5FLXC

Mammalian 40s hcv-ires complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
b'DKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5flxC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5flxC02
2NPFA 1Z0CA 2ZM6E 4JI3E 3J81Q 2BV3A 4DR5I 2A2CA 4DV5I 2UUAE 4NXME 3B82A 2HK2A 1ZM3A 1FNMA 4JI8I 3J7AM 4JI1I 3J7AG 1KTVA 4AQYI 1IBKE 4DPXA 4DV6I 2F4VI 2UUBE 4PU9A 3Q1QA 1FWLA 1Z0GA 4JI4I 3T1HE 4NXNI 5LMNI 1XMQE 4MYUA 1DARA 4RPFA 2UUCE 4B3SI 1WUUA 2R42A 2DEJA 3K1JA 3JAMC 5FLXQ 4DR1E 1N34I 1XNRI 1MU5A 4JI7E 4ZVIA 4YY3I 1PVGA 1XNQI 3PYGA 1IBME 3QT7A 3ZZTA 3ZZ0A 4DUZE 4JI3I 1B62A 3WU6A 3ZKBA 1KKHA 2UUAI 4DR4E 4LF9I 2UXCI 3J80Q 2V34A 4UTGA 2VF3A 1NZ0A 1IBKI 4MYTA 3CWVA 1J5EI 1U2RA 2UUBI 1ZXMA 4GKKE 1FWKA 3QT6A 4JV5I 3T1HI 4DR5E 2HKEA 4USMA 4DU7A 4LF8E 4DV2I 1Z0BA 1Z5BA 4JI1E 4JI7I 4AQYE 1Z59A 3PYEA 1IBMI 4EMDA 1EI1A 4DUZI 4NXNE 2ZITA 1BKNA 2HFUA 1XNRE 1Z0EA 4DPWA 1I94E 2HKJA 4FWGA 1Z5AA 4X62E 1H7UA 4DR2E 4LFAE 2HFSA 2X36A 4WUCA 4GKKI 1H74A 1OJ4A 3ZZUA 4OX9I 4LF8I 2R3VA 4PRVA 4LF9E 4X66E 1ZM2A 2E5LI 4DV1E 2UXCE 4HXZA 1Z0TA 2VQEE 4B3RE 4DV3I 2EFGA 5GMDA 1J5EE 4FWHA 5A2QC 1S4EA 4JV5E 5L3JA 1IBLI 4Z7CA 4DV2E 1KIJA 3ZKDA 4B3ME 1HNWE 4I3HA 1N33I 1RR9A 2WW4A 4DV7I 1I94I 1EA6A 3PYDA 3V2UC 4KQVA 4X62I 4DR2I 1MG7A 4LFAI 4LF4E 1Z0VA 1NHHA 4FWDA 2Q2EB 4DV0I 2UU9I 4DV4E 4B3TE 4K0KE 3J81C 2AJ4A 4HYMA 3HULA 3D4JA 4X66I 1FJGI 1ZM9A 4DV1I 1D6TA 1N32E 2VQEI 1H7SA 4B3RI 4JI0E 4LF6E 2V2ZA 4JI2I 2X7IA 2UXDE 4DR7E 2V2QA 2V2VA 4OX9E 4XTJA 5IT9C 1UEKA 4P7AA 1H73A 3T1YI 2E5LE 4B3MI 1HNWI 4R1FA 4DV3E 1NHJA 4DR6I 2DEIA 2A2DA 1PIEA 4WUBA 4Z7YA 4LF4I 1IBLE 4DV4I 4B3TI 1A6FA 1XMOE 4K0KI 4WUDA 4KHPE 1HR0E 1N33E 2HK3A 4DV7E 1H72C 1N32I 1N36E 4JI0I 3K17A 4LF6I 3B78A 3LNUA 2UXDI 4DR7I 1RREA 4DV0E 2UU9E 1S16A 4DPUA 2CZ9A 3JAMQ 3WU4A 4JI5E 1FJGE 3F0NA 5LL6R 2VQFE 5BR8E 4JI2E 3PYFA 2BM0A 3WU3A 3OTOI 4JG4A 4YHHE 2HHHE 4LF7E 3M6AA 4FW9A 1ZM4A 3WU5A 3QT5A 4P52A 4DUYI 3T1YE 1XMOI 1HNXE 4KHPI 1HR0I 3LTOA 1B63A 4JYAI 1NHIA 4DR6E 2V8PA 2BM1A 1N36I 4LFBI 1N0VC 5IT9Q 4X65E 4LFCI 2OI2A 4LF5I 4HACB 4HY1A 4X64E 4GKJE 4JI5I 4DU8A 5LMUE 4DR3E 2VQFI 5BR8I 1Z0WA 3B8HA 2ZM6I 3ZM7A 2HHHI 4YHHI 4LF7I 3V5RA 1VISA 5IWAE 2J7KA 2UXBE 1HNZE 4NXMI 1HNXI 4JI6E 5FLXC 3LPSA 1XHKA 1ZXNA 1MX0A 2GS8A 4USKA 3OTOE 4X65I 1XMQI 1FKAE 4DV5E 2UUCI 3GONA 4DUYE 4UT4A 4FN5A 4HACA 4URLA 4DR1I 4JI8E 2LJPA 4X64I 4GKJI 5GMEA 4DV6E 3QT8A 2F4VE 4JYAE 1ELOA 3J80C 4LFBE 5A2QQ 5LMUI 4DR3I 2E1RA 4DPYA 2ZBKB 4JI4E 4DPTA 5LMNE 4DXLA 4LFCE 2XEXA 4PRXA 4LF5E 4B3SE 3H4LA 1N0UA 4M1KA 5IWAI 1N34E 1PKPA 2UXBI 4DR4I 1HNZI 4ED4A 1QZRA 1KVKA 1Z5CA 1FI4A 1K47A 4JI6I 4YY3E 1XNQE
chains in the Genus database with same CATH superfamily
2NPFA 2YTNA 1UHZA 2LO3A 1Z0CA 2BR2B 3CDJA 2YT4A 1WRJA 2EN4A 2PNMA 2ZM6E 4GEQB 2BBGA 2ELYA 2EMZA 4IJDA 4ZYDA 4JI3E 3EQ1A 2EOSA 1F2IG 1Y60A 1T39A 2BV3A 2Z5BA 1WHQA 2A2CA 3J81Q 4DR5I 2EL6A 2UUAE 3KRNA 4DV5I 2F1DA 3HXLA 3KZYA 4NXME 3B82A 5JEAA 4BBYA 2HK2A 2EMYA 4NHRA 2C37A 1ZM3A 2EPMX 3AUZA 3C6KA 2CPNA 1FNMA 4JI8I 3J7AM 3M7NG 2G7HA 4JI1I 3J7AG 1KTVA 4AQYI 1IBKE 1A1IA 4DPXA 4DV6I 2F4VI 2EM7A 2JE6B 3JTZA 1Y5YA 2HJJA 2WNRB 3L7ZA 2L2NA 2UUBE 4F6MA 4PU9A 3Q1QA 1FWLA 2AE8A 1Z0GA 2MKNA 4JI4I 3T1HE 4NZVA 4NXNI 1XXEA 3TQMA 5LMNI 2EMFA 2EMXA 4R2RA 1XMQE 5K36B 1X47A 2WCC3 2EM9A 2L3CA 4MYUA 1DARA 1G2DC 2UUCE 4RPFA 4B3SI 2N3GA 1WUUA 2MC5A 3Q6MA 4RHBB 5A6JA 2R42A 3K85A 3GCMA 3HPZA 2DEJA 3K1JA 2EN7A 3JAMC 4DR1E 5FLXQ 1N34I 1XNRI 1MU5A 1OYSA 4IZKB 5A6KA 4M0VA 2ELZA 4JI7E 2DIXA 2HC5A 2L3JA 2LE2A 2K4VA 4R2CA 3M85D 4ZVIA 2YTPA 1RHYA 4YY3I 1PVGA 2RS7A 1XNQI 1J26A 5IXMB 3PYGA 1IBME 3QT7A 3ZZTA 2EOMA 4DUZE 3ZZ0A 1P42A 4FW6A 3HTXA 1PJQA 1VI7A 2E72A 4BC7A 1B62A 4JI3I 3EPHA 4O43A 1Z1BA 2EOOA 3P3GA 2V87A 3WU6A 2PNLA 3ZKBA 1KKHA 3HJCA 2EPNA 2UUAI 4DR4E 2EMWA 1MGTA 1EH6A 2YTOA 2NUFA 4LF9I 3M7ND 4BC9A 2EN2A 2ODRD 2UXCI 2V8QB 5KL3A 3EPLA 4R2SA 2V34A 3J80Q 4UTGA 2PNZB 4ZYHA 3VYYA 2YU8A 1A1FA 2VF3A 2EMAA 1DGCA 1NZ0A 2O3ZA 1IBKI 4MYTA 1ZU1A 3CWVA 2EOYA 2CTDA 2EL5A 4BA1B 2L33A 1U2RA 1J5EI 4AIDA 1A1KA 2WNRA 3C4BA 2UUBI 2B9DA 2EQ1A 2MDGA 3L00A 4GKKE 1FWKA 2EOEA 1ZXMA 3QT6A 4IS9A 2L6MA 4JV5I 3T1HI 4WFTA 4DR5E 1KJKA 2IHR1 2HKEA 2Z5BB 2YTEA 4USMA 5K36A 4O4KA 2ENCA 1WHNA 4LF8E 4DU7A 4DV2I 3ECRA 3HQ1A 1P47A 1Z0BA 2YTFA 2V85A 5JEAB 2YPNA 1ZR9A 3P1XA 1YH8A 2C37B 4OO1D 3OMLA 1E3PA 2NN6E 5A6BD 1Z5BA 4JI1E 1ZBQA 4M9VC 2EMGA 4JI7I 4AQYE 2JT2A 1Z59A 1OYRA 2RTXA 1MEYC 2NN6C 4U3BA 3LMLA 3PYEA 2FTXB 3PS1A 3H1CA 2EZ6A 1IBMI 2EPPA 4EMDA 1EI1A 4DUZI 2Z5CA 4NXNE 3BIDA 4FW4A 3KZZA 4F9AB 2YTQA 5A6AA 2ZITA 2GQ0A 5F3WA 4RH8A 1BKNA 1T4OA 4MU0A 4IFDD 5AE2A 2HFUA 3PS3A 3FIGA 2IESA 3P06A 1X6EA 2EMHA 2RSMA 2B7VA 1XNRE 1Z0EA 2BA1D 3AV0A 2HGHA 4GQUA 2JVAA 1UDSA 2JPAA 4DPWA 2EM3A 4BHBA 1YYOA 1I94E 2CG9A 5DRPA 3PRYA 4OKGA 2HKJA 4X9JA 4FWGA 5C0XD 2EOZA 1A1JA 2LRSA 1QNTA 4X62E 1Z5AA 1SR9A 1H7UA 3GLLA 4DR2E 4LFAE 4BA1A 2FGGA 2M7QA 2RSIA 2ENHA 2EM8A 2JY9A 4MLQA 2LBSB 2HFSA 2X36A 4WUCA 1BB8A 2EQ3A 2JEAA 4GKKI 2NABA 3JU0A 1NEIA 2LUQA 3VHTB 1H74A 1OJ4A 3ZZUA 4OX9I 4OO1B 4X8WA 2EOIA 5AASA 4R2AA 1A1HA 3C6MA 2EM4A 3THOB 2EN3A 5LLQA 2GO4A 4LCHA 4LF8I 1YUJA 2R3VA 4LF9E 4PRVA 4X66E 5DNYA 1ZM2A 5IV8B 2E5LI 4DV1E 2VF1A 2NUGA 2UXCE 4HXZA 5EL9A 2VQEE 1Z0TA 4B3RE 4U3DA 4ZYEA 4DV3I 2ADRA 2EFGA 5GMDA 1L4SA 4WXDA 5AC4A 2LJHA 1J5EE 2NA2A 4IFDB 2H36X 5KL4A 4FWHA 2YTIA 2YRKA 5TSEA 5A2QC 1S4EA 2DMYA 4JV5E 5L3JA 1YZ9A 2C39A 4LCFA 1IBLI 5K36E 2EPZA 4Z7CA 2NN6F 4DV2E 5AE1A 1KIJA 1B69A 3ZKDA 5C0XB 5K36C 4FW5A 2EPAA 2DB2A 2EOHA 3DF6A 4B3ME 1HNWE 1R6LA 4I3HA 1YYWA 2I9IA 2YU5A 4LTYA 1RR9A 1UDQA 1N33I 2WW4A 4DV7I 2YTDA 1I94I 2EPUA 1EA6A 3PYDA 5CFFE 3V2UC 2PO1B 1WXRA 4NBQA 3MHHC 4DKKA 1O0WA 5FWKA 4O24A 4ISAA 4KQVA 2V88A 1KYQA 4X62I 4R2EA 2WBSA 4DR2I 1MG7A 4LFAI 4LF4E 2EOJA 3H09A 1NHHA 1Z0VA 2BA0G 1X49A 2YRMA 2Z5CB 2Q2EB 4FWDA 3U1KA 4DV0I 2UU9I 2EPOA 1XNQE 4QNJA 4DV4E 3QG5C 4TUIA 4OO1A 4B3TE 2WBUA 4R2QA 3EPJA 2YWQA 1R6MA 5A6BA 2R1FA 4K0KE 3J81C 2AJ4A 4HYMA 3HULA 3D4JA 1RMDA 2IOPA 4X66I 1FJGI 1ZM9A 4DV1I 1D6TA 3EPKA 1N32E 2VQEI 1H7SA 4B3RI 4JI0E 3ADLA 2GLIA 2CVEA 4LF6E 2V2ZA 2EMBA 2M1SA 4JI2I 2UXDE 2X7IA 4DR7E 2V2QA 2JEAB 2PO2A 5A69A 2DGCA 2LJUA 1JK2A 4IFDA 2V2VA 4OX9E 4XTJA 2JEBB 2LCEA 5IT9C 5DRQA 1X48A 5AE3A 2EOXA 1UEKA 4P7AA 4BHCA 1H73A 2D9HA 3T1YI 4I8OA 1Y4SA 2E5LE 5JEAE 2EORA 1OYPA 5C0XA 1BBOA 3ADIA 4B3MI 1EH7A 1USVA 2VRDA 1GZ6A 1HNWI 2E1MA 4R1FA 4DV3E 2V83A 1NHJA 2JYAA 5JEAC 4GZNC 4DR6I 2DEIA 2EN6A 2DLKA 4FW3A 1LLMC 2DRPA 2N3HA 2A2DA 2PO1A 2RS6A 1GTKA 1PIEA 2BA0D 5K36F 4WUBA 2A25A 5ADZA 1JK1A 4Z7YA 4LF4I 2C39B 3DJWA 3IWDA 1IBLE 2EM0A 2LUPB 4DV4I 4B3TI 1A6FA 4MU3A 1XMOE 4K0KI 2EQ0A 2LMZA 4WUDA 2L8TA 4N4RB 4L8NA 4KHPE 2L92A 1HR0E 1N33E 2HK3A 2J7JA 4DV7E 2ENAA 3ADJA 2LTSA 1H72C 2O1VA 3NZKA 1N32I 2CGEA 2DMIA 1N36E 1BBGA 2N8XA 4JI0I 2K7IA 3C4TA 3P3CA 3K17A 4QNKA 5ELWA 3B78A 1AH5A 4LF6I 1A1GA 3LNUA 2EL4A 1PJSA 2C38B 2EM6A 3F6HA 4LOMA 2JXPA 4R03A 1RREA 4DR7I 2UXDI 2WZOA 4DV0E 5DRRA 4WX9A 1EKZA 2UU9E 2EE8A 1S16A 4OO1E 4DPUA 2CZ9A 4WXCA 3JAMQ 2JEBA 3HKMA 2MDRA 5KL6A 2DSYA 2JP9A 3WU4A 4FW7A 2GHFA 4OO1C 2EPKX 4JI5E 3HPSA 1FJGE 3F0NA 4BMJA 3CDIA 1IQSA 2EPCA 2RPCA 2MKDA 5LL6R 3Q6NA 2VQFE 4LCGA 3M85G 1T4NA 2EMLA 5KL2A 1UN6B 5BR8E 3UK3C 4JI2E 3PYFA 3ADGA 2BM0A 2EPLX 2PO2B 4IFDE 4ZYGA 3WU3A 1UDNA 2JR1A 3OTOI 2HHHE 4YHHE 4JG4A 4LU9A 4LF7E 4KWYA 3RMPA 4TUGA 3M6AA 2YSPA 2EPRA 2YRHA 4F9CB 5JEAF 4IFDC 4FW9A 1ZBTA 1ZM4A 3WU5A 3QT5A 4P52A 4O5GA 4DUYI 1TF3A 1N3GA 3T1YE 4P78A 2LV2A 2L2KB 2EOFA 1XMOI 2NN6A 2WP8A 5C0XE 4J3DA 2EJ4A 1HNXE 2M9AA 1NCSA 2JWOA 3IWCA 4M2ZA 1YYKA 4KHPI 1HR0I 2YTJA 3LTOA 1B63A 4JYAI 4L5NC 1NHIA 4DR6E 2V8PA 2BM1A 5DNXA 5C0XC 4OOGC 3ZOQB 1IMUA 2IOQA 1N36I 4Q28A 4P7DA 4LFBI 1N0VC 2PO0A 5KL5A 4IZJD 5DROA 2EN8A 4IS1C 4R8OA 2EWLA 5IT9Q 4X65E 2EOQA 2LTRA 1X6FA 2C38A 2OI2A 4LFCI 2EN1A 1G2FC 2F8BA 4BS9A 1QU6A 3P3EA 4LF5I 4R2DA 2V89A 2O1WA 1HK7A 1X5WA 4HACB 3UHMA 1IQOA 1E3HA 2EMKA 4MDTA 2EP3A 3F6GA 4F54A 2PRTA 4HY1A 1UBDC 1TF6A 4JI6I 4X64E 4GKJE 4JI5I 4WPYA 4KZSA 4FK5C 1UILA 2LT7A 1YFHA 2M4IA 2O1UA 5JEAD 1TN9A 5LMUE 2NN6D 4DU8A 4DR3E 2VQFI 2BR2A 1RQ0A 4N3OA 4BA2B 5BR8I 4OZEA 3K6QA 2JOXA 4OO1F 1YUIA 4AM3A 1USUA 1Z0WA 3J7Yp 2NUEA 5KL7A 2IERA 3B8HA 3ZM7A 2ZM6I 3BBGA 2GPIA 2B3TB 2KHXA 4YHHI 4MU1A 2HHHI 2R76A 2O1TA 4LF7I 1T38A 3V5RA 1GQEA 3THNA 1VISA 5IWAE 2J7KA 5AC5A 3VYXA 2WBTA 1DI2A 2UXBE 1HNZE 3MHSC 3PS2A 4NXMI 1PJTA 2BA1G 3LLHA 2CT1A 1ZAAC 4DMIA 3M99B 3GMEA 1EH8A 2VE7C 4IZJB 5T6JA 4AIMA 1HNXI 4JI6E 2B7TA 4WSGA 5FLXC 3LPSA 4IFDF 1WJPA 1AAYA 2JE6A 2EM5A 2L2MA 2EMCA 3KWRA 1Y6ZA 1XHKA 4MLVA 3BGHA 1ZXNA 4MU4A 1MX0A 3OTOE 2GS8A 1X6HA 4USKA 2FV4B 1RC7A 2EM2A 4X65I 4F6NA 2J65A 2EPXA 3B4TA 2Q8UA 1XMQI 3DD6A 4M30A 1FKAE 1YHCA 2GO3A 4DV5E 2V86A 2Z5EA 3VK6A 5C0XF 2UUCI 2EMIA 3GONA 4DUYE 4UT4A 2I13A 1UDOA 3BF2A 4FN5A 4HACA 2NN6B 4WSPA 2WP8B 4URLA 4JI8E 4DR1I 1YPNA 2DLQA 2MC6A 4BCAA 2ODRC 1YSAC 2LJPA 2KONA 4F2JC 4IZKA 4LPFA 4X64I 4HTGA 4GKJI 4F9BB 5GMEA 4DV6E 2F4VE 1PDAA 1X3CA 1STUA 4JYAE 2YSOA 2RQLA 3QT8A 2JOBA 1ELOA 3L7ZB 3J80C 4LFBE 5A2QQ 5LMUI 3P76A 2PO0B 4WYQB 4HEIA 2E1RA 4DPYA 4DR3I 1SFEA 2KOUA 2ZBKB 4BA2A 4JI4E 1DQ3A 5DNLA 2LVHA 2BB8A 2YTGA 5LMNE 4DPTA 4DXLA 4LFCE 3U1YA 2CSHA 4J8ZA 2XEXA 4PRXA 4LF5E 3MSWA 4B3SE 3H4LA 1N0UA 4M1KA 5EKWA 5IWAI 1Y4UA 2YZTA 3IWBA 1PKPA 1N34E 2UXBI 2VESA 4DR4I 1HNZI 4ED4A 1QZRA 5K36D 4MQYA 1KVKA 1Z5CA 1FI4A 1K47A 2PNZA 4R2PA 4IZJA 1T4LB 4YY3E 4Q35B 1A1LA
chains in the Genus database with same CATH topology
2NPFA 1UHZA 1Z0CA 2YT4A 2PNMA 2ZM6E 4GEQB 4JI3E 3J81Q 2BV3A 2Z5BA 1WHQA 2A2CA 4DR5I 2UUAE 4DV5I 3HXLA 4NXME 3B82A 4BBYA 2HK2A 1ZM3A 3AUZA 1FNMA 2CPNA 4JI8I 3J7AM 2G7HA 4JI1I 3J7AG 1KTVA 4AQYI 1IBKE 4DPXA 4DV6I 2F4VI 3JTZA 2L2NA 2UUBE 4PU9A 3Q1QA 1FWLA 1Z0GA 4JI4I 3T1HE 4NXNI 5LMNI 1XMQE 1X47A 2L3CA 4MYUA 1DARA 2UUCE 4RPFA 4B3SI 2N3GA 1WUUA 2MC5A 3Q6MA 2R42A 3K85A 3HPZA 2DEJA 3K1JA 3JAMC 5FLXQ 4DR1E 1N34I 1XNRI 1MU5A 4IZKB 4M0VA 4JI7E 2DIXA 2L3JA 2LE2A 2K4VA 4ZVIA 4YY3I 1PVGA 2RS7A 1XNQI 1J26A 3PYGA 1IBME 3QT7A 3ZZTA 4DUZE 3ZZ0A 3HTXA 4BC7A 4JI3I 1B62A 2V87A 3WU6A 2PNLA 3ZKBA 1KKHA 3HJCA 2UUAI 4DR4E 2NUFA 4LF9I 4BC9A 2ODRD 2UXCI 2V8QB 3J80Q 2V34A 4UTGA 3VYYA 2VF3A 1NZ0A 1IBKI 4MYTA 3CWVA 2L33A 1U2RA 1J5EI 3C4BA 2UUBI 2B9DA 4GKKE 1ZXMA 1FWKA 3QT6A 2L6MA 4JV5I 3T1HI 4WFTA 4DR5E 2Z5BB 2IHR1 2HKEA 4USMA 4DU7A 1WHNA 4LF8E 4DV2I 3HQ1A 1Z0BA 2V85A 3P1XA 3OMLA 1Z5BA 4JI1E 1ZBQA 4JI7I 4AQYE 1Z59A 2RTXA 3LMLA 3PYEA 2FTXB 2EZ6A 1IBMI 4EMDA 1EI1A 4DUZI 2Z5CA 4NXNE 4F9AB 2ZITA 2GQ0A 5F3WA 1BKNA 1T4OA 5AE2A 2HFUA 3FIGA 3P06A 2RSMA 2B7VA 1XNRE 1Z0EA 3AV0A 2JVAA 4DPWA 1YYOA 1I94E 2CG9A 3PRYA 2HKJA 4FWGA 2LRSA 4X62E 1Z5AA 1SR9A 1H7UA 4DR2E 4LFAE 2FGGA 2M7QA 2JY9A 2HFSA 2LBSB 2X36A 4WUCA 4GKKI 3JU0A 2LUQA 1H74A 1OJ4A 3ZZUA 4OX9I 4X8WA 5AASA 4LF8I 2R3VA 4LF9E 4PRVA 4X66E 5DNYA 1ZM2A 2E5LI 4DV1E 2VF1A 2NUGA 2UXCE 4HXZA 2VQEE 1Z0TA 4B3RE 4DV3I 2EFGA 5GMDA 2LJHA 1J5EE 2NA2A 2H36X 4FWHA 5A2QC 1S4EA 2DMYA 4JV5E 5L3JA 1YZ9A 1IBLI 4Z7CA 4DV2E 5AE1A 1KIJA 3ZKDA 3DF6A 2DB2A 4B3ME 1HNWE 4I3HA 1YYWA 1N33I 1RR9A 4LTYA 2WW4A 4DV7I 1I94I 1EA6A 3PYDA 5CFFE 3V2UC 1WXRA 4DKKA 1O0WA 5FWKA 4KQVA 2V88A 4X62I 4DR2I 1MG7A 4LFAI 4LF4E 1Z0VA 3H09A 1NHHA 2Z5CB 4FWDA 1X49A 2Q2EB 4DV0I 2UU9I 4DV4E 4TUIA 4B3TE 4K0KE 3J81C 2AJ4A 4HYMA 3HULA 3D4JA 2IOPA 4X66I 1FJGI 1ZM9A 4DV1I 1D6TA 1N32E 2VQEI 1H7SA 4B3RI 4JI0E 3ADLA 4LF6E 2V2ZA 2M1SA 4JI2I 2UXDE 2X7IA 4DR7E 2V2QA 2V2VA 4OX9E 4XTJA 5IT9C 1X48A 5AE3A 1UEKA 4P7AA 1H73A 3T1YI 4I8OA 1Y4SA 2E5LE 3ADIA 4B3MI 1USVA 1HNWI 1GZ6A 2E1MA 4R1FA 4DV3E 2V83A 1NHJA 4DR6I 2DEIA 2N3HA 2A2DA 2RS6A 1PIEA 4WUBA 5ADZA 4Z7YA 4LF4I 3DJWA 3IWDA 1IBLE 2LUPB 4DV4I 4B3TI 1A6FA 1XMOE 4K0KI 2LMZA 4WUDA 2L8TA 4L8NA 4KHPE 2L92A 1HR0E 1N33E 2HK3A 4DV7E 2O1VA 3ADJA 2LTSA 1H72C 1N32I 2CGEA 1N36E 4JI0I 3C4TA 3K17A 4LF6I 3B78A 3LNUA 2UXDI 3F6HA 4DR7I 4R03A 1RREA 2WZOA 4DV0E 1EKZA 2UU9E 1S16A 4DPUA 2CZ9A 3JAMQ 2MDRA 2DSYA 3WU4A 4JI5E 3HPSA 1FJGE 3F0NA 4BMJA 5LL6R 3Q6NA 2VQFE 1T4NA 5BR8E 4JI2E 3PYFA 3ADGA 2BM0A 3WU3A 2JR1A 3OTOI 2HHHE 4YHHE 4JG4A 4LU9A 4LF7E 3RMPA 4TUGA 3M6AA 4F9CB 4FW9A 1ZBTA 1ZM4A 3WU5A 3QT5A 4P52A 4DUYI 3T1YE 4P78A 2L2KB 1XMOI 1HNXE 2JWOA 3IWCA 4KHPI 4M2ZA 1YYKA 1HR0I 3LTOA 1B63A 4JYAI 4L5NC 1NHIA 4DR6E 2V8PA 2BM1A 4OOGC 3ZOQB 1N36I 2IOQA 4Q28A 4P7DA 4LFBI 1N0VC 4IZJD 4R8OA 2EWLA 5IT9Q 4X65E 2LTRA 4LFCI 2OI2A 2F8BA 4BS9A 1QU6A 4LF5I 2V89A 2O1WA 1HK7A 4HACB 3F6GA 4HY1A 4F54A 4JI6I 4X64E 4GKJE 4JI5I 4KZSA 1UILA 2M4IA 2O1UA 5LMUE 4DU8A 4DR3E 2VQFI 1RQ0A 4N3OA 5BR8I 3K6QA 2JOXA 1USUA 1Z0WA 3J7Yp 2NUEA 3B8HA 2ZM6I 3ZM7A 2HHHI 4YHHI 2B3TB 2KHXA 4LF7I 2O1TA 3V5RA 1GQEA 1VISA 5IWAE 2J7KA 3VYXA 1DI2A 2UXBE 1HNZE 4NXMI 3LLHA 4DMIA 2VE7C 4IZJB 5T6JA 1HNXI 4JI6E 2B7TA 5FLXC 3LPSA 2L2MA 3KWRA 1Y6ZA 1XHKA 1ZXNA 1MX0A 3OTOE 2GS8A 4USKA 2FV4B 1RC7A 4X65I 1XMQI 4M30A 1FKAE 4DV5E 2V86A 2Z5EA 3VK6A 2UUCI 3GONA 4DUYE 4UT4A 4FN5A 4HACA 4WSPA 4URLA 4DR1I 4JI8E 2MC6A 2LJPA 4BCAA 2ODRC 2KONA 4IZKA 4X64I 4GKJI 4F9BB 5GMEA 4DV6E 2F4VE 4JYAE 3QT8A 1STUA 2JOBA 1ELOA 3J80C 4LFBE 5A2QQ 5LMUI 4WYQB 2E1RA 4DR3I 4DPYA 2KOUA 2ZBKB 4JI4E 1DQ3A 4DPTA 5LMNE 4DXLA 4LFCE 4J8ZA 2XEXA 4PRXA 4LF5E 3MSWA 4B3SE 3H4LA 1N0UA 4M1KA 5IWAI 1Y4UA 2YZTA 3IWBA 1PKPA 1N34E 2UXBI 4DR4I 1HNZI 4ED4A 1QZRA 1KVKA 1Z5CA 1FI4A 1K47A 4IZJA 1T4LB 4YY3E 4WPYA 1XNQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPF A;  1Z0C A;  2ZM6 E;  4JI3 E;  3J81 Q;  2BV3 A;  4DR5 I;  2A2C A;  4DV5 I;  2UUA E;  4NXM E;  3B82 A;  2HK2 A;  1ZM3 A;  1FNM A;  4JI8 I;  3J7A M;  4JI1 I;  3J7A G;  1KTV A;  4AQY I;  1IBK E;  4DPX A;  4DV6 I;  2F4V I;  2UUB E;  4PU9 A;  3Q1Q A;  1FWL A;  1Z0G A;  4JI4 I;  3T1H E;  4NXN I;  5LMN I;  1XMQ E;  4MYU A;  1DAR A;  4RPF A;  2UUC E;  4B3S I;  1WUU A;  2R42 A;  2DEJ A;  3K1J A;  3JAM C;  5FLX Q;  4DR1 E;  1N34 I;  1XNR I;  1MU5 A;  4JI7 E;  4ZVI A;  4YY3 I;  1PVG A;  1XNQ I;  3PYG A;  1IBM E;  3QT7 A;  3ZZT A;  3ZZ0 A;  4DUZ E;  4JI3 I;  1B62 A;  3WU6 A;  3ZKB A;  1KKH A;  2UUA I;  4DR4 E;  4LF9 I;  2UXC I;  3J80 Q;  2V34 A;  4UTG A;  2VF3 A;  1NZ0 A;  1IBK I;  4MYT A;  3CWV A;  1J5E I;  1U2R A;  2UUB I;  1ZXM A;  4GKK E;  1FWK A;  3QT6 A;  4JV5 I;  3T1H I;  4DR5 E;  2HKE A;  4USM A;  4DU7 A;  4LF8 E;  4DV2 I;  1Z0B A;  1Z5B A;  4JI1 E;  4JI7 I;  4AQY E;  1Z59 A;  3PYE A;  1IBM I;  4EMD A;  1EI1 A;  4DUZ I;  4NXN E;  2ZIT A;  1BKN A;  2HFU A;  1XNR E;  1Z0E A;  4DPW A;  1I94 E;  2HKJ A;  4FWG A;  1Z5A A;  4X62 E;  1H7U A;  4DR2 E;  4LFA E;  2HFS A;  2X36 A;  4WUC A;  4GKK I;  1H74 A;  1OJ4 A;  3ZZU A;  4OX9 I;  4LF8 I;  2R3V A;  4PRV A;  4LF9 E;  4X66 E;  1ZM2 A;  2E5L I;  4DV1 E;  2UXC E;  4HXZ A;  1Z0T A;  2VQE E;  4B3R E;  4DV3 I;  2EFG A;  5GMD A;  1J5E E;  4FWH A;  5A2Q C;  1S4E A;  4JV5 E;  5L3J A;  1IBL I;  4Z7C A;  4DV2 E;  1KIJ A;  3ZKD A;  4B3M E;  1HNW E;  4I3H A;  1N33 I;  1RR9 A;  2WW4 A;  4DV7 I;  1I94 I;  1EA6 A;  3PYD A;  3V2U C;  4KQV A;  4X62 I;  4DR2 I;  1MG7 A;  4LFA I;  4LF4 E;  1Z0V A;  1NHH A;  4FWD A;  2Q2E B;  4DV0 I;  2UU9 I;  4DV4 E;  4B3T E;  4K0K E;  3J81 C;  2AJ4 A;  4HYM A;  3HUL A;  3D4J A;  4X66 I;  1FJG I;  1ZM9 A;  4DV1 I;  1D6T A;  1N32 E;  2VQE I;  1H7S A;  4B3R I;  4JI0 E;  4LF6 E;  2V2Z A;  4JI2 I;  2X7I A;  2UXD E;  4DR7 E;  2V2Q A;  2V2V A;  4OX9 E;  4XTJ A;  5IT9 C;  1UEK A;  4P7A A;  1H73 A;  3T1Y I;  2E5L E;  4B3M I;  1HNW I;  4R1F A;  4DV3 E;  1NHJ A;  4DR6 I;  2DEI A;  2A2D A;  1PIE A;  4WUB A;  4Z7Y A;  4LF4 I;  1IBL E;  4DV4 I;  4B3T I;  1A6F A;  1XMO E;  4K0K I;  4WUD A;  4KHP E;  1HR0 E;  1N33 E;  2HK3 A;  4DV7 E;  1H72 C;  1N32 I;  1N36 E;  4JI0 I;  3K17 A;  4LF6 I;  3B78 A;  3LNU A;  2UXD I;  4DR7 I;  1RRE A;  4DV0 E;  2UU9 E;  1S16 A;  4DPU A;  2CZ9 A;  3JAM Q;  3WU4 A;  4JI5 E;  1FJG E;  3F0N A;  5LL6 R;  2VQF E;  5BR8 E;  4JI2 E;  3PYF A;  2BM0 A;  3WU3 A;  3OTO I;  4JG4 A;  4YHH E;  2HHH E;  4LF7 E;  3M6A A;  4FW9 A;  1ZM4 A;  3WU5 A;  3QT5 A;  4P52 A;  4DUY I;  3T1Y E;  1XMO I;  1HNX E;  4KHP I;  1HR0 I;  3LTO A;  1B63 A;  4JYA I;  1NHI A;  4DR6 E;  2V8P A;  2BM1 A;  1N36 I;  4LFB I;  1N0V C;  5IT9 Q;  4X65 E;  4LFC I;  2OI2 A;  4LF5 I;  4HAC B;  4HY1 A;  4X64 E;  4GKJ E;  4JI5 I;  4DU8 A;  5LMU E;  4DR3 E;  2VQF I;  5BR8 I;  1Z0W A;  3B8H A;  2ZM6 I;  3ZM7 A;  2HHH I;  4YHH I;  4LF7 I;  3V5R A;  1VIS A;  5IWA E;  2J7K A;  2UXB E;  1HNZ E;  4NXM I;  1HNX I;  4JI6 E;  5FLX C;  3LPS A;  1XHK A;  1ZXN A;  1MX0 A;  2GS8 A;  4USK A;  3OTO E;  4X65 I;  1XMQ I;  1FKA E;  4DV5 E;  2UUC I;  3GON A;  4DUY E;  4UT4 A;  4FN5 A;  4HAC A;  4URL A;  4DR1 I;  4JI8 E;  2LJP A;  4X64 I;  4GKJ I;  5GME A;  4DV6 E;  3QT8 A;  2F4V E;  4JYA E;  1ELO A;  3J80 C;  4LFB E;  5A2Q Q;  5LMU I;  4DR3 I;  2E1R A;  4DPY A;  2ZBK B;  4JI4 E;  4DPT A;  5LMN E;  4DXL A;  4LFC E;  2XEX A;  4PRX A;  4LF5 E;  4B3S E;  3H4L A;  1N0U A;  4M1K A;  5IWA I;  1N34 E;  1PKP A;  2UXB I;  4DR4 I;  1HNZ I;  4ED4 A;  1QZR A;  1KVK A;  1Z5C A;  1FI4 A;  1K47 A;  4JI6 I;  4YY3 E;  1XNQ E; 
#chains in the Genus database with same CATH topology
 2NPF A;  2YTN A;  1UHZ A;  2LO3 A;  1Z0C A;  2BR2 B;  3CDJ A;  2YT4 A;  1WRJ A;  2EN4 A;  2PNM A;  2ZM6 E;  4GEQ B;  2BBG A;  2ELY A;  2EMZ A;  4IJD A;  4ZYD A;  4JI3 E;  3EQ1 A;  2EOS A;  1F2I G;  1Y60 A;  1T39 A;  2BV3 A;  2Z5B A;  1WHQ A;  2A2C A;  3J81 Q;  4DR5 I;  2EL6 A;  2UUA E;  3KRN A;  4DV5 I;  2F1D A;  3HXL A;  3KZY A;  4NXM E;  3B82 A;  5JEA A;  4BBY A;  2HK2 A;  2EMY A;  4NHR A;  2C37 A;  1ZM3 A;  2EPM X;  3AUZ A;  3C6K A;  2CPN A;  1FNM A;  4JI8 I;  3J7A M;  3M7N G;  2G7H A;  4JI1 I;  3J7A G;  1KTV A;  4AQY I;  1IBK E;  1A1I A;  4DPX A;  4DV6 I;  2F4V I;  2EM7 A;  2JE6 B;  3JTZ A;  1Y5Y A;  2HJJ A;  2WNR B;  3L7Z A;  2L2N A;  2UUB E;  4F6M A;  4PU9 A;  3Q1Q A;  1FWL A;  2AE8 A;  1Z0G A;  2MKN A;  4JI4 I;  3T1H E;  4NZV A;  4NXN I;  1XXE A;  3TQM A;  5LMN I;  2EMF A;  2EMX A;  4R2R A;  1XMQ E;  5K36 B;  1X47 A;  2WCC 3;  2EM9 A;  2L3C A;  4MYU A;  1DAR A;  1G2D C;  2UUC E;  4RPF A;  4B3S I;  2N3G A;  1WUU A;  2MC5 A;  3Q6M A;  4RHB B;  5A6J A;  2R42 A;  3K85 A;  3GCM A;  3HPZ A;  2DEJ A;  3K1J A;  2EN7 A;  3JAM C;  4DR1 E;  5FLX Q;  1N34 I;  1XNR I;  1MU5 A;  1OYS A;  4IZK B;  5A6K A;  4M0V A;  2ELZ A;  4JI7 E;  2DIX A;  2HC5 A;  2L3J A;  2LE2 A;  2K4V A;  4R2C A;  3M85 D;  4ZVI A;  2YTP A;  1RHY A;  4YY3 I;  1PVG A;  2RS7 A;  1XNQ I;  1J26 A;  5IXM B;  3PYG A;  1IBM E;  3QT7 A;  3ZZT A;  2EOM A;  4DUZ E;  3ZZ0 A;  1P42 A;  4FW6 A;  3HTX A;  1PJQ A;  1VI7 A;  2E72 A;  4BC7 A;  1B62 A;  4JI3 I;  3EPH A;  4O43 A;  1Z1B A;  2EOO A;  3P3G A;  2V87 A;  3WU6 A;  2PNL A;  3ZKB A;  1KKH A;  3HJC A;  2EPN A;  2UUA I;  4DR4 E;  2EMW A;  1MGT A;  1EH6 A;  2YTO A;  2NUF A;  4LF9 I;  3M7N D;  4BC9 A;  2EN2 A;  2ODR D;  2UXC I;  2V8Q B;  5KL3 A;  3EPL A;  4R2S A;  2V34 A;  3J80 Q;  4UTG A;  2PNZ B;  4ZYH A;  3VYY A;  2YU8 A;  1A1F A;  2VF3 A;  2EMA A;  1DGC A;  1NZ0 A;  2O3Z A;  1IBK I;  4MYT A;  1ZU1 A;  3CWV A;  2EOY A;  2CTD A;  2EL5 A;  4BA1 B;  2L33 A;  1U2R A;  1J5E I;  4AID A;  1A1K A;  2WNR A;  3C4B A;  2UUB I;  2B9D A;  2EQ1 A;  2MDG A;  3L00 A;  4GKK E;  1FWK A;  2EOE A;  1ZXM A;  3QT6 A;  4IS9 A;  2L6M A;  4JV5 I;  3T1H I;  4WFT A;  4DR5 E;  1KJK A;  2IHR 1;  2HKE A;  2Z5B B;  2YTE A;  4USM A;  5K36 A;  4O4K A;  2ENC A;  1WHN A;  4LF8 E;  4DU7 A;  4DV2 I;  3ECR A;  3HQ1 A;  1P47 A;  1Z0B A;  2YTF A;  2V85 A;  5JEA B;  2YPN A;  1ZR9 A;  3P1X A;  1YH8 A;  2C37 B;  4OO1 D;  3OML A;  1E3P A;  2NN6 E;  5A6B D;  1Z5B A;  4JI1 E;  1ZBQ A;  4M9V C;  2EMG A;  4JI7 I;  4AQY E;  2JT2 A;  1Z59 A;  1OYR A;  2RTX A;  1MEY C;  2NN6 C;  4U3B A;  3LML A;  3PYE A;  2FTX B;  3PS1 A;  3H1C A;  2EZ6 A;  1IBM I;  2EPP A;  4EMD A;  1EI1 A;  4DUZ I;  2Z5C A;  4NXN E;  3BID A;  4FW4 A;  3KZZ A;  4F9A B;  2YTQ A;  5A6A A;  2ZIT A;  2GQ0 A;  5F3W A;  4RH8 A;  1BKN A;  1T4O A;  4MU0 A;  4IFD D;  5AE2 A;  2HFU A;  3PS3 A;  3FIG A;  2IES A;  3P06 A;  1X6E A;  2EMH A;  2RSM A;  2B7V A;  1XNR E;  1Z0E A;  2BA1 D;  3AV0 A;  2HGH A;  4GQU A;  2JVA A;  1UDS A;  2JPA A;  4DPW A;  2EM3 A;  4BHB A;  1YYO A;  1I94 E;  2CG9 A;  5DRP A;  3PRY A;  4OKG A;  2HKJ A;  4X9J A;  4FWG A;  5C0X D;  2EOZ A;  1A1J A;  2LRS A;  1QNT A;  4X62 E;  1Z5A A;  1SR9 A;  1H7U A;  3GLL A;  4DR2 E;  4LFA E;  4BA1 A;  2FGG A;  2M7Q A;  2RSI A;  2ENH A;  2EM8 A;  2JY9 A;  4MLQ A;  2LBS B;  2HFS A;  2X36 A;  4WUC A;  1BB8 A;  2EQ3 A;  2JEA A;  4GKK I;  2NAB A;  3JU0 A;  1NEI A;  2LUQ A;  3VHT B;  1H74 A;  1OJ4 A;  3ZZU A;  4OX9 I;  4OO1 B;  4X8W A;  2EOI A;  5AAS A;  4R2A A;  1A1H A;  3C6M A;  2EM4 A;  3THO B;  2EN3 A;  5LLQ A;  2GO4 A;  4LCH A;  4LF8 I;  1YUJ A;  2R3V A;  4LF9 E;  4PRV A;  4X66 E;  5DNY A;  1ZM2 A;  5IV8 B;  2E5L I;  4DV1 E;  2VF1 A;  2NUG A;  2UXC E;  4HXZ A;  5EL9 A;  2VQE E;  1Z0T A;  4B3R E;  4U3D A;  4ZYE A;  4DV3 I;  2ADR A;  2EFG A;  5GMD A;  1L4S A;  4WXD A;  5AC4 A;  2LJH A;  1J5E E;  2NA2 A;  4IFD B;  2H36 X;  5KL4 A;  4FWH A;  2YTI A;  2YRK A;  5TSE A;  5A2Q C;  1S4E A;  2DMY A;  4JV5 E;  5L3J A;  1YZ9 A;  2C39 A;  4LCF A;  1IBL I;  5K36 E;  2EPZ A;  4Z7C A;  2NN6 F;  4DV2 E;  5AE1 A;  1KIJ A;  1B69 A;  3ZKD A;  5C0X B;  5K36 C;  4FW5 A;  2EPA A;  2DB2 A;  2EOH A;  3DF6 A;  4B3M E;  1HNW E;  1R6L A;  4I3H A;  1YYW A;  2I9I A;  2YU5 A;  4LTY A;  1RR9 A;  1UDQ A;  1N33 I;  2WW4 A;  4DV7 I;  2YTD A;  1I94 I;  2EPU A;  1EA6 A;  3PYD A;  5CFF E;  3V2U C;  2PO1 B;  1WXR A;  4NBQ A;  3MHH C;  4DKK A;  1O0W A;  5FWK A;  4O24 A;  4ISA A;  4KQV A;  2V88 A;  1KYQ A;  4X62 I;  4R2E A;  2WBS A;  4DR2 I;  1MG7 A;  4LFA I;  4LF4 E;  2EOJ A;  3H09 A;  1NHH A;  1Z0V A;  2BA0 G;  1X49 A;  2YRM A;  2Z5C B;  2Q2E B;  4FWD A;  3U1K A;  4DV0 I;  2UU9 I;  2EPO A;  1XNQ E;  4QNJ A;  4DV4 E;  3QG5 C;  4TUI A;  4OO1 A;  4B3T E;  2WBU A;  4R2Q A;  3EPJ A;  2YWQ A;  1R6M A;  5A6B A;  2R1F A;  4K0K E;  3J81 C;  2AJ4 A;  4HYM A;  3HUL A;  3D4J A;  1RMD A;  2IOP A;  4X66 I;  1FJG I;  1ZM9 A;  4DV1 I;  1D6T A;  3EPK A;  1N32 E;  2VQE I;  1H7S A;  4B3R I;  4JI0 E;  3ADL A;  2GLI A;  2CVE A;  4LF6 E;  2V2Z A;  2EMB A;  2M1S A;  4JI2 I;  2UXD E;  2X7I A;  4DR7 E;  2V2Q A;  2JEA B;  2PO2 A;  5A69 A;  2DGC A;  2LJU A;  1JK2 A;  4IFD A;  2V2V A;  4OX9 E;  4XTJ A;  2JEB B;  2LCE A;  5IT9 C;  5DRQ A;  1X48 A;  5AE3 A;  2EOX A;  1UEK A;  4P7A A;  4BHC A;  1H73 A;  2D9H A;  3T1Y I;  4I8O A;  1Y4S A;  2E5L E;  5JEA E;  2EOR A;  1OYP A;  5C0X A;  1BBO A;  3ADI A;  4B3M I;  1EH7 A;  1USV A;  2VRD A;  1GZ6 A;  1HNW I;  2E1M A;  4R1F A;  4DV3 E;  2V83 A;  1NHJ A;  2JYA A;  5JEA C;  4GZN C;  4DR6 I;  2DEI A;  2EN6 A;  2DLK A;  4FW3 A;  1LLM C;  2DRP A;  2N3H A;  2A2D A;  2PO1 A;  2RS6 A;  1GTK A;  1PIE A;  2BA0 D;  5K36 F;  4WUB A;  2A25 A;  5ADZ A;  1JK1 A;  4Z7Y A;  4LF4 I;  2C39 B;  3DJW A;  3IWD A;  1IBL E;  2EM0 A;  2LUP B;  4DV4 I;  4B3T I;  1A6F A;  4MU3 A;  1XMO E;  4K0K I;  2EQ0 A;  2LMZ A;  4WUD A;  2L8T A;  4N4R B;  4L8N A;  4KHP E;  2L92 A;  1HR0 E;  1N33 E;  2HK3 A;  2J7J A;  4DV7 E;  2ENA A;  3ADJ A;  2LTS A;  1H72 C;  2O1V A;  3NZK A;  1N32 I;  2CGE A;  2DMI A;  1N36 E;  1BBG A;  2N8X A;  4JI0 I;  2K7I A;  3C4T A;  3P3C A;  3K17 A;  4QNK A;  5ELW A;  3B78 A;  1AH5 A;  4LF6 I;  1A1G A;  3LNU A;  2EL4 A;  1PJS A;  2C38 B;  2EM6 A;  3F6H A;  4LOM A;  2JXP A;  4R03 A;  1RRE A;  4DR7 I;  2UXD I;  2WZO A;  4DV0 E;  5DRR A;  4WX9 A;  1EKZ A;  2UU9 E;  2EE8 A;  1S16 A;  4OO1 E;  4DPU A;  2CZ9 A;  4WXC A;  3JAM Q;  2JEB A;  3HKM A;  2MDR A;  5KL6 A;  2DSY A;  2JP9 A;  3WU4 A;  4FW7 A;  2GHF A;  4OO1 C;  2EPK X;  4JI5 E;  3HPS A;  1FJG E;  3F0N A;  4BMJ A;  3CDI A;  1IQS A;  2EPC A;  2RPC A;  2MKD A;  5LL6 R;  3Q6N A;  2VQF E;  4LCG A;  3M85 G;  1T4N A;  2EML A;  5KL2 A;  1UN6 B;  5BR8 E;  3UK3 C;  4JI2 E;  3PYF A;  3ADG A;  2BM0 A;  2EPL X;  2PO2 B;  4IFD E;  4ZYG A;  3WU3 A;  1UDN A;  2JR1 A;  3OTO I;  2HHH E;  4YHH E;  4JG4 A;  4LU9 A;  4LF7 E;  4KWY A;  3RMP A;  4TUG A;  3M6A A;  2YSP A;  2EPR A;  2YRH A;  4F9C B;  5JEA F;  4IFD C;  4FW9 A;  1ZBT A;  1ZM4 A;  3WU5 A;  3QT5 A;  4P52 A;  4O5G A;  4DUY I;  1TF3 A;  1N3G A;  3T1Y E;  4P78 A;  2LV2 A;  2L2K B;  2EOF A;  1XMO I;  2NN6 A;  2WP8 A;  5C0X E;  4J3D A;  2EJ4 A;  1HNX E;  2M9A A;  1NCS A;  2JWO A;  3IWC A;  4M2Z A;  1YYK A;  4KHP I;  1HR0 I;  2YTJ A;  3LTO A;  1B63 A;  4JYA I;  4L5N C;  1NHI A;  4DR6 E;  2V8P A;  2BM1 A;  5DNX A;  5C0X C;  4OOG C;  3ZOQ B;  1IMU A;  2IOQ A;  1N36 I;  4Q28 A;  4P7D A;  4LFB I;  1N0V C;  2PO0 A;  5KL5 A;  4IZJ D;  5DRO A;  2EN8 A;  4IS1 C;  4R8O A;  2EWL A;  5IT9 Q;  4X65 E;  2EOQ A;  2LTR A;  1X6F A;  2C38 A;  2OI2 A;  4LFC I;  2EN1 A;  1G2F C;  2F8B A;  4BS9 A;  1QU6 A;  3P3E A;  4LF5 I;  4R2D A;  2V89 A;  2O1W A;  1HK7 A;  1X5W A;  4HAC B;  3UHM A;  1IQO A;  1E3H A;  2EMK A;  4MDT A;  2EP3 A;  3F6G A;  4F54 A;  2PRT A;  4HY1 A;  1UBD C;  1TF6 A;  4JI6 I;  4X64 E;  4GKJ E;  4JI5 I;  4WPY A;  4KZS A;  4FK5 C;  1UIL A;  2LT7 A;  1YFH A;  2M4I A;  2O1U A;  5JEA D;  1TN9 A;  5LMU E;  2NN6 D;  4DU8 A;  4DR3 E;  2VQF I;  2BR2 A;  1RQ0 A;  4N3O A;  4BA2 B;  5BR8 I;  4OZE A;  3K6Q A;  2JOX A;  4OO1 F;  1YUI A;  4AM3 A;  1USU A;  1Z0W A;  3J7Y p;  2NUE A;  5KL7 A;  2IER A;  3B8H A;  3ZM7 A;  2ZM6 I;  3BBG A;  2GPI A;  2B3T B;  2KHX A;  4YHH I;  4MU1 A;  2HHH I;  2R76 A;  2O1T A;  4LF7 I;  1T38 A;  3V5R A;  1GQE A;  3THN A;  1VIS A;  5IWA E;  2J7K A;  5AC5 A;  3VYX A;  2WBT A;  1DI2 A;  2UXB E;  1HNZ E;  3MHS C;  3PS2 A;  4NXM I;  1PJT A;  2BA1 G;  3LLH A;  2CT1 A;  1ZAA C;  4DMI A;  3M99 B;  3GME A;  1EH8 A;  2VE7 C;  4IZJ B;  5T6J A;  4AIM A;  1HNX I;  4JI6 E;  2B7T A;  4WSG A;  5FLX C;  3LPS A;  4IFD F;  1WJP A;  1AAY A;  2JE6 A;  2EM5 A;  2L2M A;  2EMC A;  3KWR A;  1Y6Z A;  1XHK A;  4MLV A;  3BGH A;  1ZXN A;  4MU4 A;  1MX0 A;  3OTO E;  2GS8 A;  1X6H A;  4USK A;  2FV4 B;  1RC7 A;  2EM2 A;  4X65 I;  4F6N A;  2J65 A;  2EPX A;  3B4T A;  2Q8U A;  1XMQ I;  3DD6 A;  4M30 A;  1FKA E;  1YHC A;  2GO3 A;  4DV5 E;  2V86 A;  2Z5E A;  3VK6 A;  5C0X F;  2UUC I;  2EMI A;  3GON A;  4DUY E;  4UT4 A;  2I13 A;  1UDO A;  3BF2 A;  4FN5 A;  4HAC A;  2NN6 B;  4WSP A;  2WP8 B;  4URL A;  4JI8 E;  4DR1 I;  1YPN A;  2DLQ A;  2MC6 A;  4BCA A;  2ODR C;  1YSA C;  2LJP A;  2KON A;  4F2J C;  4IZK A;  4LPF A;  4X64 I;  4HTG A;  4GKJ I;  4F9B B;  5GME A;  4DV6 E;  2F4V E;  1PDA A;  1X3C A;  1STU A;  4JYA E;  2YSO A;  2RQL A;  3QT8 A;  2JOB A;  1ELO A;  3L7Z B;  3J80 C;  4LFB E;  5A2Q Q;  5LMU I;  3P76 A;  2PO0 B;  4WYQ B;  4HEI A;  2E1R A;  4DPY A;  4DR3 I;  1SFE A;  2KOU A;  2ZBK B;  4BA2 A;  4JI4 E;  1DQ3 A;  5DNL A;  2LVH A;  2BB8 A;  2YTG A;  5LMN E;  4DPT A;  4DXL A;  4LFC E;  3U1Y A;  2CSH A;  4J8Z A;  2XEX A;  4PRX A;  4LF5 E;  3MSW A;  4B3S E;  3H4L A;  1N0U A;  4M1K A;  5EKW A;  5IWA I;  1Y4U A;  2YZT A;  3IWB A;  1PKP A;  1N34 E;  2UXB I;  2VES A;  4DR4 I;  1HNZ I;  4ED4 A;  1QZR A;  5K36 D;  4MQY A;  1KVK A;  1Z5C A;  1FI4 A;  1K47 A;  2PNZ A;  4R2P A;  4IZJ A;  1T4L B;  4YY3 E;  4Q35 B;  1A1L A; 
#chains in the Genus database with same CATH homology
 2NPF A;  1UHZ A;  1Z0C A;  2YT4 A;  2PNM A;  2ZM6 E;  4GEQ B;  4JI3 E;  3J81 Q;  2BV3 A;  2Z5B A;  1WHQ A;  2A2C A;  4DR5 I;  2UUA E;  4DV5 I;  3HXL A;  4NXM E;  3B82 A;  4BBY A;  2HK2 A;  1ZM3 A;  3AUZ A;  1FNM A;  2CPN A;  4JI8 I;  3J7A M;  2G7H A;  4JI1 I;  3J7A G;  1KTV A;  4AQY I;  1IBK E;  4DPX A;  4DV6 I;  2F4V I;  3JTZ A;  2L2N A;  2UUB E;  4PU9 A;  3Q1Q A;  1FWL A;  1Z0G A;  4JI4 I;  3T1H E;  4NXN I;  5LMN I;  1XMQ E;  1X47 A;  2L3C A;  4MYU A;  1DAR A;  2UUC E;  4RPF A;  4B3S I;  2N3G A;  1WUU A;  2MC5 A;  3Q6M A;  2R42 A;  3K85 A;  3HPZ A;  2DEJ A;  3K1J A;  3JAM C;  5FLX Q;  4DR1 E;  1N34 I;  1XNR I;  1MU5 A;  4IZK B;  4M0V A;  4JI7 E;  2DIX A;  2L3J A;  2LE2 A;  2K4V A;  4ZVI A;  4YY3 I;  1PVG A;  2RS7 A;  1XNQ I;  1J26 A;  3PYG A;  1IBM E;  3QT7 A;  3ZZT A;  4DUZ E;  3ZZ0 A;  3HTX A;  4BC7 A;  4JI3 I;  1B62 A;  2V87 A;  3WU6 A;  2PNL A;  3ZKB A;  1KKH A;  3HJC A;  2UUA I;  4DR4 E;  2NUF A;  4LF9 I;  4BC9 A;  2ODR D;  2UXC I;  2V8Q B;  3J80 Q;  2V34 A;  4UTG A;  3VYY A;  2VF3 A;  1NZ0 A;  1IBK I;  4MYT A;  3CWV A;  2L33 A;  1U2R A;  1J5E I;  3C4B A;  2UUB I;  2B9D A;  4GKK E;  1ZXM A;  1FWK A;  3QT6 A;  2L6M A;  4JV5 I;  3T1H I;  4WFT A;  4DR5 E;  2Z5B B;  2IHR 1;  2HKE A;  4USM A;  4DU7 A;  1WHN A;  4LF8 E;  4DV2 I;  3HQ1 A;  1Z0B A;  2V85 A;  3P1X A;  3OML A;  1Z5B A;  4JI1 E;  1ZBQ A;  4JI7 I;  4AQY E;  1Z59 A;  2RTX A;  3LML A;  3PYE A;  2FTX B;  2EZ6 A;  1IBM I;  4EMD A;  1EI1 A;  4DUZ I;  2Z5C A;  4NXN E;  4F9A B;  2ZIT A;  2GQ0 A;  5F3W A;  1BKN A;  1T4O A;  5AE2 A;  2HFU A;  3FIG A;  3P06 A;  2RSM A;  2B7V A;  1XNR E;  1Z0E A;  3AV0 A;  2JVA A;  4DPW A;  1YYO A;  1I94 E;  2CG9 A;  3PRY A;  2HKJ A;  4FWG A;  2LRS A;  4X62 E;  1Z5A A;  1SR9 A;  1H7U A;  4DR2 E;  4LFA E;  2FGG A;  2M7Q A;  2JY9 A;  2HFS A;  2LBS B;  2X36 A;  4WUC A;  4GKK I;  3JU0 A;  2LUQ A;  1H74 A;  1OJ4 A;  3ZZU A;  4OX9 I;  4X8W A;  5AAS A;  4LF8 I;  2R3V A;  4LF9 E;  4PRV A;  4X66 E;  5DNY A;  1ZM2 A;  2E5L I;  4DV1 E;  2VF1 A;  2NUG A;  2UXC E;  4HXZ A;  2VQE E;  1Z0T A;  4B3R E;  4DV3 I;  2EFG A;  5GMD A;  2LJH A;  1J5E E;  2NA2 A;  2H36 X;  4FWH A;  5A2Q C;  1S4E A;  2DMY A;  4JV5 E;  5L3J A;  1YZ9 A;  1IBL I;  4Z7C A;  4DV2 E;  5AE1 A;  1KIJ A;  3ZKD A;  3DF6 A;  2DB2 A;  4B3M E;  1HNW E;  4I3H A;  1YYW A;  1N33 I;  1RR9 A;  4LTY A;  2WW4 A;  4DV7 I;  1I94 I;  1EA6 A;  3PYD A;  5CFF E;  3V2U C;  1WXR A;  4DKK A;  1O0W A;  5FWK A;  4KQV A;  2V88 A;  4X62 I;  4DR2 I;  1MG7 A;  4LFA I;  4LF4 E;  1Z0V A;  3H09 A;  1NHH A;  2Z5C B;  4FWD A;  1X49 A;  2Q2E B;  4DV0 I;  2UU9 I;  4DV4 E;  4TUI A;  4B3T E;  4K0K E;  3J81 C;  2AJ4 A;  4HYM A;  3HUL A;  3D4J A;  2IOP A;  4X66 I;  1FJG I;  1ZM9 A;  4DV1 I;  1D6T A;  1N32 E;  2VQE I;  1H7S A;  4B3R I;  4JI0 E;  3ADL A;  4LF6 E;  2V2Z A;  2M1S A;  4JI2 I;  2UXD E;  2X7I A;  4DR7 E;  2V2Q A;  2V2V A;  4OX9 E;  4XTJ A;  5IT9 C;  1X48 A;  5AE3 A;  1UEK A;  4P7A A;  1H73 A;  3T1Y I;  4I8O A;  1Y4S A;  2E5L E;  3ADI A;  4B3M I;  1USV A;  1HNW I;  1GZ6 A;  2E1M A;  4R1F A;  4DV3 E;  2V83 A;  1NHJ A;  4DR6 I;  2DEI A;  2N3H A;  2A2D A;  2RS6 A;  1PIE A;  4WUB A;  5ADZ A;  4Z7Y A;  4LF4 I;  3DJW A;  3IWD A;  1IBL E;  2LUP B;  4DV4 I;  4B3T I;  1A6F A;  1XMO E;  4K0K I;  2LMZ A;  4WUD A;  2L8T A;  4L8N A;  4KHP E;  2L92 A;  1HR0 E;  1N33 E;  2HK3 A;  4DV7 E;  2O1V A;  3ADJ A;  2LTS A;  1H72 C;  1N32 I;  2CGE A;  1N36 E;  4JI0 I;  3C4T A;  3K17 A;  4LF6 I;  3B78 A;  3LNU A;  2UXD I;  3F6H A;  4DR7 I;  4R03 A;  1RRE A;  2WZO A;  4DV0 E;  1EKZ A;  2UU9 E;  1S16 A;  4DPU A;  2CZ9 A;  3JAM Q;  2MDR A;  2DSY A;  3WU4 A;  4JI5 E;  3HPS A;  1FJG E;  3F0N A;  4BMJ A;  5LL6 R;  3Q6N A;  2VQF E;  1T4N A;  5BR8 E;  4JI2 E;  3PYF A;  3ADG A;  2BM0 A;  3WU3 A;  2JR1 A;  3OTO I;  2HHH E;  4YHH E;  4JG4 A;  4LU9 A;  4LF7 E;  3RMP A;  4TUG A;  3M6A A;  4F9C B;  4FW9 A;  1ZBT A;  1ZM4 A;  3WU5 A;  3QT5 A;  4P52 A;  4DUY I;  3T1Y E;  4P78 A;  2L2K B;  1XMO I;  1HNX E;  2JWO A;  3IWC A;  4KHP I;  4M2Z A;  1YYK A;  1HR0 I;  3LTO A;  1B63 A;  4JYA I;  4L5N C;  1NHI A;  4DR6 E;  2V8P A;  2BM1 A;  4OOG C;  3ZOQ B;  1N36 I;  2IOQ A;  4Q28 A;  4P7D A;  4LFB I;  1N0V C;  4IZJ D;  4R8O A;  2EWL A;  5IT9 Q;  4X65 E;  2LTR A;  4LFC I;  2OI2 A;  2F8B A;  4BS9 A;  1QU6 A;  4LF5 I;  2V89 A;  2O1W A;  1HK7 A;  4HAC B;  3F6G A;  4HY1 A;  4F54 A;  4JI6 I;  4X64 E;  4GKJ E;  4JI5 I;  4KZS A;  1UIL A;  2M4I A;  2O1U A;  5LMU E;  4DU8 A;  4DR3 E;  2VQF I;  1RQ0 A;  4N3O A;  5BR8 I;  3K6Q A;  2JOX A;  1USU A;  1Z0W A;  3J7Y p;  2NUE A;  3B8H A;  2ZM6 I;  3ZM7 A;  2HHH I;  4YHH I;  2B3T B;  2KHX A;  4LF7 I;  2O1T A;  3V5R A;  1GQE A;  1VIS A;  5IWA E;  2J7K A;  3VYX A;  1DI2 A;  2UXB E;  1HNZ E;  4NXM I;  3LLH A;  4DMI A;  2VE7 C;  4IZJ B;  5T6J A;  1HNX I;  4JI6 E;  2B7T A;  5FLX C;  3LPS A;  2L2M A;  3KWR A;  1Y6Z A;  1XHK A;  1ZXN A;  1MX0 A;  3OTO E;  2GS8 A;  4USK A;  2FV4 B;  1RC7 A;  4X65 I;  1XMQ I;  4M30 A;  1FKA E;  4DV5 E;  2V86 A;  2Z5E A;  3VK6 A;  2UUC I;  3GON A;  4DUY E;  4UT4 A;  4FN5 A;  4HAC A;  4WSP A;  4URL A;  4DR1 I;  4JI8 E;  2MC6 A;  2LJP A;  4BCA A;  2ODR C;  2KON A;  4IZK A;  4X64 I;  4GKJ I;  4F9B B;  5GME A;  4DV6 E;  2F4V E;  4JYA E;  3QT8 A;  1STU A;  2JOB A;  1ELO A;  3J80 C;  4LFB E;  5A2Q Q;  5LMU I;  4WYQ B;  2E1R A;  4DR3 I;  4DPY A;  2KOU A;  2ZBK B;  4JI4 E;  1DQ3 A;  4DPT A;  5LMN E;  4DXL A;  4LFC E;  4J8Z A;  2XEX A;  4PRX A;  4LF5 E;  3MSW A;  4B3S E;  3H4L A;  1N0U A;  4M1K A;  5IWA I;  1Y4U A;  2YZT A;  3IWB A;  1PKP A;  1N34 E;  2UXB I;  4DR4 I;  1HNZ I;  4ED4 A;  1QZR A;  1KVK A;  1Z5C A;  1FI4 A;  1K47 A;  4IZJ A;  1T4L B;  4YY3 E;  4WPY A;  1XNQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...