2CGEA

Crystal structure of an hsp90-sba1 closed chaperone complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEYEPLTKALKEILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKLLYETALLTSGFSLDEPTSFASRINRLISLGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
publication title Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 115
structure length 405
sequence length 405
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2006-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2cgeA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2cgeA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cgeA02
2O1TA 3PRYA 2O1UA 1Y6ZA 3HJCA 2IOQA 2CG9A 1SF8A 5FWKA 2O1WA 3Q6NA 1USVA 1USUA 1Y4SA 2CGEA 1HK7A 2O1VA 2GQ0A 3Q6MA 1Y4UA 2IOPA
chains in the Genus database with same CATH superfamily
1G8FA 3LYLA 1ZOOA 3NONA 2D1FA 2PX6A 3WL7A 4RZQA 3TAHA 2QM8A 1FFXA 5FBLB 4AUEA 3JAMQ 1N8SA 4X1YB 3MLGA 1D8AA 4FC6A 3ZXXA 4YONB 3A27A 2J7PA 3WHNA 4PYQA 3NRHA 4WLNA 1VIAA 4TMFA 5ECYA 3TJZA 2QRJA 3AKDA 4B75A 2WWGA 4CODB 4DMRA 5FOTA 3X1JA 3CVUA 1M2FA 1F48A 1KFKB 2WNRB 3DEAA 3U7QB 5F21A 3EIHA 4NS4A 1E3WA 4CMEC 3GRFA 3UYKA 4MR7B 3FAKA 1GQOA 1M2OB 4DJ9A 3BGWA 4QG3A 3STYA 2WT9A 4OKGA 3G0CA 1FSSA 4YJ3A 4JEAA 2F1HA 3CH5A 1CKEA 2PMDA 2G25A 3HJCA 3PT5A 1K97A 2VUTA 2CVFA 3GG2A 4N9QA 4DV3E 4Q9IA 1D0XA 1YL6A 2QUJA 2XXJA 1TA9A 2X41A 4OHFA 3FPLA 2QIOA 1T3HA 1XXHE 2FQYA 2H2AA 2ZRCA 4D99A 3V46A 2BR2A 2GUGA 3O2SB 3R3JA 1M5TA 1DPFA 3TFOA 1ODLA 3SBEA 4CKCB 5LZ8A 5D8DA 5ADUS 1MXHA 2WEKA 1OR3A 5IT9Q 3R76A 1T1EA 4YJGB 1SKAA 2JI6A 4Y6SA 2FMFA 4F5EA 1W48A 3A70A 2IYTA 3O8OB 1IBLE 1OROA 3PMRA 1DWOA 3CNEA 2CHGA 2C99A 3I1FA 4IIUA 5COQA 1YULA 2REXB 3O31A 1UK8A 1UWLA 4MPDA 2H06A 1NZEA 3IOEA 5JUAA 4FDTA 2P8JA 1ORYA 5EGSA 3LKBA 4YMTA 1DC7A 2VLBA 2C3YA 2WE8A 2ATEA 1A1SA 4LPKA 3IT3A 3V8VA 2Y6UA 4XDZA 1U8YA 1UXKA 4C88A 5A4AA 3PENA 3CE6A 3IEKA 5BQ3A 1UXJA 4MKZA 4NENA 4K6FA 2WUEA 1BKYA 4YAUA 3MQFA 4BLWA 3A6DA 3HKMA 5D87A 3IEEA 3E7PA 3IE1A 3B6IA 1J5EB 3ILSA 2B1RA 3TSWA 4KRGA 1GTMA 3A4LA 1NUTA 2IOFA 4QQKA 3OFNA 3HDGA 2G36A 2WG2A 1VSUA 1K68A 5C0XA 2HMYB 1Y1TA 2C54A 4D97A 1FFSA 5M5BA 3G79A 3PDUA 2CXNA 2O8FA 2Y3DA 4IFBA 1SURA 3CUYA 1TA0A 2QAGC 4AXBA 3A4IA 3CURA 1B14A 1ZU4A 4GZMA 1G5QA 4CT0A 4FLFA 4FEYA 4DIBA 5C1IA 1EUDB 5IRCD 4L5CA 4GR5A 1Z2CA 4CW7A 4HDCA 1OLXA 2X15A 3C87A 1FW6A 4HNUA 4JCZA 1QRTA 3WGGA 2X0FA 3ZVRA 2V98A 4ACAA 5FPHA 3HO6A 3R6LA 1HX7A 2XUGA 2ILTA 3UFXA 1PEKE 2RB5A 3I0MA 4JJ6A 2JJ2D 1B68A 4UC0A 1THMA 2WINI 3FYCA 1OSNA 4N6OA 2CNKA 2ZUFA 4M1QA 1ST3A 2OOSA 5A6JA 3IAXA 4IGEA 4PX9A 4YRKA 2BFBA 1XNQB 4YYZA 2EJWA 1DHTA 1F0KA 4KWTA 2QNIA 3ITNA 5I4CA 2CMDA 5K3AA 2F43A 3W5VA 2ZM6E 5JBNA 2B83A 2V8PA 4BJ5A 4X6UA 1EZ1A 2D00A 4RPJA 4LZOA 2PZLA 4LSWA 3W8RA 4DIDA 5TVGA 1XELA 4EL0A 3G2LA 2QW0X 3FDZB 3H2VA 2XX3A 5JRZA 1TADA 1S2MA 4NX2A 1I9GA 3UMSA 2UUCB 4DT1A 1C17M 3ZWWA 3T3GA 1P5FA 1ZMBA 2GERA 3KZVA 3UO8B 1Q12A 4DHEA 1Z33A 5ES4B 4YI3A 2FU5C 1PYGA 3PEWA 3JT1A 3T52A 3M4ZA 1KH3A 4DA8A 4HTFB 1X77A 4CCSA 3FPCA 3S2IA 4URXR 3ZHTA 4P53A 2Q7DA 5IEBA 1RRMA 1TQDA 2UKDA 4IWBA 2FWBA 1TECE 1QF9A 3SU8A 1GNTA 3U3KA 3PF9A 3A2MA 3IE2A 4W9NC 5ELXA 1RYNA 4QE3A 4EG1A 4TWJA 3DCYA 1X7GA 5BYAA 1LPNA 1KOGA 2V3WA 1LFAA 1JOGA 1WB5A 2HA7A 2LXNA 3DAOA 3LDGA 2Z5BB 3HZRA 4G5YA 2WF7A 4OBXA 1G8SA 3FNEA 3G6KA 2O0HA 3IXMA 1OCOC 2XLDA 5ESXA 3ZGOA 1WUTA 1S8OA 2XWJI 1ZH8A 2HQ1A 2VHEA 2JB9A 3GUVA 3CNQS 4EM6A 3E23A 3H2KA 1Y80A 5KU1A 1MNEA 3B3QA 2BC5A 2M4EA 2A8YA 3ELYA 3UQYS 4A4AA 4KVZA 4LYEA 3HXTA 4PG5A 2GF0A 5JZOA 1QOPB 1ZS9A 4C4YA 3PNQA 4BPBA 4UM8B 3BWDD 1Z2AA 1QP8A 3FPEA 3I9JA 2EKZA 3CUEF 1NFRA 4LVUA 1OZGA 3BTSA 3DHVA 1CF2O 1E6MA 1E86A 2QJRA 3HKEB 3JQGA 4TLMB 4WK0B 1OXMA 2Z4SA 2GD6A 1YB6A 4RTOA 1KU6A 3L8DA 3LXXA 5EP1A 5CD1A 3E9DA 1F3LA 3O4IA 4MU0A 2L6FA 1M5UA 3EFHA 1N75A 1J2YA 3HB0A 3P76A 3RIMA 2B20A 3MUEA 1OXUA 1XA4A 4MRMA 3E0XA 3L1VA 3M7ND 1Y6DA 4I5IA 3SYKA 4DVZA 4KHPE 2A6EF 2KJGA 1C9MA 4K5QA 4CEJA 3EC1A 3JZFA 1RYEA 3AHCA 2C37A 5F2KA 1RLTA 1V1RA 2ZRIA 4G8DA 1QS0B 3UXEA 3OZDA 2EU8A 2JJQA 1MUUA 5K99A 3V33A 5EIHA 3UG6A 1RCTE 2HMTA 2PGDA 4R68A 1KYWA 3MFNA 2WABA 3EZHA 5HJ2A 4LK2A 2GBIA 2WD9A 1S5PA 4KXXA 3TTXA 1BYUA 5IXJA 3FYUC 1CIJA 1Y0BA 3V8MA 3TG8A 4LXGA 4U5QA 1JFVA 3WNBA 4G97A 1U7OA 3W2TA 1QGUB 1CD5A 3IQ5A 1YR8A 1QIFA 5K6AC 4DNPA 3GGCA 3VUEA 5ICFA 3DZGA 3HBNA 1T1SA 5ITSA 4AMZA 4D46A 2HF7A 3I12A 3PFIA 5K0FA 1W29A 2PMBA 4WNAB 4BLOA 3R7AA 4Y9SA 4ZI7A 1NM5A 4DQXA 4LNUA 2YV2A 2HJGA 5IC5A 5HMLA 2XCRB 3WIOA 4W5TA 1SHLA 3PQ5A 1O95D 4XGKA 3A7EA 1H6CA 5A6AA 5FCLA 4QD3A 5FOXA 4YECA 1IN6A 5HKKA 1XDGA 4B6RA 4H7DA 3TW6A 3OIWA 2GKSA 1JHPA 1K6JA 3MX3A 3PFNA 3GFVA 3PWTA 3G5TA 2Z5FA 3IJ5A 3NYIA 4G1BA 1PX0A 3AJRA 1P3Y1 2QNRA 4QATA 1Y3FE 1XQ1A 3LBIA 4KFTA 3OJXA 4ZIRB 3ZHZA 4NBRA 1N6PA 3KQNA 2R2AA 1AMNA 4BAGA 3SEZA 4MRAA 4BTEA 4XPIA 1N0HA 3S81A 1TU3A 3EQ8A 2B3TA 2NXJA 3T6BA 4J07A 2XA2A 4EVQA 1F6BA 1U98A 4BC0A 1ZM2A 5CJ2A 4RY2A 4BQFA 1T5HX 3LM8A 2AFVA 4DC9A 5K0LA 1ECPA 4AMGA 2X3YA 5DJ5A 4K26A 2CG9A 4GKKI 2LE0A 1A8HA 1FNCA 4Z99A 2I6SA 2UZIR 3K70D 4BN0A 3AHJA 3QXGA 1LBHA 1BCRB 3U81A 4GWGA 3T99A 1XQXA 5HKOA 3ZOKA 3N2NA 4YT2A 4PZPA 4J32B 4JNKA 2P78A 3I34X 3TNYA 3FJYA 3X44A 1T3ZA 2BFDA 1Z12A 1IUNA 2WJIA 4UFOA 3RYIA 2UVPA 3B1WA 1BS9A 4W1SA 5E2QA 3JARA 2IW3A 3ER9A 1YQDA 4X97A 1KVUA 3N8NA 3S7TA 1EVKA 1MB0A 1TA4A 5CI8A 1B6GA 1E1DA 4EENA 2R9VA 2PZ8A 2UYOA 1V45E 3FCEA 1O89A 3RF6A 5KYWB 1QONA 4YJWA 2WWVD 3WQBA 1FU8A 4OBBA 3HCOA 4NU0A 4DCTA 4U6SA 4RCZA 4JC4A 5F3DA 4D9JA 4O2LA 3I5MA 5L4NA 3K0EA 3A1UA 5KYUA 1U0TA 1Y6QA 4TRNA 5M7EA 1YNSA 4Q4JA 4HEQA 4LHVA 2P65A 1SUBA 3T3IA 1S3GA 1XF9A 5CIQA 3MIIA 2GMWA 1NNLA 2E2WA 3F3YA 1JKIA 4I1YA 4XVQA 3R6TA 3CPSA 3ZIBA 2IWHA 5K3DA 2IP4A 2O8BA 5ELLA 2I3DA 2O57A 5K2OA 4NR0A 1GAJA 2CCKA 4S1WA 1J0BA 2E5LE 3UMBA 4X62I 1ZN7A 4E03A 2BR3A 3U5SA 3E7DA 4LHSA 3JYOA 3QVTA 2ZWVA 3L8YA 3CRZA 4ONSA 4EB8A 3COYA 5ICEA 2WHEA 2IQIA 2B5VA 1PTJA 5CG2A 3AV3A 3LNUA 1XN1A 3DMTC 5GJVC 4TMKA 3ROGA 1Q7BA 1WUIS 4UUQA 2AXPA 4QA9A 3TB6A 3LRPA 2H4YA 2CMFA 4GKJB 2AJTA 3L84A 3GRAA 4JFAA 5AFSA 2ATVA 1Z13A 4TS3A 2UZ0A 3IPLA 5LWHA 1GCAA 2I7CA 1NVXQ 2ZRQA 1CVLA 3WNDA 3FMFA 3WP1B 5LDHA 5EZQA 2XYQA 3OIFA 1M0SA 3MJEA 2QMEA 3JVDA 2ZBPA 3JPYA 3KKMA 2AG1A 1AKRA 1RXCA 2CJWB 3PJFA 1ZQ1A 2PBRA 3IHKA 1FMVA 3N6XA 3SZMA 3VU3A 4OFBA 4BKQA 3W4JA 1SXIA 4EVSA 1LF0A 4GL2A 5NLLA 4K0KI 3OEHA 1KZHA 4U2BA 1D5CA 4C2BA 1YZFA 4KE8A 4LSGA 4JT9A 2WJ4A 1TLTA 1U8EA 4C6TA 3DZIA 2HT6A 2RKWA 3UKDA 2PEZA 5GZ3A 2IE0A 1H9AA 2C57A 4B6EA 4HFFB 2R7UA 1XCJA 1BKSB 2QSJA 4DKJA 2VF3A 1QVAA 3HCDA 4GEHA 4HYEA 2ZJ0A 5C53B 1ZRSA 3HBFA 3G2NA 3K33A 3BGSA 1WU8A 1OA0A 2WWXA 4BWVA 5ERGB 2AE2A 4E32A 1WPXA 3SDBA 2FMHA 4DQLA 4ZOCA 3PNYA 1G59A 5GMEA 2PNFA 3VISA 1JH9A 4IFDA 5E38A 2UUBB 3GJ7A 1UG7A 2I2FA 4Q1VA 2PUGA 2EGHA 4ZOLF 4DR7I 2JIRA 3UMVA 2QR3A 3JQ6A 3JQAD 3DAGA 4JDPA 4MHSA 1LBTA 5HIJA 2HEIA 2RHDA 4NYJQ 1XNHA 4DWVA 4H3HB 2GN9A 1VB5A 4KL8S 2GHTA 4ESEA 1K0FA 1BYIA 3DFKA 2RGAA 4LJ4A 3IBYA 3HNJA 1MCZA 3KCNA 3T0GA 1CX9B 2JKZA 3GWNA 2A6PA 5KEIA 1A2QA 5DYYA 1TVKB 2B0HA 2K5UA 1WCIB 4U0KA 1MO5A 2ZBVA 1K92A 5TEWA 4GD3Q 2DFLA 3ZHCA 3Q5EA 2RGBA 3QWBA 3BXOA 4ZVOA 5HGXA 3VJMA 3M4XA 1PK7A 1X19A 4G01B 3MWEA 1LVKA 4EIWA 3D7MA 1P18A 5HUJA 1E9RA 1H9TA 2ZE7A 3WMRA 1IK6A 3WGTA 3PNBA 1MB9A 4B2IA 1FNDA 2CT8A 4A8HA 1OJ4A 4D2IA 4ZTZB 1CF4A 3R5TA 1HLGA 4FGWA 4R7GA 2R8EA 4CEIB 4YPFA 1BTOA 4BWYA 2AYXA 4IRUA 3AINA 4KDCA 3WIEA 1RJGA 3AP2A 4ARSA 2PKRA 2W71A 2ZUBA 2POQX 2HMWA 4BVKA 4P0QB 2WD7A 1JLLB 2PSDA 1X86B 2FN8A 3MYIA 1N6KA 4H18A 3E9EA 1BROA 4R1OA 2H9IA 1LJ8A 4DSTA 2OYCA 2HC9A 2NSDA 1XMOB 3FF4A 2IESA 4P86A 1EHCA 3T15A 1VYVA 1TAUA 4HAIA 3K20A 1Y6FA 4BXOB 3CSUA 2NP6A 3W2IA 3WB0A 1PR5A 2FSIA 1SQ6A 3ZXIA 2ZVPX 1JIJA 3TM4A 4RHYA 5J47A 1AT1A 4BP9A 2FSVC 1O08A 3TQIA 4URUR 3DOHA 3QVGA 1MVOA 1SBTA 4CS8A 5LMUI 4RHCA 2A2ZA 4ZDKA 1ZI8A 1JAIA 4M1KA 2QVGA 3L01A 2E6UX 3H19A 4I19A 3BJEA 4RQTA 3DMGA 2O8EB 3ET4A 3DEIA 1L5FA 5DS4A 3G85A 2JF0A 3AQ4A 4Q39A 2ZSBA 3Q1KA 1YZVA 3A26A 1RKQA 3RS2A 3KQQA 2ZUEA 1PLJA 3EMDA 4RV5A 4R1UA 2YYSA 4QOFA 2HA3A 3RVDA 1KMMA 1J9ZA 2BEVB 3LKDA 2QI9F 3PFKA 3ESXA 4IVNA 3HI6A 3QNWA 4OI2A 3CBGA 1RQGA 4DJFC 1WMSA 3HCEA 1Y3IA 3QXSA 1XMQB 4BX2A 1XLWA 3G9ZA 4RK7A 5A4MS 1F1BA 1GQQA 2HUNA 1UQRA 4LWPA 3ZDXB 1JSZA 3UUWA 3OTHA 1YMUA 1JAXA 4LJ9A 5IASA 3LI2A 4B76A 4R7ZA 3DOOA 1O6ZA 3A1VA 1OB2A 2V2ZA 4YP6A 2PMCA 3N0WA 1OFVA 4M98A 2P6VA 4TTQA 4HS4A 2ZKIA 3EUAA 3G88A 1B62A 3MD9A 2PR2A 1VSTA 3GLVA 4YBRA 4NU5A 4FIDA 2ADMA 2FWJA 1AY0A 3C98A 2P2YA 3BA6A 2WRZA 3ABRB 3SMQA 2EPMX 1ZK1A 1NN3A 4J16A 1QDUA 4ARVA 2NYUA 4CLHA 1N32I 3LVQE 1XROA 2VUUA 2ZJ5A 4GRIA 2HSWA 2APJA 4OCZA 3SS9X 4HNAB 5B2FA 1ZOLA 1GZ6A 1ZAKA 1Y1QA 2X0CA 3ZK7A 4FR0A 2YL3A 4Z4CA 4GBGA 4CKBB 1PHPA 4PRKA 5AKIA 3VYTB 1UWCA 4FDAA 4IOLA 5G0TA 1UH5A 2PRYA 3OCWA 2QLMA 1DAEA 4YQZA 4Y6LA 4TQGA 2WY2D 5C18A 4RH3A 3RJZA 1KGDA 1UM9A 3D2AA 2P4HX 4RA6B 1NMZA 4AS2A 1L5RA 2BGIA 2A0WA 4TTSA 4EL5A 2Q3CA 3LNTA 2MTBA 2AEEA 4UMEA 3FOEC 1DKLA 4G56A 5F9MA 4FYMA 2DEJA 3A4MA 4DCVA 4XB1A 3EGVA 1LS6A 2LGJA 1T2UA 2Q5LA 4ISCA 4IDAA 4D4MA 3U60B 1VL5A 1THZA 2R7LA 4EHBA 3K5WA 5AVZA 1FR0A 4LMAA 1D1SA 2GPJA 1CWUA 1X7DA 4D26A 3SM3A 4RS4A 4I4TA 3VMMA 3WU6A 4LCEA 1Z0WA 1VL0A 2HGZA 1OU4A 2I6FA 3GVCA 3DWFA 3FOOA 1ZD3A 4KI7A 3L0DA 3H1PA 2NV2B 3OWTA 1FNMA 3HB9A 2WKRA 1C4KA 1VG8A 3LC7O 1BWQA 3IDSA 1E92A 4JL5A 4E7SA 4NZ9A 2IHVA 3S27A 3FLEA 1WHTA 2YNMC 4RGVA 1EFKA 4PN3A 3SIWA 3T3MB 1A4RA 4LWQA 4FS3A 2BAGA 4Y6QA 3PUIA 4WECA 5AIAA 1VHDA 5HA5A 4JLJA 2P67A 2ZBEA 1NPYA 4RQBA 2QZ4A 2I67A 5HSGA 4FSDA 1KU0A 1OBFO 2V6IA 1H1TA 1BD3A 5IT0A 1LPBB 4H16A 1OC4A 4AUMA 2Z56A 3KYIB 3FCUB 4BO9A 4JROA 2V5VA 4GOJA 3HDJA 3WA6A 2TYSB 3ENNA 4ID3A 5K0EA 2H2HA 1Q0QA 3AXSA 4AW9A 3R7FA 4WVLA 4PGGA 3GZNB 4HYQA 1CUCA 2O23A 2CMKA 3SZRA 2ZRHA 5DBIA 1SPBS 2BKUA 3U80A 3S2YA 1K5HA 4IS9A 4REOA 2D1SA 3HCPA 2E55A 3VR0A 2WKSA 2PMFA 1W0CA 5JDIC 1PKPA 1K6EA 4TTRA 3KKPA 1GTJ1 2OCPA 1NW5A 2OCCC 1XTZA 1EFPA 5E1DA 1N0IA 3DXZA 2JZOA 4DREA 1W8IA 2UXBE 1RYBA 4FYKA 4E18A 1RS0A 1PBNA 3I05A 5C5IA 1YDIA 1XT6A 3K73O 1YK0A 3PGXA 4PGFA 3KS9A 3ZWNA 5C1PA 1R6DA 3ZWYA 4V1CA 3GLIE 3FHCB 2HK8A 3ELDA 4KFRA 3AFMA 4JVMA 1U1CA 4RPIA 2X7HA 3DYBA 3H1EA 4CM6A 2YLDA 2AZDA 4CI9A 1WY5A 4AF7A 4W5RA 5IBRA 3RVOA 5BVGB 4M1ZA 3AG3C 4JY7A 4EG6A 3H2UA 4UHDA 1Q22A 1GP2A 4ALIA 3ISJA 2PXXA 4LF7I 1L3CA 3EVFA 4MJLA 3OJFA 3KETA 2PUCA 4D5EA 3ZDFA 2V5UA 2DLDA 3GM3A 3REOA 3MCWA 4ICIA 1R8JA 4QWMA 4DPMA 2GA9A 2C2XA 2VAWA 2ACEA 5DULA 3HPQA 2NYAA 1U1GA 4XQ9A 3QUAA 3UCFA 1IIRA 3D8UA 4D0GA 4ITRC 3PEVA 4TKLA 5BQIA 1U2GA 5AKGA 4XQCA 3DXYA 1QO7A 5GONB 3QIAA 1CUWA 1MA3A 1EDDA 3UTCA 1K89A 3RC3A 1LX6A 4HGRA 4H27A 4QHTA 4R1PA 2YCBA 4LQ4A 5F1YA 4C22A 4BLTA 3RS7A 2FPUA 4MWTA 1JG2A 4P3OA 2GZ1A 3OEED 2IA5A 3R44A 3QUBA 3N7TA 4LF6E 3HYNA 3H1AA 3IQZA 2O3QA 3I5XA 2B9VA 3W8IA 3RO7A 2GYVA 4F5YA 4HVCA 2HRDA 4CTJA 2H6EA 4BB6A 3TXYA 1A97A 3NIGB 1VKNA 2PZBA 2QW1A 3D7KA 4F1WA 2BEWA 3F78A 2YS6A 3N8GA 2ZWOA 4RLHA 3NMIA 1HH4A 2PJUA 1RJ9B 2PO1A 1I5NA 2WKPA 4MQLA 721PA 3AVXA 5JSUA 3D59A 1FS4A 4YDQA 2H3EA 3MTGA 3VZPA 2PZAA 3RAGA 2CDCA 5EJEA 4YUVA 3CB2A 4ZO8A 2IYYA 4HT3B 1VHQA 4JBNA 1Y9AA 2FW7A 2IDJA 4IF6A 1P1FA 2OXIA 4JI4E 2FJ0A 4MRNA 4IHJA 4QEDA 1S96A 4OQYA 2V5AA 1NVKA 3QPAA 1BZYA 1FUYB 3D4JA 4I66A 2JASA 1IHYA 1KDTA 2VHXA 3VSCA 2RD2A 1BEEA 4H3VA 1T5IA 3PE4A 2ST1A 1MMGA 3QV1A 1DKNA 3CC8A 3S2GA 1HLDA 5DT9A 2INGX 2A9RA 3O4FA 3FB4A 3WL8A 4W5NA 2WJPA 1ZHXA 5LMNB 1HGXA 4EJ6A 3G5AA 4B34A 4J30B 4D45A 4RVHA 3BL5A 4I3FA 1ZAYA 3CTMA 3HABA 2I4OA 4C30A 2H5JA 4LF5B 1VJGA 4KQWA 4MS4A 5JRJA 3ZLTA 2EFHB 4I3GA 2J9UA 2ZXWC 1RRFA 1OJLA 2PV0A 5TQVA 1XCBA 4GECA 1MMNA 3JYNA 4HZIA 1NU7D 3M15A 4OB7A 2GO3A 3ITFA 3EY4A 4NKRA 4DLAA 5DHSA 2GDJA 3T54A 2I6XA 4QYMA 3U3DA 3CXRA 2WSIA 1A76A 3QVJA 2IITA 3E4CA 3V8NA 2YDXA 2WYHA 3ZS9A 2X58A 3RT1A 1PGQA 1H6BA 4TLEA 3GMSA 4HNSA 2GA8A 3C8HA 4LV8B 1OR8A 3QVSA 1QV7A 1O0SA 2FPGA 4OO1A 4TVKA 4EJ0A 2LTAA 4LFAE 4RVNA 4EVRA 4OIQF 2EHJA 4BMPB 1LW7A 2F3SA 3H5TA 1G3IA 4BRWA 3GJTA 1X1AA 2ECKA 4WNIA 4DR1I 2X22A 2F59A 3X2EA 2ETVA 2E21A 1JHAA 4EEKA 3FMPB 2VP9A 3TXAA 2IEZA 1TU0A 1JDJA 3BWBA 1EE2A 2Q1UA 3P96A 5CXUA 1EWYA 4X65E 3IA7A 2Y0EA 3A1TA 4EEXA 1MW8X 4BCBA 4I8DA 3JQCA 3FPGA 3PA8A 1GA4A 3GYGA 1K6MA 4LWOA 2XD4A 2IH4A 1YWGO 5BT8A 4MVSA 3UH0A 1G3RA 1C30B 1UJ6A 1P4RA 1J0EA 4PE5B 5SY6A 2ERYA 1E0DA 5BVHB 5JCZA 1QHYA 3LUKA 5DDIP 1KI2A 3NNNA 4C3UA 4D3SA 3OX3A 4DS3A 4O6MA 2H4JA 5EJIA 4DV0B 4TWZA 1CUBA 1PT9A 1ABFA 3I61A 3FSEA 4ZT6A 2IW1A 3QE4A 4DRXA 2QP9X 4NXNI 1U31A 5F7JA 4MVOA 1CVRA 5LMZA 3I0NA 4MW6A 3KQHA 4JI7E 2I4LA 2L6GA 1RW4A 2WWRA 1I80A 3HJGA 2YS7A 1ZH0A 1XDDA 4JBYA 1DC6A 1HQCA 1DG9A 3LC2O 4MCHA 4PHTA 2PIDA 3J7AC 2JD3A 1G3MA 3KAJA 1EI9A 2ZUVA 4PZZA 5L3RA 4YC7A 2YIDA 1GQAA 1ZEMA 3Q1LA 4UOEA 5A7FA 2R1TA 2NN3C 5CLHA 4JBXA 5FUMA 5FNVA 4DC0A 1ZGCA 3NT5A 4MMZB 3OTWA 3L0SA 4ZYTA 3L07A 3KHKA 1I4YA 2AS0A 5EI5A 1MQVA 4XX0B 5ECGC 2X2PA 5JE8A 5B6JA 3NVMB 3RTCA 3JZDA 3IDOA 2J9BA 4M8SA 2UXDI 3RFVA 4IIFA 2X5XA 4NH0A 1DX6A 1VZ2A 2X6TA 3IRVA 3CA8A 5G40A 4JXJA 2GEJA 1GUAA 1CULC 4RYDA 3PYGA 4DC1A 2A35A 1XMIA 2QMOA 1H3EA 3L8IA 3IO5A 3L7BA 1LPSA 3OQNA 3LHFA 2ZROA 1KO5A 2VWQA 1CCWA 4ANFA 2OLKA 3OTOI 2AHOA 2VUIB 2VF2A 4FAPB 5IFLA 5KAPA 4Q9DA 5CX1B 5E9QA 4EA7A 3Q6MA 1P2DA 3ANYB 4GMFA 4HNGA 3C4QA 2BFNA 2ZTLA 1VOMA 5TQ0B 4HAXA 1Q92A 2Z0MA 3KWLA 5A2GA 4L2IB 4K8RB 2IWRA 3W5AA 2XVZA 5FF9A 1CR6A 3BE5A 3D4PA 3H1BA 4Z7QB 1M1YB 5EPUA 4BFUA 1HSOA 1ZESA 2OT3B 3WGQA 4IAQA 1BBHA 5IK2A 4D74A 5GQSA 5LJLA 2A9FA 3JVEA 3UEOA 1ORDA 5EIBD 3A6LA 1VSBA 1AUQA 4DLPA 1CZRA 2ZYUX 4R1SA 1ULAA 3A1WA 4XDGA 3FVWA 4L0CA 4TZ6A 5A03A 2R6R1 3DKKA 3BRWA 1CZHA 4HDRA 4JZYA 1X7YB 3RHTA 2PXAA 1H2HA 1Y1LA 4UHEA 4TUYB 2YXBA 4A8JC 1IB6A 5DNVA 2AKYA 3G2MA 2RBGA 4C6SA 4UTGA 2GM9A 5DMXA 2NU7A 3L8EA 5A9RA 4IQFA 4LJRA 3BFVA 1HO3A 2C2WA 2IEGA 2FP4B 4ZCTA 2F6RA 1JIUA 2EQAA 3ZZ1A 2WWIA 1RKBA 1FXSA 3GNQA 1F8XA 1Z8DA 4Q19A 1XHKA 2NTYC 1G55A 4IIXA 3WGMA 2LR0A 3K5HA 4B3BA 3EVZA 3CVJA 2EIXA 4BVFA 3LA8A 1ISIA 1U81A 1NOKA 2DSNA 3M7NG 1VMKA 4WZ6A 2ZT6A 4DV5I 3BG5A 5G1OA 4HDNA 5L95A 10MHA 3LRXA 2Z2KA 4GLBA 3L0PA 5JAOA 3DT6A 3M6XA 3K0FB 1IBSA 3KHUA 3LQFA 1XRMA 1QZ3A 2FG7C 1NMYA 4L8YA 4GM1A 3KMIA 3QPVA 2LZ0A 4LY3A 1QP0A 4EO9A 4I1SA 3AUXA 2BFPA 3QFCA 2VN8A 3QW4B 1IWPB 4DNFA 2WHXA 1QV9A 3UKOA 2QVZX 1SXPA 1U89A 5EYPA 5LB4A 4KMRA 2OECA 4MVCA 4LY9A 2K7FA 4X1OA 4MU1A 1BVHA 2OQVA 4RCVA 3QHQA 4M53A 4E3ZA 1IBCA 2QUZA 2XVMA 1GZDA 4WTOA 3TOCA 2OWDA 1V5IA 5EPOA 3R3UA 4IDQA 3ZD7A 1E2IA 3O3CA 4MA4A 1JHOA 3QX7A 4MQEA 4BB5A 4PPNA 3RKUA 3ZN2A 4NZYA 3AVTA 4JYAI 1FJXA 1MC8A 3DEYX 5CEJA 4PQGA 3LAWA 5C32A 1YO6A 5DSXA 5LDGA 3DL7A 1W4ZA 2BA1D 4QU9A 4PJNA 1ZK3A 2XIQA 4UDXX 4N0PA 5JANA 1LVGA 2VVTA 1DOZA 3KT0A 3BHNA 1NULA 1SG6A 4IZ6A 4KNWA 1WW8A 1N5RA 3C3WA 2ODBA 2UAGA 2ZBDA 5LM3A 1YLMA 3E9CA 3SDSA 2NVUB 2MT9A 1NTRA 3NHUA 4Q7LA 1TVMA 1UEIA 2XSZD 3VPBA 2BMFA 4ZVMA 3KSUA 1QCZA 3LP6A 4LIPD 2F1OA 2I4NA 1OXBA 3O5AA 1LV8A 4RJJA 4X7BA 3RVQA 1U7PA 3KJEA 2H65A 1NPDA 4WBXC 4ITVA 4DLBA 1XLUA 2NPFA 1QSGA 3RVYA 1NLFA 3CQ9A 1PN3A 3PSAA 3HFJA 3G2PA 4Q4AB 3C6QA 1EJ2A 3MYFA 1YRYE 5EQJB 1WA5A 4MW9A 2NUTB 4R0VA 4FB4A 3ZTTA 1EXNA 2CEAA 1NQAO 3JALB 5CB4F 4UVHA 3PPVA 1GZ3A 3NTXA 1YVUA 5EESA 4O4LA 1WW2A 2R3VA 2MU1A 3ECCA 1P2BA 4B32A 3ZQVA 5K05A 2GVNA 3L7LA 3GD7A 3W5JA 2QLLA 2QVXX 2C8VA 3L8FA 3KBBA 3EVAA 2VKQA 3MHPA 4KKVA 4Y6RA 3I1YA 4F38A 4QJ4A 4HFNA 2C5EA 1WX1A 2ATIA 4PHCA 4QYXA 1BHSA 1B6SA 4DNQA 2VHZA 1SOVA 4N7BA 3BD7A 5DVZA 4YGYA 3TTTA 4OYRA 3LLSA 3DE5X 4INJA 4TS4A 3M6UA 1T2EA 3F47A 2PNJA 4EI8A 2XUHA 2WNHA 1JBKA 1IBKB 1VIDA 3TD6A 2CDNA 1GUFA 1VRWA 1V2HE 3BXXA 4PZ9A 3AIKA 3K9GA 4NDNE 3DEZA 3TF5A 1WP4A 4Y2QA 2FZVA 1AHHA 2O8DA 1KQFA 2BSAA 4PXAA 4I3HA 3WYFA 5DASA 4MRRA 3LT2A 2WM2A 1UPBA 4TVOA 3TLKA 4TRJA 1XSEA 2OXEA 2ODAA 4X00A 2EFEB 3EOZA 1L5HB 4L8FA 1M1UA 3HNPA 2Q21A 2PFSA 3RSGA 1FNNA 3DT9A 3BMOB 1X38A 4GM0A 2H0AA 1WOLA 1M6WA 2ZETA 3LPLA 3MINB 5JQWA 4RF2A 4J0DA 1G5PA 1KI8A 1HE2A 3PX7A 2XOKA 4HH1A 2YRFA 3UNGC 2C3MA 1CHDA 3PFBA 2RI1A 4TM7A 1Y9JA 1DT3A 1NBOA 4QUAA 3DJNB 3M34A 4P7BA 5JH7F 4KBGA 2HK3A 1RHJA 4JXXA 4DDVA 3SQLA 5LXTB 3VF0A 2QJFA 5DBOA 4OXKA 2XBUA 1G18A 1PFQA 1QMGA 4GF5A 2EJBA 3NP7A 2EERA 4MGYR 4PCUA 1T6QA 3MWGA 4HPJB 1Y8ZA 1NZDA 2Y2UA 4U7JA 2DULA 2FZKA 1V26A 4BMNA 4KV9A 2QZZA 2OLJA 5FJIA 3VQTA 4XD7D 5HG0A 2WICA 2IEYA 4BEWA 1OH8A 4CMCA 2QMHA 5F23A 5BW8A 2P6MA 4QI2A 3CH7A 1OKKD 3VO8A 3P06A 1NBMD 4BE7B 2BFOA 3AJAA 4CLOA 3KOUA 4P38A 1FX1A 5DN6D 3K4HA 5DW3A 4XQGA 3CLTC 1BDHA 4Q01A 1Z4NA 5FX2A 1UAYA 4OXXA 1LEHA 2QBYA 1E2XA 2NOAA 5FPQA 4NBTA 4O6VA 1EFTA 4XOIA 4BMZA 2HRBA 1I6LA 2WVNA 1GHTA 2WHQA 1QOQB 1DIRA 2PUEA 1ZXMA 2L2QA 2W48A 3RFYA 1XP5A 1WN0A 4PC2A 4RXUA 3R41A 2JBAB 3KVVA 1XZFA 4C6RA 4II7A 3FTQA 3VAAA 3H87A 2A0KA 1K5DA 2PKEA 1XAJA 1YA9A 5KNDH 3PRJA 3PHHA 2Y1OA 3UZUA 5LLTA 2VDJA 1IY0A 4MV4A 3WWOA 2VFAA 1I94B 4PO8A 3UKJA 3DJFA 2H29A 1Z29A 1S1CA 2GFHA 3PT9A 1Q0UA 3K9FC 1YD7A 3HZOA 2PUTA 4G0MA 4X7PA 3SZ3A 4FEGA 4YJKA 3RGGA 2OBMA 4ZQEA 3V80A 3BERA 3UK0A 3HP7A 1OLSA 2P7IA 3BAZA 1UDCA 3Q7QA 1OXKB 1Q15A 3AR4A 2EPLX 2QX4A 2DBYA 3A14A 1JDSA 3E8SA 5EQTA 1HPLA 3C1OA 5B1AC 3ZGNA 1H1LA 3UUFA 3FHLA 421PA 3JX9A 2R25B 3QYFA 3WXMA 5TJHA 3EFOB 1T0JB 3V00A 1F3OA 4JLDA 2IKQA 4Z49A 2WAAA 3H9BA 1XRQA 1W36D 3HVRA 5JEAA 2GEBA 3B6ZA 1NJ2A 2JH9A 2A7XA 1WUKS 1SH7A 3G3EA 4EDHA 3N7AA 4F92B 2EX1A 1XHFA 2ZR7A 1R9JA 3KB2A 4DYVA 3NEJA 3O8RA 2B4YA 3QXXA 4MI6A 4JI6B 4A2CA 2VAPA 1NUSA 1TKNA 5AOAA 4M3NA 2G67A 3KG2A 1NW7A 5J5CA 1KQNA 2AWYA 4OHWA 2ONKA 3V2UC 2OCAA 4PC7A 4M0LA 2WSBA 2RONA 1SPXA 1GM5A 4JKIA 1UXHA 4V0NA 3QV2A 3WKDA 3PKZA 2JGIA 2VZEA 1KVQA 3TFQA 1LK0A 3EZXA 3AIMA 4U63A 5KTMA 3PD0A 2BYTA 3FX2A 1NJSA 2C20A 1WUUA 1ZA2A 2VZ9A 5G0UA 3Q8WA 2NO0A 1P1HA 1JMWA 3HO1A 2X1HA 3TYXA 5KWJA 3ZKBA 1SC4A 2C9DA 2GZRA 4Z1OA 1TTTA 1IN7A 4MDTA 4KK3A 4HG2A 4MPJA 1N6OA 2CL6X 1HQKA 4AMBA 1E58A 5KVVA 3UAZA 3H2GA 3WK9A 4NBSA 1BXZA 3C48A 4USKA 2DEIA 5DX1A 2CDAA 3B38A 2IXBA 2PWPA 1ZOIA 1ZIOA 3V1KA 3L4EA 1GDHA 4J0EA 4GEKA 3WVNA 4OSEA 1Q0TA 4HNQA 4DW8A 4X45A 1I2DA 3CRVA 1BGXT 4O33A 2CFSA 3ZE2B 1U28A 2OGUA 3WJ7A 1JT9A 3B8HA 5IM5A 1QRDA 4OGKA 5TPZA 3ZV6A 1QPBA 1T3TA 2BFEA 3GPIA 2B8JA 3HA7A 4HDOB 4RK4A 4W8OA 3FPHA 3T7IA 4ILKA 4EY8A 3BE6A 4CX9A 3SVZA 2QLJA 3B9QA 3P0RA 4QGGA 2F8MA 1VJ5A 2HDHA 1GZVA 4EY6A 5DM70 2EF1A 2VSYA 4PV7A 4X92A 2JFGA 1PEYA 3GGJA 4PSAA 1GPWB 3DW1X 2BM8A 1DQRA 2PRSA 4JU9A 1GTG1 1NASA 3GRPA 1L7NA 3SMVA 3TW0A 2K2QB 4OQFA 2PSEA 4QVKA 3VYRB 4NV0A 1YA4A 2G1PA 1FPMA 1BHO1 3T41A 1FE8A 3S29A 1PR0A 4JD5A 3HVIA 4CU2A 1K86A 1VPLA 1J5EE 1BFDA 3C2QA 3C5EA 3CRMA 2NYRA 3WIUA 3JR7A 3AF3A 1XVAA 2ZBQA 1P9NA 5DPMA 3MUFA 4LFBI 2GO4A 3MSCA 4N3AA 1RHUA 3KUCA 1KTVA 4RACA 3PIDA 4IX1A 1MNDA 3I9V6 5I7WA 2HNAA 1CY7A 4GSLA 3GWLA 1TJPB 2B3DA 4FEEA 4ZGWA 3K7DA 3MWFA 3AIIA 1W4AA 3WRXC 4DR5I 3UHOA 2X5KO 3JRWA 1LB1B 2W8BB 1ZGGA 3R9XB 2I03A 4XB6B 5J43A 2YOHA 2W2MA 3FZQA 4BZWA 4TROA 5H02A 4IDFA 4LDQA 1KMHA 3DNFA 1QFYA 3HR7A 4YWHA 1ZG3A 1KI1A 1AG9A 1H65A 2NXNA 1T2VA 3OWOA 2W6IA 1F1MA 1IZYA 5HRCA 3DDOA 3HJAA 3CZ6A 1T9KA 2BN4A 5T8KC 4MQ5A 4RS3A 1XPUA 2A9OA 5AOBA 3ENZA 4RSGA 3UOWA 5ALKA 4ENRA 1XQYA 5AO9A 2OILA 3WY9A 4XLNF 4KQ2A 5DSTA 2JJYA 4JXKA 1JG6A 5K3SA 3VNUA 2ZTMA 3R8FA 5FLXC 4QXQA 4YACA 2KGOA 3L1HA 2VCAA 3F67A 4U39A 5KWVA 1L7XA 4JS0A 5B7GA 1F7VA 3HPRA 1R4MB 5E8JA 3GMDA 4K2HA 4O2RA 5F77A 3ER8A 3C8MA 4KIUA 2A68F 4RD2A 3ZX4A 2JCYA 4CCAA 1TUGA 1N3BA 4MK4A 2EINC 3PXUA 4RIGA 5KOJA 2WTBA 1GRNA 3RFUA 5JS1A 1CYEA 3OO1A 4JR2A 1PSDA 3EYWA 1HDYA 2WU1A 3FCAA 2W98A 1OF1A 1UK6A 5DTRA 1RC0A 3HWSA 3KTAA 1ADFA 2ABWA 1PQPA 1P29A 3QPUA 1VI7A 1Y6RA 4RANA 4J29A 1XZMA 3NOQA 5CYGA 4JOCA 4LJLA 2K7ZA 4DKXA 4KQKA 3RGWS 2XWPA 4QARA 3A8TA 3TW8A 4BVJA 1FMFA 3R20A 4QDJA 4Q47A 2CNDA 1JIVA 3TLEA 5HIMA 2R86A 4MICA 2O2XA 2VYNA 1IUPA 2KQUA 1HTTA 5REQB 1G42A 5AVOA 2YUTA 3E3NA 4AJ4A 3W4YA 1HZZC 4EMDA 5CK5A 4P4NA 1ONNA 5L3SB 4HY1A 3PEYA 4V2IA 2XZTA 3I2JA 3WWPA 3AB3A 5EGYA 1YBVA 1XTVA 5EJGA 2R85A 4B40A 3TK1A 2YL1A 2LW7A 1VECA 1BR4A 3DD6A 3AEUA 3A6HA 1J22A 5A2QC 4EG8A 2CWDA 2A3NA 4P9FA 3N87A 5G0SA 3FD8A 4FDLA 1Q0LA 4EF6A 4RHFA 4HX2A 1X87A 2W90A 4AL4A 1VMEA 2AYZA 2CW5A 1Q19A 1NE7A 4Y1RB 5AVJA 2AXNA 1FP4B 3FHTA 3VR5D 1CGNA 5JRAA 4ZVIA 3F6CA 2P77A 2JLUA 4M1WA 1JQAA 4EJMA 3OLCX 4BHTA 2AG6A 4QELA 3R1IA 5FBKA 2Q29A 5I9TA 4IZJB 1NYQA 4JP8A 3TAUA 1SVWA 3NMJA 3FIJA 2C2GA 3S99A 2J67A 2YYAA 3UY4A 2I4MA 3AUSA 3O83A 3IHWA 1YS2X 3DMHA 1Z18A 4Q18A 1ZNYA 4Z51A 4AQYE 3TQSA 3BE8A 1S6YA 3QNMA 2B4AA 1IVYA 1YZCA 4CPDA 1D1QA 3OQPA 4S1TA 3EGIA 4RCYA 4LVNA 2X76A 3DA8A 1QANA 5K8LA 2LKCA 1AHNA 1WS6A 3EAQA 2CHEA 1IEQA 1KY3A 3HE3A 3KD3A 4WKBA 2NN6D 5CFZA 2ZSEA 1HNWB 1HEYA 4CTMA 2UZAA 4HQKA 1OZFA 4B6OA 3SC6A 3HA3A 1XTJA 4OLFA 1PG2A 4A1FA 1PQUA 1GSOA 1D2AA 4EKIA 1B8PA 3A7DA 3RYCB 2E49A 2OHIA 3U4QA 3PFFA 2FPWA 1M34B 4I9GA 1M0TA 1PW7A 2JI4A 2P5YA 2QY6A 1O0CA 4ZAWA 1UJMA 3VU9B 2Q4TA 4LRQA 5DXJA 1FLAA 4CSAA 4DCCA 3DKRA 2XQJA 2QTAA 1D1AA 4N6HA 2X2FA 3TQHA 2H54A 5BWNA 3ONDA 2G77B 4P98A 5KKCA 4HYMA 4F3RA 5DCYA 3I8OA 1Q0KA 1S05A 2J5RA 1PL8A 5U9CA 3SYLA 4NF2A 3MCUA 4MV8A 2OV3A 2W2NA 2RGEA 1QRRA 1KZ1A 3MB5A 4JMLA 3P27A 3IDZA 1ILWA 4MI1A 4JB8A 1E5VA 1GYRA 4PVCA 3MELA 2OV4A 4IFIA 2HY7A 3EQ6A 3K3PA 4D8UA 1EB9A 1ZONA 5L6LB 5LQAA 4M0CA 3R23A 1G9SA 3SZLA 5JSLA 1VISA 3E2PA 2IOQA 3P3EA 4HZUB 2H16A 3IIEA 5BP7A 4PCVA 2IU0A 4YN3A 5LZ7A 3NHRA 2JEOA 1PFYA 2ZU0C 1UK9A 4Q1AA 3K6SB 1HNXB 1TQ8A 1VGRA 2D74A 1D1CA 4YRFA 1OXSC 5L9AA 1A7JA 3T5DA 4HUTA 3ZWQA 1TMYA 1U9CA 3QTTA 5DHTA 4G4SP 1YDMA 4FWDA 2A0BA 4GQBA 2C39B 5CHYA 1WATA 5GZ6A 1WVMA 4HK4A 4WBNA 3TIIA 5FUXA 3D0QA 1G8PA 1PUIA 3H6GA 5FOUA 2C2OA 4LYYA 2IPMA 2XNDA 1C5KA 1PFUA 5C1OA 4YASA 5FWKA 4J03A 5JYDA 3U1YA 2ECOA 1T0BA 4QRHA 4IV8A 2QB5A 3UT5B 2F22A 4RPCA 2GJ9A 2IIVA 2FG5A 3CIOA 1PZXA 2PO0B 2IHKA 2ZRFA 3RVNA 5G1NA 2NADA 2AZTA 5CX4A 4PRYA 3UG7A 1EXWA 3FG9A 3NFYA 2WSLA 1FYXA 5J59A 3PLAE 4BMDA 1W88A 1TPZA 1DBRA 3ELWA 4WGZA 4E4YA 2EEZA 3R8XA 3AGQA 3IP8A 5AW1A 5KTYA 1QXSA 5A05A 3IUPA 4K9PA 2BRUA 3RRMA 1GNRA 4JYCA 2GTIA 4YJ2A 1ZVKA 1SHUX 3KQKA 5IM4A 3H11B 5SY4A 2P8SA 3GR6A 3KJQA 4PZDA 2EARA 4YX9A 4JV5I 1OFTA 2XUZA 1XQ6A 3S2EA 1NIPA 5PGMA 3DOEA 4GLJA 4LXIA 1JMVA 4HEA1 2VCHA 1JWAB 4H35A 1SCIA 3AETB 1H9BA 1V1MA 3UMCA 3COPA 2TMYA 4JVOA 3J80C 1U0NA 1QSPA 1AS3A 5ALJA 1YDHA 2LIVA 3BRSA 5BN4A 3FVQA 2FPIA 1Z0EA 2R8ZA 3OAAA 3FYDA 2JJ8A 2EILC 4GT1A 3TBKA 1QQ3A 3PFCA 3L82B 3IV6A 4PHFA 3B3FA 2NWQA 2JEYA 5JOQA 2OCLA 3JASA 4US0R 4TSFD 3OBIA 2A5YB 4IJMA 3Q8MA 4A3SA 3DZJA 4MYHA 1Z8FA 3JSEO 3LQ1A 3BILA 1WQ4A 1I4OA 2TMDA 3NAGA 1Z28A 4HQRA 3OKAA 5FUWA 2DCMA 4YP0A 1IH8A 1BEUB 4RWZA 4DN6A 1ZDMA 1RJEA 2I6GA 2W4MA 5JQGA 5ALTA 3UJPA 2D5CA 1M6EX 1RXSA 3B1VA 3R6GA 4BZPA 3DTVA 5LA6A 1XN4A 2XF2A 1AMOA 2WHRA 2QRNA 4PQYA 1YA6A 3CLHA 1ZNZA 2P6UA 2O9XA 4CLXA 5EHIA 2WPDD 4KVGA 2R42A 1ZR2A 3UAXA 4ZWNA 2ZAYA 4ZOLB 3PR3A 4BQRA 2WF9A 1HOTA 4JHLA 1Y5RA 4ZICA 1FDWA 5KQGA 4FU0A 1U0OC 1EFAA 4X0RA 1TM2A 1IAQA 1V8PA 3MZ0A 4MTFA 4U7WA 4NS1A 4BASA 2HO4A 2COEA 4TKVA 2C77A 4A0SA 3NGMA 2YFQA 2YMQA 2DWPA 3U17A 3HBMA 4K88A 3FSGA 3IVAA 3D4NA 1VCIA 4AKGA 3W3AD 4Q9HA 3PWSA 1U0LA 3BKWA 2YV1A 3FNFA 4GOKA 2UUBE 3SHQA 5ALNA 4QDKA 1DOAA 6REQB 1NW3A 1FSZA 2Y6VA 1VE3A 1UKCA 4U9DA 1MH9A 1PYOA 4AYWA 2HMVA 3PXBA 2GJ8A 3WQRA 1L5NA 4FMBB 4URYR 3U4CA 1P4SA 5F76A 2JAPA 2BEUA 3O3NB 2QQ5A 1EGHA 3FKSA 4ZLDA 5TF4A 1PNVA 3N7UA 2FN9A 2M9MA 2O2IA 1ST2A 2BA0D 1V96A 3AGUA 1HKHA 1ZXXA 2PKYX 1EGMB 1W52X 1T0PA 5SZKB 1D1TA 4FHGA 3PHIA 5L3VA 3BC1A 5FV4A 3H13A 3JQFA 3JQ8B 4HI0E 4DR4B 1JEQA 1ZJ6A 5AW3A 1SCKA 3RI3A 2YUIA 3KU1A 2R7QA 3AB7A 1ADCA 2C4WA 1QIIA 1USKA 2IYOA 2CBZA 1H2RS 2P27A 1JYSA 5I5GA 1KEEA 1N1EA 3OZFA 1EKXA 4G8BA 1IBMI 1MTZA 1OWPA 3KQWA 4PLYA 2JVKA 4WLVA 3R7BA 5T4BA 3Q8KA 1XU7A 5A0TA 5TQJA 2PF4E 4U00A 3LY8A 1N5IA 4Z86A 1O6FA 1DJMA 1O3UA 1R6AA 2ZJOA 5L0CA 3GORA 4NPCA 1DC4A 3H0CA 3RKRA 3TBFA 1MABB 3TQOA 3PC2A 1QPZA 2Z2JA 5CNJA 5GADl 3WOVA 1EXMA 5L7WA 2X3FA 5TY0A 3PJEA 4NAHA 1U2PA 1M57C 1PFWA 3E1SA 1KEPA 4W5JA 3U9SA 3WYNA 3F74A 4K6OA 4Z7NB 1XMOE 1M66A 3E9VA 2JLRA 2AJCA 2EL9A 4F84A 2BKLA 3E05A 4U5DE 4K9QA 2IBSA 4KGDA 2KS6A 5GY7A 4BGIA 3THYB 4IR7A 3PXCX 2E85A 5DXAA 2CLDX 2O5EA 5K3BA 1E69A 2P5SA 3M85G 3TQCA 2BEKA 5E2AA 4C3BA 2ZREA 1NSTA 3MOSA 4DLRA 3IQFA 5KZMB 1TFRA 1NXWA 4FFOA 4ZYWA 4Y18A 4R8KA 4TRMA 1B0UA 2FRXA 4MRPA 1Z39A 4N0QA 1CB7A 1VG9B 3FI0A 3HQ4O 4YV2A 5J3JA 3AERA 5BW4A 3V6MA 1HNZI 3RWBA 2ZIXB 4C4OA 2V65A 1ORSC 3MQ2A 2HKVA 1X92A 1RAHA 4IDGA 4RF3A 3ZWPA 4PO3X 4RIIA 4YWJA 4JVSB 4CRWB 3PVCA 3UJ9A 4D4KA 1A9XA 4ND4A 3FNBA 4X1KA 4BO2A 1FP2A 4BLSA 1B16A 3GEHA 1N33I 4KAXA 3FFXA 4ZREA 4YP7A 4S1OA 1EEXB 1VP3A 4DLUA 2IYLD 1LPAB 4UFNA 3F1KA 5FLYA 3HFGA 1XMQE 3ZDRA 4I1IA 2YWDA 5TX7A 1ECJA 3IQHX 2DBZA 1PV3A 1T9HA 1YI0A 4JC0A 4TPKA 1QRUA 1U3CA 2XZPA 4P81A 4QSMA 3HUFA 1Z83A 1DJPA 4WX2B 4W8PA 5JY6A 2OK7A 5ICGA 5IJ9A 3KR2A 4IRMA 3ACBA 4U0JA 1FQKA 1UP4A 3RQGA 2AD5A 3A1NA 4Y0AA 1NBME 4DR3E 3ZG1A 3KHTA 2JGDA 3CRNA 5IWAB 4WABA 1QYWA 1N78A 1MQAA 3WGUA 4IUYA 1J0AA 3BH7A 3K0KA 7REQA 1OMOA 3H2JA 1U0BB 1Q1BA 2W5UA 2P0YA 1ORRA 2RH5A 3T1HB 3JD1A 2JGNA 4QTYA 3PYDA 1UWKA 2IGTA 2AFIB 1HR0B 2F4NA 1DO8A 3NV9A 4OQEA 3B6JA 2KE5A 2V7XA 3GAAA 1SZDA 5HVNA 3F4BA 4LMBA 4PNHA 2Q6LA 3RM3A 5LN1A 4JT4A 3T1YB 4A8JB 3IELA 3KTOA 4X7MA 1MX9A 1PZEA 4LZZA 1QHHA 1HT0A 4RO0A 5EN4A 1JPUA 1UBMS 1WDWB 1ZVZA 4Z7YA 3D3WB 1E2JA 3STHA 5FA8A 4LBYA 3L7YA 3NIDB 2H1IA 1DWUA 1XQ9A 4ECEA 3RSCA 5EJAA 1TPYA 3GLHB 5AXCA 1X7XB 2XMSA 1M1NB 1IJFA 2EQ5A 2VQEB 5K4HA 3K2QA 4G0PA 2VPQA 3L46A 5HWSA 5H83A 2J32A 2QYSA 2BMVA 2P79A 1OH5A 3FDQA 1B93A 5AJTA 3LU1A 3MRSA 4WESA 3EDQA 4JU8A 1ZD4A 4V24A 2J46A 1RZVA 4QUIA 5JLJA 1N2CA 1LW6E 4G4IA 4UZEA 2HFIA 3V4OA 4E6EA 1FJGE 2XRMA 3W05A 5CDYA 3UCXA 3ZW7A 1H6DA 4MWGA 1XTBA 3PTAA 4KDFA 3U9LA 5AH0A 1SBYA 4DSUA 4V0MA 2EGGA 2GUWA 3GJ6A 1RAIA 3WZLA 1U4OA 2HPHA 2Q4BA 1WXXA 3G8YA 3SHFA 1DKPA 5HOQA 4FM9A 1JLHA 3UN1A 1H74A 1TF2A 3F71A 2G9ZA 1WJGA 2ECPA 3QKSA 2IHYA 4I08A 1Q50A 2B1JA 3GCWA 2H4WA 1Z45A 1N7HA 3ZCVA 1TT5A 4K9RA 1KOFA 3SF8B 4JB0A 4OD0A 3RFFA 5FWYB 3C3CA 3O2NA 3C5CA 4P6VF 3UV7A 3EXFA 1Y5LA 5C7LO 2PUAA 3T1TA 2Q2NA 3MTDA 3ILHA 4XWJA 5H68A 4YRAA 1RKVA 5L6MB 3K0AA 1Y1SA 4PICA 1V74B 4BA1B 4HB2A 1D0SA 2PZMA 4RV4A 2B69A 4D6PA 2DJ5A 2PMWB 2XBMA 2YTZA 3MPOA 3MT9A 2EFGA 3K0BA 2C4VA 2J9VA 5KWIA 1VLLA 5FD8A 1M74A 4Y1EA 1EEHA 4HWOA 1LFDB 4RHEA 2XUDA 4FCVA 1II8B 3EB9A 1ZHHA 1RYHA 1VJCA 2NXWA 3W0LB 2O5VA 2XMCA 3KSMA 3Q7RA 2G9QA 2GOYA 4IDPA 1DKQA 3UK2A 5FOWA 2CUTA 4BQPA 3T3DA 5A1TA 5IBQA 4Q5SF 2W42A 4AIMA 5DM4A 4N4WA 4JLSA 2LSEA 4ZYYA 3DBVO 4G5RA 4IXDA 4ZEOA 3C3PA 3QE2A 1Y5IA 4Q66C 2WHYA 1D9ZA 5FBWB 1HNNA 4PHHA 1ZXLA 4BUCA 3O8CA 2XSEA 1FS5A 2X7JA 3MQ4A 1XTSA 3TZLA 4K86A 3I92A 2JLCA 4D44A 1KWKA 3OF3A 3W2HA 2HOQA 3CR8A 2D4AA 1MEOA 5JISA 5JS8A 2B78A 2P9FA 5CDFA 4IFEA 3MTIA 3MK31 1QVRA 2VC9A 1JB9A 5JY1A 4QPPA 1I1QB 3VPCA 3JAWA 5DRTA 3RSSA 4OIOF 1EP2B 1IM2A 3T7KA 3QYAA 4J76A 3AQBA 3H1FA 4TSKA 3K6KA 5EHXA 4ISBA 4KN5A 5DISB 2JGFA 1GFWA 3L93A 4QRIA 4F3NA 3RAEC 3D6MA 1E9EA 2FPSA 2V4ZA 2WR8A 2H17A 2QV7A 1LC0A 3DV0A 1E9SA 1EFCA 1V5EA 1DAHA 2PV7A 5FFNA 5ALWA 1Z0DA 2EKPA 5IX8A 4UPVA 2YMPA 3N6VA 3SXUA 4N03A 3BHMA 1UIRA 2IRWA 1QJ4A 3DP7A 1C7ZA 3GFGA 3W6UA 4PVDA 2JI7A 3FUWA 1CF9A 4YPVA 5LOVA 2WFLA 2WU3A 1YUNA 3HGTA 4LF9I 5C51B 1UOQA 3DZ8A 2VNSA 2QU8A 1JBEA 4HQFA 2NO6A 1S89A 5CRIA 4G84A 2D5AA 1V9LA 1SHKA 2V3CC 2VTVA 1DTWA 4DBZA 5KDLA 3TW4A 2FX2A 3EPRA 3MMPA 1W5AA 1SD1A 3QITA 5K20A 3VC3A 2GK7A 3OCYA 3T1VA 4ZVLA 3T0FA 3QBEA 3QVMA 1UBRS 3KE8A 5JARA 1GNQA 2QAGB 1DBIA 4R40A 2Z2YA 5H81A 4W1PA 1NG1A 3T5PA 3U44B 2O50A 4BBAA 4YALA 4EHHA 3JPWA 1ZD8A 3MS7A 3NR2A 4L15A 4BYGA 3NASA 3D6AA 3LT5A 2R05A 2NT3A 4B7CA 2FZCA 4NFLA 3DQPA 3DPSA 2D54A 2CNNA 2NUAA 1FYWA 3NJ4A 4CIHA 3ESYA 4IOKA 4KXMA 1RMTA 5KYKA 4ACBA 3R5HA 3M79A 3KEMA 4NZMA 2RI0A 5AI8A 3W9YA 3GU3A 1UF9A 2L82A 2FZ4A 4JI2I 2FJPA 4RMNA 2YV5A 5ANRB 1UJ5A 3FUUA 4NEHB 2GDCA 4E0BA 1CY2A 1ISSA 1QYIA 3DFIA 1KI7A 3HKBA 5LP6C 3QY0A 3NTRA 4QPZA 4IV0A 1TKBA 4MUFA 3RREA 1E2NA 1A4XA 2DVMA 3AHDA 5HRUA 1O2DA 1IPHA 4D96A 1EAYA 1UPUA 3OHMA 4I99A 1ZUNB 3W3AH 1X7WB 1KIAA 4D9CA 2IYXA 1BDJB 5EIEA 5L3ZA 1TIKA 5FTMA 1E9DA 4S04A 4CQNA 1ESNA 1CZOA 3OWHA 1E4YA 4OBWA 3UWKA 2ORVA 4KFSA 4FHFA 1DX4A 3TNDA 1PJRA 4AICA 2FDCA 3HDYA 3KKLA 3SJUA 3NC1C 1G2PA 4ISAA 4CV3A 3AW9A 2PG3A 2C29D 1J8VA 4W4TA 2A5DA 1YCFA 4Y30A 3C7TA 2X8JA 1G21B 3M5CA 3NM6B 2X9LA 4Y6OA 4P3PA 2H9YA 1XL1A 4LXTA 4L5AA 3NWPA 4G41A 4L9SA 5AC4A 1IY1A 1CPQA 4DR6B 1SUCA 4ZA2A 1YVEI 4EA9A 3P71T 3LD9A 3WDKA 3IKTA 3GODA 1E1KA 4PS0A 1FFWA 4H17A 7MDHA 1JWBB 1PR3A 2R6AA 4G4JA 4R1TA 1HYHA 2FE4A 3OG9A 2H0RA 4GDMA 1G0NA 1XI2A 2QTFA 4B3IA 3ZLVA 3UIEA 4G7HF 2FCRA 1CDEA 3OZCA 4DV0E 1KARA 4Q1EA 4DE5A 3QW2A 2V7EA 4TN5A 3O75A 1JKXA 4AG3A 1T4CB 3D7LA 1W581 2YY5A 4FW6A 1XJQA 3PUWA 2MSCB 1YVPA 2NN6E 1PGJA 3PL1A 4IDNA 1QG6A 5CB8A 2J5XA 2DBQA 2G4CA 5AVVA 3HP1A 2WWTA 2HV6A 1RI5A 3E35A 2FPRA 4ZCQA 2QGNA 2YL0A 1Z2OX 3R0VA 2GPTA 5A7HA 3QF4B 1E1RD 2MR5A 1ANKA 4M0FA 4AWAA 1VA5A 4H7EA 2QD4A 2PUFA 4WJLA 4OKSA 1FMTA 3UNXA 5JYBA 3V5XA 2MMCA 3R8CA 2X8BA 2R1ZA 4QBIA 4J1TC 3DMYA 1Z7BA 5JVEA 4S1PA 2J1LA 1N2HA 2DWQA 4PSDA 3O0DA 3VM6A 1XQVA 1Y5MA 1ZUD1 5K03A 2P9EA 2QKYA 1CS0B 3ZNPA 4WZAE 1SU7A 3CBQA 3U19A 4HACA 1YOVA 5DNWA 1KU2A 4K0DA 4E2ZA 4DAEA 4KB5A 1G41A 1XBTA 3JTMA 1AUOA 3AILA 4NFSA 4H6PA 4YGXB 4C01A 5FIUA 4WLOA 4ODIA 1CE8A 3KSRA 3M9LA 3ZC4A 3A04A 1TQ4A 3EXIB 3SYNA 2RC6A 3QPDA 5LC1A 4JIGA 4CKEA 4MTCA 5KQSA 3FYUB 2I3BA 2J4FA 4TWRA 3EFBA 4P9TA 2ZKLA 3E5HA 2OGZA 5IN5A 4M6WB 1TQHA 1L5LA 3QKRB 4HQ0A 4Z4FA 1UC5B 1M1YE 4HQOA 2JIQA 1Z8NA 4N6CA 3QT8A 2HNKA 5A9SA 4G9BA 4M8KA 2HIGA 2YWHA 2WYOA 1BNCA 2AFHA 3AVUA 2VRCA 4BLVA 1TYEB 2C5GA 3ROXA 3A0RB 1CUZA 1B8OA 4YREA 2VSQA 3UMKA 4MRSA 2VASA 4QTXA 4FGLA 2GZ3A 1N1CA 1JQLB 3G9UA 4ARCA 1O96A 1R4TA 2ANCA 3LTOA 2CZ9A 2YVLA 1DRVA 2IYVA 2G3YA 4F71A 3MYYA 3W2FA 5JNUA 3RWMB 2FJUA 4YUAA 2PZEA 1DO2A 3FOAA 1Z82A 4RPLA 2Z6UA 1OHHA 3QLUA 5A3VA 4YO7A 3AY6A 5BUZA 2MSWA 3Q7LA 3E8MA 4EJSA 1H2WA 5ITWA 4KYVA 4ZVPA 3IPAA 2P3SA 5ER6A 2VTKA 3Q9UA 4CDRA 3K1JA 4CN9A 3MAGA 2WSYB 3Q7PA 1E79D 4PPQA 4M60A 3SX4A 5LQJA 3OIGA 3IP1A 1L6IA 2R8YA 3BMCA 4F4BA 1Z5PA 2V7UA 1UK7A 2W7TA 1VLZA 2FTKE 2BR5A 1VMAA 1R0BA 1XYGA 4JQSA 5CA1F 4Y2JA 4AJ9A 1SHTX 4K3VA 1ETUA 4WXMA 2GPWA 9ATCA 5CVDA 4E14A 3I30X 4B47A 5AK5A 1ISFA 1JFLA 5C9ZA 4XR9A 4JJ8A 3F0TA 3OZSA 2EZ9A 2XLHA 1EINA 3ZS8A 5C4MA 2Q4OA 3RU9A 4Y2SA 5C5EA 4B7UA 4G5XA 5EJ5A 4DIFA 1EZ4A 4KXQA 2O1EA 4B6JA 2WJVA 3RTAA 3LHIA 2G5CA 3IQIX 3VKHA 3WX0A 1QH8A 2ZI4A 5A4FS 2A1UB 4DQUA 3QFFA 4DPTA 1Z7YA 5L51A 3GNTA 3VO1A 5YASA 2XL8A 1X8XA 5CB4B 1N2EA 4D4LA 1OZ0A 1VKRA 5B5SA 3SZGA 3PGA1 2CXXA 1XMVA 2OPBA 4OI1A 5B7PA 3CRW1 1X1CA 3EF3A 4HY3A 1DQZA 4A23A 4BO7A 5TPWA 2EBUA 3JD3A 2GZSA 2M1XA 3EF0A 1VHLA 4IEEA 2FMKA 4UASA 4Q1BA 1N9GA 1XZ8A 3PS2A 1IHUA 3BF8A 4E7ZA 4TV9F 3SS8A 3SXKA 2J8WA 4ARUA 4LHWA 5E3IA 3RUPA 2DMRA 2ZWPA 1YQGA 1ZJ5A 3W3ZB 4C0QC 5EMKA 2D0OB 1XD8A 1T24A 2QPAA 4MGZR 3HN6A 2ZRJA 1L8XA 2OXRA 5E3JA 1VGVA 2VP5A 1XZGA 5M3BA 3X1OA 1VBKA 3FPJA 6GPBA 4BNYA 5GJWC 2VJMA 4Q3EA 4FI3C 3LTEA 2ISSD 5HFAA 3KPVA 1PT6A 1PNQA 1PD0A 4MVJF 1YJ8A 2BBTA 4QEKA 4NTBA 4IJ5A 4J9VA 3IP3A 5EERA 5EE9A 4IGAA 3SSNA 3AEKB 3LDHA 1LA2A 2NV6A 3RU3A 3QX8A 5J2TF 1LSJA 1L4BA 1XB2A 1FUIA 2HR1A 3P52A 2J9GA 1S2NA 4ANJA 2D62A 3OESA 4WNCA 3FOPA 4PX3A 2EJTA 5IABA 5EHNA 2O1XA 1WG8A 4KSYA 4PF1A 2ZVDA 1Y98A 1Z5UA 5E2IA 4XFDA 5ALZA 4WFQA 3O1HB 6AT1A 2A9VA 4AZ0A 1XQWA 1K8RA 4QQRA 5E1BA 1FWKA 1TCAA 1NHJA 3OQIA 5DYTA 3NYLA 3ZWDA 2OI2A 4M1OA 3NYMA 5BWLA 2G9UA 2PKQP 3L0OA 1NI4A 1Q16A 1H2XA 4AURA 1OYOA 1SQ0A 4JEUA 5JH7B 3HNOA 5FJJA 5AVKA 3OZRA 1NWHA 2R7SA 1M7GA 4AT1A 1XRLA 3ZE0B 2RGCA 2PGJA 1U4NA 1E5DA 2FZ5A 2NZVG 2QN9A 1DU4A 1UDQA 5AVWA 2CVOA 4XQ0A 3S55A 5H4GA 3O9MA 4CM9D 1B8NA 1NZJA 5A5VA 4Q34A 3RJ5A 5FTWA 3GLGB 4JIOA 5JVDA 3DL0A 1WZEA 2IYAA 1EK2A 1Y4UA 3HWX1 1XKXA 2Q3DA 1VDZA 4Q7EA 5CFOA 1E1QA 4FNMA 2NSGA 3B3GA 3DFMA 1OY1A 1GU1A 4BS9A 4AXXA 2J4CA 4NMMA 3TB4A 2DR3A 4KTTE 5KX5A 5J2UF 3SXYA 4KE9A 2C1EA 3ZOZA 4P4GA 3JYYA 2IYQA 1ID8A 5BR8I 1XVLA 3WU3A 5K8JB 4OKNA 5H9VA 1KIFA 1OXTA 1MJFA 2B82A 3PTZA 4NQRA 1VBFA 2I9PA 2ZP1A 5ELWA 5DRPA 2V7WA 5AW8A 4XIYA 5CA1B 2RKOA 5AGFA 1WHSB 4XWAA 2LJPA 4GOOD 3TNJA 1U6IA 2H48A 1OE0A 3M8KA 4DQ0A 3U1VA 1LC3A 1R4NB 4ERXA 3HJNA 4U5FE 2O52A 3AJEA 3EGXB 2VJCA 3EW9A 1FP1D 1DEKA 4KPYA 3A4YA 3K17A 2FPMA 2HH9A 1AB5A 3CFYA 2DYRC 2NYVA 4PTZA 4AM8A 3ZH9B 1NVBA 4ZVSA 4HNVA 3EAFA 1KMQA 1P2TA 1NQWA 2WVOA 4HHEA 4LKOA 1EGQA 3DZFA 2DTEA 2C8JA 2PX8A 4FN4A 5HQ3B 2C3PA 2XTNA 1XNQE 4L74A 3NX4A 4M7RA 3LS1A 3LPCA 3REQB 4KZPA 1ZVJA 3UGQA 2IEDA 3M33A 3RHSA 5GOZA 2CJPA 5JIBA 5BMOA 2HSJA 5FEUA 3KXLA 4MJXA 2HQOA 2IYSA 2P2LA 3LP8A 5JO9A 4M76B 1D6SA 1KTIA 2IEIA 3W6PA 3SYRA 1Z3IX 1KR2A 1A9TA 5T41A 5D5PA 1AGNA 1WPGA 1Z4IA 3AUFA 2OORC 2UUCE 5KPDA 3KVRA 1R50A 3NBXX 3HMKA 3MWDB 3ILXA 1ZGHA 1KFEB 3H1CA 4W8GA 3FBTA 4MUEA 2ZT8A 4XPYA 2WJWA 1L5VA 1OX4A 4LHYA 3OFVA 3PFHA 5DK4A 2VDVE 1FCJA 3RBVA 2Q9CA 1F8GA 4R1FA 1SK9A 2ZFUA 1WF3A 4F56A 2SICE 3FMGA 4BO5A 4A8TA 3HXPA 2AHRA 2IYEA 1G9TA 5JP7A 3X1WA 2Y1XA 4WY5A 1U0HC 2REQA 4PZCA 3LPSA 3SLRA 4YCNA 3L05A 1NAHA 2C4TA 3MT7A 2BA0G 1NNI1 2WA2A 4PZUA 5FLEX 1A2BA 1LTHR 4F3TA 2DKNA 4GI3A 4CMGA 1K47A 4CV1A 3U16A 1CZUA 3UWOA 3W5CA 1CIPA 2H5EA 1IXSB 2VHCA 3H4MA 1M8GA 4QPDA 2W11A 4QDLA 4GWLA 4PPGA 3HXMA 2F48A 1KYTA 2X0JA 5U4XA 4DJJA 1JHXA 1Q57A 1DGQA 4O79A 1QHIA 4A9AA 1C3OA 3MBIA 1QZRA 3PIRA 4HX5A 1HLFA 4FTWA 3HYTA 3SVTA 4C9BA 2IDKA 3QI2A 1P7VA 3DMPA 5E8RA 3KVNA 1QF7A 3VR2D 3L79A 4PAWA 1Z0ZA 1GGVA 3F8TA 2Q4DA 2QN6A 3SHVA 2NU9B 2D2VA 2E9SA 2QROA 1I10A 2P9JA 1UKYA 1J2JA 4DUZB 4YQEA 2PCLA 3OJOA 4DJ5X 4P5EA 2FHSA 3T95A 1DBPA 3I9OA 3ZBTA 5BW6B 1X1QA 3T7RA 2HGSA 4B3RB 2EZTA 2DAPA 2QD2A 1JXQA 3CWVA 3ZXYA 2P2NA 2OBBA 2QR2A 3LYUA 4BMSA 3RS5A 3JQDA 5KNCD 2QMYA 1FU7A 3VGPA 2X3UA 5CIYA 2FQQA 2XCIA 1O4VA 2B4KA 2QXUA 4KIGA 3WDMA 1BE1A 2OAP1 1GRQA 4MJ3A 3KZ1E 4YUYA 3TLCA 3QTBA 2ZJ3A 3OMLA 1C9EA 3IUSA 2B0JA 5EKXA 3CKMA 1E3IA 3VYVA 2XE8A 3WXBA 1SKQA 2B2NA 5BR4A 2SNIE 5AK3A 2X2EA 2PUBA 4FYXA 3K1IC 3I04A 2FUG1 1BG6A 1U65A 5K6RA 2ZIFA 1TWAA 5IF3A 1N25A 3TUJC 1LD3A 5J9FA 4RVUA 3C5VA 2O05A 1D6TA 3LLMA 2B92A 2OC4A 2J3JA 1PL7A 4BFWA 3VKUA 1SU4A 1BJTA 4WAUA 3EVGA 4FJ1A 1TW3A 2PNZB 3ZW8A 1OWMA 3LXRA 5HR5A 4L5BA 5HKBA 3H6HA 4WZBA 2O3RA 1E94E 4P54A 3TR0A 1T1IA 4Z9YA 1GAXA 2R8XA 5KU7A 4IMJB 4JLWA 4B4DA 1WE2A 2GBLA 4P32A 2G9NA 1C03A 2J3EA 3A9TA 2JG3A 4IKOA 2HDOA 1ZHFA 3T5TA 4H1VA 2LRHA 2NMVA 2QLAA 1JE1A 4IZIA 2HEGA 5MHTA 4MJ7A 5JI2E 5KTKA 2AJLI 2ZUDA 4MMYB 3HKCB 3MRVA 3N6RA 3E3AA 5DYWA 2CDBA 4MUJA 4AI6A 4B33A 1WU7A 2MWQA 1ZXNA 1JHYA 3G0IA 3N9IA 4H4CA 4OUDA 3RD5A 5KQPA 2AUNA 2MSEB 1TCUA 3H6KA 3T06B 1NJ8A 4A6XA 1QAQA 3HYLA 4FB5A 3PDWA 3U2QA 1QM5A 1TZKA 3LVFO 5CJPA 1VE5A 2AOXA 2R7XA 1KZ4A 4K9LA 4OEHA 4QNRA 3KLMX 3RUIA 3T9AA 1U3GA 2HDNB 3OCXA 4U2FA 2BGTA 2QSUA 2AF4C 1T8UA 2J3MA 1RDFA 1IJKA 3CS3A 3S3TA 1LPPA 3IHTA 5EK0A 4LXHA 5D92A 4PLHA 4WE3A 3SC2A 3IHUA 4YLEA 4ZQIA 5COGA 4A4DA 4D5GA 2ZSAA 3QVVA 4FZJA 1P5HA 1AQLA 2G72A 1Y48E 4R2LA 1RKEA 4XASA 2PBLA 3CX6A 4HGPA 4RZUA 1R6XA 3FMIA 1XRNA 4ZVUA 1W8DA 1UADA 2J45A 3O38A 4BA2B 1DRWA 3QOWA 1G4WR 4IIVA 3INGA 3RODA 5C8YF 4GICA 3C8GA 2W0SA 2J9FB 3QVZA 2IXNA 3HTKC 2I7XA 5BYBA 5K3FA 4FGSA 4MIYA 1VYTA 3C6YA 1ZQ9A 1T36B 1G5FA 3SIPA 5EWLA 2Z2IA 1E0SA 3TI9A 4I55F 3QA9A 4BQSA 1HF3A 3BWMA 5J58A 2XH8A 1SC6A 4N41A 5KVQA 3I45A 2QN3A 4BDSA 1LJLA 4CMJA 1IBLI 1K8YB 2DF8A 4Q7QA 2BEJA 3X1YA 5HE9A 5E6SB 2B98A 5CMLA 4I4LA 3BFPA 2I65A 2FI1A 1OBVA 2BGUA 2X9VA 4C0LA 5KYVA 4BV8A 1XZBA 2DUJA 2F7SA 4RXTA 2AR7A 2AP3A 4LERA 4PLVA 3H5AA 3ES9A 5LWQA 2CXOA 1SUWA 2Q3BA 2B5OA 2OXTA 1U2QA 1J56A 5EXPA 4CLDA 5FNZA 4X71A 1RWVA 4R2WA 5DCWA 3GC6A 3MJDA 1E4VA 4Z1MA 1WSBA 3S8MA 3TRIA 1OC2A 1JDZA 2FW8A 4QDUA 2XB2A 1TYZA 3K2EA 2AG5A 2DZDA 4G9GA 1EE9A 1KRXA 3RIHA 2WWHA 4LY0A 3PHLA 2BJHA 4KH1A 1C41A 4XTJA 1ODIA 3ZV5A 2VQFB 3EH2A 3KKKA 2GHQA 3RQIA 1J0DA 4KQXA 1REQA 1MOQA 3WWEA 3Q41A 1Z6PA 4GKJE 1SVLA 1HFWA 4U7TB 3SGLA 2A6HF 5MF6A 4P35A 4TWBA 4X63A 5K45A 1WZNA 3IB6A 3PC7A 1CW2B 3UMGA 5DYGA 3T9DA 1EK6A 1X42A 4I1VA 4M55A 4GZ5A 1UZNA 4B3MB 4AX2A 3OOJA 4IG4A 4BKUA 2PD3A 4LMRA 4CTOA 1NXTA 2DHRA 4ZANA 3KLBA 4YRQA 3H99A 5FLXQ 1Z38A 3C39A 3OLWA 1NJFA 2EX0A 3KYJB 1DLJA 5JNSA 1XZJA 3DD5A 4HDKB 4YDHB 1QH1A 3V1TC 3IKJA 3G89A 2FGJA 4BAUA 5KOIA 3K0CA 4ZOAA 3MG9A 4C43A 4YAWA 1QGAA 1NVGA 1Z68A 1HNWE 4BNDB 3E27A 5EHHA 3JQEA 5FUBA 1UEKA 2ZM6I 4C03A 1QO0D 1ONPA 3TJMA 4BNZA 5BWCA 3BBLA 3DL2A 3THRA 1XCLA 3U3BA 5KWSA 2YVUA 4D9NA 2I6UA 2V6BA 3A3YA 4C0AC 4BV9A 1O9BA 1GFSA 4KRXA 3A1SA 1H69A 3IURA 4KIFA 3GNSA 3KUXA 2XCOA 5G53C 2FF7A 1UKZA 3CH4B 3ZNQA 1YKFA 4ZYLA 1ISGA 4E94A 1XEWX 1IZ7A 2J0UA 1X1SA 3TFWA 4ZMSA 3HADA 1H4QA 2OL4A 1OILA 4KUGA 2C95A 4USMA 3RABA 1ZGAA 2O4CA 2PKWA 4GXRA 5D3MB 1KPHA 1MT3A 1U2SA 2OGSA 4UBNA 3A6EA 1ZD9A 4L6IA 3WMEA 3B7WA 2XDAA 2OD9A 5IZCA 1LI5A 3OECA 4B6GA 1LH0A 4ENTA 4C0WA 4IYRA 3W5DA 4C4TA 1PV1A 4KBFA 2ZB7A 3N3BC 4C0KA 2IF0A 3PUXA 3E15A 4RTQA 4UNPA 3ADOA 1TUEA 3JQQA 2R1VA 3VBEA 4QM7A 5A2QQ 2WFAA 3C0KA 5D85A 4ID9A 4LXYA 2ODPA 3ETHA 4LZAA 4DDTA 4E5UA 2G1KA 3WO1A 1GPH1 5ITZB 2ORYA 3DGEC 3FPFA 2GPAA 1SD5A 4GE0A 3HA2A 3T12A 1HQYE 4KAAA 1RPZA 1N4DA 2R48A 4O2AA 5E1OA 1AHPA 2P3OA 3U4DA 1UZMA 3AR3A 4TWIA 1WDKA 4LOLA 3PUKA 3MBGA 1XCOA 3NLLA 4JZKA 3KL2A 1OFHA 2C9OA 4NHOA 2JZCA 3L4BC 5LP6F 2Q5CA 1X8KA 1JAZA 2OO5A 4RM3A 3NHAA 2WV9A 4NTFA 3B1JA 5HQJA 3K94A 4FWIB 1G6Q1 1C1DA 2OO7A 1ELOA 5ERXA 4DRZA 3CF4G 4LE2A 1QK4A 5DIFA 1N77A 4B3CA 3IJPA 3CO5A 4DY6A 2PUHA 5DGXA 5K0JA 1W9HA 1WSWA 1AK1A 4E1AA 1GGHA 4KHPI 4N6GA 3FFTA 3AONB 5EG5A 1KNQA 1CZKA 3BMXA 4EKWA 1VOTA 2G6TA 2P5TB 3OEOA 4RA9A 3SYMA 5CHEA 1SVIA 1D0YA 1XTPA 4KE6A 3OZWA 1IG3A 2J3KA 3QU2A 1G8KA 1J00A 4IUDS 2CD9A 3WQHA 2ZTUA 4AIDA 3ZJUA 1SUAA 2RKBA 5JDCC 4AL0A 5A69A 4R69A 2R5FA 1WBDA 2QQFA 2WDPA 3HR4A 1J5XA 4F4CA 4EB0A 1GR1A 4V02A 2CHUA 1W85B 2FLWA 2VPWA 2XS8A 1G7CA 3O1IC 3BDIA 2V59A 1RHRA 4ABTA 3BXPA 3MGBA 1UPXA 4JEBA 5EUBA 2ZR0A 1CQXA 2NG1A 5FBHA 3G2KA 3BJZA 4XWTA 3LGSA 4EG5A 2HF2A 1GLNA 2H57A 5K0IA 9ABPA 4PRLA 2QTNA 1KK1A 4QXRA 2F64A 2O7QA 1ZU5A 1E4EB 4HEHA 3NEAA 5DV9A 3V8EA 3THWB 2KPOA 3N8HA 1P74A 1HFJA 2BA1G 4CEHB 4BV3A 4WK2B 1H0RA 2G17A 4RIFA 2PN1A 2YWRA 1FQWA 4XIGS 3LQYA 1G9XA 4MYSA 1WGWA 3A6JA 1YQWA 5FBQB 4J4HA 3G0BA 2I71A 4ZXFA 4NMHA 1NVDA 3EOAI 3D2BA 4JOSA 4LC0A 4XCXA 3OE5A 3CSKA 3T4EA 4E33A 2F1KA 4LYJA 3CONA 5EWJA 3QT5A 5DLDA 2AQ8A 3ND8A 2A59A 2V55B 3UAOA 1KK2A 2G1UA 3EX7C 5EUMA 3ZHSA 1SWWA 2KBFA 1T9AA 3T7JA 3QELB 2M6RA 1WKVA 3G6WA 4G65A 3F5DA 2YL7A 5CYPA 1E5XA 4BNIA 2EPOA 1NMXA 4WRRA 2Y0BA 2G0NA 5AI9A 1BA2A 1U8FO 4TRRA 5FBRB 4UNQA 4JI0B 3VR5H 2AN9A 3ECSA 4YWQA 1SEVA 2VK8A 1SXJC 4B35A 3ZI0A 3A2NA 1STOA 1DFIA 4WLFA 5MDHA 2NVOA 1HE1C 3Q9LA 5KNCH 3ETNA 2Y67A 3JZAA 2OV8A 3AW8A 5E33A 2CNWA 2D1TA 2ZSFA 3X2SA 3IOCA 4RBNA 4R0NA 3OLZA 5HV9A 3AX6A 1EFVA 3INRA 2C4MA 4UARA 5H8WA 1ZIXA 2IYFA 3IB3A 1IG0A 2Q5FA 4X20B 4LISA 5BN3B 1GCIA 4PZAA 2X0IA 5AW9A 3OPQA 3OJEA 4KQCA 2J0XA 3ZJVA 2P2ZA 3L6BA 1LF5A 2XYRA 1H3FA 4C3OB 4IO0A 4UT4A 1AKEA 1T6YA 3IODA 5BURA 1YQQA 1BGWA 4BFVA 3J80Q 4WOKA 5LP6B 1PJ4A 2RAFA 5LR6A 4YXWA 4W99A 1O94C 2CF6A 2BSXA 1E62A 1UQTA 4HDQB 2FUNB 2ZB8A 4I9NA 2GXQA 4DR4E 5KNDA 1YGPA 1I4WA 1E3SA 2CLFB 3QT7A 1Y4DE 2A9JA 3O8BA 1TE2A 2PS9A 3HNKA 2P62A 1I5EA 3AESA 1E7WA 2D5IA 2Q6TA 4GO1A 5B7QA 4MV6A 2AVDA 4DWJA 1R0KA 4CDYA 5FFFA 4N5NA 3SR3A 4F3YA 3ZZ0A 4AO8A 1V8ZA 4BQEA 5H16A 3WRWA 2NU8B 1JJVA 3EBLA 3TD2A 5BOSA 1GR0A 2XXAB 2VQ6A 3IYLW 4YV1A 4P3KA 3D8RA 3D8NA 4KVAA 5K8CA 4B3TB 4UAGA 4CL8A 4F5ZA 5DGHA 5FADA 1KI6A 1Z73A 1W1WA 1TIBA 1TQGA 4TZTA 3K9BA 3ONFA 4BEBA 3WC4A 3GXOA 2BCJQ 1GV0A 3O2QB 1F2DA 1Y8RA 4IDBA 3EXG2 4BIIA 3CR7A 4DDKA 4EPYA 4DPWA 1N7JA 2R65A 4YH1A 4EP1A 2E4UA 3GGDA 1P45A 2ASVA 3A9SA 4YMLA 3GRVA 1X7ZA 2OESA 4HVTA 4ZKDA 1KAMA 4NE2A 4RMHA 1CJBA 3OCJA 3CLUC 3ZM7A 4C4ZA 2ID9A 3DHYA 2DP4E 1RPJA 1H8ED 1JJFA 2O4UX 5B1HA 4ARAA 2AX4A 2I2AA 3BTOA 2UDPA 3LLCA 4MVRA 3AXTA 4PR9A 3S7ZA 4OI4A 1W46A 5ARDA 2HK9A 3W7BA 2IOHA 5KYXB 4HYTA 5HTOA 3WRYC 2I66A 3WG9A 3HKDA 3F0NA 1CTQA 5JU6A 3ICCA 4MTLA 4TL6A 5LBUA 1AUEA 3HFSA 1N5MA 4DEXA 2WF8A 4M7WA 3KOWA 3FCYA 1LJUA 4D7AA 1P73A 4RE6A 3KPWA 2FN7A 4EYGA 2HKJA 1VFPA 1EG2A 5GAJA 3TEMA 3AEXA 4JLPA 4PSVA 4X1IA 1LPOA 1AQIA 3QTLA 2J08A 2DFDA 1RWNA 4GZ3A 2WKQA 1ECLA 2QN1A 4FI3F 1R74A 1FYFA 2MCFA 3EUWA 2ZVQX 4DB2A 1XRPA 4WHMA 2YWGA 1KSHA 5LBIA 3GMTA 3N0VA 4O4HF 1AUXA 2BTOA 1E0KA 1NY5A 2OM2A 2XWBF 3L8JA 3GRYA 5IAKA 3EGDA 2H7YA 3IDQA 3K9HA 4NFHA 1O6BA 3EDRA 1DPGA 3B2QA 2CN1A 4OM7A 1K3TA 4M63A 2JARA 5CM2Z 2XOXA 2C31A 5KDDA 1MA0A 3FY4A 1ZJ4A 1I7NA 4EHKA 4WVFA 1QYDA 3ZCSA 2Q5EA 2ICWG 1K8QA 1E3DA 1WUJS 4P4SB 5CFLA 1KDYA 3F7NA 2CZQA 4F2WA 4KMSA 5H7XA 5IWAE 1US8A 3T38A 4ALJA 1H4SA 2BI4A 4ZV4A