5FLXC

Mammalian 40s hcv-ires complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
DKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Ribosome
molecule keywords 18S RRNA
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5flxC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5flxC02
1Z0VA 4B3TI 1N0VC 4XTJA 1N36I 4DV6I 5LMUI 2HFUA 5IT9C 4LF4I 4LF5E 3J80Q 1FI4A 1Z0GA 4DU8A 2R42A 4DV1E 1ZM9A 4K0KE 3OTOI 4GKKE 5A2QQ 4DV0I 1PVGA 2V2QA 3PYFA 4JV5E 2X36A 2VF3A 4LFAI 4B3MI 3T1YE 3T1HE 2V8PA 5GMDA 5LMNE 4JI2E 4DV2E 4DR3I 1B62A 4USMA 4FWDA 4DUYI 1XMOI 4DPUA 2VQFE 4UTGA 2V2ZA 3QT6A 1EI1A 1IBLE 1IBMI 4JI6E 2ZITA 4PRXA 1ZM2A 4JI8I 4DR4E 5GMEA 2V2VA 4LF9I 1B63A 2VQEE 3T1HI 4X65I 5A2QC 4X62I 4AQYE 4JI3E 4JI1E 3OTOE 1U2RA 3HULA 1MU5A 1KKHA 1S4EA 4Z7YA 4DR6E 1PIEA 4HACB 1ZM3A 2GS8A 4X65E 5IWAE 3GONA 1Z0BA 4JI3I 3LNUA 4NXNI 1BKNA 2HKJA 4P52A 1HNWE 4HY1A 4LF7E 4X64I 1FWLA 2VQEI 4DR1E 1FJGI 2UXBE 1H72C 1IBKI 1Z59A 3LTOA 4WUBA 4WUCA 2F4VI 3PYEA 1DARA 3K17A 1WUUA 4DUZI 2DEJA 4FWGA 4LFCE 1FKAE 4AQYI 3F0NA 2X7IA 1N34I 2E5LE 4DV1I 2HHHE 4NXMI 4DV7E 2UXCE 2F4VE 4DPYA 4JI5I 4DV4I 3J7AM 4GKJE 1N0UA 3ZM7A 1KTVA 4DR2E 3WU4A 2OI2A 4I3HA 1IBKE 2HK2A 3J81Q 2ZBKB 1Z0EA 4DUYE 4JYAE 4DV5I 1IBME 5LMNI 4JI2I 1H7UA 5LL6R 4B3SE 1XNRE 4R1FA 4B3RI 3JAMQ 1HNXI 4OX9I 4UT4A 3K1JA 1XMQI 2BV3A 2HFSA 1Z5CA 3ZKBA 1NZ0A 4LF4E 3CWVA 1FNMA 1QZRA 4B3RE 4YY3I 5LMUE 1XNQI 2UU9I 2UXDE 4LF8I 1N32E 3B78A 4P7AA 3V5RA 4M1KA 4KHPI 1N33E 3PYDA 4USKA 4B3ME 5IWAI 4X64E 4LFAE 2HK3A 2R3VA 3T1YI 3ZKDA 1HNWI 4JI7E 1H7SA 3WU3A 4EMDA 1HNZI 4DV3E 4LFBE 4HACA 4DV2I 2UUAE 1ZXNA 4LFCI 4JI4I 2A2CA 2UUCE 2E5LI 1KIJA 3Q1QA 3B82A 4DU7A 4JI1I 1HNZE 5L3JA 1Z0WA 4DR6I 2UUBE 1K47A 2CZ9A 1RR9A 3ZZTA 4LF5I 4FN5A 1HR0E 4HXZA 4X62E 4B3TE 1ZM4A 3PYGA 2UXDI 4JI0I 1EA6A 4JI7I 1UEKA 2BM1A 5BR8I 4X66I 1H74A 4JYAI 4DPXA 2UUBI 4LF7I 1H73A 1I94I 2Q2EB 4JI0E 2WW4A 4OX9E 3B8HA 2XEXA 1XMQE 4JV5I 4HYMA 1Z5AA 4DUZE 4B3SI 4LF6E 1Z0CA 1PKPA 4LF9E 3ZZ0A 1I94E 3M6AA 4DPTA 4URLA 3QT7A 1XMOE 4MYTA 1IBLI 2BM0A 4MYUA 4JI6I 2A2DA 5BR8E 4X66E 4DR4I 4ZVIA 1XHKA 4WUDA 2AJ4A 1Z0TA 4Z7CA 4YHHE 1MX0A 3LPSA 1RREA 3J81C 4GKKI 4DV4E 2V34A 2E1RA 1NHHA 3V2UC 4KQVA 2J7KA 3WU5A 3JAMC 4DR7I 1ZXMA 3J7AG 1XNRI 2UUCI 4NXNE 4DPWA 4JG4A 4FWHA 4FW9A 4LF6I 2HKEA 2UUAI 5FLXC 4DR1I 4DXLA 4PRVA 1NHIA 2UXBI 1Z5BA 3ZZUA 4YHHI 2UU9E 4DR5E 3QT5A 3J80C 4PU9A 4DV6E 4LF8E 1N32I 4ED4A 1HR0I 1VISA 2LJPA 1N33I 1S16A 1N34E 4DR2I 4DR7E 4YY3E 1XNQE 2ZM6I 1J5EI 3WU6A 2HHHI 4DV7I 2UXCI 3QT8A 2DEIA 4NXME 4KHPE 4K0KI 4JI5E 1KVKA 4GKJI 1A6FA 1NHJA 4DV0E 4DV3I 4LFBI 3H4LA 5IT9Q 3D4JA 2ZM6E 2NPFA 1J5EE 4JI4E 4RPFA 1N36E 1OJ4A 1HNXE 4DR5I 2EFGA 5FLXQ 4DV5E 1MG7A 1ELOA 2VQFI 1FJGE 1FWKA 4JI8E 4DR3E 1D6TA
chains in the Genus database with same CATH superfamily
4OO1A 3C4BA 4BS9A 1Z0VA 4B3TI 2C38B 2JP9A 1N0VC 1UBDC 4XTJA 3EPKA 3KZZA 1N36I 2MDRA 4DV6I 5LMUI 2HFUA 2WP8A 2WBTA 4FW5A 4IZKA 2R76A 4O43A 2RSMA 5IV8B 2NUGA 1DQ3A 5IT9C 4LF4I 2EPAA 2GLIA 4LF5E 3J80Q 5KL4A 1FI4A 1Z0GA 1AH5A 4DU8A 2CPNA 2R42A 2EMWA 1KJKA 3PRYA 2I9IA 1Y6ZA 2EMAA 2BR2B 4DV1E 2JY9A 1ZM9A 4K0KE 3PS2A 3OTOI 1KYQA 5A6JA 2LJHA 4P7DA 2BBGA 4GKKE 2CT1A 4WSPA 2RQLA 4FW4A 4AIMA 1IQSA 5K36F 2B9DA 4R2AA 5A2QQ 4LTYA 1ZBTA 4DV0I 4LCGA 1PVGA 2V2QA 3PYFA 1YUIA 4JV5E 3THNA 2X36A 1OYRA 2VF3A 1GZ6A 4LFAI 5DNLA 2V87A 4B3MI 1Y5YA 3T1YE 3T1HE 2V8PA 5LMNE 1WHNA 2R1FA 4DV2E 4JI2E 5GMDA 4DR3I 1B62A 3ADIA 1R6MA 2A25A 4USMA 2JEBB 2L2KB 2EM3A 3EPHA 4FWDA 5C0XF 1EH6A 2EM0A 1RHYA 4LOMA 2JOXA 4I8OA 4LU9A 1LLMC 4DUYI 4OO1E 4ZYHA 2H36X 1XMOI 2VQFE 1UDNA 4DPUA 2CTDA 2B7VA 4UTGA 3HXLA 2YTOA 2V2ZA 1ZR9A 3QT6A 1IBLE 4JI6E 1EI1A 2NABA 4WSGA 2ZITA 4PRXA 1IBMI 1A1LA 1ZM2A 4NZVA 2FTXB 3QG5C 4DR4E 3B4TA 5TSEA 3VK6A 4JI8I 5GMEA 2V2VA 2O3ZA 2PO1A 3TQMA 4LF9I 2HJJA 3HPSA 1B63A 1X49A 1P42A 2VQEE 3T1HI 4L8NA 2KONA 5LLQA 2NN6F 1A1HA 4X65I 1T39A 2PO2A 5A2QC 4X62I 4AQYE 4JI3E 4AM3A 4JI1E 3OTOE 3NZKA 4IS1C 2Z5BA 1EH8A 1U2RA 1WHQA 2C39B 2JXPA 3HULA 1ZBQA 1MU5A 1KKHA 2EPZA 2EN2A 1S4EA 1YPNA 4Z7YA 2EN7A 2EPKX 4FK5C 1P47A 1DGCA 4BMJA 5CFFE 4DR6E 1PIEA 2EN4A 2LUPB 1E3HA 3RMPA 1OYPA 5K36A 2WNRA 1T38A 5DRQA 4LCFA 1Y4SA 4HACB 1UDQA 1ZM3A 4OOGC 5A6BA 4X65E 4MLQA 2GS8A 5IWAE 4WX9A 2IESA 2PNMA 3GONA 4MU1A 2MKNA 1Z0BA 2PO0B 4M9VC 3LNUA 4NXNI 4JI3I 1BKNA 1AAYA 2NN6D 2HKJA 5C0XA 3L00A 4P52A 2ODRC 1IMUA 3U1YA 2E1MA 1TF3A 2EPLX 3PS1A 1HNWE 2IOQA 4BA1B 2BA0G 4HY1A 3K85A 5EKWA 4M30A 1PJQA 1T4LB 4LF7E 4X64I 1FWLA 1RMDA 2EM7A 2EORA 5A6AA 1DI2A 2VQEI 4DR1E 2D9HA 1FJGI 2UXBE 2YTNA 1L4SA 1A1FA 2WZOA 3IWBA 5T6JA 2PNZA 3L7ZA 3M7ND 5ELWA 4MLVA 1H72C 3GLLA 1IBKI 3AV0A 1Z59A 3LTOA 2BA0D 4WUBA 2ODRD 2EZ6A 4BHCA 4M2ZA 5FWKA 2EOXA 5KL7A 4WUCA 2JR1A 2LE2A 2LRSA 2JWOA 3PYEA 2F4VI 2M9AA 1DARA 2JPAA 1WUUA 3K17A 4DUZI 1VI7A 5C0XC 2EMIA 3DF6A 2DEJA 4FWGA 2L2NA 1YSAC 1YFHA 4Q28A 4LFCE 1RQ0A 2EJ4A 1FKAE 4AQYI 3F0NA 2YTDA 1GQEA 2EN8A 2YRHA 2YSPA 3F6GA 4IS9A 2X7IA 1N34I 2E5LE 3ZOQB 4GEQB 4DV1I 2EOSA 3H09A 4F9AB 2HHHE 1A1IA 5C0XB 4NXMI 4Q35B 2NN6A 4DV7E 2UXCE 2CVEA 2E72A 2L2MA 4J8ZA 2F4VE 2AE8A 4DPYA 4WXDA 5DNXA 3M85D 2EL4A 4JI5I 2EOJA 5K36C 3CDIA 1HK7A 4DV4I 4GKJE 3J7AM 2EL6A 2ENCA 1WXRA 1YYWA 1N0UA 1KTVA 2F8BA 3ZM7A 1A1JA 4DR2E 5A6KA 4O24A 4BA2A 1A1GA 3WU4A 5AC5A 4F6NA 2V86A 2OI2A 5A6BD 2DRPA 2M1SA 4I3HA 4F9CB 3KWRA 2WP8B 3M85G 2ELZA 4M0VA 1IBKE 2HK2A 1NCSA 1Z1BA 3J81Q 2ZBKB 4JYAE 4DUYE 1Z0EA 3Q6NA 4DV5I 1EKZA 5K36D 2YRKA 4R2PA 1X6EA 1IBME 5LMNI 3BIDA 4JI2I 2NUFA 2PRTA 1H7UA 5LL6R 4B3SE 4R2SA 4MDTA 1XNRE 4R1FA 4LPFA 3FIGA 4B3RI 3JAMQ 1HNXI 2EPPA 2GO4A 3C4TA 4OX9I 4UT4A 3K1JA 3P76A 1XMQI 1YUJA 2BV3A 2N8XA 4R03A 4KWYA 4WYQB 3IWDA 4R2EA 1YHCA 3ECRA 5C0XD 1XXEA 4GZNC 5KL5A 2HFSA 1Z5CA 3MSWA 3ZKBA 1NZ0A 5IXMB 1TN9A 3CDJA 2LVHA 4LF4E 3DD6A 4TUIA 1X3CA 1MEYC 3THOB 3CWVA 1OYSA 2L33A 2EPCA 3BGHA 2RTXA 2I13A 4MU0A 1FNMA 1QZRA 4B3RE 2EOHA 4YY3I 5LMUE 1XNQI 2UU9I 2YTGA 2UXDE 1N32E 2K4VA 4LF8I 2LTSA 1JK2A 3B78A 2YT4A 2JT2A 4P7AA 4R2QA 4M1KA 3V5RA 1Y60A 2L8TA 2JEAA 1J26A 4KHPI 1N33E 5K36E 4R2CA 4ZYGA 2EL5A 2EPUA 2JE6A 2PNLA 3PYDA 4USKA 2PO1B 4O5GA 2LMZA 5KL3A 2WCC3 2CGEA 4KZSA 2DSYA 2EOZA 4X64E 4B3ME 5IWAI 4LFAE 2HK3A 1RC7A 2R3VA 1BBGA 2PO2B 2EE8A 3T1YI 3P3CA 1B69A 4NHRA 2Z5BB 3HKMA 2L6MA 1QU6A 5ADZA 2C39A 3ZKDA 4LCHA 1HNWI 2EOOA 3M99B 4JI7E 1UHZA 2NA2A 2J7JA 3MHSC 3F6HA 1H7SA 2HGHA 3WU3A 4BHBA 5AE1A 1PJTA 4WFTA 4BC9A 4DMIA 4FW7A 4EMDA 1HNZI 1JK1A 2EN3A 4DV3E 1MGTA 2CG9A 2EOYA 2EQ3A 4HEIA 3HPZA 4WXCA 2WNRB 4LFBE 5JEAD 4IZJB 4U3DA 2RSIA 4HACA 4DV2I 2BB8A 2EOIA 2UUAE 2EMFA 1PDAA 2YU8A 1ZXNA 4LFCI 2A2CA 3HJCA 2BA1D 4JI4I 2UUCE 1F2IG 1USUA 2EPNA 3MHHC 2YPNA 2E5LI 3EPLA 1KIJA 2DGCA 3Q1QA 2LV2A 3B82A 4BCAA 3IWCA 3C6MA 4R2RA 4DU7A 4JI1I 4IFDA 1WJPA 2Z5CB 2GPIA 2EP3A 2M7QA 4ZYEA 1R6LA 1HNZE 5L3JA 1GTKA 3BF2A 1Z0WA 2EM5A 4DR6I 4AIDA 2UUBE 3M7NG 1K47A 2CZ9A 2C37A 1RR9A 1ZAAC 1UN6B 3ZZTA 4FN5A 4LF5I 1HR0E 2B7TA 4HXZA 4X62E 2ENHA 2ELYA 4B3TE 1ZM4A 2BA1G 3L7ZB 2PNZB 2GQ0A 3PYGA 4OZEA 4F54A 2UXDI 4JI0I 1EA6A 2B3TB 1X6FA 2EMLA 4ZYDA 1WRJA 5JEAA 2EPMX 2MKDA 4JI7I 5C0XE 4QNKA 3HQ1A 2WBSA 1UEKA 2BM1A 5BR8I 3ADLA 4X66I 2L3JA 1H74A 4JYAI 2EMKA 2V88A 2ENAA 4IFDC 4DPXA 2UUBI 2Q8UA 4LF7I 1IQOA 4P78A 2RS6A 2L3CA 1H73A 1I94I 2VESA 2RS7A 2Q2EB 2EM2A 3PS3A 2G7HA 4JI0E 2O1UA 4OO1B 2C38A 3BBGA 2WW4A 3P06A 2K7IA 2YTEA 4R2DA 4BBYA 4OX9E 2EMYA 2NN6B 2XEXA 3B8HA 4IZKB 1XMQE 4JV5I 4F9BB 4HYMA 3JTZA 1NEIA 2YZTA 2N3HA 2EM8A 1Z5AA 4IFDD 1X48A 1G2FC 4MQYA 4DUZE 4B3SI 4LF6E 2EOQA 4F2JC 1Z0CA 3JU0A 2LTRA 3HTXA 2LT7A 4OO1C 1O0WA 4BA2B 2LBSB 2YTFA 1PKPA 4LF9E 3ZZ0A 1I94E 2N3GA 2YU5A 2BR2A 2EMGA 2EMCA 3M6AA 4DPTA 4URLA 3P3GA 2IOPA 2V85A 4L5NC 1XMOE 3QT7A 4MYTA 1IBLI 1PJSA 1YYKA 2NUEA 2BM0A 4GQUA 2YTJA 3P1XA 4X9JA 1A1KA 2EM6A 4MYUA 4JI6I 4O4KA 2A2DA 2EPOA 5BR8E 4X66E 2DLKA 4DR4I 3ADGA 5A69A 2ADRA 2LO3A 2MC6A 5DRPA 2DB2A 2O1WA 4ZVIA 2DMYA 1E3PA 1XHKA 2V8QB 2EPXA 4IJDA 3KZYA 2AJ4A 3Q6MA 4WUDA 1Z0TA 2YSOA 3VYXA 5JEAE 4Z7CA 2O1TA 4YHHE 5KL6A 1MX0A 2JEBA 3LPSA 3P3EA 1RREA 3J81C 4U3BA 1X47A 2GO3A 2O1VA 4RH8A 2WBUA 4J3DA 4GKKI 2EMHA 5JEAC 4DV4E 2Z5EA 2V34A 2E1RA 1NHHA 3V2UC 2EOEA 4KQVA 4WPYA 2J7KA 3WU5A 5KL2A 5DRRA 5AE3A 2LCEA 3JAMC 2YTIA 4DR7I 2FV4B 1BBOA 4IFDE 3AUZA 1ZXMA 2M4IA 2DLQA 3J7AG 4NXNE 3K6QA 1EH7A 3UHMA 2UUCI 1XNRI 1USVA 4DPWA 4JG4A 5AE2A 2LJUA 2EOFA 4FWHA 1N3GA 4FW9A 4LF6I 2JEAB 2EOMA 3GCMA 2KOUA 2EWLA 2JE6B 2HKEA 2UUAI 5FLXC 4DR1I 4TUGA 4DXLA 4PRVA 1NHIA 5K36B 2EMBA 2UXBI 5AC4A 2V83A 2EMXA 5JEAF 2GHFA 1Z5BA 3ZZUA 4YHHI 2PO0A 4FW3A 2UU9E 1T4NA 4DR5E 4OO1F 4R8OA 3J80C 2YTPA 3QT5A 4BC7A 4PU9A 1YZ9A 2EM9A 2RPCA 4DV6E 4LF8E 1N32I 3J7Yp 4BA1A 3VYYA 4ED4A 1T4OA 2EQ0A 1HR0I 2DMIA 4IZJA 1VISA 2LJPA 1N33I 2EN1A 1S16A 4MU3A 2KHXA 4X8WA 4HTGA 2VF1A 1N34E 4N3OA 4N4RB 1ZU1A 2IHR1 5EL9A 4DR2I 3ADJA 4YY3E 3C6KA 1YYOA 1XNQE 4DR7E 1UDOA 2ZM6I 3OMLA 3VHTB 1STUA 2YWQA 5F3WA 3WU6A 2FGGA 1J5EI 4OKGA 3EPJA 2L92A 2YRMA 4DV7I 2HHHI 2UXCI 3QT8A 1QNTA 3EQ1A 2DEIA 3LMLA 2JVAA 4NXME 4KHPE 2IERA 4MU4A 4IFDB 4K0KI 2Z5CA 4IZJD 1YH8A 5DROA 1SFEA 2DIXA 5AASA 4JI5E 1G2DC 1KVKA 4RHBB 4OO1D 2MC5A 4GKJI 1A6FA 2VE7C 4NBQA 4QNJA 2C37B 1NHJA 3GMEA 2LUQA 3UK3C 4DV0E 1BB8A 4DV3I 4LFBI 1Y4UA 3U1KA 3H4LA 2J65A 2F1DA 2EN6A 5IT9Q 2NN6C 3D4JA 5DNYA 3DJWA 2NN6E 2ZM6E 1J5EE 2NPFA 4JI4E 3H1CA 4RPFA 3LLHA 2VRDA 1N36E 1HNXE 1OJ4A 2JOBA 5JEAB 2JYAA 1UILA 1X6HA 4DR5I 2EFGA 2EQ1A 4DKKA 1SR9A 3KRNA 5FLXQ 4DV5E 2V89A 1MG7A 2YTQA 4FW6A 1TF6A 2MDGA 1X5WA 1ELOA 4ISAA 2EPRA 2VQFI 2EM4A 4F6MA 2EMZA 1UDSA 4IFDF 1FJGE 2HC5A 1FWKA 4JI8E 4DR3E 1D6TA 2CSHA
chains in the Genus database with same CATH topology
3C4BA 4BS9A 1Z0VA 4B3TI 1N0VC 4XTJA 1N36I 2MDRA 4DV6I 5LMUI 2HFUA 4IZKA 2RSMA 2NUGA 1DQ3A 5IT9C 4LF4I 4LF5E 3J80Q 1FI4A 1Z0GA 4DU8A 2CPNA 2R42A 3PRYA 1Y6ZA 4DV1E 2JY9A 1ZM9A 4K0KE 3OTOI 2LJHA 4P7DA 4GKKE 4WSPA 2B9DA 5A2QQ 4LTYA 1ZBTA 4DV0I 1PVGA 2V2QA 3PYFA 4JV5E 2X36A 2VF3A 1GZ6A 4LFAI 2V87A 4B3MI 3T1YE 3T1HE 2V8PA 5LMNE 1WHNA 4JI2E 4DV2E 5GMDA 4DR3I 1B62A 3ADIA 4USMA 2L2KB 4FWDA 2JOXA 4I8OA 4LU9A 4DUYI 1XMOI 2H36X 2VQFE 4DPUA 2B7VA 4UTGA 3HXLA 2V2ZA 3QT6A 1IBLE 4JI6E 1EI1A 1IBMI 2ZITA 4PRXA 1ZM2A 4JI8I 2FTXB 4DR4E 3VK6A 5GMEA 2V2VA 4LF9I 3HPSA 1B63A 1X49A 2VQEE 3T1HI 4L8NA 2KONA 4X65I 5A2QC 4X62I 4AQYE 4JI3E 4JI1E 3OTOE 2Z5BA 1U2RA 1WHQA 3HULA 1ZBQA 1MU5A 1KKHA 1S4EA 4Z7YA 4DR6E 4BMJA 5CFFE 1PIEA 2LUPB 3RMPA 1Y4SA 4HACB 1ZM3A 4OOGC 2GS8A 4X65E 2PNMA 5IWAE 3GONA 1Z0BA 4JI3I 3LNUA 4NXNI 1BKNA 2HKJA 4P52A 2ODRC 2E1MA 1HNWE 2IOQA 4HY1A 3K85A 4M30A 1T4LB 4LF7E 4X64I 1FWLA 1DI2A 2VQEI 4DR1E 1FJGI 2UXBE 2WZOA 3IWBA 5T6JA 1H72C 1IBKI 3AV0A 1Z59A 3LTOA 4WUBA 2ODRD 2EZ6A 4M2ZA 5FWKA 4WUCA 2JR1A 2LE2A 2LRSA 2JWOA 3PYEA 2F4VI 1DARA 3K17A 1WUUA 4DUZI 3DF6A 2DEJA 4FWGA 2L2NA 4Q28A 4LFCE 1RQ0A 1FKAE 4AQYI 3F0NA 1GQEA 3F6GA 2X7IA 1N34I 2E5LE 3ZOQB 4GEQB 4DV1I 3H09A 4F9AB 2HHHE 4NXMI 4DV7E 2UXCE 2L2MA 4J8ZA 2F4VE 4DPYA 4JI5I 1HK7A 4DV4I 4GKJE 3J7AM 1WXRA 1YYWA 1N0UA 3ZM7A 1KTVA 2F8BA 4DR2E 3WU4A 2OI2A 2V86A 2M1SA 4I3HA 4F9CB 3KWRA 4M0VA 1IBKE 2HK2A 3J81Q 2ZBKB 4JYAE 4DUYE 1Z0EA 3Q6NA 4DV5I 1EKZA 1IBME 5LMNI 4JI2I 2NUFA 5LL6R 4B3SE 1XNRE 4R1FA 3FIGA 4B3RI 3JAMQ 1HNXI 3C4TA 4OX9I 4UT4A 3K1JA 1XMQI 2BV3A 4R03A 4WYQB 3IWDA 2HFSA 1Z5CA 3MSWA 3ZKBA 1NZ0A 4LF4E 4TUIA 3CWVA 2L33A 2RTXA 1FNMA 1QZRA 4B3RE 4YY3I 5LMUE 1XNQI 2UU9I 2UXDE 1N32E 2K4VA 4LF8I 2LTSA 3B78A 2YT4A 4P7AA 3V5RA 4M1KA 4KHPI 2L8TA 1J26A 1N33E 4DR3E 2PNLA 3PYDA 4USKA 2LMZA 2CGEA 4KZSA 2DSYA 4B3ME 4X64E 5IWAI 4LFAE 2HK3A 1RC7A 2R3VA 3T1YI 2Z5BB 2L6MA 1QU6A 5ADZA 3ZKDA 1HNWI 1UHZA 4JI7E 2NA2A 1H7SA 3F6HA 3WU3A 5AE1A 4WFTA 4BC9A 4DMIA 4EMDA 1HNZI 4DV3E 2CG9A 3HPZA 4LFBE 4IZJB 4HACA 4DV2I 2UUAE 1ZXNA 4LFCI 4JI4I 2A2CA 3HJCA 2UUCE 1USUA 2E5LI 1KIJA 3Q1QA 3B82A 4BCAA 3IWCA 4DU7A 4JI1I 2Z5CB 2M7QA 1HNZE 5L3JA 1Z0WA 4DR6I 2UUBE 1K47A 2CZ9A 1RR9A 3ZZTA 4LF5I 4FN5A 1HR0E 2B7TA 4HXZA 4X62E 4B3TE 1ZM4A 2GQ0A 3PYGA 4F54A 2UXDI 4JI0I 1EA6A 2B3TB 4JI7I 3HQ1A 1UEKA 2BM1A 5BR8I 3ADLA 4X66I 2L3JA 1H74A 4JYAI 2V88A 4DPXA 2UUBI 4LF7I 4P78A 2RS6A 2L3CA 1H73A 1I94I 2RS7A 2Q2EB 2G7HA 4JI0E 2O1UA 2WW4A 3P06A 4OX9E 4BBYA 3B8HA 2XEXA 4IZKB 1XMQE 4JV5I 4F9BB 4HYMA 3JTZA 2YZTA 2N3HA 1Z5AA 1X48A 4DUZE 4B3SI 4LF6E 1Z0CA 3JU0A 2LTRA 3HTXA 1O0WA 2LBSB 1PKPA 4LF9E 3ZZ0A 1I94E 2N3GA 3M6AA 4DPTA 4URLA 2IOPA 2V85A 4L5NC 1XMOE 3QT7A 4MYTA 1IBLI 1YYKA 2NUEA 2BM0A 3P1XA 4MYUA 4JI6I 2A2DA 5BR8E 4X66E 4DR4I 3ADGA 2MC6A 2DB2A 2O1WA 4ZVIA 2DMYA 1XHKA 2V8QB 2AJ4A 4WUDA 3Q6MA 1Z0TA 3VYXA 4Z7CA 2O1TA 4YHHE 1MX0A 3LPSA 1RREA 3J81C 1X47A 2O1VA 4GKKI 4DV4E 2Z5EA 2V34A 2E1RA 1NHHA 3V2UC 4KQVA 4WPYA 2J7KA 3WU5A 5AE3A 3JAMC 4DR7I 2FV4B 3AUZA 1ZXMA 2M4IA 3J7AG 2UUCI 4NXNE 3K6QA 1XNRI 1USVA 4DPWA 4JG4A 5AE2A 4FWHA 4FW9A 4LF6I 2KOUA 2EWLA 2HKEA 2UUAI 5FLXC 4DR1I 4TUGA 4DXLA 4PRVA 1NHIA 2UXBI 2V83A 1Z5BA 3ZZUA 4YHHI 2UU9E 1T4NA 4DR5E 4R8OA 3J80C 3QT5A 4BC7A 4PU9A 1YZ9A 4DV6E 4LF8E 1N32I 3J7Yp 3VYYA 4ED4A 1T4OA 1HR0I 4IZJA 1VISA 2LJPA 1N33I 1S16A 2KHXA 4X8WA 1N34E 2VF1A 4N3OA 2IHR1 4DR2I 3ADJA 4YY3E 1YYOA 1XNQE 4DR7E 2ZM6I 3OMLA 5F3WA 1STUA 3WU6A 1J5EI 2FGGA 2L92A 4DV7I 2HHHI 2UXCI 3QT8A 2DEIA 3LMLA 2JVAA 4NXME 4KHPE 4K0KI 2Z5CA 4IZJD 2DIXA 5AASA 4JI5E 1KVKA 2MC5A 4GKJI 1A6FA 2VE7C 1NHJA 2LUQA 4DV0E 4DV3I 4LFBI 1Y4UA 3H4LA 5IT9Q 3D4JA 5DNYA 3DJWA 2ZM6E 1J5EE 2NPFA 4JI4E 4RPFA 3LLHA 1N36E 1HNXE 1OJ4A 2JOBA 1UILA 4DR5I 2EFGA 4DKKA 1SR9A 5FLXQ 4DV5E 2V89A 1MG7A 1ELOA 2VQFI 1FJGE 1FWKA 4JI8E 1H7UA 1D6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0V A;  4B3T I;  1N0V C;  4XTJ A;  1N36 I;  4DV6 I;  5LMU I;  2HFU A;  5IT9 C;  4LF4 I;  4LF5 E;  3J80 Q;  1FI4 A;  1Z0G A;  4DU8 A;  2R42 A;  4DV1 E;  1ZM9 A;  4K0K E;  3OTO I;  4GKK E;  5A2Q Q;  4DV0 I;  1PVG A;  2V2Q A;  3PYF A;  4JV5 E;  2X36 A;  2VF3 A;  4LFA I;  4B3M I;  3T1Y E;  3T1H E;  2V8P A;  5GMD A;  5LMN E;  4JI2 E;  4DV2 E;  4DR3 I;  1B62 A;  4USM A;  4FWD A;  4DUY I;  1XMO I;  4DPU A;  2VQF E;  4UTG A;  2V2Z A;  3QT6 A;  1EI1 A;  1IBL E;  1IBM I;  4JI6 E;  2ZIT A;  4PRX A;  1ZM2 A;  4JI8 I;  4DR4 E;  5GME A;  2V2V A;  4LF9 I;  1B63 A;  2VQE E;  3T1H I;  4X65 I;  5A2Q C;  4X62 I;  4AQY E;  4JI3 E;  4JI1 E;  3OTO E;  1U2R A;  3HUL A;  1MU5 A;  1KKH A;  1S4E A;  4Z7Y A;  4DR6 E;  1PIE A;  4HAC B;  1ZM3 A;  2GS8 A;  4X65 E;  5IWA E;  3GON A;  1Z0B A;  4JI3 I;  3LNU A;  4NXN I;  1BKN A;  2HKJ A;  4P52 A;  1HNW E;  4HY1 A;  4LF7 E;  4X64 I;  1FWL A;  2VQE I;  4DR1 E;  1FJG I;  2UXB E;  1H72 C;  1IBK I;  1Z59 A;  3LTO A;  4WUB A;  4WUC A;  2F4V I;  3PYE A;  1DAR A;  3K17 A;  1WUU A;  4DUZ I;  2DEJ A;  4FWG A;  4LFC E;  1FKA E;  4AQY I;  3F0N A;  2X7I A;  1N34 I;  2E5L E;  4DV1 I;  2HHH E;  4NXM I;  4DV7 E;  2UXC E;  2F4V E;  4DPY A;  4JI5 I;  4DV4 I;  3J7A M;  4GKJ E;  1N0U A;  3ZM7 A;  1KTV A;  4DR2 E;  3WU4 A;  2OI2 A;  4I3H A;  1IBK E;  2HK2 A;  3J81 Q;  2ZBK B;  1Z0E A;  4DUY E;  4JYA E;  4DV5 I;  1IBM E;  5LMN I;  4JI2 I;  1H7U A;  5LL6 R;  4B3S E;  1XNR E;  4R1F A;  4B3R I;  3JAM Q;  1HNX I;  4OX9 I;  4UT4 A;  3K1J A;  1XMQ I;  2BV3 A;  2HFS A;  1Z5C A;  3ZKB A;  1NZ0 A;  4LF4 E;  3CWV A;  1FNM A;  1QZR A;  4B3R E;  4YY3 I;  5LMU E;  1XNQ I;  2UU9 I;  2UXD E;  4LF8 I;  1N32 E;  3B78 A;  4P7A A;  3V5R A;  4M1K A;  4KHP I;  1N33 E;  3PYD A;  4USK A;  4B3M E;  5IWA I;  4X64 E;  4LFA E;  2HK3 A;  2R3V A;  3T1Y I;  3ZKD A;  1HNW I;  4JI7 E;  1H7S A;  3WU3 A;  4EMD A;  1HNZ I;  4DV3 E;  4LFB E;  4HAC A;  4DV2 I;  2UUA E;  1ZXN A;  4LFC I;  4JI4 I;  2A2C A;  2UUC E;  2E5L I;  1KIJ A;  3Q1Q A;  3B82 A;  4DU7 A;  4JI1 I;  1HNZ E;  5L3J A;  1Z0W A;  4DR6 I;  2UUB E;  1K47 A;  2CZ9 A;  1RR9 A;  3ZZT A;  4LF5 I;  4FN5 A;  1HR0 E;  4HXZ A;  4X62 E;  4B3T E;  1ZM4 A;  3PYG A;  2UXD I;  4JI0 I;  1EA6 A;  4JI7 I;  1UEK A;  2BM1 A;  5BR8 I;  4X66 I;  1H74 A;  4JYA I;  4DPX A;  2UUB I;  4LF7 I;  1H73 A;  1I94 I;  2Q2E B;  4JI0 E;  2WW4 A;  4OX9 E;  3B8H A;  2XEX A;  1XMQ E;  4JV5 I;  4HYM A;  1Z5A A;  4DUZ E;  4B3S I;  4LF6 E;  1Z0C A;  1PKP A;  4LF9 E;  3ZZ0 A;  1I94 E;  3M6A A;  4DPT A;  4URL A;  3QT7 A;  1XMO E;  4MYT A;  1IBL I;  2BM0 A;  4MYU A;  4JI6 I;  2A2D A;  5BR8 E;  4X66 E;  4DR4 I;  4ZVI A;  1XHK A;  4WUD A;  2AJ4 A;  1Z0T A;  4Z7C A;  4YHH E;  1MX0 A;  3LPS A;  1RRE A;  3J81 C;  4GKK I;  4DV4 E;  2V34 A;  2E1R A;  1NHH A;  3V2U C;  4KQV A;  2J7K A;  3WU5 A;  3JAM C;  4DR7 I;  1ZXM A;  3J7A G;  1XNR I;  2UUC I;  4NXN E;  4DPW A;  4JG4 A;  4FWH A;  4FW9 A;  4LF6 I;  2HKE A;  2UUA I;  5FLX C;  4DR1 I;  4DXL A;  4PRV A;  1NHI A;  2UXB I;  1Z5B A;  3ZZU A;  4YHH I;  2UU9 E;  4DR5 E;  3QT5 A;  3J80 C;  4PU9 A;  4DV6 E;  4LF8 E;  1N32 I;  4ED4 A;  1HR0 I;  1VIS A;  2LJP A;  1N33 I;  1S16 A;  1N34 E;  4DR2 I;  4DR7 E;  4YY3 E;  1XNQ E;  2ZM6 I;  1J5E I;  3WU6 A;  2HHH I;  4DV7 I;  2UXC I;  3QT8 A;  2DEI A;  4NXM E;  4KHP E;  4K0K I;  4JI5 E;  1KVK A;  4GKJ I;  1A6F A;  1NHJ A;  4DV0 E;  4DV3 I;  4LFB I;  3H4L A;  5IT9 Q;  3D4J A;  2ZM6 E;  2NPF A;  1J5E E;  4JI4 E;  4RPF A;  1N36 E;  1OJ4 A;  1HNX E;  4DR5 I;  2EFG A;  5FLX Q;  4DV5 E;  1MG7 A;  1ELO A;  2VQF I;  1FJG E;  1FWK A;  4JI8 E;  4DR3 E;  1D6T A; 
#chains in the Genus database with same CATH topology
 4OO1 A;  3C4B A;  4BS9 A;  1Z0V A;  4B3T I;  2C38 B;  2JP9 A;  1N0V C;  1UBD C;  4XTJ A;  3EPK A;  3KZZ A;  1N36 I;  2MDR A;  4DV6 I;  5LMU I;  2HFU A;  2WP8 A;  2WBT A;  4FW5 A;  4IZK A;  2R76 A;  4O43 A;  2RSM A;  5IV8 B;  2NUG A;  1DQ3 A;  5IT9 C;  4LF4 I;  2EPA A;  2GLI A;  4LF5 E;  3J80 Q;  5KL4 A;  1FI4 A;  1Z0G A;  1AH5 A;  4DU8 A;  2CPN A;  2R42 A;  2EMW A;  1KJK A;  3PRY A;  2I9I A;  1Y6Z A;  2EMA A;  2BR2 B;  4DV1 E;  2JY9 A;  1ZM9 A;  4K0K E;  3PS2 A;  3OTO I;  1KYQ A;  5A6J A;  2LJH A;  4P7D A;  2BBG A;  4GKK E;  2CT1 A;  4WSP A;  2RQL A;  4FW4 A;  4AIM A;  1IQS A;  5K36 F;  2B9D A;  4R2A A;  5A2Q Q;  4LTY A;  1ZBT A;  4DV0 I;  4LCG A;  1PVG A;  2V2Q A;  3PYF A;  1YUI A;  4JV5 E;  3THN A;  2X36 A;  1OYR A;  2VF3 A;  1GZ6 A;  4LFA I;  5DNL A;  2V87 A;  4B3M I;  1Y5Y A;  3T1Y E;  3T1H E;  2V8P A;  5LMN E;  1WHN A;  2R1F A;  4DV2 E;  4JI2 E;  5GMD A;  4DR3 I;  1B62 A;  3ADI A;  1R6M A;  2A25 A;  4USM A;  2JEB B;  2L2K B;  2EM3 A;  3EPH A;  4FWD A;  5C0X F;  1EH6 A;  2EM0 A;  1RHY A;  4LOM A;  2JOX A;  4I8O A;  4LU9 A;  1LLM C;  4DUY I;  4OO1 E;  4ZYH A;  2H36 X;  1XMO I;  2VQF E;  1UDN A;  4DPU A;  2CTD A;  2B7V A;  4UTG A;  3HXL A;  2YTO A;  2V2Z A;  1ZR9 A;  3QT6 A;  1IBL E;  4JI6 E;  1EI1 A;  2NAB A;  4WSG A;  2ZIT A;  4PRX A;  1IBM I;  1A1L A;  1ZM2 A;  4NZV A;  2FTX B;  3QG5 C;  4DR4 E;  3B4T A;  5TSE A;  3VK6 A;  4JI8 I;  5GME A;  2V2V A;  2O3Z A;  2PO1 A;  3TQM A;  4LF9 I;  2HJJ A;  3HPS A;  1B63 A;  1X49 A;  1P42 A;  2VQE E;  3T1H I;  4L8N A;  2KON A;  5LLQ A;  2NN6 F;  1A1H A;  4X65 I;  1T39 A;  2PO2 A;  5A2Q C;  4X62 I;  4AQY E;  4JI3 E;  4AM3 A;  4JI1 E;  3OTO E;  3NZK A;  4IS1 C;  2Z5B A;  1EH8 A;  1U2R A;  1WHQ A;  2C39 B;  2JXP A;  3HUL A;  1ZBQ A;  1MU5 A;  1KKH A;  2EPZ A;  2EN2 A;  1S4E A;  1YPN A;  4Z7Y A;  2EN7 A;  2EPK X;  4FK5 C;  1P47 A;  1DGC A;  4BMJ A;  5CFF E;  4DR6 E;  1PIE A;  2EN4 A;  2LUP B;  1E3H A;  3RMP A;  1OYP A;  5K36 A;  2WNR A;  1T38 A;  5DRQ A;  4LCF A;  1Y4S A;  4HAC B;  1UDQ A;  1ZM3 A;  4OOG C;  5A6B A;  4X65 E;  4MLQ A;  2GS8 A;  5IWA E;  4WX9 A;  2IES A;  2PNM A;  3GON A;  4MU1 A;  2MKN A;  1Z0B A;  2PO0 B;  4M9V C;  3LNU A;  4NXN I;  4JI3 I;  1BKN A;  1AAY A;  2NN6 D;  2HKJ A;  5C0X A;  3L00 A;  4P52 A;  2ODR C;  1IMU A;  3U1Y A;  2E1M A;  1TF3 A;  2EPL X;  3PS1 A;  1HNW E;  2IOQ A;  4BA1 B;  2BA0 G;  4HY1 A;  3K85 A;  5EKW A;  4M30 A;  1PJQ A;  1T4L B;  4LF7 E;  4X64 I;  1FWL A;  1RMD A;  2EM7 A;  2EOR A;  5A6A A;  1DI2 A;  2VQE I;  4DR1 E;  2D9H A;  1FJG I;  2UXB E;  2YTN A;  1L4S A;  1A1F A;  2WZO A;  3IWB A;  5T6J A;  2PNZ A;  3L7Z A;  3M7N D;  5ELW A;  4MLV A;  1H72 C;  3GLL A;  1IBK I;  3AV0 A;  1Z59 A;  3LTO A;  2BA0 D;  4WUB A;  2ODR D;  2EZ6 A;  4BHC A;  4M2Z A;  5FWK A;  2EOX A;  5KL7 A;  4WUC A;  2JR1 A;  2LE2 A;  2LRS A;  2JWO A;  3PYE A;  2F4V I;  2M9A A;  1DAR A;  2JPA A;  1WUU A;  3K17 A;  4DUZ I;  1VI7 A;  5C0X C;  2EMI A;  3DF6 A;  2DEJ A;  4FWG A;  2L2N A;  1YSA C;  1YFH A;  4Q28 A;  4LFC E;  1RQ0 A;  2EJ4 A;  1FKA E;  4AQY I;  3F0N A;  2YTD A;  1GQE A;  2EN8 A;  2YRH A;  2YSP A;  3F6G A;  4IS9 A;  2X7I A;  1N34 I;  2E5L E;  3ZOQ B;  4GEQ B;  4DV1 I;  2EOS A;  3H09 A;  4F9A B;  2HHH E;  1A1I A;  5C0X B;  4NXM I;  4Q35 B;  2NN6 A;  4DV7 E;  2UXC E;  2CVE A;  2E72 A;  2L2M A;  4J8Z A;  2F4V E;  2AE8 A;  4DPY A;  4WXD A;  5DNX A;  3M85 D;  2EL4 A;  4JI5 I;  2EOJ A;  5K36 C;  3CDI A;  1HK7 A;  4DV4 I;  4GKJ E;  3J7A M;  2EL6 A;  2ENC A;  1WXR A;  1YYW A;  1N0U A;  1KTV A;  2F8B A;  3ZM7 A;  1A1J A;  4DR2 E;  5A6K A;  4O24 A;  4BA2 A;  1A1G A;  3WU4 A;  5AC5 A;  4F6N A;  2V86 A;  2OI2 A;  5A6B D;  2DRP A;  2M1S A;  4I3H A;  4F9C B;  3KWR A;  2WP8 B;  3M85 G;  2ELZ A;  4M0V A;  1IBK E;  2HK2 A;  1NCS A;  1Z1B A;  3J81 Q;  2ZBK B;  4JYA E;  4DUY E;  1Z0E A;  3Q6N A;  4DV5 I;  1EKZ A;  5K36 D;  2YRK A;  4R2P A;  1X6E A;  1IBM E;  5LMN I;  3BID A;  4JI2 I;  2NUF A;  2PRT A;  1H7U A;  5LL6 R;  4B3S E;  4R2S A;  4MDT A;  1XNR E;  4R1F A;  4LPF A;  3FIG A;  4B3R I;  3JAM Q;  1HNX I;  2EPP A;  2GO4 A;  3C4T A;  4OX9 I;  4UT4 A;  3K1J A;  3P76 A;  1XMQ I;  1YUJ A;  2BV3 A;  2N8X A;  4R03 A;  4KWY A;  4WYQ B;  3IWD A;  4R2E A;  1YHC A;  3ECR A;  5C0X D;  1XXE A;  4GZN C;  5KL5 A;  2HFS A;  1Z5C A;  3MSW A;  3ZKB A;  1NZ0 A;  5IXM B;  1TN9 A;  3CDJ A;  2LVH A;  4LF4 E;  3DD6 A;  4TUI A;  1X3C A;  1MEY C;  3THO B;  3CWV A;  1OYS A;  2L33 A;  2EPC A;  3BGH A;  2RTX A;  2I13 A;  4MU0 A;  1FNM A;  1QZR A;  4B3R E;  2EOH A;  4YY3 I;  5LMU E;  1XNQ I;  2UU9 I;  2YTG A;  2UXD E;  1N32 E;  2K4V A;  4LF8 I;  2LTS A;  1JK2 A;  3B78 A;  2YT4 A;  2JT2 A;  4P7A A;  4R2Q A;  4M1K A;  3V5R A;  1Y60 A;  2L8T A;  2JEA A;  1J26 A;  4KHP I;  1N33 E;  5K36 E;  4R2C A;  4ZYG A;  2EL5 A;  2EPU A;  2JE6 A;  2PNL A;  3PYD A;  4USK A;  2PO1 B;  4O5G A;  2LMZ A;  5KL3 A;  2WCC 3;  2CGE A;  4KZS A;  2DSY A;  2EOZ A;  4X64 E;  4B3M E;  5IWA I;  4LFA E;  2HK3 A;  1RC7 A;  2R3V A;  1BBG A;  2PO2 B;  2EE8 A;  3T1Y I;  3P3C A;  1B69 A;  4NHR A;  2Z5B B;  3HKM A;  2L6M A;  1QU6 A;  5ADZ A;  2C39 A;  3ZKD A;  4LCH A;  1HNW I;  2EOO A;  3M99 B;  4JI7 E;  1UHZ A;  2NA2 A;  2J7J A;  3MHS C;  3F6H A;  1H7S A;  2HGH A;  3WU3 A;  4BHB A;  5AE1 A;  1PJT A;  4WFT A;  4BC9 A;  4DMI A;  4FW7 A;  4EMD A;  1HNZ I;  1JK1 A;  2EN3 A;  4DV3 E;  1MGT A;  2CG9 A;  2EOY A;  2EQ3 A;  4HEI A;  3HPZ A;  4WXC A;  2WNR B;  4LFB E;  5JEA D;  4IZJ B;  4U3D A;  2RSI A;  4HAC A;  4DV2 I;  2BB8 A;  2EOI A;  2UUA E;  2EMF A;  1PDA A;  2YU8 A;  1ZXN A;  4LFC I;  2A2C A;  3HJC A;  2BA1 D;  4JI4 I;  2UUC E;  1F2I G;  1USU A;  2EPN A;  3MHH C;  2YPN A;  2E5L I;  3EPL A;  1KIJ A;  2DGC A;  3Q1Q A;  2LV2 A;  3B82 A;  4BCA A;  3IWC A;  3C6M A;  4R2R A;  4DU7 A;  4JI1 I;  4IFD A;  1WJP A;  2Z5C B;  2GPI A;  2EP3 A;  2M7Q A;  4ZYE A;  1R6L A;  1HNZ E;  5L3J A;  1GTK A;  3BF2 A;  1Z0W A;  2EM5 A;  4DR6 I;  4AID A;  2UUB E;  3M7N G;  1K47 A;  2CZ9 A;  2C37 A;  1RR9 A;  1ZAA C;  1UN6 B;  3ZZT A;  4FN5 A;  4LF5 I;  1HR0 E;  2B7T A;  4HXZ A;  4X62 E;  2ENH A;  2ELY A;  4B3T E;  1ZM4 A;  2BA1 G;  3L7Z B;  2PNZ B;  2GQ0 A;  3PYG A;  4OZE A;  4F54 A;  2UXD I;  4JI0 I;  1EA6 A;  2B3T B;  1X6F A;  2EML A;  4ZYD A;  1WRJ A;  5JEA A;  2EPM X;  2MKD A;  4JI7 I;  5C0X E;  4QNK A;  3HQ1 A;  2WBS A;  1UEK A;  2BM1 A;  5BR8 I;  3ADL A;  4X66 I;  2L3J A;  1H74 A;  4JYA I;  2EMK A;  2V88 A;  2ENA A;  4IFD C;  4DPX A;  2UUB I;  2Q8U A;  4LF7 I;  1IQO A;  4P78 A;  2RS6 A;  2L3C A;  1H73 A;  1I94 I;  2VES A;  2RS7 A;  2Q2E B;  2EM2 A;  3PS3 A;  2G7H A;  4JI0 E;  2O1U A;  4OO1 B;  2C38 A;  3BBG A;  2WW4 A;  3P06 A;  2K7I A;  2YTE A;  4R2D A;  4BBY A;  4OX9 E;  2EMY A;  2NN6 B;  2XEX A;  3B8H A;  4IZK B;  1XMQ E;  4JV5 I;  4F9B B;  4HYM A;  3JTZ A;  1NEI A;  2YZT A;  2N3H A;  2EM8 A;  1Z5A A;  4IFD D;  1X48 A;  1G2F C;  4MQY A;  4DUZ E;  4B3S I;  4LF6 E;  2EOQ A;  4F2J C;  1Z0C A;  3JU0 A;  2LTR A;  3HTX A;  2LT7 A;  4OO1 C;  1O0W A;  4BA2 B;  2LBS B;  2YTF A;  1PKP A;  4LF9 E;  3ZZ0 A;  1I94 E;  2N3G A;  2YU5 A;  2BR2 A;  2EMG A;  2EMC A;  3M6A A;  4DPT A;  4URL A;  3P3G A;  2IOP A;  2V85 A;  4L5N C;  1XMO E;  3QT7 A;  4MYT A;  1IBL I;  1PJS A;  1YYK A;  2NUE A;  2BM0 A;  4GQU A;  2YTJ A;  3P1X A;  4X9J A;  1A1K A;  2EM6 A;  4MYU A;  4JI6 I;  4O4K A;  2A2D A;  2EPO A;  5BR8 E;  4X66 E;  2DLK A;  4DR4 I;  3ADG A;  5A69 A;  2ADR A;  2LO3 A;  2MC6 A;  5DRP A;  2DB2 A;  2O1W A;  4ZVI A;  2DMY A;  1E3P A;  1XHK A;  2V8Q B;  2EPX A;  4IJD A;  3KZY A;  2AJ4 A;  3Q6M A;  4WUD A;  1Z0T A;  2YSO A;  3VYX A;  5JEA E;  4Z7C A;  2O1T A;  4YHH E;  5KL6 A;  1MX0 A;  2JEB A;  3LPS A;  3P3E A;  1RRE A;  3J81 C;  4U3B A;  1X47 A;  2GO3 A;  2O1V A;  4RH8 A;  2WBU A;  4J3D A;  4GKK I;  2EMH A;  5JEA C;  4DV4 E;  2Z5E A;  2V34 A;  2E1R A;  1NHH A;  3V2U C;  2EOE A;  4KQV A;  4WPY A;  2J7K A;  3WU5 A;  5KL2 A;  5DRR A;  5AE3 A;  2LCE A;  3JAM C;  2YTI A;  4DR7 I;  2FV4 B;  1BBO A;  4IFD E;  3AUZ A;  1ZXM A;  2M4I A;  2DLQ A;  3J7A G;  4NXN E;  3K6Q A;  1EH7 A;  3UHM A;  2UUC I;  1XNR I;  1USV A;  4DPW A;  4JG4 A;  5AE2 A;  2LJU A;  2EOF A;  4FWH A;  1N3G A;  4FW9 A;  4LF6 I;  2JEA B;  2EOM A;  3GCM A;  2KOU A;  2EWL A;  2JE6 B;  2HKE A;  2UUA I;  5FLX C;  4DR1 I;  4TUG A;  4DXL A;  4PRV A;  1NHI A;  5K36 B;  2EMB A;  2UXB I;  5AC4 A;  2V83 A;  2EMX A;  5JEA F;  2GHF A;  1Z5B A;  3ZZU A;  4YHH I;  2PO0 A;  4FW3 A;  2UU9 E;  1T4N A;  4DR5 E;  4OO1 F;  4R8O A;  3J80 C;  2YTP A;  3QT5 A;  4BC7 A;  4PU9 A;  1YZ9 A;  2EM9 A;  2RPC A;  4DV6 E;  4LF8 E;  1N32 I;  3J7Y p;  4BA1 A;  3VYY A;  4ED4 A;  1T4O A;  2EQ0 A;  1HR0 I;  2DMI A;  4IZJ A;  1VIS A;  2LJP A;  1N33 I;  2EN1 A;  1S16 A;  4MU3 A;  2KHX A;  4X8W A;  4HTG A;  2VF1 A;  1N34 E;  4N3O A;  4N4R B;  1ZU1 A;  2IHR 1;  5EL9 A;  4DR2 I;  3ADJ A;  4YY3 E;  3C6K A;  1YYO A;  1XNQ E;  4DR7 E;  1UDO A;  2ZM6 I;  3OML A;  3VHT B;  1STU A;  2YWQ A;  5F3W A;  3WU6 A;  2FGG A;  1J5E I;  4OKG A;  3EPJ A;  2L92 A;  2YRM A;  4DV7 I;  2HHH I;  2UXC I;  3QT8 A;  1QNT A;  3EQ1 A;  2DEI A;  3LML A;  2JVA A;  4NXM E;  4KHP E;  2IER A;  4MU4 A;  4IFD B;  4K0K I;  2Z5C A;  4IZJ D;  1YH8 A;  5DRO A;  1SFE A;  2DIX A;  5AAS A;  4JI5 E;  1G2D C;  1KVK A;  4RHB B;  4OO1 D;  2MC5 A;  4GKJ I;  1A6F A;  2VE7 C;  4NBQ A;  4QNJ A;  2C37 B;  1NHJ A;  3GME A;  2LUQ A;  3UK3 C;  4DV0 E;  1BB8 A;  4DV3 I;  4LFB I;  1Y4U A;  3U1K A;  3H4L A;  2J65 A;  2F1D A;  2EN6 A;  5IT9 Q;  2NN6 C;  3D4J A;  5DNY A;  3DJW A;  2NN6 E;  2ZM6 E;  1J5E E;  2NPF A;  4JI4 E;  3H1C A;  4RPF A;  3LLH A;  2VRD A;  1N36 E;  1HNX E;  1OJ4 A;  2JOB A;  5JEA B;  2JYA A;  1UIL A;  1X6H A;  4DR5 I;  2EFG A;  2EQ1 A;  4DKK A;  1SR9 A;  3KRN A;  5FLX Q;  4DV5 E;  2V89 A;  1MG7 A;  2YTQ A;  4FW6 A;  1TF6 A;  2MDG A;  1X5W A;  1ELO A;  4ISA A;  2EPR A;  2VQF I;  2EM4 A;  4F6M A;  2EMZ A;  1UDS A;  4IFD F;  1FJG E;  2HC5 A;  1FWK A;  4JI8 E;  4DR3 E;  1D6T A;  2CSH A; 
#chains in the Genus database with same CATH homology
 3C4B A;  4BS9 A;  1Z0V A;  4B3T I;  1N0V C;  4XTJ A;  1N36 I;  2MDR A;  4DV6 I;  5LMU I;  2HFU A;  4IZK A;  2RSM A;  2NUG A;  1DQ3 A;  5IT9 C;  4LF4 I;  4LF5 E;  3J80 Q;  1FI4 A;  1Z0G A;  4DU8 A;  2CPN A;  2R42 A;  3PRY A;  1Y6Z A;  4DV1 E;  2JY9 A;  1ZM9 A;  4K0K E;  3OTO I;  2LJH A;  4P7D A;  4GKK E;  4WSP A;  2B9D A;  5A2Q Q;  4LTY A;  1ZBT A;  4DV0 I;  1PVG A;  2V2Q A;  3PYF A;  4JV5 E;  2X36 A;  2VF3 A;  1GZ6 A;  4LFA I;  2V87 A;  4B3M I;  3T1Y E;  3T1H E;  2V8P A;  5LMN E;  1WHN A;  4JI2 E;  4DV2 E;  5GMD A;  4DR3 I;  1B62 A;  3ADI A;  4USM A;  2L2K B;  4FWD A;  2JOX A;  4I8O A;  4LU9 A;  4DUY I;  1XMO I;  2H36 X;  2VQF E;  4DPU A;  2B7V A;  4UTG A;  3HXL A;  2V2Z A;  3QT6 A;  1IBL E;  4JI6 E;  1EI1 A;  1IBM I;  2ZIT A;  4PRX A;  1ZM2 A;  4JI8 I;  2FTX B;  4DR4 E;  3VK6 A;  5GME A;  2V2V A;  4LF9 I;  3HPS A;  1B63 A;  1X49 A;  2VQE E;  3T1H I;  4L8N A;  2KON A;  4X65 I;  5A2Q C;  4X62 I;  4AQY E;  4JI3 E;  4JI1 E;  3OTO E;  2Z5B A;  1U2R A;  1WHQ A;  3HUL A;  1ZBQ A;  1MU5 A;  1KKH A;  1S4E A;  4Z7Y A;  4DR6 E;  4BMJ A;  5CFF E;  1PIE A;  2LUP B;  3RMP A;  1Y4S A;  4HAC B;  1ZM3 A;  4OOG C;  2GS8 A;  4X65 E;  2PNM A;  5IWA E;  3GON A;  1Z0B A;  4JI3 I;  3LNU A;  4NXN I;  1BKN A;  2HKJ A;  4P52 A;  2ODR C;  2E1M A;  1HNW E;  2IOQ A;  4HY1 A;  3K85 A;  4M30 A;  1T4L B;  4LF7 E;  4X64 I;  1FWL A;  1DI2 A;  2VQE I;  4DR1 E;  1FJG I;  2UXB E;  2WZO A;  3IWB A;  5T6J A;  1H72 C;  1IBK I;  3AV0 A;  1Z59 A;  3LTO A;  4WUB A;  2ODR D;  2EZ6 A;  4M2Z A;  5FWK A;  4WUC A;  2JR1 A;  2LE2 A;  2LRS A;  2JWO A;  3PYE A;  2F4V I;  1DAR A;  3K17 A;  1WUU A;  4DUZ I;  3DF6 A;  2DEJ A;  4FWG A;  2L2N A;  4Q28 A;  4LFC E;  1RQ0 A;  1FKA E;  4AQY I;  3F0N A;  1GQE A;  3F6G A;  2X7I A;  1N34 I;  2E5L E;  3ZOQ B;  4GEQ B;  4DV1 I;  3H09 A;  4F9A B;  2HHH E;  4NXM I;  4DV7 E;  2UXC E;  2L2M A;  4J8Z A;  2F4V E;  4DPY A;  4JI5 I;  1HK7 A;  4DV4 I;  4GKJ E;  3J7A M;  1WXR A;  1YYW A;  1N0U A;  3ZM7 A;  1KTV A;  2F8B A;  4DR2 E;  3WU4 A;  2OI2 A;  2V86 A;  2M1S A;  4I3H A;  4F9C B;  3KWR A;  4M0V A;  1IBK E;  2HK2 A;  3J81 Q;  2ZBK B;  4JYA E;  4DUY E;  1Z0E A;  3Q6N A;  4DV5 I;  1EKZ A;  1IBM E;  5LMN I;  4JI2 I;  2NUF A;  5LL6 R;  4B3S E;  1XNR E;  4R1F A;  3FIG A;  4B3R I;  3JAM Q;  1HNX I;  3C4T A;  4OX9 I;  4UT4 A;  3K1J A;  1XMQ I;  2BV3 A;  4R03 A;  4WYQ B;  3IWD A;  2HFS A;  1Z5C A;  3MSW A;  3ZKB A;  1NZ0 A;  4LF4 E;  4TUI A;  3CWV A;  2L33 A;  2RTX A;  1FNM A;  1QZR A;  4B3R E;  4YY3 I;  5LMU E;  1XNQ I;  2UU9 I;  2UXD E;  1N32 E;  2K4V A;  4LF8 I;  2LTS A;  3B78 A;  2YT4 A;  4P7A A;  3V5R A;  4M1K A;  4KHP I;  2L8T A;  1J26 A;  1N33 E;  4DR3 E;  2PNL A;  3PYD A;  4USK A;  2LMZ A;  2CGE A;  4KZS A;  2DSY A;  4B3M E;  4X64 E;  5IWA I;  4LFA E;  2HK3 A;  1RC7 A;  2R3V A;  3T1Y I;  2Z5B B;  2L6M A;  1QU6 A;  5ADZ A;  3ZKD A;  1HNW I;  1UHZ A;  4JI7 E;  2NA2 A;  1H7S A;  3F6H A;  3WU3 A;  5AE1 A;  4WFT A;  4BC9 A;  4DMI A;  4EMD A;  1HNZ I;  4DV3 E;  2CG9 A;  3HPZ A;  4LFB E;  4IZJ B;  4HAC A;  4DV2 I;  2UUA E;  1ZXN A;  4LFC I;  4JI4 I;  2A2C A;  3HJC A;  2UUC E;  1USU A;  2E5L I;  1KIJ A;  3Q1Q A;  3B82 A;  4BCA A;  3IWC A;  4DU7 A;  4JI1 I;  2Z5C B;  2M7Q A;  1HNZ E;  5L3J A;  1Z0W A;  4DR6 I;  2UUB E;  1K47 A;  2CZ9 A;  1RR9 A;  3ZZT A;  4LF5 I;  4FN5 A;  1HR0 E;  2B7T A;  4HXZ A;  4X62 E;  4B3T E;  1ZM4 A;  2GQ0 A;  3PYG A;  4F54 A;  2UXD I;  4JI0 I;  1EA6 A;  2B3T B;  4JI7 I;  3HQ1 A;  1UEK A;  2BM1 A;  5BR8 I;  3ADL A;  4X66 I;  2L3J A;  1H74 A;  4JYA I;  2V88 A;  4DPX A;  2UUB I;  4LF7 I;  4P78 A;  2RS6 A;  2L3C A;  1H73 A;  1I94 I;  2RS7 A;  2Q2E B;  2G7H A;  4JI0 E;  2O1U A;  2WW4 A;  3P06 A;  4OX9 E;  4BBY A;  3B8H A;  2XEX A;  4IZK B;  1XMQ E;  4JV5 I;  4F9B B;  4HYM A;  3JTZ A;  2YZT A;  2N3H A;  1Z5A A;  1X48 A;  4DUZ E;  4B3S I;  4LF6 E;  1Z0C A;  3JU0 A;  2LTR A;  3HTX A;  1O0W A;  2LBS B;  1PKP A;  4LF9 E;  3ZZ0 A;  1I94 E;  2N3G A;  3M6A A;  4DPT A;  4URL A;  2IOP A;  2V85 A;  4L5N C;  1XMO E;  3QT7 A;  4MYT A;  1IBL I;  1YYK A;  2NUE A;  2BM0 A;  3P1X A;  4MYU A;  4JI6 I;  2A2D A;  5BR8 E;  4X66 E;  4DR4 I;  3ADG A;  2MC6 A;  2DB2 A;  2O1W A;  4ZVI A;  2DMY A;  1XHK A;  2V8Q B;  2AJ4 A;  4WUD A;  3Q6M A;  1Z0T A;  3VYX A;  4Z7C A;  2O1T A;  4YHH E;  1MX0 A;  3LPS A;  1RRE A;  3J81 C;  1X47 A;  2O1V A;  4GKK I;  4DV4 E;  2Z5E A;  2V34 A;  2E1R A;  1NHH A;  3V2U C;  4KQV A;  4WPY A;  2J7K A;  3WU5 A;  5AE3 A;  3JAM C;  4DR7 I;  2FV4 B;  3AUZ A;  1ZXM A;  2M4I A;  3J7A G;  2UUC I;  4NXN E;  3K6Q A;  1XNR I;  1USV A;  4DPW A;  4JG4 A;  5AE2 A;  4FWH A;  4FW9 A;  4LF6 I;  2KOU A;  2EWL A;  2HKE A;  2UUA I;  5FLX C;  4DR1 I;  4TUG A;  4DXL A;  4PRV A;  1NHI A;  2UXB I;  2V83 A;  1Z5B A;  3ZZU A;  4YHH I;  2UU9 E;  1T4N A;  4DR5 E;  4R8O A;  3J80 C;  3QT5 A;  4BC7 A;  4PU9 A;  1YZ9 A;  4DV6 E;  4LF8 E;  1N32 I;  3J7Y p;  3VYY A;  4ED4 A;  1T4O A;  1HR0 I;  4IZJ A;  1VIS A;  2LJP A;  1N33 I;  1S16 A;  2KHX A;  4X8W A;  1N34 E;  2VF1 A;  4N3O A;  2IHR 1;  4DR2 I;  3ADJ A;  4YY3 E;  1YYO A;  1XNQ E;  4DR7 E;  2ZM6 I;  3OML A;  5F3W A;  1STU A;  3WU6 A;  1J5E I;  2FGG A;  2L92 A;  4DV7 I;  2HHH I;  2UXC I;  3QT8 A;  2DEI A;  3LML A;  2JVA A;  4NXM E;  4KHP E;  4K0K I;  2Z5C A;  4IZJ D;  2DIX A;  5AAS A;  4JI5 E;  1KVK A;  2MC5 A;  4GKJ I;  1A6F A;  2VE7 C;  1NHJ A;  2LUQ A;  4DV0 E;  4DV3 I;  4LFB I;  1Y4U A;  3H4L A;  5IT9 Q;  3D4J A;  5DNY A;  3DJW A;  2ZM6 E;  1J5E E;  2NPF A;  4JI4 E;  4RPF A;  3LLH A;  1N36 E;  1HNX E;  1OJ4 A;  2JOB A;  1UIL A;  4DR5 I;  2EFG A;  4DKK A;  1SR9 A;  5FLX Q;  4DV5 E;  2V89 A;  1MG7 A;  1ELO A;  2VQF I;  1FJG E;  1FWK A;  4JI8 E;  1H7U A;  1D6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...