5FLXC

Mammalian 40s hcv-ires complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
DKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5flxC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5flxC02
1N33E 4JI2I 2ZBKB 1Z0VA 3ZZTA 2HHHI 2UUAI 4PRVA 5LMUE 4LF4E 4X65I 4DR4I 4X66E 2UXDE 1XHKA 3J7AG 4B3RI 5LMNI 1MU5A 4Z7CA 4NXNI 3V5RA 1Z0CA 5GMDA 2NPFA 4WUCA 2ZM6E 1WUUA 3T1HI 1H73A 3ZZUA 4X64E 4DV2E 2V2QA 2HFSA 4DXLA 4LF6I 2WW4A 3H4LA 4DR3E 1XNRE 2UXBE 4DV0I 4MYUA 4YY3E 2VQFE 1UEKA 1Z0TA 4DV7I 1XMQE 4DV6E 4JI8E 4JI5E 1FI4A 4JI7E 1FKAE 4LFBE 4B3SI 1Z5AA 4X62I 1H74A 4JI6E 4JI4I 2R42A 4DUZI 1XNQI 4FWDA 1FNMA 4DU7A 3QT5A 1Z0EA 2X7IA 1NHIA 3ZKBA 3HULA 3QT6A 3CWVA 4OX9I 1S4EA 4DPYA 4DR7I 4UTGA 1HNXE 4DR6I 2V8PA 2A2CA 4JI1I 1IBKE 4LF8E 4DV2I 1PIEA 3WU6A 1RR9A 1IBLE 4AQYI 4P52A 2J7KA 1HR0I 4RPFA 1NHJA 1FJGI 4DR1I 2E1RA 2BM1A 3PYDA 2UU9E 3Q1QA 5IWAI 4DV3E 3J80Q 3PYEA 4JYAE 1N0VC 4DV4I 4JI0I 2UXCE 1HNZE 4JI6I 2HKJA 3JAMQ 4LFAI 1S16A 1B63A 4B3MI 3OTOI 1K47A 2HFUA 4KQVA 1IBME 4LFCI 3LNUA 5IT9Q 2V2VA 4DV5E 4XTJA 4I3HA 2V34A 2R3VA 5BR8I 4LF7E 4ZVIA 1I94I 3J81Q 5FLXC 3GONA 3ZZ0A 4DR2I 4KHPE 4B3TE 4DPUA 1H7UA 2VQEE 1QZRA 1VISA 2HK2A 1N32E 4JI3E 1U2RA 4LF9I 1N36E 4JV5E 4LF5I 1Z59A 2F4VE 4DV1I 1OJ4A 3J7AM 1HNWE 4DUYI 2HKEA 1N33I 2BM0A 2Q2EB 4NXME 4ED4A 5LMUI 1XMOE 4LF4I 4K0KE 4FN5A 4M1KA 3M6AA 4DR5E 5LL6R 1ZM9A 1ELOA 4X66I 2UXDI 1N34E 4GKKE 4YHHE 2UUBE 3V2UC 1NHHA 5A2QQ 2OI2A 4HACA 2ZM6I 1J5EE 3QT8A 4GKJE 3J80C 2E5LE 3WU5A 1KTVA 2UUCE 2CZ9A 4X64I 1MG7A 1H72C 2LJPA 1Z5CA 4DR3I 1XNRI 2UXBI 4YY3I 2VQFI 1XMQI 4JI2E 1HNWI 4DV6I 4FWGA 4JI8I 3D4JA 4JI5I 4HXZA 2HHHE 2UUAE 1PVGA 4FW9A 3ZKDA 4JI7I 4X65E 4DR4E 4LFBI 2BV3A 4B3RE 5LMNE 4EMDA 4NXNE 1PKPA 4URLA 3T1HE 4MYTA 1ZM2A 4R1FA 1NZ0A 1HNXI 3B8HA 1IBKI 4LF8I 4Z7YA 4DV0E 2GS8A 1IBLI 4WUBA 4DV7E 2XEXA 1N0UA 2UU9I 3K17A 4PU9A 4DV3I 4FWHA 4DU8A 1ZM3A 4B3SE 3QT7A 4X62E 4PRXA 4JYAI 4DPWA 4JI4E 2VF3A 2UXCI 4DUZE 1HNZI 1XNQE 2A2DA 1KIJA 4WUDA 2V2ZA 5A2QC 1ZXMA 4DPTA 4OX9E 4DR7E 3F0NA 4DR6E 1DARA 1MX0A 3T1YE 4JI1E 3PYFA 1IBMI 1BKNA 3PYGA 3B82A 4AQYE 4DV5I 1Z0WA 5FLXQ 1HR0E 4LF7I 1FJGE 1FWLA 4DR1E 3K1JA 1EI1A 1H7SA 4KHPI 4P7AA 2HK3A 5IWAE 4B3TI 1RREA 4DPXA 2VQEI 2AJ4A 4DV4E 1N32I 1D6TA 4JI3I 4HACB 1Z5BA 4JI0E 5L3JA 3WU4A 1N36I 4JV5I 2DEJA 1KKHA 2F4VI 4LFAE 3JAMC 1Z0GA 4B3ME 1B62A 3OTOE 1ZXNA 4LFCE 1FWKA 3T1YI 5IT9C 2DEIA 5BR8E 4NXMI 1XMOI 1A6FA 1I94E 4K0KI 4DR5I 2X36A 4DR2E 1ZM4A 3J81C 1N34I 4HY1A 4GKKI 4YHHI 2UUBI 2ZITA 4JG4A 4USKA 2EFGA 1J5EI 3B78A 4GKJI 2E5LI 4USMA 4LF9E 3LPSA 3LTOA 4HYMA 1KVKA 2UUCI 1EA6A 1Z0BA 4LF5E 5GMEA 4LF6E 3WU3A 4DV1E 4UT4A 3ZM7A 4DUYE
chains in the Genus database with same CATH superfamily
2EMLA 1RC7A 5TSEA 1N33E 4JI2I 2ZBKB 3LMLA 2PO1B 2LVHA 1Z0VA 1QNTA 3ZZTA 2EN3A 2HHHI 3K6QA 1J26A 2UUAI 3AUZA 2O1UA 2EPLX 4PRVA 5LMUE 4LF4E 2LUPB 3UHMA 4X65I 2V89A 2JEBB 2NUFA 2EOSA 2DIXA 2V85A 1DI2A 5JEAF 3CDJA 2ADRA 4BBYA 5DROA 1X3CA 4X66E 2UXDE 1GZ6A 1XHKA 3J7AG 4B3RI 2DRPA 5LMNI 3EQ1A 1MU5A 1EH6A 2EPUA 2JYAA 4Z7CA 1X48A 4NXNI 1VI7A 4BA1A 3V5RA 5KL2A 1Z0CA 5GMDA 1UDOA 4WYQB 5KL4A 4WUCA 2NPFA 2ZM6E 1WUUA 2JEAB 2EM8A 3HXLA 4BA2A 2YRHA 3H09A 4GQUA 4FW3A 2YTQA 3T1HI 5K36A 4IZKA 1YUJA 2NN6B 5DNLA 3M85D 2LRSA 1HK7A 2D9HA 1H73A 2EL4A 1Y60A 3P3GA 5A6JA 2F1DA 3ECRA 3ZZUA 4X64E 4DV2E 4LTYA 4WXDA 4BHCA 2YU8A 2V2QA 2B3TB 2HFSA 5DRPA 4DXLA 4LF6I 5KL3A 2WW4A 2LO3A 4DR3E 2ELYA 2EMFA 4HEIA 1XNRE 2UXBE 2O1TA 3H4LA 4DV0I 3P3CA 4Q28A 4YY3E 2O1VA 4MYUA 2L8TA 2VQFE 1UEKA 1Z0TA 1T4OA 1XMQE 4KWYA 1WHQA 2VESA 4N3OA 4QNKA 4OO1A 2DSYA 4DV6E 2VF1A 1Y6ZA 2NN6F 3IWBA 1RQ0A 4JI8E 2LUQA 4JI5E 2YTPA 2GO3A 3HTXA 1A1LA 2EPCA 1T38A 4R2EA 5EKWA 1FI4A 2NA2A 4JI7E 2MDGA 1FKAE 4LFBE 1RHYA 2EE8A 2C39A 2K7IA 1UDQA 4M30A 1R6MA 2RSIA 1Z5AA 3L7ZA 4X62I 1H74A 2BR2A 4MU3A 4AIMA 2EQ1A 2Z5CA 4JI6E 1ZR9A 4JI4I 5CFFE 2R42A 2G7HA 2EPZA 4DUZI 1XNQI 4FWDA 5AASA 1X6FA 2C38B 2HJJA 1FNMA 2KONA 1UILA 3QT5A 4M9VC 4DU7A 1Z0EA 2X7IA 4J8ZA 2BBGA 1XXEA 2EOZA 1NHIA 3ZKBA 4IFDA 2Z5BB 3HULA 3QT6A 3CWVA 4OX9I 1S4EA 1Y4SA 4DPYA 4DR7I 3FIGA 2LTSA 4UTGA 2EN4A 4ZYHA 1HNXE 5AE3A 4IZJD 4DR6I 2EN6A 2FTXB 4M0VA 2EPOA 2J7JA 2AE8A 2V8PA 5FWKA 4F6MA 1IBKE 2L2MA 2A2CA 4JI1I 4LF8E 4DV2I 1PIEA 1WJPA 5AE2A 2YTGA 2JPAA 3WU6A 1IBLE 1RR9A 4DKKA 4AQYI 4P52A 4F2JC 2L2KB 4WFTA 2J7KA 1WHNA 2YT4A 5IXMB 4RPFA 2I13A 1HR0I 2RS6A 3BF2A 2PNZB 1P47A 2JE6A 1NHJA 1FJGI 4O4KA 2WBTA 2B9DA 3THOB 4M2ZA 2BM1A 2E1RA 2UU9E 3KZZA 4L5NC 4RHBB 1UBDC 2JY9A 3PYDA 4LCHA 2Q8UA 2EOQA 5IWAI 3KZYA 2EMCA 4DV3E 4WSGA 5JEAC 3J80Q 3PYEA 3ADIA 1YH8A 2PRTA 4R2CA 4R8OA 2WP8B 1YHCA 2YTNA 4HTGA 2M7QA 4JYAE 1N0VC 4DV4I 4F9BB 2EL6A 4LCFA 4NZVA 3F6GA 2UXCE 4JI0I 4AIDA 1B69A 1TF6A 1HNZE 2MC5A 4JI6I 3C6MA 3M85G 4FW7A 4IS9A 1TF3A 2EOOA 4MU0A 3GCMA 2HKJA 2RTXA 3JAMQ 3M7NG 2YTIA 2EZ6A 1NCSA 4B3SI 4LFAI 5F3WA 1GTKA 1S16A 2L3JA 1STUA 1Y5YA 1Y4UA 1B63A 3P06A 1YSAC 4B3MI 4N4RB 1IQOA 1YYKA 2L6MA 3OTOI 1K47A 2HFUA 4KQVA 2PNLA 2EM0A 2CPNA 1IBME 4LFCI 4O5GA 4AM3A 3TQMA 4R2QA 3B4TA 1A1HA 2V2VA 3LNUA 3PS2A 5IT9Q 1USVA 2C37A 3AV0A 1P42A 4DV5E 2CG9A 4XTJA 4I3HA 2V34A 2R3VA 4LF7E 2NN6C 5BR8I 3BIDA 5LLQA 4ZVIA 1IQSA 1I94I 2EPPA 3HPSA 3J81Q 4OOGC 5FLXC 2O1WA 3GONA 4R2SA 2PO1A 2CGEA 3ZZ0A 4DR2I 1OYRA 4KHPE 2CTDA 3DF6A 2ELZA 1WXRA 4B3TE 1YFHA 4DPUA 4J3DA 1H7UA 4R2DA 2EOXA 4LU9A 1UN6B 2EOYA 1F2IG 5A6KA 3MSWA 2VQEE 5DRQA 1QZRA 4BA1B 4MU4A 2N8XA 2YU5A 1OYSA 1VISA 1G2FC 1N32E 2HK2A 5JEAD 4JI3E 1U2RA 2CSHA 5A6BD 1MGTA 3ADJA 3IWCA 4WSPA 4BA2B 2RQLA 1T4NA 4GEQB 2EPNA 1N36E 4LF9I 4JV5E 5K36B 4IZKB 2DMYA 2CT1A 2LV2A 1O0WA 3M7ND 1UDSA 2EOHA 4LF5I 1Z59A 3UK3C 2EL5A 2EPMX 5DNYA 4U3BA 2F4VE 5EL9A 4U3DA 4DV1I 4ZYDA 1OJ4A 3U1YA 2LCEA 3C6KA 3J7AM 4L8NA 2YTJA 1HNWE 2EJ4A 4DUYI 2YTEA 3LLHA 2HKEA 1N33I 1A1IA 4OO1B 2BB8A 3U1KA 5K36F 4F9CB 2WBUA 4QNJA 2BM0A 2BA0G 2Q2EB 2JR1A 2R76A 1A1JA 2WCC3 5JEAE 1DQ3A 4NXME 5KL7A 1XMOE 3KRNA 4ED4A 2EPKX 5LMUI 4K0KE 5C0XC 4LF4I 4FW6A 4FN5A 2FGGA 2EQ0A 2HC5A 3M6AA 4M1KA 2C39B 2NN6D 4DR5E 3L7ZB 5LL6R 3MHHC 1ZM9A 3PRYA 1ELOA 4IZJA 4X66I 2V87A 2UXDI 2BR2B 2YRMA 3JU0A 1N34E 4OO1F 2Z5CB 3H1CA 4GKKE 5DRRA 4YHHE 2UUBE 4FW4A 2EPAA 2JT2A 3V2UC 1BBOA 1NHHA 3VK6A 2OI2A 5A2QQ 4MLQA 4P78A 4HACA 4LPFA 3PS1A 2ZM6I 1J5EE 3QT8A 3NZKA 5AC4A 2EMYA 4GKJE 4F54A 3J80C 2E5LE 3P1XA 2PO2A 5C0XB 2KOUA 2M4IA 4IFDB 5A6AA 1ZU1A 4LCGA 1E3HA 3WU5A 2LT7A 1KTVA 4F9AB 2EMAA 5AC5A 2UUCE 4OO1D 2CZ9A 2WNRA 4IJDA 4X64I 1MG7A 3RMPA 3K85A 1PJTA 1H72C 1UDNA 2RSMA 2LJPA 3EPJA 1Z5CA 2V86A 4DR3I 1XNRI 2YTFA 2UXBI 2EMGA 2JOBA 2NN6E 2EWLA 1JK2A 4YY3I 2EM7A 2VQFI 1XMQI 5C0XF 2EMXA 1ZAAC 4JI2E 4IFDF 2BA0D 4DV6I 1HNWI 4FWGA 2M9AA 3ADLA 3D4JA 1A1FA 4JI8I 4JI5I 3Q1QA 2ODRD 2R1FA 4WPYA 2DMIA 2EOFA 4HXZA 2HHHE 5DNXA 2UUAE 1ZBQA 1PVGA 4FW9A 3ZKDA 4JI7I 4X65E 2E72A 3ADGA 2BA1D 2Z5EA 2FV4B 2K4VA 4DR4E 2EMKA 4DV7I 4LFBI 2EMZA 3F6HA 3IWDA 3EPHA 4NBQA 5ELWA 2CVEA 2BV3A 5C0XD 2GPIA 1YZ9A 2DGCA 4OO1E 4B3RE 4R2RA 3J7Yp 5LMNE 2EN2A 2DB2A 3HJCA 2YZTA 2EM6A 4NXNE 1QU6A 2NUEA 2PO0B 4EMDA 3GMEA 3Q6NA 1BBGA 1PKPA 4URLA 2EMWA 2ENHA 1R6LA 2EORA 2LE2A 3HPZA 3T1HE 4MYTA 1ZM2A 3EPKA 2A25A 2I9IA 3L00A 4ZYEA 2L3CA 2JP9A 1YYWA 2LBSB 4R1FA 4DR4I 4Q35B 1NZ0A 2YTOA 4DMIA 1HNXI 2E1MA 3B8HA 2EMIA 4BC9A 1NEIA 3JTZA 1IBKI 1GQEA 4LF8I 4DR1I 4Z7YA 5JEAA 4DV0E 2EM2A 2GS8A 5A6BA 1IBLI 5C0XE 4WUBA 2KHXA 4IFDE 2C37B 2GHFA 4DV7E 4ISAA 4BMJA 5K36C 2GQ0A 2PNMA 2L33A 1X6HA 1PJSA 4BCAA 4F6NA 1KYQA 2XEXA 1YUIA 2EM3A 2L92A 1KJKA 4R2PA 2JXPA 1N0UA 2O3ZA 2UU9I 3K17A 4PU9A 2YWQA 2JWOA 4DV3I 4FWHA 2JEBA 2M1SA 3Q6MA 2DLQA 4NHRA 2YSOA 1TN9A 4DU8A 4KZSA 1ZM3A 4B3SE 2EP3A 1DGCA 2EMBA 4X62E 3QT7A 4PRXA 4JYAI 4OO1C 1X49A 4DPWA 2IESA 4BHBA 3VYYA 4JI4E 2VF3A 2UXCI 3DD6A 4DUZE 2EN8A 1XNQE 3C4BA 3M99B 1HNZI 2EM9A 5T6JA 1UHZA 2A2DA 2JEAA 1A1KA 1KIJA 3P3EA 1ZBTA 2MKDA 5KL6A 4WUDA 2HGHA 2RPCA 1L4SA 1OYPA 4TUGA 2V2ZA 2B7VA 2JVAA 3DJWA 5A2QC 3VYXA 4OX9E 1ZXMA 2NN6A 4DPTA 4DR7E 2IOPA 1X6EA 4WX9A 2ODRC 3THNA 4BC7A 3F0NA 2GO4A 5KL5A 1G2DC 4DR6E 1DARA 1MX0A 2EOJA 1MEYC 3T1YE 3HKMA 2EQ3A 1WRJA 4JI1E 4P7DA 3PYFA 1IBMI 3OMLA 1BKNA 5A69A 3C4TA 3PYGA 1SFEA 3B82A 4AQYE 1USUA 1YYOA 4DV5I 4IS1C 1A1GA 4IFDC 1Z0WA 1HR0E 5FLXQ 4LF7I 4WXCA 2BA1G 2WZOA 4O43A 2F8BA 5K36D 1FJGE 1AAYA 1FWLA 4DR1E 3K1JA 1EI1A 1X5WA 4IZJB 1H7SA 1SR9A 4KHPI 1JK1A 5IWAE 2HK3A 4P7AA 4B3TI 4GZNC 2EOMA 1RREA 4DPXA 2L2NA 2VQEI 2AJ4A 2EMHA 1RMDA 4DV4E 3VHTB 1N32I 1D6TA 2YSPA 1IMUA 4HACB 4JI3I 3QG5C 2YRKA 1Z5BA 2WBSA 4JI0E 1N3GA 5L3JA 2LJHA 3WU4A 2EOEA 4R2AA 2PO2B 2MDRA 1EH8A 5IV8B 2C38A 3GLLA 1N36I 1PDAA 4JV5I 2H36X 2N3GA 2LTRA 5ADZA 2DEJA 3BGHA 2WNRB 1KKHA 1Z1BA 2EOIA 2EPRA 2Z5BA 4X9JA 2F4VI 2EN7A 4LFAE 2EM4A 2LMZA 3JAMC 2ENAA 1Z0GA 5C0XA 5K36E 4ZYGA 1EH7A 2VRDA 2V83A 4B3ME 1B62A 4TUIA 2NUGA 2IERA 5AE1A 3OTOE 1ZXNA 4OKGA 2JE6B 1LLMC 3P76A 4R03A 4LFCE 2EM5A 1FWKA 3CDIA 3T1YI 4FK5C 3KWRA 1EKZA 2IHR1 1AH5A 4BS9A 1BB8A 5IT9C 2DEIA 5BR8E 4NXMI 2PNZA 3ZOQB 1YPNA 1A6FA 1XMOI 4O24A 2EN1A 1I94E 4MDTA 4K0KI 4IFDD 4MLVA 2YPNA 2RS7A 4DR5I 2X36A 1X47A 4DR2E 3J81C 1ZM4A 2N3HA 1N34I 1E3PA 4HY1A 4GKKI 4YHHI 2UUBI 1PJQA 2ZITA 2WP8A 4FW5A 1T4LB 4JG4A 4USKA 2EFGA 4OZEA 2NABA 3EPLA 2ENCA 1J5EI 3B78A 2EPXA 4LOMA 4GKJI 2DLKA 2VE7C 4RH8A 2E5LI 4USMA 4LF9E 4X8WA 3LPSA 3LTOA 2JOXA 2MC6A 1KVKA 2PO0A 4HYMA 4MU1A 1EA6A 1Z0BA 2UUCI 4LF5E 5GMEA 2B7TA 3MHSC 4LF6E 4I8OA 2IOQA 2V88A 3PS3A 2MKNA 4DV1E 2V8QB 3WU3A 2LJUA 4UT4A 1T39A 3ZM7A 4MQYA 3BBGA 2GLIA 5JEAB 3HQ1A 2YTDA 2J65A 4DUYE
chains in the Genus database with same CATH topology
1RC7A 1N33E 4JI2I 2ZBKB 3LMLA 1Z0VA 3ZZTA 2HHHI 3K6QA 1J26A 2UUAI 3AUZA 2O1UA 4PRVA 5LMUE 4LF4E 2LUPB 4X65I 2V89A 2NUFA 2V85A 2DIXA 1DI2A 4DR4I 4BBYA 4X66E 2UXDE 1GZ6A 1XHKA 3J7AG 4B3RI 5LMNI 1MU5A 4Z7CA 1X48A 4NXNI 3V5RA 1Z0CA 5GMDA 4WYQB 2NPFA 4WUCA 2ZM6E 1WUUA 3HXLA 3H09A 3T1HI 4IZKA 2LRSA 1HK7A 1H73A 3ZZUA 4X64E 4DV2E 4LTYA 2V2QA 2B3TB 2HFSA 4DXLA 4LF6I 2WW4A 4DR3E 1XNRE 3H4LA 2UXBE 2O1TA 4DV0I 4Q28A 4YY3E 2O1VA 4MYUA 2L8TA 2VQFE 1UEKA 1Z0TA 1T4OA 1XMQE 4DV7I 1WHQA 4N3OA 2DSYA 4DV6E 2VF1A 1Y6ZA 3IWBA 1RQ0A 4JI8E 2LUQA 4JI5E 3HTXA 1FI4A 2NA2A 4JI7E 1FKAE 4LFBE 4B3SI 1Z5AA 4M30A 4X62I 1H74A 2Z5CA 4JI6E 4JI4I 5CFFE 2R42A 2G7HA 4DUZI 1XNQI 4FWDA 5AASA 1FNMA 2KONA 1UILA 3QT5A 4DU7A 1Z0EA 2X7IA 4J8ZA 1NHIA 3ZKBA 2Z5BB 3HULA 3QT6A 3CWVA 4OX9I 1S4EA 1Y4SA 4DPYA 4DR7I 3FIGA 2LTSA 4UTGA 1HNXE 5AE3A 4IZJD 4DR6I 2V8PA 2FTXB 4M0VA 5FWKA 2A2CA 1IBKE 2L2MA 4JI1I 4LF8E 4DV2I 1PIEA 5AE2A 3WU6A 1IBLE 1RR9A 4DKKA 4AQYI 4P52A 2L2KB 4WFTA 2J7KA 1WHNA 2YT4A 4RPFA 1HR0I 2RS6A 1NHJA 1FJGI 2B9DA 4DR1I 4M2ZA 2E1RA 2BM1A 3PYDA 2UU9E 4L5NC 3Q1QA 2JY9A 5IWAI 4DV3E 3J80Q 3PYEA 3ADIA 4R8OA 2M7QA 4JYAE 1N0VC 4DV4I 4F9BB 4JI0I 3F6GA 2UXCE 1HNZE 2MC5A 4JI6I 2HKJA 2RTXA 3JAMQ 2EZ6A 4LFAI 5F3WA 1S16A 2L3JA 1STUA 1Y4UA 1B63A 3P06A 4B3MI 1YYKA 2L6MA 3OTOI 1K47A 2HFUA 4KQVA 2PNLA 2CPNA 1IBME 4LFCI 3LNUA 5IT9Q 2V2VA 1USVA 2CG9A 3AV0A 4DV5E 4XTJA 4I3HA 2V34A 2R3VA 4LF7E 5BR8I 4ZVIA 1I94I 3HPSA 3J81Q 4OOGC 5FLXC 2O1WA 3GONA 2CGEA 3ZZ0A 4DR2I 4KHPE 3DF6A 1WXRA 4B3TE 4DPUA 1H7UA 4LU9A 3MSWA 2VQEE 1QZRA 1VISA 1N32E 2HK2A 4JI3E 1U2RA 3ADJA 4WSPA 3IWCA 1T4NA 4GEQB 4LF9I 1N36E 4JV5E 4IZKB 2DMYA 1O0WA 4LF5I 1Z59A 5DNYA 2F4VE 4DV1I 1OJ4A 3J7AM 4L8NA 1HNWE 4DUYI 3LLHA 2HKEA 1N33I 4F9CB 2BM0A 2Q2EB 2JR1A 1DQ3A 4NXME 1XMOE 4ED4A 5LMUI 4LF4I 4K0KE 4FN5A 2FGGA 4M1KA 3M6AA 4DR5E 3PRYA 5LL6R 4IZJA 1ZM9A 1ELOA 4X66I 2V87A 2UXDI 3JU0A 1N34E 2Z5CB 4GKKE 4YHHE 2UUBE 3V2UC 1NHHA 3VK6A 2OI2A 5A2QQ 4P78A 4HACA 2ZM6I 1J5EE 3QT8A 4GKJE 4F54A 3J80C 2E5LE 3P1XA 2KOUA 2M4IA 3WU5A 1KTVA 4F9AB 2UUCE 2CZ9A 4X64I 1MG7A 3RMPA 3K85A 1H72C 2RSMA 2LJPA 1Z5CA 2V86A 4DR3I 1XNRI 2UXBI 2JOBA 2EWLA 4YY3I 2VQFI 1XMQI 4JI2E 1HNWI 4DV6I 4FWGA 3ADLA 3D4JA 4JI8I 4JI5I 2ODRD 4WPYA 4HXZA 2HHHE 2UUAE 1ZBQA 1PVGA 4FW9A 3ZKDA 4JI7I 4X65E 2Z5EA 3ADGA 2FV4B 2K4VA 4DR4E 4LFBI 3F6HA 3IWDA 2BV3A 1YZ9A 4B3RE 3J7Yp 5LMNE 2DB2A 3HJCA 2YZTA 4NXNE 1QU6A 2NUEA 4EMDA 3Q6NA 1PKPA 4URLA 2LE2A 3HPZA 3T1HE 4MYTA 1ZM2A 2L3CA 4R1FA 1YYWA 2LBSB 1NZ0A 4DMIA 1HNXI 2E1MA 3B8HA 4BC9A 3JTZA 1IBKI 1GQEA 4LF8I 4Z7YA 4DV0E 2GS8A 1IBLI 4WUBA 2KHXA 4DV7E 4BMJA 2GQ0A 2PNMA 2L33A 4BCAA 2XEXA 2L92A 1N0UA 2UU9I 3K17A 4PU9A 2JWOA 4DV3I 4FWHA 2M1SA 3Q6MA 4DU8A 4KZSA 1ZM3A 4B3SE 3QT7A 4X62E 4PRXA 4JYAI 1X49A 4DPWA 3VYYA 4JI4E 2VF3A 2UXCI 4DUZE 1HNZI 1XNQE 3C4BA 5T6JA 1UHZA 2A2DA 1KIJA 1ZBTA 4WUDA 4TUGA 2V2ZA 2B7VA 2JVAA 3DJWA 5A2QC 3VYXA 4OX9E 1ZXMA 4DPTA 4DR7E 2IOPA 2ODRC 3F0NA 4BC7A 4DR6E 1DARA 1MX0A 3T1YE 4JI1E 4P7DA 3PYFA 1IBMI 3OMLA 1BKNA 3C4TA 3PYGA 3B82A 4AQYE 1USUA 1YYOA 4DV5I 1Z0WA 1HR0E 5FLXQ 4LF7I 2WZOA 2F8BA 1FJGE 1FWLA 4DR1E 3K1JA 1EI1A 4IZJB 1H7SA 1SR9A 4KHPI 5IWAE 2HK3A 4P7AA 4B3TI 1RREA 4DPXA 2L2NA 2VQEI 2AJ4A 4DV4E 1N32I 1D6TA 4JI3I 4HACB 1Z5BA 4JI0E 5L3JA 2LJHA 3WU4A 1N36I 2MDRA 4JV5I 2H36X 2N3GA 2LTRA 5ADZA 2DEJA 1KKHA 2Z5BA 2F4VI 4LFAE 2LMZA 3JAMC 1Z0GA 2V83A 4B3ME 1B62A 4TUIA 2NUGA 5AE1A 3OTOE 1ZXNA 4R03A 4LFCE 1FWKA 3T1YI 3KWRA 1EKZA 2IHR1 4BS9A 5IT9C 2DEIA 5BR8E 4NXMI 3ZOQB 1XMOI 1A6FA 1I94E 4K0KI 2RS7A 4DR5I 2X36A 1X47A 4DR2E 3J81C 1ZM4A 2N3HA 1N34I 4HY1A 4GKKI 4YHHI 2UUBI 2ZITA 4JG4A 1T4LB 4USKA 2EFGA 1J5EI 3B78A 4GKJI 2VE7C 2E5LI 4USMA 4LF9E 4X8WA 3LPSA 3LTOA 2JOXA 2MC6A 1KVKA 4HYMA 2UUCI 1EA6A 1Z0BA 4LF5E 5GMEA 2B7TA 4LF6E 4I8OA 2IOQA 2V88A 4DV1E 2V8QB 3WU3A 4UT4A 3ZM7A 3HQ1A 4DUYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 E;  4JI2 I;  2ZBK B;  1Z0V A;  3ZZT A;  2HHH I;  2UUA I;  4PRV A;  5LMU E;  4LF4 E;  4X65 I;  4DR4 I;  4X66 E;  2UXD E;  1XHK A;  3J7A G;  4B3R I;  5LMN I;  1MU5 A;  4Z7C A;  4NXN I;  3V5R A;  1Z0C A;  5GMD A;  2NPF A;  4WUC A;  2ZM6 E;  1WUU A;  3T1H I;  1H73 A;  3ZZU A;  4X64 E;  4DV2 E;  2V2Q A;  2HFS A;  4DXL A;  4LF6 I;  2WW4 A;  3H4L A;  4DR3 E;  1XNR E;  2UXB E;  4DV0 I;  4MYU A;  4YY3 E;  2VQF E;  1UEK A;  1Z0T A;  4DV7 I;  1XMQ E;  4DV6 E;  4JI8 E;  4JI5 E;  1FI4 A;  4JI7 E;  1FKA E;  4LFB E;  4B3S I;  1Z5A A;  4X62 I;  1H74 A;  4JI6 E;  4JI4 I;  2R42 A;  4DUZ I;  1XNQ I;  4FWD A;  1FNM A;  4DU7 A;  3QT5 A;  1Z0E A;  2X7I A;  1NHI A;  3ZKB A;  3HUL A;  3QT6 A;  3CWV A;  4OX9 I;  1S4E A;  4DPY A;  4DR7 I;  4UTG A;  1HNX E;  4DR6 I;  2V8P A;  2A2C A;  4JI1 I;  1IBK E;  4LF8 E;  4DV2 I;  1PIE A;  3WU6 A;  1RR9 A;  1IBL E;  4AQY I;  4P52 A;  2J7K A;  1HR0 I;  4RPF A;  1NHJ A;  1FJG I;  4DR1 I;  2E1R A;  2BM1 A;  3PYD A;  2UU9 E;  3Q1Q A;  5IWA I;  4DV3 E;  3J80 Q;  3PYE A;  4JYA E;  1N0V C;  4DV4 I;  4JI0 I;  2UXC E;  1HNZ E;  4JI6 I;  2HKJ A;  3JAM Q;  4LFA I;  1S16 A;  1B63 A;  4B3M I;  3OTO I;  1K47 A;  2HFU A;  4KQV A;  1IBM E;  4LFC I;  3LNU A;  5IT9 Q;  2V2V A;  4DV5 E;  4XTJ A;  4I3H A;  2V34 A;  2R3V A;  5BR8 I;  4LF7 E;  4ZVI A;  1I94 I;  3J81 Q;  5FLX C;  3GON A;  3ZZ0 A;  4DR2 I;  4KHP E;  4B3T E;  4DPU A;  1H7U A;  2VQE E;  1QZR A;  1VIS A;  2HK2 A;  1N32 E;  4JI3 E;  1U2R A;  4LF9 I;  1N36 E;  4JV5 E;  4LF5 I;  1Z59 A;  2F4V E;  4DV1 I;  1OJ4 A;  3J7A M;  1HNW E;  4DUY I;  2HKE A;  1N33 I;  2BM0 A;  2Q2E B;  4NXM E;  4ED4 A;  5LMU I;  1XMO E;  4LF4 I;  4K0K E;  4FN5 A;  4M1K A;  3M6A A;  4DR5 E;  5LL6 R;  1ZM9 A;  1ELO A;  4X66 I;  2UXD I;  1N34 E;  4GKK E;  4YHH E;  2UUB E;  3V2U C;  1NHH A;  5A2Q Q;  2OI2 A;  4HAC A;  2ZM6 I;  1J5E E;  3QT8 A;  4GKJ E;  3J80 C;  2E5L E;  3WU5 A;  1KTV A;  2UUC E;  2CZ9 A;  4X64 I;  1MG7 A;  1H72 C;  2LJP A;  1Z5C A;  4DR3 I;  1XNR I;  2UXB I;  4YY3 I;  2VQF I;  1XMQ I;  4JI2 E;  1HNW I;  4DV6 I;  4FWG A;  4JI8 I;  3D4J A;  4JI5 I;  4HXZ A;  2HHH E;  2UUA E;  1PVG A;  4FW9 A;  3ZKD A;  4JI7 I;  4X65 E;  4DR4 E;  4LFB I;  2BV3 A;  4B3R E;  5LMN E;  4EMD A;  4NXN E;  1PKP A;  4URL A;  3T1H E;  4MYT A;  1ZM2 A;  4R1F A;  1NZ0 A;  1HNX I;  3B8H A;  1IBK I;  4LF8 I;  4Z7Y A;  4DV0 E;  2GS8 A;  1IBL I;  4WUB A;  4DV7 E;  2XEX A;  1N0U A;  2UU9 I;  3K17 A;  4PU9 A;  4DV3 I;  4FWH A;  4DU8 A;  1ZM3 A;  4B3S E;  3QT7 A;  4X62 E;  4PRX A;  4JYA I;  4DPW A;  4JI4 E;  2VF3 A;  2UXC I;  4DUZ E;  1HNZ I;  1XNQ E;  2A2D A;  1KIJ A;  4WUD A;  2V2Z A;  5A2Q C;  1ZXM A;  4DPT A;  4OX9 E;  4DR7 E;  3F0N A;  4DR6 E;  1DAR A;  1MX0 A;  3T1Y E;  4JI1 E;  3PYF A;  1IBM I;  1BKN A;  3PYG A;  3B82 A;  4AQY E;  4DV5 I;  1Z0W A;  5FLX Q;  1HR0 E;  4LF7 I;  1FJG E;  1FWL A;  4DR1 E;  3K1J A;  1EI1 A;  1H7S A;  4KHP I;  4P7A A;  2HK3 A;  5IWA E;  4B3T I;  1RRE A;  4DPX A;  2VQE I;  2AJ4 A;  4DV4 E;  1N32 I;  1D6T A;  4JI3 I;  4HAC B;  1Z5B A;  4JI0 E;  5L3J A;  3WU4 A;  1N36 I;  4JV5 I;  2DEJ A;  1KKH A;  2F4V I;  4LFA E;  3JAM C;  1Z0G A;  4B3M E;  1B62 A;  3OTO E;  1ZXN A;  4LFC E;  1FWK A;  3T1Y I;  5IT9 C;  2DEI A;  5BR8 E;  4NXM I;  1XMO I;  1A6F A;  1I94 E;  4K0K I;  4DR5 I;  2X36 A;  4DR2 E;  1ZM4 A;  3J81 C;  1N34 I;  4HY1 A;  4GKK I;  4YHH I;  2UUB I;  2ZIT A;  4JG4 A;  4USK A;  2EFG A;  1J5E I;  3B78 A;  4GKJ I;  2E5L I;  4USM A;  4LF9 E;  3LPS A;  3LTO A;  4HYM A;  1KVK A;  2UUC I;  1EA6 A;  1Z0B A;  4LF5 E;  5GME A;  4LF6 E;  3WU3 A;  4DV1 E;  4UT4 A;  3ZM7 A;  4DUY E; 
#chains in the Genus database with same CATH topology
 2EML A;  1RC7 A;  5TSE A;  1N33 E;  4JI2 I;  2ZBK B;  3LML A;  2PO1 B;  2LVH A;  1Z0V A;  1QNT A;  3ZZT A;  2EN3 A;  2HHH I;  3K6Q A;  1J26 A;  2UUA I;  3AUZ A;  2O1U A;  2EPL X;  4PRV A;  5LMU E;  4LF4 E;  2LUP B;  3UHM A;  4X65 I;  2V89 A;  2JEB B;  2NUF A;  2EOS A;  2DIX A;  2V85 A;  1DI2 A;  5JEA F;  3CDJ A;  2ADR A;  4BBY A;  5DRO A;  1X3C A;  4X66 E;  2UXD E;  1GZ6 A;  1XHK A;  3J7A G;  4B3R I;  2DRP A;  5LMN I;  3EQ1 A;  1MU5 A;  1EH6 A;  2EPU A;  2JYA A;  4Z7C A;  1X48 A;  4NXN I;  1VI7 A;  4BA1 A;  3V5R A;  5KL2 A;  1Z0C A;  5GMD A;  1UDO A;  4WYQ B;  5KL4 A;  4WUC A;  2NPF A;  2ZM6 E;  1WUU A;  2JEA B;  2EM8 A;  3HXL A;  4BA2 A;  2YRH A;  3H09 A;  4GQU A;  4FW3 A;  2YTQ A;  3T1H I;  5K36 A;  4IZK A;  1YUJ A;  2NN6 B;  5DNL A;  3M85 D;  2LRS A;  1HK7 A;  2D9H A;  1H73 A;  2EL4 A;  1Y60 A;  3P3G A;  5A6J A;  2F1D A;  3ECR A;  3ZZU A;  4X64 E;  4DV2 E;  4LTY A;  4WXD A;  4BHC A;  2YU8 A;  2V2Q A;  2B3T B;  2HFS A;  5DRP A;  4DXL A;  4LF6 I;  5KL3 A;  2WW4 A;  2LO3 A;  4DR3 E;  2ELY A;  2EMF A;  4HEI A;  1XNR E;  2UXB E;  2O1T A;  3H4L A;  4DV0 I;  3P3C A;  4Q28 A;  4YY3 E;  2O1V A;  4MYU A;  2L8T A;  2VQF E;  1UEK A;  1Z0T A;  1T4O A;  1XMQ E;  4KWY A;  1WHQ A;  2VES A;  4N3O A;  4QNK A;  4OO1 A;  2DSY A;  4DV6 E;  2VF1 A;  1Y6Z A;  2NN6 F;  3IWB A;  1RQ0 A;  4JI8 E;  2LUQ A;  4JI5 E;  2YTP A;  2GO3 A;  3HTX A;  1A1L A;  2EPC A;  1T38 A;  4R2E A;  5EKW A;  1FI4 A;  2NA2 A;  4JI7 E;  2MDG A;  1FKA E;  4LFB E;  1RHY A;  2EE8 A;  2C39 A;  2K7I A;  1UDQ A;  4M30 A;  1R6M A;  2RSI A;  1Z5A A;  3L7Z A;  4X62 I;  1H74 A;  2BR2 A;  4MU3 A;  4AIM A;  2EQ1 A;  2Z5C A;  4JI6 E;  1ZR9 A;  4JI4 I;  5CFF E;  2R42 A;  2G7H A;  2EPZ A;  4DUZ I;  1XNQ I;  4FWD A;  5AAS A;  1X6F A;  2C38 B;  2HJJ A;  1FNM A;  2KON A;  1UIL A;  3QT5 A;  4M9V C;  4DU7 A;  1Z0E A;  2X7I A;  4J8Z A;  2BBG A;  1XXE A;  2EOZ A;  1NHI A;  3ZKB A;  4IFD A;  2Z5B B;  3HUL A;  3QT6 A;  3CWV A;  4OX9 I;  1S4E A;  1Y4S A;  4DPY A;  4DR7 I;  3FIG A;  2LTS A;  4UTG A;  2EN4 A;  4ZYH A;  1HNX E;  5AE3 A;  4IZJ D;  4DR6 I;  2EN6 A;  2FTX B;  4M0V A;  2EPO A;  2J7J A;  2AE8 A;  2V8P A;  5FWK A;  4F6M A;  1IBK E;  2L2M A;  2A2C A;  4JI1 I;  4LF8 E;  4DV2 I;  1PIE A;  1WJP A;  5AE2 A;  2YTG A;  2JPA A;  3WU6 A;  1IBL E;  1RR9 A;  4DKK A;  4AQY I;  4P52 A;  4F2J C;  2L2K B;  4WFT A;  2J7K A;  1WHN A;  2YT4 A;  5IXM B;  4RPF A;  2I13 A;  1HR0 I;  2RS6 A;  3BF2 A;  2PNZ B;  1P47 A;  2JE6 A;  1NHJ A;  1FJG I;  4O4K A;  2WBT A;  2B9D A;  3THO B;  4M2Z A;  2BM1 A;  2E1R A;  2UU9 E;  3KZZ A;  4L5N C;  4RHB B;  1UBD C;  2JY9 A;  3PYD A;  4LCH A;  2Q8U A;  2EOQ A;  5IWA I;  3KZY A;  2EMC A;  4DV3 E;  4WSG A;  5JEA C;  3J80 Q;  3PYE A;  3ADI A;  1YH8 A;  2PRT A;  4R2C A;  4R8O A;  2WP8 B;  1YHC A;  2YTN A;  4HTG A;  2M7Q A;  4JYA E;  1N0V C;  4DV4 I;  4F9B B;  2EL6 A;  4LCF A;  4NZV A;  3F6G A;  2UXC E;  4JI0 I;  4AID A;  1B69 A;  1TF6 A;  1HNZ E;  2MC5 A;  4JI6 I;  3C6M A;  3M85 G;  4FW7 A;  4IS9 A;  1TF3 A;  2EOO A;  4MU0 A;  3GCM A;  2HKJ A;  2RTX A;  3JAM Q;  3M7N G;  2YTI A;  2EZ6 A;  1NCS A;  4B3S I;  4LFA I;  5F3W A;  1GTK A;  1S16 A;  2L3J A;  1STU A;  1Y5Y A;  1Y4U A;  1B63 A;  3P06 A;  1YSA C;  4B3M I;  4N4R B;  1IQO A;  1YYK A;  2L6M A;  3OTO I;  1K47 A;  2HFU A;  4KQV A;  2PNL A;  2EM0 A;  2CPN A;  1IBM E;  4LFC I;  4O5G A;  4AM3 A;  3TQM A;  4R2Q A;  3B4T A;  1A1H A;  2V2V A;  3LNU A;  3PS2 A;  5IT9 Q;  1USV A;  2C37 A;  3AV0 A;  1P42 A;  4DV5 E;  2CG9 A;  4XTJ A;  4I3H A;  2V34 A;  2R3V A;  4LF7 E;  2NN6 C;  5BR8 I;  3BID A;  5LLQ A;  4ZVI A;  1IQS A;  1I94 I;  2EPP A;  3HPS A;  3J81 Q;  4OOG C;  5FLX C;  2O1W A;  3GON A;  4R2S A;  2PO1 A;  2CGE A;  3ZZ0 A;  4DR2 I;  1OYR A;  4KHP E;  2CTD A;  3DF6 A;  2ELZ A;  1WXR A;  4B3T E;  1YFH A;  4DPU A;  4J3D A;  1H7U A;  4R2D A;  2EOX A;  4LU9 A;  1UN6 B;  2EOY A;  1F2I G;  5A6K A;  3MSW A;  2VQE E;  5DRQ A;  1QZR A;  4BA1 B;  4MU4 A;  2N8X A;  2YU5 A;  1OYS A;  1VIS A;  1G2F C;  1N32 E;  2HK2 A;  5JEA D;  4JI3 E;  1U2R A;  2CSH A;  5A6B D;  1MGT A;  3ADJ A;  3IWC A;  4WSP A;  4BA2 B;  2RQL A;  1T4N A;  4GEQ B;  2EPN A;  1N36 E;  4LF9 I;  4JV5 E;  5K36 B;  4IZK B;  2DMY A;  2CT1 A;  2LV2 A;  1O0W A;  3M7N D;  1UDS A;  2EOH A;  4LF5 I;  1Z59 A;  3UK3 C;  2EL5 A;  2EPM X;  5DNY A;  4U3B A;  2F4V E;  5EL9 A;  4U3D A;  4DV1 I;  4ZYD A;  1OJ4 A;  3U1Y A;  2LCE A;  3C6K A;  3J7A M;  4L8N A;  2YTJ A;  1HNW E;  2EJ4 A;  4DUY I;  2YTE A;  3LLH A;  2HKE A;  1N33 I;  1A1I A;  4OO1 B;  2BB8 A;  3U1K A;  5K36 F;  4F9C B;  2WBU A;  4QNJ A;  2BM0 A;  2BA0 G;  2Q2E B;  2JR1 A;  2R76 A;  1A1J A;  2WCC 3;  5JEA E;  1DQ3 A;  4NXM E;  5KL7 A;  1XMO E;  3KRN A;  4ED4 A;  2EPK X;  5LMU I;  4K0K E;  5C0X C;  4LF4 I;  4FW6 A;  4FN5 A;  2FGG A;  2EQ0 A;  2HC5 A;  3M6A A;  4M1K A;  2C39 B;  2NN6 D;  4DR5 E;  3L7Z B;  5LL6 R;  3MHH C;  1ZM9 A;  3PRY A;  1ELO A;  4IZJ A;  4X66 I;  2V87 A;  2UXD I;  2BR2 B;  2YRM A;  3JU0 A;  1N34 E;  4OO1 F;  2Z5C B;  3H1C A;  4GKK E;  5DRR A;  4YHH E;  2UUB E;  4FW4 A;  2EPA A;  2JT2 A;  3V2U C;  1BBO A;  1NHH A;  3VK6 A;  2OI2 A;  5A2Q Q;  4MLQ A;  4P78 A;  4HAC A;  4LPF A;  3PS1 A;  2ZM6 I;  1J5E E;  3QT8 A;  3NZK A;  5AC4 A;  2EMY A;  4GKJ E;  4F54 A;  3J80 C;  2E5L E;  3P1X A;  2PO2 A;  5C0X B;  2KOU A;  2M4I A;  4IFD B;  5A6A A;  1ZU1 A;  4LCG A;  1E3H A;  3WU5 A;  2LT7 A;  1KTV A;  4F9A B;  2EMA A;  5AC5 A;  2UUC E;  4OO1 D;  2CZ9 A;  2WNR A;  4IJD A;  4X64 I;  1MG7 A;  3RMP A;  3K85 A;  1PJT A;  1H72 C;  1UDN A;  2RSM A;  2LJP A;  3EPJ A;  1Z5C A;  2V86 A;  4DR3 I;  1XNR I;  2YTF A;  2UXB I;  2EMG A;  2JOB A;  2NN6 E;  2EWL A;  1JK2 A;  4YY3 I;  2EM7 A;  2VQF I;  1XMQ I;  5C0X F;  2EMX A;  1ZAA C;  4JI2 E;  4IFD F;  2BA0 D;  4DV6 I;  1HNW I;  4FWG A;  2M9A A;  3ADL A;  3D4J A;  1A1F A;  4JI8 I;  4JI5 I;  3Q1Q A;  2ODR D;  2R1F A;  4WPY A;  2DMI A;  2EOF A;  4HXZ A;  2HHH E;  5DNX A;  2UUA E;  1ZBQ A;  1PVG A;  4FW9 A;  3ZKD A;  4JI7 I;  4X65 E;  2E72 A;  3ADG A;  2BA1 D;  2Z5E A;  2FV4 B;  2K4V A;  4DR4 E;  2EMK A;  4DV7 I;  4LFB I;  2EMZ A;  3F6H A;  3IWD A;  3EPH A;  4NBQ A;  5ELW A;  2CVE A;  2BV3 A;  5C0X D;  2GPI A;  1YZ9 A;  2DGC A;  4OO1 E;  4B3R E;  4R2R A;  3J7Y p;  5LMN E;  2EN2 A;  2DB2 A;  3HJC A;  2YZT A;  2EM6 A;  4NXN E;  1QU6 A;  2NUE A;  2PO0 B;  4EMD A;  3GME A;  3Q6N A;  1BBG A;  1PKP A;  4URL A;  2EMW A;  2ENH A;  1R6L A;  2EOR A;  2LE2 A;  3HPZ A;  3T1H E;  4MYT A;  1ZM2 A;  3EPK A;  2A25 A;  2I9I A;  3L00 A;  4ZYE A;  2L3C A;  2JP9 A;  1YYW A;  2LBS B;  4R1F A;  4DR4 I;  4Q35 B;  1NZ0 A;  2YTO A;  4DMI A;  1HNX I;  2E1M A;  3B8H A;  2EMI A;  4BC9 A;  1NEI A;  3JTZ A;  1IBK I;  1GQE A;  4LF8 I;  4DR1 I;  4Z7Y A;  5JEA A;  4DV0 E;  2EM2 A;  2GS8 A;  5A6B A;  1IBL I;  5C0X E;  4WUB A;  2KHX A;  4IFD E;  2C37 B;  2GHF A;  4DV7 E;  4ISA A;  4BMJ A;  5K36 C;  2GQ0 A;  2PNM A;  2L33 A;  1X6H A;  1PJS A;  4BCA A;  4F6N A;  1KYQ A;  2XEX A;  1YUI A;  2EM3 A;  2L92 A;  1KJK A;  4R2P A;  2JXP A;  1N0U A;  2O3Z A;  2UU9 I;  3K17 A;  4PU9 A;  2YWQ A;  2JWO A;  4DV3 I;  4FWH A;  2JEB A;  2M1S A;  3Q6M A;  2DLQ A;  4NHR A;  2YSO A;  1TN9 A;  4DU8 A;  4KZS A;  1ZM3 A;  4B3S E;  2EP3 A;  1DGC A;  2EMB A;  4X62 E;  3QT7 A;  4PRX A;  4JYA I;  4OO1 C;  1X49 A;  4DPW A;  2IES A;  4BHB A;  3VYY A;  4JI4 E;  2VF3 A;  2UXC I;  3DD6 A;  4DUZ E;  2EN8 A;  1XNQ E;  3C4B A;  3M99 B;  1HNZ I;  2EM9 A;  5T6J A;  1UHZ A;  2A2D A;  2JEA A;  1A1K A;  1KIJ A;  3P3E A;  1ZBT A;  2MKD A;  5KL6 A;  4WUD A;  2HGH A;  2RPC A;  1L4S A;  1OYP A;  4TUG A;  2V2Z A;  2B7V A;  2JVA A;  3DJW A;  5A2Q C;  3VYX A;  4OX9 E;  1ZXM A;  2NN6 A;  4DPT A;  4DR7 E;  2IOP A;  1X6E A;  4WX9 A;  2ODR C;  3THN A;  4BC7 A;  3F0N A;  2GO4 A;  5KL5 A;  1G2D C;  4DR6 E;  1DAR A;  1MX0 A;  2EOJ A;  1MEY C;  3T1Y E;  3HKM A;  2EQ3 A;  1WRJ A;  4JI1 E;  4P7D A;  3PYF A;  1IBM I;  3OML A;  1BKN A;  5A69 A;  3C4T A;  3PYG A;  1SFE A;  3B82 A;  4AQY E;  1USU A;  1YYO A;  4DV5 I;  4IS1 C;  1A1G A;  4IFD C;  1Z0W A;  1HR0 E;  5FLX Q;  4LF7 I;  4WXC A;  2BA1 G;  2WZO A;  4O43 A;  2F8B A;  5K36 D;  1FJG E;  1AAY A;  1FWL A;  4DR1 E;  3K1J A;  1EI1 A;  1X5W A;  4IZJ B;  1H7S A;  1SR9 A;  4KHP I;  1JK1 A;  5IWA E;  2HK3 A;  4P7A A;  4B3T I;  4GZN C;  2EOM A;  1RRE A;  4DPX A;  2L2N A;  2VQE I;  2AJ4 A;  2EMH A;  1RMD A;  4DV4 E;  3VHT B;  1N32 I;  1D6T A;  2YSP A;  1IMU A;  4HAC B;  4JI3 I;  3QG5 C;  2YRK A;  1Z5B A;  2WBS A;  4JI0 E;  1N3G A;  5L3J A;  2LJH A;  3WU4 A;  2EOE A;  4R2A A;  2PO2 B;  2MDR A;  1EH8 A;  5IV8 B;  2C38 A;  3GLL A;  1N36 I;  1PDA A;  4JV5 I;  2H36 X;  2N3G A;  2LTR A;  5ADZ A;  2DEJ A;  3BGH A;  2WNR B;  1KKH A;  1Z1B A;  2EOI A;  2EPR A;  2Z5B A;  4X9J A;  2F4V I;  2EN7 A;  4LFA E;  2EM4 A;  2LMZ A;  3JAM C;  2ENA A;  1Z0G A;  5C0X A;  5K36 E;  4ZYG A;  1EH7 A;  2VRD A;  2V83 A;  4B3M E;  1B62 A;  4TUI A;  2NUG A;  2IER A;  5AE1 A;  3OTO E;  1ZXN A;  4OKG A;  2JE6 B;  1LLM C;  3P76 A;  4R03 A;  4LFC E;  2EM5 A;  1FWK A;  3CDI A;  3T1Y I;  4FK5 C;  3KWR A;  1EKZ A;  2IHR 1;  1AH5 A;  4BS9 A;  1BB8 A;  5IT9 C;  2DEI A;  5BR8 E;  4NXM I;  2PNZ A;  3ZOQ B;  1YPN A;  1A6F A;  1XMO I;  4O24 A;  2EN1 A;  1I94 E;  4MDT A;  4K0K I;  4IFD D;  4MLV A;  2YPN A;  2RS7 A;  4DR5 I;  2X36 A;  1X47 A;  4DR2 E;  3J81 C;  1ZM4 A;  2N3H A;  1N34 I;  1E3P A;  4HY1 A;  4GKK I;  4YHH I;  2UUB I;  1PJQ A;  2ZIT A;  2WP8 A;  4FW5 A;  1T4L B;  4JG4 A;  4USK A;  2EFG A;  4OZE A;  2NAB A;  3EPL A;  2ENC A;  1J5E I;  3B78 A;  2EPX A;  4LOM A;  4GKJ I;  2DLK A;  2VE7 C;  4RH8 A;  2E5L I;  4USM A;  4LF9 E;  4X8W A;  3LPS A;  3LTO A;  2JOX A;  2MC6 A;  1KVK A;  2PO0 A;  4HYM A;  4MU1 A;  1EA6 A;  1Z0B A;  2UUC I;  4LF5 E;  5GME A;  2B7T A;  3MHS C;  4LF6 E;  4I8O A;  2IOQ A;  2V88 A;  3PS3 A;  2MKN A;  4DV1 E;  2V8Q B;  3WU3 A;  2LJU A;  4UT4 A;  1T39 A;  3ZM7 A;  4MQY A;  3BBG A;  2GLI A;  5JEA B;  3HQ1 A;  2YTD A;  2J65 A;  4DUY E; 
#chains in the Genus database with same CATH homology
 1RC7 A;  1N33 E;  4JI2 I;  2ZBK B;  3LML A;  1Z0V A;  3ZZT A;  2HHH I;  3K6Q A;  1J26 A;  2UUA I;  3AUZ A;  2O1U A;  4PRV A;  5LMU E;  4LF4 E;  2LUP B;  4X65 I;  2V89 A;  2NUF A;  2V85 A;  2DIX A;  1DI2 A;  4DR4 I;  4BBY A;  4X66 E;  2UXD E;  1GZ6 A;  1XHK A;  3J7A G;  4B3R I;  5LMN I;  1MU5 A;  4Z7C A;  1X48 A;  4NXN I;  3V5R A;  1Z0C A;  5GMD A;  4WYQ B;  2NPF A;  4WUC A;  2ZM6 E;  1WUU A;  3HXL A;  3H09 A;  3T1H I;  4IZK A;  2LRS A;  1HK7 A;  1H73 A;  3ZZU A;  4X64 E;  4DV2 E;  4LTY A;  2V2Q A;  2B3T B;  2HFS A;  4DXL A;  4LF6 I;  2WW4 A;  4DR3 E;  1XNR E;  3H4L A;  2UXB E;  2O1T A;  4DV0 I;  4Q28 A;  4YY3 E;  2O1V A;  4MYU A;  2L8T A;  2VQF E;  1UEK A;  1Z0T A;  1T4O A;  1XMQ E;  4DV7 I;  1WHQ A;  4N3O A;  2DSY A;  4DV6 E;  2VF1 A;  1Y6Z A;  3IWB A;  1RQ0 A;  4JI8 E;  2LUQ A;  4JI5 E;  3HTX A;  1FI4 A;  2NA2 A;  4JI7 E;  1FKA E;  4LFB E;  4B3S I;  1Z5A A;  4M30 A;  4X62 I;  1H74 A;  2Z5C A;  4JI6 E;  4JI4 I;  5CFF E;  2R42 A;  2G7H A;  4DUZ I;  1XNQ I;  4FWD A;  5AAS A;  1FNM A;  2KON A;  1UIL A;  3QT5 A;  4DU7 A;  1Z0E A;  2X7I A;  4J8Z A;  1NHI A;  3ZKB A;  2Z5B B;  3HUL A;  3QT6 A;  3CWV A;  4OX9 I;  1S4E A;  1Y4S A;  4DPY A;  4DR7 I;  3FIG A;  2LTS A;  4UTG A;  1HNX E;  5AE3 A;  4IZJ D;  4DR6 I;  2V8P A;  2FTX B;  4M0V A;  5FWK A;  2A2C A;  1IBK E;  2L2M A;  4JI1 I;  4LF8 E;  4DV2 I;  1PIE A;  5AE2 A;  3WU6 A;  1IBL E;  1RR9 A;  4DKK A;  4AQY I;  4P52 A;  2L2K B;  4WFT A;  2J7K A;  1WHN A;  2YT4 A;  4RPF A;  1HR0 I;  2RS6 A;  1NHJ A;  1FJG I;  2B9D A;  4DR1 I;  4M2Z A;  2E1R A;  2BM1 A;  3PYD A;  2UU9 E;  4L5N C;  3Q1Q A;  2JY9 A;  5IWA I;  4DV3 E;  3J80 Q;  3PYE A;  3ADI A;  4R8O A;  2M7Q A;  4JYA E;  1N0V C;  4DV4 I;  4F9B B;  4JI0 I;  3F6G A;  2UXC E;  1HNZ E;  2MC5 A;  4JI6 I;  2HKJ A;  2RTX A;  3JAM Q;  2EZ6 A;  4LFA I;  5F3W A;  1S16 A;  2L3J A;  1STU A;  1Y4U A;  1B63 A;  3P06 A;  4B3M I;  1YYK A;  2L6M A;  3OTO I;  1K47 A;  2HFU A;  4KQV A;  2PNL A;  2CPN A;  1IBM E;  4LFC I;  3LNU A;  5IT9 Q;  2V2V A;  1USV A;  2CG9 A;  3AV0 A;  4DV5 E;  4XTJ A;  4I3H A;  2V34 A;  2R3V A;  4LF7 E;  5BR8 I;  4ZVI A;  1I94 I;  3HPS A;  3J81 Q;  4OOG C;  5FLX C;  2O1W A;  3GON A;  2CGE A;  3ZZ0 A;  4DR2 I;  4KHP E;  3DF6 A;  1WXR A;  4B3T E;  4DPU A;  1H7U A;  4LU9 A;  3MSW A;  2VQE E;  1QZR A;  1VIS A;  1N32 E;  2HK2 A;  4JI3 E;  1U2R A;  3ADJ A;  4WSP A;  3IWC A;  1T4N A;  4GEQ B;  4LF9 I;  1N36 E;  4JV5 E;  4IZK B;  2DMY A;  1O0W A;  4LF5 I;  1Z59 A;  5DNY A;  2F4V E;  4DV1 I;  1OJ4 A;  3J7A M;  4L8N A;  1HNW E;  4DUY I;  3LLH A;  2HKE A;  1N33 I;  4F9C B;  2BM0 A;  2Q2E B;  2JR1 A;  1DQ3 A;  4NXM E;  1XMO E;  4ED4 A;  5LMU I;  4LF4 I;  4K0K E;  4FN5 A;  2FGG A;  4M1K A;  3M6A A;  4DR5 E;  3PRY A;  5LL6 R;  4IZJ A;  1ZM9 A;  1ELO A;  4X66 I;  2V87 A;  2UXD I;  3JU0 A;  1N34 E;  2Z5C B;  4GKK E;  4YHH E;  2UUB E;  3V2U C;  1NHH A;  3VK6 A;  2OI2 A;  5A2Q Q;  4P78 A;  4HAC A;  2ZM6 I;  1J5E E;  3QT8 A;  4GKJ E;  4F54 A;  3J80 C;  2E5L E;  3P1X A;  2KOU A;  2M4I A;  3WU5 A;  1KTV A;  4F9A B;  2UUC E;  2CZ9 A;  4X64 I;  1MG7 A;  3RMP A;  3K85 A;  1H72 C;  2RSM A;  2LJP A;  1Z5C A;  2V86 A;  4DR3 I;  1XNR I;  2UXB I;  2JOB A;  2EWL A;  4YY3 I;  2VQF I;  1XMQ I;  4JI2 E;  1HNW I;  4DV6 I;  4FWG A;  3ADL A;  3D4J A;  4JI8 I;  4JI5 I;  2ODR D;  4WPY A;  4HXZ A;  2HHH E;  2UUA E;  1ZBQ A;  1PVG A;  4FW9 A;  3ZKD A;  4JI7 I;  4X65 E;  2Z5E A;  3ADG A;  2FV4 B;  2K4V A;  4DR4 E;  4LFB I;  3F6H A;  3IWD A;  2BV3 A;  1YZ9 A;  4B3R E;  3J7Y p;  5LMN E;  2DB2 A;  3HJC A;  2YZT A;  4NXN E;  1QU6 A;  2NUE A;  4EMD A;  3Q6N A;  1PKP A;  4URL A;  2LE2 A;  3HPZ A;  3T1H E;  4MYT A;  1ZM2 A;  2L3C A;  4R1F A;  1YYW A;  2LBS B;  1NZ0 A;  4DMI A;  1HNX I;  2E1M A;  3B8H A;  4BC9 A;  3JTZ A;  1IBK I;  1GQE A;  4LF8 I;  4Z7Y A;  4DV0 E;  2GS8 A;  1IBL I;  4WUB A;  2KHX A;  4DV7 E;  4BMJ A;  2GQ0 A;  2PNM A;  2L33 A;  4BCA A;  2XEX A;  2L92 A;  1N0U A;  2UU9 I;  3K17 A;  4PU9 A;  2JWO A;  4DV3 I;  4FWH A;  2M1S A;  3Q6M A;  4DU8 A;  4KZS A;  1ZM3 A;  4B3S E;  3QT7 A;  4X62 E;  4PRX A;  4JYA I;  1X49 A;  4DPW A;  3VYY A;  4JI4 E;  2VF3 A;  2UXC I;  4DUZ E;  1HNZ I;  1XNQ E;  3C4B A;  5T6J A;  1UHZ A;  2A2D A;  1KIJ A;  1ZBT A;  4WUD A;  4TUG A;  2V2Z A;  2B7V A;  2JVA A;  3DJW A;  5A2Q C;  3VYX A;  4OX9 E;  1ZXM A;  4DPT A;  4DR7 E;  2IOP A;  2ODR C;  3F0N A;  4BC7 A;  4DR6 E;  1DAR A;  1MX0 A;  3T1Y E;  4JI1 E;  4P7D A;  3PYF A;  1IBM I;  3OML A;  1BKN A;  3C4T A;  3PYG A;  3B82 A;  4AQY E;  1USU A;  1YYO A;  4DV5 I;  1Z0W A;  1HR0 E;  5FLX Q;  4LF7 I;  2WZO A;  2F8B A;  1FJG E;  1FWL A;  4DR1 E;  3K1J A;  1EI1 A;  4IZJ B;  1H7S A;  1SR9 A;  4KHP I;  5IWA E;  2HK3 A;  4P7A A;  4B3T I;  1RRE A;  4DPX A;  2L2N A;  2VQE I;  2AJ4 A;  4DV4 E;  1N32 I;  1D6T A;  4JI3 I;  4HAC B;  1Z5B A;  4JI0 E;  5L3J A;  2LJH A;  3WU4 A;  1N36 I;  2MDR A;  4JV5 I;  2H36 X;  2N3G A;  2LTR A;  5ADZ A;  2DEJ A;  1KKH A;  2Z5B A;  2F4V I;  4LFA E;  2LMZ A;  3JAM C;  1Z0G A;  2V83 A;  4B3M E;  1B62 A;  4TUI A;  2NUG A;  5AE1 A;  3OTO E;  1ZXN A;  4R03 A;  4LFC E;  1FWK A;  3T1Y I;  3KWR A;  1EKZ A;  2IHR 1;  4BS9 A;  5IT9 C;  2DEI A;  5BR8 E;  4NXM I;  3ZOQ B;  1XMO I;  1A6F A;  1I94 E;  4K0K I;  2RS7 A;  4DR5 I;  2X36 A;  1X47 A;  4DR2 E;  3J81 C;  1ZM4 A;  2N3H A;  1N34 I;  4HY1 A;  4GKK I;  4YHH I;  2UUB I;  2ZIT A;  4JG4 A;  1T4L B;  4USK A;  2EFG A;  1J5E I;  3B78 A;  4GKJ I;  2VE7 C;  2E5L I;  4USM A;  4LF9 E;  4X8W A;  3LPS A;  3LTO A;  2JOX A;  2MC6 A;  1KVK A;  4HYM A;  2UUC I;  1EA6 A;  1Z0B A;  4LF5 E;  5GME A;  2B7T A;  4LF6 E;  4I8O A;  2IOQ A;  2V88 A;  4DV1 E;  2V8Q B;  3WU3 A;  4UT4 A;  3ZM7 A;  3HQ1 A;  4DUY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...