3K17A

Crystal structure of a lin0012 protein from listeria innocua
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
355
structure length
355
Chain Sequence
NKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVSWPIGGELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETELIDQSGAKYGLGSSAAATVAVINALMTKFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAYTTFDQEWVKHRLAYKSLEWFMKEPWPMLQIETLEEPVPTFSVGWTGTPVSTGKLVSQIHAFKQEDSKNYQHFLTRNNEIMKQIIQAFHTKDEELLYSSIKENRRILQELGTKAGVNIETSLLKELADSAENMGGAGKSSGSGGGDCGIAFSKTKELAEKLVNEWEKLGIKHLPFHTGRVQITEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Lin0012 protein from Listeria innocua
rcsb
source organism Listeria innocua
molecule tags Transferase
molecule keywords Lin0012 protein
total genus 108
structure length 355
sequence length 355
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3k17A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3k17A01
1KTVA 1Z5AA 4X62E 4DV6I 4LF6E 2V2ZA 4JYAE 4DU7A 4XTJA 3T1YI 4JI7I 4B3TI 1NHIA 5LMNI 2UU9E 4X62I 4RPFA 1OJ4A 1H7SA 1XNRI 2ZITA 2UUAI 1Z0BA 1KIJA 3JAMC 1Z5BA 4ED4A 4EMDA 4LFCI 2HHHI 1FWLA 1H72C 4LF8I 2VQEE 4LFAE 1FJGI 4DV5E 1I94I 3QT6A 1PIEA 2HK3A 3B78A 2HKEA 3B82A 4DU8A 3QT8A 3T1HI 4OX9I 2XEXA 4WUDA 1ZM4A 4GKKI 4FW9A 2CZ9A 1MU5A 4B3RE 4GKJE 4LF7I 1N32E 2LJPA 2UUCE 3J7AM 4URLA 2F4VE 2J7KA 4DPWA 1Z0TA 2ZM6I 4JI6E 3WU3A 4JG4A 3GONA 3OTOI 1HNWI 1Z0EA 4DV0I 1N36E 1K47A 2VF3A 4DPYA 4FWHA 1MX0A 1BKNA 3LPSA 4LF4E 1FWKA 3J80C 2UUBI 1B62A 2GS8A 2BV3A 4DPTA 2BM0A 3F0NA 4M1KA 3CWVA 4YY3I 1XMOI 4JI3E 1N36I 3QT5A 4B3ME 4B3TE 3V5RA 4DV7I 2E1RA 4P52A 4DV1I 1FNMA 4DPXA 5A2QQ 4JI4E 2UXDE 4MYUA 5GMDA 4DV5I 4DV2E 2R42A 1ZM9A 1EA6A 2ZBKB 4DUZI 1KVKA 4AQYI 3K17A 4USMA 1ZM3A 3WU5A 4JV5I 5LMNE 3J81Q 1RR9A 4LFBI 2VQFI 2BM1A 4DR6E 2R3VA 4JI0E 1N0UA 2X7IA 2A2CA 4DUYE 4JI5I 1IBKE 1Z0GA 2UXBE 3LNUA 2UUCI 4X64I 4DXLA 1HNZI 4LF6I 1RREA 4DR2E 1FJGE 4DR6I 2UXBI 5IT9Q 4DR4E 2UU9I 1N33I 1HR0I 4JI4I 1XNQE 3ZZ0A 4X65I 1IBLI 4K0KE 1J5EI 4LF7E 1XMOE 3ZKDA 4Z7YA 4USKA 3LTOA 1Z5CA 2EFGA 1NHHA 1NHJA 5FLXC 4B3SE 3ZKBA 1HR0E 4LF9I 2NPFA 3V2UC 3PYEA 4PRXA 2UXDI 4JI8E 3T1YE 1S16A 3J80Q 1IBME 3D4JA 4LF5E 3B8HA 1EI1A 5LMUE 4NXNE 1XMQE 2V2VA 1NZ0A 4YHHE 4Z7CA 4DR5I 4I3HA 2X36A 4HY1A 4X66I 2VQFE 4ZVIA 2DEJA 2AJ4A 1ELOA 1IBMI 1S4EA 4YY3E 5LMUI 4DV4I 4X64E 5A2QC 1ZXNA 4DR1E 1FI4A 4P7AA 4OX9E 4DR7E 2V34A 1H73A 1U2RA 4R1FA 1HNXE 3ZM7A 1N32I 3J81C 2HKJA 4HACB 4DV6E 3PYFA 4JI0I 3M6AA 2UXCE 4DR1I 1A6FA 1Z0CA 1Z0WA 4KHPE 1IBKI 1Z59A 2HFUA 1H7UA 1Z0VA 3QT7A 1D6TA 5GMEA 3HULA 1KKHA 3K1JA 4PU9A 1XHKA 2E5LE 1QZRA 4JYAI 5IWAI 4JI7E 3H4LA 4FWDA 3ZZUA 5LL6R 3Q1QA 1HNZE 1FKAE 5IT9C 1N34I 4UT4A 4DPUA 1XMQI 4KQVA 3JAMQ 4DR3I 4GKJI 4B3RI 4K0KI 1I94E 4JI2E 1WUUA 1B63A 2HHHE 4DV3I 4MYTA 4DV7E 1N0VC 2VQEI 4LFAI 5BR8I 4NXME 2ZM6E 2HK2A 2HFSA 1J5EE 1N34E 5FLXQ 4GKKE 4DR5E 4LF9E 3OTOE 1HNWE 4HYMA 1ZM2A 4FN5A 4AQYE 2UXCI 4HXZA 4JI2I 2UUBE 5L3JA 4LFCE 1UEKA 4JI1I 2V8PA 4LF5I 1N33E 3ZZTA 2A2DA 4HACA 1XNRE 2V2QA 4LF8E 4FWGA 1IBLE 3WU6A 4WUBA 2DEIA 4LF4I 2F4VI 3T1HE 4NXNI 4JI5E 3J7AG 4DV1E 3PYDA 1ZXMA 4JI1E 4B3SI 1HNXI 1H74A 2Q2EB 4DV4E 4DV0E 4WUCA 4JI8I 4DR3E 1VISA 3PYGA 2UUAE 4DR2I 4UTGA 4KHPI 4PRVA 2E5LI 4DR7I 4JI3I 4DUZE 2OI2A 1DARA 4JV5E 5BR8E 4NXMI 4DR4I 4YHHI 1PKPA 4JI6I 1XNQI 4LFBE 5IWAE 4X65E 4X66E 1PVGA 4B3MI 3WU4A 4DUYI 2WW4A 1MG7A 4DV2I 4DV3E
chains in the Genus database with same CATH superfamily
1AROP 2QTWA 3F44A 3WC0A 5KT7A 2ZH5A 1UWBB 1S6OA 2HHWA 1Z5AA 4IRDA 4X62E 3MFHA 2FGCA 1M5VC 2WVCA 1NHUA 2OHDA 2YNHA 4M5GA 3I31A 4TYBA 5EX0A 4GO7X 5KFDA 3T5LA 4B3TJ 1TL7B 2OPRA 5AXKA 3SIPB 2B8PA 2PO0B 2Z2YB 3M2RB 1F6TA 1DQ8A 2XI2A 3V4IA 2V2ZA 2CGEA 1RT1A 4CQ1A 4JYAE 3CIZA 4DL2A 3M9OB 3Q2SC 4DN9A 4WKYA 4U67Q 2VHGA 4XTJA 4IZJA 1NBEB 3MR5A 3T1YI 4JI7I 1HMVB 2IJNA 4WFZA 3K57A 4DL3A 2PD1A 4URQU 3FMWA 1KLNA 1EHWA 5ETOA 5E3AA 4LF8J 1NHIA 4DUTA 5I42A 2QA2A 1JKHA 1HBMB 2LA4A 1PKUA 3LP2A 3J80U 3SSSA 2IM3A 1JLCA 3VWSA 3OTOF 1HNZJ 2PO2B 2UU9E 2FHJA 1IBCB 2IFXA 2M7SA 4RW4A 1IWGA 3OL6A 3Q23A 2BR0A 2DIVA 3NG8A 3RBZA 1NK7A 5HK4A 3I0SB 3CO9A 3R5JB 2VG7A 4ED4A 3HHLA 3ICLA 3MTKA 1RT2B 2WB1D 2K7KA 4DG1B 4LFCI 2GA7A 1FWLA 1T0TV 2J9EA 2ZKTA 3BM7A 2HG4A 3IMQJ 4F67A 1FTRA 2VASA 4ZP7A 3UD5A 4ZLPA 3TAMB 1NPRA 2DISA 4OZ1A 3Q22A 4K4YA 2XULA 4EI2A 3PS2A 4IFDE 2IHR1 3C6UB 4X4TA 2HGNA 6FD1A 4LFAE 1C0UB 3JSMA 2XY7A 4NLDA 3D66A 3R5BA 3GV8B 1BHNA 2V94A 3PX4A 1PO6A 3LGNA 4DV5E 2DB1A 2QLJB 3QT6A 4A46A 1PIEA 2HK3A 4OHVA 2CG8A 4RNMA 3FGVA 4O44B 2IM0A 2W7OA 1HWKA 2DT9A 1X4GA 4E8UA 1QM9A 3VAMA 2KFZA 3BGFA 1WD6A 1FTCA 3M30B 2IBKA 2JNJA 2RS8A 3BREA 1UW4A 1K0VA 3U1YA 1RTJB 2CFXA 1JJCB 4OYIA 3TVYA 4DR6F 2VOPA 3T1HI 2IC3B 4WFAQ 4KH0B 3QWPA 3MMCB 1S5ZA 2CJQA 3IR6B 2DR6A 2H51B 2D1CA 3HHLB 3TWZA 5F0WA 5HI7A 1S6PA 2HPUA 1OY8A 3QMQA 2KG0A 2ZJPQ 1VBZA 5B0EA 5F8LA 2N7CA 1MU5A 3DGPA 1HI8A 3NEKA 3R7SB 3UW1A 2XMVA 1DFDA 4B3RE 3VGVA 1S49A 1VK3A 3NS5A 3BZQA 1TELA 1P9YA 4YR0A 2XY5A 4LF7I 3CNQP 1DTQB 3PM9A 4PG4A 2LXIA 2UUCF 2MZ1A 2LJPA 4DLEA 4MFBA 4IZJD 3PFOA 2FY8A 3I32A 3LF0A 5KT2A 3DLGA 2V8HA 3SZ2A 3C6TA 3HT3A 3NWRA 1PYTA 3KG0A 3QWUA 2VFTA 1NJYA 4DUYJ 4RW6B 2J7KA 5KFLA 2AWZA 2B8QA 1TKDA 5J2PB 4OYWA 2QL7B 2HBRB 1S1WB 1AXQA 1FCAA 3DOKA 4XPEA 2V9KA 2UV8A 1CJUA 2MPUA 2KFNA 1VMBA 1ZOTA 4B9LA 3WU3A 1D6TA 1UDNA 4U3BA 4HTIA 4MAKA 1HNWI 1PBUA 3D2WA 2G13A 2BA9A 2O1TA 4QU7A 2LU2A 2ZNYA 4FNIA 3OUYB 3RRGA 4DSIA 4JI6F 3DLEA 4NL5A 1U24A 3MECA 4NLRA 4DFMA 5HQ8A 1X9SA 2E9ZA 2ZD1A 1BKNA 1FDDA 1FWKA 2F8HA 4DZ6A 1DHMA 1TL1A 2C3PA 2MY8A 2UUBI 3IRXB 2HMIA 3R2DJ 5ETLA 1U6ZA 4H4OB 2BE7D 1S57A 2V67A 4DEZA 5D78A 2N3OA 2R8JA 4CLUA 4Y2AA 4L73A 3UCGA 4B3SJ 3LGHA 4P72A 2PC6A 5IXUA 2C37B 1UVMA 3KK2B 4K59A 3D1QA 3SFUA 1ZPWX 4WBFA 1AUDA 2DPJA 3CWVA 3SV4A 1WNEA 1Q81T 4RW9B 1R8BA 3NCRA 5KFIA 3GIKA 1OQ6A 2HAFA 1L3UA 4OI3A 2YKQA 3MWBA 3JAMU 4CTAB 2C2ZB 5F8GA 4K0KJ 3DRRB 1D8YA 3V5RA 2H5JB 4GKJJ 4B3RJ 4RNFA 2ASYA 1OSDA 3GTYX 5EWFA 4DV7I 1WTFA 2KN4A 3H2VE 3H5YA 1RISA 3T19A 2XSJB 3QGIA 1HBNB 4Q7AA 2RB7A 4QOTA 1P8GA 2EK6A 1H2VZ 5HQLA 3QRQA 2PNLA 5T41A 2ZWOA 1S76D 3A12A 2UXDE 5EUHA 2BABA 3F41A 4USUA 2CYYA 2X1FA 3N4WA 1ULRA 4KE5A 4JI4F 5HO4A 1K44A 1FD2A 5KT3A 2VQEI 4PRFA 1R0AA 3WZ0A 4YY3J 1EP4A 3S6EA 4BWJA 3PRBA 4GRSA 1T02A 1X8DA 3A3OB 4HT7A 3CWJA 1C1CA 2JEFA 4O4GB 2CQDA 2XO7A 1JNZB 2NZCA 1SKWA 2M5YA 1V3ZA 2KT2A 4MT1A 2XLIA 1OYDA 4DUZI 5K20B 3SFGA 5AJ3F 4LFAF 4AQYI 2WHOA 3MM9A 4NWBA 1ZM3A 1DLOB 2FHOB 2HS0A 1GTEA 3NKYA 1PJ6A 2J8SA 3OR1B 1SB6A 3DRYA 4F4KA 4Y65A 3KMQA 3CCQS 2OPSB 3A1YG 1X0FA 3L3CA 4J37A 2E5JA 2H9ZA 1LWCB 2VBZA 4PPDA 1UA1A 3QPIA 4KV8A 2Q43A 4O0NA 1CG2A 3DLGB 2BW7A 2Y9HA 1AYEA 4NASA 1X9WA 1KLMA 2X1AA 4DR6E 2DRAA 1G3OA 2ZBPA 1J5OB 2QG9B 4LCGA 1Q16B 1KFSA 3N28A 2W2QP 4ZJQA 2GQCA 1W2BR 4Y0FA 1SJ3P 1HI0P 1IBKE 3X3UA 4C4WA 2G0JA 1HK7A 1Z0GA 4OO1B 3FNNA 3K5PA 1U6FA 3MR3A 3BJYA 3R8YA 1S12A 3SCKE 1WACA 3I87A 4DUYF 2WZ1A 2UUCI 2H48B 1KOHA 5D8HB 4NA2A 6FDRA 2HIYA 3LWMA 2FVSA 4W98A 2VJVA 4DXLA 1V9OA 3BF4A 2YX7A 5D3GB 1HNZI 2G0IA 1V3RA 5KFPA 2Z5BA 2LQ9A 3D9BA 3AB4B 5EWEA 4CH1A 3EPGA 4DR2E 1SQGA 1NCLA 2ZBRA 3A8KA 2PA3A 3H0PA 1UPMB 2GHPA 2FJAB 1FRMA 1L3TA 2UUAE 3C66A 3KJQB 4EO8A 2E1MC 4O3NA 5DGBA 2QA4S 2AKWB 4DUZJ 3G82A 3NCPA 2BJEA 1VRUB 1FK9A 2KKHA 3KKFA 2WNRA 1KOOA 1RYRA 2UXBI 3GFYA 5CYQB 2NXEA 2DNOA 3HP6A 3KK3A 5L1IA 5DRQA 1RK8A 2DNKA 4YQWA 2ZH7A 2RE1A 1FEEA 1WC5A 1FA0A 3T9ZA 4M94A 4QYZJ 4MU1A 1VIOA 3MM9B 4OO1A 5F3TA 5GAHU 3K7RA 4MK8A 2C3YA 3TZXA 1RI7A 2DNZA 2DH7A 3BGLA 3VGSA 2YH1A 4CO4A 3BQ2A 1VI7A 1D0EA 3BGRB 3WDOA 1XMOJ 1MWQA 4C3LA 4USIA 2E29A 4K0KF 4IDKA 2UUAJ 3L95X 2BOPA 4ZCLA 4F2RA 2JFKA 2YH0A 5K36D 1LXJA 2POKA 3RG6A 3VF0B 3R5CA 1RA7A 2W7AA 2VQFJ 3CCRS 3KLGA 2DR9A 2V8DA 3G87A 3ZKBA 2RDJA 3W65A 4QIVA 3EX7B 4FXWA 1NJZA 3G96A 3OTEA 4C8KA 5A8KB 2NPFA 4N56A 1HR0E 2RILA 3K0JA 1USVA 3JAMY 3PYEA 1LV5A 3ZC4A 4A4JA 4ZLLA 2FY1A 5DLFA 1KBRA 2UUWA 2X51A 2KB2A 2UV8G 3WBZA 5DDQC 5K8PA 5KT6A 2ZH4A 2HBYB 3GYGA 1YG0A 5CQGA 1PYSB 4JI8F 2HEKA 2QFJA 5H9EK 1U1PA 4DF8A 4LF5F 2K06A 3R2CJ 4ECWA 1RT6B 1T11A 2XCPA 3T1YF 2JEIA 3J80Q 2D69A 1EZZB 4LSZB 4ETXA 1IBME 3D4JA 5EX3A 2UXDF 1RUSA 2KRRA 4NLXA 2JZ5A 3HZGA 4JBCA 4NI2A 5BYSA 3CCUS 4QIEA 2AD9A 4RBTA 2JL9A 1XMQE 1NJWA 1TVRA 2JEJA 4OV1A 2PMZD 2VICA 4PQUA 1NZ0A 5K36C 4Z7CA 4QIGA 4ZPDA 3KJNB 4QPTA 3GR0A 5HMWA 3PKYA 4TY8A 3N5BA 4KR0B 2I6WA 3R7BB 2ZE2A 4DR5F 4I3HA 1YLXA 4HY1A 1OPIA 4OZNA 5KT5A 3J81j 3BKTA 3MEEA 3OUYA 4DV3J 4KFBB 3VTIA 2F8EX 3P45B 4M8LA 2PFFB 1VQLS 1UTAA 3L7ZB 2AJ4A 1IR0A 4M63A 1TL3B 4Y2CA 3UFCX 1S48A 3QIDA 3M2VB 5ITHA 2XHCA 1WF0A 3J7YU 3JYTB 4FS1A 1S4EA 4JV1A 4YY3E 1BXNA 4H4KA 1JLQA 5J2MA 5LMUI 2CVIA 3KLHA 5A2QY 5FDLA 1NNDA 2EPIA 1N33F 5C2CA 4RNOA 2WBRA 7FDRA 2J9DA 3QIPB 1RTHB 1X5OA 2CJBA 1UEVA 2G1DA 3GWCA 1TUVA 4MU4A 3BR8A 5DQHA 1LWXA 3GFZA 4OX9E 2PSZA 4C8MA 2BX6A 4KSEB 1UJ5A 1YIJS 1WC3A 2IPOB 1FE0A 1IR1A 1SUQB 1P27B 2V34A 4NA3A 4CNZA 3T1HJ 2UXBJ 3H40A 3MR7A 2DR8A 2PT0A 4P2SA 3RB6A 3CMQA 3LP1B 4ECRA 3NGTA 3MUVP 1Y6ZA 1ZAVA 2Z2LA 3UDCA 1C0TA 2WBMA 3FKBA 2IVFB 1P1LA 2FQQB 4DR2F 4OI0A 1EKRA 3QFWA 3HF5A 4IG0B 4D3HA 5AXNA 1PC5A 2ZHAA 2FJBB 2KXNB 3HZEA 4J5OA 1KQSR 2WVEA 3WHIA 4PG5A 3OR2B 4HACB 2KHDA 4ID8A 4OX6A 1HNXF 2FLNA 2I9SA 3PYFA 3PW5A 2GO8A 2WB4A 2NN6D 2ACYA 3HSZA 4C8OA 2PMHA 2L9WA 2N4DA 3AFGA 2XMAA 4DR3F 3M6AA 2G4BA 3OQ2A 2FYXA 3B6BA 2HFZA 4H4KC 3QSYB 1N36J 1Z0CA 1JJ4A 3MEDA 3MOJB 1CJVA 3PY8A 1WSRA 2MKJA 4YHHJ 4OX7A 2WRMA 1FRKA 2ZC3A 3MEDB 3KUEA 3M2UA 3T5HA 4IH6A 2XCAA 1Y7PA 2RMLA 3N5FA 2R2TA 2E5LF 2YKPA 5JVGQ 4WZMA 1SH0A 5F8NA 3OXFA 2GAGC 1U0HA 5DG8A 1E6YB 4JI7F 1GX6A 1XHKA 2YX1A 4LPFA 2VV5A 2GJIA 4YFUA 4JI4J 4JYAI 4QWDA 1I5OB 1R7IA 1UCNA 2PN6A 2RT3A 5HATA 1S97A 1N54B 1SIZA 3KLVA 4P2MA 4A47A 4V19J 4DBQA 2OPSA 2VBYA 4P2FA 4J9NA 5HLFB 3MM8A 4Y00A 2NN6A 3Q1QA 1VQ4S 2MKHA 1SVDA 3MPVA 1YVFA 2HHTA 1SUQA 1YDLA 2BMBA 4FYYB 3TRGA 1F1BB 4UQGA 2KM8C 3VAHA 2BJ3A 3A13A 4ELTA 1TL7A 2GO4A 3GMEA 4IFDC 3Q6MA 2IYIA 1HI1A 2R2SA 3RUBL 3O1LA 2VG7B 4DPUA 1XMQI 2B6AA 2OPPA 3AOBA 3SXLA 2FJVA 3P6YC 2AYBA 2M2BA 1NSAA 2V50A 2F8MA 1UDOA 2M8HA 1KC8T 4O3RA 4MK9A 2VG6A 1IBMF 1RJJA 1R43A 3GB0A 4FF2A 2CRLA 2BBEA 5DZ7A 2GNKA 2B7BB 3RZAA 2HHHE 4FDFA 5CCMA 3MPDA 2LDIA 1RADB 1HR0J 1UMJA 2HURA 1OO0B 3VAGA 4R5PA 1XMQF 4WKRA 4DV7E 2FVQA 3QQCD 2JE6A 1QTNB 5BR8I 2DO0A 4IS9A 1YGYA 1NDLA 4J9UE 5IFMA 4J9MA 4RUHA 5H9EJ 5FLXQ 5DETA 1RHUB 4GKKE 4DR5E 3BDEA 4PZVA 1VQPS 4GMKA 1EETA 2CZVC 2P2CB 3NS6A 4TU9A 3BKUA 3IBCB 3TW0A 3RB4A 1N34F 4IFVB 1NK9A 3G86A 3UO0A 2NN6C 3MM6A 3W2WA 1DJ0A 2DNYA 2OSRA 2PA8D 2RUGA 2H65B 3PXGa 1LWEA 3D67A 4ZVSB 4C8ZA 3M85G 1NEEA 4KPYA 1NUEA 2BJ7A 1Z1ZA 4ZPVR 3O2IA 5D0EA 1LK5A 4I7FA 5GMKa 2HYIB 1AZSB 3OVSA 4AQYF 3CULA 3NGDA 1QSYA 3B4TA 1N33E 2BE9B 2J0XA 2KVQE 4ETZA 3GIIA 4G3IA 3P5TL 1GH8A 3TJAA 2JH3A 1SJRA 1VLYA 2R2RA 3MMAA 5ETSA 2Z30B 3GYXB 1TK0A 4FWGA 2J6TA 3KTQA 4DR2I 5JEAB 5IT4A 4JV2A 1RWOB 1HNXJ 5KG4A 3KOAA 1HHQA 4A48A 2RF2A 4Q0BB 4QWCA 3MPWA 2OTLS 4KGMA 4WUBA 4ED1A 3GG1A 4ECVA 2YTCA 4MKYA 4JI5F 1VJWA 4X4QA 1K0TA 3T1AA 1PGZA 2UUTA 1CJUB 1ZZFA 1OY6A 3CSKA 1SJFA 3NNAA 1HW9A 3AQPA 3HD2A 4ED6A 3J7AG 2BUNA 3OPKA 4WFYA 4LUBA 3Q86A 2QL5B 4PABA 4NPOA 2ASLA 4DSLA 2G0CA 2WOMA 1K1QA 4ZCMA 5DG9A 2MKKA 1Y60A 4B3SI 1Z4UA 2V8GA 3P96A 2YKNA 4B9MA 2V4JA 2SXLA 3D3CJ 1AZSA 4BWMA 5KFMA 4DV4E 1U8WA 3IWXA 1FD8A 2YNIA 4MKVA 4OYMA 4DR3E 5A0YB 1FWPA 1I6JA 4DV0F 1HNIA 1GXUA 3J81U 2B5JA 1QUPA 4RW7B 2MMYA 2HHXA 1VC5A 2MDAA 2EK1A 3AA8A 8AT1B 2IY5B 2DCUB 1BWVA 4JI3I 4G1IA 1LEOA 1LW2B 2OI2A 3BSCA 3KXDA 4ZP8A 3FRYA 1JB0C 2AT1B 4HH0A 4ANDA 3SCJE 4B17A 4CIOA 1KVIA 3DI6B 3R9LA 3VCDA 1RWNB 1SJ1A 3A8EA 3MMCA 3NP5A 3VQSA 5B09A 2L9DA 4ZLJA 5CD4A 5BYRA 3QLHA 1N5SA 3CTRA 3EYZA 4K50A 4ISAA 4BA2A 4OO1D 3CPWR 4S0MA 2W25A 5J2NA 3E2EA 1T7PA 1XC9A 1N5YB 1T9XA 3QFHA 4JI6I 5KOXA 3HFVA 1XNQJ 2MQMA 1DURA 4LFBE 4USTA 1SCJB 1Y5NB 2G1HA 2VG6B 3O6QA 1GMWD 2MKYA 4IO1A 4XDCA 4QR1A 3HFKA 2VDIA 3L4BC 4KHMA 4QW8A 4A8XA 2IERA 4GO5X 4B3MI 2V5HG 1RLCL 1RB0A 4EBEA 5CH7B 1D9DA 1MG7A 4DV2I 2GQQA 5LL6d 4DN0A 2Z5CB 4DV3E 2ZH2A 3QRRA 2DNHA 2BJ9A 2QSWA 3SMZA 3Q6NA 4L72B 4F50A 3D68A 2W4CA 3HKWA 4USVA 2N7YA 1ZZNA 4DR4J 1WOOA 2XHWA 3J7ZT 1L3VA 5DO2A 5DS7A 3N6NA 5KFUA 1RZMA 1D8ZA 1TZ0A 2GZOA 3CCWA 3I96A 1Z2LA 3MMBA 1MWYA 5KFOA 2NXJA 1U1QA 1U1KA 1X9MA 4TU8A 1S0VA 1UJ4A 2B56A 3ZTSA 1H38A 3ILJA 4TLRA 4CLPA 2BANB 1WEYA 4L74A 1GAOA 3PR4A 3LP1A 1NDPA 1PBAA 4DU7A 2OEKA 1C0UA 2LYVA 3JSMB 1JLGA 1KWMA 3CDWA 4YN3B 5FD1A 1KHWA 1T9YA 1IJEB 4DL6A 1RSCA 5AXLA 3W5ZA 2RUSA 4I6WA 4F0MA 4Y2MA 5D4LA 1FFSB 4P9SA 2Z5BB 5LMNI 3MEGA 1UVLA 4IFDF 5GAGI 2BR2B 5KFTA 4NLSA 5DGAA 1OJ4A 2MKSA 2CAJA 2CPIA 2L9NA 3I82A 2CQ4A 4JOUA 4PQAA 3TA2A 3QZ8A 2R2UA 1XNRI 2LDYA 4ED0A 2QFIA 5GAEU 2BKPA 3TO8A 2ZM6J 1KIJA 2JT2A 4LQ9A 3T41A 2P8IA 5IT0A 5KFQA 2W9BA 1UAWA 2KHCA 3MAHA 4OO1E 4O23A 1JIHA 3IFEA 4ZS6A 5C42A 4DV2F 1RQ0A 1VRQC 1LQ9A 2OD4A 2HS3A 2V4JB 3QGPA 1NHVA 3DC2A 2ZHOA 3BO4A 4PPZA 1FE4A 5LMNJ 4URSA 3DDKA 1JJHA 2LQBA 3E51A 1N33J 4LF8I 2XO6A 1FO1A 3M2VA 2JLGA 1P42A 1IKVA 1CJKB 3DOMA 4AL6A 2AJQA 1FJGI 1N34J 3DXSX 2BJ1A 1BQMB 2CJXB 2HKEA 2HLTA 2OMLA 4E0DA 3I4HX 2I5JB 4WU2A 3G71S 4DR6J 3B82A 4ES2A 2NREA 5F9NA 2DGSA 2QT7A 2Y1LB 3FJ2A 3QAEA 3QT8A 5KG3A 5KFNA 3AJ1A 3EGVA 3VGUA 2KFYA 4DV5J 5K14A 2H4YB 4ZHRA 2AGOA 4QPXA 5IT9U 1ZM4A 1CSJA 1QDUB 2GIQA 4DV4F 2HFOA 3A4TA 4LRBA 4ZA1A 3AQOA 1CULB 3FCVA 1NO8A 1RWXB 3FBFA 4I7FB 4OI6A 4ANEA 3G8SA 5JVHQ 4DFPA 1NK8A 1JK9B 3IAS9 4RU2A 2HNYB 8RUCA 1FJGJ 1LK7A 2O5DA 1FKOA 3JQJA 5U47A 4F7VA 3DU5A 3CJ8A 2DK2A 5B0DA 2F9DA 1RKJA 1O0PA 2DXEA 3KNGA 2MYFA 4ZVGA 4AL7A 3SQOP 2EKYA 2O1WA 2A1BA 2GQ0A 1VGYA 4USWA 3J7AM 5J2PA 1ZA1B 2GCFA 1S4FA 3C15B 3KLEB 4F4XA 3W61A 1IM6A 1B3TA 4PQUB 4URLA 3MGJA 3AOAA 5L1LA 2M70A 2MHNA 3CGIA 3ITHB 4M5NA 3RYLA 3U1LA 2EFVA 5B0BA 2JX2A 5L1JA 3KFWX 3U1KA 3DD6A 1YBUA 4LFBF 4WWSA 3KRNA 1N8RT 4JI6E 2B51A 4C11A 1IBLJ 2DHXA 4P2XA 3G6XA 4JG4A 1QTMA 1LXNA 2XG8A 3I56S 2R7WA 5ELWA 2VF3A 4YDDB 1TUWA 3NGKA 4DPYA 4FWHA 1U26A 4M5LA 4NXMJ 3J80C 1I51B 4WFBQ 1B62A 2YKAA 3TOQA 2GS8A 2B9XA 2WAQD 3HVAA 3O8WA 2I5JA 2ZBCA 4I69A 2BV3A 2XMUA 5D4NA 4ZVEA 2H5IB 3UR3C 2BVZA 3GV7B 1KS2A 1RAJA 1QAYA 2HVDA 2K8GA 4HEA9 2Y8WA 2IC3A 1EIYB 3NOGA 1JXEA 3MM8B 2NN6B 3M8RA 3F0NA 4CWBA 3MM7A 2MGZA 1M1HA 4EZ9A 5C0XA 1SJ4P 4X4UA 1WHYA 2WVBA 3I5BA 4KGXB 4HTJA 3CJKB 1FX2A 1NPPA 2GVDB 1HQUB 4LIRA 1NM2A 5D3GA 1KR4A 1EJ7L 3BSNA 1ZTTA 5K9FA 4JI3E 3N0VA 4K8RA 3QT5A 2A0FB 3CCTA 2KG1A 1GK8A 2DIUA 2DGWA 2G2YA 4JB8B 4M5KA 5ETNA 3CXCR 4ECQA 2LECA 4IG3B 3MCMA 4B3MF 2HNDA 2VH7A 2IIHA 2W9CA 2Y1IA 5T14A 1FNMA 5IV3A 3KLIA 4QWEA 2Z5CA 5A2QQ 3GCXP 4AL5A 1Q78A 4JI4E 2V63A 1FFGB 2W9AA 3CDBA 3IBFB 2XLKA 3GJTB 2BACA 2AJ2A 2XBPA 1YRTA 1IVZA 1S1XA 4R8UA 4ILLA 3M7NG 3EVMA 5I3QA 1RGVA 3EXYA 5LSLA 1VQ7S 4FW6A 4ENOA 3MCSA 4MJKA 4NLPA 2WVDA 5LXYA 3D6MB 4OX9J 3CD7A 5JEAF 4DV2E 4BLGA 4JI0E 3ULHA 1PJ5A 2FHKA 2L41A 3TQ1A 2AHOB 4DV0J 3VAJA 4U8VA 3D6FB 3GMGA 4FF3A 4KHPJ 2DO4A 1B7YB 3K17A 1JLEB 2C38A 4QNJA 5IT9Q 5B0GA 3OTDA 1Q8LA 3MFIA 4ELUA 1F2HA 1VOMA 3HHNB 3BYRA 5F0UA 1YRUA 3MF5A 1HD1A 2FZGB 3IG1A 1C1BA 1X60A 4KC5A 3H2LA 3DLKA 3M9MB 1LOUA 3U1NA 3C6UA 3J81Q 3DHWC 3CB4A 3K5MA 2F7VA 3FQLA 3BSAA 3NS7B 3VHQA 1NKBA 3LW5C 4X64F 2DHSA 2HVHA 1R8HA 3GIRA 1IBKF 4BHQA 4LF2A 2YNHB 2JC0A 2QMXA 4KAIA 4E98A 1DZ5A 2XZTB 4ZVHA 4USHA 1KLMB 2X7IA 4DUYE 3D3BJ 5KFCA 4JI5I 4JI0F 3P3CA 1RABB 1UWBA 3WIVA 3NNHA 5F8HA 1VBXA 2UXBE 4EUVA 4DSFA 3C14B 1M1GA 1AT1B 2YWKA 1Y5YA 2AZ1A 3DRRA 3F73A 1HQEA 3CCLS 4DR1J 5B7WA 1HW8A 2PI5A 1MROB 4CM2A 5KFEA 3EDQB 3D28A 2XSJA 4PXCA 4C7QA 2RHSB 5C25A 1H2UX 2BDPA 2LEPA 1WC6A 1TV6A 4PXEA 5F9LA 4ICLA 3RR8A 4RBVA 1D9AA 3H1CA 4IG3A 1RU2A 4P75A 3AJ2A 4DR6I 2DYAA 1SKSA 4HR2A 4N8OA 3THTA 2RHQB 3TA0A 4DX8H 3U27A 1R0AB 3HSGA 3PJXA 4H4OA 3CJSA 2HHVA 2PO0A 2GVZA 3PFEA 5CCLA 1FRIA 2ZNZA 3HI9A 1L5UA 4IR1A 2HNZB 1TKTB 1UVKA 4OJHA 3KK2A 3M32A 3W1YC 5IWAJ 2FLLA 5KFRA 4X4VA 2D9PA 4OYXA 3TANA 3VR1A 3AY0A 2ZZMA 4ECUA 1S6QB 3DM2B 3W2WB 4O4RA 3ZTQA 3KNAA 2VFUA 1IBLI 2F1FA 4K0KE 3NGUA 1ITPA 4WP3A 1FNOA 1R6VA 1S1TB 1UZDA 2P6TA 2YY3A 2QE5A 2FVPA 3H20A 4X66J 3FEYB 2G2OA 3IM9A 2MTLA 2AMCB 4RX6A 3J7Z5 3W9IA 3H5XA 1AA1B 1S1TA 2ZOMA 1Q79A 3LTOA 3FUYA 2EFGA 4FPIA 4TKTA 4XDDA 2BE2B 4LIWA 4RNNA 3LWLA 1NHHA 1WG1A 2DY9A 3G8TA 1HR0F 1FDAA 1HPZB 1TUGB 1NLKL 1Y4SA 2LMIA 4B3SE 1R3NA 2H1YA 4EU0A 2ZHBA 1BQNB 4WFXA 1RT7B 1OSCA 3M32B 3PS3A 3DOLB 3V2UC 4JI3F 2C2OB 4EBDA 2ZDPA 2B9YA 2RRBA 2RSQA 1T3NA 3W60A 1ZPVA 2NUUG 4N47A 2XS2A 1IQTA 4JI8E 2RQKA 3UD4P 2M8DB 3T1YE 3Q2TC 2IM2A 1S6UA 2RD5C 3WX4A 3CIMA 1YWXA 3MECB 4P7VA 3GCWP 2DGTA 4KGKA 5D15A 3CCJS 5E3QA 1JQGA 5IM0A 1UFLA 2VD3A 4U7CA 3W2VA 4JI2F 1X7VA 3PIOQ 3LAMA 2WONB 2YPZA 4M5IA 5C25B 2VPWB 2ZH9A 4KIAA 2AQ4A 2YVSA 3J81Y 4JYAJ 2IOQA 3DXBA 4NZ0A 3E01B 1LNQA 2XM3A 1M0SA 3PW7A 2V8VA 3K85A 4RW6A 3K5NA 1HNWJ 5JEAE 3ZTOA 3MEGB 2UZAA 2IRXA 3GE9A 4L3KA 3IRWP 2ZM6F 1PVGA 3UVJA 2CJYB 5K5MA 4I56A 4QIFA 5HSPA 4FXDA 1S6QA 3HHKA 4Y2IA 4X66I 1T9TA 1VYAA 1RTDA 2VQFE 3KHRA 2MQPA 3I5CA 1OMSA 4HHHA 1ZETA 1TKTA 4ZVIA 3GYNA 4IH5A 4OIXA 3M2UB 3PRYA 5LMNF 1P1TA 3KWMA 5JMNA 2Z56B 2DPIA 1RT2A 1MMLA 4Y34A 2ZH6A 2C1EB 1J27A 4YR3A 2R8GA 2MQOA 3DKDA 3P06A 3PX6A 2WK4A 4LF7J 2CQGA 2EFPA 2JC1A 3D6HB 4FS2A 1TMMA 1O8BA 2MQ8A 4X64E 3CD5A 3IGVA 1N5TA 3MAAA 4KY3A 4Q2MA 1TV6B 2G2ZA 1VHFA 4OX9F 2CDRB 4RW4B 5ETMA 3MOZA 3C6TB 1XNRF 1RTJA 4LSNA 2OTJS 3H8YA 4MTPA 1DAXA 3M8SA 2UXBF 4GQUA 3IC1A 1S72S 2FZCB 1B4SA 1URRA 3BPSP 2HWTA 2C2RA 1SPBP 1H73A 2X1BA 3J7YI 2KJWA 3HHLD 3JTPA 4UOCA 5HJYA 1QAJA 1OYSA 3BB5A 1VDHA 2CDQA 1PAUB 1RAGB 3ZZZA 1V5VA 5KFGA 3MXHP 3HJCA 2AEFA 4G1QB 4X84A 2PMWA 2OPPB 1DLOA 2AE8A 5C24A 3BO3A 3NZKA 5C7PA 2W2NP 1HNXE 2M52A 4DQIA 2OP5A 3UN3A 3KDNA 1A6LA 1NK4A 3ONQA 4X4RA 3ZM7A 2RKIA 1BY9A 1RBOB 5D4OA 3CO0P 2Z4PA 1GMUA 1V3SA 4IZJB 1FHTA 3DLKB 4JI0I 2B3TB 3S8SA 3W3SA 2G9OA 1WOSA 3GSDA 3M30A 2OSQA 2K3KA 3TYTA 3PW0A 3EZUA 2UUAF 1HNIB 3CC7S 1IBKI 1RAEB 9RUBA 1SC4B 1WHVA 2LP4A 2F9JA 3ETOA 4QJVA 3MTJA 5G0RB 2MJNA 3DGVA 5CD4H 3R1HA 3D7SB 2I38A 5EHHA 4EYIB 1CS4B 2QYGA 4KPCA 2EFNA 1LWFB 1U0HB 1CJTB 2Q1LA 3HULA 1T9WA 3Q8SB 1VFJA 1KKHA 3P49B 3X1LB 1AFJA 2HLUA 3TUJC 5EGYA 2U1AA 4JI6J 3BYPA 4CYUB 1RHQB 4C3MA 4A8YA 4DG1A 2Q66A 2UXCJ 1RTDB 3FSIA 1S79A 4ECXA 4ZVFA 2NQPA 5DQGA 2DGXA 4JI8J 2QV6A 2O3ZA 4ZIVA 3OL9A 3H4LA 2CPJA 2V69A 3KLFB 1AFIA 3ZZUA 1U1MA 2C39B 2DNNA 3W8GA 4OO1C 3MUTP 3M8QA 4B3SF 1BLUA 4WTYA 5A2QU 3C8YA 2XS7A 3KK1B 4LF4E 3V6KA 4UZBA 4B9UA 2DNPA 4F4AA 4X4SA 4DQRA 4YDXA 5J2QB 1I94J 4C0HA 2VODA 2VBXA 4KKOB 5H9FJ 4IOAQ 3RU0A 4EEYA 4RUBA 4DR3I 2XC9A 4GKJI 1XERA 4B3RI 4DS5A 4MKAA 1TL4A 1OYPA 3L7ZA 3AXMA 3DLEB 4IFYA 4JI2E 1WUUA 4DV3I 4DV7F 5SZTA 1JLBA 4Q2LA 3HM9A 1NJIT 4PWDA 3RAQA 4GVBB 1JLAB 3T6BA 2GHVC 3FVYA 2HQ3A 3GLJA 5LOQA 1Q5YA 2KT3A 4LRCA 4NCGB 1KVJA 1UPPA 4GKKF 2YNIB 1NXIA 2ALZA 3CJRA 1RTHA 2JVRA 1NDCA 4LR7A 2QLBB 2XYGB 2C2DA 2D7SA 3I6PA 2VFRA 2HK2A 2HFSA 2IDEA 3U1MA 3KHLA 4C8YA 1N34E 1J5EE 2JE6B 2DJWA 4LF9E 1IQZA 2FIUA 1IXKA 4NXMF 1HNWE 1CS4A 4Q5VA 2VQFF 2PEHA 3JQMA 1HA1A 1ZM2A 2QN6B 1KP6A 3PRVA 4A8OA 3BKFA 1FRHA 2F63A 3BH7B 2KDOA 1UKUA 5LM7E 3B54A 4C11B 1M90T 5CYJA 3H7HB 1FRJA 4AQYE 4J90A 4HXZA 2UXCI 3TX0A 2JFDA 4YEAA 4YB5A 2IJFA 1YZ6A 2YWFA 2UUBE 2K1RB 3MEEB 2XMKA 5IC4B 4LR8A 2J9CA 1X5SA 3MI7X 4NYPA 2VQEJ 3ZZTA 4QQBA 1IKVB 3DOMB 4LBIA 4NEZA 1CC8A 1RTIB 1IKYA 2FHJD 4ZLNA 2RS2A 2K2PA 5BJRA 1VC0A 2RU3A 2MZSA 2V2QA 3CCZA 4OZLA 2E66A 2ILZA 3FCHA 3GG0A 2XMMA 3NGSA 3EDRB 3PG9A 3QGHA 4DL0C 1YJWS 4CLLA 1WG5A 2Z57B 2MLYA 3HT0A 2KYZA 3IO1A 3ZTRA 2XNQA 2MLZA 4DL4A 1YJ9S 5CYMB 1X31C 4J9OA 2E1CA 4JI1J 4X4NA 2AU0A 4IZKA 3OFEA 2BEFA 4O44A 4PG7A 4DR3J 4DFJA 2C39A 4YOEA 1C4CA 1Q5VA 1RDRA 2NN6F 3D6TB 3JTNA 4HI2A 4RR5A 2FVRA 4JP8A 4YR2A 3T1HE 2QJ3A 1QSLA 1RT5A 3SQGA 1A7GE 1ZXMA 4HT5A 4OL8A 1GQEA 2PEBA 2VKZG 2RVJA 4N3OA 1H74A 1UVNA 2DNQA 1S1VA 2CPFA 2KI2A 4PWUA 4RW8B 2F40A 3LO3A 3UDEA 4CLWA 4D3GA 1T9VA 4JI1F 4DV0E 2KO1A 2CG9A 4JI8I 2M4MA 4WU3A 4LT6A 4DS4A 5HP1B 4M95A 2FZKB 2FLOA 1UZHA 2AF6A 1XK8A 3GJQB 4EWTA 3PV8A 1SKRA 1YJVA 3PO5A 5KFFA 1VRUA 2EG2A 2Y3YA 4DUZF 4ZVUB 4C8NA 4ES3A 1ZA2B 2E5LI 4G1PA 4DR7I 4KHPI 3M8PB 2EFQA 4FYWB 5AE2A 5I3UB 3SDEA 1WI6A 1TKZA 4IQXA 1VBKA 4DSEA 3TUIC 2GQ2A 1LWFA 3UI3A 3J7A1 1RACB 4FVCA 3VQTA 3NNCA 3MMBB 4BA2B 3Q24A 3P3EA 5B0AA 1KHVA 3FFIB 4NXMI 3UVJB 4U7UD 1G4CA 1XR7A 5ETTA 3UCZP 1OYEA 3LAKA 4YHHI 1IJFB 4I6AA 2ROPA 3DI6A 1WDDA 2R7RA 1D1UA 1PKPA 2RQ4A 5IC6B 1S0OA 1ZS6A 4G1QA 2WSCC 1RCOB 3ET6A 1C1BB 1YK9A 4B3OB 5L8RC 3OFGA 3C16A 2BQ3A 4IRCA 1R0CB 3NXZA 2BZ2A 2EI5A 3DYAA 1R6YA 2QRRA 2DH8A 2HVZA 4NOHA 4DV3F 2DXFA 2BXJA 3O3LA 4K4SA 4P74A 2MJUA 3MEKA 3C2PA 2W2MP 2XMJA 4WF9Q 2O67A 2FJEB 2RIJA 2W2PP 3ENVA 2IAJA 3OVAA 3NGRA 4ID5B 2CADA 4NMLA 3ISNC 3RW7A 3FBCA 2UVRA 4F02A 1KTVA 1N48A 2B7CB 1D9FA 5DQIA 4O3PA 1UDQA 1DQ9A 2ZUAA 2BA0G 3G2XA 5E3PA 4CNYA 3PEHA 1MLAA 2B4PA 4FYVB 1UFWA 2XTJP 2HGMA 3B4DA 3RGIA 1IKXA 2H3EB 4FPRA 4CT8A 2JEAA 3EWGA 1HBOA 2CJAA 1SKUB 3CJ4A 4OJGA 4QW9A 4X62J 3TI0A 4KFBA 2E5LJ 2O1UA 1J2VA 1Y9OA 3O5TB 2ZDOA 5C0XD 3OSNA 3RR7A 3EGWB 1YKWA 2NYIA 1FT8A 2XI3A 3OBIA 2BA1G 4NLYA 4B3TI 3EPIA 2PDAA 5DDOC 2LU1A 2V9WA 4OZ3A 1H7XA 1UEUA 3IR5B 4DPOA 4LF9F 4ZJLA 2A6OA 1HNWF 1RXOB 1CPZA 4WP8A 3SYZA 4RPFA 2L08A 1H0HB 4NI2B 4OQJA 1QY7A 2L48A 1MU2B 4ZVRB 3HO1A 2M0GB 3QO9B 3LOUA 3I0RA 1L3SA 5E33A 2ZFHA 1GEHA 1M5PC 4IRKA 3EM1A 2CPYA 5J2NB 4LQ3A 3CJ2A 3JAMC 1VCTA 1DY3A 5LSRA 3OD2A 2PIIA 3U02A 3G8QA 1HWIA 4DV7J 1Z5BA 4EMDA 4WXWA 4P10A 1OS5A 2AZ3A 4M5DB 2R4FA 4CZCA 1QAXA 2R9LA 2VUGA 1U8SA 4OYZA 1T03A 4IUFA 1RBLA 2HQCA 4UUWA 4GKKJ 2HVIA 4OHWA 4LVOP 5KG7A 1H72C 2APOA 2K1RA 2E5GA 3HXMA 4I0WA 2VQEE 4UOFA 3CJQA 3NAHA 3NMRA 1HBUA 1JLFA 1FDNA 3BV8A 3LPYA 5A76A 4R5PB 4DSKA 5GAEI 3KLGB 4ER8A 2D3O1 5J2QA 1IBMJ 1GT8A 4FF4A 2ZH3A 4Y28C 3H4BA 3G4SS 1MU2A 2U2FA 2F5GA 1ZYQA 3O44A 2I2YA 2IM1A 2VDHA 3M8QB 1MWZA 5KG1A 5LT5A 2V4QA 4DU8A 5L9XA 1TP7A 2CA9A 3T1HF 5ETPA 1VQNS 1RLDA 2DRDA 1DQAA 4A8SA 3CD6S 1Q8BA 5AE3A 3EZOA 4B08A 4RL1A 3N6MA 2IA0A 2XEXA 5IV4A 4FBUA 1T03B 2NXNA 4WK1A 1HL6A 1F9FA 1PG5B 3GILA 3HVTB 4F8RA 2MKIA 3MMJA 1KQFB 4PWDB 4RW9A 3ZFVA 1Y0HA 2XGQA 3DM2A 2HRUA 5IOLA 4WIQA 1T3OA 4ZP9A 5E3RA 3GZ7A 3IG1B 3SCLE 2AV5A 4ECZA 2N82B 3MHYA 1VR6A 2QZ8A 4DZDA 3V6JA 4OHYA 3EE3A 3I9ZA 2GX8A 4I64A 1SBRA 2DGUA 4ZN3A 5A8RB 3UD3P 2GVZB 1T05B 2EFOA 3IRXA 5E3CA 2HMIB 3MD1A 2GJ2A 5H1SV 3EZ5A 4OJ3A 3W9HA 1U1OA 2OD6A 4LREA 2E9RX 2I0XA 2W8KA 2JLFA 3R5GA 2UUCJ 3BH6B 4XK8C 1USUA 1R8AA 1VQ6S 1HHTP 3PVXA 2F4VE 1SL2A 1N52B 4DPWA 1SC6A 2IJRA 3AOCA 3UNGC 2ZM6I 2IVMA 4RWXA 1U25A 3Q8UA 2AYMA 2MXYA 4A8FA 4P73A 4PG8A 8ATCB 2XGPA 4HI1A 2D9OA 2I8EA 3OTOI 1IKXB 1MROA 2CXEA 2DH9A 1HQEB 3UN5A 2NS1B 1XNQF 4NX9A 5ETKA 5ADZA 3BGOP 1UW9A 1VLOA 2XWXA 2WP8B 2JRSA 1WC4A 4UY8T 4DOZA 3H2UB 5HBMB 1ZBTA 4WE1A 2DVIA 5H9FK 3FRZA 1R8PA 4K2XA 4PYDA 1T9UA 2QC3A 3AD9C 3PJWA 5A6WA 5DZ6A 2BKOA 3W66A 3TZYA 4AQYJ 1NPKA 4TVAB 1H7WA 4OX8A 3H98A 4PYAA 1TKZB 4WE1B 3MZIA 4DPTA 4KV8B 4JI2J 2HGLA 4OMFG 2Q3PA 4KB7A 3OHBA 3TA1A 5I3UA 2CJKA 4K4ZA 4M5MA 1MN7A 2D3ZA 4PR6A 1S0NA 1O6XA 3OFFA 1E6VA 1ICEB 1FVSA 2VZ9A 4URGA 4ZOSA 2IRUA 1XMOI 1HIYA 1S6PB 4QBUA 5GADU 4ZPAA 2CQPA 2ATCB 2NSCA 2YX4A 4ANCA 1XQIA 2C38B 4HKQA 3ZXWA 1SL0A 4B3ME 4F4ZA 2R7QA 4R25A 2VIHA 4HLBA 2VB6A 4WTOB 4H4MA 1ZH5A 2PNZA 5CABA 4FW3A 4P52A 4DV1I 1R0BG 4FNHA 3P76A 4P71A 3FZBA 3TNVA 3HK2A 4DPXA 2NUHA 3ILLA 4NXNJ 3BO2A 1S1XB 2QLXA 5KG0A 3CW2C 4FKYA 4C48A 3LP2B 1OQ3A 1K8AT 5CYMA 3MM7B 5KOWA 1OY9A 2MGZB 3EGZA 2PGCA 2X3GA 2YNFB 5KTQA 4RUCA 5GMDA 3ENQA 2R42A 1BC6A 3H5UA 2DGQA 2FC9A 3GR1A 3VZHA 2GGPA 1ZM9A 3GFXA 3HVTA 3CF5Q 1RYSA 2XYHB 2ZE2B 4CH0S 2ZBKB 1U49A 4C6AA 5HL7Q 2ASDA 4ZVPB 2VQEF 1KVKA 4I68A 5HN0A 1IWAA 4USMA 1RWMB 4RO0A 2FLPA 2BKNA 1S9GA 5GVQA 2E9TA 3EICA 7FD1A 5E7OB 1VS3A 4BCAA 3JTOA 4LBPA 5KFXA 2HNYA 3UE2A 4GVLA 3FK4A 3V81B 5D0GA 1TK5A 4YUDA 4DLGA 3JYTA 3A3PB 3DRXA 3Q8PB 4LF6J 4AIDA 3UDVA 3K5LA 1EQ0A 1U48A 1Q7YT 5F8JA 3DRSA 1JLFB 2BM1A 2HRYA 3BN4A 2FDNA 1T05A 2CNOB 1MMDA 1S10A 2CUYA 3H90A 5CHCB 1N0UA 1WC1A 2BE2A 4AE5A 2ATLA 2PO1A 1ZAWA 3J7AN 3OW2R 2CPDA 3C15A 1K9MT 2E7XA 4C8LA 3W64A 1C1CB 2ZZTA 1URNA 2A10A 4DR1F 2IDLA 1LW0B 2F65A 2B9EA 2GHWA 3F56A 4O3OA 4X64I 2JLEA 4ZPWR 2YWGA 2J5AA 3Q89A 3ILOA 1FNXH 2OPRB 1Q0NA 4LFBJ 1Y4UA 2X3DA 4X4PA 4A8WA 1N6QB 4Z37A 3AXKA 4LF6I 2DNLA 1WKJA 1PAEX 1YZ7A 1HBNA 1HNVB 3HLUA 3W5XA 1XN9A 4F3MA 1HBUB 4OZJA 4HYKA 3V81A 5DM7Q 1CVJA 1FJGE 2HW3A 4QYRA 4IDKB 3V6DB 1U1NA 4GC7A 5EWGA 2LCWA 3WQPA 4OLOA 4QNKA 1SV5A 2LKZA 4TQRA 1Q82T 4U3DA 1K1SA 4MMOA 4G6VB 1OPZA 2YNGA 2CPEA 1KN6A 2KXFA 2HQDA 4TY9A 2GGPB 1NZ8A 3Q0AA 1VQ9S 4R0JA 5FIIA 2WSEC 5KFAA 3T3FA 4KHPF 1S0MA 3QAUA 1D3WA 1FX4A 3CD0A 2UU9I 1N33I 4L76A 1NB2A 1DTTB 2GMHA 2YPYA 4HHUA 1T8EA 4DQPA 3C46A 5D4PA 1GXTA 4ZJOA 1RBAA 5DDPC 4OFZA 4I67A 3ZZ0A 1FKPA 2ZEJA 3K2YA 1TKXA 5HVFA 3R6LB 4M5DA 4J91A 5BR8J 4LF7E 3L7OA 3R5DA 4KHRA 3ZKDA 4CDIA 4FYDA 4K4UA 2DRBA 2ZOGA 4PG6A 4Z7YA 4F4YA 3BGRA 3SV3A 1SC1B 2VL1A 2ZC4A 1XMOF 1Z5CA 2Z5EA 4RU9A 1NHJA 1OYRA 2HWHA 2NLWA 3PTWA 4NYOA 2QEXS 3HD1A 1M5HA 1REVB 1YJ7A 4U7UK 1TR0A 4L6V3 2D41A 3N6LA 2C3OA 1N5VA 2LFVA 2E44A 3P5BP 4PEOA 4IFVA 2CQ2A 3PEJA 5F41A 3OL8A 1S9EA 1OIAA 4UQTA 4IOCQ 1SXLA 4YB7A 4A8MP 1QLNA 1PC4A 4DX7A 3S7RA 2EW9A 2P9EA 2O1PA 2VG5B 5CYQA 5E2QA 4PRXA 2UXDI 1F3VA 2M88A 1VQYA 3VGTA 3EXCX 2J7UA 3H4DA 4E2FB 2UVVA 4Z2XA 4FW7A 1J5OA 4ILRA 1H7UA 5A8WB 5JEAD 1WC0A 5KFZA 3QSIA 2BW2A 4TU7A 2HHPA 2YKMB 3QYYA 4OYPA 4WJBA 2ZJRQ 3VALA 1B99A 5IS2A 1DTQA 2RNEA 4DFKA 5CXTA 4NYZA 3ZZYA 3Q8YA 1LWCA 3Q83A 3B8HA 1EI1A 3H25A 1YJRA 1WTBA 5LMUE 1H3DA 1IKWA 3T1YJ 4U6PA 2FB0A 4ITSA 2C2EA 4NXNE 2Y1RI 3H59A 2V2VA 4X4OA 3KJVB 4YHHE 5DNXA 4ID5A 4KGVB 3UNYA 2ERRA 4OI4A 4PAAA 4LVNP 4J9RA 3CJ3A 4PKDB 2W9BB 3B4MA 2F4FA 2HHSA 2X36A 2EBGA 5I3PA 3PHTA 1F9HA 1X4CA 3SEOA 6AT1B 1TFYA 3POTB 3NCQA 2QL9B 1GMVA 3RRHA 3R1LA 3G6ES 4LOMA 4N76A 1YBAA 3PKMA 3M2RA 3V4IB 2J0SD 2HVEA 3W7BA 2HHHJ 2KVIA 4RUAA 5DG7A 2GO9A 1AW0A 2OKQA 3CCSS 1XXEA 2OEJA 4LFCF 3P8BB 2HBZB 2HHQA 5A2QC 5AT1B 1KTQA 3CEDA 5FLXY 3RBDA 4FF1A 4WPAA 2VFSA 3DLBA 1M5SA 4NLTA 3DRPB 2JWNA 3IN5A 4PUOB 2W8LA 4EFAC 3K89A 5K36F 1UDSA 3EUNA 4R8UB 1ZXNA 2BJDA 3MDFA 2VG5A 2I1RA 1X4AA 1AUSL 1WOPA 3DHXA 5HJXA 2DR5A 4P7AA 4DR1E 4J9SA 3CMES 5GAGU 1GXLA 1DTTA 1U2RA 2GW8A 2J8AA 2ZOFA 4EZ6A 4LF9J 3AAWB 4ZVQB 3HJFA 4DR7F 1RHYA 5DRRA 5E41A 1KD1T 1FDBA 3RTVA 4FW4A 2NPIA 3N79A 2LLZA 3GQCA 1YH8A 5EN1A 4IH7A 4FYXB 1FJGF 1S1UA 2EBEA 2W2OP 3DCAA 5KG2A 4XO0A 1IR2A 4DV1F 1TAUA 1F0XA 3TUZC 4ED8A 1N32I 3J81C 2W24A 3P3DA 1YHCA 1F2GA 5A8RA 1RWKB 5RUBA 4CLKA 3FEXB 5BYQA 4ZITA 3FSXA 3ISND 1Y3KA 4WYWA 2MQQA 3BSOA 4NCGA 3HVRA 3LGMA 3R7NB 4EGLA 4NLGA 5MLCV 1A6FA 4KHPE 2KJVA 3HSJA 2QYCA 4U95A 1HPZA 1Q53A 2CQCA 2DKOB 3MM6B 4WIIA 2HFUA 3KUGA 5HAOA 3I5AA 4C3KA 1UP1A 2R8KA 3D1HA 1U6BA 4IFDD 3QT7A 2AEMA 3A3NB 3FC9A 3G9CA 2YNGB 1KONA 3PR5B 1X5PA 2RAQA 2RDIA 4U8YA 1FESA 3I0RB 1H98A 2RDDA 1QD1A 2XZWA 4MIWA 4L3NA 1S99A 5GMEA 3OHAA 2OJ3A 4LF7F 2F1DA 3THPA 3EVWA 3L9ZA 1QVGR 4FKXA 5HROA 4PU9A 1N88A 4FW5A 2FGOA 3HHDA 4EBCA 2HZVA 4IFDA 3C19A 5DRPA 3E8OA 1QZRA 3D54A 5GADI 5IWAI 4UOGA 1TL5A 3RRKA 4M5HA 1TL3A 3ETMA 3EVOA 2YKOA 4CLFA 3CCVS 3GCMA 4FWDA 3QRPA 2KTQA 1B7FA 1W25A 3MCOA 4NLVA 4IR9A 4CRJA 5J1NA 1HNZE 1F9EB 2A3JA 3JSYA 4LRDA 4L75A 3KLFA 2PI4A 3KLEA 1GMWA 4DV6E 2R7TA 1S16A 5IT9C 3JB9k 4ZVTB 1X4HA 1FF2A 1WEXA 4LJMA 1S1WA 4MH8A 3M6WA 4UT4A 2CPHA 5DLGA 3NL0A 4KQVA 3JAMQ 1GTHA 4CM0A 4WXOA 3FMBA 4K0KI 3GIMA 2BJ8A 5HANA 4LF6F 2P6SA 1I94E 1SIWB 2R7VA 2JEAB 3FEZA 1MNEA 1B63A 2DHGA 2Y0BB 5DDRC 1JMTA 3IS9A 1LKZA 1Z2ZA 2OUGA 1EAYC 1S9GB 3FZ2A 3MPYA 2KU7A 1KSPA 1FERA 3PNIA 4NXNF 3DYAB 1NRKA 1J5EF 3QJJA 3OL7A 4YHHF 1N0VC 1TL1B 5KFJA 1VBYA 4NXME 4OZ2A 4NLOA 2QA1A 3LQVA 4QCLA 3TVZA 1IUJA 4H54A 2IAJB 4J9PA 5KFKA 4ED3A 4CI0B 3FDSA 2YBVA 3MAQA 4KH1B 3EMTA 4O3SA 2DHHA 2GC8A 2KL8A 5A8KA 2W01A 2JEGA 4J7CA 3GJSB 2UP1A 2B0GA 2OFHX 2ZBQA 2JVOA 3ILIA 2UUBF 4FN5A 2HHUA 3PZPA 1Y5IB 3HSDA 3K5OA 3OSPA 3M85D 1BQXA 4ZVOB 2MZJA 1IN0A 2DGOA 5G0RA 4P6QA 4CYUA 1S59A 1L3KA 3HMJG 4JI2I 4ED5A 3BBBA 5L3JA 4U96A 3OXLA 1UEKA 5BXIA 1U4BA 4XAKA 2J65A 5KG6A 4NLUA 2V8PA 1U09A 4JI1I 2OPQA 3M4XA 1QE1A 2A2DA 4LRAA 3OR2A 4HACA 1V6HA 4F04B 4LRFA 3DNCA 1E6YA 2HS4A 5HP1A 4DV1J 4LF8E 2ZH1A 1EB0A 4BA1A 4NLQA 1IBLE 1FEHA 1IBKJ 4LF5I 4AFFA 4OI2A 4HDHA 5G4DA 3RBEA 2NXUA 2NN6E 3L7PA 4NLWA 2QSFA 3GJRB 3PDNA 3IR7B 1NK0A 4JI0J 3D1OA 3HVWA 3WU6A 3KK3B 2B6AB 1IM4A 2LXFA 4BC9A 4ZIWA 5D0RA 2UXCE 2VJUA 2DEIA 2Z58B 3GPAA 4WCEQ 1PYOB 2FJDB 5DRKA 2F4VI 3GV5B 3LH2S 1KRPA 1X5TA 4ZCIA 3Q8VA 4ECYA 4MDTA 3CC4S 2O66A 4F25A 5D0HA 2GO3A 4DV1E 3I4PA 3MURP 5C0XF 4JI1E 1JLGB 3Q8RB 2XS5A 1QE1B 3QBCA 2C2MB 5IZHA 1B64A 3AD8C 1R6LA 2Q2EB 4ZN1A 5ETVA 3JXOA 3SI8A 5I42B 2BANA 2EKNA 3AD7C 4DHVA 2XSFA 5T7LA 3KLHB 4DL5A 4WUCA 3VVTA 1YHQS 1IKYB 1BE4A 1NDKA 2UXCF 1Q8KA 4UTGA 2Y8YA 1WKLA 4DWIA 1W2IA 5J1EB 2Z2ZA 2Q6CA 3DFEA 4AT1B 3VAKA 4KYZA 2XY6A 2IMWP 1JNRB 1SJQA 2B5JB 2B4UA 4RW7A 1U02A 3ADAC 2M9KA 2UXDJ 1Y3JA 3AJDA 1Y11A 2A6MA 1DARA 3W9JA 1RAHB 4YP3A 2NZ4A 5JJBA 1BGXT 3H5SA 2J6SA 4W90B 5DNLA 1XNQE 4DR4I 1D09B 2B4VA 2QMUB 1M5OC 1WSVA 2MSTA 2C3UA 4CLSA 5K8OA 1HHSA 4IG0A 3GFHA 4KGZB 5BR8F 4TLQA 1XNQI 1T94A 3IS9B 2IBOA 4NEYA 5IWAE 5C2GA 1HNVA 3PO4A 4KJIA 3ELHA 2HQGA 4AXIA 3HPOA 4C9DA 3WU4A 2RQCA 1ROFA 2WONA 2OH2A 3OR1A 1JKHB 1HBMA 1QUVA 2CQHA 3W2VB 1VQSA 3LA0A 4X65F 3J80Y 1TU0B 4TQSA 5IT9Y 4LF4F 2JDJA 2RU9A 3OT9A 2IA6A 3IXQA 5KT4A 3KYLA 1VQKS 1E3PA 4KQZA 3ZZOA 1U47A 3CCES 3GU0A 4AXJA 1SH3A 1EP4B 4K5RA 4DV6I 4XIUA 1MMNA 2CPZA 2ZBIA 3MPUB 2AIRB 4X2BA 2FHMA 4LF6E 4X62F 1X4BA 3FCWA 3CCMS 4I2QB 4C97A 4KKOA 3WC2A 1BQNA 2RQMA 1XNRJ 2GAHC 2XB2D 2ADCA 2K3IA 2DBBA 2V4RA 1PCAA 3DU6A 3FSYA 1HWJA 4LCFA 4HVZA 1JX4A 4X66E 4F2SA 4IFDB 2H4WB 3BQ0A 3QATA 4OHZA 5FDLB 4UUXA 4NRUA 4DV4J 1M5KC 4JYAF 2BA1D 2FVCA 2VC1A 7AT1B 3PW2A 2MY7A 2V68A 3DMJA 3K59A 1EETB 2Z2MA 3KK1A 3TZWA 4RLEA 3PRDA 4ICLB 3G6YA 1NSPA 2YQ0A 4X62I 3LPEA 5F8MA 1H7SA 2ZH8A 3D5MA 4Q0BA 4F26A 5J1EA 2ZITA 2ZVIA 5L38A 1Q86T 2O01C 2BQUA 1HYSB 4WK3A 1MSWD 1Z0BA 2UUAI 4W92B 2HFNA 5B08A 3ENAA 1SQFA 2MSSA 1VK8A 2VFVA 2HHHI 1YJNS 5K36A 2JEBA 2AX0A 2VPXB 2COLA 3EGNA 3LP0B 1WG4A 1KQKA 3UQSA 5C0XC 2PE8A 1U2CA 3L7UA 5CZXA 4DV2J 1U2FA 2CQ1A 1IBLF 2QIFA 4CO0A 5T7LB 1RT3A 2PO4A 1RAOA 3KHHA 1UFKA 2W4DA 3NY0A 1UVJA 1I94I 1J5EJ 1WDTA 1HLWA 1RHRB 2N4CA 1VRTA 3UWTA 1WEZA 3B78A 2EWHA 2OAUA 3TP2A 3KHGA 1CJKA 1UWAA 3UCUP 4MQYA 1RHMB 4DV5F 1E6VB 3LPSA 2GIRA 4ZMMA 4LF1A 3VAIA 3QJLA 2AGQA 2VPZB 1GFWB 3DDNA 3V4MA 2MB0B 2R8IA 1F5AA 4OX9I 2CQ3A 3PIPQ 5C0XE 2EG1A 1NJXA 2PFDA 2MZTA 4WUDA 4G65A 5C24B 1VJQA 4GKKI 2C42A 1RA6A 3TVKA 4FW9A 2OPQB 4LBHA 1UA0A 4CO5A 2CZ9A 2Y0SD 3OV7A 2D3OR 2WP8A 4DF4A 2IESA 1R89A 1CQMA 3HKZD 3M8ZA 3QGGA 3RW6A 2EC2A 4NBQA 1MW7A 1WKKA 2YQ3A 4NA1A 4WYLA 1HARA 1QJHA 2VC0A 2YQ1A 3KJFB 4LMZA 4JUZA 1N32E 1VRTB 4Q8FA 5THWA 1CJVB 2RKIB 4LSNB 3T9NA 4B3RF 4GKJF 1REVA 2F4VF 3KLIB 9ATCB 4Y6IA 2Y1JA 1PILA 2UUCE 4LFCJ 4FP9A 3CDAA 3MR6A 2MEWA 1XMQJ 2EVZA 3RAMA 2HBQB 4C0BA 2N3LA 1Q1KA 2CQIA 3WIUA 3M1VB 1S9EB 4CH7A 1APSA 1Z0TA 3OTBA 5FJ4A 5K8MA 3M7VA 3AODA 2Q6BA 3TAQA 2R7UA 2JEBB 2WNRB 3PACA 4OV6A 1JLEA 2AP6A 2DNRA 3HHEA 1VQOS 2NXCA 1P9QC 1WELA 3BGUA 3BN7A 3GONA 4MKBA 5AXMA 5HMYA 1Z0EA 3TZZA 4DV0I 1RAAB 2V6AA 2ROEA 1K47A 1TAQA 2YKMA 4M5JA 4EYHB 4IO9Q 1MN9A 3CT9A 1N5YA 5KFBA 2HSEB 2YWHA 1X4EA 5D6GA 2ZWPA 4MIBA 4RW8A 4CT9A 5LXRA 1MX0A 3BDPA 3ENWA 5KFHA 1Y10A 4QYZK 5CZVA 4YMEA 2HNDB 2W9CB 1FRLA 2JHEA 2QMWA 3N01A 1SC3B 4ZPBA 3GIJA 3H42A 3IBWA 1RCXB 2CPXA 4DUZE 3OLBA 3DMJB 2J9DE 4OZ0A 2E1AA 1LW2A 1YRXA 1Y4ZB 3W62A 1S7HA 2BM0A 3PCOB 4K2JA 4NMXA 3Q8QB 4DJBA 4ZK7M 3T5JA 2R7SA 2DCLA 1U1RA 2GVDA 1X4FA 1CQNA 4M1KA 1KFDA 4IQMA 4RWWA 4V19X 4IZKB 1W7WA 4OYOA 4YY3I 1BWEA 4ECSA 2LQJA 2JSXA 3HDSA 3V6HA 2HQIA 2CG4A 3LP0A 3QNWB 1N36I 2GJFA 1CBKA 1X0PA 4I2QA 3D0GE 4X65J 3PW4A 3MUMP 4B9SA 4B3TE 2HRTA 1TKXB 4DCOB 1T95A 1I3OB 1PJ7A 2WOMB 1C0TB 2QGFB 3LALA 2E1RA 4LSLA 1U1LA 2FTRA 1FFWB 1Q8IA 3E01A 2ZD1B 2MZQA 3IWNC 4OHXA 2YWEA 2CZ4A 4DL7A 4QR0A 4JV5J 3W5YA 3JSBA 2YXLA 1JLAA 4HHJA 4NRTA 3TJ8A 4ECTA 2AJ1A 2MHEA 4MYUA 1QVFR 3A8IA 5KAKA 2VU5A 4OZEA 3DOKB 4V1Ak 1VQ5S 4O4GA 5EL9A 2L3MA 2Z8QA 4CO1A 3SSQA 4LCHA 2UU9J 4DV5I 5K8NA 4K4TA 1YITS 4ILMA 4HL9A 1EA6A 2Q79A 3KG4A 3DLHA 3UR0A 4LF5J 2QLWA 3MM5B 2QLFB 2NSBA 3RAXA 3DLLQ 4K4VA 4YB1P 5I4MA 4ZPCA 4GVBA 1NU4A 2XLJA 2J0WA 4P7TA 1NZAA 1CEZA 1JXLA 4JV5I 1O51A 1S9FA 1WORA 2OMOA 2FC8A 3MR2A 4DV6J 2J6UA 1RT4A 3TR5A 1RR9A 2AX1A 4LFBI 4NCAA 1LFWA 2VQFI 3R3TA 2VESA 5MAOA 2R3VA 3MMAB 2D74B 2ZZNA 4K4XA 4I1TA 5ETRA 2P9GA 2VBWA 3WU5A 4GC6A 1FJEB 2UVUA 2R7XA 1YJUA 3IAM9 2AYGA 2A2CA 2HAIA 5E5NA 4KRWA 4DSJA 4I2PB 3E3XA 3BBCA 4IOBA 4OYAA 4R0EA 4ALZA 1CJTA 1G6BA 2BA0D 2D3UA 2C37A 2V0NA 5CA5A 3NRBA 2OEMA 3KUHA 4RNHA 5C42B 5HVGA 3LNUA 4CCHA 1N6QA 1F5CA 1LWEB 2KM8B 2F4VJ 4N77A 4B9NA 4MU0A 3NWGA 4ED7A 1A0OB 2VA3A 5EDWA 1N32F 1RREA 1F5BA 2UUBJ 2PNMA 4B3OA 2GFFA 1B0PA 2IRYA 3D0HE 5GAHI 3U7JA 1B0VA 2E7WA 1NKCA 2LVWA 4AD6A 4YS2A 3BR9A 1XTZA 2BQRA 4LSLB 3P3GA 2KYXA 4N5SA 3EJMA 4DQSA 4Q45A 4BA1B 4F3QA 3CC2S 1RHJB 2BRLA 2YNFA 2AW0A 1BQMA 3TEGA 3DRSB 5J1PA 2BRKA 2ZKUA 1B70B 2M3DA 2XWYA 3BS9A 2O3DA 4MFBB 4CP5A 1R31A 3ZNUA 3NMAA 3PJ9A 4DI6A 2ADBA 1F60B 3HKMA 4DR4E 1RTZA 3LANA 3SDEB 1N56A 1JXVA 1R8CA 3M6UA 1HQ2A 2IMOA 4I4BA 1HR0I 4JI4I 2KZMA 1S77D 3NOCA 2RH3A 1H6KX 1WHXA 5JXSA 4X65I 1YI2S 3AA9A 1TFWA 2B4OA 1O5JA 4H4MB 4UF4A 1I1GA 1UJ6A 1J5EI 5HBMA 3CJ5A 3TQEA 3THVA 1NSQA 1FJCA 1XMOE 1BUXA 3TJ9A 1RU1A 2AGPA 1R27B 2E7VA 4JI5J 3FBBA 3C16B 1EQMA 3M05A 4USKA 5IQ6A 4KO0B 1GX5A 5KFSA 2B43A 3RB3A 3CVKA 3TAPA 3RBXA 4BDPA 5FWKA 3OJSA 1XR6A 1XMBA 3BPDA 3OLAA 2R7OA 2R8HA 2BOAA 1FRXA 2LQ8A 5FLXC 3G82B 4F4WA 4ED2A 2ILYA 3ISZA 2XQCA 3FFIA 4LF9I 3P4UB 3S1TA 1V5IB 5L9NA 4FBTA 1FXDA 4NZ6A 3A8JA 5KG5A 3PX0A 4JI7J 5E0OA 2RRNA 4B3TF 2PNZB 2V2KA 4JI3J 1UL3A 3LUYA 3TAMA 5HQMA 5LSOA 2CQ0A 3L09A 1HQUA 2XMWA 2NR0A 1RTIA 3FQKA 3SCIE 5LMUF 3TARA 5LJ5Y 1XJWB 4J3DA 4IKAA 1NB7A 1RT4B 2ABYA 2ACMA 4KO0A 4Y3CA 4Q43A 2J0QD 1A9NB 4LF5E 1Q7LB 1N5QA 2HFVA 3TX8A 2P9CA 4QWAA 4HDGA 3R6GB 3OTOJ 3MD3A 3M7ND 4DDFA 4TXSA 4Y2KA 2C2KB 1VQMS 1JLCB 3CUNA 2PO2A 4DR5I 3I0SA 4A8KA 4F0KA 2CWKA 2OLWA 3UN2A 4DX5A 2LEBA 2HIQA 1PSDA 3R97A 2VA2A 4B9VA 1NH8A 2X1GA 1KEKA 5B0FA 1DRZA 3CJKA 1XIQA 2FPHX 3IWLA 2ZM6E 1CC7A 2RJZA 1C2PA 4XTTA 2DEJA 1DBDA 4AUKA 2CNKB 4DCJB 3JQKA 1M1KT 1U0SA 4ELVA 2ZUGA 3TEHB 2A18A 1ELOA 4HH1A 4FZVA 2FJWA 2EEYA 1U45A 1IBMI 1TMJA 1YBTA 1OWXA 1H2TZ 3ZZRA 5A6PA 3CJ0A 5JEAC 4MIAA 4OYBA 4KT0C 1NKEA 4DV4I 4J9VA 2LA6A 1G2EA 3QJPA 3W63A 4QWBA 2KXHA 4YY3F 2B9WA 5KFWA 1AB8A 2HQFA 2QA4G 1RE1B 1YQHA 2DNGA 2CQBA 3IA0A 1WHWA 4B9TA 2VKRA 5C5JA 2FJXA 2IOPA 2PO1B 1FI4A 1EX8A 4DR7E 2KT5A 3NBPA 4BS2A 2XNRA 4I6YA 2LEAA 1NK6A 1NSKL 4R1FA 1XR5A 4NE9C 1REGX 3BEGB 3OJUA 1F3FA 3KMSA 1CULA 2WVFA 1WF2A 2YKNB 1VQ8S 2HZCA 2AYEA 1RT6A 1XEZA 4W4MA 1N4LA 4CLZA 1Y00A 4OKGA 3OTCA 1RWPB 3OVBA 3ZO7A 3C3LA 4NCBA 3DN9A 4CTAA 4DR2J 5LJ3Y 1YSJA 2HKJA 5K36E 2OELA 1JLBB 1RWVB 4EK2A 1S7IA 3DRPA 4LFCE 2F3JA 2HZAA 4DMZA 2DR7A 1YJTA 2RF2B 4DV6F 4DR1I 1UVIA 4DR4F 5JEAA 1Z0WA 3S01A 2ALYB 2GV1A 2YWWA 5JUMA 1Z59A 2DD8S 2IYGA 1NH7A 1W26A 4BC7A 4LF4J 2DTJA 1YX2A 3NBPB 2VONA 1G7CB 2WSFC 3MM5A 1Z0VA 4F36A 3C14A 4LR9A 2KH9A 5K14B 4ZHRB 1HWLA 1N32J 1VIXA 5HROB 2Z0GA 3ET6B 4TNOA 3RJMB 3IP0A 1XBWA 1S1UB 3ZNJ1 3K58A 5IQQA 4JV5F 3UDLA 3K1JA 2GIFA 1YTYA 2DXDA 4O0IA 2CIMA 4UY85 4TN2A 3AH6A 2E5LE 4GKJE 5DJBA 5CAAA 2J7WA 3M8YA 4UOHA 1EARA 3OXGA 1VHIA 1BD6A 5F8IA 2KRBA 3T5KA 3AB2B 4NZ7A 4PXDA 1HNZF 4JI7E 1RKIA 4OO1F 3N9UC 5L46A 3W8PA 2DGVA 2QX0A 1IKWB 3JSRA 4QIWD 1K73T 5LL6R 2UVWA 1FK9B 5L39A 3TUPA 4DR7J 2MLXA 4BBYA 2LXUA 4ZDNA 1FKAE 1N34I 5EKWA 2BYCA 4UW2A 4KBIA 4PCQA 2WTFA 4A8QA 3AHPA 2XMTA 4OI1A 5M2RA 4ES1A 3VV2B 4C2MA 4J9LA 2FD2A 1FJ7A 3PHEA 2DY1A 5F3ZA 2MKCA 3VZIA 2W4PA 1HKAA 4WFNQ 2VPYB 3VAFA 1I94F 4F3OA 1KQGB 4WP9A 1E3HA 2H54B 3QZ7A 2CWXA 1SQEA 2IVYA 5KFYA 2C22A 2WCXA 1RWWB 3KDOA 3DGPB 1FVQA 1WJ9A 2DNMA 2MQNA 4FVMA 4IYQA 4K4WA 1SL1A 1RT5B 3IGNA 2AEJA 1HBOB 4DX6A 4K7QA 1FXRA 1UETA 4MYTA 2DITA 1WWHA 1TTHB 3UHMA 3JS9A 2C28A 2BR2A 2HHHF 1BMQB 3D0IE 4B3MJ 3PS1A 3DLJA 1KDNA 4N7TA 4ZKAA 1ZAXA 3GSIA 4LFAI 4PUOA 1WF1A 1XNRE 3CJTA 4MK7A 1C4AA 3M9NB 5HLFA 4RKUC 3K8WA 2UU9F 3US5A 3OTOE 4HYMA 3QLHB 3M8PA 2E5HA 4N41A 2GMLA 3FBEA 2P5VA 4CLYA 4Q8EA 5AE1A 2CVEA 4XPCA 1FKPB 1NK5A 3SBMA 1TK8A 5C0XB 4AIMA 2ROGA 2JOQA 4MU3A 3UPFA 4RBUA 2J76E 1NHKL 3M1VA 4QU6A 5HVHA 4OJ1A 4PXBA 5B0CA 2E5IA 4RZRA 3POTA 1VC6A 2KZZA 1X4DA 2MQLA 3I9V9 2E1PA 3GP9A 3R5AA 1Q95G 2XYPB 1SH2A 3HX9A 3KG1A 3MAAB 2W1BA 3M8WA 4LFAJ 4QZVB 2AJ0A 4OZ5A 5A0YA 3VVUA 4CLTA 2VOOA 5LMUJ 4AYBD 3MCNA 2OO4A 1N36E 2MZRA 3M6VA 4N8NA 3G6VA 5L1KA 1SI9A 1SV5B 2CNNB 3OFHA 3I55S 3BBFA 3KJVA 4J9QA 4OLPA 5D77A 1HWUA 3BQ1A 2OGUA 5DM6Q 4B02A 2JJ4D 2ZJQQ 3V6DA 4RJVA 1XWLA 1NAQA 3DOLA 1NMEB 3CE8A 5M2PA 2OIHA 2CKWA 4ATNA 1JJ2R 2OFGX 1RP5A 3GLLA 3AT1B 4AM3A 3HFZB 2C3MA 1CLFA 1HYSA 4LF4I 3DDIA 5A8WA 3ITHA 5SUHA 1B0TA 1G1XA 4NXNI 4JI5E 3PYDA 1RAIB 1S1VB 1EKSA 4CO3A 4C0OC 4Q44A 3CMAS 4QR2A 1LW0A 1HMVA 1LFPA 1HNXI 3ZZPA 5HMZA 3SQGB 5ETQA 1ZTWA 1FXLA 1Y5LB 4EO6A 1RWUA 1RT1B 5HMXA 3HCXA 2O1VA 1P6TA 2CJ9A 3NAIA 4ZPTR 3RB0A 1VISA 1GNKA 2GMJA 1JLQB 1TVRB 3PYGA 5IM0B 5J2MB 1RHKB 1QAIA 4KTQA 1RT3B 2QO3A 5DROA 1FKOB 5FLXU 3CDUA 5AJ3J 1KNZA 5KFVA 4JV0A 4PRVA 3QO9A 1QSSA 4CO2A 2EC0A 1HD0A 2HWIA 3QIPA 1ACMB 5M2UA 3CDIA 2NYHA 2HNZA 3M6XA 4O3QA 1WI8A 4C98A 1Q4RA 4FXVA 4PWWA 4I2PA 4USJC 5LMNE 2H5EA 3T6JA 4WZQA 1HFEL 1R6MA 1RT7A 2FUG9 2DHAA 4TYAA 4DCPB 4ERDA 5BR8E 3HHLC 4JV5E 4TY8B 4UZCA 2W7PA 3SSRA 1U7LA 3HJVA 4ZP6A 4ZCKA 5IWAF 3CDEA 2RRAA 3WX8A 4K5SA 3NLCA 2C2NA 3IM8A 2NCKL 4X64J 2AJFE 2CNLB 4IFYB 4X65E 1RAFB 2K7JA 2XZDB 1JWWA 5K36B 3K8VA 4U9RA 3ZTPA 4J9KA 1N36F 3CDJA 4DQQA 2ZVSA 2EXUA 4X66F 2WW4A 3R27A 4DR5J 1FKAF 4LF8F 4DUYI 4YB6A 2WW8A 4F0HA 1TQLA 2LQ5A 2ASJA
chains in the Genus database with same CATH topology
3Q6NA 1KTVA 1Z5AA 4X62E 4DV6I 4LF6E 2CGEA 2V2ZA 4JYAE 2O1UA 4DU7A 4XTJA 4IZJA 3T1YI 4JI7I 4B3TI 1NHIA 2Z5BB 5LMNI 2UU9E 4X62I 4RPFA 1OJ4A 1H7SA 1XNRI 2ZITA 2UUAI 1Z0BA 1KIJA 3JAMC 1Z5BA 4ED4A 4EMDA 4LFCI 2HHHI 1FWLA 1H72C 4LF8I 2VQEE 4LFAE 1FJGI 4DV5E 1I94I 3QT6A 1PIEA 2HK3A 3B78A 2HKEA 3B82A 4DU8A 3QT8A 3T1HI 4OX9I 2XEXA 4WUDA 2O1WA 1ZM4A 4GKKI 4FW9A 2CZ9A 1MU5A 4B3RE 4GKJE 4LF7I 1N32E 2LJPA 2GQ0A 4IZJD 2UUCE 3J7AM 1USUA 4URLA 2F4VE 2J7KA 4DPWA 1Z0TA 2IOQA 2ZM6I 4JI6E 3WU3A 4JG4A 3GONA 3OTOI 1HNWI 1Z0EA 4DV0I 2O1TA 1N36E 1K47A 2VF3A 4DPYA 4FWHA 1MX0A 1BKNA 3LPSA 4LF4E 1FWKA 3J80C 2UUBI 1B62A 2GS8A 2BV3A 4DPTA 2BM0A 3F0NA 4M1KA 3CWVA 4IZKB 4YY3I 1XMOI 4JI3E 1N36I 3QT5A 4B3ME 4B3TE 3V5RA 4DV7I 2E1RA 4P52A 4DV1I 1FNMA 4DPXA 2Z5CA 5A2QQ 4JI4E 2PNLA 2UXDE 4MYUA 5GMDA 4DV5I 4DV2E 2R42A 1ZM9A 1EA6A 2ZBKB 4DUZI 1KVKA 4AQYI 3K17A 4USMA 1ZM3A 3WU5A 4JV5I 5LMNE 3J81Q 1RR9A 4LFBI 2VQFI 2BM1A 4DR6E 2R3VA 4JI0E 1N0UA 2X7IA 2A2CA 4DUYE 4JI5I 1IBKE 1HK7A 1Z0GA 2UXBE 3LNUA 2UUCI 4X64I 4DXLA 1Y4UA 1HNZI 4LF6I 1RREA 2Z5BA 4DR2E 2PNMA 1FJGE 4DR6I 2UXBI 5IT9Q 4DR4E 2UU9I 1N33I 1HR0I 4JI4I 1XNQE 3ZZ0A 4X65I 1IBLI 4K0KE 1J5EI 4LF7E 1XMOE 3ZKDA 4Z7YA 4USKA 3LTOA 1Z5CA 2EFGA 2Z5EA 1NHHA 1NHJA 5FWKA 1Y4SA 5FLXC 4B3SE 3ZKBA 1HR0E 4LF9I 2NPFA 3V2UC 1USVA 3PYEA 4PRXA 2UXDI 4JI8E 3T1YE 1S16A 3J80Q 1IBME 3D4JA 4LF5E 3B8HA 1EI1A 5LMUE 4NXNE 3K85A 1XMQE 2V2VA 1NZ0A 4YHHE 4Z7CA 4DR5I 4I3HA 2X36A 4HY1A 4X66I 2VQFE 4ZVIA 2DEJA 3PRYA 2AJ4A 1ELOA 1IBMI 1S4EA 3P06A 4YY3E 5LMUI 4DV4I 4X64E 5A2QC 1ZXNA 4DR1E 1FI4A 4P7AA 4OX9E 4DR7E 2V34A 1H73A 1U2RA 4R1FA 1Y6ZA 3HJCA 1HNXE 3ZM7A 1N32I 3J81C 2HKJA 4HACB 4DV6E 4IZJB 3PYFA 4JI0I 3M6AA 2UXCE 4DR1I 1A6FA 1Z0CA 1Z0WA 4KHPE 1IBKI 1Z59A 2HFUA 1H7UA 1Z0VA 3QT7A 1D6TA 5GMEA 3HULA 1KKHA 3K1JA 4PU9A 1XHKA 2E5LE 1QZRA 4JYAI 5IWAI 4JI7E 3H4LA 4FWDA 3ZZUA 5LL6R 3Q1QA 1HNZE 1FKAE 5IT9C 1N34I 3Q6MA 4UT4A 4DPUA 1XMQI 4KQVA 3JAMQ 4DR3I 4GKJI 4B3RI 4K0KI 1I94E 4JI2E 1WUUA 1B63A 2HHHE 4DV3I 4MYTA 4DV7E 1N0VC 2VQEI 4LFAI 5BR8I 4NXME 2ZM6E 2HK2A 2HFSA 1J5EE 1N34E 5FLXQ 4GKKE 4DR5E 4LF9E 3OTOE 1HNWE 4HYMA 1ZM2A 4FN5A 4AQYE 2UXCI 4HXZA 4JI2I 2UUBE 5L3JA 4LFCE 1UEKA 4JI1I 2V8PA 4LF5I 1N33E 3ZZTA 2A2DA 4HACA 1XNRE 2V2QA 4LF8E 4FWGA 1IBLE 4IZKA 3WU6A 4WUBA 2DEIA 4LF4I 2F4VI 3T1HE 4NXNI 4JI5E 3J7AG 4DV1E 3PYDA 1ZXMA 4JI1E 4B3SI 1HNXI 4N3OA 1H74A 2Q2EB 4DV4E 4DV0E 4WUCA 2CG9A 2O1VA 4JI8I 4DR3E 1VISA 3PYGA 2UUAE 4DR2I 4UTGA 4KHPI 4PRVA 2E5LI 4DR7I 4JI3I 4DUZE 2OI2A 2IOPA 1DARA 4JV5E 5BR8E 4NXMI 4DR4I 4YHHI 1PKPA 4JI6I 1XNQI 4LFBE 5IWAE 4X65E 4X66E 1PVGA 4B3MI 3WU4A 4DUYI 2WW4A 1MG7A 4DV2I 2Z5CB 4DV3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTV A;  1Z5A A;  4X62 E;  4DV6 I;  4LF6 E;  2V2Z A;  4JYA E;  4DU7 A;  4XTJ A;  3T1Y I;  4JI7 I;  4B3T I;  1NHI A;  5LMN I;  2UU9 E;  4X62 I;  4RPF A;  1OJ4 A;  1H7S A;  1XNR I;  2ZIT A;  2UUA I;  1Z0B A;  1KIJ A;  3JAM C;  1Z5B A;  4ED4 A;  4EMD A;  4LFC I;  2HHH I;  1FWL A;  1H72 C;  4LF8 I;  2VQE E;  4LFA E;  1FJG I;  4DV5 E;  1I94 I;  3QT6 A;  1PIE A;  2HK3 A;  3B78 A;  2HKE A;  3B82 A;  4DU8 A;  3QT8 A;  3T1H I;  4OX9 I;  2XEX A;  4WUD A;  1ZM4 A;  4GKK I;  4FW9 A;  2CZ9 A;  1MU5 A;  4B3R E;  4GKJ E;  4LF7 I;  1N32 E;  2LJP A;  2UUC E;  3J7A M;  4URL A;  2F4V E;  2J7K A;  4DPW A;  1Z0T A;  2ZM6 I;  4JI6 E;  3WU3 A;  4JG4 A;  3GON A;  3OTO I;  1HNW I;  1Z0E A;  4DV0 I;  1N36 E;  1K47 A;  2VF3 A;  4DPY A;  4FWH A;  1MX0 A;  1BKN A;  3LPS A;  4LF4 E;  1FWK A;  3J80 C;  2UUB I;  1B62 A;  2GS8 A;  2BV3 A;  4DPT A;  2BM0 A;  3F0N A;  4M1K A;  3CWV A;  4YY3 I;  1XMO I;  4JI3 E;  1N36 I;  3QT5 A;  4B3M E;  4B3T E;  3V5R A;  4DV7 I;  2E1R A;  4P52 A;  4DV1 I;  1FNM A;  4DPX A;  5A2Q Q;  4JI4 E;  2UXD E;  4MYU A;  5GMD A;  4DV5 I;  4DV2 E;  2R42 A;  1ZM9 A;  1EA6 A;  2ZBK B;  4DUZ I;  1KVK A;  4AQY I;  3K17 A;  4USM A;  1ZM3 A;  3WU5 A;  4JV5 I;  5LMN E;  3J81 Q;  1RR9 A;  4LFB I;  2VQF I;  2BM1 A;  4DR6 E;  2R3V A;  4JI0 E;  1N0U A;  2X7I A;  2A2C A;  4DUY E;  4JI5 I;  1IBK E;  1Z0G A;  2UXB E;  3LNU A;  2UUC I;  4X64 I;  4DXL A;  1HNZ I;  4LF6 I;  1RRE A;  4DR2 E;  1FJG E;  4DR6 I;  2UXB I;  5IT9 Q;  4DR4 E;  2UU9 I;  1N33 I;  1HR0 I;  4JI4 I;  1XNQ E;  3ZZ0 A;  4X65 I;  1IBL I;  4K0K E;  1J5E I;  4LF7 E;  1XMO E;  3ZKD A;  4Z7Y A;  4USK A;  3LTO A;  1Z5C A;  2EFG A;  1NHH A;  1NHJ A;  5FLX C;  4B3S E;  3ZKB A;  1HR0 E;  4LF9 I;  2NPF A;  3V2U C;  3PYE A;  4PRX A;  2UXD I;  4JI8 E;  3T1Y E;  1S16 A;  3J80 Q;  1IBM E;  3D4J A;  4LF5 E;  3B8H A;  1EI1 A;  5LMU E;  4NXN E;  1XMQ E;  2V2V A;  1NZ0 A;  4YHH E;  4Z7C A;  4DR5 I;  4I3H A;  2X36 A;  4HY1 A;  4X66 I;  2VQF E;  4ZVI A;  2DEJ A;  2AJ4 A;  1ELO A;  1IBM I;  1S4E A;  4YY3 E;  5LMU I;  4DV4 I;  4X64 E;  5A2Q C;  1ZXN A;  4DR1 E;  1FI4 A;  4P7A A;  4OX9 E;  4DR7 E;  2V34 A;  1H73 A;  1U2R A;  4R1F A;  1HNX E;  3ZM7 A;  1N32 I;  3J81 C;  2HKJ A;  4HAC B;  4DV6 E;  3PYF A;  4JI0 I;  3M6A A;  2UXC E;  4DR1 I;  1A6F A;  1Z0C A;  1Z0W A;  4KHP E;  1IBK I;  1Z59 A;  2HFU A;  1H7U A;  1Z0V A;  3QT7 A;  1D6T A;  5GME A;  3HUL A;  1KKH A;  3K1J A;  4PU9 A;  1XHK A;  2E5L E;  1QZR A;  4JYA I;  5IWA I;  4JI7 E;  3H4L A;  4FWD A;  3ZZU A;  5LL6 R;  3Q1Q A;  1HNZ E;  1FKA E;  5IT9 C;  1N34 I;  4UT4 A;  4DPU A;  1XMQ I;  4KQV A;  3JAM Q;  4DR3 I;  4GKJ I;  4B3R I;  4K0K I;  1I94 E;  4JI2 E;  1WUU A;  1B63 A;  2HHH E;  4DV3 I;  4MYT A;  4DV7 E;  1N0V C;  2VQE I;  4LFA I;  5BR8 I;  4NXM E;  2ZM6 E;  2HK2 A;  2HFS A;  1J5E E;  1N34 E;  5FLX Q;  4GKK E;  4DR5 E;  4LF9 E;  3OTO E;  1HNW E;  4HYM A;  1ZM2 A;  4FN5 A;  4AQY E;  2UXC I;  4HXZ A;  4JI2 I;  2UUB E;  5L3J A;  4LFC E;  1UEK A;  4JI1 I;  2V8P A;  4LF5 I;  1N33 E;  3ZZT A;  2A2D A;  4HAC A;  1XNR E;  2V2Q A;  4LF8 E;  4FWG A;  1IBL E;  3WU6 A;  4WUB A;  2DEI A;  4LF4 I;  2F4V I;  3T1H E;  4NXN I;  4JI5 E;  3J7A G;  4DV1 E;  3PYD A;  1ZXM A;  4JI1 E;  4B3S I;  1HNX I;  1H74 A;  2Q2E B;  4DV4 E;  4DV0 E;  4WUC A;  4JI8 I;  4DR3 E;  1VIS A;  3PYG A;  2UUA E;  4DR2 I;  4UTG A;  4KHP I;  4PRV A;  2E5L I;  4DR7 I;  4JI3 I;  4DUZ E;  2OI2 A;  1DAR A;  4JV5 E;  5BR8 E;  4NXM I;  4DR4 I;  4YHH I;  1PKP A;  4JI6 I;  1XNQ I;  4LFB E;  5IWA E;  4X65 E;  4X66 E;  1PVG A;  4B3M I;  3WU4 A;  4DUY I;  2WW4 A;  1MG7 A;  4DV2 I;  4DV3 E; 
#chains in the Genus database with same CATH topology
 1ARO P;  2QTW A;  3F44 A;  3WC0 A;  5KT7 A;  2ZH5 A;  1UWB B;  1S6O A;  2HHW A;  1Z5A A;  4IRD A;  4X62 E;  3MFH A;  2FGC A;  1M5V C;  2WVC A;  1NHU A;  2OHD A;  2YNH A;  4M5G A;  3I31 A;  4TYB A;  5EX0 A;  4GO7 X;  5KFD A;  3T5L A;  4B3T J;  1TL7 B;  2OPR A;  5AXK A;  3SIP B;  2B8P A;  2PO0 B;  2Z2Y B;  3M2R B;  1F6T A;  1DQ8 A;  2XI2 A;  3V4I A;  2V2Z A;  2CGE A;  1RT1 A;  4CQ1 A;  4JYA E;  3CIZ A;  4DL2 A;  3M9O B;  3Q2S C;  4DN9 A;  4WKY A;  4U67 Q;  2VHG A;  4XTJ A;  4IZJ A;  1NBE B;  3MR5 A;  3T1Y I;  4JI7 I;  1HMV B;  2IJN A;  4WFZ A;  3K57 A;  4DL3 A;  2PD1 A;  4URQ U;  3FMW A;  1KLN A;  1EHW A;  5ETO A;  5E3A A;  4LF8 J;  1NHI A;  4DUT A;  5I42 A;  2QA2 A;  1JKH A;  1HBM B;  2LA4 A;  1PKU A;  3LP2 A;  3J80 U;  3SSS A;  2IM3 A;  1JLC A;  3VWS A;  3OTO F;  1HNZ J;  2PO2 B;  2UU9 E;  2FHJ A;  1IBC B;  2IFX A;  2M7S A;  4RW4 A;  1IWG A;  3OL6 A;  3Q23 A;  2BR0 A;  2DIV A;  3NG8 A;  3RBZ A;  1NK7 A;  5HK4 A;  3I0S B;  3CO9 A;  3R5J B;  2VG7 A;  4ED4 A;  3HHL A;  3ICL A;  3MTK A;  1RT2 B;  2WB1 D;  2K7K A;  4DG1 B;  4LFC I;  2GA7 A;  1FWL A;  1T0T V;  2J9E A;  2ZKT A;  3BM7 A;  2HG4 A;  3IMQ J;  4F67 A;  1FTR A;  2VAS A;  4ZP7 A;  3UD5 A;  4ZLP A;  3TAM B;  1NPR A;  2DIS A;  4OZ1 A;  3Q22 A;  4K4Y A;  2XUL A;  4EI2 A;  3PS2 A;  4IFD E;  2IHR 1;  3C6U B;  4X4T A;  2HGN A;  6FD1 A;  4LFA E;  1C0U B;  3JSM A;  2XY7 A;  4NLD A;  3D66 A;  3R5B A;  3GV8 B;  1BHN A;  2V94 A;  3PX4 A;  1PO6 A;  3LGN A;  4DV5 E;  2DB1 A;  2QLJ B;  3QT6 A;  4A46 A;  1PIE A;  2HK3 A;  4OHV A;  2CG8 A;  4RNM A;  3FGV A;  4O44 B;  2IM0 A;  2W7O A;  1HWK A;  2DT9 A;  1X4G A;  4E8U A;  1QM9 A;  3VAM A;  2KFZ A;  3BGF A;  1WD6 A;  1FTC A;  3M30 B;  2IBK A;  2JNJ A;  2RS8 A;  3BRE A;  1UW4 A;  1K0V A;  3U1Y A;  1RTJ B;  2CFX A;  1JJC B;  4OYI A;  3TVY A;  4DR6 F;  2VOP A;  3T1H I;  2IC3 B;  4WFA Q;  4KH0 B;  3QWP A;  3MMC B;  1S5Z A;  2CJQ A;  3IR6 B;  2DR6 A;  2H51 B;  2D1C A;  3HHL B;  3TWZ A;  5F0W A;  5HI7 A;  1S6P A;  2HPU A;  1OY8 A;  3QMQ A;  2KG0 A;  2ZJP Q;  1VBZ A;  5B0E A;  5F8L A;  2N7C A;  1MU5 A;  3DGP A;  1HI8 A;  3NEK A;  3R7S B;  3UW1 A;  2XMV A;  1DFD A;  4B3R E;  3VGV A;  1S49 A;  1VK3 A;  3NS5 A;  3BZQ A;  1TEL A;  1P9Y A;  4YR0 A;  2XY5 A;  4LF7 I;  3CNQ P;  1DTQ B;  3PM9 A;  4PG4 A;  2LXI A;  2UUC F;  2MZ1 A;  2LJP A;  4DLE A;  4MFB A;  4IZJ D;  3PFO A;  2FY8 A;  3I32 A;  3LF0 A;  5KT2 A;  3DLG A;  2V8H A;  3SZ2 A;  3C6T A;  3HT3 A;  3NWR A;  1PYT A;  3KG0 A;  3QWU A;  2VFT A;  1NJY A;  4DUY J;  4RW6 B;  2J7K A;  5KFL A;  2AWZ A;  2B8Q A;  1TKD A;  5J2P B;  4OYW A;  2QL7 B;  2HBR B;  1S1W B;  1AXQ A;  1FCA A;  3DOK A;  4XPE A;  2V9K A;  2UV8 A;  1CJU A;  2MPU A;  2KFN A;  1VMB A;  1ZOT A;  4B9L A;  3WU3 A;  1D6T A;  1UDN A;  4U3B A;  4HTI A;  4MAK A;  1HNW I;  1PBU A;  3D2W A;  2G13 A;  2BA9 A;  2O1T A;  4QU7 A;  2LU2 A;  2ZNY A;  4FNI A;  3OUY B;  3RRG A;  4DSI A;  4JI6 F;  3DLE A;  4NL5 A;  1U24 A;  3MEC A;  4NLR A;  4DFM A;  5HQ8 A;  1X9S A;  2E9Z A;  2ZD1 A;  1BKN A;  1FDD A;  1FWK A;  2F8H A;  4DZ6 A;  1DHM A;  1TL1 A;  2C3P A;  2MY8 A;  2UUB I;  3IRX B;  2HMI A;  3R2D J;  5ETL A;  1U6Z A;  4H4O B;  2BE7 D;  1S57 A;  2V67 A;  4DEZ A;  5D78 A;  2N3O A;  2R8J A;  4CLU A;  4Y2A A;  4L73 A;  3UCG A;  4B3S J;  3LGH A;  4P72 A;  2PC6 A;  5IXU A;  2C37 B;  1UVM A;  3KK2 B;  4K59 A;  3D1Q A;  3SFU A;  1ZPW X;  4WBF A;  1AUD A;  2DPJ A;  3CWV A;  3SV4 A;  1WNE A;  1Q81 T;  4RW9 B;  1R8B A;  3NCR A;  5KFI A;  3GIK A;  1OQ6 A;  2HAF A;  1L3U A;  4OI3 A;  2YKQ A;  3MWB A;  3JAM U;  4CTA B;  2C2Z B;  5F8G A;  4K0K J;  3DRR B;  1D8Y A;  3V5R A;  2H5J B;  4GKJ J;  4B3R J;  4RNF A;  2ASY A;  1OSD A;  3GTY X;  5EWF A;  4DV7 I;  1WTF A;  2KN4 A;  3H2V E;  3H5Y A;  1RIS A;  3T19 A;  2XSJ B;  3QGI A;  1HBN B;  4Q7A A;  2RB7 A;  4QOT A;  1P8G A;  2EK6 A;  1H2V Z;  5HQL A;  3QRQ A;  2PNL A;  5T41 A;  2ZWO A;  1S76 D;  3A12 A;  2UXD E;  5EUH A;  2BAB A;  3F41 A;  4USU A;  2CYY A;  2X1F A;  3N4W A;  1ULR A;  4KE5 A;  4JI4 F;  5HO4 A;  1K44 A;  1FD2 A;  5KT3 A;  2VQE I;  4PRF A;  1R0A A;  3WZ0 A;  4YY3 J;  1EP4 A;  3S6E A;  4BWJ A;  3PRB A;  4GRS A;  1T02 A;  1X8D A;  3A3O B;  4HT7 A;  3CWJ A;  1C1C A;  2JEF A;  4O4G B;  2CQD A;  2XO7 A;  1JNZ B;  2NZC A;  1SKW A;  2M5Y A;  1V3Z A;  2KT2 A;  4MT1 A;  2XLI A;  1OYD A;  4DUZ I;  5K20 B;  3SFG A;  5AJ3 F;  4LFA F;  4AQY I;  2WHO A;  3MM9 A;  4NWB A;  1ZM3 A;  1DLO B;  2FHO B;  2HS0 A;  1GTE A;  3NKY A;  1PJ6 A;  2J8S A;  3OR1 B;  1SB6 A;  3DRY A;  4F4K A;  4Y65 A;  3KMQ A;  3CCQ S;  2OPS B;  3A1Y G;  1X0F A;  3L3C A;  4J37 A;  2E5J A;  2H9Z A;  1LWC B;  2VBZ A;  4PPD A;  1UA1 A;  3QPI A;  4KV8 A;  2Q43 A;  4O0N A;  1CG2 A;  3DLG B;  2BW7 A;  2Y9H A;  1AYE A;  4NAS A;  1X9W A;  1KLM A;  2X1A A;  4DR6 E;  2DRA A;  1G3O A;  2ZBP A;  1J5O B;  2QG9 B;  4LCG A;  1Q16 B;  1KFS A;  3N28 A;  2W2Q P;  4ZJQ A;  2GQC A;  1W2B R;  4Y0F A;  1SJ3 P;  1HI0 P;  1IBK E;  3X3U A;  4C4W A;  2G0J A;  1HK7 A;  1Z0G A;  4OO1 B;  3FNN A;  3K5P A;  1U6F A;  3MR3 A;  3BJY A;  3R8Y A;  1S12 A;  3SCK E;  1WAC A;  3I87 A;  4DUY F;  2WZ1 A;  2UUC I;  2H48 B;  1KOH A;  5D8H B;  4NA2 A;  6FDR A;  2HIY A;  3LWM A;  2FVS A;  4W98 A;  2VJV A;  4DXL A;  1V9O A;  3BF4 A;  2YX7 A;  5D3G B;  1HNZ I;  2G0I A;  1V3R A;  5KFP A;  2Z5B A;  2LQ9 A;  3D9B A;  3AB4 B;  5EWE A;  4CH1 A;  3EPG A;  4DR2 E;  1SQG A;  1NCL A;  2ZBR A;  3A8K A;  2PA3 A;  3H0P A;  1UPM B;  2GHP A;  2FJA B;  1FRM A;  1L3T A;  2UUA E;  3C66 A;  3KJQ B;  4EO8 A;  2E1M C;  4O3N A;  5DGB A;  2QA4 S;  2AKW B;  4DUZ J;  3G82 A;  3NCP A;  2BJE A;  1VRU B;  1FK9 A;  2KKH A;  3KKF A;  2WNR A;  1KOO A;  1RYR A;  2UXB I;  3GFY A;  5CYQ B;  2NXE A;  2DNO A;  3HP6 A;  3KK3 A;  5L1I A;  5DRQ A;  1RK8 A;  2DNK A;  4YQW A;  2ZH7 A;  2RE1 A;  1FEE A;  1WC5 A;  1FA0 A;  3T9Z A;  4M94 A;  4QYZ J;  4MU1 A;  1VIO A;  3MM9 B;  4OO1 A;  5F3T A;  5GAH U;  3K7R A;  4MK8 A;  2C3Y A;  3TZX A;  1RI7 A;  2DNZ A;  2DH7 A;  3BGL A;  3VGS A;  2YH1 A;  4CO4 A;  3BQ2 A;  1VI7 A;  1D0E A;  3BGR B;  3WDO A;  1XMO J;  1MWQ A;  4C3L A;  4USI A;  2E29 A;  4K0K F;  4IDK A;  2UUA J;  3L95 X;  2BOP A;  4ZCL A;  4F2R A;  2JFK A;  2YH0 A;  5K36 D;  1LXJ A;  2POK A;  3RG6 A;  3VF0 B;  3R5C A;  1RA7 A;  2W7A A;  2VQF J;  3CCR S;  3KLG A;  2DR9 A;  2V8D A;  3G87 A;  3ZKB A;  2RDJ A;  3W65 A;  4QIV A;  3EX7 B;  4FXW A;  1NJZ A;  3G96 A;  3OTE A;  4C8K A;  5A8K B;  2NPF A;  4N56 A;  1HR0 E;  2RIL A;  3K0J A;  1USV A;  3JAM Y;  3PYE A;  1LV5 A;  3ZC4 A;  4A4J A;  4ZLL A;  2FY1 A;  5DLF A;  1KBR A;  2UUW A;  2X51 A;  2KB2 A;  2UV8 G;  3WBZ A;  5DDQ C;  5K8P A;  5KT6 A;  2ZH4 A;  2HBY B;  3GYG A;  1YG0 A;  5CQG A;  1PYS B;  4JI8 F;  2HEK A;  2QFJ A;  5H9E K;  1U1P A;  4DF8 A;  4LF5 F;  2K06 A;  3R2C J;  4ECW A;  1RT6 B;  1T11 A;  2XCP A;  3T1Y F;  2JEI A;  3J80 Q;  2D69 A;  1EZZ B;  4LSZ B;  4ETX A;  1IBM E;  3D4J A;  5EX3 A;  2UXD F;  1RUS A;  2KRR A;  4NLX A;  2JZ5 A;  3HZG A;  4JBC A;  4NI2 A;  5BYS A;  3CCU S;  4QIE A;  2AD9 A;  4RBT A;  2JL9 A;  1XMQ E;  1NJW A;  1TVR A;  2JEJ A;  4OV1 A;  2PMZ D;  2VIC A;  4PQU A;  1NZ0 A;  5K36 C;  4Z7C A;  4QIG A;  4ZPD A;  3KJN B;  4QPT A;  3GR0 A;  5HMW A;  3PKY A;  4TY8 A;  3N5B A;  4KR0 B;  2I6W A;  3R7B B;  2ZE2 A;  4DR5 F;  4I3H A;  1YLX A;  4HY1 A;  1OPI A;  4OZN A;  5KT5 A;  3J81 j;  3BKT A;  3MEE A;  3OUY A;  4DV3 J;  4KFB B;  3VTI A;  2F8E X;  3P45 B;  4M8L A;  2PFF B;  1VQL S;  1UTA A;  3L7Z B;  2AJ4 A;  1IR0 A;  4M63 A;  1TL3 B;  4Y2C A;  3UFC X;  1S48 A;  3QID A;  3M2V B;  5ITH A;  2XHC A;  1WF0 A;  3J7Y U;  3JYT B;  4FS1 A;  1S4E A;  4JV1 A;  4YY3 E;  1BXN A;  4H4K A;  1JLQ A;  5J2M A;  5LMU I;  2CVI A;  3KLH A;  5A2Q Y;  5FDL A;  1NND A;  2EPI A;  1N33 F;  5C2C A;  4RNO A;  2WBR A;  7FDR A;  2J9D A;  3QIP B;  1RTH B;  1X5O A;  2CJB A;  1UEV A;  2G1D A;  3GWC A;  1TUV A;  4MU4 A;  3BR8 A;  5DQH A;  1LWX A;  3GFZ A;  4OX9 E;  2PSZ A;  4C8M A;  2BX6 A;  4KSE B;  1UJ5 A;  1YIJ S;  1WC3 A;  2IPO B;  1FE0 A;  1IR1 A;  1SUQ B;  1P27 B;  2V34 A;  4NA3 A;  4CNZ A;  3T1H J;  2UXB J;  3H40 A;  3MR7 A;  2DR8 A;  2PT0 A;  4P2S A;  3RB6 A;  3CMQ A;  3LP1 B;  4ECR A;  3NGT A;  3MUV P;  1Y6Z A;  1ZAV A;  2Z2L A;  3UDC A;  1C0T A;  2WBM A;  3FKB A;  2IVF B;  1P1L A;  2FQQ B;  4DR2 F;  4OI0 A;  1EKR A;  3QFW A;  3HF5 A;  4IG0 B;  4D3H A;  5AXN A;  1PC5 A;  2ZHA A;  2FJB B;  2KXN B;  3HZE A;  4J5O A;  1KQS R;  2WVE A;  3WHI A;  4PG5 A;  3OR2 B;  4HAC B;  2KHD A;  4ID8 A;  4OX6 A;  1HNX F;  2FLN A;  2I9S A;  3PYF A;  3PW5 A;  2GO8 A;  2WB4 A;  2NN6 D;  2ACY A;  3HSZ A;  4C8O A;  2PMH A;  2L9W A;  2N4D A;  3AFG A;  2XMA A;  4DR3 F;  3M6A A;  2G4B A;  3OQ2 A;  2FYX A;  3B6B A;  2HFZ A;  4H4K C;  3QSY B;  1N36 J;  1Z0C A;  1JJ4 A;  3MED A;  3MOJ B;  1CJV A;  3PY8 A;  1WSR A;  2MKJ A;  4YHH J;  4OX7 A;  2WRM A;  1FRK A;  2ZC3 A;  3MED B;  3KUE A;  3M2U A;  3T5H A;  4IH6 A;  2XCA A;  1Y7P A;  2RML A;  3N5F A;  2R2T A;  2E5L F;  2YKP A;  5JVG Q;  4WZM A;  1SH0 A;  5F8N A;  3OXF A;  2GAG C;  1U0H A;  5DG8 A;  1E6Y B;  4JI7 F;  1GX6 A;  1XHK A;  2YX1 A;  4LPF A;  2VV5 A;  2GJI A;  4YFU A;  4JI4 J;  4JYA I;  4QWD A;  1I5O B;  1R7I A;  1UCN A;  2PN6 A;  2RT3 A;  5HAT A;  1S97 A;  1N54 B;  1SIZ A;  3KLV A;  4P2M A;  4A47 A;  4V19 J;  4DBQ A;  2OPS A;  2VBY A;  4P2F A;  4J9N A;  5HLF B;  3MM8 A;  4Y00 A;  2NN6 A;  3Q1Q A;  1VQ4 S;  2MKH A;  1SVD A;  3MPV A;  1YVF A;  2HHT A;  1SUQ A;  1YDL A;  2BMB A;  4FYY B;  3TRG A;  1F1B B;  4UQG A;  2KM8 C;  3VAH A;  2BJ3 A;  3A13 A;  4ELT A;  1TL7 A;  2GO4 A;  3GME A;  4IFD C;  3Q6M A;  2IYI A;  1HI1 A;  2R2S A;  3RUB L;  3O1L A;  2VG7 B;  4DPU A;  1XMQ I;  2B6A A;  2OPP A;  3AOB A;  3SXL A;  2FJV A;  3P6Y C;  2AYB A;  2M2B A;  1NSA A;  2V50 A;  2F8M A;  1UDO A;  2M8H A;  1KC8 T;  4O3R A;  4MK9 A;  2VG6 A;  1IBM F;  1RJJ A;  1R43 A;  3GB0 A;  4FF2 A;  2CRL A;  2BBE A;  5DZ7 A;  2GNK A;  2B7B B;  3RZA A;  2HHH E;  4FDF A;  5CCM A;  3MPD A;  2LDI A;  1RAD B;  1HR0 J;  1UMJ A;  2HUR A;  1OO0