5FLXC

Mammalian 40s hcv-ires complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
DKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S RRNA
publication title Molecular Architecture of the Ribosome-Bound Hepatitis C Virus Internal Ribosomal Entry Site RNA.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5flxC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5flxC02
2UUBE 4WUCA 1FI4A 1HNWI 1Z0WA 4DV1I 5FLXQ 4JI6I 3V2UC 4P52A 3ZZUA 4YHHI 1QZRA 4DV0E 4JI1E 2UXCE 2HK3A 4ZVIA 2Q2EB 1PVGA 2V2QA 2VQFE 1Z0CA 4DPUA 4LF8I 1FKAE 5BR8I 1HNWE 4DXLA 2V8PA 1HNZE 4HACB 4LFCI 1ZM2A 2HFSA 1XMOI 4JI0I 4B3TE 2CZ9A 4LF9E 4JI2E 4FWHA 2E1RA 4B3MI 4DPYA 1Z0TA 1BKNA 1ZXNA 4JI5I 1B63A 4JI7E 5LMUI 3Q1QA 3WU4A 4PRVA 4JI4I 2HFUA 4UT4A 5GMDA 3ZKBA 1UEKA 3LPSA 4LFCE 2J7KA 1Z0GA 4JYAI 1EA6A 1NHHA 4X64E 3WU6A 1U2RA 4B3ME 1IBKI 1FJGI 3J7AG 4JI5E 3J80C 1K47A 3QT7A 1XNRI 3CWVA 1NHIA 2A2DA 4DV5E 2UU9I 4URLA 1XMQI 1ZM3A 1N36E 4LF4I 1KVKA 5IT9C 4NXNI 4X65I 4DR1I 4DV3I 4DV6E 2UXDE 1HNXI 4DR3E 1IBLI 1S4EA 3PYFA 1H73A 1IBKE 1MG7A 1KIJA 1RREA 3F0NA 4KHPI 1NHJA 4DR6I 3K1JA 1ZXMA 1RR9A 1WUUA 1Z5AA 2E5LI 4JV5E 1Z0VA 4NXNE 2AJ4A 4UTGA 1HNXE 4FWGA 2R3VA 5A2QC 4Z7YA 1H7UA 3LNUA 3PYEA 4WUDA 2X36A 2ZITA 3WU3A 4KHPE 4EMDA 4DR4E 4DPTA 1I94I 2VQEE 5IWAI 1VISA 4DV7I 5GMEA 4DR5I 3H4LA 1A6FA 4Z7CA 3K17A 2ZBKB 4DV1E 3T1HI 4JI6E 1FNMA 3J80Q 1H74A 3HULA 1DARA 4B3SI 2HHHI 3GONA 4GKJI 1N0VC 4YHHE 4DU8A 2R42A 1D6TA 4DV2I 5LMNI 2V2VA 2F4VI 1I94E 4AQYI 2BM0A 4DR5E 4DPWA 3JAMQ 1PIEA 4P7AA 4LF8E 4GKKI 1Z5CA 4FN5A 4OX9I 5BR8E 2HKEA 2UXBI 4MYUA 3J81C 2BV3A 3B8HA 1Z0EA 4DR2I 5FLXC 2EFGA 2HHHE 1XMOE 4JI0E 1IBMI 4DV2E 2LJPA 4JI3I 1J5EI 1XNQI 5LMUE 2HK2A 1S16A 4LF7I 3M6AA 2UUCI 4AQYE 4FW9A 4LFBI 4JI4E 4LFAI 3ZM7A 1KTVA 4HXZA 4GKKE 1XHKA 4OX9E 4HYMA 5A2QQ 4DV4I 2UUAI 3WU5A 4LF5I 3QT6A 4DR2E 2WW4A 4JYAE 4FWDA 4PU9A 3B82A 1J5EE 1XNQE 4DR7I 1FJGE 4B3RI 3J7AM 4YY3I 4LF6I 1XNRE 4K0KI 1EI1A 1Z5BA 2UU9E 2UUBI 4LFAE 1XMQE 4X62I 2HKJA 4LF4E 3PYDA 4DV4E 4X65E 4DR1E 4LF5E 1N34I 4DV3E 1OJ4A 1PKPA 4DV0I 4JI1I 1IBLE 3QT8A 2UXCI 4USMA 4RPFA 4DPXA 2BM1A 4B3RE 3QT5A 2VQFI 2ZM6I 4DR6E 2OI2A 3J81Q 1N32I 4X62E 2E5LE 1HNZI 1NZ0A 1HR0I 1N34E 4XTJA 4B3TI 4LF9I 4JI2I 4JI7I 2XEXA 3ZZTA 2ZM6E 4JI8I 2VF3A 5IT9Q 4HY1A 1KKHA 1N32E 4JG4A 5IWAE 4DV7E 1N0UA 1HR0E 1H7SA 4M1KA 4ED4A 4X66I 4X64I 3LTOA 3T1HE 4B3SE 1H72C 4GKJE 4DV5I 1Z0BA 4JI8E 5LMNE 2GS8A 3T1YI 1N33I 1N36I 2F4VE 2V2ZA 2X7IA 1B62A 1FWKA 4DV6I 2UXDI 4DR3I 3OTOI 4NXMI 2UXBE 5L3JA 4X66E 4DUZI 1FWLA 4DUYI 4PRXA 4I3HA 2DEIA 1IBME 4MYTA 4JI3E 3T1YE 1N33E 4JV5I 1MX0A 4LF7E 2UUCE 2A2CA 3ZZ0A 4R1FA 4USKA 4LFBE 1ZM4A 3PYGA 3OTOE 3JAMC 2V34A 2UUAE 4NXME 4DUZE 3ZKDA 4DUYE 1MU5A 4HACA 2NPFA 4WUBA 3V5RA 4DU7A 5LL6R 4KQVA 1ZM9A 3B78A 4DR4I 1ELOA 2VQEI 1Z59A 4DR7E 4YY3E 4LF6E 2DEJA 4K0KE 3D4JA
chains in the Genus database with same CATH superfamily
2PRTA 2UUBE 4R2EA 2WP8B 2N3HA 2EN8A 2PO2A 4FW3A 4WUCA 1X5WA 5TSEA 1FI4A 5C0XD 1HNWI 1Z0WA 4LTYA 4MDTA 4DV1I 3F6GA 2E72A 2EMFA 2BA1D 5FLXQ 4JI6I 3M7NG 3V2UC 3Q6MA 2DMIA 1JK2A 2EPOA 4P52A 3HKMA 2EOXA 3P76A 3B4TA 4FW5A 4WXDA 3ZZUA 4YHHI 1AH5A 1QZRA 4N4RB 5KL4A 4DV0E 4GEQB 4JI1E 3PRYA 2RS6A 2UXCE 2HK3A 2L3CA 4ZVIA 2O1TA 1RMDA 1QU6A 4DKKA 2YTIA 3LMLA 2Q2EB 1PJTA 5DRQA 2CT1A 1PVGA 2V2QA 2VQFE 4R03A 1Z0CA 4M9VC 4DPUA 3K6QA 4LF8I 2H36X 2N3GA 1RC7A 1FKAE 2JXPA 1YYOA 3VYXA 5BR8I 2R76A 1LLMC 2WBUA 1HNWE 4P78A 4DXLA 2V8PA 3HPSA 4NBQA 3OMLA 3U1YA 1ZR9A 1HNZE 4ISAA 2O1UA 4HACB 2B3TB 1Y4UA 4LFCI 4OO1F 1ZM2A 2HFSA 4TUGA 2LV2A 3H09A 1XMOI 4JI0I 2C37B 1UHZA 4B3TE 3BIDA 2CZ9A 4LF9E 4JI2E 4FWHA 2E1RA 4B3MI 4DPYA 1Z0TA 2JE6A 2ELYA 5KL3A 1BKNA 1ZXNA 4JI5I 4JI7E 1B63A 5LMUI 1USVA 3Q1QA 3UK3C 1R6LA 3WU4A 4X8WA 4PRVA 2EPPA 1T4NA 4L5NC 4JI4I 4R2PA 1HK7A 3RMPA 1YH8A 2HFUA 2EOQA 3P3GA 2I9IA 2NA2A 2Z5EA 4MQYA 2RSIA 1EH7A 2Z5BA 4UT4A 1T38A 4MU4A 1Y4SA 4M30A 2ENCA 2I13A 5GMDA 1DGCA 4F9CB 3ZKBA 3VHTB 1G2DC 3P3CA 1UEKA 4ZYGA 3LPSA 2EQ3A 4LFCE 2EOYA 2J7KA 3JTZA 1Z0GA 2EM4A 3C6MA 4MLQA 3HTXA 4AIDA 3MHSC 5JEAD 2WP8A 4JYAI 5EL9A 2A25A 1N3GA 4WFTA 2YU5A 1EA6A 1NHHA 4X64E 3WU6A 1U2RA 4IFDB 4B3ME 1IBKI 4MU3A 2R1FA 5DNXA 3AV0A 3THNA 2PNLA 1FJGI 3J7AG 4JI5E 3M85D 3J80C 1K47A 3QT7A 1XNRI 2Q8UA 3CWVA 1NHIA 1ZBTA 2M7QA 2A2DA 4DV5E 4R2DA 2UU9I 1UDOA 2MC6A 2ENHA 4URLA 1XMQI 2EM3A 3GCMA 1ZM3A 1YUIA 3HQ1A 2RPCA 1N36E 4LF4I 1KVKA 5IT9C 4NXNI 2EM7A 4X65I 4DR1I 2YU8A 1JK1A 2NABA 4DV3I 5A6AA 2L6MA 4DV6E 3ADJA 2UXDE 4NZVA 1HNXI 4DR3E 2M4IA 4IZKB 1X47A 3ADGA 2BA0D 1IBLI 1S4EA 3PYFA 2EPAA 5DRPA 2EOIA 2G7HA 1DI2A 1H73A 4F9BB 2V83A 4F6MA 1IBKE 1A1KA 2EOEA 1KIJA 1MG7A 2BR2A 1Z1BA 3KWRA 1A1JA 4MU0A 1ZU1A 1EH8A 4F6NA 3VK6A 5JEAE 2EN4A 1RREA 2EMCA 3F0NA 4KHPI 1NHJA 4F9AB 4QNKA 2N8XA 3K1JA 4DR6I 3L7ZB 4OO1D 2RQLA 1A1LA 1BBGA 2BB8A 2FV4B 3EPKA 1RR9A 1WUUA 1ZXMA 2CVEA 4BC9A 3EPLA 1Z5AA 2E5LI 2YSOA 4IZJB 1O0WA 4JV5E 2EWLA 1Z0VA 5K36E 4NXNE 4J8ZA 4IFDC 4J3DA 4LOMA 2AJ4A 3MSWA 3M7ND 4O43A 4UTGA 2O1WA 2EQ0A 1UILA 2V86A 1HNXE 2EL6A 1STUA 1GTKA 4FWGA 2EPMX 2R3VA 1UDNA 1NCSA 5A2QC 3NZKA 1H7UA 4Z7YA 3LNUA 3PYEA 4WUDA 4FW7A 2WCC3 4IFDF 1X49A 1YYKA 2WZOA 2D9HA 3C4TA 3M99B 5KL7A 2AE8A 2X36A 1T39A 2JOXA 2ZITA 3WU3A 2V85A 2EMAA 1AAYA 4BBYA 3HJCA 5DRRA 4KHPE 4LPFA 2VESA 4EMDA 4F2JC 5A6BD 4DR4E 1UDQA 4DPTA 2VF1A 1UDSA 1ZAAC 4IFDA 1I94I 2VQEE 2B7VA 4LCHA 5IWAI 2EOHA 3ADLA 1VISA 5GMEA 4DV7I 4DR5I 4OO1E 3H4LA 4BC7A 2EN7A 2EPNA 1A1HA 4IJDA 1A1GA 1A6FA 1WJPA 1GQEA 1YFHA 1IQOA 5DNLA 2YTFA 3Q6NA 4Z7CA 3K17A 2ZBKB 2EMLA 2BR2B 4DMIA 4DV1E 1L4SA 4JI6E 2LUQA 3T1HI 1FNMA 4FW6A 3QG5C 3J80Q 3CDIA 1H74A 2YWQA 3HULA 3IWBA 1DARA 2EN3A 3C4BA 4WXCA 4WSPA 3GONA 1OYPA 5C0XE 2HHHI 4GKJI 4Q35B 1N0VC 4YHHE 4DU8A 4U3BA 2R42A 4F54A 4P7DA 1D6TA 2MKDA 5LLQA 4R2QA 3P1XA 4IZKA 4DV2I 2DLQA 2L92A 5LMNI 1KYQA 4O5GA 2LT7A 2V2VA 2LJHA 1XXEA 2YTDA 2L33A 1YUJA 2F4VI 2EM6A 3PS1A 2LTSA 1I94E 4AQYI 4WPYA 4BA1B 2BM0A 2C38A 1J26A 2PO1A 1ZBQA 4R2CA 4DR5E 4LCGA 4DPWA 3JAMQ 2L3JA 1PIEA 4LF8E 4HEIA 2CG9A 4P7AA 1Z5CA 4GKKI 5FWKA 4FN5A 4OX9I 2NN6D 3L7ZA 4I8OA 5BR8E 1B69A 2HKEA 3THOB 2UXBI 4MYUA 3J81C 2BV3A 4IZJA 2LVHA 2VE7C 2EOJA 2YRMA 4WSGA 3B8HA 1PJSA 3KZZA 1Z0EA 4DR2I 5FLXC 4LCFA 2EFGA 2HHHE 1XMOE 2LTRA 4JI0E 2PO0B 2LO3A 3J7Yp 2EM2A 5ADZA 1YHCA 3K85A 2YPNA 1IBMI 2KOUA 2J65A 4BHBA 4DV2E 2PNZB 2LJPA 4FK5C 2EP3A 4JI3I 1J5EI 1XNQI 2MKNA 5LMUE 5JEAB 2F1DA 1S16A 2HK2A 4LF7I 3M6AA 2UUCI 4AQYE 2EOSA 2V89A 1KJKA 1P42A 4FW9A 4LFBI 4JI4E 3GLLA 2LUPB 4LFAI 3ZM7A 1KTVA 5CFFE 1MGTA 4HXZA 4GKKE 1XHKA 2EPCA 1Y60A 4M0VA 4OX9E 4HYMA 5A2QQ 3P06A 2WBSA 2EPRA 2MDGA 4DV4I 2UUAI 5AC5A 1USUA 3EQ1A 3WU5A 4LF5I 5K36B 2YTPA 3DJWA 2O3ZA 5T6JA 1Y5YA 3H1CA 2NN6E 3BGHA 4QNJA 2Z5CB 2IERA 4DR2E 3QT6A 2WW4A 4JYAE 4FWDA 2B7TA 2ODRC 1TF6A 4GQUA 4PU9A 1WHNA 2EZ6A 4HTGA 2EL4A 3B82A 1J5EE 1XNQE 2C38B 3KRNA 4DR7I 1FJGE 5AE1A 4B3RI 3J7AM 4BCAA 1XNRE 3C6KA 4YY3I 4LF6I 1EI1A 2CGEA 4K0KI 1Z5BA 2HJJA 2L8TA 2UU9E 3L00A 4RH8A 4LFAE 2UUBI 2DIXA 2EE8A 1E3HA 1XMQE 1PDAA 2LRSA 4X62I 1WRJA 2HKJA 1UBDC 1F2IG 4AM3A 4LF4E 4GZNC 2GO4A 4DV4E 3PYDA 1A1FA 4X65E 4DR1E 4LF5E 4OZEA 1N34I 4OO1B 4BA1A 1T4LB 4WYQB 4DV3E 1OJ4A 1SFEA 4TUIA 1PKPA 2EORA 2FTXB 4ZYHA 4IS1C 2GQ0A 2DB2A 5JEAC 3DF6A 4BS9A 4DV0I 1RQ0A 2EMBA 4KZSA 4JI1I 3KZYA 3HXLA 1IBLE 3QT8A 4BA2B 2UXCI 2MC5A 3MHHC 2L2NA 5AC4A 5EKWA 1T4OA 2YZTA 2YTOA 2NUEA 5C0XB 4USMA 1MEYC 4RPFA 2EMKA 4DPXA 2BM1A 3JU0A 4B3RE 3BF2A 4R8OA 3QT5A 2ZM6I 4ZYEA 2VQFI 2EN2A 5KL6A 5JEAF 5K36C 5A6JA 2YSPA 1TF3A 4ZYDA 2PO0A 4OKGA 4DR6E 2OI2A 5KL5A 2JY9A 4LU9A 2JEAB 3J81Q 2JT2A 2IOPA 1N32I 2O1VA 5K36A 4X62E 2E5LE 1R6MA 2PNZA 2IHR1 2DLKA 3FIGA 1HNZI 5JEAA 1GZ6A 1NZ0A 2JEBB 1HR0I 1N34E 5K36F 3DD6A 2FGGA 2BA1G 2E1MA 2EMIA 2CTDA 2LCEA 4O24A 3ADIA 4XTJA 4B3TI 1YZ9A 4LF9I 2EMYA 4JI2I 2V88A 2EPKX 4OOGC 2M1SA 4U3DA 1YPNA 2WNRB 4JI7I 4BMJA 2C39B 2BBGA 2GO3A 1X6FA 5AE2A 2XEXA 3ZZTA 2Z5CA 2LJUA 4OO1C 2KONA 2ZM6E 4R2SA 4JI8I 2VF3A 5DROA 5IT9Q 5DNYA 1DQ3A 3GMEA 4HY1A 2ADRA 1VI7A 1KKHA 2EOOA 2LMZA 2YTGA 3IWCA 2YRKA 2EMZA 1N32E 4JG4A 5AASA 2KHXA 5IWAE 4R2AA 2GLIA 4DV7E 2NUGA 1PJQA 1HR0E 2YTEA 1N0UA 3CDJA 1Y6ZA 5C0XC 1EH6A 1H7SA 2JWOA 3ECRA 4MLVA 1WXRA 2VRDA 4KWYA 2IESA 4M1KA 4ED4A 4X66I 1OYSA 4X64I 2GPIA 3LTOA 1NEIA 4BHCA 3P3EA 3T1HE 2B9DA 3ZOQB 2JYAA 3UHMA 2ODRD 2NN6B 4OO1A 4B3SE 3HPZA 3EPHA 4GKJE 1H72C 2EQ1A 5C0XF 4DV5I 1Z0BA 1SR9A 1P47A 2PO2B 4JI8E 5LMNE 1E3PA 2EPXA 2GS8A 4M2ZA 3T1YI 4BA2A 1N33I 1X3CA 2JR1A 2EMXA 2F4VE 1N36I 1TN9A 2EM9A 2EJ4A 2V2ZA 2YTJA 2X7IA 1B62A 5C0XA 3TQMA 2EL5A 2YT4A 2CSHA 1FWKA 4DV6I 2JP9A 4IFDD 2EPZA 5KL2A 1YYWA 3F6HA 4Q28A 2UXDI 4DR3I 2PNMA 2GHFA 3PS2A 2EM0A 2K7IA 3OTOI 2JVAA 2DRPA 2JEAA 2YRHA 2EOMA 1YSAC 4NXMI 2UXBE 5L3JA 4X66E 4DUZI 5A69A 2DGCA 2HGHA 1UN6B 1BBOA 1FWLA 2EN1A 4FW4A 1BB8A 1OYRA 4L8NA 2MDRA 2JEBA 4DUYI 2PO1B 2ENAA 5A6BA 4PRXA 4I3HA 2RS7A 4MU1A 2DEIA 1EKZA 5K36D 3LLHA 1IBME 3M85G 4MYTA 2WBTA 2EMHA 4JI3E 2EPUA 1RHYA 3T1YE 3U1KA 1X6EA 4O4KA 1N33E 2EM5A 4JV5I 1QNTA 3AUZA 3BBGA 5A6KA 2L2KB 4LF7E 1MX0A 2WNRA 2C39A 2UUCE 2A2CA 3IWDA 3ZZ0A 4R1FA 1X6HA 4LFBE 4USKA 2NN6C 2RTXA 1A1IA 2EOZA 1WHQA 2V8QB 1ZM4A 3VYYA 2JOBA 3JAMC 3OTOE 3PYGA 2V34A 2JE6B 5IXMB 2K4VA 2V87A 4R2RA 2UUAE 2EMWA 2DMYA 4NXME 1X48A 4IFDE 1IQSA 2YTQA 4DUZE 2EN6A 2BA0G 3ZKDA 2M9AA 2F8BA 2LE2A 2JPAA 2EMGA 2EPLX 4DUYE 1MU5A 2DSYA 2NN6F 2LBSB 4HACA 4IZJD 5AE3A 4WUBA 2NPFA 3V5RA 1IMUA 2NUFA 4DU7A 5LL6R 4IS9A 4KQVA 4X9JA 2RSMA 1ZM9A 2C37A 2EOFA 2J7JA 2CPNA 2IOQA 3B78A 4B3SI 4DR4I 5F3WA 4WX9A 1ELOA 4N3OA 2EM8A 2HC5A 2L2MA 2YTNA 5IV8B 4DR7E 1Z59A 3PS3A 5ELWA 2VQEI 3EPJA 2NN6A 4NHRA 4YY3E 4LF6E 4K0KE 1G2FC 2DEJA 2Z5BB 3D4JA 4RHBB 4AIMA 2ELZA
chains in the Genus database with same CATH topology
2UUBE 2N3HA 4WUCA 1FI4A 1HNWI 1Z0WA 4LTYA 4DV1I 3F6GA 5FLXQ 4JI6I 3V2UC 3Q6MA 4P52A 3ZZUA 4YHHI 1QZRA 4DV0E 4GEQB 4JI1E 3PRYA 2RS6A 2UXCE 2HK3A 2L3CA 4ZVIA 2O1TA 1QU6A 4DKKA 3LMLA 2Q2EB 1PVGA 2V2QA 2VQFE 4R03A 1Z0CA 4DPUA 3K6QA 4LF8I 2H36X 2N3GA 1RC7A 1FKAE 1YYOA 3VYXA 5BR8I 1HNWE 4P78A 4DXLA 2V8PA 3HPSA 3OMLA 1HNZE 2O1UA 4HACB 2B3TB 1Y4UA 4LFCI 1ZM2A 2HFSA 4TUGA 3H09A 1XMOI 4JI0I 1UHZA 4B3TE 2CZ9A 4LF9E 4JI2E 4FWHA 2E1RA 4B3MI 4DPYA 1Z0TA 1BKNA 1ZXNA 4JI5I 4JI7E 1B63A 5LMUI 1USVA 3Q1QA 3WU4A 4X8WA 4PRVA 1T4NA 4L5NC 4JI4I 1HK7A 3RMPA 2HFUA 2NA2A 2Z5EA 4UT4A 2Z5BA 1Y4SA 4M30A 5GMDA 4F9CB 3ZKBA 1UEKA 3LPSA 4LFCE 2J7KA 3JTZA 1Z0GA 3HTXA 4JYAI 4WFTA 1EA6A 1NHHA 4X64E 3WU6A 1U2RA 4B3ME 1IBKI 3AV0A 2PNLA 1FJGI 3J7AG 4JI5E 3J80C 1K47A 3QT7A 1XNRI 3CWVA 1NHIA 1ZBTA 2M7QA 2A2DA 4DV5E 2UU9I 2MC6A 4URLA 1XMQI 1ZM3A 3HQ1A 1N36E 4LF4I 1KVKA 5IT9C 4NXNI 4X65I 4DR1I 4DV3I 2L6MA 4DV6E 3ADJA 2UXDE 1HNXI 4DR3E 2M4IA 4IZKB 1X47A 3ADGA 1IBLI 1S4EA 3PYFA 2G7HA 1DI2A 1H73A 4F9BB 2V83A 1IBKE 1MG7A 1KIJA 3KWRA 3VK6A 1RREA 3F0NA 4KHPI 1NHJA 4F9AB 4DR6I 3K1JA 1ZXMA 2Z5BB 1RR9A 1WUUA 2FV4B 4BC9A 1Z5AA 2E5LI 4IZJB 1O0WA 4JV5E 2EWLA 1Z0VA 4NXNE 4J8ZA 2AJ4A 3MSWA 4UTGA 2O1WA 1UILA 2V86A 1HNXE 1STUA 4FWGA 2R3VA 5A2QC 4Z7YA 1H7UA 3LNUA 3PYEA 4WUDA 1X49A 1YYKA 2WZOA 3C4TA 2X36A 2JOXA 2ZITA 3WU3A 2V85A 3HJCA 4BBYA 4KHPE 4EMDA 4DR4E 4DPTA 2VF1A 1I94I 2VQEE 2B7VA 5IWAI 1VISA 3ADLA 4DV7I 5GMEA 4DR5I 3H4LA 4BC7A 1A6FA 1GQEA 3Q6NA 4Z7CA 3K17A 2ZBKB 4DMIA 4DV1E 4JI6E 2LUQA 3T1HI 1FNMA 3J80Q 1H74A 3HULA 3IWBA 1DARA 3C4BA 4B3SI 2HHHI 4WSPA 3GONA 4GKJI 1N0VC 4YHHE 4DU8A 2R42A 4F54A 4P7DA 1D6TA 3P1XA 4IZKA 4DV2I 2L92A 5LMNI 2V2VA 2LJHA 2L33A 2F4VI 2LTSA 1I94E 4AQYI 4WPYA 2BM0A 1J26A 1ZBQA 4DR5E 4DPWA 3JAMQ 2L3JA 1PIEA 4LF8E 2CG9A 4P7AA 4GKKI 1Z5CA 5FWKA 4FN5A 4OX9I 4I8OA 5BR8E 2HKEA 2UXBI 4MYUA 3J81C 2BV3A 4IZJA 2VE7C 3B8HA 1Z0EA 4DR2I 5FLXC 2EFGA 2HHHE 1XMOE 4JI0E 2LTRA 3J7Yp 3K85A 5ADZA 1IBMI 2KOUA 4DV2E 2LJPA 4JI3I 1J5EI 1XNQI 5LMUE 2HK2A 1S16A 4LF7I 3M6AA 2UUCI 4AQYE 2V89A 4FW9A 4LFBI 4JI4E 4LFAI 2LUPB 3ZM7A 1KTVA 5CFFE 4HXZA 4GKKE 1XHKA 4M0VA 4OX9E 4HYMA 5A2QQ 3P06A 4DV4I 2UUAI 1USUA 3WU5A 4LF5I 3DJWA 5T6JA 2Z5CB 4DR2E 3QT6A 2WW4A 4JYAE 4FWDA 2B7TA 2ODRC 4PU9A 1WHNA 2EZ6A 3B82A 1J5EE 1XNQE 4DR7I 1FJGE 5AE1A 4B3RI 3J7AM 4BCAA 1XNRE 4YY3I 4LF6I 4K0KI 1EI1A 2CGEA 1Z5BA 2L8TA 2UU9E 4LFAE 2UUBI 2DIXA 1XMQE 2LRSA 4X62I 2HKJA 4LF4E 4DV4E 3PYDA 4X65E 4DR1E 4LF5E 1N34I 1T4LB 4WYQB 4DV3E 1OJ4A 4TUIA 1PKPA 2FTXB 2GQ0A 2DB2A 3DF6A 4BS9A 4DV0I 1RQ0A 4JI1I 4KZSA 3HXLA 1IBLE 3QT8A 2UXCI 2MC5A 2L2NA 1T4OA 2YZTA 2NUEA 4USMA 4RPFA 4DPXA 2BM1A 3JU0A 4B3RE 3QT5A 4R8OA 2VQFI 2ZM6I 4DR6E 2OI2A 2JY9A 4LU9A 3J81Q 2IOPA 1N32I 2O1VA 4X62E 2E5LE 2IHR1 3FIGA 1HNZI 1GZ6A 1NZ0A 1HR0I 1N34E 2FGGA 4XTJA 2E1MA 3ADIA 4B3TI 1YZ9A 4LF9I 4JI2I 2V88A 4OOGC 2M1SA 4JI7I 4BMJA 5AE2A 2XEXA 3ZZTA 2Z5CA 2KONA 2ZM6E 4JI8I 2VF3A 5IT9Q 5DNYA 1DQ3A 4HY1A 1KKHA 3IWCA 2LMZA 1N32E 4JG4A 5AASA 2KHXA 5IWAE 4DV7E 2NUGA 1HR0E 1N0UA 1Y6ZA 1H7SA 2JWOA 1WXRA 4M1KA 4ED4A 4X66I 4X64I 3LTOA 3T1HE 2B9DA 3ZOQB 2ODRD 4B3SE 3HPZA 4GKJE 1H72C 4DV5I 1Z0BA 1SR9A 4JI8E 5LMNE 2GS8A 4M2ZA 3T1YI 1N33I 2JR1A 2F4VE 1N36I 2V2ZA 2X7IA 1B62A 2YT4A 1FWKA 4DV6I 1YYWA 3F6HA 4Q28A 2UXDI 4DR3I 2PNMA 3OTOI 2JVAA 4NXMI 2UXBE 5L3JA 4X66E 4DUZI 1FWLA 4L8NA 2MDRA 4DUYI 4PRXA 4I3HA 2RS7A 2DEIA 1EKZA 3LLHA 1IBME 4MYTA 4JI3E 3T1YE 1N33E 4JV5I 3AUZA 4LF7E 1MX0A 2L2KB 2UUCE 2A2CA 3IWDA 3ZZ0A 4R1FA 4LFBE 4USKA 2RTXA 1WHQA 2V8QB 1ZM4A 3VYYA 2JOBA 3JAMC 3OTOE 3PYGA 2V34A 2UUAE 2K4VA 2V87A 2DMYA 4NXME 1X48A 4DUZE 3ZKDA 2F8BA 2LE2A 4DUYE 1MU5A 4HACA 2DSYA 2LBSB 4IZJD 4WUBA 5AE3A 2NPFA 3V5RA 4DU7A 2NUFA 5LL6R 4KQVA 2RSMA 1ZM9A 3B78A 2CPNA 2IOQA 4DR4I 5F3WA 1ELOA 4N3OA 2L2MA 2VQEI 1Z59A 4DR7E 4YY3E 4LF6E 4K0KE 2DEJA 3D4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB E;  4WUC A;  1FI4 A;  1HNW I;  1Z0W A;  4DV1 I;  5FLX Q;  4JI6 I;  3V2U C;  4P52 A;  3ZZU A;  4YHH I;  1QZR A;  4DV0 E;  4JI1 E;  2UXC E;  2HK3 A;  4ZVI A;  2Q2E B;  1PVG A;  2V2Q A;  2VQF E;  1Z0C A;  4DPU A;  4LF8 I;  1FKA E;  5BR8 I;  1HNW E;  4DXL A;  2V8P A;  1HNZ E;  4HAC B;  4LFC I;  1ZM2 A;  2HFS A;  1XMO I;  4JI0 I;  4B3T E;  2CZ9 A;  4LF9 E;  4JI2 E;  4FWH A;  2E1R A;  4B3M I;  4DPY A;  1Z0T A;  1BKN A;  1ZXN A;  4JI5 I;  1B63 A;  4JI7 E;  5LMU I;  3Q1Q A;  3WU4 A;  4PRV A;  4JI4 I;  2HFU A;  4UT4 A;  5GMD A;  3ZKB A;  1UEK A;  3LPS A;  4LFC E;  2J7K A;  1Z0G A;  4JYA I;  1EA6 A;  1NHH A;  4X64 E;  3WU6 A;  1U2R A;  4B3M E;  1IBK I;  1FJG I;  3J7A G;  4JI5 E;  3J80 C;  1K47 A;  3QT7 A;  1XNR I;  3CWV A;  1NHI A;  2A2D A;  4DV5 E;  2UU9 I;  4URL A;  1XMQ I;  1ZM3 A;  1N36 E;  4LF4 I;  1KVK A;  5IT9 C;  4NXN I;  4X65 I;  4DR1 I;  4DV3 I;  4DV6 E;  2UXD E;  1HNX I;  4DR3 E;  1IBL I;  1S4E A;  3PYF A;  1H73 A;  1IBK E;  1MG7 A;  1KIJ A;  1RRE A;  3F0N A;  4KHP I;  1NHJ A;  4DR6 I;  3K1J A;  1ZXM A;  1RR9 A;  1WUU A;  1Z5A A;  2E5L I;  4JV5 E;  1Z0V A;  4NXN E;  2AJ4 A;  4UTG A;  1HNX E;  4FWG A;  2R3V A;  5A2Q C;  4Z7Y A;  1H7U A;  3LNU A;  3PYE A;  4WUD A;  2X36 A;  2ZIT A;  3WU3 A;  4KHP E;  4EMD A;  4DR4 E;  4DPT A;  1I94 I;  2VQE E;  5IWA I;  1VIS A;  4DV7 I;  5GME A;  4DR5 I;  3H4L A;  1A6F A;  4Z7C A;  3K17 A;  2ZBK B;  4DV1 E;  3T1H I;  4JI6 E;  1FNM A;  3J80 Q;  1H74 A;  3HUL A;  1DAR A;  4B3S I;  2HHH I;  3GON A;  4GKJ I;  1N0V C;  4YHH E;  4DU8 A;  2R42 A;  1D6T A;  4DV2 I;  5LMN I;  2V2V A;  2F4V I;  1I94 E;  4AQY I;  2BM0 A;  4DR5 E;  4DPW A;  3JAM Q;  1PIE A;  4P7A A;  4LF8 E;  4GKK I;  1Z5C A;  4FN5 A;  4OX9 I;  5BR8 E;  2HKE A;  2UXB I;  4MYU A;  3J81 C;  2BV3 A;  3B8H A;  1Z0E A;  4DR2 I;  5FLX C;  2EFG A;  2HHH E;  1XMO E;  4JI0 E;  1IBM I;  4DV2 E;  2LJP A;  4JI3 I;  1J5E I;  1XNQ I;  5LMU E;  2HK2 A;  1S16 A;  4LF7 I;  3M6A A;  2UUC I;  4AQY E;  4FW9 A;  4LFB I;  4JI4 E;  4LFA I;  3ZM7 A;  1KTV A;  4HXZ A;  4GKK E;  1XHK A;  4OX9 E;  4HYM A;  5A2Q Q;  4DV4 I;  2UUA I;  3WU5 A;  4LF5 I;  3QT6 A;  4DR2 E;  2WW4 A;  4JYA E;  4FWD A;  4PU9 A;  3B82 A;  1J5E E;  1XNQ E;  4DR7 I;  1FJG E;  4B3R I;  3J7A M;  4YY3 I;  4LF6 I;  1XNR E;  4K0K I;  1EI1 A;  1Z5B A;  2UU9 E;  2UUB I;  4LFA E;  1XMQ E;  4X62 I;  2HKJ A;  4LF4 E;  3PYD A;  4DV4 E;  4X65 E;  4DR1 E;  4LF5 E;  1N34 I;  4DV3 E;  1OJ4 A;  1PKP A;  4DV0 I;  4JI1 I;  1IBL E;  3QT8 A;  2UXC I;  4USM A;  4RPF A;  4DPX A;  2BM1 A;  4B3R E;  3QT5 A;  2VQF I;  2ZM6 I;  4DR6 E;  2OI2 A;  3J81 Q;  1N32 I;  4X62 E;  2E5L E;  1HNZ I;  1NZ0 A;  1HR0 I;  1N34 E;  4XTJ A;  4B3T I;  4LF9 I;  4JI2 I;  4JI7 I;  2XEX A;  3ZZT A;  2ZM6 E;  4JI8 I;  2VF3 A;  5IT9 Q;  4HY1 A;  1KKH A;  1N32 E;  4JG4 A;  5IWA E;  4DV7 E;  1N0U A;  1HR0 E;  1H7S A;  4M1K A;  4ED4 A;  4X66 I;  4X64 I;  3LTO A;  3T1H E;  4B3S E;  1H72 C;  4GKJ E;  4DV5 I;  1Z0B A;  4JI8 E;  5LMN E;  2GS8 A;  3T1Y I;  1N33 I;  1N36 I;  2F4V E;  2V2Z A;  2X7I A;  1B62 A;  1FWK A;  4DV6 I;  2UXD I;  4DR3 I;  3OTO I;  4NXM I;  2UXB E;  5L3J A;  4X66 E;  4DUZ I;  1FWL A;  4DUY I;  4PRX A;  4I3H A;  2DEI A;  1IBM E;  4MYT A;  4JI3 E;  3T1Y E;  1N33 E;  4JV5 I;  1MX0 A;  4LF7 E;  2UUC E;  2A2C A;  3ZZ0 A;  4R1F A;  4USK A;  4LFB E;  1ZM4 A;  3PYG A;  3OTO E;  3JAM C;  2V34 A;  2UUA E;  4NXM E;  4DUZ E;  3ZKD A;  4DUY E;  1MU5 A;  4HAC A;  2NPF A;  4WUB A;  3V5R A;  4DU7 A;  5LL6 R;  4KQV A;  1ZM9 A;  3B78 A;  4DR4 I;  1ELO A;  2VQE I;  1Z59 A;  4DR7 E;  4YY3 E;  4LF6 E;  2DEJ A;  4K0K E;  3D4J A; 
#chains in the Genus database with same CATH topology
 2PRT A;  2UUB E;  4R2E A;  2WP8 B;  2N3H A;  2EN8 A;  2PO2 A;  4FW3 A;  4WUC A;  1X5W A;  5TSE A;  1FI4 A;  5C0X D;  1HNW I;  1Z0W A;  4LTY A;  4MDT A;  4DV1 I;  3F6G A;  2E72 A;  2EMF A;  2BA1 D;  5FLX Q;  4JI6 I;  3M7N G;  3V2U C;  3Q6M A;  2DMI A;  1JK2 A;  2EPO A;  4P52 A;  3HKM A;  2EOX A;  3P76 A;  3B4T A;  4FW5 A;  4WXD A;  3ZZU A;  4YHH I;  1AH5 A;  1QZR A;  4N4R B;  5KL4 A;  4DV0 E;  4GEQ B;  4JI1 E;  3PRY A;  2RS6 A;  2UXC E;  2HK3 A;  2L3C A;  4ZVI A;  2O1T A;  1RMD A;  1QU6 A;  4DKK A;  2YTI A;  3LML A;  2Q2E B;  1PJT A;  5DRQ A;  2CT1 A;  1PVG A;  2V2Q A;  2VQF E;  4R03 A;  1Z0C A;  4M9V C;  4DPU A;  3K6Q A;  4LF8 I;  2H36 X;  2N3G A;  1RC7 A;  1FKA E;  2JXP A;  1YYO A;  3VYX A;  5BR8 I;  2R76 A;  1LLM C;  2WBU A;  1HNW E;  4P78 A;  4DXL A;  2V8P A;  3HPS A;  4NBQ A;  3OML A;  3U1Y A;  1ZR9 A;  1HNZ E;  4ISA A;  2O1U A;  4HAC B;  2B3T B;  1Y4U A;  4LFC I;  4OO1 F;  1ZM2 A;  2HFS A;  4TUG A;  2LV2 A;  3H09 A;  1XMO I;  4JI0 I;  2C37 B;  1UHZ A;  4B3T E;  3BID A;  2CZ9 A;  4LF9 E;  4JI2 E;  4FWH A;  2E1R A;  4B3M I;  4DPY A;  1Z0T A;  2JE6 A;  2ELY A;  5KL3 A;  1BKN A;  1ZXN A;  4JI5 I;  4JI7 E;  1B63 A;  5LMU I;  1USV A;  3Q1Q A;  3UK3 C;  1R6L A;  3WU4 A;  4X8W A;  4PRV A;  2EPP A;  1T4N A;  4L5N C;  4JI4 I;  4R2P A;  1HK7 A;  3RMP A;  1YH8 A;  2HFU A;  2EOQ A;  3P3G A;  2I9I A;  2NA2 A;  2Z5E A;  4MQY A;  2RSI A;  1EH7 A;  2Z5B A;  4UT4 A;  1T38 A;  4MU4 A;  1Y4S A;  4M30 A;  2ENC A;  2I13 A;  5GMD A;  1DGC A;  4F9C B;  3ZKB A;  3VHT B;  1G2D C;  3P3C A;  1UEK A;  4ZYG A;  3LPS A;  2EQ3 A;  4LFC E;  2EOY A;  2J7K A;  3JTZ A;  1Z0G A;  2EM4 A;  3C6M A;  4MLQ A;  3HTX A;  4AID A;  3MHS C;  5JEA D;  2WP8 A;  4JYA I;  5EL9 A;  2A25 A;  1N3G A;  4WFT A;  2YU5 A;  1EA6 A;  1NHH A;  4X64 E;  3WU6 A;  1U2R A;  4IFD B;  4B3M E;  1IBK I;  4MU3 A;  2R1F A;  5DNX A;  3AV0 A;  3THN A;  2PNL A;  1FJG I;  3J7A G;  4JI5 E;  3M85 D;  3J80 C;  1K47 A;  3QT7 A;  1XNR I;  2Q8U A;  3CWV A;  1NHI A;  1ZBT A;  2M7Q A;  2A2D A;  4DV5 E;  4R2D A;  2UU9 I;  1UDO A;  2MC6 A;  2ENH A;  4URL A;  1XMQ I;  2EM3 A;  3GCM A;  1ZM3 A;  1YUI A;  3HQ1 A;  2RPC A;  1N36 E;  4LF4 I;  1KVK A;  5IT9 C;  4NXN I;  2EM7 A;  4X65 I;  4DR1 I;  2YU8 A;  1JK1 A;  2NAB A;  4DV3 I;  5A6A A;  2L6M A;  4DV6 E;  3ADJ A;  2UXD E;  4NZV A;  1HNX I;  4DR3 E;  2M4I A;  4IZK B;  1X47 A;  3ADG A;  2BA0 D;  1IBL I;  1S4E A;  3PYF A;  2EPA A;  5DRP A;  2EOI A;  2G7H A;  1DI2 A;  1H73 A;  4F9B B;  2V83 A;  4F6M A;  1IBK E;  1A1K A;  2EOE A;  1KIJ A;  1MG7 A;  2BR2 A;  1Z1B A;  3KWR A;  1A1J A;  4MU0 A;  1ZU1 A;  1EH8 A;  4F6N A;  3VK6 A;  5JEA E;  2EN4 A;  1RRE A;  2EMC A;  3F0N A;  4KHP I;  1NHJ A;  4F9A B;  4QNK A;  2N8X A;  3K1J A;  4DR6 I;  3L7Z B;  4OO1 D;  2RQL A;  1A1L A;  1BBG A;  2BB8 A;  2FV4 B;  3EPK A;  1RR9 A;  1WUU A;  1ZXM A;  2CVE A;  4BC9 A;  3EPL A;  1Z5A A;  2E5L I;  2YSO A;  4IZJ B;  1O0W A;  4JV5 E;  2EWL A;  1Z0V A;  5K36 E;  4NXN E;  4J8Z A;  4IFD C;  4J3D A;  4LOM A;  2AJ4 A;  3MSW A;  3M7N D;  4O43 A;  4UTG A;  2O1W A;  2EQ0 A;  1UIL A;  2V86 A;  1HNX E;  2EL6 A;  1STU A;  1GTK A;  4FWG A;  2EPM X;  2R3V A;  1UDN A;  1NCS A;  5A2Q C;  3NZK A;  1H7U A;  4Z7Y A;  3LNU A;  3PYE A;  4WUD A;  4FW7 A;  2WCC 3;  4IFD F;  1X49 A;  1YYK A;  2WZO A;  2D9H A;  3C4T A;  3M99 B;  5KL7 A;  2AE8 A;  2X36 A;  1T39 A;  2JOX A;  2ZIT A;  3WU3 A;  2V85 A;  2EMA A;  1AAY A;  4BBY A;  3HJC A;  5DRR A;  4KHP E;  4LPF A;  2VES A;  4EMD A;  4F2J C;  5A6B D;  4DR4 E;  1UDQ A;  4DPT A;  2VF1 A;  1UDS A;  1ZAA C;  4IFD A;  1I94 I;  2VQE E;  2B7V A;  4LCH A;  5IWA I;  2EOH A;  3ADL A;  1VIS A;  5GME A;  4DV7 I;  4DR5 I;  4OO1 E;  3H4L A;  4BC7 A;  2EN7 A;  2EPN A;  1A1H A;  4IJD A;  1A1G A;  1A6F A;  1WJP A;  1GQE A;  1YFH A;  1IQO A;  5DNL A;  2YTF A;  3Q6N A;  4Z7C A;  3K17 A;  2ZBK B;  2EML A;  2BR2 B;  4DMI A;  4DV1 E;  1L4S A;  4JI6 E;  2LUQ A;  3T1H I;  1FNM A;  4FW6 A;  3QG5 C;  3J80 Q;  3CDI A;  1H74 A;  2YWQ A;  3HUL A;  3IWB A;  1DAR A;  2EN3 A;  3C4B A;  4WXC A;  4WSP A;  3GON A;  1OYP A;  5C0X E;  2HHH I;  4GKJ I;  4Q35 B;  1N0V C;  4YHH E;  4DU8 A;  4U3B A;  2R42 A;  4F54 A;  4P7D A;  1D6T A;  2MKD A;  5LLQ A;  4R2Q A;  3P1X A;  4IZK A;  4DV2 I;  2DLQ A;  2L92 A;  5LMN I;  1KYQ A;  4O5G A;  2LT7 A;  2V2V A;  2LJH A;  1XXE A;  2YTD A;  2L33 A;  1YUJ A;  2F4V I;  2EM6 A;  3PS1 A;  2LTS A;  1I94 E;  4AQY I;  4WPY A;  4BA1 B;  2BM0 A;  2C38 A;  1J26 A;  2PO1 A;  1ZBQ A;  4R2C A;  4DR5 E;  4LCG A;  4DPW A;  3JAM Q;  2L3J A;  1PIE A;  4LF8 E;  4HEI A;  2CG9 A;  4P7A A;  1Z5C A;  4GKK I;  5FWK A;  4FN5 A;  4OX9 I;  2NN6 D;  3L7Z A;  4I8O A;  5BR8 E;  1B69 A;  2HKE A;  3THO B;  2UXB I;  4MYU A;  3J81 C;  2BV3 A;  4IZJ A;  2LVH A;  2VE7 C;  2EOJ A;  2YRM A;  4WSG A;  3B8H A;  1PJS A;  3KZZ A;  1Z0E A;  4DR2 I;  5FLX C;  4LCF A;  2EFG A;  2HHH E;  1XMO E;  2LTR A;  4JI0 E;  2PO0 B;  2LO3 A;  3J7Y p;  2EM2 A;  5ADZ A;  1YHC A;  3K85 A;  2YPN A;  1IBM I;  2KOU A;  2J65 A;  4BHB A;  4DV2 E;  2PNZ B;  2LJP A;  4FK5 C;  2EP3 A;  4JI3 I;  1J5E I;  1XNQ I;  2MKN A;  5LMU E;  5JEA B;  2F1D A;  1S16 A;  2HK2 A;  4LF7 I;  3M6A A;  2UUC I;  4AQY E;  2EOS A;  2V89 A;  1KJK A;  1P42 A;  4FW9 A;  4LFB I;  4JI4 E;  3GLL A;  2LUP B;  4LFA I;  3ZM7 A;  1KTV A;  5CFF E;  1MGT A;  4HXZ A;  4GKK E;  1XHK A;  2EPC A;  1Y60 A;  4M0V A;  4OX9 E;  4HYM A;  5A2Q Q;  3P06 A;  2WBS A;  2EPR A;  2MDG A;  4DV4 I;  2UUA I;  5AC5 A;  1USU A;  3EQ1 A;  3WU5 A;  4LF5 I;  5K36 B;  2YTP A;  3DJW A;  2O3Z A;  5T6J A;  1Y5Y A;  3H1C A;  2NN6 E;  3BGH A;  4QNJ A;  2Z5C B;  2IER A;  4DR2 E;  3QT6 A;  2WW4 A;  4JYA E;  4FWD A;  2B7T A;  2ODR C;  1TF6 A;  4GQU A;  4PU9 A;  1WHN A;  2EZ6 A;  4HTG A;  2EL4 A;  3B82 A;  1J5E E;  1XNQ E;  2C38 B;  3KRN A;  4DR7 I;  1FJG E;  5AE1 A;  4B3R I;  3J7A M;  4BCA A;  1XNR E;  3C6K A;  4YY3 I;  4LF6 I;  1EI1 A;  2CGE A;  4K0K I;  1Z5B A;  2HJJ A;  2L8T A;  2UU9 E;  3L00 A;  4RH8 A;  4LFA E;  2UUB I;  2DIX A;  2EE8 A;  1E3H A;  1XMQ E;  1PDA A;  2LRS A;  4X62 I;  1WRJ A;  2HKJ A;  1UBD C;  1F2I G;  4AM3 A;  4LF4 E;  4GZN C;  2GO4 A;  4DV4 E;  3PYD A;  1A1F A;  4X65 E;  4DR1 E;  4LF5 E;  4OZE A;  1N34 I;  4OO1 B;  4BA1 A;  1T4L B;  4WYQ B;  4DV3 E;  1OJ4 A;  1SFE A;  4TUI A;  1PKP A;  2EOR A;  2FTX B;  4ZYH A;  4IS1 C;  2GQ0 A;  2DB2 A;  5JEA C;  3DF6 A;  4BS9 A;  4DV0 I;  1RQ0 A;  2EMB A;  4KZS A;  4JI1 I;  3KZY A;  3HXL A;  1IBL E;  3QT8 A;  4BA2 B;  2UXC I;  2MC5 A;  3MHH C;  2L2N A;  5AC4 A;  5EKW A;  1T4O A;  2YZT A;  2YTO A;  2NUE A;  5C0X B;  4USM A;  1MEY C;  4RPF A;  2EMK A;  4DPX A;  2BM1 A;  3JU0 A;  4B3R E;  3BF2 A;  4R8O A;  3QT5 A;  2ZM6 I;  4ZYE A;  2VQF I;  2EN2 A;  5KL6 A;  5JEA F;  5K36 C;  5A6J A;  2YSP A;  1TF3 A;  4ZYD A;  2PO0 A;  4OKG A;  4DR6 E;  2OI2 A;  5KL5 A;  2JY9 A;  4LU9 A;  2JEA B;  3J81 Q;  2JT2 A;  2IOP A;  1N32 I;  2O1V A;  5K36 A;  4X62 E;  2E5L E;  1R6M A;  2PNZ A;  2IHR 1;  2DLK A;  3FIG A;  1HNZ I;  5JEA A;  1GZ6 A;  1NZ0 A;  2JEB B;  1HR0 I;  1N34 E;  5K36 F;  3DD6 A;  2FGG A;  2BA1 G;  2E1M A;  2EMI A;  2CTD A;  2LCE A;  4O24 A;  3ADI A;  4XTJ A;  4B3T I;  1YZ9 A;  4LF9 I;  2EMY A;  4JI2 I;  2V88 A;  2EPK X;  4OOG C;  2M1S A;  4U3D A;  1YPN A;  2WNR B;  4JI7 I;  4BMJ A;  2C39 B;  2BBG A;  2GO3 A;  1X6F A;  5AE2 A;  2XEX A;  3ZZT A;  2Z5C A;  2LJU A;  4OO1 C;  2KON A;  2ZM6 E;  4R2S A;  4JI8 I;  2VF3 A;  5DRO A;  5IT9 Q;  5DNY A;  1DQ3 A;  3GME A;  4HY1 A;  2ADR A;  1VI7 A;  1KKH A;  2EOO A;  2LMZ A;  2YTG A;  3IWC A;  2YRK A;  2EMZ A;  1N32 E;  4JG4 A;  5AAS A;  2KHX A;  5IWA E;  4R2A A;  2GLI A;  4DV7 E;  2NUG A;  1PJQ A;  1HR0 E;  2YTE A;  1N0U A;  3CDJ A;  1Y6Z A;  5C0X C;  1EH6 A;  1H7S A;  2JWO A;  3ECR A;  4MLV A;  1WXR A;  2VRD A;  4KWY A;  2IES A;  4M1K A;  4ED4 A;  4X66 I;  1OYS A;  4X64 I;  2GPI A;  3LTO A;  1NEI A;  4BHC A;  3P3E A;  3T1H E;  2B9D A;  3ZOQ B;  2JYA A;  3UHM A;  2ODR D;  2NN6 B;  4OO1 A;  4B3S E;  3HPZ A;  3EPH A;  4GKJ E;  1H72 C;  2EQ1 A;  5C0X F;  4DV5 I;  1Z0B A;  1SR9 A;  1P47 A;  2PO2 B;  4JI8 E;  5LMN E;  1E3P A;  2EPX A;  2GS8 A;  4M2Z A;  3T1Y I;  4BA2 A;  1N33 I;  1X3C A;  2JR1 A;  2EMX A;  2F4V E;  1N36 I;  1TN9 A;  2EM9 A;  2EJ4 A;  2V2Z A;  2YTJ A;  2X7I A;  1B62 A;  5C0X A;  3TQM A;  2EL5 A;  2YT4 A;  2CSH A;  1FWK A;  4DV6 I;  2JP9 A;  4IFD D;  2EPZ A;  5KL2 A;  1YYW A;  3F6H A;  4Q28 A;  2UXD I;  4DR3 I;  2PNM A;  2GHF A;  3PS2 A;  2EM0 A;  2K7I A;  3OTO I;  2JVA A;  2DRP A;  2JEA A;  2YRH A;  2EOM A;  1YSA C;  4NXM I;  2UXB E;  5L3J A;  4X66 E;  4DUZ I;  5A69 A;  2DGC A;  2HGH A;  1UN6 B;  1BBO A;  1FWL A;  2EN1 A;  4FW4 A;  1BB8 A;  1OYR A;  4L8N A;  2MDR A;  2JEB A;  4DUY I;  2PO1 B;  2ENA A;  5A6B A;  4PRX A;  4I3H A;  2RS7 A;  4MU1 A;  2DEI A;  1EKZ A;  5K36 D;  3LLH A;  1IBM E;  3M85 G;  4MYT A;  2WBT A;  2EMH A;  4JI3 E;  2EPU A;  1RHY A;  3T1Y E;  3U1K A;  1X6E A;  4O4K A;  1N33 E;  2EM5 A;  4JV5 I;  1QNT A;  3AUZ A;  3BBG A;  5A6K A;  2L2K B;  4LF7 E;  1MX0 A;  2WNR A;  2C39 A;  2UUC E;  2A2C A;  3IWD A;  3ZZ0 A;  4R1F A;  1X6H A;  4LFB E;  4USK A;  2NN6 C;  2RTX A;  1A1I A;  2EOZ A;  1WHQ A;  2V8Q B;  1ZM4 A;  3VYY A;  2JOB A;  3JAM C;  3OTO E;  3PYG A;  2V34 A;  2JE6 B;  5IXM B;  2K4V A;  2V87 A;  4R2R A;  2UUA E;  2EMW A;  2DMY A;  4NXM E;  1X48 A;  4IFD E;  1IQS A;  2YTQ A;  4DUZ E;  2EN6 A;  2BA0 G;  3ZKD A;  2M9A A;  2F8B A;  2LE2 A;  2JPA A;  2EMG A;  2EPL X;  4DUY E;  1MU5 A;  2DSY A;  2NN6 F;  2LBS B;  4HAC A;  4IZJ D;  5AE3 A;  4WUB A;  2NPF A;  3V5R A;  1IMU A;  2NUF A;  4DU7 A;  5LL6 R;  4IS9 A;  4KQV A;  4X9J A;  2RSM A;  1ZM9 A;  2C37 A;  2EOF A;  2J7J A;  2CPN A;  2IOQ A;  3B78 A;  4B3S I;  4DR4 I;  5F3W A;  4WX9 A;  1ELO A;  4N3O A;  2EM8 A;  2HC5 A;  2L2M A;  2YTN A;  5IV8 B;  4DR7 E;  1Z59 A;  3PS3 A;  5ELW A;  2VQE I;  3EPJ A;  2NN6 A;  4NHR A;  4YY3 E;  4LF6 E;  4K0K E;  1G2F C;  2DEJ A;  2Z5B B;  3D4J A;  4RHB B;  4AIM A;  2ELZ A; 
#chains in the Genus database with same CATH homology
 2UUB E;  2N3H A;  4WUC A;  1FI4 A;  1HNW I;  1Z0W A;  4LTY A;  4DV1 I;  3F6G A;  5FLX Q;  4JI6 I;  3V2U C;  3Q6M A;  4P52 A;  3ZZU A;  4YHH I;  1QZR A;  4DV0 E;  4GEQ B;  4JI1 E;  3PRY A;  2RS6 A;  2UXC E;  2HK3 A;  2L3C A;  4ZVI A;  2O1T A;  1QU6 A;  4DKK A;  3LML A;  2Q2E B;  1PVG A;  2V2Q A;  2VQF E;  4R03 A;  1Z0C A;  4DPU A;  3K6Q A;  4LF8 I;  2H36 X;  2N3G A;  1RC7 A;  1FKA E;  1YYO A;  3VYX A;  5BR8 I;  1HNW E;  4P78 A;  4DXL A;  2V8P A;  3HPS A;  3OML A;  1HNZ E;  2O1U A;  4HAC B;  2B3T B;  1Y4U A;  4LFC I;  1ZM2 A;  2HFS A;  4TUG A;  3H09 A;  1XMO I;  4JI0 I;  1UHZ A;  4B3T E;  2CZ9 A;  4LF9 E;  4JI2 E;  4FWH A;  2E1R A;  4B3M I;  4DPY A;  1Z0T A;  1BKN A;  1ZXN A;  4JI5 I;  4JI7 E;  1B63 A;  5LMU I;  1USV A;  3Q1Q A;  3WU4 A;  4X8W A;  4PRV A;  1T4N A;  4L5N C;  4JI4 I;  1HK7 A;  3RMP A;  2HFU A;  2NA2 A;  2Z5E A;  4UT4 A;  2Z5B A;  1Y4S A;  4M30 A;  5GMD A;  4F9C B;  3ZKB A;  1UEK A;  3LPS A;  4LFC E;  2J7K A;  3JTZ A;  1Z0G A;  3HTX A;  4JYA I;  4WFT A;  1EA6 A;  1NHH A;  4X64 E;  3WU6 A;  1U2R A;  4B3M E;  1IBK I;  3AV0 A;  2PNL A;  1FJG I;  3J7A G;  4JI5 E;  3J80 C;  1K47 A;  3QT7 A;  1XNR I;  3CWV A;  1NHI A;  1ZBT A;  2M7Q A;  2A2D A;  4DV5 E;  2UU9 I;  2MC6 A;  4URL A;  1XMQ I;  1ZM3 A;  3HQ1 A;  1N36 E;  4LF4 I;  1KVK A;  5IT9 C;  4NXN I;  4X65 I;  4DR1 I;  4DV3 I;  2L6M A;  4DV6 E;  3ADJ A;  2UXD E;  1HNX I;  4DR3 E;  2M4I A;  4IZK B;  1X47 A;  3ADG A;  1IBL I;  1S4E A;  3PYF A;  2G7H A;  1DI2 A;  1H73 A;  4F9B B;  2V83 A;  1IBK E;  1MG7 A;  1KIJ A;  3KWR A;  3VK6 A;  1RRE A;  3F0N A;  4KHP I;  1NHJ A;  4F9A B;  4DR6 I;  3K1J A;  1ZXM A;  2Z5B B;  1RR9 A;  1WUU A;  2FV4 B;  4BC9 A;  1Z5A A;  2E5L I;  4IZJ B;  1O0W A;  4JV5 E;  2EWL A;  1Z0V A;  4NXN E;  4J8Z A;  2AJ4 A;  3MSW A;  4UTG A;  2O1W A;  1UIL A;  2V86 A;  1HNX E;  1STU A;  4FWG A;  2R3V A;  5A2Q C;  4Z7Y A;  1H7U A;  3LNU A;  3PYE A;  4WUD A;  1X49 A;  1YYK A;  2WZO A;  3C4T A;  2X36 A;  2JOX A;  2ZIT A;  3WU3 A;  2V85 A;  3HJC A;  4BBY A;  4KHP E;  4EMD A;  4DR4 E;  4DPT A;  2VF1 A;  1I94 I;  2VQE E;  2B7V A;  5IWA I;  1VIS A;  3ADL A;  4DV7 I;  5GME A;  4DR5 I;  3H4L A;  4BC7 A;  1A6F A;  1GQE A;  3Q6N A;  4Z7C A;  3K17 A;  2ZBK B;  4DMI A;  4DV1 E;  4JI6 E;  2LUQ A;  3T1H I;  1FNM A;  3J80 Q;  1H74 A;  3HUL A;  3IWB A;  1DAR A;  3C4B A;  4B3S I;  2HHH I;  4WSP A;  3GON A;  4GKJ I;  1N0V C;  4YHH E;  4DU8 A;  2R42 A;  4F54 A;  4P7D A;  1D6T A;  3P1X A;  4IZK A;  4DV2 I;  2L92 A;  5LMN I;  2V2V A;  2LJH A;  2L33 A;  2F4V I;  2LTS A;  1I94 E;  4AQY I;  4WPY A;  2BM0 A;  1J26 A;  1ZBQ A;  4DR5 E;  4DPW A;  3JAM Q;  2L3J A;  1PIE A;  4LF8 E;  2CG9 A;  4P7A A;  4GKK I;  1Z5C A;  5FWK A;  4FN5 A;  4OX9 I;  4I8O A;  5BR8 E;  2HKE A;  2UXB I;  4MYU A;  3J81 C;  2BV3 A;  4IZJ A;  2VE7 C;  3B8H A;  1Z0E A;  4DR2 I;  5FLX C;  2EFG A;  2HHH E;  1XMO E;  4JI0 E;  2LTR A;  3J7Y p;  3K85 A;  5ADZ A;  1IBM I;  2KOU A;  4DV2 E;  2LJP A;  4JI3 I;  1J5E I;  1XNQ I;  5LMU E;  2HK2 A;  1S16 A;  4LF7 I;  3M6A A;  2UUC I;  4AQY E;  2V89 A;  4FW9 A;  4LFB I;  4JI4 E;  4LFA I;  2LUP B;  3ZM7 A;  1KTV A;  5CFF E;  4HXZ A;  4GKK E;  1XHK A;  4M0V A;  4OX9 E;  4HYM A;  5A2Q Q;  3P06 A;  4DV4 I;  2UUA I;  1USU A;  3WU5 A;  4LF5 I;  3DJW A;  5T6J A;  2Z5C B;  4DR2 E;  3QT6 A;  2WW4 A;  4JYA E;  4FWD A;  2B7T A;  2ODR C;  4PU9 A;  1WHN A;  2EZ6 A;  3B82 A;  1J5E E;  1XNQ E;  4DR7 I;  1FJG E;  5AE1 A;  4B3R I;  3J7A M;  4BCA A;  1XNR E;  4YY3 I;  4LF6 I;  4K0K I;  1EI1 A;  2CGE A;  1Z5B A;  2L8T A;  2UU9 E;  4LFA E;  2UUB I;  2DIX A;  1XMQ E;  2LRS A;  4X62 I;  2HKJ A;  4LF4 E;  4DV4 E;  3PYD A;  4X65 E;  4DR1 E;  4LF5 E;  1N34 I;  1T4L B;  4WYQ B;  4DV3 E;  1OJ4 A;  4TUI A;  1PKP A;  2FTX B;  2GQ0 A;  2DB2 A;  3DF6 A;  4BS9 A;  4DV0 I;  1RQ0 A;  4JI1 I;  4KZS A;  3HXL A;  1IBL E;  3QT8 A;  2UXC I;  2MC5 A;  2L2N A;  1T4O A;  2YZT A;  2NUE A;  4USM A;  4RPF A;  4DPX A;  2BM1 A;  3JU0 A;  4B3R E;  3QT5 A;  4R8O A;  2VQF I;  2ZM6 I;  4DR6 E;  2OI2 A;  2JY9 A;  4LU9 A;  3J81 Q;  2IOP A;  1N32 I;  2O1V A;  4X62 E;  2E5L E;  2IHR 1;  3FIG A;  1HNZ I;  1GZ6 A;  1NZ0 A;  1HR0 I;  1N34 E;  2FGG A;  4XTJ A;  2E1M A;  3ADI A;  4B3T I;  1YZ9 A;  4LF9 I;  4JI2 I;  2V88 A;  4OOG C;  2M1S A;  4JI7 I;  4BMJ A;  5AE2 A;  2XEX A;  3ZZT A;  2Z5C A;  2KON A;  2ZM6 E;  4JI8 I;  2VF3 A;  5IT9 Q;  5DNY A;  1DQ3 A;  4HY1 A;  1KKH A;  3IWC A;  2LMZ A;  1N32 E;  4JG4 A;  5AAS A;  2KHX A;  5IWA E;  4DV7 E;  2NUG A;  1HR0 E;  1N0U A;  1Y6Z A;  1H7S A;  2JWO A;  1WXR A;  4M1K A;  4ED4 A;  4X66 I;  4X64 I;  3LTO A;  3T1H E;  2B9D A;  3ZOQ B;  2ODR D;  4B3S E;  3HPZ A;  4GKJ E;  1H72 C;  4DV5 I;  1Z0B A;  1SR9 A;  4JI8 E;  5LMN E;  2GS8 A;  4M2Z A;  3T1Y I;  1N33 I;  2JR1 A;  2F4V E;  1N36 I;  2V2Z A;  2X7I A;  1B62 A;  2YT4 A;  1FWK A;  4DV6 I;  1YYW A;  3F6H A;  4Q28 A;  2UXD I;  4DR3 I;  2PNM A;  3OTO I;  2JVA A;  4NXM I;  2UXB E;  5L3J A;  4X66 E;  4DUZ I;  1FWL A;  4L8N A;  2MDR A;  4DUY I;  4PRX A;  4I3H A;  2RS7 A;  2DEI A;  1EKZ A;  3LLH A;  1IBM E;  4MYT A;  4JI3 E;  3T1Y E;  1N33 E;  4JV5 I;  3AUZ A;  4LF7 E;  1MX0 A;  2L2K B;  2UUC E;  2A2C A;  3IWD A;  3ZZ0 A;  4R1F A;  4LFB E;  4USK A;  2RTX A;  1WHQ A;  2V8Q B;  1ZM4 A;  3VYY A;  2JOB A;  3JAM C;  3OTO E;  3PYG A;  2V34 A;  2UUA E;  2K4V A;  2V87 A;  2DMY A;  4NXM E;  1X48 A;  4DUZ E;  3ZKD A;  2F8B A;  2LE2 A;  4DUY E;  1MU5 A;  4HAC A;  2DSY A;  2LBS B;  4IZJ D;  4WUB A;  5AE3 A;  2NPF A;  3V5R A;  4DU7 A;  2NUF A;  5LL6 R;  4KQV A;  2RSM A;  1ZM9 A;  3B78 A;  2CPN A;  2IOQ A;  4DR4 I;  5F3W A;  1ELO A;  4N3O A;  2L2M A;  2VQE I;  1Z59 A;  4DR7 E;  4YY3 E;  4LF6 E;  4K0K E;  2DEJ A;  3D4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...