5EJEA 5C8XA 1RZ3A 4I4IA 2C5SA 5GMOA 3DGFC 1S2IA 2GEVA 1TYAE 4U63A 4YJHA 1V0JA 2OCKA 4DR4B 3K20A 1BGWA 2CHQA 3JRTA 2O8VA 1XV5A 3AZQA 1RC8A 3D8TA 3LX4A 2O0HA 3L6OO 4D96A 4X7RA 1KKUA 1YARO 5AT1A 2ETXA 4AY5A 4LK2A 4DC9A 1Z2AA 2BFOA 2Z56A 5IM4A 1JAXA 4Q3KA 1WZ2A 4EKDA 4BL5A 3S29A 1Z5WA 1T8WA 2Q28A 3TRDA 2N3ZA 1E1RD 2AQIA 1W46A 5ALDA 2PGXA 1XO1A 2HLPA 5EMLA 3B5JA 16PKA 1C9EA 1RLOA 4CKCA 3ESYA 1RHMA 2XGMA 3BCRA 3WRYA 1QVAA 4KR7A 3K0CC 3GLSA 5C5EA 2IP1A 2OUKA 2Q9CA 2C9OA 2X0JA 4PWZA 2JI4A 1CF2O 4AY6A 4CVNA 3EB9A 2ODPA 3B48A 2BM0A 5JD6A 4P82A 5AVZA 3R2PA 4WIAA 2AE2A 2OKGA 2EZUA 1HYBA 3KYIB 2IT1A 4XDYA 3AIKA 3EBPA 2QVYX 4PLGA 2MTBA 3RBVA 1EVQA 1K04A 1JIXA 4K9OA 3HM2A 4X6YA 5EYPB 4L16A 4LKOA 5LMNE 2J32A 1GGJA 4JU8A 4QVKA 1H3NA 3U17A 1U8XX 2GLXA 3DNFA 4GX0A 2EG5A 3CLTC 2BGLA 4LE1A 3JRMO 2YKGA 1T9CA 4Y2PA 4BQPA 3C7AA 3PCVA 3GGOA 1VL6A 1Z2EA 3O10A 1SBTA 3UATA 2GBLC 3OZ7A 2WVNA 3RYFA 4CCWA 3IBCA 4BC1A 3ZNQA 4U0KA 3KJFA 1N0UA 2VATA 2YASA 1EUCB 1G6KA 3BERA 2I5PO 3VPAA 4IZ6A 3KYDA 3HBAA 6YASA 3U1TA 3NTRA 4UM8B 4M89A 4WXYB 3DTVD 4DMHA 1XDZA 4PQGA 5CDYA 3UJNA 2O5RA 2VNSA 1PJRA 3UW3A 2OY0A 4UAJA 3B52X 4YMTA 1I2CA 3CNNA 3HUUA 3UJ3X 1HNWB 2YMPA 4X91A 5JLIA 3W2FA 1P9LA 3G8CA 4LVUA 4L7VA 3RVOA 1F0KA 4DSNA 4I8DA 4IFDA 1J70A 2QWXA 3PUYA 3C5HA 2J9VA 3R3VA 1ZK1A 4KGZA 4IEFB 5L0IA 4YDRA 4Y8VA 3QLTA 1E2MA 2GYWA 2FPXA 3K35A 4USMA 3F49S 4NMHA 1RC1A 2JFNA 4QFMA 5AQ1A 1QP4A 2LIPA 5DRQA 2FCAA 1CY2A 4WGFA 3HNIA 3UH0A 5DM4A 1EGAA 1YJXA 1MQ9A 3C16C 3AVQA 3PIIA 3X2QC 3KUKA 3JTEA 1K7EB 4M7WA 2OKCA 4KIGA 5ALFA 4UHBA 4FPXA 4J0HA 5FI5A 4Y67A 1YBAA 3F6EX 3E9ZA 2N75A 1XL0A 1QBKC 3ADBA 1IHDA 1F51E 5EP3A 2FFBA 4MDFA 3PENA 4CFYA 2OO3A 5HIMA 2EC5A 3D3KA 4RVFA 4RZUA 1E6UA 3GJYA 5THKA 5B7PA 1UJ4A 4L5JA 3PEUA 1Z2CA 5EZQA 3WHNA 2P0NA 5C8ZA 5FL7A 3L1IA 1TU0A 2P0YA 5KJCA 2Z9BA 1KY3A 2PPVA 2K7FA 3KH2A 4KWEA 1CYEA 3O6XA 2MHCA 4N9QA 1SOWA 3GRRA 1T0IA 4N12A 5SY4A 2B8EA 4R0VA 1FIUA 4XEKA 2HNBA 3E48A 5CI8A 4DR3I 4XX0A 1EGVB 2GCOA 3W1EA 3E9EA 4Y30A 3NIBA 4ISAA 1QE0A 3UJDA 4ZEMA 5TPWB 5TVGA 4KUEA 1UG7A 4QRHA 4X1YA 3QUQA 1Q7CA 5T5QA 4YREA 4HLDA 1RAAA 3L49A 3LRTA 4U7PB 1Z0VA 4HWRA 5GIOE 4V0KA 5EIHA 1V8ZA 4YFYA 1XU7A 2IESA 4AL4A 1RHUA 2G9NA 2R8YA 1WP4A 4E21A 1YHYA 3RC8A 1A04A 3JQAB 3M5PA 4GQIA 7YASA 3HRHA 5F1PA 4H1WA 4K9MA 4W1PA 1SVSA 4B3SB 3ZS8A 4ZDWA 1ZKDA 1W5TA 4FKMA 3ZC4A 3FYUB 4TV9B 4ZP1A 4EG5A 4C5BA 1G5ZA 1WXHA 1EI9A 3V1NA 2DF8A 3IEUA 2ZJ8A 3VQTA 4KWIA 4P08A 1W2WB 2JCVA 3RVBA 4QPCA 4I50F 4JU9A 1ODFA 1GZ5A 2GM5A 3TIGA 3TQTA 1QVRA 1O54A 1ZEJA 1VZ2A 1P6UA 4TT8A 4Z6KA 1JIUA 1GLVA 3HUEA 3WHKA 4D57A 3A0RB 4BATA 3TEJA 1W0KA 4HQNA 5KMGB 1LC3A 1AKWA 1ZYUA 5KNCH 1L7DA 5CI9A 1TU3A 3HWWA 2Q5JA 2RHBA 4JUBA 4J07A 4ENQA 2PNLA 2I4TA 3PGKA 3KKEA 3W7BA 2G9UA 1L7AA 2Y92A 5GPGB 5BNFA 1UM9B 4AO6A 2Q7OE 2GJSA 4C0XA 3DDWA 2GNOA 2VDRB 1N78A 4AJ2A 5BN4B 2HA4A 1KQPA 1L7QA 1EFVB 4IIGA 3ZW7A 1AGYA 1J0CA 2ZJBA 4G5RA 5JXWA 1TPZA 5FCLA 4XRRA 3A4MA 1Z63A 2Q7DA 2IYFA 3QF7A 1LWOA 4BP9A 1Z3IX 4PLTA 4OLFA 1R8JA 1YQEA 1WUTA 5HIJA 1QIJA 5JALA 4CTKA 4OXRA 2OC4A 3AYZB 2P9GA 3GOHA 3CEHA 4R9SA 1E62A 4WUBA 3ANLA 4BNHA 3D9QX 1DG3A 1Q1GA 5BQ5A 2OG2A 1YI8A 2JFGA 2WI8A 3RFXA 4UEKA 3N28A 3OVMA 1MO3A 2BKVA 5EXTA 1MBZA 5FO1A 5K2OA 3FBWA 4PHTA 4DCSA 5D6NA 3W8HA 3BXOA 4W63A 1V8FA 2J31A 2JE6A 4KQ9A 4RA9B 2D1FA 2PX8A 1M5UA 3ZE6A 1AQYA 1NY5A 4GP7A 5JSQA 3WADA 2XLOA 3DBRA 4HDMB 1ANKA 4GMDA 3VV3A 2O2JA 5IM5A 1GG5A 3BMCA 4ON9A 3FSGD 3FRJA 4DU8A 2GTIA 3RFCA 2C2GA 3I53A 2HZ8A 3LGXA 1IBKI 2FKAA 3C3JA 2AMVA 4KIUA 5C35A 5K4GA 5CLGA 2X86A 4FWIB 5HFAA 4O4IB 3NZEA 2H00A 2V7QD 2J3HA 2VQEE 2IH2A 4NZNA 3S99A 4HACA 2DLNA 3SOPA 1R6TA 1AT1A 1E3LA 2GPBA 3MN1A 2PJRA 4WJKB 1DHTA 2POQX 4K9QA 4P38A 1R0RE 2IY8A 2WABA 1DT5A 1Q2XA 1RJEA 4DCJA 3I61A 1OV6A 5E9JA 4ZANA 1UDWA 4R40A 2IF0A 4V2IA 3DMYA 2NYRA 2HSWA 3T5DA 5E4FA 2XJ4A 2CV0A 5FBRB 2FI1A 1T0BA 3K8ZA 1TOAA 2MCFA 2J8ZA 2V26A 3W2GA 2CNOA 3UA4A 3RUHA 4M1QA 4QAJA 4EPVA 3RSQA 2W93A 5B3JC 2HUJA 1GTRA 4OHRA 2CFTA 5CCXA 3JRXA 2XVYA 2AVNA 1YDGA 2JK0A 3KE9A 4Z4CA 4G9EA 1GP2A 4AQ7A 3QM1A 2G4CA 2PMKA 2BFBA 3R4VA 3WFZA 5KYXB 1EDDA 3SLGA 4GBJA 1ISRA 5K9ZA 4NXNI 4C2UA 1X3SA 2GN8A 2J9WA 1XPUA 4MW7A 2JI8A 2XYPA 1UBLS 5HMLA 4HSGA 1Y81A 4IINA 4CDNA 4JI8E 3HKEA 2YLDA 3L8FA 1IYZA 1WABA 4JY7A 2IIVA 4MW6A 4OIFA 2FUKA 3V9PA 4XIYA 3EWNA 4OK3A 3M34A 4YH1A 3GQBB 4TSKA 1ZGHA 2A1TS 4QTXA 1X1DA 1VJ0A 2RHDA 4BRZA 5IT5A 1Z6PA 3LYHA 1E8MA 3AHEA 4I1UA 5B7NA 5BSFA 1ENZA 4E7ZA 3GGSA 2VH1A 1JAFA 3J81k 3ZX5A 5AXCA 4NX2A 4OK6A 3OTWA 1XXLA 3NZKA 2JIRA 3EA5A 3IPLA 1CFJA 4W9RA 1D2RA 1N5DA 3OLCX 2B4QA 1LSSA 3WGLA 2V7BA 4BUCA 2ADMA 4P7JA 2CEKA 2HBRA 5HP4A 4NMLA 5T41A 3MTDA 1UDRA 4ILKA 4C7XA 1EA5A 5HSGA 5B36A 4YJ3A 4DBQA 1DRKA 3LCRA 2PCLA 1G1MA 4CRWB 3WWDA 1SKYB 4MV0A 3C3AA 2A59A 2O20A 3SIWA 1QZRA 1FLNA 4LQ4A 3SHFA 1CQIB 1T5DX 1NM5C 1YJAA 5K6RA 5SYAA 2DYSC 2F43A 4JI0E 3K32A 3VR4A 4MV5A 1CULC 1EWYA 4JSTA 2X22A 4X54A 4JMLA 2VASA 1LLDA 4D4GA 3OIYA 2W2LA 3TTUA 4QNRA 3GF4A 3M6AA 4QHYA 1VSTA 1N33E 3SS9X 4YO8A 2IQIA 1VYTA 3U8VA 4YVFA 1DKPA 3ROMA 1HDRA 3OP1A 2XDQB 1TUBA 5G0VA 2GILA 3D6JA 3G0IA 1W5EA 3H1AA 2VHYA 4NU8X 4HGPA 2WIBA 3LTNC 1RFGE 4TMVA 5J47A 4I6JA 4Q9AA 3QEMB 1RHKA 1JVNA 2J8WA 3H5IA 1CB7A 3M4XA 3CB2A 4UULA 4WT7A 3JZDA 5IT4A 4Z9XA 2V1XA 2PKCA 4ZVIA 3AGPA 3UAWA 1CTQA 4RNCA 1H6GA 3EK2A 5CA0F 1C9KA 1VL5A 3T9BA 1XLWA 2BL4A 3TCKA 2IHZA 5ED4A 3LFHA 3T1TA 4TXNA 3WLMA 2ODQA 4O2AB 2X1MA 1K47A 1OBFO 1GTSA 5JQGB 1V4NA 4HAUA 2R6GA 1LNSA 4OK5A 2OORC 1I2DA 2EP8A 4E2WA 3SXUB 3A04A 4U7WA 3AF0A 5J2TA 1H2EA 2IODA 3KPHA 2XUHA 1DJLA 3ZDCA 4DVZA 3AETA 1NMXA 3OFSA 2K87A 3M6IA 3TOLA 3K85A 4OIOF 3OE1A 2IE8A 2KSQA 1ULSA 2DQ4A 3O8NA 4N6NA 2PLWA 1PR4A 4OHPA 4BC0A 1A8HA 4IO0A 1PJAA 1E1MA 1K8RA 1UOOA 5LCXA 1V1JA 2WPNA 3N9IA 1XALA 3SFVA 3P9NA 4MUEA 5G4KB 3MHTA 1QG0A 1A95A 3WGKA 4P92A 3E4DA 1OCRC 2EHJA 4UPEA 1IL0A 1JMKC 4DF3A 3ICEA 5FUXA 4JB2A 1W5SA 4IOLA 2PO1B 4KR6A 3LQ2A 1FK8A 3MT9A 1BMFD 1P73A 1G8SA 1V6CA 4OA8A 3LT1A 4BVKA 1JDPA 3R09A 2XT0A 2O8EB 3KRNA 3L02A 3IUEA 4DV2B 5KHLB 1T9DA 3GRKA 4HDKB 1NVKA 1SQSA 2J3LA 5JSHA 3HCRA 1P7CA 4KIFA 3CIOA 1E1RA 1Y8ZA 3FOZA 4Q9NA 1ZQ1A 1SIWA 3VFDA 1V39A 3HMKA 5LMUE 1JRLA 4PONA 2YZSA 4E33A 4JLUA 1G6HA 3CNOA 5C0XC 4Z0HO 2I66A 3B9QA 4HYQA 4Q4LA 1N9GA 3AR2A 5F98A 3EDRA 4XPYA 1PDOA 2WUFA 1VI6A 1UBHS 4ZKEA 2G80A 2IVFA 4MUYA 1Z5UA 4PYNA 3TI7A 2G4VA 5HCUA 2E5LI 4B7XA 2C5HA 4DV3E 4JGIA 2E1RA 2A2DA 1T4DA 3OZCA 1EM6A 1HL7A 3ELWA 4R2LA 1Z5GA 3SFZA 3F1KA 1WW8A 3GP8A 3ZE7A 2UUCI 2NU7A 3AINA 4JIGA 1IBMB 3M4JA 1KJ9A 3FG9A 3V7FA 5TEWA 1M7HA 4BP3A 5KYTA 2OAQ1 3T4XA 2RDMA 2E6UX 3ANNA 4B6QA 1S8OA 2O2XA 2KE5A 4RKWA 3R9KA 5DQTA 1SU4A 5L3SA 2XLHA 2L82A 1ZICA 4P9NA 4XWYA 7GPBA 2Z43A 3FOOA 4V3BA 4TQ9A 5EWJB 4LOLA 3ZLVA 4MUGA 3PSAA 1NWHA 2VZEA 1ZW3A 3DLIA 3WRYC 2BKXA 2FWMX 2XMZA 4EHBA 3PYGA 4BO3A 4H60A 1PGPA 3DF7A 1XRNA 3C3YA 3VH4A 4XM2A 2YY5A 3IAM1 4HV4A 5AKGA 3IL2A 4HEA6 4FHZA 2CLOB 3COSA 3WGUA 2JEBA 4DV4B 2BA1G 4UU1A 2NN6E 5IM4F 4H77A 3OOEA 5GJCA 2GF0A 2WJAA 3DBLB 2HCRA 4OAQA 2W6IA 1MQAA 1ZMBA 1C4XA 3AFNA 5TE9A 4NYJQ 4QKQA 2ZYAA 1YDFA 1N2CA 4QGSA 4CI9A 3MWDA 1MXFA 1JSCA 1G4UR 1N6IA 5K8LA 3WKAA 4IJ5A 4A0HA 4P4NA 4FSDA 3ZE1B 4N0MA 2EX1A 3VJLA 2OCXA 1YE3A 4GLJA 2RGUA 2J6IA 5EVJA 3L1KA 1A9RA 5KPDA 3KFXA 2YWDA 4YRAA 4I1PA 1VB5A 2EEPA 4PICA 1RR6A 3JR7A 1J0AA 1ISSA 1R6VA 1NY6A 4LVNA 3CIFA 2RAUA 5HCIA 4EW1A 2X14A 4HGQA 3QBVA 5HKBA 2DFPA 3B6IA 1ABFA 2Y4NA 3DEIA 1LBSA 1GLNA 1T2DA 4RM2A 3P4UA 2KQ9A 1LDMA 1EFRA 1Q7GA 2PP4A 1R6DA 3IPAA 1MGOA 1ATZA 3V80A 2RHJA 5LFAA 1J0EA 2PBRA 2OQMA 1E2UA 4LYDA 1UBCA 3EXHC 3OFKA 1TC1A 1QHSA 3NALA 1JEOA 4I7EA 2NV6A 4ARZA 4YI3A 1NP7A 3LPMA 2ROQA 2YVAA 4IDAA 5TPZA 3RQSA 4DTIA 4JBNA 1D04A 1P80A 1P4JA 2ZIVB 4IFDC 4Q3EA 3W04A 4PZ0A 1KWKA 5T8KA 4PSKA 1FRNA 2J0UB 4XYBA 3SS7X 1O4WA 2H08A 2Q1WA 2HLDA 2V6BA 3DR5A 4CF5A 4LLEA 1G0NA 3LESA 1NL3A 1S7CA 1D07A 4EA7A 4EGCB 2VWPA 3IT2A 4GF5A 3H97A 1PDWA 4IOKA 4ZA2A 4BNDA 1EP1B 1Y4CA 2VK1A 5TXGA 4F5YA 4E15A 3TNJA 4IZJB 1I7SB 1SKMA 4N5NA 1ATIA 3GRYA 1Z5PA 4PX3A 3ZQKA 4YUWA 4I5EA 5B7GA 2EPOA 3AF2A 1Z2DA 3TZKA 5AKJA 2Q41A 3HVHA 3SZUA 4NCHA 4IFDF 5TQJA 4BFVA 1S3FA 1P18A 3ZE2B 1U3GA 3LY9A 1TMOA 2I1LA 1KSFX 2DWPA 3LZCA 4ISBA 1AXGA 4R9RA 1YQUA 3B8EA 3RLIA 1BWQA 4DV2E 4NV1A 7MDHA 3KB2A 2ZRIA 4EY3A 1AHHA 3RS3A 2E4VA 3PQCA 3GWZA 2RHMA 5KDOA 3OPYI 3AZPA 2Q00A 4MS3A 1YD7A 3SJZA 1U02A 4ZTUB 4OMFG 2GBCA 4R7TA 3BQMB 5CH5A 4PZYA 3A4NA 1HT1E 1TM3E 2A4MA 3EASA 5JPIA 3L8CA 3TLJA 1STOA 4CI0B 1UZMA 4XB6B 4GZ6A 1KO1A 1XLUA 4E18A 3QH4A 1LI5A 2C2YA 1ZI8A 1TZJA 5JPDA 2HJGA 2ZXOA 1TUIA 3DHWC 2AUMA 3DO8A 1K97A 2UXCE 3FPHA 1XU4A 3WB0A 2O7VA 5EUCA 4Q01A 1PEAA 1P0CA 1ZD5A 5IWAI 1IHUA 4M49A 3SS8A 2X2PA 5F12A 1JIJA 2IL1A 2AOWA 5SZJA 2KQUA 2VS1A 2VF3A 1U2QA 3FLMA 4TLBA 1L7CA 4OSOA 2AN3A 3FYDA 1D7OA 2HRRA 3LMKA 3EFOB 3OBIA 4IFDD 3T12A 5IC5A 1PQPA 3G9UA 1EDBA 5CA1B 3PDWA 2XCUA 4OKNA 2Y0DA 2Z09A 2VF5X 4RHCA 3BXXA 5TF4A 2PZLA 3D1JA 4S1VA 5JASA 2WJPA 1WDWB 1X1BA 3RIMA 1CY0A 5CFOA 3PLRA 3X3HA 4NYMQ 2Q0HA 1U28A 1YNSA 4EQ6B 4UE2A 3OMWA 1C0PA 1PD1A 1GPAA 1UC4B 3CNLA 3FPFA 3SBDA 1YE8A 1H3FA 1FDRA 2Y68A 4NC3A 2R4QA 4US0R 4F97A 2Y1KA 3ZU4A 1M72A 2NVOA 1GGVA 1EBBA 4DV4E 1NQVA 1ZN9A 3QVKA 1VE7A 2G5CA 3VO1A 4C43A 2H48A 3OCZA 4XD7A 2VNIA 3FPSA 4ZVTA 1G5IA 1VKNA 3IB3A 2D2VA 2OAEA 5DYTA 2RCYA 2BC9A 4H7JA 1WXDA 5FWYA 1RVDA 3BGOS 3QTBA 3DLPX 4WUCA 2BGGA 4YECA 1H93A 4AIMA 1XHFA 4WOKA 1UBJS 2Q49A 4JLKA 1Q0SA 4BB0A 1SIUA 1WCXA 5BN1A 3ZD8A 2IOPA 5JZBA 1T8YA 3RIEA 2G28A 1IN1A 5TQ2B 3U4MA 1BXRA 3H5TA 3GZNB 4DPWA 4E4RA 4K6FA 1JIIA 4B7UA 2A9QA 1PR0A 4MU3A 1ACJA 3R3ZA 4KPFC 5FL7D 4QM6A 1XMXA 5F3RA 4NJMA 4F84A 1FNDA 3OZGA 1W25A 4X0EA 1Z47A 4C7VA 3AFMA 1B42A 1GEGA 5EE0A 1KZ4A 4YY3B 1BN6A 2PO2B 2FZVA 3QVXA 4PC3A 4JEUA 2UXBE 3FDQA 3DJUB 3FUTA 2IBFA 5HFJA 1CE8A 1VA5A 2BEWA 4GZ3A 4HAIA 5DNAA 4A0FA 1J1IA 2BTOA 3Q9SA 4URZR 4ZALA 1UQUA 5D6OA 4U5XA 5MFZA 1ZNQO 4M3NA 1AV7A 4LY0A 1HYGA 1RU3A 2JJ8A 4YMIA 1XELA 3R23A 4PQRA 3RRJA 4JLDA 3FHCB 2P3QA 4G1EB 4IGEA 4LC1A 3SKYA 5H81A 4BB5A 3DE0X 3PD1A 3KQPA 2EYUA 3I28A 1SA0B 3ITKA 1CUAA 4F3CA 5SY9A 2C9MA 3FNRA 2L81A 5JLAA 4Q4AA 3PXXA 4TN1A 3MK31 4P7FA 3UJAA 5KVVA 2NTJA 1N8KA 3TSOA 1H66A 4YNBA 2L7AA 4JCOA 3AUXA 3DS8A 2ZE6A 1MNQA 1RYDA 3U80A 5E3IA 4JVSA 1H1TA 2HFJA 4LF4B 2ZSUA 2NO6A 2H4XA 2C4HA 3M33A 4PGAA 1XNRI 4UQOA 2BCJQ 3ORFA 3OQVA 1EK5A 2FFRA 3QXCA 4EBJA 2JAQA 3BUSA 3ROEA 4OXNA 1P2TA 2BMDA 2RKBA 2DJ5A 1UF9A 4FWGA 4A8HA 1W0KD 3LDAA 5E3JA 5DCWA 3ZVRA 3OTOI 3UFXB 3H6HA 1AZWA 4QUHA 3GYGA 5E9AA 1U8CB 4NCIA 4U6NA 2R44A 5M2QA 1MC4A 1SKBA 1LDNA 1M75A 3HJUA 1L1RA 3SSAA 2R6AA 1S2GA 1HKHA 2ZZNA 2C97A 2AJ8A 1NR1A 4BV9A 2VPWA 2QTRA 2XM0A 5H3HA 4KODA 1P1CA 2QTLA 4WGGA 3BC1A 2UYOA 2P4UA 4JBLA 2OD9A 3EEBA 3OUUA 4JXKA 4FP9A 2WB4A 2WQ6A 1P2VA 5EQDA 3OMXA 1EVIA 2WSIA 3CWQA 3MMSA 5LDGA 2PVSA 3O91A 5MGBA 3OCYA 1MVNA 2WE7A 3OM9A 1AY0A 1OBCA 1YTUA 1DS6A 4PGFA 2QMEA 1EG7A 4DG5A 3UV3A 5L4SA 2ONCA 5LZ8A 1N36I 4M9SA 2X7XA 3Q7RA 1UWCA 3UMSA 3UQZA 1M8KA 1DWQA 4B4DA 2I3GA 2X7IA 1HH4A 3BCHA 3NWOA 4RWZA 1FUUA 2H0AA 3MC1A 4C2BA 2GXQA 5E6RA 1C50A 3PEEA 3ZY3A 2OCGA 3E7FA 4CUJA 1EVLA 4H54A 1IPHA 2H9YA 3NPMA 4BMYA 1O96A 2JLVA 4V2UA 3I04M 2VBIA 1ZG3A 4JJIA 4Z2YA 3EN0A 1TYEB 5JFGA 3I83A 1R1DA 2V54A 2WP8A 4CU5A 5FEMA 4OL0A 3CEAA 3VUFA 2O8CB 5FHQA 3GLLA 2Q1TA 2CCJA 1ZWKA 3BULA 2ZIWB 2WG1A 4FFRA 3HWX1 5BRJA 1B26A 1XX6A 1E61A 3R3XA 2AWNA 1PEKE 2BP7B 2XMRA 1M0TA 4UUAA 4KN5A 4L4RA 3G7UA 2NUPB 4H6XA 4CLRB 4JLWA 5BYAA 1W93A 2Y2VA 4H9GA 4LGVA 2BFEB 2B99A 3CURA 2HCBA 1ORHA 1CRLA 1C1XA 2UZ0A 5K5EA 2C7OA 5GVSA 4LV5B 4HGNA 3HRIA 3SDZA 1CF4A 2ONZA 2V59A 2E4WA 1V43A 4EEXA 1Z8HA 4EG7A 2TS1A 1YVEI 1ADJA 1L5KA 2JKVA 3QX7A 2B8JA 2XTMA 2ZETA 2P3SA 1GKYA 4JUCA 3U4QB 3HHPA 3ZDBA 1FR0A 2NACA 3S84A 3L8ZA 2BCGY 4Q1VA 3I5XA 1HSOA 5AICA 1T3SA 2YRXA 1NJ8A 3GCGA 3KHSA 4YJ3F 2I2FA 5GP1A 3VU1A 4ARAA 5IDXA 4TWBA 5LP1A 3JARA 4WESA 1XNQB 1F7UA 3R5FA 2P6NA 2PSJA 4YY3E 2G67A 2BEUB 2QJRA 1XCGB 4W1QA 5DSTA 3KSUA 1O0CA 3G8YA 2IRWA 1VGQA 4CODB 4ZT2A 3EPJA 5BUSA 4MW9A 2R8EA 1Z35A 4FOPA 3O5AA 4IVNA 5JU6A 4JS0A 1Q0PA 3I4UA 2CLMB 1P1RA 4W8HA 4O1IA 1CJUC 2TMYA 2CZQA 1GKIA 1GTG1 3MMNA 1AVOB 2NNWB 5JTUA 5BV7A 2PSEA 2ZXRA 2A0UA 3ZCUA 2MT9A 3EVBA 3W3AH 5AVTA 4NL4H 4XFDA 4JXXA 2J5KA 4JL8A 3VYSB 4HMQA 4LS3A 3U4CA 5BYJA 5JV5A 4RSGA 4C4XA 4EVSA 1HETA 4Y9UA 2DC1A 2I33A 1AGRA 2GO4A 1CJSA 1J25A 1MX3A 1PF7E 3AUTA 3C3CA 4LRTB 5G2OA 2ODTX 3EJ6A 3FRIA 2DFDA 4C3OB 4C9BA 2AZXA 3T3NA 2ZM6E 2PV7A 3PXEA 4LF4E 4BFZA 4EY8A 1PJBA 2H2IA 3QKSB 5A5VA 3LCJA 3PCRB 5I7WA 4TZ6A 3CUKA 3H5VA 1L4YA 1XEXB 3HBNA 3AUKA 4YRBA 3MJCA 1GU1A 3DE6X 3P9RA 1BG6A 3G17A 3KSMA 2QT1A 2J65A 2FEAA 1T01A 2COUA 3ZJ5A 2ZTVA 5EZ5A 4UQPA 4EHIA 5LVAA 4MI6A 2EVWX 1K2WA 2HK8A 3NM5A 3VR4D 5J2TF 3OX3A 2Y1XA 3KQVA 3GCZA 3DOJA 1RE0A 4LX8A 2W2LD 3S27A 1V5IA 4UU0A 1P39A 3L0SA 2X8WA 4HH1A 1SB9A 2PKEA 2PQ6A 4IQGA 5KOJB 4GIBA 2DFTA 1BQ3A 3G49A 2OXFA 5WRFA 3FNIA 3R8FA 4C0HA 3HZHA 2IS2A 3CAXA 3V6MA 2HO5A 4RELA 4AK9A 5DKFA 1GPDG 2QN1A 3EW7A 4YXWA 1JDUA 2X4IA 1L4NA 3RF3A 3J80A 5BR8I 2C4MA 3OSZA 3D3WB 3M5DA 4CL3A 3VHXA 4NBUA 2NN6A 3AEQB 1M1YB 2P61A 1TZ2A 2Y4OA 3GFQA 1ZUD1 1RPZA 4KUGA 5LC1A 3LUJA 2JGFA 2EX0A 1M2EA 4P33A 2GESA 1FCJA 5DHTA 3SMQA 2IELA 2JZOA 4P6VF 1B0PA 3ILYA 4XQGA 1OTHA 2B4TO 3ZZMA 3V2UC 2HMVA 2F22A 1CPRA 4IG9A 3O74A 3B4TA 4MIOA 3I4CA 4YALA 5DRTA 2QUZA 5HZHA 2AWYA 4P3YA 2BJHA 4QBTA 3TKYA 3VBEA 2QTVB 4WW0A 5LPNA 5KWJA 3ZTYA 4EI2A 2PX4A 1Z7WA 2IUSA 4BB9A 2A0XA 4BNIA 2ACKA 2MIIA 5I7VA 3AR3A 5AVYA 2IOHA 5CGZA 2JFXA 3G7NA 4XFKA 4EK9A 2C7QA 5E2BA 2DFLA 3D81A 1Q1BA 1R9NA 4FGLA 5G0WA 1NX6A 1MJNA 4CTOA 3ZQYA 4LF6I 3HSYA 1T0JB 2CW5A 3SHWA 4R31A 4EWCA 1G9SA 3HB1A 5FFFA 3OJ0A 4C3UA 1QRDA 5AHWA 4A1FA 3QITA 7AT1A 5JYEA 4MRMA 4BLOA 2MSKA 4U0JA 4ANFA 3DDCA 4MMZB 2XUIA 3MINB 1Q0UA 1VBMA 3CUYA 1E5DA 4K1LA 3IXQA 3PL1A 5TSDA 4WOCA 3RYIB 4JJ4A 1THMA 1D1AA 1DB3A 4HZIA 2XVXA 4N6GA 1HI9A 2H6EA 1XD2A 3GA7A 4HDNA 3CO5A 3F4BA 5FOVA 4QBHA 1TCUA 3MRVA 1PT5A 3DBHB 3T1OA 3ZHOA 4P4SA 1L8AA 5TMBA 3FHLA 2MWQA 3I2IA 1E1CB 1L4HA 2IM8A 2OZLB 2XZOA 5HGXA 3EBLA 4IMPA 1A2OA 2FW7A 1WXEA 2NIPA 4LPKA 1HMDA 1XG5A 1ILEA 1OW3B 4WPGA 4JI6I 4DUZE 3ZKAA 5KX5A 1REQA 1FB5A 1SWWA 4ZHSA 1F7VA 2PA3A 4HS4A 4MS4A 2LR0A 3THRA 1BWSA 1P75A 4XIGS 1ES9A 1KR5A 4KPEC 1WZEA 3EHMA 1ULAA 1IWBB 5D7NA 1A97A 2HFSA 2GARA 4V24A 3O83A 2D74A 4CS8A 1HRKA 2WZDA 5F3WB 4JOQA 5F78A 3M85D 2VKQA 1A1VA 3L6EA 1II8B 3AV0B 4OHFA 4EUKA 1A6FA 5EQTA 2ZT6A 5TJ9A 5GINE 3T3OA 4WJZA 5T8KC 2HPZA 3C8GA 3JZFA 4GP9A 5KNDH 1U6KA 3JYHA 1MOZA 1P31A 1G1AA 3IKMB 4JLBA 4YROA 1UODA 1GYPA 4R51A 4PG6A 3BICA 3QQPA 4EG8A 2ZJAA 3WMRA 4LZOA 3THXA 3M82A 3ST7A 4ABTA 4FT4A 4EW6A 5C1PA 2NPFA 3CEJA 3FNQA 3LKVA 2OBXA 5AJHA 3H1FA 4K9PA 4D7AA 1ULHA 2XNDA 2G1AA 1JT2A 2CFSA 4PO1A 3QW0A 4K6CA 3PFCA 2W6ID 1DUSA 3C6ZA 3V8QA 1VKZA 1QXSA 4NYIR 4NTBA 2BW0A 4CM9A 4QDOA 2QBYB 3H4MA 3GORA 4ZCLA 2C8VA 2O6LA 1MIOA 2H3HA 3PQFA 3TJZA 3O8OB 4OJMX 4HNAA 2H7BA 3JCZA 1R5NA 1UP6A 1HQCA 2V55B 4MDEA 4WABA 3ONEA 1Z6YA 5KOIA 1NXQA 2A4KA 4MR9B 1CUZA 2JKYA 3KT6A 2X4LA 2NZ8A 1D5CA 1K1EA 2XSEA 2CB0A 2XD4A 4L3VA 3LBIA 3B12A 4P53A 1WZIA 4K3UA 3CO0S 3P06A 1OF1A 4KI2A 1M1YE 3G8DA 3K0BA 5I6DA 1GSAA 1PFUA 1MJGM 4MVJE 4YP9A 4Z9BA 4XM1A 4D42A 2QQ5A 2Q45A 1EFRD 1E3WA 1NW8A 1TM4E 4ZZ2A 4YDQA 2WNRB 4I3HA 1YS1X 1GCAA 4EAQA 2QNBA 2JLRA 3DWGA 1YA6A 3B1FA 5H9WA 4JG4A 1RCUA 5DBEX 3LS2A 3GNQA 2PY6A 2R8OA 1JMYA 2OA0A 4B47A 5TPZD 2O9JA 1OIWA 2H29A 1GKLA 1SOAA 4QNKA 5HIKA 4XDZA 2AFHE 1Q95A 4ZRDA 1NF3A 4RS3A 2QY6A 3R5TA 4M9RA 1ZISA 2AVDA 2PL3A 3WS7A 3ZGZA 2HLDD 1PUIA 3O7MA 1U28C 5AM1A 3PQDA 2Z3WA 2A9KA 4ZOLA 3FWYA 1XZQA 3HJFA 1NW7A 2WR8A 3FFWA 1E9AA 3HXPA 1I94I 4UDNA 4CS9A 5FBZA 1JA9A 4X8HA 3KKQA 2I8BA 2R8ZA 2YL3A 2Q9AA 3LDGA 5CB4B 4Z4GA 1FMCA 3I5PA 2OEPA 1YH3A 1VC2A 1Y5LA 4HNRA 1XAJA 4X20B 4ROTA 3HNOA 4BFLA 3MOIA 1TRHA 4H35A 2DKOA 3DOIA 3N8IA 4DR4E 4JEAA 1BC5A 4ENTA 1T10A 4DA6A 4IH4A 3AV3A 5LJIA 2C38A 2GOYA 3EIXA 2B4YA 4Q1BA 2IVZA 5IH7A 2GZDA 4WFKA 3W7VA 5DT2A 3DQPA 3G0GA 4U5EE 3VKFA 1IZ0A 4ND6A 3WGIA 3LP5A 2UXDI 3WA6A 4FD3A 3V4SA 3IEPA 1NR7A 2C4UA 1M2VB 2EFDB 3WGYA 5LKRA 1XP5A 3KLNA 1ABEA 4MZXA 5LB2A 1FFBA 2YS7A 1NXTA 1NKTA 1A7DA 4EA6A 2I29A 1TZBA 5IKMA 1M2JA 1WN0A 4IS9A 4TVBA 1SUCA 3DLCA 2ZI3A 4HKTA 4FGKA 1JUDA 4K5QA 4PR3A 3EPVA 4AN1A 1WL8A 4QQ8A 3HEAA 1YB7A 1N3LA 4N3BA 5FDFA 2MHRA 4GFDA 1XA4A 1G6OA 3C5VA 5FFNA 3VU9A 4Q3DA 2UZ1A 2FR8C 1CY1A 2CMFA 5KYWA 1P2BA 2K5UA 4PNZA 2HDOA 2ZD9A 5HM6A 4U9EA 4RTQA 4B81A 2BA1D 3JS5A 3LKBA 3HGMA 1H23A 3OKCA 1GLGA 4IQ4A 5DLYA 4MGIR 3DQZA 1CZHA 3KKOA 4BBPA 4Z7CA 3BREA 1EFCA 4P84A 4JCCA 4QGGA 4ZVVA 2ZRJA 2RBGA 1MHTA 5I9MA 4H4CA 1Y4DE 1BXGB 3MJHA 4BV3A 3DEAA 3Q9UA 3F97A 4BEWA 3I34X 4XDHA 3RHSA 1RRVA 3HPRA 4URLA 4IGGA 5KNBA 4HLNA 3WI7A 5CU7A 1JDTA 4MQFA 2BZ1A 4LK3A 3G50A 4DOZA 1EHCA 4JJZA 5TT1A 2CJPA 4R05A 2FUG1 3DTYA 3C3WA 3HSKA 5LZ7A 1LIHA 4QJ5A 4D43A 3W2HA 5FADA 4BVEA 1A50B 1FFCA 1OAKA 2B37A 3DLBA 3R7WB 1SOUA 1KI2A 4XD7D 1ZH2A 4CL8A 5K03A 2CWDA 3R7BA 4DEYA 1PNTA 1G3IA 1CLUA 4GH5A 4KMOA 2I76A 3O1IC 2FMUA 4QUJA 4X7PA 1JW9B 2LSEA 3K66A 3KPVA 2Z4TA 1OH6A 5JH7A 2JIZA 1Q7TA 4GLBA 4PY2A 3STHA 1QU3A 4CJGA 1M2GA 1FAPB 1HNWE 3DW1X 5D8DA 2QJWA 1TCCA 4KJXA 4ID9A 3P71T 2FPGA 2R05A 1WEKA 4FMBB 4J16C 4B43A 4DJ5X 4JSRA 3LWZA 5K05A 3PR2B 2ZWVA 5EERA 1RWPA 3WO0A 1S2OA 3MUEA 3LCVB 3C7KA 1GCOA 1YU9A 3ADKA 4DUYB 4OH7A 4FGWA 2Q1YA 4L51A 3O75A 1R2QA 3WISA 1MFZA 5NLLA 3HYNA 4PJLA 3M4ZA 1Q1AA 3VC1A 1T36B 3VJRA 2HV9A 3A1SA 1GARA 4IR7A 5LD2C 3UA3A 1U8EA 4O5AA 1VI7A 2XHEA 2Y71A 1WG8A 4C2AA 4XGIA 4IF4A 2TMGA 1PDVA 5CCDA 3DMRA 2N42A 3R44A 5DHAA 3KJGA 2ZJZA 3GD5A 3P45A 3E0XA 2ZJOA 2OQVA 1NONA 1Z34A 5BP7A 1L5SA 1WZUA 2WJ4A 4F4CA 2DFKB 4OKSA 2GJ4A 5BUCA 2I6TA 3MJFA 3RTGA 5ALQA 2WTUA 1NUTA 5TC4A 2NNLD 1T13A 2O7SA 3D0KA 4R5MA 3DDSA 2HMZA 3NRJA 3D1LA 3KTOA 4PG8A 4KK3A 4FFVA 2LGJA 2IYOA 1H6BA 4KLZA 3LO8A 4B8YA 3F78A 3GODA 4N3GA 5AVXA 4EKEA 1KI9A 3EC2A 4Z9IA 3RADC 1B62A 5K3BA 1V1RA 3BCSA 1TWCA 4EO7A 4OBXA 3KLBA 3US6A 4YMHA 2HAEA 1S01A 2F17A 3J7AM 5F35A 1M7BA 1T25A 4U2GA 2IW1A 1XDWA 3LX6A 2BLLA 2H2FA 1E58A 3GLHA 1E1YA 1Z08A 4EI8A 4EPXA 2FSVC 3IAAA 4HAWA 5CT5A 1UBSB 3SJ7A 5L0FA 1YS7A 2A0KA 2YWEA 2FP4A 1QHEA 3IUBA 3OEEA 5CURA 2TRSB 3RFUA 5FI3A 4AUEA 4B3SE 1OH8A 2P6VA 4DLUA 4B5KA 3I9MA 4FQ8A 4HLUA 2ECKA 1KEVA 3WTCA 4GM0A 1QFXA 5KTOA 3M49A 2Z2ZA 4G2NA 4Z9AA 3NHWA 4D9GA 3KM0A 3EE6A 1JEYA 3PIDA 3CZMA 2QW8A 4X65I 4LRQA 3DTTA 2H1FA 2FSSA 2IZ7A 4N47A 2M64A 4TVKA 3WK6A 1B2LA 5J1SB 4EP1A 2XB4A 4XWGA 1E2QA 2E37A 1YZAA 5FR2A 3Q1KA 1IATA 2QL9A 4Z9YA 3GT0A 2ST1A 3JQGB 1EX1A 4I81A 3RIPA 3S6JA 2ZRCA 3E8SA 2H2AA 3DMTA 2H5JA 2D2EA 4N3NA 3RT9A 4M6WB 2BJVA 2BF4A 1VSQA 3GVIA 2I34A 4ALKA 1YB1A 4U7FA 1CIVA 3RRBA 3UUGA 3RHZA 3CHYA 1GUAA 3CSSA 4JC4A 2MU1A 4AS1A 2AXPA 5B6IA 3ZV7A 3OT5A 3FJ1A 1CHNA 4EUEA 3PUKA 3Q5DA 2ISQA 2P9FA 2ZRPA 3QF4B 1KBZA 2PH7A 4IW3B 2HRCA 2Q3JA 3EULA 5E0OA 5D51S 4E12A 3W1VA 2A35A 2ZROA 1MZPA 3OLVA 1ZBQA 2HM7A 3ZUPA 3KFVA 5LBIA 4FEAA 4B6RA 2ZU6A 3VNQA 3PC3A 3GAZA 5FBHA 6LDHA 1CU1A 3DJFA 4BJ6A 3GMDA 2QU7A 2GWWA 3A4VA 1E1DA 1Z0GA 5COGA 2C58A 3KYCB 5DFAA 4BWVA 5L0DA 4W99A 1KZ6A 3UF0A 4KE9A 5CCEA 3CW8X 1J5PA 4MV9A 5A6SA 3O26A 1WXXA 2PSHA 1TO6A 4KAFA 1JI0A 1QGAA 3JVIA 1LRJA 1QFYA 3TBKA 3IAEA 4D2IA 4LOIA 3TUZC 2YMQA 3Q6MA 5KVAA 3T3MB 4BEBA 3F2IA 5FLXA 2DKFA 3CR7A 1U1EA 3EXAA 3H1BA 1R6BX 4EI9A 1KIMA 2GKOA 4MVJG 3ESZA 2QPLA 1Q0QA 2ATEA 4RMIA 3H3FA 2YL1A 3J80C 2PT5A 1G5FA 1Y4UA 3JWPA 4ZDKA 2BHRA 4DV6B 2AD5A 3V5NA 4JLJA 4BQFA 2C7GA 1VHJA 3O39A 1Y0BA 4LCBA 2XZDA 4CIAA 5EZYB 2QTMA 2WIDA 4LGMA 1YZNA 4ESHA 3MPOA 2CHFA 1LLUA 3A06A 5A6JA 1JI3A 4JYPA 4Z86A 4JJKA 3R24A 4UCFA 3A9VA 1CEXA 1J2RA 1IB0A 1YAUO 2GAOA 1W9HA 2M6KA 1T2AA 2F3PA 5K45A 2CZGA 4WCDA 1Q77A 3TOCA 1O57A 4JT9A 3FHJA 3Q98A 3LW7A 4ND5A 5LQJA 2HN9A 3BHMA 3KU1A 1GNRA 5DM60 3MWFA 3KSAC 1HNZB 1T9AA 1X42A 2TYSB 2NN6F 4A2CA 2QLAA 2V7GA 4E1BA 4D9IA 1PGOA 1VIVA 2ES4A 2C82A 1QCYA 1G8YA 1T2CA 2PA0A 5IUNC 4H3KB 3OOWA 1W4AA 4IGFA 2IKSA 3H2VA 2H07A 4N76A 2IUEA 1Y9JA 4UQLA 3IKVA 4P9TA 3OQ1A 4G1FA 4L2IA 4WAUA 2PRJA 2JGJA 3EQ8A 4KYTA 2PJZA 3C8HA 4M83A 1EP9A 4OD5A 5DZSA 3KQWA 1DTEA 2W2OA 1OPRA 1Y82A 1T1EA 2FN9A 1YGYA 2XKAA 3OZAA 2Y9MB 1KZ1A 4E7PA 1IN6A 4GICA 4WNYA 3AB3A 2H17A 4BASA 4OUDA 4LNAA 2PSDA 1NC1A 1EUDB 1JE1A 3VMFA 2AWCA 3OQIB 4AIRA 3CW2A 5JS1A 2VSNA 4TM8A 4YXWD 1OC2A 3ZD7A 5C5DA 1B1CA 1T6IA 3ZE9A 3D6AA 3FOBA 4CE6A 3DMGA 1P2GA 5ES4B 1T15A 1MRSA 4EUFA 4Y1EA 1BE0A 5CG2A 3AL0C 1DAGA 3LDFA 3HY4A 4G0HA 1OMOA 1GFSA 2NN6D 4QC2A 1GL9B 4OMCA 3B6KA 2FHPA 4G07A 4XWWA 3FTFA 4ML3A 3EGEA 1SHJA 1QX3A 4JLMA 4QYSA 1SKYE 3WZMA 2VNJA 5HIIA 4N4WA 2OYRA 1XMJA 4RK0A 4DMRA 3NHLA 1TA0A 2A7QA 1PYGA 3ZS9A 3RS5A 5BQ3A 4RTNA 1ZOLA 4BJTA 4ZREA 4DMFA 2FF7A 1XWIA 3DCIA 3VZQA 3T4RA 4DVJA 4AX8A 2BMFA 4B40A 3CLVA 1NRWA 3DBOB 5BV0A 3RUIA 4XTCS 2DQYA 5CT9A 1QFSA 2F3UA 3ZHYA 3JATB 1IUKA 3B2NA 3U6BA 3R7DA 5DTEA 4F3RA 1PEYA 3UR3C 4O6VA 5KX5F 5HUHA 1MAAA 1PRYA 3GU3A 1MAHA 3K0HA 4TYPA 4RMNA 2X58A 4MVJA 3II6X 3H6GA 2XGGA 3S8YA 3M6FA 3W3ZB 3EVTA 5CFPA 1WKCA 3K7EA 4Y2HA 4QT4A 4TXHA 1P4SA 4C0JA 1AX9A 4FHCA 2I4LA 4ZO6A 1GM5A 1XMQI 1Y7HA 3PKJA 1TVKA 3AF5A 2AB0A 3L7JA 1DQYA 5I45A 4M8KA 3R9WA 3U60B 1ZW6A 3SIPA 2P1ZA 3UXHA 3CX3A 3LA6A 1ZSYA 3NTVA 1USGA 1P4RA 1PJ4A 4U3JA 3I5AA 1KYXA 2FR1A 2AFHA 1P42A 4BPMA 2NX2A 2CL6X 3KYJA 2V6GA 3I62A 1DC4A 2GZRA 3K1ZA 3POVA 4BKRA 1TM1E 3PS1A 1W581 1XDBA 2QD4A 2VCYA 1ZXBA 1QS0B 4OJTA 3AHHA 2GAIA 2AEJA 3EOZA 4DCOA 2A5FA 4UOZA 5M34A 3R0XA 3WR5A 1UT5A 3V48A 3LC2O 2OGTA 4DIUA 1TM2A 3PHIA 3IDZA 2QVLA 4OHWA 4IF6A 4UEOA 3GMIA 3V33A 2E5WA 1R10A 3CTPA 3G5AA 4MP3A 4U6SA 4KH1A 2VRWA 1VYUA 1AKVA 2XHZA 2B1IA 2GK4A 4FJ0A 2VDQB 4HX9A 1PWEA 2XUDA 2RSLA 1IIRA 3UMHA 3FETA 2HCFA 4RF4A 3EY4A 2ZS8A 1NQXA 1FP1D 5AI6A 2FQYA 4O4HB 3LVRE 1FP6A 1L7XA 4HUJA 1Y6FA 2EAUA 2PUAA 3MCAA 5IYZB 1FYWA 4DQDA 5AJVB 2ODBA 2EL7A 5IKPA 4X9XA 1SBQA 1E9FA 3DD1A 1HDXA 4LC0A 4G9GA 2P5SA 3KAKA 4L50A 1O0BA 4LEIA 3G2OA 1DMSA 4ZOCA 4A73A 5FPHA 4ZD6A 3C8GD 4MU1A 3CR3C 2QLBA 3UWKA 1QUEA 1NNLA 5TJHA 5ITSA 4WUVA 1FTYA 5FIUA 3U44B 3AOEA 1G7SA 1T24A 3MWGA 2A5LA 5FNVB 4FR0A 2PZEA 2DSTA 4CS9C 2HTEA 5EK0A 3KYIA 1UT6A 3BGDA 4MI9A 4BFCA 2ZUFA 1EWRA 1W4ZA 4NNPA 2XNDD 4R8VA 4L3WA 4V0RA 4KAJA 4XUDA 5EYPA 4BV2A 4Q1FA 1IHXA 1Q1EA 3LXUX 1W4BA 1HA3A 4CM9D 1PFWA 2H54A 5C7OO 4AQYB 5A4DA 2EQ5A 4I4CA 1IBME 2QAJA 3BGIA 3MLBA 3N05A 1SC4A 4OHMA 4MIEA 4P9FA 3TQOA 2P6RA 4ZOLF 1FSPA 1ELOA 4OGFA 2HI0A 5FA5A 5TGDA 3DW3X 1XOIA 4E0IA 1VE9A 1B14A 4Z51A 4OOFA 3GFVA 2VRNA 3R7LA 1EM8B 3G88A 1EUCA 4Q1AA 1FRQA 3KP1A 1SXHA 2VCHA 3JVVA 3V8PA 2WJ6A 3CNHA 1DQRA 4FGZA 2EILC 5JWOA 5U4XA 3RC1A 4CDMA 3TAUA 1LJUA 1JYFA 3P4YA 1VLVA 5JMPA 3DHVA 2ECFA 3FFAA 4DMCA 2F1DA 5CLHA 2P7HA 1KAOA 3TZLA 1XDGA 2A8YA 3U9SA 5JS5A 5LNK6 1RKXA 4NCBA 2WAAA 4DR1I 2Q7XA 1RIIA 2EGHA 3Q7QA 5H80A 4OATA 4EHAA 1VLMA 2NP7A 1PS8A 1ZH8A 2G09A 4KI7A 1OGJA 5IFLA 3DKPA 3UJBA 3G4ZA 2IZ0A 1E8DA 4IAOA 3E22B 2B7LA 1N3IA 4G1CA 1HLFA 4D4MA 1PWYE 1F8GA 1H2YA 2HF7A 3ND9A 5BVHB 4B0OA 4EM6A 1G3UA 4PLZA 1U90A 2WNHA 1J97A 4NFHA 2QQEA 1SVIA 3PKZA 5BNIA 2QZPA 4BRSA 5K3SA 2C3MA 3DYIA 3OLXA 4LZPA 2WFZA 4HNTA 5D3MB 4HL6A 5FOUA 5BT8A 2HA2A 1IB6A 1WB5A 1CLEA 4G63A 1T0UA 4ETNA 1U65A 2SKDA 3E7DA 2QDKA 1NSFA 1KAMA 1DO0A 2X5KO 4HBZA 2DWOA 5B1YA 2OUIA 1EEXB 3S4YA 3Q5GA 2K6GA 4TMWA 2X3YA 2JGKA 4XGRA 1YIAA 3I6ZA 2WFMA 1QYRA 1TJ4A 1ZJWA 2C2XA 3W5VA 4A9AA 3A9UA 2IYTA 4XR4A 2HWXA 2AR0A 4JGBA 4O79A 2ZLBA 4K6MA 1UIRA 2YQ5A 1ZRSA 5JY6A 3TKLA 3ONWA 3JAKB 4LYJA 2VAPA 4LV8B 4L4ZA 4ZGWA 4S1NA 2V97A 1NKSA 5E7QA 3RVSA 2QTNA 1WSBA 2HUPA 2WW8A 5IF3A 2BGJA 4ZI3A 3KZ1E 1Q50A 4B46A 1XK7A 4NZYA 2KHZA 2ZRNA 4P0QB 2E2WA 3H2SA 1POXA 5B1SA 4MCJA 4ALNA 4UARA 4YK5A 2Y76A 4YUVA 4PINA 2YJ6A 1WAMA 2Q4TA 1W2GA 3GK3A 4YUZA 5JAPA 4JYBA 1TT7A 5JCOA 1JRAA 3PDMP 3WYNA 1S1CA 4XPZA 4P58A 5I9SA 4WUDA 1Y80A 4LXTA 3ODPA 2VCEA 3FLBA 5TPWA 4I46A 3IIKA 1HG0A 5JH7F 1QKKA 1RE1A 2C61A 3QEKA 3BEDA 5HKAA 3UV7A 2JHFA 2CMDA 5DGIA 1YCHA 4KIWA 3L82B 1U0BB 2DTXA 5TEVA 4TVSA 1E3JA 1RYZA 4HI0E 3MBOA 3O4HA 4P3PA 3CINA 3JQAA 5A5EA 3DULA 3SNHA 4CLHA 4MEAA 4Y0AA 1O5OA 3SZRA 4C1BA 1B6TA 1WA5A 3VSBA 1PV4A 3CUVA 1MP0A 3PWSA 3A3OA 4TV9A 3FYUA 1DIGA 3G59A 1E6EA 3RRFA 3K8YA 2Z3ZA 5EJ9A 1OB2A 5KNBD 1XA3A 1K7YA 1IZ9A 1GRNA 3G0CA 3ABQB 4M55A 5KJFA 3FVYA 1W2WA 3OF3A 4DHWA 4J91A 1Z8NA 3C3EA 3PK0A 4XH9B 3O2JA 1HKUA 5JYCA 3UGOA 1Q0GA 2W8ZA 2WZLA 2GA9A 1XTPA 3TNDA 3KWMA 4DXHA 5C5CA 4KXVA 3B5IA 3OZUA 2AN1A 4DV7B 2ZBUA 4F1KA 1DVRA 3MFYA 4JA0A 2I7VA 1RXSA 2VDPB 1JGTA 4XGQA 5KMGA 3EVZA 2H7XA 2W5UA 2Q9BA 3I09A 4Z9JA 1OYSA 2Z4RA 4WK0B 2RSEB 3LC0A 4D0GA 5J23A 1QK3A 2GD6A 1HFKA 1UM9A 2V1UA 3SX2A 1YSCA 2JIZD 4AQYE 4RGBA 5DGHA 1DUVG 1Z0BA 1JDBB 1EA6A 1U9JA 4JV5I 2FGJA 5BN4A 3O1LA 5J5CA 1EFVA 2DMRA 4TTJA 3C74A 4LFBI 2VUIB 5DPMA 3BJZA 4MP8A 3WIUA 3MUNA 1DXQA 2ZXUA 4XB1A 4YRIA 2OKUA 1H2AS 5C3UA 1PZFA 3FMSA 2NO5A 4HLUC 3NT2A 2RGXA 2UYYA 2BH9A 3KR1A 5IJXA 4ZVOA 4AZTA 4INZA 1Y6RA 1CZNA 3K71B 4H31A 1U3CA 3SYNA 5TIIA 2B5WA 1NVAA 3H17A 3HLYA 1J2JA 2OFFA 2RHLA 3NAZA 3MMXA 5T64A 2FKNA 3IURA 3LPNA 3TR5A 4Q21A 3CLUC 1DAHA 1HBJA 4HRAA 1BROA 3B1KA 4DANA 4RA9A 3WLFA 2CMGA 3HXOA 1OFTA 3IP5A 4JT8A 3DMTC 1MENA 2WG2A 1E3HA 1HT2E 1IZ8A 3IVGA 4HDMA 3QPVA 1OCZC 5DGXA 3VUEA 2WM8A 1KC3A 3EWAA 2YQ4A 1P3DA 2FXVA 1D4AA 2I4NA 4AL1A 2ZQ5A 5IAAA 1CZOA 5CR9A 2DAPA 4GPBA 2QQGA 1SKAA 3PYEA 3TAHA 1SPXA 3EVDA 2WSSA 4O4IA 4U5CE 2I7CA 4AW9A 1EFTA 5GGYA 5JEDA 5CM2Z 2R60A 2RAPA 3NDJA 2ZR0A 2DHQA 3EDMA 3GMEA 1JXMA 3NUZA 3ZJUA 4B75A 2BFNA 1PG2A 2YJZA 1HOTA 4BJ6C 1THZA 3IBFA 3QZUA 1UPBA 4HCJA 1E83A 4EHNA 3EPPA 1ECGA 4J2TA 3F6SA 1VIYA 4ZYLA 4Z9HA 5D3ZA 3BM5A 1OWOA 3L84A 2W11A 5HE8A 2DEUA 4MR8B 2V4MA 1DAFA 4D9KA 4HLCA 4F4DA 5LU8A 4ND8B 1Y3FE 1Y7PA 4FMCF 1IPFA 1QSGA 3B53X 2JLQA 4Q9JA 1JKJB 4JZAA 3O8CA 4LSWA 3AW8A 1LS4A 5U4QA 2GN2A 4MJ7A 2DLCX 2H5IA 4RK7A 3GHHA 3LFUA 5MF6A 3N7UA 2X1LA 3NBQA 4OFZA 1JVSA 5FLXC 3VI4B 3NJ4A 4TLCA 3OEED 4L9WA 4GD3Q 3KUXA 2Y1EA 5JADA 5KYXA 3RABA 1U0OC 4N8SA 3PUWA 3RVMA 1RQPA 2UVQA 2YW9A 1S3GA 4R98A 1JHZA 1Z0FA 3PE3A 3JTMA 3BSFA 4YRKA 5DISB 5A5DA 4N54A 3LNMB 2OECA 2IU0A 3WLTA 3GY0A 3RS2A 1JE0A 3WG7C 4P4LA 3CLUD 2I78A 5EP1A 3EXEB 4UVDA 1OVGA 4U2EA 3TXXA 1MUUA 1N8TA 3D4IA 1JN0A 1O9BA 2X36A 3GQBA 4KMSA 1NVVQ 5HRUA 2ENUA 4QBFA 2XDAA 3B0PA 4RHTA 4ALIA 2YCLA 4G6ZA 1USVA 1K5GA 5LUAA 2WC1A 2QYSA 1CWUA 1OW7A 1E6LA 2B98A 2Q1UA 4Y6PA 5AMXA 2L9JA 2XLMA 3EW9A 4GGPA 1P1HA 3PS9A 4JOCA 4Q9LA 3AUYA 3SKVA 3I39X 4DADA 4CZ2A 3S0JA 1F2UB 1ZEMA 4UNSA 4DV7E 1X1AA 3GJ3A 4DSUA 5CNKA 3PFBA 4RZ3A 1M1UA 1CQIA 3CZ4A 2R6HA 2GFIA 1C17M 3IV7A 3F7NA 2HC9A 2Z8ZA 2EPKX 3QVGB 3TEFA 3VDXA 4D98A 4YRTA 3JASB 3FYCA 4CMEA 1ST2A 3Q3VA 4Y1RB 2OI2A 4X1IB 3A1FA 4DOMA 3WLAA 4F91B 4RHUA 1T9BA 1XPOA 2B7BA 3G5TA 2WAOA 3THYB 2XDQA 5EPEA 5I9NA 1FFYA 3BTOA 1I9GA 3LU1A 3UWOA 5PGMA 4X6LA 4CS7A 1IZMA 2I6XA 1O9GA 3ZU5A 5B30A 4DWWA 3ZCVA 4LSMA 4TRJA 2CVFA 3QEMA 3B7PA 4ERXA 1R8YA 1QORA 4EKIA 3AYXB 4ZTZB 5I4IA 5KPJA 4A2QA 1Y1PA 1LA2A 1PKEA 3V2GA 1M1ZA 4NBQA 3NVMB 3S2IA 4EPRA 3KZNA 2JIQA 1T1IA 3G1WA 2IXTA 3TQFA 4ALLA 4URFA 1SUAA 5CNMA 2VPZA 4NYJR 4ZV4A 1FWLA 1J9EA 5TMDA 3GEHA 5JANA 2WWIA 1G60A 1XK6A 5CK4A 1ZVKA 5D01A 2ECQA 2KSFA 4PZPA 2CNNA 1U04A 4O2AA 1NE7A 2GVDC 2PR7A 7ADHA 5JQGA 1UR5A 5L3JA 4HWTA 3RBAA 3DDZX 4LCFA 5JD3A 4E31A 3KQUA 2ENWA 3OUZA 4EVIA 2DUWA 3TMAA 5AXBA 3SXUA 3RS0A 3FM9A 1JHRA 4TS9A 5FPTA 4I5IA 3E2MA 1K88A 4YBZA 3V4FA 4XTRA 1EGMB 2NMVA 3IUMA 3H8SA 2EOAA 1I4OA 3H9GA 2IPOA 1CUEA 2W6NA 2VK8A 2YYSA 1PL0A 3T0GA 3KEQA 1V7QA 3GLQA 5GOTA 4RVOA 4BMZA 4JI2B 1H4VB 1XNQE 5JNRA 3SAJA 2B25A 1XMIA 4AYXA 5G4KA 1R5JA 3OZBA 4Q3OA 4GMKA 4YCMA 4QBKA 4AD8A 5B55A 5KTKA 3DJYA 4OMDA 4HQOA 2GEKA 1EWVA 3K70D 2OLJA 4HXYA 3VPGA 4XJVA 3RIGA 5F3DA 3VOTA 4DLKA 5B2FA 3KUUA 3JPYA 3C14C 3CRZA 4JIOA 2PO1A 3D2CA 2ZYIA 3ZWPA 4TWRA 3TMYA 2WU0A 3TZQA 4LGCA 3F8TA 1JA1A 2IHKA 1NN1A 2V2QA 4QARA 5HRAA 2O8EA 4Q4ZF 1G8KA 2WYOA 1LPMA 2FX5A 2H7YA 3H9UA 3FUXA 2ZJFA 4V3CA 4HDKA 3ACBA 1NURA 2WTEA 3STVA 1PTJA 4MVJF 3WYFA 5D3KA 2BBSA 2O2ZA 3V8MA 3UG6A 4AIDA 3QU2A 1TKNA 2NTVA 3PPWA 1YQQA 1X80B 5E1OA 1G17A 2J0WA 2FFQA 3SHQA 3RK1A 4Y6OA 2WIKA 3OIGA 4KLAA 3QELB 4KE8A 5ICMA 4YMLA 3S81A 1EVEA 1LQUA 1BMQA 2ZOSA 4MUKA 1XAHA 3JQ8B 3FCAA 1EI7A 3TSYA 3I76A 1M0WA 3SC4A 2PSFA 3HYTA 3VA7A 2PGIA 2VYVA 2F48A 3L8EA 5IJ0B 4B2LA 1KYIA 3HUDA 1FDWA 4X24A 1GR0A 4ARVA 2XQJA 1BE1A 3DVRX 4XA8A 5K3OA 2JS7A 2GBGA 1O2DA 3FTCA 5C1BA 3ZZ0A 4LYGA 4P5DA 6ABPA 3ZV6A 1ZXNA 4RJLA 5EWJA 1PNQA 1L6IA 3ILVA 1RVV1 5DTRA 2JAWA 1J9GA 1XZBA 4ARBA 4K46A 3OQJA 3EYWA 4MEJA 4COOA 3LDHA 4KO4S 3SX4A 1N3BA 1L7PA 1S8NA 2DBQA 1OZGA 2CVHA 2D4UA 2EZTA 4M1TA 2CUZA 2JGDB 5KTPA 3ZQVA 2Q2OA 2HK7A 4MVJD 4KHPB 3W8DA 1UKAA 2A5JA 4AMBA 4M98A 1UP4A 5DK6A 2O5CA 1KI6B 4C4RA 1RQ7A 4ZRNA 2EEZA 2QN6A 1FYFA 4G4GA 5EKDA 3EARA 2D3WA 5CW2A 1S6YA 3HBLA 1V4AA 3DBLA 2RGCA 1ZLXA 2P5TB 3BH6A 1SQ0A 3AJMA 2Y77A 5TB5A 3BWCA 1QF6A 4F4HA 3LOQA 4YAOA 4IVRA 2W4BA 1KP3A 2OQ2A 1TYZA 2YR0A 3LHSA 1N2OA 4DLTA 3G85A 4EB0A 3AM5A 4P36A 1W34A 4YACA 3KV1A 2Y3DA 4ZAXA 1NYRA 3S7ZA 5JW6A 4MTFA 2Q27A 1EQAA 3L0IB 4NYMR 4TYNA 3BWYA 4BLPA 3D7SA 2DTDA 3G2KA 3QMPA 1V3UA 4R84A 3M2PA 4G0OA 2UAGA 3KXDA 1R50A 2IV2X 4B2IA 3HBFA 1E8NA 3ETGA 4KPUB 3LL7A 3C8MA 3BF8A 1VCHA 1PUJA 2OBYA 1OH7A 1ULBA 3HXQA 4URUR 2G08A 3W8IA 3T1VA 1J8FA 4RVDA 5GMDA 4MAMA 1P2FA 1QRUA 4O8ZA 2YWXA 4R8SA 1L3CA 2EBUA 2XF2A 1OQCA 1SO8A 3HXTA 1ZD4A 1JAZA 1P1JA 5KINB 5F9MA 4J3NA 3K1HA 3LSYA 2M1ZA 4D74A 3EHEA 4GHWA 3MIZA 3GZTB 4Q18A 1I5EA 2J0UA 2CK3A 4YUYA 4YBRA 2XB6A 3IEXA 3K30A 4PYMA 1BSVA 3KSBC 1M56C 1RBZA 1LX7A 3GT4A 4HN4B