2CGEA

Crystal structure of an hsp90-sba1 closed chaperone complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
405
structure length
405
Chain Sequence
TKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEYEPLTKALKEILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKLLYETALLTSGFSLDEPTSFASRINRLISLGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
total genus 115
structure length 405
sequence length 405
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2006-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2cgeA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2cgeA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cgeA02
1USUA 1HK7A 1USVA 1Y6ZA 5FWKA 2O1VA 2O1WA 2GQ0A 3Q6MA 3HJCA 2IOPA 1Y4SA 2CGEA 3Q6NA 2O1UA 2CG9A 2O1TA 2IOQA 1Y4UA 3PRYA 1SF8A
chains in the Genus database with same CATH superfamily
3TD9A 3PHJA 2IRWA 1GTL1 4HI0E 2G77B 1NBOA 3VAYA 4GOLD 1XKQA 4O2RA 4PRLA 4LCHA 3P5SA 4BEWA 4WECA 1K7XB 2AA3A 2YVUA 4HLQB 4OHWA 5AJVB 3NOOA 3UENA 1ZH2A 3UF0A 5A5GA 4BNIA 2XUKA 3AM3A 4MDFA 5JAMA 3GMIA 1LVKA 1FP4B 2UVPA 4P98A 5L7WA 3B9PA 1SG6A 4KQGA 5DI3B 5DYTA 4BX8A 3LE8A 3LOUA 3ZX5A 5JR3A 3HNRA 1SVLA 5FQNA 5DXJA 1ZI8A 2GBPA 3AFMA 4LMAA 4EHHA 2O5EA 1TJYA 3U7IA 3LP5A 2BFPA 2D74A 4ZZIA 3U44A 1RHKA 3TRJA 2UU9B 1LPSA 4AMYA 1NDQA 3EGOA 3EMBA 1BD4A 3OQBA 3GN1A 3IEXA 3ND7A 4PQEA 4RENA 2KW3C 4OJNA 4UXJA 4UEJA 2L6GA 1N9KA 2EEZA 3DVRX 4OIMA 4E2FA 4AE4B 3OKCA 5LZ9A 1OCZC 1X1TA 5ADHA 4L6CA 3PHHA 1WXFA 4UMFA 4FZVA 1N7IA 3T7JA 3V5NA 4DSOA 1V35A 2E4YA 2DBVO 3UJBA 4WKGA 5JAOA 4ZGWA 4FHDA 2DI3A 1E7WA 1I0ZA 1QVVA 2FNAA 2PTHA 4ZYWA 1UJ2A 1VGRA 1X8KA 1MF7A 1RCTE 2N0SA 1I24A 3LA8A 2VDWA 4GOKA 5L8VA 2OFOA 2A6HF 3H5OA 1FNTc 4X92A 2WYHA 5IU6A 3RVZA 2IXGA 2I87A 4UNPA 4JIMA 1EQUA 1JSCA 4CS7A 4P33A 5C8ZA 4BRSA 1BEZA 3O8LA 2LBPA 4UHEA 5I7VA 3O9ZA 3WGGA 4MNTA 5C80A 1XPJA 2QSUA 4GHWA 1ZR2A 3PNSA 3KK0A 5FIUA 2BDUA 5K2MA 5LMZA 1Y81A 4IIXA 3V8NA 2PL1A 4JBXA 1W1WA 3NC4A 3FPAA 4YJWA 3CVWA 3OBBA 1UBKS 2QD1A 2JPDA 3C8ZA 4XPYA 3MWGA 1VE1A 1CP3A 2Y0CA 3IIJA 1L5GB 4E14A 4C07A 3R3VA 4RFVA 2XM0A 3JR7A 1SA0A 4P8RA 5HUQA 4AIMA 2MMCA 4C89A 3FNQA 4TVSA 2RGUA 4CJOA 1SXJC 1JDUA 4JEAA 1K66A 1U9JA 1AY0A 2E85A 2IYFA 3D43A 1ZM3A 3M5PA 4MYRA 4NECA 2PZBA 1N8TA 2PD4A 3BXZA 1XHFA 1QOZA 1S3FA 2E37A 4FCWA 3C3XA 1YZVA 3LO8A 4PLVA 4H1VA 1D5WA 1ZH4A 4UREA 3LBHA 5FTKA 3UAYA 5B6JA 1EDEA 1IMJA 1YRYE 3R1IA 4TN5A 3NEPX 2EWWA 2WK1A 4DCSA 4FB5A 3GDHA 1F06A 2PM8A 3SC6A 1L3IA 3IELA 3AF2A 3OHMA 3W8HA 3TR6A 4DKJA 3S68A 1TB4A 4WESA 4LYJA 5FPQA 1E2FA 1O97C 3T1TA 1WUUA 5HMLA 1L5QA 1UKVY 4M9CA 2BR2B 1N0WA 3SAJA 4AZWA 2IBMA 4EABA 1MMFB 4G5YA 5A06A 1GKIA 5IYZA 4RULA 4UXIA 4GGOA 2N46A 5DFAA 2UYQA 4DCCA 2ZXOA 1GLNA 1VFPA 3EOZA 2QMUA 3MUEA 1HUQA 2JVJA 2Z9DA 3GJ3A 2Z5BB 3IILA 3Q7QA 2WT4A 3JSEO 1ZVQA 2ANBA 1JMYA 2CCKA 2FZ5A 4MVOA 3AWIA 1N3YA 3C0KA 2G9NA 1B62A 2C9ZA 3JAKA 5ITZA 5FA6A 1XMIA 4IB4A 2CFSA 3DOIA 3KR0A 1Z68A 4WUVA 3WBJA 4CDMA 5JJLA 4CTKA 1LQUA 3WQHA 4N0QA 2FJPA 4WZBB 4R0NA 3U37A 5TJ5E 2CBGA 3ER8A 4NCAA 1W0KA 2IUTA 3FMOB 1R0YA 1TUEA 3GPIA 1J0XO 3EEIA 2AT1A 4ZAZA 3SM9A 4Y1EA 5BWBA 3TAXA 4WK4B 4Y1GA 1G98A 1A4XA 4B5KA 1NI5A 4F9FA 2AJ4A 1Y89A 3I61A 1S7GA 2ZPTX 2F43A 2JBAB 1NMQA 3U4QA 4NZNA 3OLXA 3LWZA 5D51S 3GGGA 1MRNA 4PPYA 1X87A 4MGKR 1NQWA 4D80A 2P1RA 3MYFA 4EMTA 4E5SA 4B3CA 1V71A 1JU3A 5AVYA 5GGXA 1TWCA 3CIFA 3TMAA 1F12A 2SICE 3EHNA 3C3AA 1K7EB 5A3SA 3SCZA 1XRQA 4U5EE 2C38B 2BFBB 2XMPA 1JA0A 3C8DA 5D3QA 1SCBA 5LP6C 3HRHA 1TZBA 4E32A 1UT8A 1Z8DA 4KL8S 2Q2EB 4P9TA 2QZ4A 1QYDA 1CIVA 2Q3HA 3PENA 3PGMA 3PQ7A 1N34B 1NWCA 1BQEA 2I6TA 1PWZA 3Q1QA 2QT0A 1PHRA 3DBHA 4HQOA 2IEGA 4FGZA 5CXQA 1C1XA 1IYZA 1XDBA 3I58A 3OO0A 5J47A 1LF0A 2VJBA 5HF8A 2F4NA 4JWKA 1Z8FA 1QLHA 5AVKA 4DLAA 4EY4A 2P79A 1JFTA 2BEVA 3PDUA 4ZIRB 1QHIA 5IHPA 1XMOB 1DAMA 3FFXA 4XDHA 5BN4B 5HM6A 3ZGLA 2V55B 3I3OA 3OVMA 5EIAA 1CYEA 3RFFA 1MC4A 4IUBS 4FAPB 3FBGA 2H07A 4HQ6A 1HBJA 1X1CA 1O96A 5GONF 4BX2A 5HQ3B 2FQYA 1ML3A 1SKAA 1QAOA 5DGCA 2A84A 5HZHA 4J2TA 1E2KA 3CQZA 1Z9BA 3RGWS 4A8JB 4QPJC 2VC2B 4YAGA 2HJWA 4UDVA 1NVDA 1PR2A 3D7KA 3MPUA 2L0XA 2EZ9A 3AEXA 3NKVA 2FA9A 3JQCA 4BAZA 1GG2A 1OW8A 1C1XB 2J45A 1L7NA 1UXOA 3LF1A 4RH1A 4ZVUA 2BR3A 1LTHR 1E3JA 3F1LA 3IE0A 4O5OA 721PA 3UT5B 1PUXA 1JSZA 3D59A 1XVLA 3LQKA 1SNYA 1UMBB 3NBMA 3QOYA 1YLMA 3TOMA 5C31A 3ZZ0A 5KYTA 2PUTA 3D3QA 4NXNE 1DC8A 1OTYA 2XYRA 1KIMA 3ITKA 1UOEA 3BMXA 2UXBE 2YY7A 4I4TF 3UVEA 1BVRA 1ZNWA 2OBNA 5K3AA 1R6VA 1Z0UA 1DJQA 2PGXA 2PZMA 2Z58A 4NF2A 4ZT5A 3HZHA 4UVGA 1PP4A 3ROZA 4H18A 3H11A 3SVTA 1BJKA 1YNOA 4KW7A 5EXXA 1GZSA 3ROKA 2PS3A 3ONDA 4IRUB 4ZA2A 1GPYA 2J59A 3O83A 3C3CA 2ZRIA 3SJBA 2Z0MA 4KWCA 3E0QA 3HCNA 3V9PA 2CK3A 4AK9A 1QHNA 1YS6A 2A5FA 1PKXA 5JEEA 1IBCA 2HU7A 3DWFA 1X19A 1EK0A 1W46A 3B1KA 3FSGA 4L5BA 1G8HA 4LN1A 2X4GA 2X9VA 2OYCA 1S2MA 1IJKA 2QW8A 4JC7A 3GC6A 4I36A 4K8RB 2G3VA 4MJ7A 3W77A 2HWUA 1Y3CE 3FDIA 1CD5A 1GPMA 1EP3B 3RWMB 3CA8A 3ILVA 4ZK6A 3CC8A 2J5BA 2M1ZA 3N70A 5K7SA 4HUQB 3IP7A 4QOGA 3JZ0A 3FLEA 2YV5A 1I30A 4I1MA 1XKLA 4AULA 2DWOA 4CU5A 1WMBA 1XZGA 2AC2A 3BGDA 4HAIA 3OF2A 5K6AA 3Q8MA 3KHKA 2HZ8A 1ESEA 1G9SA 5BSFA 4CEHA 2GZHA 3V7NA 1HDOA 1NHWA 5KQRA 4PLTA 2REXB 4PTZA 4NC3A 3NAGA 4G24A 4RL6A 1BW9B 2JHGA 1LW7A 3E8MA 1E69A 4LE0A 3HDHA 3GWNA 2I22A 2HDWA 1HOXA 3VZRA 4BX0A 4M60A 2QV7A 5JQGF 6REQA 1BN6A 3A6DA 4DR7B 4Y9TA 2D62A 3U9SA 5JWOA 2Y1FA 3KOUA 2I4TA 5DOVA 5ANRB 2J3KA 3W5SA 1DKNA 3M3DA 4PF1A 4CF5A 3PYEA 1UKZA 3NRCA 4LYDA 4AQ7A 1LA2A 5CVEA 3OF5A 4FDVA 4W5TA 3GNTA 5LMCA 2A9JA 3MX3A 4AJ1A 3MVEA 2RAFA 4IUCS 1P1RA 4WK0B 2E4AA 2GYUA 3DMTC 1U0EA 5KYUB 2NVUB 4LKRA 1YTLA 3HKEB 3ROFA 1ZD5A 3NYMA 3KQPA 4NBLA 2QYHA 2FP4B 2LTAA 3PFHA 1RCUA 1E9CA 2XH8A 2HPZA 4YONB 2G4VA 3QKRB 1TQDA 1UMDB 2B2XA 2BZ1A 4RIEA 4DR2E 1CUGA 5E9JA 4OO1F 3V00A 1M10A 4IWXA 1HW2A 4EJSC 1JPVA 1DV1A 4P0QB 4WFQA 1K4YA 1KH2A 3RQGA 1T4CB 1W88A 2X6QA 2G5PA 1GWNA 1EVKA 4PNHA 4YJ3F 2ATCA 1IRIA 3N76A 2C4UA 4BOYA 1MQ8B 4DANA 2RHOA 3P45A 1JYSA 2G88A 2OOSA 4H35A 1CDZA 2GWHA 2YZ2A 4DV5B 3E35A 3SC4A 4C7MA 1KKLA 2IS4A 3C8MA 5KX5F 4ENSA 3CRMA 4G01B 5AKJA 3M6UA 1CY1A 1TPZA 2JJ1A 4X20B 4US0R 3ZE7A 1AS3A 1RIIA 3CZMA 3L8DA 4ZYUA 1MC5A 821PA 1P0PA 1MQ9A 1R4ZA 1OX4A 1YQGA 2PNJA 1T8TA 2DU8A 4X1KB 1F5NA 3JRNA 1EKXA 1YUMA 3IQXA 4N9QA 2Q7XA 2V03A 3OU7A 1PFUA 4NZPA 2AN4A 5G2OA 4BN0A 1PSZA 1C9MA 1ZJZA 3ZI0A 3C15C 3ZQVA 1ADYA 3A4MA 2NO4A 3KE9A 3T9BA 5IT4A 1BZYA 3HBMA 3DR3A 5LP6F 1MJFA 2H16A 1F1BA 2CFCA 3ZR4B 1U98A 1F4VA 1L9XA 2CLOB 4HH3C 1SC3A 4Q4JA 3T38A 1NR1A 1TF7A 3L1KA 3T1HI 5HKOA 5ER9A 5L4SA 4Y9UA 1KRXA 1XKTA 4Z0TA 4BFXA 4C2TA 3GRKA 4YCBA 1VYHA 5C34B 2ODEA 3ZX4A 5MHTA 4MWSA 3M4YA 1QKJA 4WGGA 1KGDA 1KYVA 4II2A 5JWRA 4EHNA 3FZGA 3I83A 2EIKC 2G7MC 3DBLB 3JD4A 3PPIA 1SCKA 1QHHB 1KYWA 2V74B 2WUDA 4TT8A 1P61B 4RY2A 3M4NA 4AN0A 3DAHA 3EWIA 4IXWA 1PBNA 3KUKA 1WD5A 2WTBA 3A2LA 3H11B 5ALTA 4K0DA 2H3HA 4PG6A 5FUWA 3WP1B 1ICIA 3HA5A 2JKYA 2WB2A 2C7QA 1W29A 1OHHD 3KTAA 4XRGA 1DG9A 1U1EA 1T6IA 1YS4A 1C8KA 4QPPA 1JVNA 5HW0A 5K9ZA 4UBLA 3SS7X 1JHRA 4IWYA 5A3QA 3VFDA 4ZFNA 4BYGA 4M1EA 4EECA 4EIWA 2OC4A 3V3TA 3EGVA 4CKXA 3FH0A 2MMGA 3CRQA 3HACA 5LYJF 3B1JA 3ZZ1A 2B4AA 1VYKA 4DV3E 3UJ7A 4C3UA 4C14A 3MUOA 2AR9A 4R81A 1P17A 3ODPA 4F7WA 4HC4A 2OCKA 3MFQA 5L3ZA 3JQ7A 4RD4A 1DX6A 2J1LA 3E2PA 4PX2A 5BV0A 2LRHA 3NMKA 2I3DA 2QN7A 3LU1A 4EG7A 4HEHA 3PDJA 5L51A 4M8SA 3RAJA 3GVXA 3O9VA 4OIOF 1EVIA 2GYVA 2IQIA 2C2GA 2XQFA 2YQ4A 3LRTA 3JARB 2HMZA 3QHPA 4URZR 5KUTA 4NCBA 2ODQA 3FYCA 2DQ4A 4RDXA 3S4YA 4GI5A 4QBIA 1PT5A 1ZJYA 1DT3A 2QGNA 2KPOA 4NMHA 4JR1A 3FUXA 3UFBA 1KQFA 3VF0A 5FULA 3TOVA 1XMOI 1WSAA 2V2VA 2JRLA 2QROA 1V45E 2V7PA 4QECA 1WUTA 4WLUA 4ZEXA 2COKA 1V8OA 1JKIA 3AHEA 3EIQA 3HI4A 4MQ6A 2FYTA 4JYAE 2CBXA 5CCDA 1I9CA 3SX2A 4B8YA 3KV3O 1JVBA 1MN6A 2O52A 4AJNA 3QUQA 4JI7B 2RHTA 2O0KA 2PWPA 1I94I 4Q16A 3VR5H 1J1IA 2VJQA 3WJAA 2DLNA 4YRIA 1T1SA 3I2JA 4C4AA 2J5XA 4FR0A 4IUDS 4MGHA 5TGTA 3EVGA 5IBPA 1L5YA 3NBUA 4GE0A 3TL3A 2J3LA 3TSWA 5E8JA 3ZE0B 2DYKA 1D6JA 4IOKA 2UXBI 1Z0WA 3KS9A 1BE6A 2O2CA 4G85A 3FUVA 4R9UC 1N2CB 1AUXA 5REQB 3KZVA 4LJSA 1RWWA 5E38A 1EMDA 2QLNA 3R75A 3LQ2A 2ONJA 1HR0E 1E6WA 2DWQA 2I2WA 1FSFA 3NASA 4N39A 3STTA 3VR5D 3ERCA 2ICWG 2V97A 1A41A 5DWVA 4X62B 2HF8A 4J1SA 1JFFB 4K9KA 3H0CA 3DUWA 3OM8A 4L0QA 4GEGA 2V7BA 1HG1A 2LGJA 4R7TA 3ZU4A 4DLXA 4JP3A 4KAXA 2ZW9A 1Y5MA 4PNZA 4J2HA 1OR2A 2J31A 2QRLA 2HF9A 4CL0A 2NSYA 2AP3A 4LY0A 1TQ4A 4NBNA 4WFIA 1RWVA 4M9XA 5B7PA 3NG1A 4XLPF 2A78A 4EHAA 2QTZA 1UBSB 1Z0FA 2WPDD 4TMFA 3T5PA 2FZCA 3T0IA 4QBKA 1T15A 1R6TA 1ZA1A 3N1UA 4IDDA 1Q7TA 1SH7A 1WUKS 3DO5A 2ICAA 4HB3A 4ZVQA 4KTTE 4KN9S 1MENA 2Y92A 4YI5A 3AUSA 3BL8A 1NF9A 1CZKA 1NBME 1ZIPA 1A9RA 3E9EA 4AUKA 1RXIA 1IXYA 4MDEA 4P7AA 5JNLA 3OJ0A 4QO8A 4F5DA 2HRDA 3U5SA 1XDSA 3RVRA 3NTRA 2VF5X 2GBCA 1T4MA 4PBTA 1LE4A 3ADPA 1XTSA 2WNHA 4G0HA 1NA5A 2P9HA 1RYNA 2P69A 3FAKA 1EFHA 4L4ZA 1BU8A 4WBNF 2VJLA 3SNKA 1POXA 2P11A 5JVEA 4F12A 3DQQA 2IODA 2A1UA 4GX1A 2VUIB 4NXME 3WK5A 4Z54A 5ITSA 2VP4A 2RKWA 3PUXA 2RMKA 5KQLA 1U0OC 4DLUA 2IOFK 4HAXA 4ITVA 4LYYA 4D4LA 3MLEA 3LI2A 3AM5A 3W4IA 3L41A 1RI4A 3RSOA 4JQYA 2FZLA 3UANA 4RSRA 1QV6A 3R76A 5JE8A 2EJTA 1XRRA 1YBHA 2JI8A 3I6MA 2HJVA 3KKQA 4H31A 1I7QB 2HSQA 4C78A 2EW8A 2ZPUA 3IXMA 3QYJA 3ICQB 2PMFA 2ZUBA 4B0OA 1FU7A 4YLYA 3LRPA 5CLIA 1PTJC 4XFJA 2XKAA 1QYXA 4D0SA 1NW5A 1M7GA 1JZQA 1BWSA 1RYFA 2X19A 3F7TA 4L57A 5F21A 4D44A 4D56A 2APJA 3IPXA 4CKZA 2FPLA 1V9SA 4M8KA 5GJWC 1VBMA 1YACA 2QTTA 4MPDA 4KXNA 5DCWA 4NBQA 3PXAA 3HVHA 2V59A 4EJSA 2FRVA 1XQVA 3ZCXA 3M49A 2FFHA 1PJ4A 1NDUA 2I3BA 3I0ZA 3VZBA 4F6RA 4F60A 2O2IA 5G1NA 3Q87B 4GU5A 1Y3FE 4BVJA 4FLMA 4FYKA 1NUPA 2IYUA 2GXUA 2I62A 2JD0A 3P9SA 1AUQA 4BQSA 2PX8A 2YJNA 1ZXBA 3BMQA 3FHCB 3AOGA 5E7IA 3ROQA 2XUAA 3DT6A 3QU5A 3RAGA 3GCXA 4GBGA 2ES4A 3VPFA 4TLAA 1WGWA 4DV5I 3IURA 3KLMX 1ZCAA 4RF4A 1VI2A 3A1FA 2X0FA 4Q0MA 4LNAA 1L7OA 1RYHA 1JEAA 2O1VA 2C2YA 1PDWA 3NBQA 4MKFA 3GM3A 3UMSA 4Q4ZF 4LHYA 3BE6A 3Q6MA 1PR6A 2G1AA 4A2PA 2FPSA 3CLSD 1N33I 3ZHQA 1ISHA 1CC1S 1SN7A 1RBZA 2HMYB 3AHGA 4MO2A 5IAEA 3RYCB 4HMPA 3C98A 2XMGA 5CX1A 3ZU5A 4N8EA 3L5OA 4F71A 5C1OA 1N2CE 3UMCA 5JQGB 1UPCA 4LY3A 3QVJA 1OH5A 1Z4QA 1P6UA 3COZA 4XDYA 2ZAYA 1Q2XA 1JZSA 1OREA 1AMOA 5CFLA 4L4UA 3SK0A 2PT6A 5A1JA 3BULA 3WFJA 4Y98A 5FLYA 1RZ3A 3QZUA 1BG6A 1MNAA 2OL4A 1JR8A 5A9TA 4YMLA 4TS3A 4JI8B 4PJMA 3IVAA 2HHHE 3G79A 4B3TI 4WLFA 1HMPA 3UGPA 3FDQA 1X39A 5EJMA 3DB2A 3DTNA 4YCSA 3AG4C 3T7KA 5C5CA 4F8EA 2O3QA 1UMKA 2FUG6 5JXWA 4QLOA 4PM4A 1XZMA 3IAS6 1TWAA 3VU1A 2NZJA 4ROTA 5C5IA 2GEFA 2BIFA 4EDHA 3Q7LA 3UB3A 4ZCIA 5TS2A 4BDSA 1GAQA 1HMYA 4U2GA 5L4NA 4O1IA 4YJGB 2GD0A 2R68A 1YQQA 4RFLA 4NR0A 2XRFA 4DSNA 4UUNA 2Z6QA 3QW1A 1ZN7A 4XQEA 4UULA 1P6QA 4MHSA 4YY3E 5J59A 3ZDXB 3HGQA 4NHEA 3KLPX 2I4MA 4TPKA 1K4MA 4CEIB 1AKWA 4ZYLA 3KLOA 3HNLA 3WBFA 4GKKE 3BK7A 5IG2A 3FGPA 3QPAA 2GFQA 1DBVO 2JCBA 2YZ7A 2FFRA 3FI0A 4HGZA 1RMYA 4JB2A 1G41A 1XNRB 2PNOA 2HIMA 1BGXT 3V97A 3WIDA 1E6MA 3KXIA 3RHFA 4YT2A 1BVYF 4MVJD 7GPBA 1QLWA 1EINA 4WNCA 2ENWA 4Q48A 1TQ2A 5H81A 4DR6E 2ECQA 1ZXMA 1UEIA 1YBFA 3ILYA 4Z9YA 3U7GA 3S70A 3NVMB 1W0JD 2FPOA 5JH7A 3O55A 3DTVB 4MMZB 4BNUA 4OGLA 3G1TA 1JSRA 4QTTB 4BTLA 1AXEA 3I0NA 2Y0DA 1N2OA 2GFIA 4MA4A 1DRWA 1FNNA 4TOIA 4HT3B 3DPIA 3HTKC 1SOVA 3E7WA 4G4GA 5ED4A 2CWDA 4ZQCB 5DT9A 1N25A 1V8ZA 3R0QA 1ADJA 3MJVA 3NTOA 3RSSA 1YUBA 2JI9A 1G38A 3REGA 4JJZA 2P2GA 2GAQA 2VHTA 3GEMA 5T41A 4AAYA 2GZRA 5COFA 1YB6A 1TD1A 3MCVA 1UPBA 4B7XA 4E5UA 3FCEA 3IQHX 3BQNB 2VNSA 3WQBA 5MGNA 4H7PA 3OFND 5KX5A 4G0WA 1BA3A 4H1WA 1QIMA 3W2TA 4V3BA 1VIYA 1KETA 1XD8A 1Z56C 2SECE 3M1YA 3N2GB 2WJ3A 1J56A 1R0ZA 1NN0A 1U1DA 2EL7A 5LU9A 5EVCA 1IN1A 4CT4B 1WOYA 1P7WA 2NPFA 5D3MA 2Z5CA 1EFRA 3CZ9A 5BWMA 2QP9X 1FJXA 3UJDA 5LDDC 3T5AA 3ZJUA 1K3TA 1MLDA 3EISA 1BXZA 4N0MA 3CFYA 1RLOA 1NGSA 2NVWA 2FP4A 3NC1C 1JDBB 3C14C 2YNMC 4KO4S 4KXFB 3ZCSA 4CKBA 4KRXA 4Q5IA 3R20A 4F6CA 1EI9A 4Z6KA 5AVZA 3OQNA 5AW0A 1WKBA 2QUJA 4CWAA 3I4LA 4LTDA 4D1YA 2B4QA 1FI4A 2FUEA 5EKSA 3RR2A 4ZOLA 4X7BA 3NP7A 3M7ND 3DAYA 4LZWA 4MAMA 2HF2A 3MYIA 4N6NA 3TGWA 2GAOA 1FLDA 4N5MA 4YP9A 3BTOA 4KWIA 1EXVA 4PJLA 2AUMA 1M6YA 2FE1A 3ITNA 2HOQA 4E51A 2DOKA 5KHAA 5A7FA 4FONA 4PX9A 3UBTA 4L0CA 2J0XA 1CU1A 4HBGA 2Y9PB 4LWZA 2R5WA 1LLDA 3TNLA 4CKBB 3KLBA 4LXHA 4Z2YA 4AJKA 1C9DB 4G0UA 5DO9A 5CDFA 4JXZA 3PXBA 2CE7A 3I72A 3TIIA 4OP2A 1CPQA 2PFGA 4YJHB 2E3JA 2QAIA 2FSPA 3BSYA 2HHAA 1DEAA 1EGMB 4OQQA 4EB6B 5LYJA 5IXYA 3SYKA 1Y9AA 2DCMA 2R6FA 1MAWA 2JFZA 3VVBA 1RAAA 1E4VA 1K5PA 2BN4A 2W6ID 2I1WA 2VBIA 2VHUA 3KQSA 4K6FA 3GUHA 3JZMA 4U3BA 3TQSA 2XLMA 4FD2A 5JDIC 3E7DA 4I55B 3LYAA 2WPNA 3O3OB 2HA6A 5I51A 1R9MA 1Y8CA 3F3KA 2D2IA 3GDFA 4G9BA 4BWGA 1KMQA 4CMGA 2JANA 2A35A 5FNZA 1LI5A 1AZLA 3O75A 4E4TA 4DARA 1P81A 5H16A 5JD5A 1SBTA 5LN1A 2X0CA 3Q5GA 3VAZA 3WRVA 1UUFA 4EI9A 1RE0A 1BKYA 3CU5A 2HIHA 2UUOA 3MTAA 3G0GA 1REQA 3G17A 4RXTA 1IXKA 3UMRA 2F55A 3C3PA 3NKFA 4ZT6A 3G7NA 4LUCA 4FW7A 5KTSA 1C80A 1ZH6A 4RQTA 3ELDA 4ZQGA 5TNXA 3SGLA 4E46A 5C0XB 3W90A 3B0VC 2HY7A 2AC4A 3QUSA 4LXXA 2DQSA 1E2MA 2QT9A 1B8VA 2VO1A 4CM6A 2A1TS 2Q6TA 2GX6A 5CXSA 3F6RA 1RXCA 2C3UA 2C2XA 2QTLA 3FFAA 3CTMA 4O4LB 3SF0A 1ATIA 2G6BA 2Z95A 4MUKA 3VV2A 5K99A 1MX0A 3O1LA 2X0KA 4JJAA 1EU1A 1IBLB 1JNXX 1KU6A 1F6DA 4QDJA 1CFZA 3GLRA 5B6IA 1RHJA 1E92A 2XT9A 4W1QA 3S84A 3H5IA 5EXEA 2OGZA 1YA8A 3FPGA 4QQNA 5K51A 3GXBA 1CEYA 1GGVA 4HGOA 3DHYA 3SEZA 4BO2A 5CK5A 2QMYA 2YL2A 1EFVB 3LDHA 4ZPXA 5CEJA 2VQFE 4ONSA 4PHTA 4UNSA 5JARA 4RTOA 5JMWA 5I6DA 3IO5A 5B3SC 1B68A 1R9JA 4FWHA 1Y9DA 2MINB 5IF3A 1HOTA 3RK4A 2CF6A 1FCJA 1PL8A 4XLNF 1IOZA 1RJFA 2BZ0A 2FEPA 2QX9A 1AKYA 1JB1A 5DWDA 4EHDA 3A26A 4D3ZA 1RP1A 3HHPA 1V8FA 1XVTA 3SG0A 1J8DA 5I8ZA 3DBHB 3DT8A 1DUIA 4IHAA 2AV6A 1JQDA 2OTCA 3BKWA 5CAEB 1XVIA 2NACA 2O7RA 2VT3A 3NHYA 1ZRMA 1IUOA 3R8CA 2W43A 3CW2A 5TQ2B 3W78A 1FFCA 4FDTA 3D3WB 3HL4A 2Q3CA 1X1AA 4D9EA 5C8YF 3B1WA 2UZIR 2H5JA 3WMRA 3CEAA 1NXXA 3IPCA 5JNSA 2XQVA 1W44A 3HVJA 4E0HA 3TE6A 1CW2B 4BAUA 1JIUA 1E8DA 1P0FA 1WUYA 2ODPA 3AW9A 3EVCA 3MERA 2QVLA 3OICA 4WBNA 2PS1A 5JSQA 2OGSA 2GK6A 2A14A 1MXHA 1OBVA 2JASA 2WZFA 2IU3A 4S1PA 1OY1A 2J46A 3R6TA 5LDHA 3CLTD 5HK8A 3DWWA 4Y9SA 5IC5A 1BIFA 3FCOA 3W9SA 2X6RA 3LHIA 1FA9A 4LTMA 3CUEF 3G0CA 4OZEA 4N7BA 3J7AM 1NF8A 3KUXA 5T64A 4DMCA 2V6FA 5IT9A 2EATA 1VK5A 3PGLA 2FSFA 3IVMA 4PFKA 2EFEB 1Q16A 4BG0A 5CRIA 4GWLA 4ZAGA 5GZ1A 4D4NA 1N6NA 4B6JA 4PLWA 3IL2A 5EIOA 1X0VA 2ZUDA 4INJA 1YH3A 2A0BA 2ETXA 1SOMA 2V7TA 4YHHB 3HNPA 3IBCA 1I5OA 3EC1A 1TTQB 1MVLA 3P52A 1NXPA 2HRRA 1ZK4A 1YO6A 2QTRA 2BHTA 5E1DA 3TI9A 2OXFA 5TF4A 4XUEA 3RT9A 3EUAA 1KVKA 1TECE 2OYRA 3ZDAA 2UZ3A 1P4SA 4GSYA 2J8ZA 3KBOA 4GXQA 3HWX1 3W3AH 2QLTA 1LVGA 4EAAA 4KDFA 4HSGA 4NCXA 4HNSA 5BT9A 4BB5A 2VQSA 1VI5A 5IDWA 2Z4SA 3LC2O 1Y8ZA 1PG5A 3R5FA 3O94A 3OX3A 3SEAA 5MFZA 1JEEA 3FAPB 4KLNA 2C07A 1A98A 2D2FA 3QKUA 1C29B 3ZY4A 4X1IB 5CFRA 2O2HA 1Q5PA 3UOAB 3ZNNA 2V7XA 2X5XA 2H7VC 1NUTA 4WZBE 4RMIA 1FBNA 1LSSA 1V48A 2YS7A 1MEJA 1LJ8A 2HGZA 4N76A 2HD4A 1DIBA 4V0ME 2ZSIA 3SHVA 2WWXA 3Q8XB 2J6BA 3PKZA 5I47A 1M1ZA 1G6OA 4NZZA 5BN4A 1BVHA 1HLPA 5CM8B 1J5PA 1S2IA 3NCTA 2OCGA 4NYJR 1UDRA 3LHFA 4CS8C 2YJTD 1B3BA 1VE7A 3MPOA 5LBIA 4C6HA 3O4VA 1C9YA 1E2JA 2VWQA 3HE3A 3MS7A 3OLVA 4PWYA 4W8HA 1KERA 1B00A 6REQB 5IABA 3LMKA 5I7UA 3RCBA 1TYBE 2IBTA 3I32A 4DDTA 1AN0A 1L4GA 2IZ0A 1JT2A 3O84A 4OXKA 3FKQA 1O08A 3KJNA 4RVFA 1CEQA 3AHJA 3K8ZA 4LCBA 2VHZA 2IA5A 4PFJA 3OIFA 1N36E 3QEOA 3GP8A 4A2WA 3O92A 3NZEA 4E5MA 4Z49A 5K01A 4WIAA 1VG0B 3LH5A 4X65B 1RXVA 2NVUA 4JP2A 3D0KA 2LK4A 4PC6A 3KPJA 1F2VA 4LDKA 4CHTA 1C3VA 4JJEA 2PJRA 3S99A 4YFYA 5DM2A 3UXEA 3POVA 2X14A 3WGNA 2SKDA 2EPOA 1O8CA 3QVLA 3ASVA 5L6LB 1THTA 3X2EA 1KXZA 1DZ3A 1PJQA 2JFFA 5HXAA 2HKJA 1CWUA 4U8HA 1GGKA 2PA0A 4LZPA 2OGTA 4RK5A 3SYMA 2PV7A 4JBHA 5GINE 3ASYA 3E9VA 4LRTB 5CW1A 2FDXA 2PSEA 4ZOBA 5SY6A 1HT3A 4G4JA 3R9WA 3TSYA 1Z2DA 2JB9A 3O2SB 4CEJA 4DR3E 3KUUA 1TJNA 5KSWB 4R41A 3K92A 1TM7E 1EUCB 4DPYA 2F59A 2I1VB 3NBAA 4V1CB 4PBSA 1RWKA 2X0RA 4L0MA 5A02A 1KL7A 5M29A 4D46A 3NHAA 3LLVA 2VOEA 2ZXPA 4DEVA 3LUJA 1DC3A 1YU9A 4NCKA 3DEKA 2ZE7A 4OP1A 3KUCA 4E5DA 5JSUA 1XYGA 1KI8A 4QYIA 3O1JC 3T0GA 4CU2A 1A5SB 2KX7A 4TKLA 3AUFA 5LSAA 1UF9A 1T24A 1PFGA 3AL2A 3NNNA 4W4TA 3TLAA 3VPDA 1AB6A 1GNPA 3VU0A 4U6SA 1J4AA 1NQUA 3S8MA 4MR9A 4CG2A 1DCTA 1Y4AE 4Z0PA 3GCMA 3IERA 2ASVA 2IUYA 1H3NA 5FJJA 1NUSA 5EZYA 5LC1A 1EJ2A 5I7HA 1L7VC 4WAUA 1WMAA 2W0MA 3ETNA 1SHKA 3QQ5A 5U4XA 5KO2A 2WTMA 2ZGVA 2ZS9A 3KJXA 1MO3A 3W5HA 5L7YA 4BNJA 5K3EA 1UC4B 4Y2TA 3ZE8A 4FYVA 4U4AA 2Q7RA 1HLDA 2C1EA 3KSUA 3DC2A 1ZC3A 5L3QB 1KQGA 1IIBA 1B8OA 1O97D 1CDEA 2R7NA 5T4EA 2O4UX 1W1IA 3KJZA 2WVNA 1HI9A 3MMNA 3PC3A 3BXFA 3NJ4A 1BDBA 1D03A 1I7PA 3CMMA 4LPSA 3QENA 3GR6A 4MKZA 5IUNC 1NW3A 2I03A 2ZSJA 3ESXA 3QVTA 5JS8A 4ZQHA 4G2TA 4LQLA 3NTQA 2BKAA 1P5JA 4OHXA 1UAYA 4XSGA 5GTDA 4J6EA 2OBYA 2JFPA 1BFUA 3FOWA 1WPQA 1ZBDA 3OTWA 4MUNA 3N24A 2QRPA 3FOBA 1BSVA 4B1FA 3VSCA 1QU3A 3WV4A 4HDSA 1C3OB 1MC1A 3BRWA 4RL4A 4TX1A 1F17A 3LC7O 2R4TA 3KYCB 4PPQA 2BUBA 2Q4RA 1T4CA 1WPRA 1NP6A 2ZSAA 2QN3A 3DTVA 3ST7A 2OHVA 4YRDA 2B1QA 3G2KA 3LT2A 1H0RA 3EEYA 4PZEA 1ULUA 3V8EA 5K6AC 1XU7A 4Q3CA 1QFJA 1Z2NX 3GPLA 1OZ0A 1UBFA 2WILA 2ZR8A 4TN1A 5ED0A 3AQIA 3EDYA 4DDKA 1XZHA 5EE5B 1H85A 2GTPA 5G1OA 3TLYA 2VCBA 1G7TA 3NOXA 4XD7A 1WXEA 5EMKA 5JMTA 2CF5A 1KZ1A 2VHQA 2JLAA 3KVRA 5HIJA 1SKYB 3V6LA 1RWNA 3KR2A 1HE5A 2FMTA 1W2WA 4U9DA 5MGBA 1X86B 3ZWNA 4NBKA 1SBZA 3B60A 1FXUA 2ZE8A 5IP5A 4J0GA 1Y5YA 1PUIA 1JDPA 2CVFA 1U2RA 4TTVA 1XDDA 4L5IA 4MWOA 4CFZA 2EYUA 1ARZA 1EZ1A 4LFBI 4M76B 4LX8A 3EIEA 1K0UA 1DU4A 5ABPA 1GCGA 4MPRA 1FTSA 3OPMA 1AGRA 1B4DA 2ZIEA 1E2PA 1IEVA 3MYRA 4JLKA 1IEQA 3THRA 3UQZA 4D9BA 1SRQA 4MK4A 5EKWA 2G82A 3ENZA 1K04A 1RCPA 1UBJS 3G6WA 2QN9A 4TV8B 1Z5OA 5A5VA 3T3OA 2WAYA 1IZYA 1EEHA 1I01A 4JJKA 3S9OA 4V38A 2I7DA 2UDPA 1Q22A 1FSPA 4RZ3A 4MW8A 5L0IA 1P3Y1 1PS8A 2Q5OA 3CX3A 2YINC 4JK3A 5AJZA 1TT5A 5FHQA 3EDRA 2PO1A 4GM1A 4NONA 5K3DA 3UYLA 4DAOA 3IQFA 3QLUA 4KO1S 3VM6A 4MV4A 1P2SA 4MVYA 4QBHA 4BBZA 5EJ5A 2EHJA 3FRHA 1RMQA 2O8CA 2NQ8A 3NWBA 5EVJA 5JSLA 3DMDA 3S5UA 2WTXA 1WXQA 2JFUA 3E7PA 1GFIA 1E99A 3QPVA 4GH5A 2P9ZA 4IXDA 4C4SA 1ZVVA 4ALLA 2FLWA 3L5KA 2AUTA 4HGNA 2P7HA 1MMNA 4S1NA 5IWCA 1JMWA 1TZKA 4WNIA 5J4HA 3R5SA 4P3YA 4QOJA 5AUPB 1CZHA 2XDYA 4LE1A 4TXMA 5EMJA 3ZGNA 4EO9A 1GDTA 1TT5B 2OHHA 3CGWA 4M7WA 4LSGA 2ZSUA 4NE9A 3ZY2A 3PSAA 1N1CA 4CLEA 4EEZA 5DCYA 3TAHA 4FWVA 1QXSA 4LY6A 5CVJA 5AOCA 4YK5A 1RYYA 2WU0A 2IU6A 4EF6A 4ND4A 2BVNA 4Q7CA 4AWXA 1LDGA 3H1AA 1JL3A 1GA1A 5JALA 1KRWA 3I9MA 2WUEA 4D9IA 5EMMA 4IOLA 1KHHA 4NYMQ 1WBJB 2CDNA 4HAOA 4RJTA 1FQWA 1ENPA 1TOAA 2PGLA 2VRBA 1GTRA 2X8JB 4NEHB 2FRXA 4LJ7A 1YS1X 2ZUTA 3RU3A 3L7NA 3DMYA 4LYFA 5BN5A 1WXHA 2WWWA 3S2FA 4IJJA 3N59A 2W2KA 1PV2A 1UC8A 3BSWA 1O5IA 1E84A 1QIIA 3DYIA 3NORA 2OAP1 1BDMA 3PCTA 4P4SA 4MR8A 3NKDA 1W85A 4L78A 3UOWA 4X66E 1ZHOA 2VPQA 2VKTA 1UZMA 3QOFA 5FFNA 2XL4A 1SA0B 5TJ9A 4Y2GA 3PFWO 4QI0A 3U2MA 5AH0A 3RARA 1UBOS 3RV3A 4EENA 3QBJA 5I7RA 1SC6A 3AZOA 1U28C 2OAQ1 3UK2A 3QKSB 1Q0SA 1EWVA 3G2IA 3B6MA 1Q17A 2AOVA 2VXCA 1Z5AA 3NH6A 4RV9A 3ZQYA 1APBA 3B1YA 3N2IA 5F5FA 2FW6A 3TSCA 1H9TA 2IOYA 2P3OA 2P4SA 2AHRA 1GYQA 1EDOA 4OK5A 4OUDB 1E6KA 2R8YA 2Q9UA 2D4HA 4XR9A 1JHUA 2NV0A 3PX3A 1MNEA 1V8BA 1T3SA 3ZWCA 1Z39A 4LXQA 5HCNA 2YQ5A 3R7BA 3TLKA 5BQGA 5B6PA 3HZZA 1D6SA 3DM9B 1PNTA 2JAOA 2JD2A 1VGQA 2PX2A 2GHIA 3FYUA 1OQAA 4HNAB 4OA8A 4P4UA 1L7MA 3A9CA 4U9IS 3HB7A 4OX9B 4XTCS 3EQLF 5K3BA 1I94E 2IIVA 1TEHA 2PO2A 3FMGA 4KN5A 1L5RA 3TBKA 5AVWA 3DV0B 1JPJA 1I2BA 4P93A 5IC6A 2Q7DA 4QFCA 1XQXA 1ZVZA 1WABA 3RI3A 4QHTA 1XTKA 2ZATA 3KSMA 4BGDA 4F1WA 1Q0DA 2B1IA 3MAJA 1YQTA 5AKEA 4TKUA 3D0QA 6YASA 1QGDA 4R2HA 1Z74A 2J5QA 5FLXC 1U8FO 2W2MA 2X9QA 3PEFA 1CRZA 2GM3A 3ES9A 3QEMB 4FZRA 1Y3HA 4MX8A 4ND5A 2IH5A 3AIIA 2F43B 3OZWA 4L07A 4MGIR 1D1PA 4RU1A 4WZBA 5FB3A 2J9FB 4EWLA 1HR0B 3BXXA 1TUBA 3AXSA 3W3AA 3M33A 5C32A 4PE5B 1BR1A 4FYPA 1R0XA 5I7SA 2RB5A 2B94A 1THGA 5DNYB 2CMFA 4NC9A 5DX1A 3S27A 2O14A 4WLVA 4JW1A 3KDPA 2A1UB 3OESA 4HH4A 4ZAWA 4BPBA 5EJ7A 3OX4A 2ZVPX 3AFHA 4X5OA 2WSBA 4DJEC 3RYFB 4QA9A 3MM4A 4EGAA 5KVSA 4GPD1 2WFMA 2C4NA 3UZUA 3VJMA 4RGQA 4INPA 5CM2Z 5JO9A 5EJ8A 1KFJB 2EFGA 2A88A 1ZESA 3F4LA 3OP1A 4UXHA 1OLSA 1F20A 3H9BA 1S4EA 2FMUA 2P9FA 4FW8A 4JBLA 1JR3E 5L9AA 4YMWA 4TWBA 4JVSB 2C5GA 2I29A 3ILXA 4N18A 2ZT6A 3CEPB 4ZOCA 3NO4A 4FFBA 3I39X 2DEIA 1KQPA 4N6HA 3D0OA 4CLOB 2GLTA 1Y7PA 4PC1A 3SM3A 3K71B 1ZYUA 1NVVQ 3EXG1 3CH7A 3KSDO 2VQFB 5AVRA 3BWEA 4BNWA 3A9RA 4MV8A 4NU5A 4ND1A 4R83A 5AK3A 1ZKDA 4FYMA 5AW1A 2DVMA 3C74A 3GRVA 3LP8A 3WKBA 3TEMA 1ZU4A 4KFCA 1JQAA 2YL7A 2X3YA 3KPVA 3QHQA 5KYYB 3EWAA 1SD2A 4I08A 2J3DA 4RS4A 5DASA 4MB6A 5IVHA 4ZMRA 4NAUA 2P0AA 1HFJA 2Z5FA 4TV9B 4Q93A 1ST3A 1BE1A 4CF6A 1U8EA 4OK6A 1DCMA 1C0KA 3D6VA 3PNPA 5DISB 3PXCX 1NI4B 1IHXA 2IVFA 2OCAA 1E5VA 4O4IA 2PANA 3ANMA 4O2BF 2JAUA 3VHXB 2GF2A 4UFPA 2F62A 3D7LA 3FZEA 4MQMA 5DTEA 2ZUSA 4KQKA 1N92A 1UC9A 4LHEA 2HO4A 2GD6A 3DO6A 5COBA 2VJCA 3W2HA 1E8MA 3OFJA 5FOXA 3WYEA 1TADA 3OE7D 3T7RA 2HUJA 1IFXA 3RYCA 1AKEA 3PA8A 3LVBA 3MD0A 1E1RD 5JAHA 1QX3A 2HJRA 4JCZA 2I15A 1UDBA 2NSGA 3C1UA 3DTTA 3PNLA 3VR2A 4DMRA 3ND5A 4I9NA 4XYLA 1EE1A 1PK7A 3PWKA 1JE0A 2V0NA 5KCMA 1T9GS 3SC2B 1EFAA 3QG1A 2GESA 1DJMA 5CD1A 4B3TB 1SU8A 4JL6A 4AIDA 3ND9A 1O03A 2H9AA 1CUEA 5BOVA 3T95A 4GGMX 3LHDA 2RK4A 4DMKA 2FLVA 2DFVA 4R9VA 1FMVA 3ILSA 4KDEA 3UXHA 3WHKA 2AOUA 1I4EB 1AUPA 1PGQA 3ZNQA 5CA0B 1GPDG 3F2IA 4IGEA 4U2BA 4KREA 1PYDA 4H4CA 4HUQA 5K0JA 4EBKA 3HLKA 1Z6AA 2VQEE 1H66A 3A2NA 4Q47A 3C24A 4NU8X 3QMKA 1KDRA 1QPUA 1LS6A 2XAAA 3NUZA 4MVJI 4EPRA 3H99A 4F06A 9GPBA 2PRYA 4JQOA 2WBLC 3KXPA 4G5SA 3ZH2A 3RUEA 5JFOA 3JZAA 4G0YA 1FTNA 2A7QA 3FVYA 2VH1A 4KKVA 2NYVA 3W1WA 1CY2A 3S1LA 2EKBA 5L0HA 2IQ5A 4J0CA 1XZPA 2I34A 4L8VA 4P92A 4XIJA 5EZYF 3ZWPA 4EA9A 1O3YA 5KYVA 1I33A 3FKSA 1P9WA 3LT4A 3LWDA 3U0BA 1AZWA 1Q15A 2GO4A 1QQ5A 1W93A 1KZ9A 3GNLA 3R3SA 1NMXA 2FMXA 3DLHA 4ARCA 3I2YX 1HX7A 1IONA 3ZHSA 3NFYA 4YCAA 2H2HA 1CRPA 4OXYA 4XR4A 4N4AA 1F4PA 2GSDA 2I4OA 4UUAA 4AZSA 4W1SA 2LR0A 3R3ZA 4ALJA 3G5AA 2GWWA 1EX1A 2Z56A 3IMEA 3PS2A 3DE8A 1PYGA 3K05A 3H4TA 3SJ7A 4JI2B 1KMHA 4BA2A 3AW8A 3GLLA 1OSNA 4ARUA 2OG2A 4TZ6A 5BPFA 1L4YA 2X15A 3R74A 5IX8A 3OLYA 3IE1A 3GLIA 5K3SA 1E9SA 2IUEA 2R48A 1TAUA 5HX7A 1G8PA 3GORA 3I28A 1A2OA 2F8MA 2YZKA 3SVZA 3SZGA 3PHLA 2XECA 1B63A 3W2FA 5JPCA 1B8PA 4M88A 3EVAA 5F4ZA 1KAOA 1ZMXA 4ZMSA 2G9VA 2PZKA 4UC0A 4LFAI 1VSVA 3INYA 4GGPA 1P7VA 3NBXX 5GAJA 5JCZA 2XSZA 3D2LA 4GLLA 1ZGCA 2UXCI 4OXQA 4DSAA 5KWEA 5CX1B 2VHXA 3MMZA 1J2EA 1E9VA 4XEKA 2A5LA 4QUDA 4HJRA 1U0NA 5ELLA 2WQ6A 5KX5B 4CLRB 5BN3A 4CIHA 4DV7E 1XTRA 2YHIA 4RFSA 2C5EA 1ZH8A 3O7WA 4G9EA 3JRWA 4D42A 1AHPA 1OUMA 1JI3A 2V5UA 1T8SA 4G1EB 4AKIA 4NBTA 4UBOA 1K27A 4JLAA 4WRRA 5JASA 2HF7A 2MYTA 3TR5A 1FYWA 1U8YA 5B3IA 4QDTA 2IHVA 3HDQA 5SZIA 5BV2P 5TLSA 1NFRA 1VJCA 3CLUC 3KFXA 4ZU6X 1NLFA 3PQ5A 2XCQA 4ALIA 2QRVA 5AM0A 3R40A 3U7FB 3M4CA 3O2QB 3PI7A 3U9TA 3WMXA 1UJNA 5ALYA 3QPCA 1CLUA 2HXSA 3EE6A 3U80A 1E3SA 2FEAA 1N36B 5T8KC 2WD7B 5I4KA 2Z04A 2IYYA 1E64A 3G2MA 2XLCA 3IBTA 1RMVA 3E22B 4I99A 2D1RA 3K8YA 5I9BA 3TBHA 4A8PA 2BP7A 2XA1A 1V25A 3OCWA 1WEKA 2GA8A 1GDHA 4MCAA 4OHUA 4CGYA 1R5OA 4F72A 5C35A 2AUNA 2JI6A 3MGCA 4IDGA 2X13A 4OHMA 1WASA 2FW8A 2O3UA 5D01A 3TTSA 3WQSB 1E3MA 4WH0A 3TFOA 3PTAA 1PBTA 2C2ZA 1HV8A 3LOPA 1B73A 1U6IA 4TT3D 1CRLA 3JD2A 4DR1B 1E20A 2ZRBA 4IH9A 4LZOA 3AB3A 5HBRA 4AWBA 3CINA 2CHVA 1G3UA 3IP6A 2NTJA 4PYRA 2ZRCA 2A1DD 2DTXA 3JASB 4HR7A 4DXLA 3OT5A 1XJQA 4CCSA 4ZK2A 3LY7A 2VP6A 2HC9A 1NSYA 1I3OA 3ESCA 1YHCA 3G6KA 3MGBA 5F5NA 4RH3A 2IP1A 1D9ZA 3A6ZA 3LUGA 1M2OA 3ICEA 1YZNA 4Z0NA 2DFDA 4RA9B 4DIOA 1ICEA 4JLBA 4UUBA 1RRGA 3CY6A 2HQOA 1N33B 3U56A 1R1DA 3VHQA 1K9SA 3MQ2A 4YV7A 4OATA 5A0TA 4Q3OA 4EKIA 4ER5A 2R7QA 1E3WA 2PGDA 2QG9A 3H18A 4XJXA 3VR3A 3BWCA 4EHKA 1T2UA 3GONA 1P8JA 3RVYA 1MGOA 3Q11A 4X3OA 1TYDE 4R31A 3B70A 5AXCA 2GZMA 4Q1BA 3OFVA 5MN6A 2F90A 2P6UA 1Z26A 4KYUA 4YBZA 3E48A 1XZEA 1KEZA 3ZCUA 5GJBA 1YZFA 2KQ9A 3MC1A 1KQ3A 1YVDA 3CO5A 1A9SA 3O1HB 2V65A 4IMIB 3ANTA 4M7PA 5ILQA 3OQIB 4B8ZA 4YRZA 5H5JA 3R5XA 1S0UA 4H7EA 3L7OA 2IIPA 3UHAA 4M36A 1Q95A 421PA 3W2IA 3QY0A 5DYIA 1QCDA 4M2LA 3SF8B 4AY3A 1YAJA 1NNI1 3H16A 3H17A 5EUMA 1O5OA 5MN4A 5L4LA 5DTQA 2Z5CB 2HUPA 2VT7A 3PFBA 3AEZA 5DEIA 1HNZB 4EBBA 4AG5A 3CUKA 4XPZA 4EPVA 4EVRA 5HZGA 3LW8A 4WCFC 2HHHI 4BQQA 1IWOA 1IZ0A 4IDFA 2FZGA 3UA4A 3ZHXA 4F86A 5K09A 1ZLXA 1Y80A 1FP4A 4WGZA 2B7LA 2UVPB 3FVQA 3GLHB 3VI4B 3VOBA 3L82B 3THWB 1L4EA 4KXLA 4FHEA 1KFCB 2BGIA 1EVZA 5KU1A 1FPQA 3D3JA 2F2TA 2JLQA 4R40A 1MU0A 5DP1A 3WKCA 3KTOA 4FTWA 4C1BA 4DCGA 2HYIC 3MQFA 4D6PA 2HZBA 3GFSA 1MTOA 5J2UA 2HREA 2OV8A 2F8LA 3HLYA 4M98A 2VRNA 4KIJA 5J5CA 3TDKA 4C3VA 2RGGA 2UUAB 2F8SA 5K03A 2XCTB 3BMOB 4MIEA 3KJFA 4EL5A 3S6JA 1YA6A 1V16A 5EJ9A 2ANCA 2R1VB 3T1YI 4CLRA 2HHJA 2XUQA 2Y1XA 4N54A 4F9TA 4F4JA 3WI7A 1WCIB 4CMBA 3HNJA 4FI3C 2GA9A 2LW7A 4ZOLB 2P78A 2ZB3A 3K0FA 1HE1C 2XMZA 3VBCA 1Z8NA 5KS2A 2HFUA 4KQJA 3U1YA 2HK7A 4PYOA 3DD6A 3ZUGA 3PJRA 1U6KA 5AUNB 3ZS9A 2Q2NA 5LWQA 5KYWA 3IHKA 2WU4A 5GPGB 1PI3A 4LX0A 4R2LA 2PE5A 4KVAA 3UAWA 1P2GA 1KKHA 3M8KA 4BNDA 5FQOA 4EMSA 3AEQA 4DSTA 1E7YA 1EGVB 3OPXA 3KQUA 1LV8A 2I80A 4IX1A 2NU9A 1YU6A 1MRSA 3L0PA 3VJLA 1VC2A 2PZFA 2FPIB 4J1TC 2JIQA 3PFKA 1R8YA 2QJOA 3C5VA 5HUHA 5JPDA 1CHNA 4QVGA 2Q1XA 2VDRB 4MW0A 2R84A 2HW8A 3K9LA 4PFQA 2QUPA 3DI5A 1IY1A 3I4UA 1YFKA 1C9KA 4F1KA 1Y9EA 5TX7A 4M3NA 1N4AA 5KOHB 1RWBA 1W73A 2F64A 1KORA 3E8XA 3GGDA 3IEEA 4DR2B 2BH9A 4IDQA 2PR2A 2CUTA 4HPJB 4RLSA 4YJ3B 5EN4A 1DBWA 2AJ8A 1ZISA 3IQDB 4Y6QA 5HJ7A 2AXNA 2D0DA 3FZNA 4HB4A 1O54A 4WUCA 2SBTA 1AKUA 2CDBA 3A4YA 3DEIA 4GOND 4RAQA 3K0AB 3I2HA 3Q12A 1E94E 1I2MA 2O0LA 3D6JA 4OQMA 1ESCA 3ZEIA 4HQKA 2QY9A 4MU4A 1JU9A 4QQFA 2QN8A 1QYCA 4J7YA 4KC9A 2BFFB 2ZTUA 2BHSA 1MUUA 4FOTA 2Q7OE 3L4EA 2DQZA 4MVJA 1AS2A 4NEQA 2OQMA 1FUYB 4QGBA 1OFUA 4U7TB 3S2YA 4QYXA 4BCBA 3QNWA 3G88A 4J4HA 3GODA 1FVHA 1P2TA 2XOEA 1B0ZA 3JCUQ 5EMLA 1WUJS 3EA0A 2LZ0A 2WM8A 4XQ1A 4S0ZA 1PDOA 1XF1A 3DW3X 2JGAA 3DZGA 1GRCA 4ZU1X 3TQHA 4P08A 1BGWA 1TQHA 5F73A 2B4TO 2VXBA 4LLEA 3QX3A 5DN9A 3KO8A 4P6VF 1TE2A 2WA2A 3ADDA 1BWQA 3G4ZA 1T6NA 1U90A 4DT1A 4YQFA 2IHTA 3AJMA 3UH1A 2OO5A 1KO1A 2IZOA 3NTUA 1KP3A 2YCLA 1NURA 2UUIA 1UK6A 1A7AA 1N2JA 2I7VA 3QF4A 1QZRA 3HULA 1XEFA 4FGSA 5BR8B 1Q7CA 3HKDA 1MFZA 5JY6A 4HS4A 3PGVA 4DADA 1HSOA 1ZP6A 4XTJA 1OR8A 3TBFA 5BSTA 3VNAA 1C14A 4C0AC 1PD1A 4NMXB 3VPBA 4P3PA 4AMGA 3D1VA 4O0MA 1Z7GA 1MT3A 4KB5A 1X8LA 2ZUUA 2W83A 3WLNA 3DMNA 1K6JA 4DUGA 2QTHA 3B51X 1CY7A 1A9YA 3OEOA 2V6MA 2KB0A 3DVAB 3IDQA 3R4VA 4PRXA 4IZ6A 4OVKA 4XVRA 5IBRA 5JSKA 3L7AA 4S05A 1OT5A 1H9CA 1CK4A 3NAZA 4JTAB 4L7QA 1HKUA 3CSDA 4TRRA 4CIDA 2GCIA 2BKUA 4WW0A 4XWGA 4A0QA 1QQBA 2PO0B 3B12A 4HB2A 2H31A 4NXNB 1G17A 2I7TA 3MRVA 1TLTA 1WKCA 2BI4A 3RYIA 5JJIA 1PZEA 1JFLA 1RREA 2JW5A 1ZJ6A 4FEYA 4WZ6A 2ETVA 3CNEA 1CJMA 3HFJA 2C5SA 2A2CA 3FA2A 4HFNA 4RDAA 4NCIA 1QRUA 2ZXWC 4H77A 1JEDA 1A2BA 1ZOIA 4EKEA 2PKEA 3RS8A 2RK3A 2YX1A 3PTLA 3BCHA 1MJNA 4FC6A 4G09A 1GR0A 1XAJA 2JK0A 3K6RA 3KPWA 4I1SA 1OV6A 1U7WA 4ARBA 4ERXA 1D5CA 3NV9A 3EBOA 5AT1A 3EFEA 1UCFA 1SBNE 1ZMTA 3V42A 3WDMA 5BVHB 1KZ6A 4W63A 3BC1A 4ES6A 4FW9A 2QTGA 4U8GA 4WVLA 4DKXA 5B55A 1VCIA 2QPLA 3EWNA 5IJ0B 2F22A 3AU8A 2Y1WA 4HWGA 4IKOA 3WSWA 4CIXA 5C5EA 2GPSA 3WGLA 2W98A 3WNZA 2WDPA 3EC2A 4DWWA 1IZMA 3QPDA 2ILTA 1XZQA 4G2NA 4GPTA 5AOBA 4X91A 5BMOA 4IFDB 4YIKA 1JR6A 1Q83A 3EZ2A 1M2HA 4ZEWA 4DZZA 3KMIA 4JT4A 3NJRA 5HCUA 4HP8A 3HWRA 4U39A 1HZZA 3FOPA 4PVDA 1HPLA 2FCAA 2F1KA 3HVUA 2QWXA 1W5EA 5DM4A 5F78A 4AF7A 5I7WA 1NVWQ 3EVFA 3VTZA 1M2VA 4TM8A 2CVOA 2VJMB 4TMVA 4HLNA 3LPNA 3AI7A 2F17A 1QIGA 4W5JA 5ILGA 2OZVA 5BO5A 1O0CA 1ONSA 2OPHA 5E3IA 3REOA 2CDRA 2JIMA 3SDBA 3SSAA 4A4AA 1X7ZA 4JAVC 2ZRPA 3LUFA 4ZDKA 5FLXA 1U3FA 1PN3A 3A37A 5IJZA 2EW2A 1TLLA 1ZIOA 3AEKB 3G5TA 4XM2A 1CRQA 3MBOA 1CYDA 3DXZA 1FQKA 4M1WA 4CM5A 1Z17A 3KAJA 3L43A 2IYLD 1QU2A 2PNMA 5JCPA 2WJ6A 3B5IA 4B6EA 3T9FA 3VU9B 2VN8A 3BVPA 4KK3A 4QLBA 2IH4A 4CFYA 4R2XA 5BQOA 1DIGA 1JN0A 2OCDA 5TB5A 1K75A 1MRZA 3SDSA 1KI3A 5LBUA 1QOPB 1R50A 2A6PA 3VAAA 2AW3A 3WWCA 4LF5I 2RKOA 4PR0A 1WZUA 2QTNA 3QYAA 1TJ5A 2IL1A 2W6NA 4G5OA 5IUJC 2XZDA 3ONNA 3RKUA 2G0AA 1ZA2A 4BASA 1CPYA 2MSNA 2NYRA 3S2IA 1IK6A 1KEUA 2W2QA 2BRUC 3PL5A 2RAPA 1ND5A 4PICA 4QDZA 5EA2A 3PK0A 4ND2A 2QD4A 4AJLA 3LECA 1XRPA 1Z0BA 1DO0A 2GHTA 1EK1A 3WA7A 3S7ZA 5F3WB 1RWXA 1D3AA 1EGQA 2M9MA 3CLRD 4JS0A 1J0DA 1WXXA 4U6QA 5LIRA 3H19A 1M73E 4JOQA 1F48A 4JI2I 1I4ZA 4DG5A 1RT9A 4MIKA 4B3SI 4YFVA 2DC1A 5KZMB 1FFAA 1SG9A 2C38A 1U2SA 2BM1A 2JBHA 3QLEA 2GPNA 4GLBA 3GIDA 4XYMA 3UMGA 2AF3C 3Q41A 2NU7B 3QMWA 3ZCQA 5LLSA 5JLIA 1NX9A 3OQPA 4IJ6A 2ZYSA 1CJUC 4MYTA 1FFXB 3AR2A 3SJUA 2IY7A 3HMKA 3U4DA 4F2DA 4LTNA 4GT1A 4UPVA 5AIBA 5LPNA 4YMIA 4RMNA 2V6JA 5NULA 1NP7A 5CBPB 1YIDA 5B30A 3OAAA 2GYYA 2PP4A 3WL5A 1OXTA 3DVLA 2MHRA 3BSSA 1FJ2A 2WMNB 3SSNA 4WUDA 1GU0A 4QPCA 3WFZA 4DR5I 1I4WA 3MS2A 4UUOA 4LBZA 1Z83A 2IIBA 1PNRA 3TCNA 4IZKB 2BA0D 1TF5A 1UJ5A 1CZNA 4DPXA 2J07A 3HFSA 3NALA 4QOSA 3S2EA 1QF9A 4H4DA 1Y33E 3KSAC 5FV7A 2JLVA 2AVKA 1H23A 3ABRB 1E2GA 2XYVA 4NYMR 4AN1A 3ABLC 1W2HA 3DDSA 4L3OA 4PZZA 3HXPA 2BA0G 3QJYA 1MMGA 4H59A 3ADOA 3E8SA 1RI3A 3MMXA 3Q4GA 1RHRA 2COEA 2GXQA 4JD5A 1UWCA 3A6GA 5LDGA 4RTLA 4LI0A 3G89A 2XQGA 1O2DA 4DZTA 4CIBA 2YWGA 5DB4A 4EJMA 2HV6A 1D0VA 3TQFA 3FYUB 4F21A 3T15A 3ZY3A 1ZGBA 1AVTA 1Q92A 1Y7IA 4JI3I 3CNBA 2FW0A 1U6HA 4LDRA 2VPIA 3QHAA 3F6BX 3OOSA 4EBJA 4I5IA 5HJEA 2JGLA 2W6JD 3O7MA 1G18A 2QYOA 1YGYA 3BBLA 4WFKA 1KZ4A 1J1UA 2XPCA 2WF9A 2O3RA 4GYKA 4JC0A 4TRMA 4XPXA 3KD2A 4DDVA 3FRJA 1XHEA 2PZJA 1JNYA 5B1HA 3DVQX 4ZVTA 3U31A 4WABA 3K72B 4HFMA 1XEXA 4MVJG 3RM3A 3EGDA 1XT6A 2HKEA 3N2KB 3EXEA 5A2QA 2DHQA 4V0OA 1HZZC 2DZDA 1JQJC 1KH1A 5FWXB 3GFTA 2M1XA 1IBSA 3THYA 2R2GA 4M9SA 3KWLA 1CVRA 2ZSFA 3JYHA 4M8IA 5H9WA 3K6BA 2CV0A 4AS1A 2JARA 1DAFA 4GMXA 3CISA 2UXCE 1Y42X 2PAFA 2ZBUA 1PCXA 4NJEA 5DTIA 3KETA 3B0UX 4LFAE 4BJ3A 3C62A 5EEGA 3SZRA 1T6UA 1SB9A 1XG5A 4OKNA 3C18A 4PSDA 4EGSA 4YPVA 1PK9A 4HDRA 5BRNA 4EIYA 3I1JA 3IR7A 1FIUA 1VPTA 5AKYA 4C3ZA 1ULTA 3SICE 3TQCA 2OORA 4MRNA 4DB4A 3JSZA 4R1FA 2Y05A 2IOPA 2BGTA 2GR9A 2WVGA 1HMOA 1VSBA 2XUJA 3PX2A 3VDRA 4ZEVA 5LNK1 4LJRA 2Z1NA 4OG2A 4OQNA 2W4BA 4OYHA 4N06A 2GEDA 5FWXA 4KR9A 5FLXQ 4JVLA 5AI5A 4IQFA 1I7LA 1YC2A 3OPYA 4FYYA 4YJFA 2JJYA 3SY8A 5FUQA 3ZJVA 3V4RA 3KSZO 1IXZA 2YXPX 4ZVSA 1CS0B 1LPPA 3H83A 2VYVD 3BM5A 3PD7A 1JJFA 4NQFA 2A86A 1NRIA 2H59A 4ZQEA 2ID7A 5HIAA 1KC1A 1SVIA 4KKXB 3JQ9A 1K0FA 3AUYA 3IQGX 1YI1A 2Y67A 3DBOB 1FQJA 1SQGA 2AXQA 4GXTA 4ZRMA 1JEQA 2FGKA 3HV0A 4D8UA 2GEKA 3PD0A 4HNAA 2V8PA 1FX0B 4PCLA 2ALJA 4DQUA 3VKWA 2XTNA 3JTLO 2MDTA 5KNCA 1US8A 3A04A 4ABTA 4AY4A 4Y2UA 4TXJA 3TF5A 3SIRA 4EARA 4ZI7B 4YCLA 1OTXA 2Q6VA 3DEZA 4MQFA 4ZN6A 4DR5E 2R00A 3ELBA 3LPMA 4KGXA 2DM6A 5EE0A 3V8PA 4OXXA 3C41J 3JALB 2PO1B 1RAFA 1XMPA 3MILA 3D1LA 3GZ4A 4A3SA 4BZWA 1FLVA 2BTOA 2HO5A 3WYAA 2WB7A 2RHCA 3UK6A 4CCWA 4OX9I 4RD0A 2FI1A 4DAEA 1NV9A 2DB3A 2RAVA 3U26A 3GVIA 3RW9A 4QG3A 1N32B 1PWXA 1NVUQ 3AUXA 2Q9CA 4DRHB 3RLFA 1ECJA 1XCMA 2O3TA 1BNCA 3U3OA 5LXTB 3ZK7A 4BO1A 3NBFA 3WMGA 1O5HA 4OO1A 1X9HA 4J30B 1UKEA 5K2OA 2JLZA 1UJ4A 4EYSA 4MP6A 1YVRA 1RKCA 3ENWA 2X36A 4K9NA 2XODA 4I44A 2CHEA 4HQNA 4ZVRA 1ZCJA 2W70A 1E66A 1OAAA 4P35A 1C41A 1M8GA 2ZR7A 3OM0A 3GNQA 4MVJF 5C0XA 4UTOA 3RS3A 5HZMA 5JP7A 1D7AA 1ONOA 2B9VA 2HFIA 2XCSB 4W8PA 1X7XB 2BGLA 4B3RI 1MG5A 3DE0X 2GO3A 1NPTO 3H8WA 4KXXA 1T6XA 1MTZA 3BRCA 3DLIA 4N6CA 3DWGA 3JWPA 4X7MA 4BX9A 4UMVA 4EP1A 1E4EA 5KOJA 2GLXA 1QYWA 2FPIA 3G4XA 1C7FA 1NQ5A 1SHUX 1YI8A 2PDAA 4GNKA 3YASA 3EVTA 4FFBB 3UAXA 3O3MB 1GR1A 3H1FA 3TG8A 3EPKA 3QIAA 2ZR9A 2QTCA 3RIYA 4ZHQF 1QWOA 5FPHA 4UUPA 1Y1PA 2FPMA 1BYIA 2P41A 2IHZA 3Q2IA 3V2IA 1SWVA 2H29A 2R96A 4Y1RA 5LZ4A 1IN4A 1SHLA 4X7PA 3HY6A 4ZOAA 2XCLA 2CDQA 2TMDA 3AERA 3EXFB 5K4AA 4YCCA 2P67A 1J97A 2IEBA 4O02B 4RXUA 2EKQA 4HHEA 4ZP1A 4DMHA 3GRZA 4JX8A 3OKFA 3HU5A 4LACB 3EULA 3BD9A 1GIAA 1K86A 1FDVA 1U2TA 3E9ZA 3TGLA 2Q1WA 3QITA 1I80A 3QK7A 3JQPA 3OIWA 3TK1A 1C3XA 4D3XA 3L7ZA 4NE2A 5DWQA 1KJJA 3C45A 1ZM4A 3ABQB 3DJFA 1LGYA 1WSWA 1DP4A 2NSLA 1XJ0A 3DOOA 3GB9A 3GK3A 4DR1I 1WW3A 3OZAA 4P7JA 4QBGB 4RZQA 5LQMA 1EBUA 4G56A 4V0MA 1AQUA 2J67A 3ROMA 1MGPA 2MSWA 2QX4A 1LLFA 2CXNA 4EUKB 2BGMA 2PT5A 3DQPA 5ALUA 5C18A 4PC7A 3I9FA 3PS3A 2EG5A 3SP1A 3T5MA 3OT1B 3OQMA 3KT3A 1U2ZA 1ZBQA 1UXJA 3C6YA 3P0IA 3OSUA 4RV5A 4E88A 2FW7A 1CQXA 4QJ5A 3BH0A 4B3SB 1LJLA 1ZVMA 2P1ZA 3FYUC 3HG7A 3SLRA 4A0SA 3UFXB 621PA 1KPIA 2A7XA 2XHEA 2WUGA 4H7IA 4D0GA 3OEED 2CBZA 3HJHA 3CNNA 4RNDB 3H3JA 4QM6A 1DIAA 2P0YA 1QV7A 1FFEA 2QX8A 4FC7A 4FUQA 2XBMA 3MRSA 2MSDB 1VCNA 1KNQA 3ED1A 3FJYA 1ZHTA 3GZNA 2OO5C 4V0LA 4YJ2F 3UJCA 3ZDYB 4B3MB 3HR4A 3WP0A 5K05A 1UC5B 3UPTA 2YRXA 3WLOA 4PR9A 4QICA 3D8TA 1VOMA 4UE2A 10MHA 1YL7A 3EPRA 2BUCA 3N6RA 2G9RA 4L8LA 4OD0A 4QVKA 2IBSA 4YLEA 5E6SA 5LQDA 2H7BA 1FX0A 4MRVA 2NN6B 4BLVA 1AMNA 2B5VA 4GI2A 4DDWA 4G5FA 4EGCB 1WTCA 4UJ5A 1XROA 1AD2A 1UDAA 3L6BA 5T5QA 3KQKA 1L6IA 5ENZA 2BGGA 2P35A 2QZZA 5D6OA 3S2UA 4YUWA 2DPGA 1WWPA 3SZOA 1CZOA 4CR7A 3RYIB 1E3HA 2J3QA 1P2BA 3CPHA 3BFXA 3KQLA 4KDRA 1OIXA 3A3PA 3I9V1 3OZEA 1J33A 5AOVA 2PEYA 1WDKA 3BIJA 3G59A 3TKYA 3O2JA 4O2BB 4KR6A 4PSAA 1H94A 4B6RA 2BJVA 1C1DB 3JSAA 2W2LD 2HPAA 3IAS1 5A4MS 1TL7C 1SZIA 5P8WA 4AMUA 3RQFA 1PEAA 5EPUA 2E48A 2AE8A 1DAPA 1JU4A 2EWVA 3O1IC 4P58A 4UU0A 5DTJA 2Y3BA 5BQPA 3SQDA 3O93A 4FWTA 1KNYA 1GU7A 3KHTA 2IOQA 1INLA 2O8NA 1AA9A 3M6FA 2OXIA 3X1MA 3MT9A 3TQIA 5LP1A 4MW1A 3Q3CA 2QUKA 5LU8A 3WU3A 2IEIA 1W19A 5CU7A 3RJ9A 3ZBUA 4BQNA 1WY7A 2H1SA 1DRVA 2VAMA 3PQCA 3UMKA 4HN2A 5WRFA 1FR0A 3J80C 1Z6ZA 2CCJA 1EA8A 1OA1A 3WO0A 4DCJA 3DHVA 1P9OA 2CD7A 1SUAA 3OTGA 4JR2A 1NWHA 1QK3A 2KS6A 3H4VA 1BXKA 1YC5A 2WSSD 3SSOA 1K8YB 4ZKDA 1RZVA 2IFTA 2I1QA 2CXRA 1V26A 2FTKE 2BISA 2Y69C 2R7UA 2IUSA 3TW8A 4B6GA 4A7PA 4BNTA 3OQ1A 4HNTA 5IF9A 2ZRKA 4C4RA 4C0KA 1AQJA 3ZWOA 1DEXA 4C7OB 2ZEJA 4MR7A 1WMDA 3OP4A 5A4FS 4KOAA 1L3PA 5GONA 3DLAA 3EZHA 3IRUA 4P6IC 4LFCI 3NT2A 4QQ8A 4U2FA 3UH0A 2VF8A 1N0VC 1YRWA 3RK1A 4TQAA 1K89A 3KPUA 1IUPA 3VR3D 2ZWIA 3FBWA 4F4FA 3AU9A 4P4LA 2ZTSA 5EL9A 1CJTC 2C9CA 2R6ZA 2DBYA 2YHBA 4N5DA 3RNLA 4JCCA 3VOSA 3O31A 2QRVB 1HDCA 2ENUA 3VX3A 4H27A 1SXQA 3N58A 4POAA 2QRGA 3L06A 3DL0A 3MMSA 3QZCA 5ES3A 4KJXA 3O3CA 1LPBB 1NNEA 3IEMA 4Y6LA 4ZJUA 1LK7A 3K4PA 4RM2A 2X58A 5K6RA 3QSGA 4TV8A 4TMZA 4N41A 1WV1A 1N5OX 2QJRA 3ZKWA 1JAFA 1NW4A 1SRRA 3UAGA 3FYHA 4EB0A 4I4TA 1VPWA 1NC1A 4BO0A 1TXGA 3A4TA 3DPUA 4E22A 2R62A 3NANA 2D7DA 2CMKA 1W35A 3H5AA 3P97A 5IEBA 4OIFA 4OI4A 3B7PA 3E2MA 2ORYA 4P36A 4UCQA 1TYZA 4DCUA 3VA7A 3LVFO 3HSYA 4JOBA 2O8CB 1KPHA 1F2UB 3GY0A 4F93B 3RADC 4MS3A 3GEGA 1RMTA 1KJIA 3EMDA 4IHKA 4Q4HB 3JAKB 4GOJA 3RS9A 1NR7A 4ZT3A 4RY0A 4HEA1 3QKIA 2H92A 3T5GA 5DI9A 5FBWB 3BERA 3W4KA 1JEOA 5EWLA 4ZV9A 3GJSA 4DA0A 3CW9A 3RFVA 2VZ9A 2Z8YM 1U3TA 5HOEA 4WHMA 3VXKA 2D8MA 3FD8A 4WZAA 3LC1O 2X2OA 2O2SA 4H6VA 2JFVA 2YS6A 3BKXA 3CWQA 1JLKA 3M5DA 4EG1A 2VG8A 2OXTA 5D5QA 4AC9A 4F7DA 2Z2KA 4FCVA 3OJLA 4GWGA 1UK8A 2HIGA 1OI2A 2VUSA 5G0SA 4OBWA 1OIVA 1PK8A 2GZSA 3OUUA 3GFQA 2CV2A 4A16A 4A8JC 3PQ6A 1ZIXA 1XNQI 4MVMA 1QRDA 2HBYA 2P7IA 1VIVA 2YQZA 4GYJA 2V5AA 5EKXA 5AW4A 1HNWB 1ND6A 3F8TA 2ZFUA 1DC6A 1H2XA 5JQGA 1Q0UA 2O2GA 3QXXA 4N49A 3WLPA 4KI0A 3VQTA 1N3IA 1ZI9A 1QKRA 4OB7A 1G8KA 1G6HA 4DV6I 1ZUNB 2C59A 2H7XA 1FTYA 1Q6ZA 1TO2E 4IJQA 4PHCA 1LPOA 4ILEA 5E6RA 3DL7A 3C7DB 2QQFA 3CRVA 3BIXA 4HDSB 4KMRA 4H3VA 5FPTA 5JMOA 4IXTA 4KLZA 2ZCJA 2NQTA 2H9YA 3FKJA 3ECCA 4YHHI 4MWDA 4MPPA 5B36A 1U8XX 4DV5E 1M54A 1Z18A 3GJ4A 4L76A 1QKIA 4LK2A 1F7UA 3LYLA 1E9DA 3CT4A 3TW0A 1YUNA 1PZNA 5BW6B 3ZBPA 4L7VA 1ZIYA 1F2TB 2OUIA 4MUYA 3DBLA 4JP8A 3IESA 1Y1LA 3W1EA 3TDNA 4RV4A 2X9LA 3L0BA 4J0DA 4OKSA 5JS1A 2QG6A 3KELA 1R6DA 4JHLA 4J0IA 4XOIA 1VHLA 2Z4RA 3ME5A 3OCXA 1BE8A 2HQSA 2WU1A 1R0LA 3EF3A 1YBAA 1LBSA 4XYBA 1T4BA 2FR8A 4X45A 1GVHA 1VG1A 1UADA 1WRBA 3TWOA 3HADA 1Y3IA 1NKSA 3GUUA 4WJ0A 4JB0A 4WLNA 2H4WA 2ZTLA 5J40A 1PR4A 4CNBA 4OA5A 3A1NA 4LPFA 2WWHA 4C9BA 2GF0A 2R7LA 3BS4A 2HHHB 5LL6R 1MMAA 3L2OB 1GNQA 1R6BX 3Q3HA 4BS9A 5JZMA 2NOAA 3WYDA 3GPCA 2XUZA 1FSSA 2W7TA 1WLSA 1RJDA 4PS1A 3ZGVA 1H5NA 5AKGA 5J23A 1B1AA 1MHPA 1OA0A 2CFTA 2Y4NA 2XIJA 1LSUA 2OHIA 1N7HA 4QUEA 5A05A 4BJTA 2I1LA 4TKMA 2PRIA 1IOWA 5IZ4A 1VYIA 1LS1A 1F4LA 2AE2A 4S24A 2IZ5A 1JQBA 1W5BA 4AO6A 2P2ZA 1XLTA 3DEHA 1W4LA 2F3UA 2GK7A 2BGUA 1P6XA 1R8SA 4JXJA 5TSDA 2X51A 1CETA 5DH9A 2PRSA 1JBKA 1R37A 2RGAA 2M6SA 5E9QA 3T7EA 5H3LA 4XE5A 2C2MA 1Z7YA 1KTIA 3JT1A 4J0KA 3H9GA 4J29A 4GS5A 3FF1A 4GEHA 2J7PD 4BU1A 1P1HA 3EQZA 3VO9A 4TLEA 4H6XA 4AP5A 2JHAA 5E1MA 2QP3A 2WP8J 3PQEA 4BYMA 1TRKA 3G0HA 2EL9A 5H68A 3PJEA 3FBTA 2PH3A 4Z0HO 5FLKA 5JXGA 4B6QA 5B4TA 1MAVA 2DHRA 2ARKA 3HTXA 1OW6A 3F96A 1PEKE 2WB4A 1YDIA 4FT4A 4D9CA 3M5WA 4M1TA 4K9LA 4P3XA 1VLVA 4TZTA 2A4KA 2H5IA 5C0XF 4PONA 1QHHA 1DB3A 5BURA 1HDRA 4YCNA 1UPXA 5EGYA 3FDJA 1S1MA 1NBEA 5TQJA 1PZXA 1U9ZA 1M1YB 4LZJA 3R24A 1NYQA 1HRKA 5DPMA 2ZDQA 4I6EA 1CJSA 5T4BA 4J2OA 4EHJA 4O3MA 3MQ4A 2PUCA 4DLKA 1I4TD 3SE7A 5KREA 1WLYA 4JA2A 1NM5A 5K8VA 3H3XA 1XFDA 3AESA 3BXHA 3E27A 4DLLA 2ZJ2A 3W9BA 1KMIY 3ZCVA 4D5GA 5CB4B 4ZO8A 1AG9A 1C81A 4LIPD 1KIAA 2ORIA 3UM9A 1M2KA 4JI4E 3GLGE 4FN4A 5CB0A 1HYHA 1NL3A 1TFUA 2UUCI 2WPDA 4D96A 2XT6A 2RH5A 1QFSA 1JSLA 4ZC8A 5HMMA 2I3AA 1KJYA 4ZVIA 2W48A 2DXIA 2QTFA 4YQEA 3HXLA 3H4IA 3IDOA 2BE5F 3CTPA 4EITA 4YAIA 1S4QA 1UBHS 3DEFA 4PZPA 4MDHA 1IK4A 4Q3DA 3ZW8A 4E13A 1SULA 4M83A 1HDYA 1XEAA 2OXRA 3HBLA 2GCOB 3VR5A 1G8SA 3II6X 1YJCA 5JZSA 4I1PA 4RLFA 4JODA 2N75A 4NVRA 1X80A 1OBOA 4BMXA 3FIUA 1UPTA 3QFSA 1JDTA 2HHLA 9ABPA 1G2OA 3LX8A 3RC1A 4QHSA 1RZUA 1XRNA 3BZUA 4B3JA 4UHHA 3RS2A 5FWYA 4WUBA 4L75A 5DSZA 1YASA 3QP9A 1N57A 1T01A 2BGKA 1JLHA 2EJWA 2DEUA 3IIIA 4IHQA 1A0BA 3GHHA 4GE3A 1BHJA 2VYND 4G36A 3KOYA 3S2ZA 3EGIA 4IHJB 2YVKA 4R3WA 4E11A 3NR2A 2Z6UA 1U7DA 3DOHA 3AJ9A 3ZG6A 4MJ3A 1LTQA 1Z59A 1QVWA 2QNIA 2AFVA 1IEWA 3FVRA 4X84A 1OWNA 4DDMA 4UOZA 5LJIA 3QEBZ 2KBFA 3OIGA 4CT5A 2L17A 3GROA 2AZ4A 4TROA 1XTJA 5JD3A 1B6SA 4ENQA 4F3RA 1Q0GA 2G0TA 4TKZA 5H7XA 5JT4A 4JGIA 4RKWA 1CCWA 5CPBA 4YJ2A 2B69A 1Q0PA 2PFDA 1I0IA 1VYUA 2FPXA 2RK6A 4ZZ2A 4DJJA 5CDYA 1ZVJA 2H2DA 4JX9A 5TMDA 4YV2A 5J1SB 3VYSB 2VZEA 3OHPA 4JI3B 2Z2XA 5SY9A 3GOHA 3W8EA 5L3SA 2BV3A 2UU9I 1GGJA 1N77A 4CDGA 4Z51A 1E1DA 3COJA 4WT7A 1FNDA 5JXJA 2JLBA 3RFTA 1SY7A 3GF4A 4M1QA 3B2NA 5KHOC 1NY6A 3K1AA 1XTPA 4GICA 4MV3A 1YZLA 4R51A 1RP7A 1NBIA 2DJIA 3SQMA 1VSQA 3K09C 1UFBA 1L4MA 3B7GA 5BWCA 3GJRA 4XQCA 3WNVA 3EY4A 2ID8A 4I1OA 5L45A 3EZ6A 3W5CA 2Z3VA 3WQRA 1QIEA 1I8TA 1Z5PA 3E23A 4KXUA 1A8PA 4OUKX 2FZEA 3V2UC 5ECWA 4KCGA 3H6KA 1U0FA 2A5GA 3C7TA 2KYHA 3OSZA 4FFVA 5F1YA 1JKMA 2ZBPA 1H69A 4D8XA 2IK8A 4USKA 1WCWA 1LLUA 3NV7A 1MOPA 3C48A 4PPFA 2P91A 2M6LA 1ISPA 3ENQA 4F45A 3E9YA 3ROEA 3DDZX 1UM9B 1AV7A 2EPLX 2FUNB 4NOKA 2O7QA 4QREA 3UHOA 4I3MA 1N7JA 4RF2A 5F9MA 4CS9C 5LIPA 5IJWA 3EXAA 3DE1X 4BXOA 5ESXA 2HDOA 3N8DA 3I9OA 1GV0A 1X7GA 4J16A 1ETUA 2GEUA 2ACEA 2B61A 1W4RA 1E83A 3EXHB 4TM7A 4OI1A 4CL2A 3F97A 1KBQA 2VCCA 3DT9A 1HTTA 3L01A 1LFDB 2E4WA 3IP8A 4FN5A 1Z75A 3NM6B 4I9GA 4LXUA 1Z0SA 1K8XB 3E1GA 2POQX 4O6VA 4BO6A 2WL8A 3N74A 3ROPA 1EFUA 4QBFA 4CRWB 2QDKA 4DZRA 1BOOA 1KZGB 3BXPA 3C3YA 4QZVA 2UUBB 5DGDA 2DEJA 4ZCLA 3ZV3A 4N3AA 1FFYA 2NSJA 4XEFA 2H2FA 1FVOA 3CZ4A 1HQCA 1UM9A 3D3EA 3EZGA 2IPAB 4G81A 5K3OA 3QE9Y 1Y7HA 4FINA 2IXAA 2KLBA 3T4EA 1KWKA 2JEAB 4IQ0A 3I6IA 4P3NA 3HJNA 1S3IA 4G97A 4K9DA 5ESRA 3B3JA 3HN6A 4XD7D 4QWWA 1MBZA 2PJUA 4IVQA 1UBTS 1CNFA 4AM8A 5DK4A 4QQRA 1PJSA 1CERA 4G78A 4OHOA 2B5OA 2HLHA 1KR5A 1ZJ4A 2AH5A 1WV0A 3AR8A 1N34E 4ULWA 2J0EA 2VHJA 2VP2A 4M54A 4BECA 4F3NA 2BE9A 4WL0A 4YQYA 2GN9A 4GRIA 1VMKA 5KSPA 1NSGB 2XADA 1OW7A 2R7RA 3ZBTA 2XLBA 1Q7EA 4A2NB 1BAPA 3NMUF 1GFSA 1U0SY 2XUIA 2H00A 1J6UA 2ERCA 2JI4A 1GEGA 1W52X 1XA3A 2NM0A 4HDOB 4RSMA 2FQ1A 4GPIB 2E89A 1OCCC 4UASA 4YRLA 3X2QC 1U04A 1VJ5A 3LD9A 5BYJA 3B3GA 2HJ3A 1R5JA 1T36B 2EZ8A 2PYZA 1ISRA 2A9QA 3D5QA 3RFXA 5D91A 1OIWA 3R77A 3VNRA 2XR1A 4KH0A 2XQJA 5DYGA 3WLIA 2W58A 1Z5NA 2DGDA 2IYPA 3WV5A 1T2CA 3ICOA 1FS5A 3ZQKA 2AKYA 2WZLA 5JEAB 1HF3A 2CHUA 4X66B 1L5MA 2E5FA 4U6NA 4URVR 1YFLA 1EK6A 2JVKA 2I6GA 2EU8A 1NAHA 2VIIA 2MIIA 3US6A 4FLEA 4PAOA 4KRFA 3CF0A 5FCLA 1UEJA 1TEVA 3P2IA 1C4OA 1H0HA 4H4EA 4I1UA 3EH2A 4KXWA 4NP6A 3UYKA 3VVMA 3VZSA 2RARA 5F28E 2ZYIA 2XGGA 1MD9A 3I8SA 3GANA 1XRSB 2N1BA 1IN8A 2WP0A 2QT1A 1QE0A 1T5HX 3Q0TA 3L4BA 4Q05A 4CKEB 1E2BA 2FWNA 2QSJA 1ZFNA 2OHXA 3N6XA 3U4IA 2E87A 4OO1E 2WW8A 2ZYGA 3E3OA 3LZCA 4XDZA 2OZLA 4HN4B 3H8SA 4OO1D 2YJ3A 2HRZA 4HN9A 3MWKA 4RTQA 3W6OA 1ORSC 1P80A 3EHEA 4ZAYA 4ENTA 4JBNA 3BXEA 4IEEA 2BYTA 1Y8QB 1TCCA 1BJTA 2VEDA 3EZ9A 2FFAA 3CJTA 3HJTA 4KSYA 4ECEA 3NRJA 2HK3A 4GD3Q 4XVHA 3P0RA