5FLXC

Mammalian 40s hcv-ires complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
DKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
molecule keywords 18S RRNA
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5flxC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5flxC02
4JI8I 3QT7A 4NXNE 4FW9A 1RREA 1UEKA 4WUDA 3J7AG 1EI1A 5L3JA 4LFCE 4DR5E 1IBKE 3CWVA 4DUZI 3T1HE 4LF9I 3QT6A 2NPFA 3QT8A 4DR6E 3V5RA 4K0KE 1Z0WA 1H74A 4R1FA 2V34A 4B3TE 2HKEA 1Z5CA 3D4JA 5FLXQ 2ZITA 4DV3E 4DPYA 2V2VA 4DV7I 3LPSA 1Z0CA 1B62A 4LFBE 3LTOA 5IT9C 4LF7I 4JI3E 4JI6E 1HNZI 4DR3E 4DUYI 4JI0E 4NXME 4OX9I 2HFUA 4USKA 1MU5A 2LJPA 3ZKDA 3B8HA 2UXCE 1RR9A 4JYAE 4JI2E 4LF6I 1KKHA 4DR7E 2UU9I 1KIJA 4B3RI 4X64E 4X62E 1S16A 3J80C 1XNRE 4DV5I 3J81Q 4DR4I 4LF5I 1FJGE 1Z0BA 1MG7A 4DUYE 4DR2I 4DR6I 5LMUE 5A2QC 5IWAI 1XHKA 4LF8I 5LMNE 1HNXE 1K47A 3LNUA 1ZM4A 2HHHI 4MYUA 2F4VE 5IWAE 3WU6A 4DV4I 3WU4A 2GS8A 4M1KA 4DR5I 4DU8A 1PKPA 4PRVA 1ELOA 4I3HA 3HULA 1N34E 4KHPI 1EA6A 4X66E 1KVKA 4DR2E 1N32I 4JYAI 2WW4A 4JI1I 1FNMA 2VQEE 4NXMI 4OX9E 1B63A 1HR0I 2UUBE 3PYGA 4UTGA 2HFSA 2UXBI 2E5LI 4FWDA 4JI2I 1U2RA 4DV7E 4FWHA 4MYTA 1N33E 4JG4A 4DPXA 4Z7CA 2DEJA 4WUBA 2AJ4A 4DV3I 4X66I 1N32E 4DV0I 4URLA 1Z5BA 2R3VA 2V2ZA 2A2CA 2VF3A 5LMUI 1XMOE 1NHJA 4FWGA 2UUCE 4DUZE 4HYMA 4LF9E 1HNWE 4KQVA 2DEIA 4RPFA 1J5EI 1H7UA 2HK3A 2UXDE 1NZ0A 2E1RA 1IBLE 3V2UC 4B3RE 3T1HI 3K17A 4DV1E 3JAMC 1DARA 2X36A 5FLXC 2A2DA 4LF5E 1FJGI 4GKJE 3T1YI 1N36E 3J81C 1FWKA 3JAMQ 2HK2A 3ZZTA 2HKJA 1IBLI 4HACB 4JV5E 4LF4I 2UXDI 1Z0EA 4JI0I 3J80Q 5GMEA 1XMQE 4DV2E 3B78A 1BKNA 4JI6I 4B3SI 4P7AA 1MX0A 1XNQI 3J7AM 4X64I 2UU9E 4JI7E 1N36I 4NXNI 2OI2A 4DV4E 5IT9Q 4LF4E 3ZKBA 4UT4A 4Z7YA 1Z0TA 4JI5I 2E5LE 4JI1E 1HNZE 3OTOI 1H73A 1A6FA 5A2QQ 2VQEI 1HR0E 2VQFI 4DR1I 4LFAI 4JI5E 4LFBI 2HHHE 4PRXA 2BV3A 1S4EA 1XMOI 1PVGA 4JV5I 4GKJI 3Q1QA 1N0UA 4PU9A 1N34I 4KHPE 4B3TI 1J5EE 4JI8E 4DV0E 4DXLA 4YY3I 4LFAE 2VQFE 4DR1E 2EFGA 3WU3A 4LF8E 3K1JA 3M6AA 4EMDA 2UUAE 1XNRI 1ZXNA 3ZM7A 5LMNI 4B3ME 3B82A 2X7IA 1N0VC 4USMA 2V8PA 1FWLA 2BM0A 3OTOE 1NHHA 1VISA 4HY1A 2ZM6E 4X65E 1Z0VA 1ZXMA 4ZVIA 1ZM3A 4DV5E 4WUCA 1H7SA 3GONA 1XNQE 3QT5A 4GKKE 1NHIA 1FI4A 4JI4I 1OJ4A 4YHHI 2UXBE 4HXZA 1XMQI 3F0NA 4DR3I 5BR8I 3PYFA 1HNXI 5LL6R 4GKKI 2CZ9A 5GMDA 2ZM6I 3H4LA 4JI3I 4LF7E 2UUBI 4B3SE 2UUAI 4YY3E 4AQYI 2J7KA 2F4VI 4X62I 1PIEA 4JI7I 4DU7A 2Q2EB 4K0KI 1IBMI 4AQYE 4X65I 1Z59A 2BM1A 1HNWI 4DR4E 1N33I 4JI4E 1ZM2A 4DPTA 1D6TA 1ZM9A 2R42A 2ZBKB 4DV1I 5BR8E 4LF6E 1Z5AA 4DPUA 3T1YE 4DPWA 4DR7I 4YHHE 2V2QA 1H72C 1I94I 3ZZ0A 4FN5A 4XTJA 1FKAE 2UUCI 3PYDA 4DV2I 1I94E 4HACA 4DV6E 4P52A 4B3MI 2XEXA 4DV6I 1KTVA 1WUUA 1Z0GA 1IBME 3ZZUA 1IBKI 4ED4A 4LFCI 3WU5A 1QZRA 3PYEA 2UXCI
chains in the Genus database with same CATH superfamily
2EM5A 2YTIA 1J26A 2BA1D 4LCGA 2EMKA 4JI8I 4NXNE 3QT7A 3JTZA 2JP9A 2M7QA 4DR5I 4FW9A 2YTJA 1RREA 2EOXA 2JEAB 3Q6NA 5AE2A 1UEKA 4WUDA 1STUA 3J7AG 3NZKA 2JVAA 1EI1A 3EQ1A 5L3JA 4L8NA 1HK7A 3C6MA 4QNKA 2EN3A 4ISAA 4LFCE 1USVA 2JEAA 1T4NA 4DR5E 3U1YA 1IBKE 3BBGA 4HEIA 3CWVA 2RS7A 4DUZI 3T1HE 1E3PA 3QT6A 4LF9I 2NPFA 2LO3A 1EKZA 3ADLA 3QT8A 4MLQA 5C0XF 2CSHA 2V88A 2YTQA 4BMJA 4DR6E 5K36F 2EOIA 3V5RA 2EM4A 4K0KE 1Z0WA 1H74A 4DMIA 4R1FA 4B3TE 2V34A 2HKEA 1ZU1A 2DSYA 1Y4SA 2PNLA 1YUIA 2EM2A 4BHBA 4F2JC 1Z5CA 2PNZA 1X3CA 3GMEA 3D4JA 5FLXQ 5K36E 2A25A 3GLLA 1YZ9A 2YTPA 2ZITA 3PS3A 4M9VC 4DV3E 4O24A 4DPYA 4AIDA 3THNA 2WCC3 2V2VA 4DV7I 4IJDA 5KL6A 3LPSA 1Z0CA 1B62A 4LFBE 3VYXA 2YZTA 5IT9C 3LTOA 3EPKA 2DLKA 2EPUA 2GO3A 1G2DC 2WBTA 2EL5A 2NUGA 4LF7I 3P3CA 2PO1A 3HJCA 4JI3E 4JI6E 3GCMA 4DR3E 3TQMA 1HNZI 4O4KA 4WXCA 1A1HA 4P7DA 1UDOA 5KL4A 4OZEA 4DUYI 1RMDA 4F9CB 4JI0E 1EH6A 4NXME 4OX9I 4KZSA 3EPHA 2EPXA 2HFUA 4USKA 5A6JA 4L5NC 1MU5A 2LJPA 3ZKDA 2UXCE 3MHHC 4OOGC 4X8WA 2YU8A 3B8HA 2YTGA 1X47A 2GLIA 4JI2E 4JYAE 1RR9A 2CGEA 4LF6I 2EQ1A 1KKHA 2WBUA 4DR7E 3FIGA 2JR1A 3KZZA 2RS6A 2UU9I 2C37A 1KIJA 4B3RI 4ZYGA 2CT1A 2EM9A 4X64E 3P3EA 4X62E 1S16A 4BCAA 2B7VA 2LCEA 3J80C 1XNRE 3HQ1A 3J81Q 4DV5I 4DR4I 1FJGE 1O0WA 3P76A 4LF5I 4U3DA 5A69A 1Z0BA 1MG7A 2EN4A 5JEAD 4DUYE 1X48A 4BS9A 4TUGA 2EL6A 3JU0A 1PJSA 4FW4A 2JYAA 4DR2I 4IZJA 4OO1D 4DR6I 3P3GA 2EOFA 1YH8A 2B9DA 3L7ZB 3QG5C 2CVEA 5LMUE 5A2QC 4BA2A 2B7TA 4GZNC 5IWAI 2ODRD 4R2EA 1XHKA 5LMNE 4LF8I 2EPNA 1BBOA 1HNXE 2BBGA 1K47A 3LNUA 2EMFA 1ZM4A 1A1KA 2BA0G 5DNXA 2V85A 4AIMA 2HHHI 4MYUA 2EJ4A 5IWAE 2F4VE 3WU6A 1G2FC 2ENHA 1T38A 4DV4I 3KWRA 2LT7A 1UDQA 4GQUA 3WU4A 2GS8A 3IWBA 2CG9A 1SR9A 1YPNA 4M1KA 2EPOA 2IOQA 4DU8A 1NCSA 1ZR9A 2EPMX 4DKKA 1A1IA 2C39A 3PRYA 1PKPA 2L6MA 4LU9A 4R2DA 4PRVA 4F54A 1ELOA 4I3HA 3HULA 5C0XE 2EOSA 1N34E 4KHPI 1EA6A 4MQYA 4X66E 1KVKA 4DR2E 2PNZB 3J7Yp 1N32I 4JYAI 2WW4A 3CDIA 4JI1I 2EN2A 4NZVA 2EM8A 1FNMA 4BC7A 4WFTA 4LCFA 2F1DA 2VQEE 2EPZA 4OX9E 4NXMI 1T4OA 2EMZA 1B63A 2R76A 1HR0I 2IOPA 4IFDD 2LJUA 2UUBE 2YTFA 4I8OA 3PYGA 4UTGA 2EOYA 2HFSA 2NN6C 3ZOQB 4R8OA 2UXBI 2E5LI 4FW7A 4FWDA 4JI2I 1U2RA 2RQLA 2PRTA 4OO1F 4DV7E 2N3GA 4NBQA 4FWHA 1N33E 4MYTA 4OKGA 5DRQA 1UHZA 1OYRA 4F6MA 3LLHA 4IS9A 4JG4A 4DPXA 2EM7A 4Z7CA 2DEJA 3MSWA 4WUBA 1Y4UA 2AJ4A 2EPCA 2L33A 4N4RB 5AC4A 1L4SA 3B4TA 5AE1A 4DV3I 4IS1C 5EKWA 3WU3A 5KL2A 1PDAA 2GPIA 1N32E 2AE8A 4X66I 2EOZA 4DV0I 2V89A 5AC5A 4URLA 5T6JA 3K85A 2EMYA 1Z5BA 2DIXA 2E72A 2JT2A 4IFDB 2R3VA 2V2ZA 2R1FA 5AE3A 5IV8B 4Q35B 1IQOA 1GZ6A 2A2CA 2PNMA 1YSAC 2VF3A 3HPZA 3PS2A 2LUQA 2GQ0A 4FW6A 5DNLA 5C0XC 5LMUI 1WXRA 1XMOE 1UILA 1NHJA 4FWGA 4M0VA 2JE6B 2HC5A 2J7JA 2UUCE 2FV4B 4DUZE 4R2RA 1Z1BA 2NUFA 1QU6A 3EPLA 4LF9E 4HYMA 4J3DA 2EN1A 5JEAE 2YTOA 4NHRA 1HNWE 1OYSA 4KQVA 2F8BA 2EMCA 3C4BA 2ODRC 2RPCA 2DEIA 4RPFA 4O43A 1J5EI 1H7UA 5JEAA 2HK3A 2UXDE 4R2QA 2YPNA 4MU0A 4RH8A 3UHMA 1NZ0A 2E1RA 1IBLE 5FWKA 3V2UC 1AAYA 4B3RE 3T1HI 3K17A 1JK2A 4DV1E 5LLQA 2PO0A 3JAMC 4MU1A 2EMLA 5DNYA 1DARA 1QNTA 5FLXC 2EPAA 2EZ6A 2A2DA 4LF5E 2X36A 4WYQB 1FJGI 2EMBA 4BC9A 1WJPA 1X6HA 2DMIA 4GKJE 3T1YI 2DRPA 1N36E 2RTXA 3J81C 1FWKA 2EORA 3KZYA 3KRNA 3JAMQ 2HK2A 1BBGA 2DLQA 2MC6A 4ZYEA 2EQ3A 2DGCA 2Z5EA 3ZZTA 4IZKB 5CFFE 1NEIA 1KJKA 2HKJA 1IBLI 2PO1B 4HACB 4JV5E 4LF4I 4OO1C 3DD6A 2UXDI 3H1CA 1EH7A 1T39A 1Z0EA 4FW3A 4JI0I 3J80Q 1VI7A 2O1TA 4FW5A 5GMEA 2VRDA 5JEAB 1XMQE 3F6HA 4DV2E 5K36C 3VHTB 3B78A 1BKNA 4JI6I 4B3SI 2JPAA 4P7AA 2EWLA 1MX0A 1XNQI 4LOMA 2YTEA 2HJJA 4IZJB 2NN6A 3AV0A 2CTDA 3J7AM 2YRKA 2C38A 3HKMA 3EPJA 2IERA 4X64I 5DRRA 2UU9E 1AH5A 4JI7E 1N36I 4NXNI 2OI2A 4DV4E 5IT9Q 2EP3A 4LF4E 3ADIA 4IFDA 2EOHA 5KL5A 1DQ3A 3BIDA 5KL3A 1T4LB 3ECRA 3ZKBA 4UT4A 5ADZA 2MDRA 4Z7YA 2JWOA 1SFEA 2KONA 1Z0TA 3AUZA 4JI5I 1F2IG 2JEBA 1N3GA 2E5LE 4LCHA 4JI1E 2ELZA 1RHYA 1A1LA 1HNZE 1YUJA 1IMUA 3OTOI 1UN6B 2EQ0A 1A6FA 1H73A 2FTXB 1B69A 4IZJD 4OO1A 5A2QQ 2VQEI 3M7ND 2YRMA 5A6AA 1HR0E 5K36D 3M99B 2JXPA 2VQFI 4DR1I 4JI5E 2J65A 2HHHE 2JE6A 4LFAI 4LFBI 4PRXA 1TN9A 1RC7A 4R2AA 2BV3A 1GQEA 1S4EA 5TSEA 3BF2A 2VESA 4BA1B 3DJWA 2WNRA 5AASA 1XMOI 1PVGA 4JV5I 4GKJI 3Q1QA 2KOUA 4WXDA 2WNRB 1N0UA 3DF6A 4PU9A 2EPLX 2KHXA 2HGHA 4KHPE 1N34I 1Y5YA 3Q6MA 1J5EE 4B3TI 2O3ZA 4JI8E 1WRJA 2H36X 4Q28A 2MC5A 1IQSA 2DMYA 4DV0E 4U3BA 2EOJA 2N8XA 3L00A 2K7IA 4DXLA 4AM3A 4YY3I 2V8QB 2NN6E 4IFDF 5A6BA 5K36B 2YU5A 2VQFE 4DR1E 4LFAE 4WX9A 2EFGA 3BGHA 4LF8E 5F3WA 2O1WA 4RHBB 3K1JA 3M6AA 4MU3A 2UUAE 4EMDA 2EM6A 1XNRI 1ZXNA 2EPKX 3ZM7A 1JK1A 2FGGA 2LTSA 2LV2A 2WZOA 2LVHA 2YRHA 3LMLA 5JEAF 2NA2A 5LMNI 4WSGA 3OMLA 2DB2A 2EMGA 4B3ME 2L8TA 1BB8A 4BA1A 2ENAA 1R6MA 3B82A 1X6EA 2X7IA 1N0VC 4USMA 2LTRA 4HTGA 2V8PA 4OO1B 1FWLA 1ZBQA 2BM0A 3OTOE 3P06A 2RSIA 1NHHA 3RMPA 2ZM6E 4M30A 1VISA 4HY1A 4X65E 5C0XD 1XXEA 1Z0VA 1ZXMA 4ZVIA 1ZM3A 2C39B 1YHCA 4DV5E 4KWYA 2L92A 1LLMC 2YWQA 4WPYA 4WUCA 2L2KB 2O1VA 2EMIA 1H7SA 1E3HA 3GONA 1XNQE 4R2SA 3QT5A 2EN7A 1P47A 2ADRA 4R2PA 4GKKE 1NHIA 2MDGA 1ZAAC 4O5GA 1FI4A 1YYOA 4JI4I 1OJ4A 4YHHI 4IZKA 5A6KA 2UXBE 3PS1A 4HXZA 1XMQI 3F0NA 4DR3I 5BR8I 1UBDC 1RQ0A 3PYFA 1HNXI 4FK5C 2GO4A 5LL6R 4ZYDA 4M2ZA 4GKKI 2EPRA 2EOMA 4QNJA 2M1SA 2BR2B 4F9BB 2LUPB 2CZ9A 5GMDA 2NN6D 3H4LA 2YSOA 2ZM6I 4JI3I 1A1FA 2PO2B 1DI2A 4LPFA 4LF7E 2Z5CA 2BA1G 2UUBI 4IFDC 4R2CA 1P42A 1DGCA 4B3SE 5EL9A 2EOOA 2UUAI 3VK6A 2YSPA 1USUA 2C37B 4OO1E 2E1MA 2VE7C 1A1JA 5DRPA 2K4VA 2I13A 2GHFA 2MKDA 4YY3E 2EE8A 3M7NG 4AQYI 2J7KA 2F4VI 3THOB 4X62I 2VF1A 1PIEA 4JI7I 2L2NA 3C4TA 1MEYC 2Q2EB 2WP8A 4DU7A 3M85G 4K0KI 1IBMI 4GEQB 3U1KA 2EM3A 1WHNA 1Y6ZA 2Z5CB 3ADJA 2MKNA 5ELWA 4AQYE 4F9AB 2Z5BB 4P78A 2IESA 4X65I 2EMWA 3P1XA 2BA0D 1KYQA 1Y60A 3L7ZA 2BR2A 1Z59A 2EMAA 2NN6B 2BM1A 2M9AA 1HNWI 3MHSC 1MGTA 2L3CA 3HXLA 1UDNA 2EOQA 4DR4E 5KL7A 4X9JA 1R6LA 1N33I 2LRSA 2WP8B 2D9HA 2JOXA 1YFHA 1YYKA 2EN6A 4JI4E 1GTKA 3UK3C 1ZM2A 4DPTA 1UDSA 1D6TA 3K6QA 2NN6F 4MU4A 4IFDE 1ZM9A 2V87A 2R42A 1X49A 2I9IA 2ZBKB 4DV1I 5BR8E 4LF6E 1TF6A 4R03A 1Z5AA 2O1UA 5JEAC 2PO2A 3H09A 4DPUA 5DROA 3T1YE 2JOBA 4DPWA 4DR7I 2Q8UA 5A6BD 4YHHE 4MLVA 3IWDA 1TF3A 2EN8A 2YT4A 1EH8A 2V2QA 4MDTA 1PJQA 1H72C 2B3TB 1X6FA 4N3OA 2C38B 1ZBTA 1PJTA 2V86A 1I94I 2EMHA 3F6GA 3ZZ0A 4FN5A 2BB8A 2V83A 4XTJA 1WHQA 1FKAE 2M4IA 2YTDA 2CPNA 2N3HA 2UUCI 3IWCA 1X5WA 3CDJA 4BHCA 3HTXA 3PYDA 2EM0A 3HPSA 2EPPA 4WSPA 4DV2I 2ELYA 1I94E 4DV6E 1YYWA 4HACA 4LTYA 2EL4A 2NUEA 2EOEA 3C6KA 5C0XA 4P52A 2L2MA 1OYPA 5K36A 3M85D 2ENCA 1A1GA 2JEBB 4B3MI 4F6NA 5C0XB 2LMZA 2RSMA 2XEXA 2YTNA 4DV6I 1KTVA 1WUUA 2IHR1 2NABA 2L3JA 1Z0GA 2G7HA 1IBME 2LBSB 2Z5BA 3ZZUA 1IBKI 2EMXA 4ED4A 4TUIA 4ZYHA 4J8ZA 4LFCI 5IXMB 2PO0B 2LE2A 3ADGA 3WU5A 2LJHA 1QZRA 3VYYA 3PYEA 2JY9A 4BA2B 2WBSA 4BBYA 2UXCI
chains in the Genus database with same CATH topology
1J26A 4JI8I 4NXNE 3QT7A 3JTZA 2M7QA 4FW9A 1RREA 3Q6NA 5AE2A 1UEKA 4WUDA 1STUA 3J7AG 2JVAA 1EI1A 5L3JA 4L8NA 1HK7A 4LFCE 1USVA 1T4NA 4DR5E 1IBKE 3CWVA 2RS7A 4DUZI 3T1HE 4LF9I 3QT6A 2NPFA 3ADLA 1EKZA 3QT8A 2V88A 4BMJA 4DR6E 3V5RA 4K0KE 1Z0WA 1H74A 4DMIA 4R1FA 4B3TE 2V34A 2HKEA 2DSYA 1Y4SA 2PNLA 1Z5CA 3D4JA 5FLXQ 1YZ9A 2ZITA 4DV3E 4DPYA 2V2VA 4DV7I 3LPSA 1Z0CA 1B62A 4LFBE 3VYXA 2YZTA 5IT9C 3LTOA 2NUGA 4LF7I 3HJCA 4JI3E 4JI6E 1HNZI 4DR3E 4P7DA 4DUYI 4F9CB 4JI0E 4NXME 4OX9I 4KZSA 2HFUA 4USKA 4L5NC 1MU5A 2LJPA 3ZKDA 2UXCE 4OOGC 4X8WA 3B8HA 1RR9A 1X47A 4JI2E 4JYAE 2CGEA 4LF6I 1KKHA 4DR7E 3FIGA 2JR1A 2UU9I 2RS6A 1KIJA 4B3RI 4X64E 4X62E 1S16A 4BCAA 2B7VA 3J80C 1XNRE 4DV5I 3HQ1A 3J81Q 4DR4I 1FJGE 1O0WA 4LF5I 1Z0BA 1MG7A 4DUYE 1X48A 4BS9A 4TUGA 3JU0A 4DR2I 4IZJA 4DR6I 2B9DA 5LMUE 5A2QC 2B7TA 5IWAI 2ODRD 1XHKA 4LF8I 5LMNE 1HNXE 1K47A 3LNUA 1ZM4A 2V85A 2HHHI 4MYUA 2F4VE 5IWAE 3WU6A 4DV4I 3KWRA 3WU4A 2GS8A 3IWBA 2CG9A 1SR9A 4M1KA 2IOQA 4DR5I 4DU8A 4DKKA 3PRYA 1PKPA 2L6MA 4LU9A 4PRVA 4F54A 1ELOA 4I3HA 3HULA 1N34E 4KHPI 1EA6A 4X66E 1KVKA 4DR2E 1N32I 3J7Yp 4JYAI 2WW4A 4JI1I 1FNMA 4BC7A 4WFTA 2VQEE 4OX9E 4NXMI 1T4OA 1B63A 1HR0I 2IOPA 2UUBE 4I8OA 3PYGA 4UTGA 2HFSA 3ZOQB 4R8OA 2UXBI 2E5LI 4FWDA 4JI2I 1U2RA 4DV7E 2N3GA 4FWHA 1N33E 4MYTA 1UHZA 3LLHA 4JG4A 4DPXA 4Z7CA 2DEJA 3MSWA 4WUBA 1Y4UA 2AJ4A 2L33A 5AE1A 4DV3I 1N32E 4X66I 4DV0I 2V89A 4URLA 5T6JA 3K85A 1Z5BA 2DIXA 2R3VA 2V2ZA 5AE3A 2PNMA 2A2CA 1GZ6A 2VF3A 3HPZA 2LUQA 2GQ0A 5LMUI 1WXRA 1XMOE 1NHJA 1UILA 4FWGA 4M0VA 2UUCE 2FV4B 4DUZE 4LF9E 2NUFA 4HYMA 1QU6A 1HNWE 4KQVA 2F8BA 3C4BA 2ODRC 2DEIA 4RPFA 1J5EI 1H7UA 2HK3A 2UXDE 1NZ0A 2E1RA 1IBLE 5FWKA 3V2UC 4B3RE 3T1HI 3K17A 4DV1E 3JAMC 5DNYA 1DARA 2EZ6A 5FLXC 2A2DA 2X36A 4LF5E 1FJGI 4WYQB 4BC9A 4GKJE 3T1YI 1N36E 2RTXA 3J81C 1FWKA 3JAMQ 2HK2A 2MC6A 2Z5EA 3ZZTA 4IZKB 5CFFE 2HKJA 1IBLI 4HACB 4JV5E 4LF4I 2UXDI 1Z0EA 4JI0I 3J80Q 2O1TA 5GMEA 1XMQE 3F6HA 4DV2E 3B78A 1BKNA 4JI6I 4B3SI 4P7AA 2EWLA 1MX0A 1XNQI 4IZJB 3AV0A 3J7AM 4X64I 2UU9E 4JI7E 1N36I 4NXNI 2OI2A 4DV4E 5IT9Q 4LF4E 3ADIA 1DQ3A 1T4LB 3ZKBA 4UT4A 5ADZA 2MDRA 4Z7YA 2JWOA 2KONA 1Z0TA 3AUZA 4JI5I 2E5LE 4JI1E 1HNZE 3OTOI 1H73A 1A6FA 2FTXB 4IZJD 5A2QQ 2VQEI 1HR0E 2VQFI 4DR1I 4LFAI 4JI5E 4LFBI 2HHHE 4PRXA 1RC7A 2BV3A 1GQEA 1S4EA 3DJWA 5AASA 1XMOI 1PVGA 4JV5I 4GKJI 3Q1QA 2KOUA 1N0UA 3DF6A 4PU9A 2KHXA 4KHPE 1N34I 4B3TI 3Q6MA 1J5EE 4JI8E 2H36X 4Q28A 2MC5A 4DV0E 2DMYA 4DXLA 4YY3I 2V8QB 2VQFE 4DR1E 4LFAE 2EFGA 2O1WA 4LF8E 3WU3A 5F3WA 3K1JA 3M6AA 4EMDA 2UUAE 1XNRI 1ZXNA 3ZM7A 2FGGA 2LTSA 2WZOA 3LMLA 5LMNI 2NA2A 3OMLA 2DB2A 4B3ME 2L8TA 3B82A 2X7IA 1N0VC 4USMA 2LTRA 2V8PA 1FWLA 1ZBQA 2BM0A 3OTOE 3P06A 1NHHA 3RMPA 2ZM6E 4M30A 1VISA 4HY1A 4X65E 1Z0VA 1ZXMA 4ZVIA 1ZM3A 4DV5E 2L92A 4WPYA 4WUCA 2L2KB 2O1VA 1H7SA 3GONA 1XNQE 3QT5A 4GKKE 1NHIA 1FI4A 1YYOA 4JI4I 1OJ4A 4YHHI 4IZKA 2UXBE 4HXZA 1XMQI 3F0NA 4DR3I 5BR8I 1RQ0A 3PYFA 1HNXI 5LL6R 4M2ZA 4GKKI 2M1SA 4F9BB 2LUPB 2CZ9A 5GMDA 2ZM6I 3H4LA 4JI3I 1DI2A 4LF7E 2Z5CA 2UUBI 4B3SE 2UUAI 3VK6A 1USUA 2E1MA 2VE7C 2K4VA 4YY3E 4AQYI 2J7KA 2F4VI 4X62I 2VF1A 1PIEA 4JI7I 2L2NA 3C4TA 2Q2EB 4DU7A 4K0KI 1IBMI 4GEQB 1Y6ZA 1WHNA 2Z5CB 3ADJA 4AQYE 4F9AB 2Z5BB 4P78A 4X65I 3P1XA 1Z59A 2BM1A 1HNWI 2L3CA 3HXLA 4DR4E 1N33I 2LRSA 2JOXA 1YYKA 4JI4E 1ZM2A 4DPTA 1D6TA 3K6QA 1ZM9A 2V87A 2R42A 1X49A 2ZBKB 4DV1I 5BR8E 4LF6E 4R03A 1Z5AA 2O1UA 3H09A 4DPUA 3T1YE 2JOBA 4DPWA 4DR7I 4YHHE 3IWDA 2YT4A 2V2QA 1H72C 2B3TB 4N3OA 1ZBTA 2V86A 1I94I 3F6GA 3ZZ0A 4FN5A 2V83A 4XTJA 1WHQA 1FKAE 2M4IA 2CPNA 2N3HA 2UUCI 3IWCA 3HTXA 3PYDA 3HPSA 4WSPA 4DV2I 1I94E 4DV6E 1YYWA 4HACA 4LTYA 2NUEA 4P52A 2L2MA 4B3MI 2LMZA 2RSMA 2XEXA 4DV6I 1KTVA 1WUUA 2IHR1 2L3JA 1Z0GA 2G7HA 1IBME 2LBSB 2Z5BA 3ZZUA 1IBKI 4ED4A 4TUIA 4J8ZA 4LFCI 2LE2A 3ADGA 3WU5A 2LJHA 1QZRA 3VYYA 3PYEA 2JY9A 4BBYA 2UXCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 I;  3QT7 A;  4NXN E;  4FW9 A;  1RRE A;  1UEK A;  4WUD A;  3J7A G;  1EI1 A;  5L3J A;  4LFC E;  4DR5 E;  1IBK E;  3CWV A;  4DUZ I;  3T1H E;  4LF9 I;  3QT6 A;  2NPF A;  3QT8 A;  4DR6 E;  3V5R A;  4K0K E;  1Z0W A;  1H74 A;  4R1F A;  2V34 A;  4B3T E;  2HKE A;  1Z5C A;  3D4J A;  5FLX Q;  2ZIT A;  4DV3 E;  4DPY A;  2V2V A;  4DV7 I;  3LPS A;  1Z0C A;  1B62 A;  4LFB E;  3LTO A;  5IT9 C;  4LF7 I;  4JI3 E;  4JI6 E;  1HNZ I;  4DR3 E;  4DUY I;  4JI0 E;  4NXM E;  4OX9 I;  2HFU A;  4USK A;  1MU5 A;  2LJP A;  3ZKD A;  3B8H A;  2UXC E;  1RR9 A;  4JYA E;  4JI2 E;  4LF6 I;  1KKH A;  4DR7 E;  2UU9 I;  1KIJ A;  4B3R I;  4X64 E;  4X62 E;  1S16 A;  3J80 C;  1XNR E;  4DV5 I;  3J81 Q;  4DR4 I;  4LF5 I;  1FJG E;  1Z0B A;  1MG7 A;  4DUY E;  4DR2 I;  4DR6 I;  5LMU E;  5A2Q C;  5IWA I;  1XHK A;  4LF8 I;  5LMN E;  1HNX E;  1K47 A;  3LNU A;  1ZM4 A;  2HHH I;  4MYU A;  2F4V E;  5IWA E;  3WU6 A;  4DV4 I;  3WU4 A;  2GS8 A;  4M1K A;  4DR5 I;  4DU8 A;  1PKP A;  4PRV A;  1ELO A;  4I3H A;  3HUL A;  1N34 E;  4KHP I;  1EA6 A;  4X66 E;  1KVK A;  4DR2 E;  1N32 I;  4JYA I;  2WW4 A;  4JI1 I;  1FNM A;  2VQE E;  4NXM I;  4OX9 E;  1B63 A;  1HR0 I;  2UUB E;  3PYG A;  4UTG A;  2HFS A;  2UXB I;  2E5L I;  4FWD A;  4JI2 I;  1U2R A;  4DV7 E;  4FWH A;  4MYT A;  1N33 E;  4JG4 A;  4DPX A;  4Z7C A;  2DEJ A;  4WUB A;  2AJ4 A;  4DV3 I;  4X66 I;  1N32 E;  4DV0 I;  4URL A;  1Z5B A;  2R3V A;  2V2Z A;  2A2C A;  2VF3 A;  5LMU I;  1XMO E;  1NHJ A;  4FWG A;  2UUC E;  4DUZ E;  4HYM A;  4LF9 E;  1HNW E;  4KQV A;  2DEI A;  4RPF A;  1J5E I;  1H7U A;  2HK3 A;  2UXD E;  1NZ0 A;  2E1R A;  1IBL E;  3V2U C;  4B3R E;  3T1H I;  3K17 A;  4DV1 E;  3JAM C;  1DAR A;  2X36 A;  5FLX C;  2A2D A;  4LF5 E;  1FJG I;  4GKJ E;  3T1Y I;  1N36 E;  3J81 C;  1FWK A;  3JAM Q;  2HK2 A;  3ZZT A;  2HKJ A;  1IBL I;  4HAC B;  4JV5 E;  4LF4 I;  2UXD I;  1Z0E A;  4JI0 I;  3J80 Q;  5GME A;  1XMQ E;  4DV2 E;  3B78 A;  1BKN A;  4JI6 I;  4B3S I;  4P7A A;  1MX0 A;  1XNQ I;  3J7A M;  4X64 I;  2UU9 E;  4JI7 E;  1N36 I;  4NXN I;  2OI2 A;  4DV4 E;  5IT9 Q;  4LF4 E;  3ZKB A;  4UT4 A;  4Z7Y A;  1Z0T A;  4JI5 I;  2E5L E;  4JI1 E;  1HNZ E;  3OTO I;  1H73 A;  1A6F A;  5A2Q Q;  2VQE I;  1HR0 E;  2VQF I;  4DR1 I;  4LFA I;  4JI5 E;  4LFB I;  2HHH E;  4PRX A;  2BV3 A;  1S4E A;  1XMO I;  1PVG A;  4JV5 I;  4GKJ I;  3Q1Q A;  1N0U A;  4PU9 A;  1N34 I;  4KHP E;  4B3T I;  1J5E E;  4JI8 E;  4DV0 E;  4DXL A;  4YY3 I;  4LFA E;  2VQF E;  4DR1 E;  2EFG A;  3WU3 A;  4LF8 E;  3K1J A;  3M6A A;  4EMD A;  2UUA E;  1XNR I;  1ZXN A;  3ZM7 A;  5LMN I;  4B3M E;  3B82 A;  2X7I A;  1N0V C;  4USM A;  2V8P A;  1FWL A;  2BM0 A;  3OTO E;  1NHH A;  1VIS A;  4HY1 A;  2ZM6 E;  4X65 E;  1Z0V A;  1ZXM A;  4ZVI A;  1ZM3 A;  4DV5 E;  4WUC A;  1H7S A;  3GON A;  1XNQ E;  3QT5 A;  4GKK E;  1NHI A;  1FI4 A;  4JI4 I;  1OJ4 A;  4YHH I;  2UXB E;  4HXZ A;  1XMQ I;  3F0N A;  4DR3 I;  5BR8 I;  3PYF A;  1HNX I;  5LL6 R;  4GKK I;  2CZ9 A;  5GMD A;  2ZM6 I;  3H4L A;  4JI3 I;  4LF7 E;  2UUB I;  4B3S E;  2UUA I;  4YY3 E;  4AQY I;  2J7K A;  2F4V I;  4X62 I;  1PIE A;  4JI7 I;  4DU7 A;  2Q2E B;  4K0K I;  1IBM I;  4AQY E;  4X65 I;  1Z59 A;  2BM1 A;  1HNW I;  4DR4 E;  1N33 I;  4JI4 E;  1ZM2 A;  4DPT A;  1D6T A;  1ZM9 A;  2R42 A;  2ZBK B;  4DV1 I;  5BR8 E;  4LF6 E;  1Z5A A;  4DPU A;  3T1Y E;  4DPW A;  4DR7 I;  4YHH E;  2V2Q A;  1H72 C;  1I94 I;  3ZZ0 A;  4FN5 A;  4XTJ A;  1FKA E;  2UUC I;  3PYD A;  4DV2 I;  1I94 E;  4HAC A;  4DV6 E;  4P52 A;  4B3M I;  2XEX A;  4DV6 I;  1KTV A;  1WUU A;  1Z0G A;  1IBM E;  3ZZU A;  1IBK I;  4ED4 A;  4LFC I;  3WU5 A;  1QZR A;  3PYE A;  2UXC I; 
#chains in the Genus database with same CATH topology
 2EM5 A;  2YTI A;  1J26 A;  2BA1 D;  4LCG A;  2EMK A;  4JI8 I;  4NXN E;  3QT7 A;  3JTZ A;  2JP9 A;  2M7Q A;  4DR5 I;  4FW9 A;  2YTJ A;  1RRE A;  2EOX A;  2JEA B;  3Q6N A;  5AE2 A;  1UEK A;  4WUD A;  1STU A;  3J7A G;  3NZK A;  2JVA A;  1EI1 A;  3EQ1 A;  5L3J A;  4L8N A;  1HK7 A;  3C6M A;  4QNK A;  2EN3 A;  4ISA A;  4LFC E;  1USV A;  2JEA A;  1T4N A;  4DR5 E;  3U1Y A;  1IBK E;  3BBG A;  4HEI A;  3CWV A;  2RS7 A;  4DUZ I;  3T1H E;  1E3P A;  3QT6 A;  4LF9 I;  2NPF A;  2LO3 A;  1EKZ A;  3ADL A;  3QT8 A;  4MLQ A;  5C0X F;  2CSH A;  2V88 A;  2YTQ A;  4BMJ A;  4DR6 E;  5K36 F;  2EOI A;  3V5R A;  2EM4 A;  4K0K E;  1Z0W A;  1H74 A;  4DMI A;  4R1F A;  4B3T E;  2V34 A;  2HKE A;  1ZU1 A;  2DSY A;  1Y4S A;  2PNL A;  1YUI A;  2EM2 A;  4BHB A;  4F2J C;  1Z5C A;  2PNZ A;  1X3C A;  3GME A;  3D4J A;  5FLX Q;  5K36 E;  2A25 A;  3GLL A;  1YZ9 A;  2YTP A;  2ZIT A;  3PS3 A;  4M9V C;  4DV3 E;  4O24 A;  4DPY A;  4AID A;  3THN A;  2WCC 3;  2V2V A;  4DV7 I;  4IJD A;  5KL6 A;  3LPS A;  1Z0C A;  1B62 A;  4LFB E;  3VYX A;  2YZT A;  5IT9 C;  3LTO A;  3EPK A;  2DLK A;  2EPU A;  2GO3 A;  1G2D C;  2WBT A;  2EL5 A;  2NUG A;  4LF7 I;  3P3C A;  2PO1 A;  3HJC A;  4JI3 E;  4JI6 E;  3GCM A;  4DR3 E;  3TQM A;  1HNZ I;  4O4K A;  4WXC A;  1A1H A;  4P7D A;  1UDO A;  5KL4 A;  4OZE A;  4DUY I;  1RMD A;  4F9C B;  4JI0 E;  1EH6 A;  4NXM E;  4OX9 I;  4KZS A;  3EPH A;  2EPX A;  2HFU A;  4USK A;  5A6J A;  4L5N C;  1MU5 A;  2LJP A;  3ZKD A;  2UXC E;  3MHH C;  4OOG C;  4X8W A;  2YU8 A;  3B8H A;  2YTG A;  1X47 A;  2GLI A;  4JI2 E;  4JYA E;  1RR9 A;  2CGE A;  4LF6 I;  2EQ1 A;  1KKH A;  2WBU A;  4DR7 E;  3FIG A;  2JR1 A;  3KZZ A;  2RS6 A;  2UU9 I;  2C37 A;  1KIJ A;  4B3R I;  4ZYG A;  2CT1 A;  2EM9 A;  4X64 E;  3P3E A;  4X62 E;  1S16 A;  4BCA A;  2B7V A;  2LCE A;  3J80 C;  1XNR E;  3HQ1 A;  3J81 Q;  4DV5 I;  4DR4 I;  1FJG E;  1O0W A;  3P76 A;  4LF5 I;  4U3D A;  5A69 A;  1Z0B A;  1MG7 A;  2EN4 A;  5JEA D;  4DUY E;  1X48 A;  4BS9 A;  4TUG A;  2EL6 A;  3JU0 A;  1PJS A;  4FW4 A;  2JYA A;  4DR2 I;  4IZJ A;  4OO1 D;  4DR6 I;  3P3G A;  2EOF A;  1YH8 A;  2B9D A;  3L7Z B;  3QG5 C;  2CVE A;  5LMU E;  5A2Q C;  4BA2 A;  2B7T A;  4GZN C;  5IWA I;  2ODR D;  4R2E A;  1XHK A;  5LMN E;  4LF8 I;  2EPN A;  1BBO A;  1HNX E;  2BBG A;  1K47 A;  3LNU A;  2EMF A;  1ZM4 A;  1A1K A;  2BA0 G;  5DNX A;  2V85 A;  4AIM A;  2HHH I;  4MYU A;  2EJ4 A;  5IWA E;  2F4V E;  3WU6 A;  1G2F C;  2ENH A;  1T38 A;  4DV4 I;  3KWR A;  2LT7 A;  1UDQ A;  4GQU A;  3WU4 A;  2GS8 A;  3IWB A;  2CG9 A;  1SR9 A;  1YPN A;  4M1K A;  2EPO A;  2IOQ A;  4DU8 A;  1NCS A;  1ZR9 A;  2EPM X;  4DKK A;  1A1I A;  2C39 A;  3PRY A;  1PKP A;  2L6M A;  4LU9 A;  4R2D A;  4PRV A;  4F54 A;  1ELO A;  4I3H A;  3HUL A;  5C0X E;  2EOS A;  1N34 E;  4KHP I;  1EA6 A;  4MQY A;  4X66 E;  1KVK A;  4DR2 E;  2PNZ B;  3J7Y p;  1N32 I;  4JYA I;  2WW4 A;  3CDI A;  4JI1 I;  2EN2 A;  4NZV A;  2EM8 A;  1FNM A;  4BC7 A;  4WFT A;  4LCF A;  2F1D A;  2VQE E;  2EPZ A;  4OX9 E;  4NXM I;  1T4O A;  2EMZ A;  1B63 A;  2R76 A;  1HR0 I;  2IOP A;  4IFD D;  2LJU A;  2UUB E;  2YTF A;  4I8O A;  3PYG A;  4UTG A;  2EOY A;  2HFS A;  2NN6 C;  3ZOQ B;  4R8O A;  2UXB I;  2E5L I;  4FW7 A;  4FWD A;  4JI2 I;  1U2R A;  2RQL A;  2PRT A;  4OO1 F;  4DV7 E;  2N3G A;  4NBQ A;  4FWH A;  1N33 E;  4MYT A;  4OKG A;  5DRQ A;  1UHZ A;  1OYR A;  4F6M A;  3LLH A;  4IS9 A;  4JG4 A;  4DPX A;  2EM7 A;  4Z7C A;  2DEJ A;  3MSW A;  4WUB A;  1Y4U A;  2AJ4 A;  2EPC A;  2L33 A;  4N4R B;  5AC4 A;  1L4S A;  3B4T A;  5AE1 A;  4DV3 I;  4IS1 C;  5EKW A;  3WU3 A;  5KL2 A;  1PDA A;  2GPI A;  1N32 E;  2AE8 A;  4X66 I;  2EOZ A;  4DV0 I;  2V89 A;  5AC5 A;  4URL A;  5T6J A;  3K85 A;  2EMY A;  1Z5B A;  2DIX A;  2E72 A;  2JT2 A;  4IFD B;  2R3V A;  2V2Z A;  2R1F A;  5AE3 A;  5IV8 B;  4Q35 B;  1IQO A;  1GZ6 A;  2A2C A;  2PNM A;  1YSA C;  2VF3 A;  3HPZ A;  3PS2 A;  2LUQ A;  2GQ0 A;  4FW6 A;  5DNL A;  5C0X C;  5LMU I;  1WXR A;  1XMO E;  1UIL A;  1NHJ A;  4FWG A;  4M0V A;  2JE6 B;  2HC5 A;  2J7J A;  2UUC E;  2FV4 B;  4DUZ E;  4R2R A;  1Z1B A;  2NUF A;  1QU6 A;  3EPL A;  4LF9 E;  4HYM A;  4J3D A;  2EN1 A;  5JEA E;  2YTO A;  4NHR A;  1HNW E;  1OYS A;  4KQV A;  2F8B A;  2EMC A;  3C4B A;  2ODR C;  2RPC A;  2DEI A;  4RPF A;  4O43 A;  1J5E I;  1H7U A;  5JEA A;  2HK3 A;  2UXD E;  4R2Q A;  2YPN A;  4MU0 A;  4RH8 A;  3UHM A;  1NZ0 A;  2E1R A;  1IBL E;  5FWK A;  3V2U C;  1AAY A;  4B3R E;  3T1H I;  3K17 A;  1JK2 A;  4DV1 E;  5LLQ A;  2PO0 A;  3JAM C;  4MU1 A;  2EML A;  5DNY A;  1DAR A;  1QNT A;  5FLX C;  2EPA A;  2EZ6 A;  2A2D A;  4LF5 E;  2X36 A;  4WYQ B;  1FJG I;  2EMB A;  4BC9 A;  1WJP A;  1X6H A;  2DMI A;  4GKJ E;  3T1Y I;  2DRP A;  1N36 E;  2RTX A;  3J81 C;  1FWK A;  2EOR A;  3KZY A;  3KRN A;  3JAM Q;  2HK2 A;  1BBG A;  2DLQ A;  2MC6 A;  4ZYE A;  2EQ3 A;  2DGC A;  2Z5E A;  3ZZT A;  4IZK B;  5CFF E;  1NEI A;  1KJK A;  2HKJ A;  1IBL I;  2PO1 B;  4HAC B;  4JV5 E;  4LF4 I;  4OO1 C;  3DD6 A;  2UXD I;  3H1C A;  1EH7 A;  1T39 A;  1Z0E A;  4FW3 A;  4JI0 I;  3J80 Q;  1VI7 A;  2O1T A;  4FW5 A;  5GME A;  2VRD A;  5JEA B;  1XMQ E;  3F6H A;  4DV2 E;  5K36 C;  3VHT B;  3B78 A;  1BKN A;  4JI6 I;  4B3S I;  2JPA A;  4P7A A;  2EWL A;  1MX0 A;  1XNQ I;  4LOM A;  2YTE A;  2HJJ A;  4IZJ B;  2NN6 A;  3AV0 A;  2CTD A;  3J7A M;  2YRK A;  2C38 A;  3HKM A;  3EPJ A;  2IER A;  4X64 I;  5DRR A;  2UU9 E;  1AH5 A;  4JI7 E;  1N36 I;  4NXN I;  2OI2 A;  4DV4 E;  5IT9 Q;  2EP3 A;  4LF4 E;  3ADI A;  4IFD A;  2EOH A;  5KL5 A;  1DQ3 A;  3BID A;  5KL3 A;  1T4L B;  3ECR A;  3ZKB A;  4UT4 A;  5ADZ A;  2MDR A;  4Z7Y A;  2JWO A;  1SFE A;  2KON A;  1Z0T A;  3AUZ A;  4JI5 I;  1F2I G;  2JEB A;  1N3G A;  2E5L E;  4LCH A;  4JI1 E;  2ELZ A;  1RHY A;  1A1L A;  1HNZ E;  1YUJ A;  1IMU A;  3OTO I;  1UN6 B;  2EQ0 A;  1A6F A;  1H73 A;  2FTX B;  1B69 A;  4IZJ D;  4OO1 A;  5A2Q Q;  2VQE I;  3M7N D;  2YRM A;  5A6A A;  1HR0 E;  5K36 D;  3M99 B;  2JXP A;  2VQF I;  4DR1 I;  4JI5 E;  2J65 A;  2HHH E;  2JE6 A;  4LFA I;  4LFB I;  4PRX A;  1TN9 A;  1RC7 A;  4R2A A;  2BV3 A;  1GQE A;  1S4E A;  5TSE A;  3BF2 A;  2VES A;  4BA1 B;  3DJW A;  2WNR A;  5AAS A;  1XMO I;  1PVG A;  4JV5 I;  4GKJ I;  3Q1Q A;  2KOU A;  4WXD A;  2WNR B;  1N0U A;  3DF6 A;  4PU9 A;  2EPL X;  2KHX A;  2HGH A;  4KHP E;  1N34 I;  1Y5Y A;  3Q6M A;  1J5E E;  4B3T I;  2O3Z A;  4JI8 E;  1WRJ A;  2H36 X;  4Q28 A;  2MC5 A;  1IQS A;  2DMY A;  4DV0 E;  4U3B A;  2EOJ A;  2N8X A;  3L00 A;  2K7I A;  4DXL A;  4AM3 A;  4YY3 I;  2V8Q B;  2NN6 E;  4IFD F;  5A6B A;  5K36 B;  2YU5 A;  2VQF E;  4DR1 E;  4LFA E;  4WX9 A;  2EFG A;  3BGH A;  4LF8 E;  5F3W A;  2O1W A;  4RHB B;  3K1J A;  3M6A A;  4MU3 A;  2UUA E;  4EMD A;  2EM6 A;  1XNR I;  1ZXN A;  2EPK X;  3ZM7 A;  1JK1 A;  2FGG A;  2LTS A;  2LV2 A;  2WZO A;  2LVH A;  2YRH A;  3LML A;  5JEA F;  2NA2 A;  5LMN I;  4WSG A;  3OML A;  2DB2 A;  2EMG A;  4B3M E;  2L8T A;  1BB8 A;  4BA1 A;  2ENA A;  1R6M A;  3B82 A;  1X6E A;  2X7I A;  1N0V C;  4USM A;  2LTR A;  4HTG A;  2V8P A;  4OO1 B;  1FWL A;  1ZBQ A;  2BM0 A;  3OTO E;  3P06 A;  2RSI A;  1NHH A;  3RMP A;  2ZM6 E;  4M30 A;  1VIS A;  4HY1 A;  4X65 E;  5C0X D;  1XXE A;  1Z0V A;  1ZXM A;  4ZVI A;  1ZM3 A;  2C39 B;  1YHC A;  4DV5 E;  4KWY A;  2L92 A;  1LLM C;  2YWQ A;  4WPY A;  4WUC A;  2L2K B;  2O1V A;  2EMI A;  1H7S A;  1E3H A;  3GON A;  1XNQ E;  4R2S A;  3QT5 A;  2EN7 A;  1P47 A;  2ADR A;  4R2P A;  4GKK E;  1NHI A;  2MDG A;  1ZAA C;  4O5G A;  1FI4 A;  1YYO A;  4JI4 I;  1OJ4 A;  4YHH I;  4IZK A;  5A6K A;  2UXB E;  3PS1 A;  4HXZ A;  1XMQ I;  3F0N A;  4DR3 I;  5BR8 I;  1UBD C;  1RQ0 A;  3PYF A;  1HNX I;  4FK5 C;  2GO4 A;  5LL6 R;  4ZYD A;  4M2Z A;  4GKK I;  2EPR A;  2EOM A;  4QNJ A;  2M1S A;  2BR2 B;  4F9B B;  2LUP B;  2CZ9 A;  5GMD A;  2NN6 D;  3H4L A;  2YSO A;  2ZM6 I;  4JI3 I;  1A1F A;  2PO2 B;  1DI2 A;  4LPF A;  4LF7 E;  2Z5C A;  2BA1 G;  2UUB I;  4IFD C;  4R2C A;  1P42 A;  1DGC A;  4B3S E;  5EL9 A;  2EOO A;  2UUA I;  3VK6 A;  2YSP A;  1USU A;  2C37 B;  4OO1 E;  2E1M A;  2VE7 C;  1A1J A;  5DRP A;  2K4V A;  2I13 A;  2GHF A;  2MKD A;  4YY3 E;  2EE8 A;  3M7N G;  4AQY I;  2J7K A;  2F4V I;  3THO B;  4X62 I;  2VF1 A;  1PIE A;  4JI7 I;  2L2N A;  3C4T A;  1MEY C;  2Q2E B;  2WP8 A;  4DU7 A;  3M85 G;  4K0K I;  1IBM I;  4GEQ B;  3U1K A;  2EM3 A;  1WHN A;  1Y6Z A;  2Z5C B;  3ADJ A;  2MKN A;  5ELW A;  4AQY E;  4F9A B;  2Z5B B;  4P78 A;  2IES A;  4X65 I;  2EMW A;  3P1X A;  2BA0 D;  1KYQ A;  1Y60 A;  3L7Z A;  2BR2 A;  1Z59 A;  2EMA A;  2NN6 B;  2BM1 A;  2M9A A;  1HNW I;  3MHS C;  1MGT A;  2L3C A;  3HXL A;  1UDN A;  2EOQ A;  4DR4 E;  5KL7 A;  4X9J A;  1R6L A;  1N33 I;  2LRS A;  2WP8 B;  2D9H A;  2JOX A;  1YFH A;  1YYK A;  2EN6 A;  4JI4 E;  1GTK A;  3UK3 C;  1ZM2 A;  4DPT A;  1UDS A;  1D6T A;  3K6Q A;  2NN6 F;  4MU4 A;  4IFD E;  1ZM9 A;  2V87 A;  2R42 A;  1X49 A;  2I9I A;  2ZBK B;  4DV1 I;  5BR8 E;  4LF6 E;  1TF6 A;  4R03 A;  1Z5A A;  2O1U A;  5JEA C;  2PO2 A;  3H09 A;  4DPU A;  5DRO A;  3T1Y E;  2JOB A;  4DPW A;  4DR7 I;  2Q8U A;  5A6B D;  4YHH E;  4MLV A;  3IWD A;  1TF3 A;  2EN8 A;  2YT4 A;  1EH8 A;  2V2Q A;  4MDT A;  1PJQ A;  1H72 C;  2B3T B;  1X6F A;  4N3O A;  2C38 B;  1ZBT A;  1PJT A;  2V86 A;  1I94 I;  2EMH A;  3F6G A;  3ZZ0 A;  4FN5 A;  2BB8 A;  2V83 A;  4XTJ A;  1WHQ A;  1FKA E;  2M4I A;  2YTD A;  2CPN A;  2N3H A;  2UUC I;  3IWC A;  1X5W A;  3CDJ A;  4BHC A;  3HTX A;  3PYD A;  2EM0 A;  3HPS A;  2EPP A;  4WSP A;  4DV2 I;  2ELY A;  1I94 E;  4DV6 E;  1YYW A;  4HAC A;  4LTY A;  2EL4 A;  2NUE A;  2EOE A;  3C6K A;  5C0X A;  4P52 A;  2L2M A;  1OYP A;  5K36 A;  3M85 D;  2ENC A;  1A1G A;  2JEB B;  4B3M I;  4F6N A;  5C0X B;  2LMZ A;  2RSM A;  2XEX A;  2YTN A;  4DV6 I;  1KTV A;  1WUU A;  2IHR 1;  2NAB A;  2L3J A;  1Z0G A;  2G7H A;  1IBM E;  2LBS B;  2Z5B A;  3ZZU A;  1IBK I;  2EMX A;  4ED4 A;  4TUI A;  4ZYH A;  4J8Z A;  4LFC I;  5IXM B;  2PO0 B;  2LE2 A;  3ADG A;  3WU5 A;  2LJH A;  1QZR A;  3VYY A;  3PYE A;  2JY9 A;  4BA2 B;  2WBS A;  4BBY A;  2UXC I; 
#chains in the Genus database with same CATH homology
 1J26 A;  4JI8 I;  4NXN E;  3QT7 A;  3JTZ A;  2M7Q A;  4FW9 A;  1RRE A;  3Q6N A;  5AE2 A;  1UEK A;  4WUD A;  1STU A;  3J7A G;  2JVA A;  1EI1 A;  5L3J A;  4L8N A;  1HK7 A;  4LFC E;  1USV A;  1T4N A;  4DR5 E;  1IBK E;  3CWV A;  2RS7 A;  4DUZ I;  3T1H E;  4LF9 I;  3QT6 A;  2NPF A;  3ADL A;  1EKZ A;  3QT8 A;  2V88 A;  4BMJ A;  4DR6 E;  3V5R A;  4K0K E;  1Z0W A;  1H74 A;  4DMI A;  4R1F A;  4B3T E;  2V34 A;  2HKE A;  2DSY A;  1Y4S A;  2PNL A;  1Z5C A;  3D4J A;  5FLX Q;  1YZ9 A;  2ZIT A;  4DV3 E;  4DPY A;  2V2V A;  4DV7 I;  3LPS A;  1Z0C A;  1B62 A;  4LFB E;  3VYX A;  2YZT A;  5IT9 C;  3LTO A;  2NUG A;  4LF7 I;  3HJC A;  4JI3 E;  4JI6 E;  1HNZ I;  4DR3 E;  4P7D A;  4DUY I;  4F9C B;  4JI0 E;  4NXM E;  4OX9 I;  4KZS A;  2HFU A;  4USK A;  4L5N C;  1MU5 A;  2LJP A;  3ZKD A;  2UXC E;  4OOG C;  4X8W A;  3B8H A;  1RR9 A;  1X47 A;  4JI2 E;  4JYA E;  2CGE A;  4LF6 I;  1KKH A;  4DR7 E;  3FIG A;  2JR1 A;  2UU9 I;  2RS6 A;  1KIJ A;  4B3R I;  4X64 E;  4X62 E;  1S16 A;  4BCA A;  2B7V A;  3J80 C;  1XNR E;  4DV5 I;  3HQ1 A;  3J81 Q;  4DR4 I;  1FJG E;  1O0W A;  4LF5 I;  1Z0B A;  1MG7 A;  4DUY E;  1X48 A;  4BS9 A;  4TUG A;  3JU0 A;  4DR2 I;  4IZJ A;  4DR6 I;  2B9D A;  5LMU E;  5A2Q C;  2B7T A;  5IWA I;  2ODR D;  1XHK A;  4LF8 I;  5LMN E;  1HNX E;  1K47 A;  3LNU A;  1ZM4 A;  2V85 A;  2HHH I;  4MYU A;  2F4V E;  5IWA E;  3WU6 A;  4DV4 I;  3KWR A;  3WU4 A;  2GS8 A;  3IWB A;  2CG9 A;  1SR9 A;  4M1K A;  2IOQ A;  4DR5 I;  4DU8 A;  4DKK A;  3PRY A;  1PKP A;  2L6M A;  4LU9 A;  4PRV A;  4F54 A;  1ELO A;  4I3H A;  3HUL A;  1N34 E;  4KHP I;  1EA6 A;  4X66 E;  1KVK A;  4DR2 E;  1N32 I;  3J7Y p;  4JYA I;  2WW4 A;  4JI1 I;  1FNM A;  4BC7 A;  4WFT A;  2VQE E;  4OX9 E;  4NXM I;  1T4O A;  1B63 A;  1HR0 I;  2IOP A;  2UUB E;  4I8O A;  3PYG A;  4UTG A;  2HFS A;  3ZOQ B;  4R8O A;  2UXB I;  2E5L I;  4FWD A;  4JI2 I;  1U2R A;  4DV7 E;  2N3G A;  4FWH A;  1N33 E;  4MYT A;  1UHZ A;  3LLH A;  4JG4 A;  4DPX A;  4Z7C A;  2DEJ A;  3MSW A;  4WUB A;  1Y4U A;  2AJ4 A;  2L33 A;  5AE1 A;  4DV3 I;  1N32 E;  4X66 I;  4DV0 I;  2V89 A;  4URL A;  5T6J A;  3K85 A;  1Z5B A;  2DIX A;  2R3V A;  2V2Z A;  5AE3 A;  2PNM A;  2A2C A;  1GZ6 A;  2VF3 A;  3HPZ A;  2LUQ A;  2GQ0 A;  5LMU I;  1WXR A;  1XMO E;  1NHJ A;  1UIL A;  4FWG A;  4M0V A;  2UUC E;  2FV4 B;  4DUZ E;  4LF9 E;  2NUF A;  4HYM A;  1QU6 A;  1HNW E;  4KQV A;  2F8B A;  3C4B A;  2ODR C;  2DEI A;  4RPF A;  1J5E I;  1H7U A;  2HK3 A;  2UXD E;  1NZ0 A;  2E1R A;  1IBL E;  5FWK A;  3V2U C;  4B3R E;  3T1H I;  3K17 A;  4DV1 E;  3JAM C;  5DNY A;  1DAR A;  2EZ6 A;  5FLX C;  2A2D A;  2X36 A;  4LF5 E;  1FJG I;  4WYQ B;  4BC9 A;  4GKJ E;  3T1Y I;  1N36 E;  2RTX A;  3J81 C;  1FWK A;  3JAM Q;  2HK2 A;  2MC6 A;  2Z5E A;  3ZZT A;  4IZK B;  5CFF E;  2HKJ A;  1IBL I;  4HAC B;  4JV5 E;  4LF4 I;  2UXD I;  1Z0E A;  4JI0 I;  3J80 Q;  2O1T A;  5GME A;  1XMQ E;  3F6H A;  4DV2 E;  3B78 A;  1BKN A;  4JI6 I;  4B3S I;  4P7A A;  2EWL A;  1MX0 A;  1XNQ I;  4IZJ B;  3AV0 A;  3J7A M;  4X64 I;  2UU9 E;  4JI7 E;  1N36 I;  4NXN I;  2OI2 A;  4DV4 E;  5IT9 Q;  4LF4 E;  3ADI A;  1DQ3 A;  1T4L B;  3ZKB A;  4UT4 A;  5ADZ A;  2MDR A;  4Z7Y A;  2JWO A;  2KON A;  1Z0T A;  3AUZ A;  4JI5 I;  2E5L E;  4JI1 E;  1HNZ E;  3OTO I;  1H73 A;  1A6F A;  2FTX B;  4IZJ D;  5A2Q Q;  2VQE I;  1HR0 E;  2VQF I;  4DR1 I;  4LFA I;  4JI5 E;  4LFB I;  2HHH E;  4PRX A;  1RC7 A;  2BV3 A;  1GQE A;  1S4E A;  3DJW A;  5AAS A;  1XMO I;  1PVG A;  4JV5 I;  4GKJ I;  3Q1Q A;  2KOU A;  1N0U A;  3DF6 A;  4PU9 A;  2KHX A;  4KHP E;  1N34 I;  4B3T I;  3Q6M A;  1J5E E;  4JI8 E;  2H36 X;  4Q28 A;  2MC5 A;  4DV0 E;  2DMY A;  4DXL A;  4YY3 I;  2V8Q B;  2VQF E;  4DR1 E;  4LFA E;  2EFG A;  2O1W A;  4LF8 E;  3WU3 A;  5F3W A;  3K1J A;  3M6A A;  4EMD A;  2UUA E;  1XNR I;  1ZXN A;  3ZM7 A;  2FGG A;  2LTS A;  2WZO A;  3LML A;  5LMN I;  2NA2 A;  3OML A;  2DB2 A;  4B3M E;  2L8T A;  3B82 A;  2X7I A;  1N0V C;  4USM A;  2LTR A;  2V8P A;  1FWL A;  1ZBQ A;  2BM0 A;  3OTO E;  3P06 A;  1NHH A;  3RMP A;  2ZM6 E;  4M30 A;  1VIS A;  4HY1 A;  4X65 E;  1Z0V A;  1ZXM A;  4ZVI A;  1ZM3 A;  4DV5 E;  2L92 A;  4WPY A;  4WUC A;  2L2K B;  2O1V A;  1H7S A;  3GON A;  1XNQ E;  3QT5 A;  4GKK E;  1NHI A;  1FI4 A;  1YYO A;  4JI4 I;  1OJ4 A;  4YHH I;  4IZK A;  2UXB E;  4HXZ A;  1XMQ I;  3F0N A;  4DR3 I;  5BR8 I;  1RQ0 A;  3PYF A;  1HNX I;  5LL6 R;  4M2Z A;  4GKK I;  2M1S A;  4F9B B;  2LUP B;  2CZ9 A;  5GMD A;  2ZM6 I;  3H4L A;  4JI3 I;  1DI2 A;  4LF7 E;  2Z5C A;  2UUB I;  4B3S E;  2UUA I;  3VK6 A;  1USU A;  2E1M A;  2VE7 C;  2K4V A;  4YY3 E;  4AQY I;  2J7K A;  2F4V I;  4X62 I;  2VF1 A;  1PIE A;  4JI7 I;  2L2N A;  3C4T A;  2Q2E B;  4DU7 A;  4K0K I;  1IBM I;  4GEQ B;  1Y6Z A;  1WHN A;  2Z5C B;  3ADJ A;  4AQY E;  4F9A B;  2Z5B B;  4P78 A;  4X65 I;  3P1X A;  1Z59 A;  2BM1 A;  1HNW I;  2L3C A;  3HXL A;  4DR4 E;  1N33 I;  2LRS A;  2JOX A;  1YYK A;  4JI4 E;  1ZM2 A;  4DPT A;  1D6T A;  3K6Q A;  1ZM9 A;  2V87 A;  2R42 A;  1X49 A;  2ZBK B;  4DV1 I;  5BR8 E;  4LF6 E;  4R03 A;  1Z5A A;  2O1U A;  3H09 A;  4DPU A;  3T1Y E;  2JOB A;  4DPW A;  4DR7 I;  4YHH E;  3IWD A;  2YT4 A;  2V2Q A;  1H72 C;  2B3T B;  4N3O A;  1ZBT A;  2V86 A;  1I94 I;  3F6G A;  3ZZ0 A;  4FN5 A;  2V83 A;  4XTJ A;  1WHQ A;  1FKA E;  2M4I A;  2CPN A;  2N3H A;  2UUC I;  3IWC A;  3HTX A;  3PYD A;  3HPS A;  4WSP A;  4DV2 I;  1I94 E;  4DV6 E;  1YYW A;  4HAC A;  4LTY A;  2NUE A;  4P52 A;  2L2M A;  4B3M I;  2LMZ A;  2RSM A;  2XEX A;  4DV6 I;  1KTV A;  1WUU A;  2IHR 1;  2L3J A;  1Z0G A;  2G7H A;  1IBM E;  2LBS B;  2Z5B A;  3ZZU A;  1IBK I;  4ED4 A;  4TUI A;  4J8Z A;  4LFC I;  2LE2 A;  3ADG A;  3WU5 A;  2LJH A;  1QZR A;  3VYY A;  3PYE A;  2JY9 A;  4BBY A;  2UXC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...