2CGEA

Crystal structure of an hsp90-sba1 closed chaperone complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEYEPLTKALKEILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKLLYETALLTSGFSLDEPTSFASRINRLISLGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
publication title Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 115
structure length 405
sequence length 405
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2006-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2cgeA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2cgeA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cgeA02
2O1UA 2O1TA 1Y6ZA 2O1VA 1USVA 1Y4SA 1SF8A 2IOPA 3Q6MA 2O1WA 2IOQA 2GQ0A 2CGEA 1HK7A 1USUA 3Q6NA 1Y4UA 5FWKA 2CG9A 3HJCA 3PRYA
chains in the Genus database with same CATH superfamily
4DOMA 4IQ0A 2XE6A 3VU3A 4PXSA 3R41A 1EP1B 2C8VA 1YA8A 2ZYSA 2C5SA 4DS3A 2WMOB 4YLEA 2OXCA 2HIGA 3U5ZB 1YKSA 2AN4A 3BDVA 3QVLA 1FNMA 2X13A 3RFXA 1X74A 1OLSB 1R6DA 1FTYA 1JH9A 3M0EA 4PHHA 3K85A 4LX8A 4EHPA 5D7NA 2O52A 2UUHA 2YR0A 5FX2A 3BMNB 2VSQA 2E5WA 2HYIC 2RHWA 2GVNA 3BZWA 1CUHA 3A6DA 1PSWA 2J6CA 3UCEA 1SMYF 3VM6A 2PZEA 3K4PA 1PFWA 2W71A 3K9GA 3K0FB 3MBGA 2AOUA 1RI4A 3AP3A 3M1CB 3AF1A 3SYRA 3OFJA 2DCMA 2JGAA 1A72A 2X0EA 4N5HX 3V7OA 1JRAA 5KYKA 3DE5X 2OSBA 4P6IC 5HIKA 4R8SA 3EGXA 2F1RA 4MH0R 5REQB 3CBQA 1T3SA 1PR4A 3Q3JB 4Y98A 1QWOA 1CB7A 1BNCA 3T0IA 2FFQA 3D3QA 4KO3S 2BVNA 2V1UA 2P1ZA 4ZT6A 3DZKA 4V03A 4YHHB 4B44A 1BDJA 2DWPA 4S1WA 3IXMA 4YH1A 1NQWA 5E3JA 1SNYA 5ICEA 4N3AA 4Q3OA 3G0CA 2C59A 1FRVA 1E8NA 1T2EA 2FMFA 4Q47A 1XV5A 3U7IA 2JIPA 5CB6A 3NHWA 3EEQA 3MWLA 2Z56A 4TS3A 4RWZA 1AV6A 1TT5B 3PL5A 3EW7A 3ONWA 3FNRA 3OZXA 1A5AB 5FR2A 1W34A 4MU1A 2Y1XA 2Q28A 4V0SA 2XKBA 3BMQB 3OESA 4LNHA 3AHGA 2W6NA 3ICOA 4MKFA 2VCAA 2Z5GA 2P3LA 1QYXA 1GDTA 2AF4C 1QQ5A 5TQ2B 3ADOA 2VJKA 2M6KA 5AM3A 3BRCA 1C0IA 4DQLA 1FU7A 2K7ZA 4ECAA 4PSDA 1M7HA 2AI1A 3SKVA 3WZ2A 3TI7A 5HF8A 1K66A 3Q3EA 3PNSA 2JHFA 2NLOA 2GJ8A 2B35A 1S2MA 2QLJA 1OYRA 4CR8A 1SH7A 1N8KA 3O91A 5LLDA 1UMCA 3FTDA 2DWOA 1KPHA 3USZA 4R1TA 4ZQFA 4CDNA 2BSQA 1QFXA 4YWHA 4C87A 2YWJA 3ABSB 4EZIA 3L01A 4WGFA 1YL6A 4XKJA 4GUAA 5J1TB 3VHLB 2VCEA 4QASA 3N86A 3PT5A 1MOZA 3IOCA 1SXJE 4C3DA 3M9LA 1N0VC 3S40A 4DPWA 4UVGA 3V9AA 2IXDA 4EY6A 5TC4A 3RW0A 3G5TA 1C3XA 1GFIA 3UYLA 4CLOB 1TDJA 5FA6A 5DLPA 1XYGA 4Q3AA 4MPPA 2ZJ2A 1BOFA 4HY1A 5C7IO 1XGKA 3IJPA 2BD0A 2ZI3A 4G1FA 1EFAA 2WAOA 1JZQA 3AVUA 4NMXB 3I92A 4NE9A 1TECE 2WNIA 4LYEA 4IFIA 1BMDA 4DXWA 4RJLA 1E4EB 3P0FA 3ER6A 5CA1A 4XB2A 1SK9A 4ZMRA 3MQ4A 4CTJA 3LDGA 1YI1A 1W4ZA 3ZGLA 2GLUA 3E22B 3W5HA 4QEDA 2IEGA 4FZJA 5AJHA 3LBNA 4EEXA 5FOSA 1HDYA 1XMVA 3QNMA 4UW9A 2YVQA 3NANA 1RAHA 4PCLA 5JDIC 1OTYA 4IARA 4TRMA 1J06A 4OHRA 1XPJA 4A15A 3S7ZA 4X62B 1PUJA 3PXAA 1LC0A 4Q9JA 1Z36A 1N0HA 1M5TA 1CDEA 5K36F 4B3TB 4N7RA 2PO2B 5J58A 3GPIA 2IUEA 4EY4A 1VDMA 3GUZA 1EHCA 3QBTA 3ZG6A 2FOLA 3ROGA 1XZQA 2QP4A 2WR8A 4A1FA 3HKDA 4LERA 1P29A 2H7VA 4BZXA 4EJMA 1QBKC 4IHJA 5D3ZA 5HFNA 2I6UA 3AEQA 4MVCA 2R86A 1MAAA 1E0KA 4GLFA 2I91A 5FBHA 2WZLA 1O5IA 2G7ZA 5MFPA 4KDEA 1VISA 3A7EA 1ENOA 1THTA 4DR5E 3NVKI 1AH2A 3ZV7A 4AY5A 1QMPA 2OLJA 1M1XB 3LUJA 1LDEA 1HT1E 2IDJA 3CXUA 2NQ8A 2OFXA 1YZHA 4OFBA 2JVKA 3U4HA 1T5TA 1J9ZA 4UU1A 2BP7A 2GD1O 3H4LA 4KPUB 5JRZA 2DKFA 2DHRA 2B8NA 3MLEA 1NIJA 5DWQA 2P6OA 3ZY4A 3GONA 4HDMB 2V8BA 3RVLA 2G80A 2I2CA 1ECJA 3AY7A 1FMTA 4ROTA 1JYFA 1Y63A 3GOHA 4P3YA 4WK0B 2ZJFA 3AM4A 4RULA 1VXRA 4Z9AA 2V5UA 1J5PA 3ZGNA 5EP4A 3AIOA 1T0JB 2H1FA 2ISQA 1XAJA 5FQNA 3KV3O 1ZVJA 2PO1B 3FPAA 3M49A 4MTOA 4IDNA 3FYDA 1NF9A 3R9WA 4GD3Q 3DBLA 1J00A 2BMWA 2QGFA 1RAEA 4N6GA 5JVEA 3ROEA 4G65A 5EZQA 3P3CA 3TN7A 3D1LA 2Y05A 1UM8A 4IDHA 4XDHA 1K88A 1I3OA 2FWIA 2Y3DA 4D9CA 5JTTA 3S1AA 2ZBRA 3B3QA 3KDPA 4OIRF 3WTCA 5K3EA 4OQNA 4DXHA 1QLWA 1QFYA 1LM3B 4AN0A 1OZAA 1PYOA 4N6HA 1GDDA 2AHOA 5J1SB 1OGYA 1MC8A 1RQPA 1UF9A 3HRIA 1JQDA 1AVOB 1RJFA 1VP3A 3RADC 3X2SA 3JY6A 3LT4A 2WLSA 3H2JA 4YJHB 5AJUA 4UARA 4TRNA 1WNTA 1S2GA 2A68F 4FW7A 4QBGB 1Z0FA 1GGKA 4DA7A 1YB6A 5ILQA 3YASA 1SIOA 1XQXA 2A1TS 1VRVA 3ZTZA 5B55A 3ESAA 4IIYA 4B75A 2W4IA 3D3EA 1IMOA 3HN2A 3FKQA 4MYCA 2ZOSA 2ZW9A 1SQSA 1XHLA 4NMHA 1HFWA 4FEEA 3WBKA 3TSOA 5FJIA 3G2KA 4POOA 2N1MA 2J7KA 1IUNA 5F3WB 4DV1B 4PQRA 1FMVA 5A0VA 4AG3A 3E18A 1OZ0A 3PGXA 3PITA 5A6BA 3Q8LA 5JEDA 5L45A 2KW5A 3EXIA 1DKPA 3SBEA 3UJDA 5G53C 3ISVA 2HPVA 4LYYA 5CVTA 3AM1A 5FI0B 1ZD2P 4Q3KA 3K32A 3C0KA 4IGFA 1CE8A 2HA0A 5B58T 3LECA 4A23A 2QT0A 3TSZA 4CCWA 2XADA 3T6GB 4JQZA 4XB6B 2H2DA 4JBLA 4QZVA 3VHRA 2NTVA 4V0QA 5DNUA 1KE2A 2V1XA 1Z7GA 1YDHA 1RAAA 1H1DA 1JYEA 3QVWA 1EDZA 2ZI6A 3NBYC 1J0EA 1IY2A 4DLTA 2JKZA 2QRUA 1JLMA 2FPMA 4NCNA 1P5RA 2PRYA 1HQCA 4GLLA 2XBMA 4AO7A 4NJEB 3H87A 4TYYA 5TPWB 4BMDA 3GHHA 4QIHA 4WINA 1T24A 2GHRA 4C0BA 1JTEA 4F97A 4C21A 4C14A 1SWVA 1N3YA 3IDFA 1V9LA 2FJUA 3IVMA 4CX9A 4ZICA 3CVJA 1PNOA 4D80A 1G3UA 2VH1A 4L4YA 2F43B 1X1QA 4G24A 4IZKB 5TARA 3KPHA 3FZGA 4IS2A 3LX6A 2NVWA 3FTEA 1Z2CA 4Y9DA 5BWNA 4ZT7A 1REQA 3KZMA 4MWDA 4PTZA 2WVAA 2Z04A 4KO4S 1T2FA 1KQOA 3JV7A 1J42A 5LQKA 1MNDA 2HJWA 4RE6A 1H4QA 1OILA 1EZZA 4R8KA 4KGXA 1VLMA 4BB5A 3SNHA 4HQOA 3DOHA 2F1HA 4LPSA 5DDIP 1A9SA 1RZUA 2IXGA 2RGGA 4EVIA 2X1HA 3EOBI 4RJ2A 1Z0GA 3IXLA 3TOXA 4O7GA 2HYDA 4X45A 1DG1G 4LFCB 3O4GA 4G4JA 2AE1A 4IVNA 2E87A 3D54D 5IWAI 2L7AA 1V74B 4NCAA 1PFKA 1BE6A 2GHIA 4EG6A 3W8IA 2CVOA 3ANMA 1LFAA 5HIAA 2BRUC 4U9UA 2A9QA 1CUWA 3EOZA 4CW7A 5JSZB 4MI3A 1M2OA 3M1AA 1YGYA 3ZE2B 3OU6A 4DR3I 1L5NA 2H59A 2Q99A 3WWZA 3O1IC 4N48A 4OK6A 5HM8A 3ZLJA 1RHUA 3IQ5A 1OIVA 2A94A 3IMGA 1H93A 3P0EA 2FWBA 4O5AA 5CHYA 4X6XA 2CXUA 1AXGA 3KEQA 3ANTA 1X38A 3PDHA 3IV9A 2O5RA 3ZWAA 1UPFA 1TLFA 4D79A 3E5HA 3L8FA 3QMVA 3AC0A 3HUUA 3TDKA 3LX4A 4D3FA 4AS3A 2HMZA 4PX9A 5B5SA 1NU8A 2GN1A 4RIFA 2JARA 1ZCAA 3ITFA 4IIJF 4XTRA 3VX3A 2BEJA 5CIYA 2QA5A 4ZYVA 4WZBA 2B36A 1HDEA 2OKGA 3OOHA 1RQLA 2NP7A 2XUGA 3LWBA 2O50A 5DLQC 2CXPA 4DHEA 2A86A 4LXYA 4HXYA 3SKXA 4QELA 1MHTA 2ECFA 2H5JA 1VG9B 1GAWA 2JEBA 2Y3BA 3AY6A 4P52A 3MTBA 4OV6B 4X64E 3BEHA 4XX0B 4BQRA 2WW4A 4YQYA 2Y0DA 5CEFA 1NQTA 1UBJS 2L6HA 1TEVA 3FDZB 4D8TA 1YIOA 3VV2A 2X0CA 2VPPA 2ACEA 4K9KA 3EXHB 5L7YA 2HT1A 1T3GA 1M3SA 2YYSA 3B2QA 1WW3A 3INNA 5FO1A 2IZ0A 4CNBA 3HYNA 5DXJA 1WUUA 3ZHQA 1ZVVA 2HFKA 2H1RA 3AY3A 3NFYA 4ZO9A 4LSWA 2B20A 2RHOA 1KI7A 1FMCA 4NATA 2X41A 2LD6A 2EG9A 4QFDA 4RZ3A 4AROA 1BJKA 2Q5JA 1YRYE 1TD1A 1LI7A 2R44A 2PMWB 1WHSA 2VSFA 5A4JA 4LF8I 1E1NA 2O0LA 4RA6A 4KCGA 3RS7A 2I7TA 4G0ZA 1NI4A 4PIVA 1YQQA 2RC5A 1MOPA 3Q8KA 1YHCA 1K68A 3BC1A 4A10A 4U5CE 4DSOA 1N2GA 3ZIAA 4YIKA 2AQ8A 1CR6A 2J30A 1TFKB 3O95A 1QYIA 4LGMA 4WNCA 4N40A 4KXMA 3IT1A 3CT6A 5ITVA 2AGVA 2W0SA 4EK9A 1Q7CA 4W9RA 3EIFA 4QYWA 4ZOAA 5AK4A 2TYSB 4EOGA 2ATEA 1QAQA 3U1BA 3ZC4A 5LQAA 3RM3A 4BBJA 1CUAA 1KTMA 5J5VA 1SCNE 3RSSA 4IFDE 5CLIA 1F8YA 1PUIA 2J9UA 5KYTA 4IWBA 3MTQA 3DBHA 1E96A 1QPUA 3WL6A 4B7CA 4ANFA 2HCJB 3SEAA 3I30X 4U2BA 3ASUA 4WT7A 3FWHA 3KWMA 4GNRA 3H11A 5AIAA 3KQTA 4BNJA 4HUQB 2D0IA 4L5AA 5A62A 1XF9A 4TWZA 5DU2A 3A3PA 5IHPA 3WQHA 4PANA 3A14A 3V7WA 1WOLA 2RGNC 3W4KA 2ZDGA 3B6MA 2K2WA 2WIAA 3KKLA 2ZUEA 1DMSA 4I2VA 1VE7A 3IELA 3BMNA 4ZO8A 3MILA 1WSBA 3UT5B 2HTFA 2CXXA 5B3KA 3ELDA 4R81A 4OD5A 3P2YA 3DMFA 1Z4QA 4LTMA 4KWTA 4JI6E 4JODA 3P8ZA 1P5HA 3H65A 1GN8A 4C20A 2Z2KA 1K4KA 4B48A 3J06A 3KJQA 5CFMA 1FRNA 4IILA 4Y6SA 3I3SR 2DOKA 4I9FA 3A70A 4X84A 4ESEA 4UDXX 4RW0A 5FF9A 3OSUA 3QVYA 1MENA 2I3DA 2FP3A 1M6HA 3GMEA 4E2YA 3HKBB 2V3CC 4RY8A 1MAVA 3CUKA 5REQA 3CMCO 5EJ6A 5IFKA 4Q00A 2QLAA 2YKGA 3IUBA 1ZK1A 1KFEB 2NYRA 1CHDA 4OY3A 4ND2A 2ERXA 1UK7A 5HS6A 3FPKA 4B3BA 1X87A 3WSTA 2F7SA 4I14A 4E4YA 2ONJA 5BOSB 2BW0A 3H5NA 4D45A 1AM4D 2Z4RA 2BJVA 5DASA 2AW5A 4ZV7A 4D3ZA 1X1CA 4S0XA 2JJ8A 2F59A 1Z38A 3DUWA 1V5EA 4J91A 4A6PA 5D01A 4OSOA 3CTMA 4Y2XA 1VLHA 3JRTA 3ID6C 4JOQA 4QYSA 3EFOB 4KZPA 2WTXA 5B1AC 2FOXA 1P7WA 1SR8A 4L51A 2Z57A 3UC5A 1MRSA 4REOA 4I81A 3TTSA 3V7FA 2CHFA 3HCDA 4Z4FA 3C3YA 5TQ2A 821PA 4RHXA 1N0UA 5CW2A 2X7JA 3G8BA 5JIBA 3M4ZA 4DR1I 4K7JA 3NHJA 2ORVA 5IK2A 3UJ9A 1ZNXA 1RKCA 1GZ6A 3QOFA 4ALMA 2VZ9A 1KHHA 1FPQA 1KEEA 3GXBA 4FZVA 1TE2A 4PGFA 2N47A 4HUTA 2F3SA 3KEFA 3NCTA 4CEIA 2JAHA 2NUTB 1I9CA 2H3HA 4MQBA 2QMYA 3ABIA 4FNAA 4C2UA 4PYJA 2V6MA 4OIFA 3TZCA 1KIAA 1I5RA 3ESRA 2IELA 4R1PA 2BA0D 3LT1A 4XPYA 5EE9A 3L0YA 2BJWA 4L2IB 2YWDA 1CJUC 2XXBA 3JAMC 5CEJA 1RM3A 2ZWVA 3A4VA 1W6RA 4HN9A 1WP4A 1SCIA 4Q4HA 1BR1A 1JSLA 1NNSA 4DV6B 3WJ7A 3AJEA 1DIRA 3PFGA 1U1EA 2FMIA 3I4FA 4DADA 1SC9A 5BQ5A 1HNWE 2OG1A 4TLLB 5FYDA 1QFZA 1DOHA 1EVQA 3F96A 1H3NA 3SS9X 2AV6A 4YDSA 3OUUA 3WBFA 4MVJA 2UZ3A 2XGOA 3AUSA 3GAMA 3EIHA 1O97C 5E1BA 4EDHA 4RACA 5IVKA 4JI8I 1Q0FA 1OF1A 3QHPA 3PVSA 4DLKA 4B7UA 1X7DA 2H9IA 3CR3C 2X0NA 2IU6A 3IEMA 1E4EA 4HC4A 1GGFA 4L0MA 4C05A 1GCIA 1UT6A 3DFMA 2NN6F 3HS3A 4UVEA 3RVDA 1P7VA 4RJTA 2FQWA 2EW1A 2NXCA 4QOSA 4XFJA 4G7ZF 2MSLA 1K04A 3EGXB 3QNUA 3PHHA 3RSCA 5KJ6A 1HURA 2HPAA 2Q46A 3O93A 2FWJA 1ORVA 4FB4A 2ZPUA 2R1UA 4Y2QA 2O2YA 2OV8A 3GGCA 3GLUA 3P97A 1JKJA 2EOAA 4QPPA 3O8RA 1JU3A 3K66A 1DAGA 2CMKA 2QF7A 2VQDA 1WE2A 2Z15A 1EX1A 1ILEA 5LKAA 2EX1A 3TQHA 2XUFA 4BQFA 2PMFA 3IA7A 2O1UA 4BKQA 2ZATA 3FBTA 2VYFA 5HF5A 1JAFA 4TTRA 4QDKA 3B1JA 4JT8A 3ZNNA 1F06A 4PS1A 1DXYA 4PZYA 1APCA 2WJAA 1L5OA 4HXEB 3IP9A 1DKQA 1KR2A 4HLNA 2L6FA 3A2NA 1XO1A 3IE0A 3WWEA 1A0BA 1ZH0A 2M6LA 1AS0A 2LRHA 1E9VA 1VJGA 3AFMA 4D81A 1DWQA 4BLQA 4HRYA 3ATPA 4CTKA 2GJKA 1UMCB 2DFVA 1NHJA 4DBVO 3NC4A 3QELA 3OX4A 5DSTA 3A4IA 1IK4A 4P33A 3TBFA 1ADBA 1KGSA 1FSPA 1V3QE 4ENVA 5GMDA 2PRZA 2J0UA 3UMCA 2VJMB 2HREA 1U9IC 1SU6A 3HU2A 4MUHA 1GSHA 3LKDA 2EFDB 4LF6E 1B8NA 2A0XA 2O1XA 1DWPA 3A6KA 1FS5A 3AFGA 1P77A 3RPEA 4MZDA 5CXUA 3DMGA 1C41A 1XTZA 4ZZ0A 4ENUA 4S12A 1JWAB 1D3AA 4QGAA 4I9GA 4ZEOA 2HHJA 1TU3A 4LBVA 5DRTA 3HCRA 1JKMA 3A6EA 2FXIA 4AP9A 3KQPA 4MVQA 1IHOA 5C3MA 2X7HA 3GWZA 4LJAA 3WZMA 2UDPA 3WL4A 3E9VA 1Q21A 4D6XA 5FLYA 3HR4A 1WGWA 3TNDA 4HHEA 5FTLA 1XLVA 1Y3IA 2GFIA 1RYMA 4BKOA 2FW8A 3F1LA 1Y6QA 2J41A 4RA9A 4B4DA 2GAAA 3FVYA 1XJWA 1MVNA 4JK3A 1C9DB 3KETA 1JDJA 1Y89A 1Q50A 3MVEA 1RBQA 5AW2A 1V25A 5CXXA 4AJLA 2WI8A 1W2WA 2JAUA 5F5NA 1Z6QA 2FEAA 2I7CA 4TSKA 4YJHA 2PRSA 4UEWA 4EPVA 4MLZA 1BKSB 4ZC1A 4L3OA 3GM3A 2Q1UA 3WWDA 1UP7A 1J97A 3U2QA 1BWPA 4E6EA 4Z7CA 3GZJA 1M34A 1IWBB 3CLSD 2LGJA 2GJAA 2VRBA 3F90A 5DN6A 2YICA 3H97A 5GTDA 1AKUA 3RS2A 1QQ3A 3C7AA 1FB5A 5K05A 2EGUA 2J33A 5JJBA 1NW5A 4Y0NA 4ZWNA 2DJIA 4BPRA 4WKCA 1TO1E 5EMKA 5E95A 4UVDA 5D5PA 2DYKA 2OBXA 3F4KA 4G5SA 1E6CA 3K8OE 1Q91A 3LX5A 5EXPA 1QQAA 4DILA 3L4BC 2CVEA 4W1QA 4HF7A 5LOVF 2HRBA 1PJRA 3WU3A 2H4YA 4X8MA 4HXFB 3RVOA 1DX4A 1L4HA 3P52A 5B1DA 5LQJA 5JQWA 5ENDA 5F73A 3SEQA 4K40A 3HKDB 3U19A 4I8DA 1MFPA 2WVJA 1MB3A 4C9BA 4J4TA 2A2DA 3LPDA 4PPGA 4UTOA 1E1RA 4BV9A 5C8DA 3E05A 1Y5RA 4IL5A 2QR5A 3GG2A 4IHJB 2DFTA 3EPLA 2OBYA 1TWGA 4QLAA 2GVZC 4F1WA 3AEQB 3VNVA 3MYRA 2JBHA 4JC5A 3GRYA 4M0UA 1KMQA 1CNFA 2HGSA 1H6BA 2JD1A 1T8WA 5AJZA 5JNUA 2BH9A 4FSXA 4ZJYA 3NTRA 4ENSA 3KSAC 3JU3A 1AF7A 1HDXA 1QHGA 2BP7B 4PGMA 2E5FA 5H7XA 1Y9AA 3KO8A 2WIGA 2C77A 4MA4A 3IT2A 3WGGA 1GL6A 3GVHA 2JGJA 1TA0A 4OP1A 3OPXA 3CB2A 2PPLA 1TMKA 4XUGB 4XEKA 1JHQA 3OJFA 4WN9B 2PZMA 4KR7A 4F12A 1ZZGA 2HUNA 4G5HA 4GEKA 4QTUB 4N54A 4YONB 5J40A 3OEYA 4HB4A 1LV7A 2UUCE 4J6EA 1KQFA 3CNBA 1ZI8A 1RPZA 2QUKA 4A2PA 3CONA 3FMOB 1WATA 3CE6A 3LOQA 1PQYA 2QJWA 3NHFA 4DJ5X 5KSYA 1MRZA 2HBYA 5ICFA 3CISA 3NOVA 4DL9A 3DBLB 13PKA 2BTEA 1TQ4A 4ADSG 2NYAA 2R9VA 3LHKA 3AUTA 5HKKA 1EJ2A 2I22A 3LC0A 3S1AB 1JEDA 3JARA 4G63A 2XEDA 2ZE8A 3VGPA 4V0LA 4LISA 1D07A 1L5VA 2D7JA 9LDBA 1KH3A 1AF4A 2HDNB 4X91A 2W2LA 4EKDA 2HFSA 3DPSA 3CUWA 2GZ1A 2MSKA 1RRCA 5JS2A 4EX7A 2ODAA 4PAMA 3CUEF 3AIIA 3O8BA 2H1IA 1U28C 4G0XA 4CJXA 3O74A 1QNFA 1HR0B 3WK8A 1EKYA 4B3SI 1G5IA 1N2XA 1Z2PX 1CUGA 3IUMA 1Q7GA 3LUPA 3OU2A 3M89A 3C3MA 1EFTA 1SZJG 3STYA 2FEKA 2IM8A 2PL1A 2WHYA 3VKWA 4M8NE 1B0AA 4K2AA 1S2DA 4TQGA 1IRXA 1QVRA 4H08A 3Q10A 5F12A 1AHHA 1T43A 3I5UA 4XSVA 2XMPA 1RHJA 4ND3A 3WO1A 3CZ9A 1A7KA 1BE8A 1T6NA 1FRZA 2I15A 4YT8A 2OESA 1PK9A 3CVYA 1L5ZA 4QQ8A 2WC1A 2W0MA 3N7UA 1PS9A 2L9JA 2VRCA 2P9GA 3Q3CA 4DCCA 1JT2A 4N8EA 3L4SO 3WWYA 1RXUA 1UQRA 2CHEA 4YAUA 3UHFA 2RK4A 1L4UA 3EGOA 1ODJA 3ECAA 4B5LA 5F2EA 3RV4A 3BRSA 1CE8B 4UEJA 2XB9A 3B60A 4COOA 4E70A 4F85A 2RHDA 4MITA 4DRJB 5AOAA 2QNIA 4PINA 1OYSA 1ECFA 5HRUA 1L7MA 2GXAA 1KOJA 3CF6R 2ZTLA 3DSRA 2JAXA 4KYUA 2UYHA 5K0JA 1M2VA 4MCIA 4LFBI 1N2BA 3ZHZA 3FDZA 1JMKC 1SEVA 2PX0A 4GKBA 5EJMA 2I9PA 2TMVP 3DFUA 1XZDA 3DZHA 3IAFA 3ISTA 1XTPA 4X8LA 2Y76A 4MWBA 5DRYA 2DBQA 4IS3A 1W4BA 3RQFA 1ZCJA 3IBCA 5EQTA 1HC7A 1VGRA 1SBIA 2R96A 5FT9A 2X8BA 4IWXA 3OKFA 1P8JA 5A02A 3S27A 1LS1A 3UHOA 2QRNA 2PD6A 2D5CA 2RAVA 4XTKA 4BCBA 3FBGA 1REQB 2JI6A 4NARA 1KDOA 2J07A 1W7AA 3TNLA 1QAMA 1N6KA 2VZ0A 1CK4A 4P92A 4C4XA 2WPNA 4DA9A 4XR4A 5EQDA 2B98A 4EX6A 2ALJA 2V5AA 4LC0A 1UKBA 1H0RA 3CVOA 1QKKA 2DHEA 3BHIA 3E3MA 4DR7B 2FG6C 3CRZA 3ZHUA 2JZCA 2GEBA 2VR1A 1XWIA 1GKLA 2ZFUA 4LHZA 3UPUA 3EZHA 2PFSA 3KUDA 4ZREA 3OJCA 4XIIA 5K36A 2VJYA 1T2AA 1XZLA 2D59A 2X9QA 1NN0A 1ZVZA 1Z8NA 2JFHA 3JD2A 1UZUA 4CM3A 5GZ1A 4N0DA 4WESB 4LF5E 4WADA 2QYOA 2HDHA 1GKIA 10MHA 2A30A 2VAVA 4DDVA 1ORWA 3ZVMA 1PWXA 3TAHA 3T7TA 1U0SY 3Q3GE 3V1MA 3HU5A 4XOUA 4B2LA 5K6AC 2O6LA 3GQBA 4JJ6A 4CL8A 5DKFA 1M2OB 2W7TA 4G36A 2VIIA 1CDDA 1Z2NX 3UAVA 1NRIA 2FMUA 2BA1D 4UDVA 2I6FA 5AM1A 1W0JD 1FBNA 3RH0A 3HNKA 1PJ8A 1F4VA 4V0OA 3PS9A 1P33A 4FESA 4OOFA 1ZMOA 1MMAA 5A4IS 4WGZA 3A58B 1NR1A 3TDNA 1SXIA 1GNTA 3I61A 2VYCA 3D7KA 3LRXA 4XPWA 2GBLC 1RYDA 3PTAA 1SUIA 1E4YA 4UBOA 4QL3A 4RY2A 1Y1PA 4DGQA 4OQMA 4RDHA 2WMDA 1MNQA 1XNQB 3H18A 3H5AA 1JDBC 2I29A 5ALLA 1RBZA 1AB5A 3E3LA 4UZFA 1JHUA 5KKNB 3CUVA 3OLYA 4JT4A 3C16C 4C06A 3QNWA 3JR7A 4J16A 2OQVA 5DTMA 4WZBB 2ES4A 3O03A 3F49S 1W5FA 1EWYA 3ELUA 3RFCA 3U1VA 1KAOA 1N9ZA 1B6RA 4UHJA 3O0DA 4GKJI 3OZ7A 2HWWA 4WFIA 3WGJA 1WW8A 2BBTA 4JKYA 2JEBB 5B64A 2WE7A 3QJGA 5CB8A 3OP1A 3VDXA 4G23A 3JQDA 1KYYA 2QS9A 1PKEA 5EE1A 4MJ7A 1ICIA 4C2AA 1B0ZA 1RBYA 4Q37A 3I37X 3FKJA 3LQQA 3OHMA 4H60A 4FR0A 2ECOA 1CPQA 5I4IA 4JJ4A 1MG5A 4UMFA 3LPSA 4LMAA 2PF4E 2C9ZA 3R0ZA 4HAXA 3T3IA 2EZUA 1K6IA 3JZIA 2Q9BA 1GSAA 3RQGA 1NRJB 2CVQA 3I72A 3WHKA 1NFQA 3PI6A 1LB1B 1SVOA 3EFOA 3OIWA 2IV7A 5JCZA 2KS6A 3AG1C 5KYYB 5JS6A 3AW8A 4RFVA 4QM6A 1M72A 2QPOA 1WHSB 3TWOA 3LCUA 4EO9A 3QVJA 5LP6C 2DFLA 4RA6B 4PFQA 4Y9RA 4UCXA 4I4NA 3KUKA 3NHAA 1KY2A 4GKKB 2PH1A 4X85A 2WA1A 3BZBA 5LL6P 3MB5A 1YZGA 2OC4A 1DAIA 4O2RA 3L5KA 1FTGA 1R4TA 5LWQA 3DFIA 1Q11A 4GQUA 2GDCA 1YCFA 2VRWA 2PRJA 3HNOA 2BEKA 5F33A 3WSWA 3N2ZB 3CH6A 2JVIA 3D8TA 5M04A 1MD9A 1CB0A 1XDDA 4P9NA 5FA5A 4C3UA 2HV9A 2C92A 3NDPA 3PA8A 2Y1LA 2HK3A 4JH0A 2HC9A 1ZR4A 1DLIA 4L2IA 5HSGA 3V8EA 1FUIA 3TUZC 2XT9A 3EGIA 1HGXA 3G0GA 5IT9C 2J09A 3FB1A 4R9UC 4HB3A 2HIMA 3SX0A 2ZZNA 4HGNA 3OPNA 4NH4A 2P75A 1XCLA 4CKCA 3S81A 3CSUA 2ZVPX 2QVBA 3AJ9A 3PGLA 2V7GA 3FNIA 3H11B 2ZB2A 4HWPA 4NV0A 2BFOA 4JR2A 1XRNA 1ZW1A 3HL4A 3VVCA 1M0TA 1QRRA 4HH4A 4MW6A 5HJ7A 2FB9A 3ZOZA 2QN1A 3BF7A 2NO1A 3RKRA 4PX3A 3B6IA 4P5DA 4EPYA 4C29A 2A1IA 2J3HA 2EATA 4P6VF 4GAEA 4YC7A 1W36D 2W5UA 3OPYI 3DCNA 3EC2A 4ND6A 4KPFC 2X9VA 1NLUA 1E66A 5JALA 2BLNA 4R1LA 3DMTC 1ZL0A 1E0AA 4QJBA 1JHPA 1XAIA 3TK1A 3KDSE 2QDXA 1PL6A 4B74A 2BM8A 2WUGA 5E7QA 2QE6A 4YLYA 4C5CA 5KOJA 2EFHB 1Y6GA 3RS4A 1M2FA 1DE0A 2XVMA 1UWKA 1KZHA 2O0KA 1KBOA 1ODIA 2FR1A 3UK0A 5E1OA 3MLBA 4K9DA 5C0XC 4B6EA 1TADA 2J5RA 3MLAA 3AP1A 4G86A 3PB3A 3PU6A 3IRUA 2AG8A 5FFMA 3QITA 2AL7A 4MHOA 1AMOA 3TMAA 4LXTA 5AJYA 1Q0DA 2G8NA 3QU9A 3JZFA 3WGKA 5K0EA 1HE1C 5COQA 1QCZA 1D2MA 1JA9A 3OZIA 4A8TA 4ENQA 2FFRA 4J0HA 1FS6A 1QHSA 5ENZA 1UDWA 4CGYA 4EH1A 4OKNA 3HB7A 2PANA 4MRMA 3QWHA 4HNQA 1N36E 1DQRA 4C30A 3RFTA 1L0BA 4KP7A 1RZRA 5A2QC 2B5WA 4FOPA 1E2NA 1EFUA 5KWEA 5DW3A 5JANA 1KA9H 2I3AA 2FG7C 2HHHE 4OQYA 1OHHA 4YRFA 4JBHA 3ZUGA 1Z13A 4WGGA 1E61A 2XX3A 2I55A 2E48A 4Q7KA 2C2BA 3VH3A 5M3BA 3P0IA 5TMBA 4BO3A 3R3HA 1Y81A 3B9PA 2AMYA 3C5EA 2A0FA 3OZRA 4G85A 1S0UA 3GGOA 3LHIA 2ZUBA 2FKAA 1OLOA 1E3MA 1FJGB 2XECA 3UW3A 4FW8A 5GINE 4RJJA 3QFFA 1KEEB 1BVYF 2X6QA 4WXRA 1LH0A 3K5WA 1XTBA 4CEIB 2GCOA 5TY0A 4WAUA 3B8HA 3W8EA 1MGOA 2VL7A 3R9IA 4IIJA 1JSCA 4IJ5A 2RGEA 3FVVA 1N2ZA 4B3ME 1JXOA 1ZJ6A 1H8ED 4HQRA 2VJMA 3K6SA 4JTDB 4FUQA 1R0WA 1OC2A 2YWEA 3A1CA 2EEPA 2QV0A 2PKEA 1BQEA 5AVXA 3S8MA 3AM3A 1QGED 4NPAA 3IVAA 1LSOA 5ADHA 3FYUC 4MP6A 4Q4HB 1TFUA 1ZMRA 2HK6A 4NFLA 4YCSA 2IUSA 4G8JA 4R3UC 1UC4B 4LHXA 1Y1QA 1JEEA 4A2NB 4LBYA 1EE9A 4YK7A 2WJ6A 3KHTA 2YMQA 1ESEA 3FMIA 1CP2A 3EIEA 3A6FA 2I6TA 1UJCA 1X0XA 4MW4A 1OTXA 2ODTX 2JA2A 1OGJA 1VIAA 3U7EB 2Q0HA 4BQEA 4PV7A 3QTHA 1BHSA 4E22A 1P60A 4OMUA 3MTAA 4U00A 2QVXX 4R98A 4MWOA 1IZ9A 3CWVA 3ICQB 2BI7A 3F5SA 4R0VA 1CY8A 4FWTA 4PZPA 4TGLA 2Q4DA 1AE1A 4QXMA 4LDNA 2Y1KA 5E1DA 2BWJA 4EITA 3NHZA 1O08A 1NP3A 1R88A 2DT5A 4EHFA 3B6JA 4DJAA 2E9SA 2AYYA 9GPBA 3KNZA 1EWRA 2EX4A 4LSMA 2PX2A 2BFEA 2HHAA 3EVFA 3GJXC 2RGYA 2E49A 4EW3A 2UU9B 3TF5A 5DGIA 3UW1A 4K05A 4AU1A 1U0FA 3VR6H 3A1SA 3DDOA 3BFKA 1JKJB 5H3LA 1UFRA 2YV4A 2ICAA 4MRVA 4ZQHA 4EJ6A 4TXLA 1P0FA 1PT9A 3PYMA 3BD9A 1GAXA 4O33A 1RTKA 1OA0A 3CZMA 5IVPA 3DHEA 5DTIA 5FBKA 4DUZE 2B4KA 2FPPA 2Z8YA 4L75A 1PJAA 4EY3A 2VKQA 4GNKA 3PUVA 4AKGA 1Y33E 2AFVA 3PJGA 3WMFA 3MLGA 4MROA 1ORSC 2JZOA 2WU8A 3IAUA 2OY0A 2A88A 2G5CA 3DZBA 3R7AA 1DC5A 1W6UA 2VAMA 5HWSA 4QD3A 4QYMA 1IBLE 1LZLA 1YR6A 4EA7A 3FA2A 4TXNA 3T3DA 4JLNA 5EJ2A 2CUZA 2F2TA 1SULA 2ETVA 1NOKA 2GX6A 2WZQA 1Z28A 1QF7A 4QVIA 1H7SA 2C95A 4HDOB 4YUWA 1P2DA 2EIJC 5KJCA 1XWJA 1E64A 1X8LA 4YRNA 2Q1TA 3QELB 4IHAA 3BTUA 5B1HA 4WN9A 4EIYA 1EZ4A 3VNSA 1EXVA 4F1JA 4UT4A 1CNMA 5JUAA 1ULTA 4H35A 2J0UB 5A9RA 1EK1A 5C1BA 1V4AA 2XUZA 1PFVA 1FQKA 2BFMA 3Q41A 2QT9A 5DULA 3W9UA 5FFFA 1XNRB 5HZKA 1TM4E 2PCLA 3U9TA 3V1KA 3ZQ4A 1I7SB 4KC9A 3AU8A 4U1RA 1SGWA 3R3XA 4JI2I 4FMBB 4DIMA 2UUBB 1XLTC 1T0BA 3G8DA 4LYAA 2DI3A 2G7MC 3TDMA 1HDIA 1N2JA 3SFVA 3NKEA 3TGLA 3WJ1A 3R09A 3A4TA 1P0CA 5LU9A 4I1VA 1A7DA 3G59A 4DV7E 3PXCX 3VO2A 3P9IA 4TYMA 4BNUA 2EIXA 1COWA 4BV2A 1EP9A 1E2BA 5BUOA 4RA9B 2UYOA 5JROA 2Z5CA 1MA3A 1BMFA 4CR6A 4RL6A 4MTCA 4UXJA 4A1OA 1EWQA 1W2WB 3D9QX 4N39A 4X7BA 5F3DA 4O6MA 2D1YA 3D7NA 2P41A 1XZMA 2P8JA 2XD9A 3DOOA 2C4HA 2F00A 4MAMA 3NDIA 2QBYA 1FF9A 2HKJA 1T5LA 2XSEA 3L02A 1J23A 3GK3A 4Z0PA 2ON6A 4Z7OB 5HK9A 1Z0DA 1N33E 3VAYA 3ZHOA 4EKWA 4G01B 1M34B 3D0KA 3ZY5A 2HKVA 2ZUTA 4IQ4A 3FBWA 2R8XA 3HKEA 4LZZA 4AZSA 1EJBA 3PXUA 4BRUA 1W4RA 1W19A 3ZNPA 4JBIA 5DYNA 3Q3IA 3U8PA 4AICA 1L6RA 4H2DA 2IDKA 4U2CA 1TKBA 2I34A 1HWYA 2BHSA 4JEIA 1R8YA 2CUNA 1NF8A 1HH4A 3T3GA 1L5GB 2YWCA 4FD2A 7ABPA 4GYWA 5G4LA 5T4BA 3IQCA 3ZC3A 2GAJA 4DG5A 3FG9A 5TXGA 1E63A 2PWZA 3S1LA 1NMXA 3DQZA 3FR7A 3VTZA 3WJ2A 2RGDA 2QK4A 3F6YA 4NENA 1QGYA 3Q0EA 2J3MA 4UDNA 1IJBA 2YRWA 3TW4A 1ZAKA 4DUGA 2C3MA 2HI0A 3MJ4A 2XA1A 4IAOA 1AO3A 3M5WA 1KAQA 2ASRA 3IOEA 1XT6A 4W5JA 3LT5A 4DDWA 3RVZA 3A9CA 4HGYA 3SZ3A 1PS0A 3O6XA 3KXIA 4XDGA 2WJPA 2WU3A 3U80A 1MX3A 4Q9LA 3H3XA 3C7KA 4IFDD 1L7VC 3OQIA 3WLSA 4IH1A 2CYDA 2NTYC 2NN6A 1M8PA 4C3ZA 5CVJA 2R3VA 3WGHA 2JHCA 1K08A 4UM9B 4BPMA 3TE6A 1HETA 3HBAA 2FSVA 1YZNA 1R12A 3PC8A 2IIVA 4GU5A 4P4UA 5MGBA 2VA9A 4IZOA 3R5KA 1QU2A 4HX2A 3KM0A 4FJ1A 1ZGGA 4M87A 2G9UA 2I03A 3PKIA 4K6FA 3TEMA 4MR9A 4FNGA 4LJ9A 2L19A 4DJDC 3EH2A 4BIMA 2BGNA 3VXKA 1Y6FA 2WYUA 3A0RB 2FZGA 3BZUA 2UZIR 7GPBA 1QZTA 3D3WA 4BJ5C 3ZWMA 3I23A 2W2TA 3JARB 4WESA 4I2NA 3G0BA 5DBFA 4XD7D 1MC1A 1TTQB 3DKKA 3OE1A 4P93A 3A1TA 3LXXA 1O89A 4EJSA 4LRYA 4Z9JA 1AQLA 4ML3A 4TYWA 3G6KA 1NX9A 1XXHB 4FKZA 1FYFA 1HOXA 2ZZKA 3NU1A 5KEIA 3PQ7A 1CQIA 3L1HA 1XTVA 2FX2A 1UOPA 3EUAA 1G291 4JDUA 4IRUA 4ARSA 1R4MA 4MKIA 4F04A 4YV1A 5LSAA 3MMZA 1IM8A 1TCBA 4P4SB 2V8OA 4JUCA 1D0XA 3WDLA 1E2PA 3SQWA 3M34A 5KTSA 4UNPA 3FLMA 2FYTA 2ZWIA 3SVTA 2YINC 4IV0A 4FYJA 5HVNA 3U40A 1V3VA 1DUVG 2DUWA 3NXKA 5KNDD 1JALA 1E9BA 3GJ7A 2P5UA 1B6GA 2SECE 4B43A 4CBVA 2N9UA 3NTVA 4CG1A 3GEBA 1JIJA 3OJOA 1AK1A 1IBKI 4YRTA 1MPXA 3PR1A 4B87A 3LLIA 1R6UA 4PIMA 3H5IA 2D5IA 1Z2EA 3ZCPA 3LQRA 4ZYWA 1PTJA 3I8XA 1Z29A 1RLOA 3AERA 5FUVA 4F6RA 6AT1A 2R03A 1Z0VA 1I6WA 5TGZA 2C54A 2HJHA 4BVJA 1M2VB 3DKRA 2JF0A 4ZAZA 4L3WA 1SG9A 4JLMA 1DQSA 4BWGA 2W43A 4GBMA 2R6DA 2PJDA 3UMKA 1YA9A 4AXBA 4YHHI 3WB2A 4R83A 2IY8A 4DV5E 2CNOA 5AH0A 3EA0A 4PJMA 3E1SA 1BXGA 3P4UA 5KI6A 2R62A 3Q7RA 4OGKA 2BC5A 1CRLA 3R3VA 2XHZA 2LXNA 1D1SA 1OQAA 5FHRA 2QLFA 3OOWA 1E6EA 4YCCA 4MQUA 1U2EA 4XD2A 5KYYA 5I7UA 3OTWA 3I28A 4XYBA 4F2GA 2VQEI 3TRJA 5JSKA 3RUAA 4Y6QA 2PRKA 1SHUX 3KRNA 4EW6A 3A1WA 2CFTA 1Z26A 1CG6A 5A4KA 5IUNC 2Q45A 4XLZA 3NBQA 1L4FA 3PYEA 5L0IA 3FWZA 4F84A 1UIRA 3VKHA 3KQMA 5HJEA 5JAIA 4BMYA 4GR5A 3W8HA 1NU9C 5AP9A 1N78A 1Z4MA 4TRJA 4D96A 5ES3A 5K36B 2F3QA 5LOVA 2G8LA 1G2IA 5F76A 3T35A 1E20A 3SQLA 4OQDA 1ACJA 1EP2B 1E0DA 1BHJA 3U5TA 1B1CA 2XRZA 5E7MA 5B3JA 3TTVA 1AUVA 1II0A 2IYYA 3T1QA 1JG1A 5EVCA 3EEYA 4R4JA 4F06A 1CWUA 1M0WA 3GQBB 3VR5D 8ATCA 3Q7QA 2F9LA 3C39A 1P4GA 4M1SA 3GI1A 2Z2YA 5ALNA 5AOCA 2WAMA 5AKEA 4UNQA 2TMYA 1F3LA 2CE2X 1HNZE 2UXBE 3VH1A 3LW7A 5FPQA 4AMZA 2GN0A 4J7YA 2D3WA 4CQMA 2P9BA 3BRWA 2A69F 4C7KA 1I8TA 1OWLA 3B6EA 4JLSA 2J0WA 3CZ6A 2X8WA 2VQSA 5I5GA 2ZJ1A 2OCLA 3VPCA 3HZRA 1Z8FA 1L5LA 1WB5A 3MNFA 2PM8A 4KKXB 3AKDA 2HWUA 5LZ8A 2UUAB 2Q62A 4JIGA 5HRCA 1U0BB 2ZANA 4BO0A 3MMSA 1D1BA 1FWKA 2JJ2D 4FWVA 2R6HA 1P0PA 2J5KA 4K0KI 3U4CA 4DMLA 1X3LA 5BWLA 3M1LA 3T5CA 1PT8A 4MRPA 3VBCA 3NAGA 3K5HA 2Z9CA 1QVVA 4FYMA 3L7LA 1UPUA 3JQGB 1CR2A 4BUJA 2ZTMA 2EC5A 5CJJA 4FYPA 1JHOA 4FI3C 1LTHR 2PIDA 2OK7A 1ZSNA 3IEXA 1KYQA 4G5XA 2H7YA 2VHVA 4UU8A 3X1WA 2CZQA 3TQOA 1EBBA 3DDHA 4IINA 3S44A 1J2TA 4Q0MA 3JWEA 4E5UA 4B3TI 2OL4A 1ZRSA 4L27A 4ESHA 3I1YA 1QXSA 2FXVA 3BHMA 3ELYA 3L84A 1FDWA 1XF1A 1RM0A 3IERA 3QVZA 4CM7A 1GU7A 2H8KA 2GZHA 1SURA 4BVEA 1ST6A 4BMCA 4YMVA 1KDTA 1ZU4A 5ALZA 3IQIX 4QFBA 4N06A 3M2TA 3UO8B 1CFJA 3W3AD 2YNMC 4IHKA 1GUBA 1OPRA 3CAXA 4AJJA 2XWSA 1XQ9A 3FXHA 1VRWA 1WPRA 2W90A 4KG7A 1DIGA 4UASA 4WBNF 2FFBA 2Q1YA 3WAQA 1E2MA 4EUNA 3HDGA 2O7SA 1KEZA 3KOYA 1PR2A 3IEPA 4O4HF 1U0GA 4R8LA 1NBIA 1W1UA 1HFKA 4I9UA 2ACWA 3D5QA 2LK4A 4M8SA 2XCLA 4YCNA 3RIXA 3T3HA 4KNVA 2MR5A 1E2QA 4E7ZA 2HU8A 4AY4A 1INLA 3R5XA 4D9FA 2CCYA 4IZJD 2GEJA 1IQPA 2GVDC 2H85A 1V6SA 2C5FA 4DMHA 3L8YA 2PXCA 4CU2A 4BO7A 1E6MA 1QPBA 3OP4A 3T1VA 2R7TA 1DQYA 3QENA 1IB0A 3ZY6A 4JVSA 4CKCB 1XQYA 3OE7A 2I4MA 5FOXA 5L3QA 2RHCA 3D6VA 1CULC 4FQ7A 3NXSA 2VP3A 3HB0A 4AMYA 5KNCD 3PQDA 4K03A 5B3SC 3I58A 2YJNA 4I1MA 1SEPA 3AJAA 3C48A 2ZJ6A 5A69A 1YT5A 1GSOA 3R3YA 1CUXA 3AHJA 2P9YA 3TMKA 2EWWA 3OOJA 4G8BA 3IP6A 1X19A 3HVHA 2XUAA 4DUYE 4KE9A 1VECA 4LJ8A 3OCJA 3RVSA 2VFAA 2FWMX 1KARA 2PT5A 2ZS7A 4PZ0A 1E1MA 3WIVA 4A27A 4QUDA 4FDTA 4G0UA 4IDAA 3CW8X 4GO1A 2ANBA 4JSRA 3RSQA 4B5KA 4MUNA 1F12A 5KOJB 4NY3A 5DHPA 4WLVA 1LQUA 4FFWA 2PZGA 3MGCA 4DG9A 2L81A 3WU5A 4U3BA 4NQFA 5G0TA 3INRA 3OY7A 2G9QA 1CEYA 4UUPA 1UFKA 1QH0A 3CZ4A 2R6R1 4PONA 1B3RA 3ZHYA 2P0YA 1F1MA 3IAS1 4B2PA 1FP1D 3V2UC 1KERA 1XRRA 4PC3A 4MV5A 1V7QA 2XS1A 4Q4AA 3LC2O 1UDQA 1OXBA 3LKZA 3QPDA 2LDXA 1YH3A 2J5BA 2Q3HA 1S1CA 1V37A 3HG7A 4YMUA 1OU4A 1BD4A 1GTMA 2CXOA 2FPWA 4KC0A 5J23A 4LV5B 3AWDA 5NULA 2XL8A 3T1TA 4MRMB 3ZD7A 2V7VA 4C0AC 3UB4A 3TEJA 5TSDA 1QYDA 2RMKA 4YL3A 2WJWA 3ITNA 4GKAA 5EK0A 2GZRA 3CXRA 4URLA 1OMOA 2HMYB 4ZFNA 2X23A 4RTKA 1H1TA 3ZPXA 2MR6A 2GYVA 2O1WA 4HOYA 2BJHA 2O2CA 4OAQA 2P2CA 2AXPA 3LT0A 1KYTA 1PU2A 1P75A 3VYUB 3CZCA 3R0QA 3I9V1 2VF3A 1UXIA 3JAWA 1ZS9A 2AK2A 4EI7A 2GCOB 2C04A 4PC6A 3SZMA 2V0NA 4M1MA 4GLOA 4FNOA 4IIJB 5L4LA 3NT4A 4QJ3A 3I09A 4GL4A 5LB2A 3FN4A 3OF3A 3ZIBA 3K6SB 4RLFA 3U3BA 4IV8A 4W1SA 5BV1A 3ZZNA 3WGUA 1TJNA 3VNQA 4JI4B 3NIWA 1VYTA 4HN4B 4BO6A 3AZPA 3SBXA 4Z5XA 4IDBA 2C9MA 1GFZA 4BO4A 4DLAA 3QLEA 4IUYA 1GFWA 4F11A 4C3OB 3FOEC 2F1DA 4R16A 5EIXA 1HMYA 4RD2A 1NE2A 3A7DA 3VZCA 1OZFA 4ER3A 2FPIA 1N5RA 1P9NA 4WNYA 3D6NB 3ZDFA 1JBEA 3K3PA 4PN7A 4J1TC 1IWOA 3L7NA 2YMMA 1M2JA 4Y9UA 1I32A 4UDYX 1WXDA 2OCAA 1Q2XA 1MTZA 3DD6A 4KR0A 3H1FA 3FSJX 3FOOA 1AKRA 3W5IA 3D31A 2XNDA 2I1WA 1L5YA 3HYLA 1GNVA 2PNZA 4MJ3A 2D1FA 2PH5A 3KAJA 3TR0A 3KB2A 3WE7A 5EWLA 1V8BA 3KVNA 5H3HA 5JZOA 2J3QA 1LRJA 1RMQA 3LF2A 2NO9A 3E6AA 1K1EA 1HNNA 1MH1A 1RAIA 1FXWF 1LBTA 2BFEB 2WZBA 1B8VA 2H8AA 4F2WA 1YQGA 2FUG1 2PT9A 2ZSJA 2OMEA 4XXHA 2C4NA 5LZ4A 3VUFA 4Q03A 3EYWA 4M1YA 3CCBA 4ZVVA 1ZHTA 1YQUA 4P0PB 1IBRA 3GJQA 3VSDA 4GSKA 4B2IA 3PHIA 3IP8A 4L8GA 3O8LA 5A9TA 5GJWC 2INGX 4M1WA 1QLHA 2M64A 1QYVA 2Q7OE 4EYSA 3QVMA 2P67A 2FPPB 4LWZA 1SPBS 3LKVA 4M83A 1NVVR 4QDXA 1E69A 3FH0A 3DAGA 3GJ4A 4S2EA 3ZVLA 3OX3A 4QUKA 4X6LA 2VXYA 4P54A 5F35A 2ZYVX 1J5EE 5FI3A 4EG8A 1CUZA 3NM6B 4RNCA 4JAVC 4OYRA 1JIQA 4WZZA 1HT2E 2ZJZA 2Q3JA 1M0SA 2DBVO 2B2XA 2G0TA 1I3LA 1N4AA 1C17M 1E3LA 1EBFA 4YJFA 4QPDA 1O57A 1H2EA 2AH5A 4RK0A 5JMTA 5DE3A 2HAEA 2IVFA 1KY3A 3GLHA 5KYXA 3RCBA 1PYGA 4LK3A 5EPEA 4XQ1A 2RI1A 2R6CA 3NYQA 5D91A 2QYSA 2QVYX 3QHAA 4ZI2A 3H0EA 1XEAA 3MCWA 3L1VA 4OIMA 3FCXA 3M81A 1NHGA 3B1VA 4NYJR 3DKAA 1GA6A 3VO8A 4UHKA 4CM5A 4PBSA 1QE0A 3ITDA 1RP7A 2PSSA 2BGTA 4FWBA 3SI7A 1Z75A 3J81C 4MQ4A 2HA2A 1IWPB 4H31A 1L7EA 1FUUA 1O9GA 4UMEA 2RC6A 5GOTA 1RQ2A 2Z2JA 4DF3A 3W6OA 3WL5A 4RGYA 4LJYA 4MUFA 2XQGA 1BR2A 5A04A 3DL2A 3S2YA 5A9SA 2O5EA 4KX5A 2WMNB 3RKOF 3WLNA 2UZAA 4LNAA 3DKIA 1KMNA 4M0FA 2PNFA 3KTOA 5IHXA 3J80C 3GAAA 2EW2A 4JP5A 2YHIA 2Z5CB 1XXHA 4K9SA 4ETWA 3JYNA 3IV7A 4QREA 5T8KA 3FF1A 1CRWG 4S24A 4ICIA 3N2EA 4LCHA 1XA4A 3OMWA 3CINA 1H9CA 4P4SA 2QBYB 1VGQA 2VYVA 3MTEA 3DAFA 4O4LF 4OUKX 1E98A 4MO9A 3CLUC 2JB9A 3WHNA 2EHDA 4P31A 2V7XA 2R8EA 4ZOLF 5L9AA 2VSYA 1VA4A 1ABBA 2PDAA 3C3EA 3HKEB 2B92A 4LRTB 1LPAB 3LBYA 3UV3A 1GRRA 4B1FA 4WHMA 3U2MA 2X3FA 4G5RA 1PV2A 1G4WR 4M54A 2AG0A 3N8IA 4PX2A 2LCQA 1E2FA 3W5BA 2QL9A 4GI3A 3OTIA 2ZQ5A 3E9YA 2QR3A 4RS4A 1NL3A 2D6FA 3K4QA 1NSTA 4Z8XA 2ZIZA 3QPAA 3B7GA 3H8WA 3BE8A 4RGVA 3C43A 4C4SA 2O8VA 3F6RA 1Q57A 1J0DA 2NW6A 3IHKA 2QPLA 4NENB 2I6QA 5FRDA 4BP1A 2H11A 4MS1A 4MCJA 4KHPB 3GA0A 1CX9B 2Z8XA 4E5YA 3AKEA 4G5OA 4E21A 1LBQA 3U17A 2ZROA 2N75A 3CH7A 2JFYA 2HCFA 2HMSA 5EZYF 2J0QA 3SHOA 3N8NA 3PF9A 3GGPA 5ECYA 4F2HA 1XJQA 3AESA 4DW8A 2CL5A 3LCJA 1TCAA 2Z5BA 2QZ9A 3LZDA 2YMPA 4NBKA 3JQBA 4G25A 3OQIB 4G0PA 3L7DA 3D3KA 3EG5A 3LMKA 2I67A 2NN6B 4X8HA 4LJ5A 1H2BA 1QPGA 2JAQA 3NGMA 3QGMA 2A5GA 1YCDA 5EJ8A 1SD5A 1FJHA 3L6EA 4Y9TA 3EXHC 4IM7A 2UVDA 2C38A 3C3JA 5BR7A 3O83A 3IS3A 2DRIA 1IZ0A 1RWWA 6GPBA 3PDJA 4ZAYA 4A3SA 3BPSA 3PEYA 1BX1A 4MR9B 4TVBA 2OGUA 3DYBA 1DX6A 2Y6UA 4JXXA 3ZN2A 1P1JA 3KQNA 1RQNA 4JQSA 5ENVA 3RW9A 3FOWA 4NXMI 4USKA 1FDSA 1C7QA 1TRHA 4YAJA 1UJBA 4KKVA 3D3WB 3AFHA 5MDHA 3PLNA 4ZXPA 4OHCA 3LK6A 4LDZA 4M7PA 4PNHA 4JYPA 3E23A 4R7GA 5SZJA 5JNVA 3AVVA 5I4KA 1RPAA 4URZR 2LR0A 2VEDA 4EJSB 2WNRA 4F92B 3PHGA 2Y9PB 1XRJA 5EKUA 4J3DA 1ONBA 1HG1A 4ZRMA 2WU4A 4QHTA 3SHFA 3DZIA 1BFUA 1CQIB 1R00A 1XVVA 5ED0A 4KXWA 2APJA 2P4SA 4DV6I 4GI7A 1WBBA 4IRUB 1EBUA 1R4MB 4E5PA 3KTAA 4WA7A 2HZ8A 1XOIA 4E5NA 1NVWQ 2JHGA 4X3CA 2GCPA 4M0PA 4NK5A 2FN9A 1DUIA 3R9KA 1SPXA 5G0SA 1MB4A 3SF0A 4Z9FA 1FXSA 4C0JA 3LEVA 1TQ6A 1G3IA 1C7RA 4K7BA 3IDZA 5DIZA 1VL1A 1RKXA 4W8GA 3TCXB 1MO3A 3ZWYA 5I7SA 3CLTD 3QOXA 4KI0A 3UAOA 4KXYA 4R54A 4RCYA 2H2AA 2HNBA 3K9NA 3BE4A 4HFKB 1QVAA 4EHJA 1YRLA 5KWJA 1Q1BA 1Y42X 1OI7A 1AMNA 5KQRA 4AD8A 5I8PA 3R6TA 4FEGA 2I78A 1Y34E 2JEOA 5DI3A 5ILOA 2WMYA 2P7HA 3GRAA 3MS4A 1SHKA 3G0IA 1NXWA 2R05A 3STHA 3ZEAA 3JQGA 4DMGA 3UK6A 3FI9A 1XZKA 2Y67A 4IOMA 4B6RA 1LDYA 4MJXA 2O1VA 1PG5A 5AK3A 3PFHA 3AERB 4F6RB 3ZJ4A 5IT0A 2NN3C 3BF8A 4Y2JA 1RW4A 4ZK2A 2WYVA 3ZE1B 2GDZA 4DLPA 2IESA 3RIMA 4D8YA 4JCHA 1D2GA 1JHZA 4MYUA 3VMFA 2FSGA 5BV2P 4PFKA 2OXIA 1HUQA 1BS2A 1NX6A 3GEHA 3UV7A 4IW3B 3RABA 2XXAA 1AS2A 1BXGB 4OCZA 4ZRDA 3AF2A 5BQIA 3HZOA 5ER9A 4OD4A 3T41A 1U3WA 2BEVA 3LWZA 1GZHB 2KWIA 2YOHA 1CFZA 3BXEA 2VJNA 4OYHA 4H18A 3WA6A 3UZUA 2DQYA 4TLMB 3CEMA 2DTDA 4BP8A 1O94D 2R7AA 2XRHA 3ONVA 5AW0A 3EFBA 2RJ3A 5K3FA 3LFHA 3C2QA 4GECA 4FDVA 3FHTA 5K2MA 1HY3A 2PSDA 1CUFA 4JI0E 1R8XA 5JEAF 5I45A 3EGCA 1GPLA 3W9YA 1SVSA 3GRPA 2D1SA 3BGOS 2FEOA 4F2DA 3MUFA 4YACA 1GARA 2DX7A 5DBGA 3UUEA 2QTRA 4LJSA 3ESZA 1QONA 3ICCA 5LOVB 1OR2A 1GQOA 3ESDA 3RKSA 4E32A 1IM5A 2Q3BA 5K01A 4FSDA 2D7DA 1KJJA 2ZBVA 5JWOA 4K6OA 4MP3A 5LYYA 4AJKA 4EA8A 3OT4A 2ODWA 3QYJA 2JAPA 3PUIA 2JPUA 1NBOA 1IAQA 3W78A 4HDNA 2MDTA 2PR2A 1ZJWA 1IAVA 2BGMA 5B7NA 3CRRA 2JEYA 4L4SA 5JJCA 2PPVA 4YRMA 2JFFA 3HBJA 2MU1A 2CYCA 4U6SA 2J3LA 1SKBA 5EIBD 1YE8A 3UOAB 3VR2D 3H9CA 3Q8XB 3HI6A 2QAIA 3AKYA 1T8RA 1EFHA 1FE8A 4CQMB 2CLLB 1VB5A 1NI3A 4C7VA 3UQZA 3H1EA 3H2HA 4MW1A 5IH7A 1WXHA 2EZ8A 5K3AA 1BQ4A 1A8IA 1IXSB 4Z4CA 2HJMA 1SZIA 4HEQA 5CNKA 4ZU3A 4LC1A 1H69A 5DM4A 5TT1A 2WTBA 3R3WA 2AJCA 1USVA 1LDGA 5IN5A 2HBQA 3A27A 4IXDA 3JATA 3HDHA 1KIMA 2UXCE 3ZZ0A 1A2QA 3PG5A 4KV9A 4FFLA 1CF9A 3AG2C 2DQ4A 1R8SA 5ANRB 2PLWA 1FDVA 4R8VA 5HGJA 2DPYA 1AXRA 3WO0A 1LZKA 3EA5A 2XKJE 4YIHA 2VWPA 2O5VA 5EMMA 4QNRA 1Z5WA 4JUFA 1IY8A 3LO5A 2FPXA 1KNYA 5EZ6B 4FEAA 2QD3A 3H2ZA 4X3OA 4KYTA 2B5OA 5I3CA 3LHSA 3E2PA 4AL0A 1FSGA 5C7LO 5EI5A 4DSTA 3FGNA 3EZNA 4Q1EA 2V59A 2NO5A 1EK5A 2O3ZA 4B3RE 1ZX1A 5HMLA 2AD5A 5SY6A 1UPCA 4CN9A 4BEVA 1ANKA 3PNPA 3CVVA 1FDIA 4KPGA 3G0HA 2R7WA 5KYWA 4YRDA 4QO7A 2YV1A 1FPMA 2AZMA 1CPRA 1WY7A 5KVCA 2AA3A 2BOVA 5PNTA 4KBFA 2XMGA 1L4GA 1YJGA 2JLVA 1UCFA 1JFFA 2Y1OA 5CJ2A 2NZVG 3GA5A 3LSTA 5FJJA 3MJCA 1U8XX 1ZK3A 2AJTA 2HWXA 1P5ZB 1OVGA 3MPUA 5CD1A 4R01A 4G8CA 2E3JA 3G9TA 3PCVA 3MBIA 3WWPA 2DR0A 1QGZA 4MVJG 4PLTA 1HV8A 2QWXA 2WHPA 1JQ5A 3RLIA 3STVA 2HWYA 2KMLA 1E79A 2O20A 4M1TA 1ZI9A 3JASA 3RF7A 3O3NB 4MV6A 2PUDA 3B5EA 4MQLA 1MXHA 1QTQA 5THXA 3ZYCA 2ODEA 3DL0A 3CEHA 3ENNA 1WDKA 4JI3I 5JT1A 4YCJA 2ET6A 1BGVA 1OYYA 5BVHA 4XFDA 1J1UA 2IKSA 2CXHA 1NG9A 4I1RA 2GHQA 1H6CA 5JTUA 4JS0A 5DSZA 4JVSB 2H1OA 3WYNA 2AN1A 1KKMA 1WZEA 1FAPB 5L3QB 3PS3A 1N1EA 3SXJA 3JYOA 4ZPXA 2L6GA 1HA3A 1TW3A 2V0GA 4TTTS 1ULSA 2DVMA 3IUYA 3WFZA 1RM4A 2IPAB 1ZZPA 4F91B 4WUVA 2RCYA 1KC1A 4Y1RA 4RYDA 4JUBA 4JBXA 1IHXA 3P1JA 8GPBA 2GT1A 5A4MS 2R6GA 4HVCA 5KTRA 1LJUA 2O3SA 1BDHA 4EJ0A 3HWSA 5ELXA 4WACA 2JCBA 3H0CA 3HMQA 2CLHB 4GPAA 2RKWA 2FFHA 2L2QA 3DTYA 2HPHA 3GWNA 1HR0I 2R5NA 3D0RA 2OK8A 1AZSC 1KYZA 1O6GA 1U8UA 3HYSA 3O1HB 2JNWA 2ZYGA 1TUEA 1JDNA 1NPYA 4AX4A 3B1FA 4CDRA 3P27A 3WFIA 4HFNA 1ZKMA 3ROTA 1GTL1 4BL5A 4FD3A 1ECGA 1QHHB 1SA0B 3HR7A 3C8ZA 3UXMA 3GCZA 3L0OA 3ORSA 3QKUA 4ERNA 2ZT7A 5ICSA 4Q4AB 4KL8S 1KVUA 3K6KA 1P61B 1OXBB 3BRJA 1R5OA 1SCUA 3NT5A 1Z18A 3R4CA 4ZAWA 3T8YA 2VLBA 3X1ZA 2R4TA 3VR4H 1DT5A 1RD4A 3G68A 3EZGA 2O3TA 4MR8A 5KB3A 4GM0A 2XF8A 2WYHA 3PYGA 2XUQA 5LMNI 1LNZA 3DJNB 4YMSA 1I7QB 5CHEA 1A50B 5JU6A 2YVAA 3LDHA 4LOJA 1DC7A 4LZNA 3GT3A 2D62A 5ELWA 1HLGA 1ONPA 4ZYTA 3S5JA 5HIIA 3S90A 1KSGA 2Q0XA 4OXRA 5EYPA 5DX8A 3ZBUA 1P9WA 3DNPA 3QX7A 3DL4A 3SJZA 2O4CA 3AO0B 4HXGA 1J39A 4F5ZA 2WA2A 1V95A 1HYBA 2PMDA 3JAWB 2HJ3A 1X42A 1DMRA 2H7VC 3U6BA 3PIDA 5ADWA 1JAXA 5B3IA 3AG4C 2R47A 2XKKA 3VFDA 4B3CA 3QE9Y 2VJQA 3V7NA 3GZTB 1T1IA 1IJFA 3L8IA 4RPIA 4A6XA 1Z22A 3EK2A 1FFHA 3R74A 2QRHA 4CIBA 2AWYA 1JS1X 1AS3A 5KREA 2N3ZA 2IUYA 2PKRA 1UDXA 3QFTA 3I5YA 2UVPB 2RHLA 4LJLA 1T5OA 2GDJA 2J3KA 4ZT5A 3C6QA 2ZQZA 3L1MA 3QWFA 4ZT2A 3OBBA 2NNWB 4MUMA 4PCUA 5B30A 2P4QA 1NVAA 3F78A 1JPJA 2J0SA 1F4PA 2GNPA 2FPIB 5KOYA 2FZLA 1I0IA 4KW7A 2P3QA 3WU6A 3SEOA 3V4OA 2LP4A 4QUGA 3O3OB 4Z0NA 1FSZA 1A77A 4RBNA 1FFDA 4FN5A 3KHSA 2C29D 4C0HA 2CUKA 3ORHA 3UMRA 1LVGA 4NPHA 3L7MA 3H2YA 4G0OA 4W5RA 5ICGA 4OM8A 4CHGA 1ZMBA 2GAQA 3FJYA 1K40A 2PNZB 3EF3A 5C7YA 3BBPA 4WBNA 1X92A 5EWLB 1HM5A 1QGOA 4ZCQA 4E17A 3PDIA 1SXQA 3REGA 3L7JA 2P9QA 4TL7A 1CD5A 3G82C 3QV1A 5B36A 3AL2A 4YP1A 4O4HA 4JENA 1OCRC 3HZHA 4MDEA 4LXUA 2VT6A 4PGGA 3PD1A 2YZMA 5B1EA 3IQHX 1DPFA 2XAAA 2EEZA 3BGSA 1RWVA 4KQ2A 4HDSA 4TWBA 1SVMA 4DR6I 2C99A 2FFAA 3CJRA 1GUYA 1K8QA 2B61A 1XNQI 2F4VB 4ZKEA 1VKHA 3OQNA 3T4UA 2Z1DA 4IR7A 4TL6A 3ETLA 2QQGA 4N7JA 1PD0A 1MNEA 1NMYA 5EIAA 2XTZA 3QWAA 3FVTA 2VWHA 3LT2A 2OCYC 1RPTA 2LCIA 1W581 3QTLA 2FW0A 2HJVA 3DO6A 3VPDA 4JI5E 4B7AA 2OGTA 1NW7A 4P08A 5L3SA 3NBUA 1FMJA 2EKPA 5LYJF 4M89A 3JYPA 3C15C 4UUMA 1MX1A 4IIVA 5KDOA 4YJFB 4YPOA 1J7JA 4HMOA 1D1CA 5BP7A 4Q3BA 4RTJA 3FCEA 2HD4A 3UFBA 2HV6A 3GLHB 5KYXB 2YJ6A 3IBYA 3JQRA 3TLAA 5F9MA 5FFNA 3K5IA 1DADA 2PSFA 3F5DA 4CGZA 1YDIA 2CZ9A 5K3BA 3AP2A 1NXPA 3QU2A 3BKWA 4K3VA 4QEKA 4RESA 2AFIB 1DARA 1TJ5A 1R0SA 4JJKA 1J5XA 4PJNA 2NO6A 1LK7A 4BDTA 4B80A 4FZ5A 4ZEMA 2OQIA 3L7ZB 1I5NA 1K92A 1M73E 3D7MA 1XVLA 2C07A 5TQJA 5DCLA 3D6UA 4RPCA 4WLOA 4PXAA 4DIEA 4C08A 1ST2A 4X63A 4NAHA 2XMBA 4YXFA 3IPXA 3I6QA 3I0ZA 1PIEA 4OAOA 3CLRD 1J07A 2Z5FA 2K2QB 4OBEA 3ZHSA 3SIRA 3GLVA 4W63A 2D5LA 5A5VA 1PRYA 1R9GA 2CHQA 4X1IA 2OENG 3EVDA 4MVMA 5A9SB 3MW8A 5LQUA 2AI2A 2OBLA 5KVQA 2WFLA 4LZPA 1PCXA 3VZBA 1IOWA 2YHIB 2G70A 4RD0A 1GG8A 3G2PA 4QUJA 3DWFA 1O4VA 3FCYA 4LF9B 3NYWA 4C0LA 3SCZA 3I6YA 3BWCA 1ADCA 3OEHD 3H7IA 4OTZA 1R8JA 2A3NA 2A7XA 4EB0A 1X15A 2CVHA 2CLSA 1UOEA 3L8DA 3CDIA 2QG9A 1JI3A 4DM4A 2ZRMA 5CLJA 1CC1S 3KCNA 4GEHA 2GA0A 3ZV6A 3U3KA 1NKVA 1GGHA 2QI9C 2E85A 3UOGA 2CMDA 5FQOA 4HYMA 4D0RA 2D54A 3UK7A 4EQZA 2VDQB 3OZFA 2Q0QA 1NVBA 2Z09A 4G5FA 4B81A 3TCKA 4Q3CA 4RVFA 2EINC 2WSIA 1L7BA 1YJ8A 5CFOA 1MGPA 2FKNA 3C6MA 4XWTA 1BFKA 2QMEA 8MHTA 4MS1B 1PT5A 4KN9S 2OUIA 2W8ZA 3L8CA 5D2CA 2AJ4A 3MRTA 3NHUA 1YJQA 2CW0F 3UN1A 4OF4A 4BVGA 1D6TA 1KH2A 5CLQA 5TIIA 4OK5A 4K5QA 1GT91 3B3JA 5JRAA 3AESB 1IHDA 1OAOA 5DBIA 2QZSA 2R00A 2RH9B 2IYNA 2Z5BB 1B00A 4Z7JA 1KP3A 3KPUA 3ZDEA 4NBLA 1JWBB 4WKGA 5FUMA 3DP9A 5C3UA 4AQYB 3GLTA 3RF3A 4H0NA 4G84A 4Q5IA 2Z83A 1YDGA 1LLUA 2V7TA 2IEZA 5KDDA 3S28A 1FXWA 4ER0A 3OA2A 3WRYA 4N5IX 4CMJA 2C38B 1I4OA 2OGSA 2C2WA 4KR9A 3T1YE 3OLWA 3KQSA 1JHYA 1T10A 1ZXXA 3SQNA 4RZHA 3O4RA 2JLSA 2NP6A 1O95A 4G7OF 4MVJP 5JFGA 1GVHA 3RF6A 1FJGI 1GUZA 4FS8A 4R3NA 3N7AA 2CYAA 3K92A 3PYFA 1K4YA 3DE2X 2P1DA 3MRXA 2QRJA 4P98A 4ZXFA 2ETSA 1EUYA 1Y6DA 1XR3A 1D04A 4J4HA 4YP0A 1EXMA 4P3NA 4DE5A 4XH9B 4GX2A 1SBZA 3GFSA 3COZA 2WNRB 2BPOA 4BNXA 4X65E 1GLNA 3VU1A 1B93A 1D7AA 3D7SA 5ALPA 3BHNA 1Q0LA 1P81A 3NDBB 4XCQA 2BFFA 3Q1LA 4KIGA 1JT9A 2AX3A 4LJ7A 2E0IA 3KTAB 3HQ4O 4R40A 1JKIA 1MDBA 1XI2A 2ID8A 4X41A 4PU9A 2OHVA 3EWIA 4ZZ2A 4LOHA 4C5AA 5CCXA 3OT1A 1N77A 3QFSA 4QU5A 4TLAA 3L3BA 1G4UR 4JLAA 4ZAGA 1YS7A 2HT6A 2QTGA 2OFOA 1FOEB 4TTQA 4MVJI 4L95C 4EHBA 2NZYA 1UBEA 3I5MA 2CFRA 4OBXA 1MFZA 3QTTA 2ZR8A 4BLSA 3AVOA 3A4NA 2HF9A 4QNKA 4N6OA 1VLZA 2WIBA 3S5UA 3OTQA 4A6DA 4CFZA 2QVGA 4FCVA 1ZL2A 3QVVA 4QDOA 3V8QA 4KI7A 4RD9A 1M7GA 1RLUA 3I1JA 4PHCA 3HXPA 4AL4A 2YYYA 5DI3B 5DB4A 4DVGA 3FZNA 4J1QA 4GFDA 3ZLVA 5HIMA 1XMOB 1OBOA 2WZCA 3U48A 2Z5VA 2X4GA 5I9IA 3CZAA 4QYIA 4NNJA 3OWXA 5CVUA 1YE3A 4OREX 4JD5A 5I7AA 3I04A 5BT9A 2UU9I 1FUYB 4X62I 5KYUA 3OT5A 2C9DA 5AI8A 3ROKA 2QSUA 3SQOA 3NYLA 4KHZA 3I4CA 5IUJC 3AFIA 2NTJA 3P20A 4NCXA 2I2WA 3G88A 1Q3TA 1WXWA 3A1VA 3LBIA 3E0QA 5A06A 2M4EA 1MQ9A 2XXAB 2IY9A 3PQ6A 3NDJA 1RU3A 4H59A 2XW6A 1BKDR 4WGYA 4IS9A 2AUTA 2BEVB 3BS4A 1LE4A 3K31A 4HVLA 1F3OA 4UPDA 5T3YA 5CRIA 3G0DA 2DFKB 4O4LA 3KSBC 2HZBA 5K3FB 1XZIA 2E5LB 4MTLA 3I1IA 3KZKA 4ZOLA 2A0WA 2JFVA 4O63O 2LIPA 3IVGA 4RL4A 2ZD9A 5JMOA 1IBME 1A2KC 3E9CA 2CHGA 3ORFA 1IDOA 4MIOA 1ZXNA 2CGEA 2ACKA 5SYAA 2G1AA 1GNLA 3Q6IA 2WABA 3IUSA 4QECA 4YO8A 1YB7A 3X2FA 2C82A 4TVSA 4E7SA 2WWXA 1Y5YA 4XUCA 1NW8A 2NV0A 4LZOA 3NIBA 2JLRA 4CS8A 4L5JA 3NMUF 2WWRA 4FLEA 1T2NA 3K15A 1T5IA 3PSAA 3KQOA 3RFVA 4R3WA 1G63A 4KQEA 4U3JA 5AQ1A 1KBQA 1SOWA 3NB0A 3QKTA 2ZYWX 4CEHB 1WUKS 1TYBE 2QTNA 5KIAA 4HDNB 3IDAA 3T5GA 4JROA 1D6NA 2JCSA 4UZEA 1XNRI 4UAJA 2IH2A 1G38A 3FCAA 3TZEA 2UUBI 4L6AA 1GKKA 2JLZA 3H5WA 4OXQA 3P2MA 2RHJA 2JFXA 5FWDA 5I47A 3VSAA 4BLRA 3LEOA 3WU4A 4RTLA 3V1UA 5LDDC 4X1OA 2AJ8A 4K9PA 3CO0S 4IFDF 4PLFA 4FJ0A 3FWPA 2NSDA 4YEDA 4ITVA 3CLHA 4HDAA 5LU8A 1NFOA 3TH5A 2B25A 3MWFA 4PYMA 4PC7A 4JI1E 5LMUB 4FBLA 4QGBA 2HNKA 5C5DA 4QU0A 4NH0A 4DVYP 3JATB 1YC5A 3PR2B 5EG5A 2QD1A 4MUXA 5JISA 1P1RA 2H07A 5F5FA 4P7AA 521PA 1MQVA 1EE1A 2WTEA 4FFMA 2ZWMA 1UH5A 3HMKA 2CT8A 4G4SP 4OD0A 2VA8A 5KTTA 1QHHA 1SA0A 2WM3A 1LS6A 4LVNA 1XXLA 3QMWA 4YP9A 3UWPA 1NU7D 2P0EA 4O5OA 2JFUA 3AR7A 4YRAA 3Q0TA 4DV1I 4DPYA 2GPNA 5KPDA 3FLBA 3BB1A 2PYZA 5DS4A 2OSVA 3LNRA 2OTCA 3U2LA 3PDCA 3D4NA 3IX7A 3LOUA 1L4YA 3PJFA 3BCUA 2NZWA 5BQHA 2VKTA 3OQ6A 4LACB 3NBAA 1I94E 4Q6BA 3KS9A 2D1TA 1NVDA 4DV2E 1XP5A 3GN1A 5DNYB 3AVTA 4TTAA 1VKOA 1OA1A 3IO3A 5KYWB 1YJBA 2MMGA 1NYQA 4MK4A 3G7NA 4L74A 3SU8A 1GM5A 2W6PA 1M66A 1UUFA 1TM1E 1SFRA 2O7NA 621PA 3Q85A 1YFZA 1ZBDA 1RQXA 1JFFB 3IPMO 1THGA 3VX4A 5A6KA 3U3OA 1WMAA 2AP3A 2FGJA 3IPAA 4KODA 3CRW1 3R76A 2VS1A 2BFWA 1NVXQ 4E4TA 4HE8D 5BVGA 1HFEL 4BLTA 4AUNA 1SQ5A 1FX1A 3SIXA 4LVUA 5CGZA 4CLEA 3Q87B 1XU9A 2FLWA 2UVQA 3GUVA 3S2GA 1QTNA 3D5EA 1VPEA 4R9SA 2W83A 2WHPB 2R25A 1RYNA 2V2VA 3VR0A 3RS3A 3EZXA 1QH1A 5KU7A 3JASB 5H70A 2F67A 2FUCA 4RVGA 3CNHA 3W9SA 5TEVA 1YF3A 3KUUA 2VPWA 3ADKA 4D4GA 4OXKA 5BVHB 3ELWA 1P18A 1FYVA 2UVPA 4Q39A 1YRQA 2X19A 3UEOA 2Q5CA 1SOUA 2DZDA 2O2IA 2GXSA 4EHHA 3EPHA 1ODCA 3W8RA 2A2CA 3P4XA 1RXIA 4F1KA 1IL0A 4MU3A 4P34A 3FLAA 1WCIA 1YZCA 1S3GA 5AO9A 4EZEA 4KQGA 3UMIA 3Q3HA 2JIQA 1NURA 4YJKA 4LFCI 5CLLA 2J4FA 3BDAA 4Y1RB 3WK5A 1H4SA 2EPOA 5JYBA 3K0KA 1CLUA 4E94A 3E7WA 5ITZB 3LTNC 1ISRA 3ORRA 5BSKA 4RTRA 1CQPA 2HR1A 1H0HA 4NS1A 3IT3A 2A84A 5LMZA 2QW8A 2EP7A 3L7AA 3TM5A 2VHYA 4EHLA 4JY7A 3LPCA 2A5YB 3LPLA 1E2DA 2V7EA 3I1FA 5J2TF 2AK3A 5JEAA 4OI1A 3WRWA 2EAUA 2HRDA 2DEIA 3SICE 2GCNA 3IUQA 4KR3A 4L5IA 4P80A 4ALNA 4V1CA 4UMVA 2J65A 3O84A 4KLZA 4ABTA 2HJRA 1GAJA 3KFXA 4X7MA 1DAPA 3TOVA 3AVXA 5CEEA 1T0HB 4BQOA 3G3EA 5AW4A 4U9EA 5E38A 2B7LA 2Q3MA 2ZIXA 1OIWA 5CIQA 3B3AA 4WOPA 4MDTA 2YHAA 4G1CA 2J87A 4P86A 4OIPF 1SCUB 1GUDA 5FEUA 1Q74A 4HNSA 4KE8A 5KTNA 1F0PA 3O94A 3E9ZA 3L18A 3MUOA 4PYNA 2ZU0C 2VUSA 1YHZA 2I8BA 2EL7A 3UKDA 4MR8B 2CWDA 4GQIA 3KVYA 3WZLA 3GYBA 1JQJC 4JU8A 1JA1A 1V4VA 4ECEA 4V0MA 4BQNA 1VHWA 3PJDA 4WXEA 1OLXB 3R5JA 4JLDA 4A0FA 2RGWA 2XLEA 2OA0A 4XARA 5EYPB 5G4KA 2CLIB 3P26A 4BVAA 2C4WA 2JLWA 2XZOA 3CCCA 3GCWA 5IABA 1ZUD1 4JL8A 3O2QB 4ZQGA 1N6RA 4AN4A 4L07A 1VHDA 4CKEA 1XWFA 4JP3A 4INOA 3RB8A 3KJFA 3OICA 3QI2A 1Q84A 1QHEA 4QDZA 2DLDA 5HBGA 2BFDA 4HS4A 2VDVE 2CL7X 1MT3A 3SZGA 4KXUA 2AFIA 3A36A 1ZHZA 1FKAE 3DCIA 3UG6A 5KQMA 5FA8A 1Y6ZA 2HQ1A 2Y68A 1F2VA 4CI9A 3N5CA 3A1FA 3QXXA 4W7SA 4PJJA 3ZE0B 5INTA 3OKAA 3L7ZA 4UEQA 3G5UA 1OB2A 4KUEA 4DM7A 1BFDA 2QN7A 1OVMA 3PS1A 1JR6A 2FK8A 1WDLA 2CV1A 4NYIR 5LZ9A 3MXOA 4LYJA 3BCHA 1R66A 3U44A 3AQBA 4DQ0A 1QIFA 1MV5A 3ZXIA 1SKQA 5TRTA 3N2IA 1Y8ZA 3OZDA 2VDOB 3GM1A 2X0IA 4V39A 2YN0A 1ORTA 4JJZA 2FETA 1H9TA 1DI0A 4C3EA 2GRJA 3WLOA 2WFAA 1PVGA 1YS2X 1FJ2A 3HO1A 1HTWA 4KUHA 4XEHA 1O0CA 3WYFA 1RZVA 5DOVA 5C5IA 2HBRA 4LEIA 4DCOA 3A1UA 3V1TC 3FUTA 1DC8A 3AG6A 3HWX1 3UWDA 2JIZD 2COEA 5EEGA 4RTNA 5ALMA 2PTHA 4WBNB 4D46A 5BY2A 3TOLA 5TPZD 3PDIB 2PXXA 5EP2A 3S70A 3MRVA 3SLRA 3L4EA 4RLQA 1BMTA 4I44A 4O4HB 5DHUA 3E81A 1DFHA 1CTQA 3DTNA 5BNWA 1AKQA 2RH8A 1OBFO 3N2LA 2WHXA 3L7BA 2RI6A 4HDSB 4GWGA 5HCIA 4YRKA 1KAEA 2CCGA 4DBLE 1W8DA 1MJNA 1VCHA 4YB8A 5DYTA 2G62A 3K6BA 1LY1A 3BRQA 3VR3D 4BO5A 4OEHA 3DZJA 3UAGA 5I3ZA 1L4EA 3F9CA 3P4YA 2PN1A 4KRXA 3H1CA 3BIXA 1Y4ZA 3WLQA 2BF4A 4EJFA 1PSZA 1Z5AA 1J8DA 1N2CA 2PS0A 3HM9A 1K98A 4Z9XA 5L3SB 1GZ3A 4ZV4A 5BR4A 3QBVA 1QRDA 4ENTA 1TT7A 1W52X 4D0GA 2QMOA 2AQKA 3UNXA 5T7BA 1QG4A 4B47A 1STOA 5KYNA 1G2PA 3RRMA 4NXNB 4O8ZA 2UUOA 3WY9A 3JVEA 2VHZA 4ZVUA 5I01A 4ILKA 4X3PA 4MW3A 5ILGA 3MC1A 4I9NA 4RH1A 1C0LA 1I1OA 1Z6TA 2XGMA 1KRXA 4QDJA 4AJ9A 2R7SA 3KQUA 1GAEO 2C4UA 4FXPA 3M3HA 1T4DA 3HE3A 4X61A 4FYVA 1PGJA 4RMNA 4HGQA 2C31A 4OU4A 1LRLA 3AUJB 1EDDA 1TC1A 2MHRA 2B0JA 4G1VA 4QQKA 3HCPA 2IHZA 2NX2A 3KX2A 3C6XA 4GPBA 4ND8A 4MHTA 3MCTA 4JEMA 1YYXA 5C34B 4WLUA 2O8FB 3UUFA 4CVNA 4BX0A 4DEVA 3KDAA 5DV9A 1BH2A 2XLCA 4HWGA 2PBRA 1EGMB 1TZBA 3ENZA 3AGPA 4KLAA 4ZEXA 3OPVA 1M74A 4PFPA 1C81A 2NXWA 5IKEA 1QZXA 4ZT4A 4P2BA 4X1IB 3W0LB 1O3UA 1G20E 721PA 4HFFB 3PPIA 3LKBA 3U1TA 5D7BA 2QN2A 2ERCA 3MHPA 4WLEA 2WFLB 1VMDA 2IVZA 1PK8A 5FL7D 4OA5A 1W0JA 3I6IA 3AR2A 3JZAA 2X40A 1Q7EA 2ISCA 2V7QD 4U9IS 3OC0A 2H17A 4PPFA 3GP5A 3NORA 1CR0A 3WNCA 5C81A 4CNQA 4WK4B 5K36C 1NW4A 3L7KA 5IYZF 5BORA 1DBPA 4BFLA 4ZI5A 1TQGA 3CX4A 4KOAA 3OEED 5IBRA 2ZK7A 4YTEA 2PX6A 1RLIA 3R5SA 3W5SA 2A9VA 4R8MA 1JLLA 3UHPA 1U0NA 2GM3A 4E15A 2X1LA 1YH8A 1I1QB 1M6WA 2BAGA 3IKJA 3D6FA 3I6BA 1ENZA 1HE8B 2YL7A 1EWKA 2QTTA 4ARUA 1EA6A 4B4VA 5M34A 1CV2A 2WSMA 2ZSKA 4MW8A 5IZCA 2C5GA 4NECA 2I5PO 3DHNA 4BNGA 2WDZA 3HP4A 2RBKA 1YI0A 4DHWA 3WKCA 1IIRA 4K9MA 2WHRA 5T67A 1ZHYA 2CZCA 2VOEA 2GPBA 3HHEA 3S8YA 4D1YA 2QUJA 3Q11A 1Q0QA 4B6FA 2WQ6A 5K5EA 2WP8J 1VGVA 3O55A 2PKCA 2ZUUA 5BRAA 3V7YA 4AIMA 1ZOSA 3PC4A 5BR8E 1N34B 4IDQA 4Y67A 2VK8A 4AYXA 2ZRNA 2HADA 3SFZA 3DVLA 2XQIA 4BU1A 3ETEA 2ZSHA 4NBSA 1VXOA 3CWQA 3HP1A 3AIK