2UXBI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxbI00
1I94I 4X64E 4LF7E 3HULA 1ZM2A 2UXDE 1PVGA 2V2QA 4XTJA 4LF7I 2HKJA 2UXDI 2XEXA 4DPUA 4Z7YA 4DV4E 4NXNE 4DV4I 4ZVIA 2J7KA 2HK3A 1RR9A 4I3HA 4LF8I 1H7SA 4MYTA 4FN5A 2F4VE 1KVKA 2HKEA 2F4VI 3ZZ0A 3T1HI 2UXCE 1BKNA 1MU5A 4JI6E 2EFGA 1NZ0A 2GS8A 4X66E 1ZM9A 5FLXC 3PYFA 4JYAE 4X66I 1Z5BA 1Z0CA 1ZM4A 4NXME 1Z0TA 4Z7CA 3QT7A 3WU4A 4DUZE 1XNRE 5IT9Q 2V2VA 1VISA 4R1FA 1QZRA 2HHHE 4DUZI 1NHIA 4DV5E 4P7AA 1XNRI 1H74A 3T1YI 4DV5I 4LF6E 2R42A 4DR5E 3OTOI 1IBME 4ED4A 4LF6I 4DR4E 4DR5I 1IBMI 4DXLA 5IT9C 3QT6A 1MX0A 3J7AG 1Z0EA 4JG4A 3ZZUA 1HNZE 3H4LA 2V2ZA 2V8PA 2E5LE 1HNZI 3CWVA 2VQFI 4LFCE 4LFCI 2OI2A 3PYEA 1N0UA 1EA6A 1Z0BA 1WUUA 4DPXA 3ZZTA 4LF9E 5BR8E 2HFUA 1XHKA 1J5EE 2WW4A 1N36E 3LNUA 1ELOA 3V5RA 4LF9I 5BR8I 4LFAI 4DV6I 2ZBKB 4DV7I 4UTGA 4LFBE 4GKJI 4DR3E 1KTVA 4DR3I 5L3JA 4RPFA 1FWLA 4X64I 1NHJA 4JI8E 4OX9E 4JI8I 3B82A 3B78A 1ZXMA 4OX9I 3WU3A 4NXNI 4YY3E 4DPTA 1H72C 4YY3I 4DV1E 4JV5E 3JAMQ 2LJPA 4DV1I 3K17A 4JV5I 4DR1E 4PU9A 1ZXNA 4DR1I 1PIEA 1B63A 2AJ4A 2BM1A 3K1JA 4JI7E 3QT5A 2UXCI 4JI7I 4DPYA 4JI6I 3JAMC 2HK2A 1HNXE 3J81Q 1HNXI 1NHHA 4JYAI 4EMDA 4NXMI 1K47A 2A2DA 2UUCE 1N32E 4JI3E 2UUCI 1N32I 2HHHI 4JI3I 1B62A 4GKKE 4KHPE 1EI1A 4B3TE 1MG7A 4GKKI 4KHPI 4AQYE 4DR4I 1Z5AA 3Q1QA 3WU6A 1FWKA 4AQYI 1RREA 5LL6R 1XNQE 2R3VA 1IBKE 4WUDA 4JI4E 1DARA 3J80Q 1IBKI 2E5LI 5GMDA 4JI4I 3ZKDA 3ZKBA 2NPFA 4WUBA 1FNMA 4JI0E 4B3RE 5GMEA 4HACB 2CZ9A 4JI0I 4B3RI 4FWGA 4DR6E 4HY1A 2UUBE 4P52A 4DR6I 1S4EA 3B8HA 4DV3E 1J5EI 2X36A 1N36I 4DV3I 2UUAE 1HNWE 4LF4E 1HNWI 3QT8A 4YHHE 4LFBI 2BV3A 4B3ME 4LF4I 4YHHI 5LMNE 4DR7E 4B3MI 1N34E 4JI1E 5LMNI 4DR7I 3LPSA 1N34I 1Z0VA 4B3SE 1D6TA 1Z0WA 4UT4A 2A2CA 4B3SI 4K0KE 2HFSA 3WU5A 4DV0E 4PRVA 1KIJA 1I94E 1Z5CA 1FJGE 1FJGI 4FWHA 4DUYE 1FKAE 3GONA 1FI4A 4FWDA 5LMUE 4DUYI 1XMQE 1H73A 5IWAE 4LF8E 3M6AA 2X7IA 5LMUI 1XMQI 5IWAI 4HYMA 1Z0GA 5FLXQ 4X65E 1HR0E 3T1HE 4X65I 1HR0I 1OJ4A 2V34A 2E1RA 4DU7A 2ZM6E 3J81C 2ZM6I 4JI5E 4JI5I 4USKA 4HXZA 4KQVA 4B3TI 4PRXA 3D4JA 3PYDA 3LTOA 3T1YE 2VF3A 4MYUA 3OTOE 1XNQI 2UU9E 1UEKA 1N0VC 1XMOE 2UU9I 1XMOI 1IBLE 3V2UC 4DV2E 1IBLI 1S16A 5A2QQ 1A6FA 1ZM3A 3J80C 2VQEE 2VQFE 4DV2I 4USMA 2VQEI 3ZM7A 1N33E 2UXBE 1U2RA 2UUBI 4DU8A 4JI2E 1N33I 2UXBI 4M1KA 4DPWA 5A2QC 4JI2I 1Z59A 2UUAI 3PYGA 4X62E 2DEJA 4X62I 4URLA 4LFAE 4DV6E 2ZITA 2DEIA 2Q2EB 3F0NA 4FW9A 1PKPA 4DV7E 4JI1I 2BM0A 4GKJE 4WUCA 4LF5E 1H7UA 4DR2E 4K0KI 4LF5I 1KKHA 3J7AM 4HACA 4DR2I 4DV0I
chains in the Genus database with same CATH superfamily
4MU0A 1I94I 4BA2A 4X64E 2IESA 4LF7E 2JE6A 3P06A 3HULA 4OZEA 1ZM2A 2UXDE 1PVGA 4MU3A 2PO2B 2V2QA 4XTJA 4LF7I 2HKJA 2C37B 2UXDI 2XEXA 4DPUA 4Z7YA 4DV4E 4NXNE 3M7ND 5EL9A 2Z5CB 4DV4I 4ZVIA 2J7KA 2HK3A 1RR9A 4I3HA 4LF8I 1H7SA 4LCFA 4MYTA 2O3ZA 4FN5A 2CVEA 2F4VE 1KVKA 2HKEA 2JEAA 2F4VI 2C39A 4IZJB 3ZZ0A 5K36B 4N3OA 3T1HI 2UXCE 4QNKA 1BKNA 4OO1C 1MU5A 4JI6E 2NN6A 2GO4A 2WP8A 4IFDD 2EFGA 4MQYA 3P3EA 1NZ0A 2GS8A 5C0XA 4X66E 1ZM9A 5FLXC 3PYFA 4JYAE 4LCGA 4X66I 1Z5BA 2NN6D 1Z0CA 1ZM4A 2O1WA 4NXME 1Z0TA 4Z7CA 3P3GA 5C0XF 3QT7A 1Y5YA 3WU4A 4DUZE 1XNRE 5IT9Q 2V2VA 1VISA 4R1FA 2IOQA 5JEAB 1QZRA 4DV5E 4DUZI 1NHIA 3U1YA 4P7AA 2HHHE 1XNRI 1H74A 3T1YI 4DV5I 4LF6E 2R42A 4DR5E 3OTOI 1IBME 4ED4A 4LF6I 2BA1D 4DR4E 4DR5I 1IBMI 4DXLA 5IT9C 4IFDC 3QT6A 1MX0A 3J7AG 1Z0EA 4QNJA 4JG4A 3ZZUA 5FWKA 1HNZE 3H4LA 2V2ZA 2V8PA 2E5LE 1HNZI 2AE8A 3CWVA 2VQFI 4LFCE 1UDSA 4FW5A 5K36E 4LFCI 2OI2A 4FW3A 3PYEA 2PO1B 1N0UA 1EA6A 3GCMA 3M7NG 2Z5EA 1Z0BA 1WUUA 5K36C 3Q6NA 3K85A 4DPXA 3ZZTA 2JE6B 5BR8E 2HFUA 4LF9E 1XHKA 1J5EE 1OYPA 2WW4A 1N36E 3LNUA 1ELOA 2BA0G 3V5RA 5BR8I 4LF9I 4DV6I 4LFAI 3KRNA 2ZBKB 5DRRA 2PO0A 5JEAE 4DV7I 4UTGA 4LOMA 4LFBE 4GKJI 4DR3E 3PS3A 1KTVA 4DR3I 5L3JA 5JEAC 2JT2A 4RPFA 1FWLA 4IFDB 2C38A 4X64I 2JEAB 1NHJA 3L7ZB 4JI8E 4OX9E 2J65A 4JI8I 3B82A 3B78A 1ZXMA 1UDNA 4OX9I 3WU3A 2NN6B 2WP8B 4NXNI 1P42A 2CG9A 4YY3E 4DPTA 1E3PA 1H72C 4YY3I 4OO1E 4DV1E 4JV5E 4AIDA 2BA0D 3JAMQ 2LJPA 4DV1I 2BA1G 3K17A 3P3CA 4PU9A 4DR1E 4JV5I 1ZXNA 4DR1I 1PIEA 1B63A 2AJ4A 2WNRB 2BM1A 3K1JA 4JI7E 4FW7A 2O1TA 3QT5A 2UXCI 4JI7I 4DPYA 4JI6I 3JAMC 2HK2A 1HNXE 1Y4SA 3HJCA 3J81Q 1HNXI 1NHHA 4JYAI 1USUA 4EMDA 1UDQA 5C0XD 4IS9A 1Y60A 4NXMI 1K47A 2C37A 2A2DA 3M85D 2UUCE 2Z5CA 1N32E 5ELWA 4JI3E 4IFDE 4MU4A 2PNZA 3U1KA 2UUCI 1N32I 4AIMA 2HHHI 4JI3I 2IERA 1B62A 4GKKE 4KHPE 1EI1A 4LCHA 1XXEA 4B3TE 2NN6E 1MG7A 1YH8A 4GKKI 4KHPI 3P76A 4AQYE 2VESA 4DR4I 1Z5AA 3Q1QA 3WU6A 1FWKA 4IZJA 4AQYI 1RREA 3H1CA 5LL6R 2PNLA 1XNQE 2R3VA 2NN6C 1IBKE 1E3HA 4MDTA 4WUDA 4U3DA 4JI4E 1DARA 3Q6MA 3J80Q 1IBKI 2E5LI 5GMDA 5C0XC 3PS1A 4JI4I 2PO0B 4J3DA 3ZKDA 3ZKBA 4IZKA 1VI7A 2NPFA 4WUBA 3CDIA 1FNMA 4JI0E 4B3RE 5DRPA 5GMEA 3B4TA 4HACB 2CZ9A 4JI0I 4B3RI 2Z5BA 4FWGA 4BA2B 4AM3A 4DR6E 4HY1A 2UUBE 4P52A 4DR6I 1S4EA 1RHYA 2F1DA 3B8HA 4DV3E 1J5EI 1HK7A 2X36A 5JEAF 1N36I 2GQ0A 4DV3I 2UUAE 1HNWE 4LF4E 2CGEA 1HNWI 2JEBA 3QT8A 4YHHE 4LFBI 2BV3A 4B3ME 4LF4I 4YHHI 5LMNE 4DR7E 4B3MI 1N34E 4JI1E 5LMNI 4DR7I 5DNXA 3LPSA 1N34I 5DRQA 1Z0VA 4B3SE 1D6TA 1Z0WA 2BR2A 1YHCA 4UT4A 1OYRA 2A2CA 2C39B 3HKMA 4B3SI 5DROA 4K0KE 4OO1A 2HFSA 2PO1A 3WU5A 3M85G 4DV0E 4BA1A 4PRVA 5DNLA 2PNMA 1KIJA 1I94E 1Z5CA 5C0XB 4OO1D 3NZKA 4OO1F 2IOPA 1FJGE 1FJGI 2O1VA 4FWHA 4DUYE 1FKAE 3GONA 1FI4A 4FWDA 5LMUE 4DUYI 1XMQE 1H73A 5IWAE 4LF8E 2PNZB 3M6AA 2X7IA 5LMUI 1XMQI 5IWAI 4ISAA 4HYMA 4GQUA 1Z0GA 1OYSA 3UHMA 5FLXQ 4X65E 4IFDA 1UDOA 2PO2A 1HR0E 3T1HE 3L7ZA 4X65I 1HR0I 1OJ4A 2V34A 2E1RA 3PS2A 4DU7A 2ZM6E 2O1UA 4IFDF 3J81C 2ZM6I 4JI5E 4JI5I 2NN6F 4USKA 4IZKB 4HXZA 4KQVA 1Y4UA 4B3TI 4PRXA 3D4JA 5C0XE 3PYDA 4NBQA 3LTOA 3GMEA 5K36A 2WNRA 3T1YE 2Z5BB 2VF3A 4MYUA 3OTOE 1XNQI 2UU9E 1UEKA 4IZJD 5K36D 5K36F 1N0VC 1XMOE 2UU9I 3PRYA 4LPFA 5EKWA 1XMOI 1IBLE 3V2UC 2JEBB 4DV2E 1IBLI 1S16A 5A2QQ 1A6FA 1ZM3A 3J80C 2VQEE 2VQFE 4DV2I 5JEAA 4USMA 4OKGA 2VQEI 2C38B 3ZM7A 4FW6A 2GO3A 4U3BA 2BR2B 1N33E 2UXBE 1U2RA 2UUBI 4DU8A 5JEAD 4JI2E 1N33I 2UXBI 4M1KA 4OO1B 4DPWA 5A2QC 3DD6A 4JI2I 1Z59A 4BA1B 2UUAI 4DV0I 4FW4A 1USVA 3PYGA 4X62E 2DEJA 1Y6ZA 4X62I 4URLA 4LFAE 4DV6E 2ZITA 2DEIA 2Q2EB 1R6LA 3F0NA 4FW9A 1PKPA 4DV7E 4JI1I 2BM0A 4GKJE 4WUCA 4LF5E 3GLLA 1H7UA 4MU1A 4DR2E 4K0KI 4LF5I 1KKHA 3CDJA 3J7AM 1R6MA 4DR2I 4HACA
chains in the Genus database with same CATH topology
1I94I 4X64E 4LF7E 3P06A 3HULA 1ZM2A 2UXDE 1PVGA 2V2QA 4XTJA 4LF7I 2HKJA 2UXDI 2XEXA 4DPUA 4Z7YA 4DV4E 4NXNE 2Z5CB 4DV4I 4ZVIA 2J7KA 2HK3A 1RR9A 4I3HA 4LF8I 1H7SA 4MYTA 4FN5A 2F4VE 1KVKA 2HKEA 2F4VI 4IZJB 3ZZ0A 4N3OA 3T1HI 2UXCE 1BKNA 1MU5A 4JI6E 2EFGA 1NZ0A 2GS8A 4X66E 1ZM9A 5FLXC 3PYFA 4JYAE 4X66I 1Z5BA 1Z0CA 1ZM4A 2O1WA 4NXME 1Z0TA 4Z7CA 3QT7A 3WU4A 4DUZE 1XNRE 5IT9Q 2V2VA 1VISA 4R1FA 2IOQA 1QZRA 4DV5E 4DUZI 1NHIA 2HHHE 4P7AA 1XNRI 1H74A 3T1YI 4DV5I 4LF6E 2R42A 4DR5E 3OTOI 1IBME 4ED4A 4LF6I 4DR4E 4DR5I 1IBMI 4DXLA 5IT9C 3QT6A 1MX0A 3J7AG 1Z0EA 4JG4A 3ZZUA 5FWKA 1HNZE 3H4LA 2V2ZA 2V8PA 2E5LE 1HNZI 3CWVA 2VQFI 4LFCE 4LFCI 2OI2A 3PYEA 1N0UA 1EA6A 2Z5EA 1Z0BA 1WUUA 3Q6NA 3K85A 4DPXA 3ZZTA 4LF9E 5BR8E 2HFUA 1XHKA 1J5EE 2WW4A 1N36E 3LNUA 1ELOA 3V5RA 4LF9I 5BR8I 4LFAI 4DV6I 2ZBKB 4DV7I 4UTGA 4LFBE 4GKJI 4DR3E 1KTVA 4DR3I 5L3JA 4RPFA 1FWLA 4X64I 1NHJA 4JI8E 4OX9E 4JI8I 3B82A 3B78A 1ZXMA 4OX9I 3WU3A 4NXNI 2CG9A 4YY3E 4DPTA 1H72C 4YY3I 4DV1E 4JV5E 3JAMQ 2LJPA 4DV1I 3K17A 4JV5I 4DR1E 4PU9A 1ZXNA 4DR1I 1PIEA 1B63A 2AJ4A 2BM1A 3K1JA 4JI7E 2O1TA 3QT5A 2UXCI 4JI7I 4DPYA 4JI6I 3JAMC 2HK2A 1HNXE 1Y4SA 3HJCA 3J81Q 1HNXI 1NHHA 4JYAI 1USUA 4EMDA 4NXMI 1K47A 2A2DA 2UUCE 2Z5CA 1N32E 4JI3E 2UUCI 1N32I 2HHHI 4JI3I 1B62A 4GKKE 4KHPE 1EI1A 4B3TE 1MG7A 4GKKI 4KHPI 4AQYE 4DR4I 1Z5AA 3Q1QA 3WU6A 1FWKA 4IZJA 4AQYI 1RREA 5LL6R 2PNLA 1XNQE 2R3VA 1IBKE 4WUDA 4JI4E 1DARA 3Q6MA 3J80Q 1IBKI 2E5LI 5GMDA 4JI4I 3ZKDA 3ZKBA 4IZKA 2NPFA 4WUBA 1FNMA 4JI0E 4B3RE 5GMEA 4HACB 2CZ9A 4JI0I 4B3RI 2Z5BA 4FWGA 4DR6E 4HY1A 2UUBE 4P52A 4DR6I 1S4EA 3B8HA 4DV3E 1J5EI 1HK7A 2X36A 1N36I 2GQ0A 4DV3I 2UUAE 1HNWE 4LF4E 2CGEA 1HNWI 3QT8A 4YHHE 4LFBI 2BV3A 4B3ME 4LF4I 4YHHI 5LMNE 4DR7E 4B3MI 1N34E 4JI1E 5LMNI 4DR7I 3LPSA 1N34I 1Z0VA 4B3SE 1D6TA 1Z0WA 4UT4A 2A2CA 4B3SI 4K0KE 2HFSA 3WU5A 4DV0E 4PRVA 2PNMA 1KIJA 1I94E 1Z5CA 2IOPA 1FJGE 1FJGI 2O1VA 4FWHA 4DUYE 1FKAE 3GONA 1FI4A 4FWDA 5LMUE 4DUYI 1XMQE 1H73A 5IWAE 4LF8E 3M6AA 2X7IA 5LMUI 1XMQI 5IWAI 4HYMA 1Z0GA 5FLXQ 4X65E 1HR0E 3T1HE 4X65I 1HR0I 1OJ4A 2V34A 2E1RA 4DU7A 2ZM6E 2O1UA 3J81C 2ZM6I 4JI5E 4JI5I 4USKA 4IZKB 4HXZA 4KQVA 1Y4UA 4B3TI 4PRXA 3D4JA 3PYDA 3LTOA 3T1YE 2Z5BB 2VF3A 4MYUA 3OTOE 1XNQI 2UU9E 1UEKA 4IZJD 1N0VC 1XMOE 2UU9I 3PRYA 1XMOI 1IBLE 3V2UC 4DV2E 1IBLI 1S16A 5A2QQ 1A6FA 1ZM3A 3J80C 2VQEE 2VQFE 4DV2I 4USMA 2VQEI 3ZM7A 1N33E 2UXBE 1U2RA 2UUBI 4DU8A 4JI2E 1N33I 2UXBI 4M1KA 4DPWA 5A2QC 4JI2I 1Z59A 2UUAI 1USVA 3PYGA 4X62E 2DEJA 1Y6ZA 4X62I 4URLA 4LFAE 4DV6E 2ZITA 2DEIA 2Q2EB 3F0NA 4FW9A 1PKPA 4DV7E 4JI1I 2BM0A 4GKJE 4WUCA 4LF5E 1H7UA 4DR2E 4K0KI 4LF5I 1KKHA 3J7AM 4HACA 4DR2I 4DV0I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 I;  4X64 E;  4LF7 E;  3HUL A;  1ZM2 A;  2UXD E;  1PVG A;  2V2Q A;  4XTJ A;  4LF7 I;  2HKJ A;  2UXD I;  2XEX A;  4DPU A;  4Z7Y A;  4DV4 E;  4NXN E;  4DV4 I;  4ZVI A;  2J7K A;  2HK3 A;  1RR9 A;  4I3H A;  4LF8 I;  1H7S A;  4MYT A;  4FN5 A;  2F4V E;  1KVK A;  2HKE A;  2F4V I;  3ZZ0 A;  3T1H I;  2UXC E;  1BKN A;  1MU5 A;  4JI6 E;  2EFG A;  1NZ0 A;  2GS8 A;  4X66 E;  1ZM9 A;  5FLX C;  3PYF A;  4JYA E;  4X66 I;  1Z5B A;  1Z0C A;  1ZM4 A;  4NXM E;  1Z0T A;  4Z7C A;  3QT7 A;  3WU4 A;  4DUZ E;  1XNR E;  5IT9 Q;  2V2V A;  1VIS A;  4R1F A;  1QZR A;  2HHH E;  4DUZ I;  1NHI A;  4DV5 E;  4P7A A;  1XNR I;  1H74 A;  3T1Y I;  4DV5 I;  4LF6 E;  2R42 A;  4DR5 E;  3OTO I;  1IBM E;  4ED4 A;  4LF6 I;  4DR4 E;  4DR5 I;  1IBM I;  4DXL A;  5IT9 C;  3QT6 A;  1MX0 A;  3J7A G;  1Z0E A;  4JG4 A;  3ZZU A;  1HNZ E;  3H4L A;  2V2Z A;  2V8P A;  2E5L E;  1HNZ I;  3CWV A;  2VQF I;  4LFC E;  4LFC I;  2OI2 A;  3PYE A;  1N0U A;  1EA6 A;  1Z0B A;  1WUU A;  4DPX A;  3ZZT A;  4LF9 E;  5BR8 E;  2HFU A;  1XHK A;  1J5E E;  2WW4 A;  1N36 E;  3LNU A;  1ELO A;  3V5R A;  4LF9 I;  5BR8 I;  4LFA I;  4DV6 I;  2ZBK B;  4DV7 I;  4UTG A;  4LFB E;  4GKJ I;  4DR3 E;  1KTV A;  4DR3 I;  5L3J A;  4RPF A;  1FWL A;  4X64 I;  1NHJ A;  4JI8 E;  4OX9 E;  4JI8 I;  3B82 A;  3B78 A;  1ZXM A;  4OX9 I;  3WU3 A;  4NXN I;  4YY3 E;  4DPT A;  1H72 C;  4YY3 I;  4DV1 E;  4JV5 E;  3JAM Q;  2LJP A;  4DV1 I;  3K17 A;  4JV5 I;  4DR1 E;  4PU9 A;  1ZXN A;  4DR1 I;  1PIE A;  1B63 A;  2AJ4 A;  2BM1 A;  3K1J A;  4JI7 E;  3QT5 A;  2UXC I;  4JI7 I;  4DPY A;  4JI6 I;  3JAM C;  2HK2 A;  1HNX E;  3J81 Q;  1HNX I;  1NHH A;  4JYA I;  4EMD A;  4NXM I;  1K47 A;  2A2D A;  2UUC E;  1N32 E;  4JI3 E;  2UUC I;  1N32 I;  2HHH I;  4JI3 I;  1B62 A;  4GKK E;  4KHP E;  1EI1 A;  4B3T E;  1MG7 A;  4GKK I;  4KHP I;  4AQY E;  4DR4 I;  1Z5A A;  3Q1Q A;  3WU6 A;  1FWK A;  4AQY I;  1RRE A;  5LL6 R;  1XNQ E;  2R3V A;  1IBK E;  4WUD A;  4JI4 E;  1DAR A;  3J80 Q;  1IBK I;  2E5L I;  5GMD A;  4JI4 I;  3ZKD A;  3ZKB A;  2NPF A;  4WUB A;  1FNM A;  4JI0 E;  4B3R E;  5GME A;  4HAC B;  2CZ9 A;  4JI0 I;  4B3R I;  4FWG A;  4DR6 E;  4HY1 A;  2UUB E;  4P52 A;  4DR6 I;  1S4E A;  3B8H A;  4DV3 E;  1J5E I;  2X36 A;  1N36 I;  4DV3 I;  2UUA E;  1HNW E;  4LF4 E;  1HNW I;  3QT8 A;  4YHH E;  4LFB I;  2BV3 A;  4B3M E;  4LF4 I;  4YHH I;  5LMN E;  4DR7 E;  4B3M I;  1N34 E;  4JI1 E;  5LMN I;  4DR7 I;  3LPS A;  1N34 I;  1Z0V A;  4B3S E;  1D6T A;  1Z0W A;  4UT4 A;  2A2C A;  4B3S I;  4K0K E;  2HFS A;  3WU5 A;  4DV0 E;  4PRV A;  1KIJ A;  1I94 E;  1Z5C A;  1FJG E;  1FJG I;  4FWH A;  4DUY E;  1FKA E;  3GON A;  1FI4 A;  4FWD A;  5LMU E;  4DUY I;  1XMQ E;  1H73 A;  5IWA E;  4LF8 E;  3M6A A;  2X7I A;  5LMU I;  1XMQ I;  5IWA I;  4HYM A;  1Z0G A;  5FLX Q;  4X65 E;  1HR0 E;  3T1H E;  4X65 I;  1HR0 I;  1OJ4 A;  2V34 A;  2E1R A;  4DU7 A;  2ZM6 E;  3J81 C;  2ZM6 I;  4JI5 E;  4JI5 I;  4USK A;  4HXZ A;  4KQV A;  4B3T I;  4PRX A;  3D4J A;  3PYD A;  3LTO A;  3T1Y E;  2VF3 A;  4MYU A;  3OTO E;  1XNQ I;  2UU9 E;  1UEK A;  1N0V C;  1XMO E;  2UU9 I;  1XMO I;  1IBL E;  3V2U C;  4DV2 E;  1IBL I;  1S16 A;  5A2Q Q;  1A6F A;  1ZM3 A;  3J80 C;  2VQE E;  2VQF E;  4DV2 I;  4USM A;  2VQE I;  3ZM7 A;  1N33 E;  2UXB E;  1U2R A;  2UUB I;  4DU8 A;  4JI2 E;  1N33 I;  2UXB I;  4M1K A;  4DPW A;  5A2Q C;  4JI2 I;  1Z59 A;  2UUA I;  3PYG A;  4X62 E;  2DEJ A;  4X62 I;  4URL A;  4LFA E;  4DV6 E;  2ZIT A;  2DEI A;  2Q2E B;  3F0N A;  4FW9 A;  1PKP A;  4DV7 E;  4JI1 I;  2BM0 A;  4GKJ E;  4WUC A;  4LF5 E;  1H7U A;  4DR2 E;  4K0K I;  4LF5 I;  1KKH A;  3J7A M;  4HAC A;  4DR2 I;  4DV0 I; 
#chains in the Genus database with same CATH topology
 4MU0 A;  1I94 I;  4BA2 A;  4X64 E;  2IES A;  4LF7 E;  2JE6 A;  3P06 A;  3HUL A;  4OZE A;  1ZM2 A;  2UXD E;  1PVG A;  4MU3 A;  2PO2 B;  2V2Q A;  4XTJ A;  4LF7 I;  2HKJ A;  2C37 B;  2UXD I;  2XEX A;  4DPU A;  4Z7Y A;  4DV4 E;  4NXN E;  3M7N D;  5EL9 A;  2Z5C B;  4DV4 I;  4ZVI A;  2J7K A;  2HK3 A;  1RR9 A;  4I3H A;  4LF8 I;  1H7S A;  4LCF A;  4MYT A;  2O3Z A;  4FN5 A;  2CVE A;  2F4V E;  1KVK A;  2HKE A;  2JEA A;  2F4V I;  2C39 A;  4IZJ B;  3ZZ0 A;  5K36 B;  4N3O A;  3T1H I;  2UXC E;  4QNK A;  1BKN A;  4OO1 C;  1MU5 A;  4JI6 E;  2NN6 A;  2GO4 A;  2WP8 A;  4IFD D;  2EFG A;  4MQY A;  3P3E A;  1NZ0 A;  2GS8 A;  5C0X A;  4X66 E;  1ZM9 A;  5FLX C;  3PYF A;  4JYA E;  4LCG A;  4X66 I;  1Z5B A;  2NN6 D;  1Z0C A;  1ZM4 A;  2O1W A;  4NXM E;  1Z0T A;  4Z7C A;  3P3G A;  5C0X F;  3QT7 A;  1Y5Y A;  3WU4 A;  4DUZ E;  1XNR E;  5IT9 Q;  2V2V A;  1VIS A;  4R1F A;  2IOQ A;  5JEA B;  1QZR A;  4DV5 E;  4DUZ I;  1NHI A;  3U1Y A;  4P7A A;  2HHH E;  1XNR I;  1H74 A;  3T1Y I;  4DV5 I;  4LF6 E;  2R42 A;  4DR5 E;  3OTO I;  1IBM E;  4ED4 A;  4LF6 I;  2BA1 D;  4DR4 E;  4DR5 I;  1IBM I;  4DXL A;  5IT9 C;  4IFD C;  3QT6 A;  1MX0 A;  3J7A G;  1Z0E A;  4QNJ A;  4JG4 A;  3ZZU A;  5FWK A;  1HNZ E;  3H4L A;  2V2Z A;  2V8P A;  2E5L E;  1HNZ I;  2AE8 A;  3CWV A;  2VQF I;  4LFC E;  1UDS A;  4FW5 A;  5K36 E;  4LFC I;  2OI2 A;  4FW3 A;  3PYE A;  2PO1 B;  1N0U A;  1EA6 A;  3GCM A;  3M7N G;  2Z5E A;  1Z0B A;  1WUU A;  5K36 C;  3Q6N A;  3K85 A;  4DPX A;  3ZZT A;  2JE6 B;  5BR8 E;  2HFU A;  4LF9 E;  1XHK A;  1J5E E;  1OYP A;  2WW4 A;  1N36 E;  3LNU A;  1ELO A;  2BA0 G;  3V5R A;  5BR8 I;  4LF9 I;  4DV6 I;  4LFA I;  3KRN A;  2ZBK B;  5DRR A;  2PO0 A;  5JEA E;  4DV7 I;  4UTG A;  4LOM A;  4LFB E;  4GKJ I;  4DR3 E;  3PS3 A;  1KTV A;  4DR3 I;  5L3J A;  5JEA C;  2JT2 A;  4RPF A;  1FWL A;  4IFD B;  2C38 A;  4X64 I;  2JEA B;  1NHJ A;  3L7Z B;  4JI8 E;  4OX9 E;  2J65 A;  4JI8 I;  3B82 A;  3B78 A;  1ZXM A;  1UDN A;  4OX9 I;  3WU3 A;  2NN6 B;  2WP8 B;  4NXN I;  1P42 A;  2CG9 A;  4YY3 E;  4DPT A;  1E3P A;  1H72 C;  4YY3 I;  4OO1 E;  4DV1 E;  4JV5 E;  4AID A;  2BA0 D;  3JAM Q;  2LJP A;  4DV1 I;  2BA1 G;  3K17 A;  3P3C A;  4PU9 A;  4DR1 E;  4JV5 I;  1ZXN A;  4DR1 I;  1PIE A;  1B63 A;  2AJ4 A;  2WNR B;  2BM1 A;  3K1J A;  4JI7 E;  4FW7 A;  2O1T A;  3QT5 A;  2UXC I;  4JI7 I;  4DPY A;  4JI6 I;  3JAM C;  2HK2 A;  1HNX E;  1Y4S A;  3HJC A;  3J81 Q;  1HNX I;  1NHH A;  4JYA I;  1USU A;  4EMD A;  1UDQ A;  5C0X D;  4IS9 A;  1Y60 A;  4NXM I;  1K47 A;  2C37 A;  2A2D A;  3M85 D;  2UUC E;  2Z5C A;  1N32 E;  5ELW A;  4JI3 E;  4IFD E;  4MU4 A;  2PNZ A;  3U1K A;  2UUC I;  1N32 I;  4AIM A;  2HHH I;  4JI3 I;  2IER A;  1B62 A;  4GKK E;  4KHP E;  1EI1 A;  4LCH A;  1XXE A;  4B3T E;  2NN6 E;  1MG7 A;  1YH8 A;  4GKK I;  4KHP I;  3P76 A;  4AQY E;  2VES A;  4DR4 I;  1Z5A A;  3Q1Q A;  3WU6 A;  1FWK A;  4IZJ A;  4AQY I;  1RRE A;  3H1C A;  5LL6 R;  2PNL A;  1XNQ E;  2R3V A;  2NN6 C;  1IBK E;  1E3H A;  4MDT A;  4WUD A;  4U3D A;  4JI4 E;  1DAR A;  3Q6M A;  3J80 Q;  1IBK I;  2E5L I;  5GMD A;  5C0X C;  3PS1 A;  4JI4 I;  2PO0 B;  4J3D A;  3ZKD A;  3ZKB A;  4IZK A;  1VI7 A;  2NPF A;  4WUB A;  3CDI A;  1FNM A;  4JI0 E;  4B3R E;  5DRP A;  5GME A;  3B4T A;  4HAC B;  2CZ9 A;  4JI0 I;  4B3R I;  2Z5B A;  4FWG A;  4BA2 B;  4AM3 A;  4DR6 E;  4HY1 A;  2UUB E;  4P52 A;  4DR6 I;  1S4E A;  1RHY A;  2F1D A;  3B8H A;  4DV3 E;  1J5E I;  1HK7 A;  2X36 A;  5JEA F;  1N36 I;  2GQ0 A;  4DV3 I;  2UUA E;  1HNW E;  4LF4 E;  2CGE A;  1HNW I;  2JEB A;  3QT8 A;  4YHH E;  4LFB I;  2BV3 A;  4B3M E;  4LF4 I;  4YHH I;  5LMN E;  4DR7 E;  4B3M I;  1N34 E;  4JI1 E;  5LMN I;  4DR7 I;  5DNX A;  3LPS A;  1N34 I;  5DRQ A;  1Z0V A;  4B3S E;  1D6T A;  1Z0W A;  2BR2 A;  1YHC A;  4UT4 A;  1OYR A;  2A2C A;  2C39 B;  3HKM A;  4B3S I;  5DRO A;  4K0K E;  4OO1 A;  2HFS A;  2PO1 A;  3WU5 A;  3M85 G;  4DV0 E;  4BA1 A;  4PRV A;  5DNL A;  2PNM A;  1KIJ A;  1I94 E;  1Z5C A;  5C0X B;  4OO1 D;  3NZK A;  4OO1 F;  2IOP A;  1FJG E;  1FJG I;  2O1V A;  4FWH A;  4DUY E;  1FKA E;  3GON A;  1FI4 A;  4FWD A;  5LMU E;  4DUY I;  1XMQ E;  1H73 A;  5IWA E;  4LF8 E;  2PNZ B;  3M6A A;  2X7I A;  5LMU I;  1XMQ I;  5IWA I;  4ISA A;  4HYM A;  4GQU A;  1Z0G A;  1OYS A;  3UHM A;  5FLX Q;  4X65 E;  4IFD A;  1UDO A;  2PO2 A;  1HR0 E;  3T1H E;  3L7Z A;  4X65 I;  1HR0 I;  1OJ4 A;  2V34 A;  2E1R A;  3PS2 A;  4DU7 A;  2ZM6 E;  2O1U A;  4IFD F;  3J81 C;  2ZM6 I;  4JI5 E;  4JI5 I;  2NN6 F;  4USK A;  4IZK B;  4HXZ A;  4KQV A;  1Y4U A;  4B3T I;  4PRX A;  3D4J A;  5C0X E;  3PYD A;  4NBQ A;  3LTO A;  3GME A;  5K36 A;  2WNR A;  3T1Y E;  2Z5B B;  2VF3 A;  4MYU A;  3OTO E;  1XNQ I;  2UU9 E;  1UEK A;  4IZJ D;  5K36 D;  5K36 F;  1N0V C;  1XMO E;  2UU9 I;  3PRY A;  4LPF A;  5EKW A;  1XMO I;  1IBL E;  3V2U C;  2JEB B;  4DV2 E;  1IBL I;  1S16 A;  5A2Q Q;  1A6F A;  1ZM3 A;  3J80 C;  2VQE E;  2VQF E;  4DV2 I;  5JEA A;  4USM A;  4OKG A;  2VQE I;  2C38 B;  3ZM7 A;  4FW6 A;  2GO3 A;  4U3B A;  2BR2 B;  1N33 E;  2UXB E;  1U2R A;  2UUB I;  4DU8 A;  5JEA D;  4JI2 E;  1N33 I;  2UXB I;  4M1K A;  4OO1 B;  4DPW A;  5A2Q C;  3DD6 A;  4JI2 I;  1Z59 A;  4BA1 B;  2UUA I;  4DV0 I;  4FW4 A;  1USV A;  3PYG A;  4X62 E;  2DEJ A;  1Y6Z A;  4X62 I;  4URL A;  4LFA E;  4DV6 E;  2ZIT A;  2DEI A;  2Q2E B;  1R6L A;  3F0N A;  4FW9 A;  1PKP A;  4DV7 E;  4JI1 I;  2BM0 A;  4GKJ E;  4WUC A;  4LF5 E;  3GLL A;  1H7U A;  4MU1 A;  4DR2 E;  4K0K I;  4LF5 I;  1KKH A;  3CDJ A;  3J7A M;  1R6M A;  4DR2 I;  4HAC A; 
#chains in the Genus database with same CATH homology
 1I94 I;  4X64 E;  4LF7 E;  3P06 A;  3HUL A;  1ZM2 A;  2UXD E;  1PVG A;  2V2Q A;  4XTJ A;  4LF7 I;  2HKJ A;  2UXD I;  2XEX A;  4DPU A;  4Z7Y A;  4DV4 E;  4NXN E;  2Z5C B;  4DV4 I;  4ZVI A;  2J7K A;  2HK3 A;  1RR9 A;  4I3H A;  4LF8 I;  1H7S A;  4MYT A;  4FN5 A;  2F4V E;  1KVK A;  2HKE A;  2F4V I;  4IZJ B;  3ZZ0 A;  4N3O A;  3T1H I;  2UXC E;  1BKN A;  1MU5 A;  4JI6 E;  2EFG A;  1NZ0 A;  2GS8 A;  4X66 E;  1ZM9 A;  5FLX C;  3PYF A;  4JYA E;  4X66 I;  1Z5B A;  1Z0C A;  1ZM4 A;  2O1W A;  4NXM E;  1Z0T A;  4Z7C A;  3QT7 A;  3WU4 A;  4DUZ E;  1XNR E;  5IT9 Q;  2V2V A;  1VIS A;  4R1F A;  2IOQ A;  1QZR A;  4DV5 E;  4DUZ I;  1NHI A;  2HHH E;  4P7A A;  1XNR I;  1H74 A;  3T1Y I;  4DV5 I;  4LF6 E;  2R42 A;  4DR5 E;  3OTO I;  1IBM E;  4ED4 A;  4LF6 I;  4DR4 E;  4DR5 I;  1IBM I;  4DXL A;  5IT9 C;  3QT6 A;  1MX0 A;  3J7A G;  1Z0E A;  4JG4 A;  3ZZU A;  5FWK A;  1HNZ E;  3H4L A;  2V2Z A;  2V8P A;  2E5L E;  1HNZ I;  3CWV A;  2VQF I;  4LFC E;  4LFC I;  2OI2 A;  3PYE A;  1N0U A;  1EA6 A;  2Z5E A;  1Z0B A;  1WUU A;  3Q6N A;  3K85 A;  4DPX A;  3ZZT A;  4LF9 E;  5BR8 E;  2HFU A;  1XHK A;  1J5E E;  2WW4 A;  1N36 E;  3LNU A;  1ELO A;  3V5R A;  4LF9 I;  5BR8 I;  4LFA I;  4DV6 I;  2ZBK B;  4DV7 I;  4UTG A;  4LFB E;  4GKJ I;  4DR3 E;  1KTV A;  4DR3 I;  5L3J A;  4RPF A;  1FWL A;  4X64 I;  1NHJ A;  4JI8 E;  4OX9 E;  4JI8 I;  3B82 A;  3B78 A;  1ZXM A;  4OX9 I;  3WU3 A;  4NXN I;  2CG9 A;  4YY3 E;  4DPT A;  1H72 C;  4YY3 I;  4DV1 E;  4JV5 E;  3JAM Q;  2LJP A;  4DV1 I;  3K17 A;  4JV5 I;  4DR1 E;  4PU9 A;  1ZXN A;  4DR1 I;  1PIE A;  1B63 A;  2AJ4 A;  2BM1 A;  3K1J A;  4JI7 E;  2O1T A;  3QT5 A;  2UXC I;  4JI7 I;  4DPY A;  4JI6 I;  3JAM C;  2HK2 A;  1HNX E;  1Y4S A;  3HJC A;  3J81 Q;  1HNX I;  1NHH A;  4JYA I;  1USU A;  4EMD A;  4NXM I;  1K47 A;  2A2D A;  2UUC E;  2Z5C A;  1N32 E;  4JI3 E;  2UUC I;  1N32 I;  2HHH I;  4JI3 I;  1B62 A;  4GKK E;  4KHP E;  1EI1 A;  4B3T E;  1MG7 A;  4GKK I;  4KHP I;  4AQY E;  4DR4 I;  1Z5A A;  3Q1Q A;  3WU6 A;  1FWK A;  4IZJ A;  4AQY I;  1RRE A;  5LL6 R;  2PNL A;  1XNQ E;  2R3V A;  1IBK E;  4WUD A;  4JI4 E;  1DAR A;  3Q6M A;  3J80 Q;  1IBK I;  2E5L I;  5GMD A;  4JI4 I;  3ZKD A;  3ZKB A;  4IZK A;  2NPF A;  4WUB A;  1FNM A;  4JI0 E;  4B3R E;  5GME A;  4HAC B;  2CZ9 A;  4JI0 I;  4B3R I;  2Z5B A;  4FWG A;  4DR6 E;  4HY1 A;  2UUB E;  4P52 A;  4DR6 I;  1S4E A;  3B8H A;  4DV3 E;  1J5E I;  1HK7 A;  2X36 A;  1N36 I;  2GQ0 A;  4DV3 I;  2UUA E;  1HNW E;  4LF4 E;  2CGE A;  1HNW I;  3QT8 A;  4YHH E;  4LFB I;  2BV3 A;  4B3M E;  4LF4 I;  4YHH I;  5LMN E;  4DR7 E;  4B3M I;  1N34 E;  4JI1 E;  5LMN I;  4DR7 I;  3LPS A;  1N34 I;  1Z0V A;  4B3S E;  1D6T A;  1Z0W A;  4UT4 A;  2A2C A;  4B3S I;  4K0K E;  2HFS A;  3WU5 A;  4DV0 E;  4PRV A;  2PNM A;  1KIJ A;  1I94 E;  1Z5C A;  2IOP A;  1FJG E;  1FJG I;  2O1V A;  4FWH A;  4DUY E;  1FKA E;  3GON A;  1FI4 A;  4FWD A;  5LMU E;  4DUY I;  1XMQ E;  1H73 A;  5IWA E;  4LF8 E;  3M6A A;  2X7I A;  5LMU I;  1XMQ I;  5IWA I;  4HYM A;  1Z0G A;  5FLX Q;  4X65 E;  1HR0 E;  3T1H E;  4X65 I;  1HR0 I;  1OJ4 A;  2V34 A;  2E1R A;  4DU7 A;  2ZM6 E;  2O1U A;  3J81 C;  2ZM6 I;  4JI5 E;  4JI5 I;  4USK A;  4IZK B;  4HXZ A;  4KQV A;  1Y4U A;  4B3T I;  4PRX A;  3D4J A;  3PYD A;  3LTO A;  3T1Y E;  2Z5B B;  2VF3 A;  4MYU A;  3OTO E;  1XNQ I;  2UU9 E;  1UEK A;  4IZJ D;  1N0V C;  1XMO E;  2UU9 I;  3PRY A;  1XMO I;  1IBL E;  3V2U C;  4DV2 E;  1IBL I;  1S16 A;  5A2Q Q;  1A6F A;  1ZM3 A;  3J80 C;  2VQE E;  2VQF E;  4DV2 I;  4USM A;  2VQE I;  3ZM7 A;  1N33 E;  2UXB E;  1U2R A;  2UUB I;  4DU8 A;  4JI2 E;  1N33 I;  2UXB I;  4M1K A;  4DPW A;  5A2Q C;  4JI2 I;  1Z59 A;  2UUA I;  1USV A;  3PYG A;  4X62 E;  2DEJ A;  1Y6Z A;  4X62 I;  4URL A;  4LFA E;  4DV6 E;  2ZIT A;  2DEI A;  2Q2E B;  3F0N A;  4FW9 A;  1PKP A;  4DV7 E;  4JI1 I;  2BM0 A;  4GKJ E;  4WUC A;  4LF5 E;  1H7U A;  4DR2 E;  4K0K I;  4LF5 I;  1KKH A;  3J7A M;  4HAC A;  4DR2 I;  4DV0 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...