2UXBI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxbI00
4DV1I 2OI2A 1Z0CA 1HNZE 4DV3E 4JI6E 4B3TE 1Z59A 3HULA 5LMNE 4LF5E 2VQFE 4DR2E 2X36A 1N0UA 1N36I 2E1RA 3JAMQ 1HNXI 1ZM2A 1NZ0A 3PYEA 1FWLA 2R3VA 4DUZE 2CZ9A 1Z0EA 1I94E 4DV6E 4DV0I 4DR6I 4USMA 4YY3I 3WU4A 4K0KI 4DUYE 1XMOI 4YHHE 2HFUA 4JI3I 4JI1I 5IWAI 3GONA 3J7AG 2UXBE 4HYMA 4JI8I 1H73A 1EA6A 3ZZ0A 4JI5I 4KHPI 1U2RA 4DV5E 1RREA 4Z7YA 5LL6R 2UXDE 4DV2I 2EFGA 3B78A 1IBLI 4DPUA 1ZM3A 1H7SA 1MU5A 4DR7E 5A2QC 4DR4E 2VQEI 3ZM7A 3K1JA 4KQVA 2Q2EB 5GMEA 4GKKI 2LJPA 3WU3A 4JI4I 2HK3A 4DXLA 2V2QA 5IT9C 1ZM9A 1HNWE 2UXCI 4WUDA 1FJGE 4MYUA 4UTGA 1XHKA 3H4LA 1Z0TA 4ED4A 4DPXA 1Z0WA 4LFBE 4X65E 2HKEA 4DR3E 4LFCE 4R1FA 4JYAE 2V8PA 2ZM6I 1MG7A 1FNMA 4JI2E 4EMDA 3D4JA 4DV4E 5FLXC 4LF4I 5LMUE 4JI0I 1N32I 4LF6E 3K17A 1J5EI 2UUBI 4X64I 4DV1E 4LFAI 4NXMI 1B63A 4LF8I 3T1YI 2F4VI 3QT5A 3LTOA 4AQYE 1IBMI 2UUAI 3JAMC 3F0NA 1ELOA 3ZKBA 4DPWA 4DR1I 1IBKE 4ZVIA 4DPYA 5L3JA 4I3HA 3LNUA 2BM0A 3V5RA 4DR6E 4YY3E 1ZXNA 4K0KE 1XMQE 1PVGA 1XMOE 4GKJI 2XEXA 1XNRI 4JI1E 2NPFA 2WW4A 3QT6A 4DU8A 4DR5E 4JI8E 1Z0BA 1HNZI 4FWHA 1DARA 3B82A 4PRVA 4B3TI 5LMNI 4LF5I 1XNQI 3ZZTA 4DR2I 1BKNA 4X62E 1IBLE 1KTVA 3T1HI 4XTJA 1PIEA 3J80Q 2VQEE 1H7UA 4UT4A 4GKKE 2HKJA 4JI7E 3PYFA 2UXCE 4LF7I 1NHIA 1Z0VA 2A2DA 4USKA 2R42A 4MYTA 2UXBI 4HY1A 1HR0I 4X66E 2VF3A 4M1KA 2X7IA 4FN5A 4DV7I 4PRXA 1QZRA 2UXDI 1FI4A 3J7AM 1VISA 4NXNE 4DR4I 4LF4E 4JI0E 1N32E 1B62A 3M6AA 1J5EE 1N33E 2V2ZA 1MX0A 4HACB 2UUBE 1HNWI 2E5LI 4LFAE 5GMDA 1FJGI 1ZXMA 1FKAE 1N34I 4B3ME 4JV5I 2HK2A 4LF8E 4OX9I 2F4VE 1IBME 4B3RI 2ZBKB 1PKPA 2UUAE 1Z5CA 1H72C 4PU9A 1Z0GA 4DR3I 1N36E 1KVKA 2ZITA 3OTOI 4JYAI 1HNXE 3WU5A 4LF9I 3V2UC 4B3SI 5LMUI 3ZKDA 4GKJE 1XNRE 4DV0E 2HHHI 4HACA 3QT7A 3ZZUA 2UUCI 1RR9A 1D6TA 4JI3E 5IWAE 1XNQE 3J81Q 2UU9I 1EI1A 4AQYI 5BR8I 2DEJA 4DV3I 4JI6I 4JI5E 3T1HE 4WUBA 4KHPE 2VQFI 2BV3A 1KIJA 3J80C 1IBKI 3PYGA 1N0VC 4DV2E 2J7KA 4DUZI 1XMQI 1H74A 1NHHA 1S16A 1I94I 4LF7E 3CWVA 4DV6I 3PYDA 4P52A 4DR5I 4DUYI 4JI4E 1NHJA 4YHHI 1HR0E 1OJ4A 4P7AA 2BM1A 4DV7E 4FWGA 4X62I 4HXZA 1Z5AA 1K47A 3LPSA 4DV5I 4URLA 1FWKA 4DPTA 5A2QQ 2ZM6E 4DR7I 4JI7I 3QT8A 2E5LE 1N34E 4JV5E 4OX9E 1WUUA 5IT9Q 2V34A 4B3RE 4X64E 2A2CA 4X66I 4NXME 3T1YE 1ZM4A 2AJ4A 3OTOE 3Q1QA 4RPFA 4LF9E 4LFBI 2DEIA 4X65I 4DU7A 4B3SE 4FW9A 4LFCI 4Z7CA 4NXNI 4DR1E 2HFSA 2GS8A 4FWDA 2V2VA 4JI2I 4DV4I 5FLXQ 2HHHE 4WUCA 1N33I 2UUCE 1S4EA 4B3MI 3WU6A 4LF6I 1Z5BA 1KKHA 4JG4A 1UEKA 2UU9E 3J81C 5BR8E 3B8HA 1A6FA
chains in the Genus database with same CATH superfamily
4DV1I 2OI2A 1Z0CA 1HNZE 4DV3E 4JI6E 2JEBB 4B3TE 1Z59A 2WNRA 3HULA 5LMNE 4LF5E 2VQFE 4DR2E 2X36A 1N0UA 1N36I 2E1RA 3JAMQ 1HNXI 1ZM2A 1NZ0A 3M7ND 3PYEA 1Y4SA 3L7ZB 1FWLA 5DNXA 2R3VA 3M85G 4DUZE 2CZ9A 1Z0EA 1I94E 4ISAA 4DV6E 4DV0I 4DR6I 5DNLA 4USMA 4YY3I 3WU4A 3NZKA 1OYRA 4K0KI 4DUYE 2C39B 1XMOI 4YHHE 1R6MA 2HFUA 2F1DA 4OKGA 4IZJB 4JI1I 4JI3I 5C0XD 5IWAI 3GONA 5JEAE 4MU1A 3J7AG 2UXBE 4HYMA 4JI8I 2JEBA 1H73A 4N3OA 1EA6A 3ZZ0A 4JI5I 2Z5CA 4KHPI 1U2RA 2O1UA 4DV5E 1RREA 4Z7YA 5LL6R 3PS2A 5C0XF 4IFDE 2UXDE 2GQ0A 4DV2I 2EFGA 2NN6B 4J3DA 3B78A 4MQYA 1IBLI 4DPUA 4LCFA 1ZM3A 1H7SA 1MU5A 4DR7E 5A2QC 4DR4E 2VQEI 4OO1E 3ZM7A 3KRNA 3K1JA 4BA1B 4KQVA 2O1VA 2Q2EB 2C39A 5GMEA 4GKKI 2LJPA 3WU3A 4JI4I 2HK3A 4DXLA 2V2QA 5IT9C 1ZM9A 1HNWE 2UXCI 4WUDA 1FJGE 4MYUA 4UTGA 4FW4A 2C37A 1XHKA 3H4LA 1Z0TA 1UDSA 2PNZB 2PO2B 4ED4A 4DPXA 1Z0WA 4LFBE 4X65E 3Q6NA 2HKEA 4DR3E 4LFCE 3K85A 2NN6A 4R1FA 3P3GA 5FWKA 4JYAE 3PRYA 2V8PA 3P3CA 2ZM6I 1MG7A 1FNMA 4JI2E 4EMDA 2JEAA 3D4JA 4DV4E 5K36F 5FLXC 4LF4I 4FW5A 5LMUE 4BA1A 4JI0I 1N32I 4LF6E 3P06A 3K17A 1J5EI 2UUBI 4X64I 4DV1E 4LFAI 4NXMI 2BA1G 1B63A 4LF8I 3CDIA 3T1YI 2F4VI 3QT5A 3LTOA 2PO2A 4AQYE 1UDNA 1IBMI 1R6LA 3U1KA 5JEAC 2UUAI 3JAMC 3F0NA 1ELOA 2CGEA 3DD6A 5K36A 3ZKBA 4DPWA 4DR1I 2Z5CB 1IBKE 4ZVIA 2CG9A 4LCGA 4DPYA 5L3JA 4IFDC 4I3HA 3LNUA 2BM0A 3V5RA 3HKMA 2BR2B 4DR6E 4LCHA 4YY3E 1ZXNA 4K0KE 1XMQE 1PVGA 1XMOE 4LOMA 4GKJI 2XEXA 4OO1C 1XNRI 4JI1E 2NPFA 2WW4A 3QT6A 4DU8A 1OYPA 2PNMA 4DR5E 4JI8E 1Z0BA 1Y5YA 1HNZI 4FWHA 1DARA 3B82A 4PRVA 4GQUA 4B3TI 4BA2A 2PO1B 5LMNI 2C37B 4LF5I 1XNQI 3ZZTA 4DR2I 1BKNA 4X62E 5C0XE 1IBLE 1KTVA 5C0XB 3T1HI 2O1WA 4XTJA 1PIEA 3J80Q 4IZJD 1USUA 4LPFA 2VQEE 2NN6E 5JEAD 1H7UA 2GO3A 2BR2A 4UT4A 4U3BA 4GKKE 2JEAB 2HKJA 4JI7E 3PYFA 2BA0D 2VESA 2GO4A 2UXCE 4LF7I 1NHIA 4IFDD 1Z0VA 4MU3A 2A2DA 5DRPA 5JEAF 4USKA 2R42A 3H1CA 4MYTA 2UXBI 4HY1A 1HR0I 4X66E 3U1YA 2PO1A 2VF3A 4M1KA 4OO1D 2X7IA 1UDQA 4FN5A 4DV7I 4NBQA 4PRXA 4IFDF 3GMEA 1E3PA 5C0XA 1QZRA 2UXDI 1VI7A 4AIMA 3M85D 1FI4A 3J7AM 1YH8A 3UHMA 1VISA 4OO1F 4NXNE 4DR4I 5K36E 4LF4E 4QNJA 5K36B 2CVEA 4JI0E 1N32E 5DROA 1B62A 1USVA 3M6AA 1J5EE 1N33E 4IZKA 2V2ZA 1MX0A 4HACB 2UUBE 1HNWI 2E5LI 4LFAE 5GMDA 1FJGI 1ZXMA 1FKAE 1N34I 4B3ME 4JV5I 2HK2A 4LF8E 4OX9I 2F4VE 2AE8A 3PS3A 5ELWA 4AM3A 1IBME 2C38A 4B3RI 2ZBKB 1P42A 1PKPA 2UUAE 1Z5CA 1E3HA 1H72C 4PU9A 2Z5BA 5EKWA 2Z5EA 1Z0GA 1Y6ZA 2O3ZA 4DR3I 4BA2B 1N36E 1KVKA 2ZITA 3OTOI 4JYAI 3WU5A 1HNXE 4LF9I 3V2UC 1UDOA 3CDJA 4B3SI 4OZEA 1Y4UA 5LMUI 3ZKDA 1HK7A 4U3DA 4GKJE 2NN6C 4MU0A 3GCMA 1XNRE 4DV0E 2HHHI 4HACA 3QT7A 3ZZUA 2UUCI 1RR9A 4MDTA 1D6TA 1Y60A 4JI3E 5IWAE 1XNQE 3J81Q 2UU9I 1EI1A 4AQYI 5DRRA 5BR8I 2DEJA 4DV3I 4JI6I 4JI5E 3T1HE 4WUBA 5EL9A 1RHYA 4KHPE 2VQFI 2BV3A 1KIJA 3J80C 1IBKI 3PYGA 1N0VC 2PO0B 4AIDA 4DV2E 2J7KA 3HJCA 4FW3A 2WP8B 2IESA 4DUZI 1XMQI 4MU4A 1H74A 1NHHA 1S16A 1I94I 2JE6B 5K36C 4LF7E 3CWVA 4DV6I 3PYDA 2BA1D 4P52A 4DR5I 5JEAB 4DUYI 4JI4E 1NHJA 4YHHI 1HR0E 1OJ4A 4P7AA 2BM1A 4IZKB 2IOQA 2NN6D 4DV7E 4FWGA 3L7ZA 4IFDB 2JT2A 4X62I 2C38B 4HXZA 1Z5AA 1K47A 2Z5BB 3LPSA 2PO0A 4DV5I 2NN6F 4URLA 4OO1B 1FWKA 3GLLA 2WP8A 3P76A 4FW7A 4DPTA 5A2QQ 2ZM6E 5DRQA 4DR7I 2O1TA 3M7NG 2PNLA 2JE6A 4JI7I 3QT8A 4QNKA 2E5LE 3P3EA 4IZJA 1N34E 4JV5E 1OYSA 3PS1A 4OX9E 5JEAA 1WUUA 5IT9Q 2V34A 4B3RE 4X64E 2A2CA 4X66I 4NXME 5K36D 3T1YE 2IOPA 1XXEA 4IFDA 2WNRB 1ZM4A 2AJ4A 3OTOE 3Q1QA 4RPFA 4LF9E 4LFBI 2DEIA 4X65I 4DU7A 4B3SE 4FW9A 4LFCI 4Z7CA 4NXNI 4IS9A 4OO1A 4DR1E 4FW6A 2HFSA 2GS8A 4FWDA 2V2VA 4JI2I 5C0XC 2J65A 4DV4I 5FLXQ 3B4TA 2HHHE 4WUCA 1N33I 2UUCE 1S4EA 4B3MI 3WU6A 2IERA 2BA0G 4LF6I 1Z5BA 1KKHA 2PNZA 4JG4A 1UEKA 2UU9E 3Q6MA 3J81C 1YHCA 5BR8E 3B8HA 1A6FA
chains in the Genus database with same CATH topology
4DV1I 2OI2A 1Z0CA 1HNZE 4DV3E 4JI6E 4B3TE 1Z59A 3HULA 5LMNE 4LF5E 2VQFE 4DR2E 2X36A 1N0UA 1N36I 2E1RA 3JAMQ 1HNXI 1ZM2A 1NZ0A 3PYEA 1Y4SA 1FWLA 2R3VA 4DUZE 2CZ9A 1Z0EA 1I94E 4DV6E 4DV0I 4DR6I 4USMA 4YY3I 3WU4A 4K0KI 4DUYE 1XMOI 4YHHE 2HFUA 4IZJB 4JI1I 4JI3I 5IWAI 3GONA 3J7AG 2UXBE 4HYMA 4JI8I 1H73A 4N3OA 1EA6A 3ZZ0A 4JI5I 2Z5CA 4KHPI 1U2RA 2O1UA 4DV5E 1RREA 4Z7YA 5LL6R 2UXDE 2GQ0A 4DV2I 2EFGA 3B78A 1IBLI 4DPUA 1ZM3A 1H7SA 1MU5A 4DR7E 5A2QC 4DR4E 2VQEI 3ZM7A 3K1JA 4KQVA 2O1VA 2Q2EB 5GMEA 4GKKI 2LJPA 3WU3A 4JI4I 2HK3A 4DXLA 2V2QA 5IT9C 1ZM9A 1HNWE 2UXCI 4WUDA 1FJGE 4MYUA 4UTGA 1XHKA 3H4LA 1Z0TA 4ED4A 4DPXA 1Z0WA 4LFBE 4X65E 3Q6NA 2HKEA 4DR3E 4LFCE 3K85A 4R1FA 5FWKA 4JYAE 3PRYA 2V8PA 2ZM6I 1MG7A 1FNMA 4JI2E 4EMDA 3D4JA 4DV4E 5FLXC 4LF4I 5LMUE 4JI0I 1N32I 4LF6E 3P06A 3K17A 1J5EI 2UUBI 4X64I 4DV1E 4LFAI 4NXMI 1B63A 4LF8I 3T1YI 2F4VI 3QT5A 3LTOA 4AQYE 1IBMI 2UUAI 3JAMC 3F0NA 1ELOA 2CGEA 3ZKBA 4DPWA 4DR1I 2Z5CB 1IBKE 4ZVIA 2CG9A 4DPYA 5L3JA 4I3HA 3LNUA 2BM0A 3V5RA 4DR6E 4YY3E 1ZXNA 4K0KE 1XMQE 1PVGA 1XMOE 4GKJI 2XEXA 1XNRI 4JI1E 2NPFA 2WW4A 3QT6A 4DU8A 2PNMA 4DR5E 4JI8E 1Z0BA 1HNZI 4FWHA 1DARA 3B82A 4PRVA 4B3TI 5LMNI 4LF5I 1XNQI 3ZZTA 4DR2I 1BKNA 4X62E 1IBLE 1KTVA 3T1HI 2O1WA 4XTJA 1PIEA 3J80Q 4IZJD 1USUA 2VQEE 1H7UA 4UT4A 4GKKE 2HKJA 4JI7E 3PYFA 2UXCE 4LF7I 1NHIA 1Z0VA 2A2DA 4USKA 2R42A 4MYTA 2UXBI 4HY1A 1HR0I 4X66E 2VF3A 4M1KA 2X7IA 4FN5A 4DV7I 4PRXA 1QZRA 2UXDI 1FI4A 3J7AM 1VISA 4NXNE 4DR4I 4LF4E 4JI0E 1N32E 1B62A 1USVA 3M6AA 1J5EE 1N33E 4IZKA 2V2ZA 1MX0A 4HACB 2UUBE 1HNWI 2E5LI 4LFAE 5GMDA 1FJGI 1ZXMA 1FKAE 1N34I 4B3ME 4JV5I 2HK2A 4LF8E 4OX9I 2F4VE 1IBME 4B3RI 2ZBKB 1PKPA 2UUAE 1Z5CA 1H72C 4PU9A 2Z5BA 2Z5EA 1Z0GA 1Y6ZA 4DR3I 1N36E 1KVKA 2ZITA 3OTOI 4JYAI 3WU5A 1HNXE 4LF9I 3V2UC 4B3SI 1Y4UA 5LMUI 3ZKDA 1HK7A 4GKJE 1XNRE 4DV0E 2HHHI 4HACA 3QT7A 3ZZUA 2UUCI 1RR9A 1D6TA 4JI3E 5IWAE 1XNQE 3J81Q 2UU9I 1EI1A 4AQYI 5BR8I 2DEJA 4DV3I 4JI6I 4JI5E 3T1HE 4WUBA 4KHPE 2VQFI 2BV3A 1KIJA 3J80C 1IBKI 3PYGA 1N0VC 4DV2E 2J7KA 3HJCA 4DUZI 1XMQI 1H74A 1NHHA 1S16A 1I94I 4LF7E 3CWVA 4DV6I 3PYDA 4P52A 4DR5I 4DUYI 4JI4E 1NHJA 4YHHI 1HR0E 1OJ4A 4P7AA 2BM1A 4IZKB 2IOQA 4DV7E 4FWGA 4X62I 4HXZA 1Z5AA 1K47A 2Z5BB 3LPSA 4DV5I 4URLA 1FWKA 4DPTA 5A2QQ 2ZM6E 4DR7I 2O1TA 2PNLA 4JI7I 3QT8A 2E5LE 4IZJA 1N34E 4JV5E 4OX9E 1WUUA 5IT9Q 2V34A 4B3RE 4X64E 2A2CA 4X66I 4NXME 3T1YE 2IOPA 1ZM4A 2AJ4A 3OTOE 3Q1QA 4RPFA 4LF9E 4LFBI 2DEIA 4X65I 4DU7A 4B3SE 4FW9A 4LFCI 4Z7CA 4NXNI 4DR1E 2HFSA 2GS8A 4FWDA 2V2VA 4JI2I 4DV4I 5FLXQ 2HHHE 4WUCA 1N33I 2UUCE 1S4EA 4B3MI 3WU6A 4LF6I 1Z5BA 1KKHA 4JG4A 1UEKA 2UU9E 3Q6MA 3J81C 5BR8E 3B8HA 1A6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 I;  2OI2 A;  1Z0C A;  1HNZ E;  4DV3 E;  4JI6 E;  4B3T E;  1Z59 A;  3HUL A;  5LMN E;  4LF5 E;  2VQF E;  4DR2 E;  2X36 A;  1N0U A;  1N36 I;  2E1R A;  3JAM Q;  1HNX I;  1ZM2 A;  1NZ0 A;  3PYE A;  1FWL A;  2R3V A;  4DUZ E;  2CZ9 A;  1Z0E A;  1I94 E;  4DV6 E;  4DV0 I;  4DR6 I;  4USM A;  4YY3 I;  3WU4 A;  4K0K I;  4DUY E;  1XMO I;  4YHH E;  2HFU A;  4JI3 I;  4JI1 I;  5IWA I;  3GON A;  3J7A G;  2UXB E;  4HYM A;  4JI8 I;  1H73 A;  1EA6 A;  3ZZ0 A;  4JI5 I;  4KHP I;  1U2R A;  4DV5 E;  1RRE A;  4Z7Y A;  5LL6 R;  2UXD E;  4DV2 I;  2EFG A;  3B78 A;  1IBL I;  4DPU A;  1ZM3 A;  1H7S A;  1MU5 A;  4DR7 E;  5A2Q C;  4DR4 E;  2VQE I;  3ZM7 A;  3K1J A;  4KQV A;  2Q2E B;  5GME A;  4GKK I;  2LJP A;  3WU3 A;  4JI4 I;  2HK3 A;  4DXL A;  2V2Q A;  5IT9 C;  1ZM9 A;  1HNW E;  2UXC I;  4WUD A;  1FJG E;  4MYU A;  4UTG A;  1XHK A;  3H4L A;  1Z0T A;  4ED4 A;  4DPX A;  1Z0W A;  4LFB E;  4X65 E;  2HKE A;  4DR3 E;  4LFC E;  4R1F A;  4JYA E;  2V8P A;  2ZM6 I;  1MG7 A;  1FNM A;  4JI2 E;  4EMD A;  3D4J A;  4DV4 E;  5FLX C;  4LF4 I;  5LMU E;  4JI0 I;  1N32 I;  4LF6 E;  3K17 A;  1J5E I;  2UUB I;  4X64 I;  4DV1 E;  4LFA I;  4NXM I;  1B63 A;  4LF8 I;  3T1Y I;  2F4V I;  3QT5 A;  3LTO A;  4AQY E;  1IBM I;  2UUA I;  3JAM C;  3F0N A;  1ELO A;  3ZKB A;  4DPW A;  4DR1 I;  1IBK E;  4ZVI A;  4DPY A;  5L3J A;  4I3H A;  3LNU A;  2BM0 A;  3V5R A;  4DR6 E;  4YY3 E;  1ZXN A;  4K0K E;  1XMQ E;  1PVG A;  1XMO E;  4GKJ I;  2XEX A;  1XNR I;  4JI1 E;  2NPF A;  2WW4 A;  3QT6 A;  4DU8 A;  4DR5 E;  4JI8 E;  1Z0B A;  1HNZ I;  4FWH A;  1DAR A;  3B82 A;  4PRV A;  4B3T I;  5LMN I;  4LF5 I;  1XNQ I;  3ZZT A;  4DR2 I;  1BKN A;  4X62 E;  1IBL E;  1KTV A;  3T1H I;  4XTJ A;  1PIE A;  3J80 Q;  2VQE E;  1H7U A;  4UT4 A;  4GKK E;  2HKJ A;  4JI7 E;  3PYF A;  2UXC E;  4LF7 I;  1NHI A;  1Z0V A;  2A2D A;  4USK A;  2R42 A;  4MYT A;  2UXB I;  4HY1 A;  1HR0 I;  4X66 E;  2VF3 A;  4M1K A;  2X7I A;  4FN5 A;  4DV7 I;  4PRX A;  1QZR A;  2UXD I;  1FI4 A;  3J7A M;  1VIS A;  4NXN E;  4DR4 I;  4LF4 E;  4JI0 E;  1N32 E;  1B62 A;  3M6A A;  1J5E E;  1N33 E;  2V2Z A;  1MX0 A;  4HAC B;  2UUB E;  1HNW I;  2E5L I;  4LFA E;  5GMD A;  1FJG I;  1ZXM A;  1FKA E;  1N34 I;  4B3M E;  4JV5 I;  2HK2 A;  4LF8 E;  4OX9 I;  2F4V E;  1IBM E;  4B3R I;  2ZBK B;  1PKP A;  2UUA E;  1Z5C A;  1H72 C;  4PU9 A;  1Z0G A;  4DR3 I;  1N36 E;  1KVK A;  2ZIT A;  3OTO I;  4JYA I;  1HNX E;  3WU5 A;  4LF9 I;  3V2U C;  4B3S I;  5LMU I;  3ZKD A;  4GKJ E;  1XNR E;  4DV0 E;  2HHH I;  4HAC A;  3QT7 A;  3ZZU A;  2UUC I;  1RR9 A;  1D6T A;  4JI3 E;  5IWA E;  1XNQ E;  3J81 Q;  2UU9 I;  1EI1 A;  4AQY I;  5BR8 I;  2DEJ A;  4DV3 I;  4JI6 I;  4JI5 E;  3T1H E;  4WUB A;  4KHP E;  2VQF I;  2BV3 A;  1KIJ A;  3J80 C;  1IBK I;  3PYG A;  1N0V C;  4DV2 E;  2J7K A;  4DUZ I;  1XMQ I;  1H74 A;  1NHH A;  1S16 A;  1I94 I;  4LF7 E;  3CWV A;  4DV6 I;  3PYD A;  4P52 A;  4DR5 I;  4DUY I;  4JI4 E;  1NHJ A;  4YHH I;  1HR0 E;  1OJ4 A;  4P7A A;  2BM1 A;  4DV7 E;  4FWG A;  4X62 I;  4HXZ A;  1Z5A A;  1K47 A;  3LPS A;  4DV5 I;  4URL A;  1FWK A;  4DPT A;  5A2Q Q;  2ZM6 E;  4DR7 I;  4JI7 I;  3QT8 A;  2E5L E;  1N34 E;  4JV5 E;  4OX9 E;  1WUU A;  5IT9 Q;  2V34 A;  4B3R E;  4X64 E;  2A2C A;  4X66 I;  4NXM E;  3T1Y E;  1ZM4 A;  2AJ4 A;  3OTO E;  3Q1Q A;  4RPF A;  4LF9 E;  4LFB I;  2DEI A;  4X65 I;  4DU7 A;  4B3S E;  4FW9 A;  4LFC I;  4Z7C A;  4NXN I;  4DR1 E;  2HFS A;  2GS8 A;  4FWD A;  2V2V A;  4JI2 I;  4DV4 I;  5FLX Q;  2HHH E;  4WUC A;  1N33 I;  2UUC E;  1S4E A;  4B3M I;  3WU6 A;  4LF6 I;  1Z5B A;  1KKH A;  4JG4 A;  1UEK A;  2UU9 E;  3J81 C;  5BR8 E;  3B8H A;  1A6F A; 
#chains in the Genus database with same CATH topology
 4DV1 I;  2OI2 A;  1Z0C A;  1HNZ E;  4DV3 E;  4JI6 E;  2JEB B;  4B3T E;  1Z59 A;  2WNR A;  3HUL A;  5LMN E;  4LF5 E;  2VQF E;  4DR2 E;  2X36 A;  1N0U A;  1N36 I;  2E1R A;  3JAM Q;  1HNX I;  1ZM2 A;  1NZ0 A;  3M7N D;  3PYE A;  1Y4S A;  3L7Z B;  1FWL A;  5DNX A;  2R3V A;  3M85 G;  4DUZ E;  2CZ9 A;  1Z0E A;  1I94 E;  4ISA A;  4DV6 E;  4DV0 I;  4DR6 I;  5DNL A;  4USM A;  4YY3 I;  3WU4 A;  3NZK A;  1OYR A;  4K0K I;  4DUY E;  2C39 B;  1XMO I;  4YHH E;  1R6M A;  2HFU A;  2F1D A;  4OKG A;  4IZJ B;  4JI1 I;  4JI3 I;  5C0X D;  5IWA I;  3GON A;  5JEA E;  4MU1 A;  3J7A G;  2UXB E;  4HYM A;  4JI8 I;  2JEB A;  1H73 A;  4N3O A;  1EA6 A;  3ZZ0 A;  4JI5 I;  2Z5C A;  4KHP I;  1U2R A;  2O1U A;  4DV5 E;  1RRE A;  4Z7Y A;  5LL6 R;  3PS2 A;  5C0X F;  4IFD E;  2UXD E;  2GQ0 A;  4DV2 I;  2EFG A;  2NN6 B;  4J3D A;  3B78 A;  4MQY A;  1IBL I;  4DPU A;  4LCF A;  1ZM3 A;  1H7S A;  1MU5 A;  4DR7 E;  5A2Q C;  4DR4 E;  2VQE I;  4OO1 E;  3ZM7 A;  3KRN A;  3K1J A;  4BA1 B;  4KQV A;  2O1V A;  2Q2E B;  2C39 A;  5GME A;  4GKK I;  2LJP A;  3WU3 A;  4JI4 I;  2HK3 A;  4DXL A;  2V2Q A;  5IT9 C;  1ZM9 A;  1HNW E;  2UXC I;  4WUD A;  1FJG E;  4MYU A;  4UTG A;  4FW4 A;  2C37 A;  1XHK A;  3H4L A;  1Z0T A;  1UDS A;  2PNZ B;  2PO2 B;  4ED4 A;  4DPX A;  1Z0W A;  4LFB E;  4X65 E;  3Q6N A;  2HKE A;  4DR3 E;  4LFC E;  3K85 A;  2NN6 A;  4R1F A;  3P3G A;  5FWK A;  4JYA E;  3PRY A;  2V8P A;  3P3C A;  2ZM6 I;  1MG7 A;  1FNM A;  4JI2 E;  4EMD A;  2JEA A;  3D4J A;  4DV4 E;  5K36 F;  5FLX C;  4LF4 I;  4FW5 A;  5LMU E;  4BA1 A;  4JI0 I;  1N32 I;  4LF6 E;  3P06 A;  3K17 A;  1J5E I;  2UUB I;  4X64 I;  4DV1 E;  4LFA I;  4NXM I;  2BA1 G;  1B63 A;  4LF8 I;  3CDI A;  3T1Y I;  2F4V I;  3QT5 A;  3LTO A;  2PO2 A;  4AQY E;  1UDN A;  1IBM I;  1R6L A;  3U1K A;  5JEA C;  2UUA I;  3JAM C;  3F0N A;  1ELO A;  2CGE A;  3DD6 A;  5K36 A;  3ZKB A;  4DPW A;  4DR1 I;  2Z5C B;  1IBK E;  4ZVI A;  2CG9 A;  4LCG A;  4DPY A;  5L3J A;  4IFD C;  4I3H A;  3LNU A;  2BM0 A;  3V5R A;  3HKM A;  2BR2 B;  4DR6 E;  4LCH A;  4YY3 E;  1ZXN A;  4K0K E;  1XMQ E;  1PVG A;  1XMO E;  4LOM A;  4GKJ I;  2XEX A;  4OO1 C;  1XNR I;  4JI1 E;  2NPF A;  2WW4 A;  3QT6 A;  4DU8 A;  1OYP A;  2PNM A;  4DR5 E;  4JI8 E;  1Z0B A;  1Y5Y A;  1HNZ I;  4FWH A;  1DAR A;  3B82 A;  4PRV A;  4GQU A;  4B3T I;  4BA2 A;  2PO1 B;  5LMN I;  2C37 B;  4LF5 I;  1XNQ I;  3ZZT A;  4DR2 I;  1BKN A;  4X62 E;  5C0X E;  1IBL E;  1KTV A;  5C0X B;  3T1H I;  2O1W A;  4XTJ A;  1PIE A;  3J80 Q;  4IZJ D;  1USU A;  4LPF A;  2VQE E;  2NN6 E;  5JEA D;  1H7U A;  2GO3 A;  2BR2 A;  4UT4 A;  4U3B A;  4GKK E;  2JEA B;  2HKJ A;  4JI7 E;  3PYF A;  2BA0 D;  2VES A;  2GO4 A;  2UXC E;  4LF7 I;  1NHI A;  4IFD D;  1Z0V A;  4MU3 A;  2A2D A;  5DRP A;  5JEA F;  4USK A;  2R42 A;  3H1C A;  4MYT A;  2UXB I;  4HY1 A;  1HR0 I;  4X66 E;  3U1Y A;  2PO1 A;  2VF3 A;  4M1K A;  4OO1 D;  2X7I A;  1UDQ A;  4FN5 A;  4DV7 I;  4NBQ A;  4PRX A;  4IFD F;  3GME A;  1E3P A;  5C0X A;  1QZR A;  2UXD I;  1VI7 A;  4AIM A;  3M85 D;  1FI4 A;  3J7A M;  1YH8 A;  3UHM A;  1VIS A;  4OO1 F;  4NXN E;  4DR4 I;  5K36 E;  4LF4 E;  4QNJ A;  5K36 B;  2CVE A;  4JI0 E;  1N32 E;  5DRO A;  1B62 A;  1USV A;  3M6A A;  1J5E E;  1N33 E;  4IZK A;  2V2Z A;  1MX0 A;  4HAC B;  2UUB E;  1HNW I;  2E5L I;  4LFA E;  5GMD A;  1FJG I;  1ZXM A;  1FKA E;  1N34 I;  4B3M E;  4JV5 I;  2HK2 A;  4LF8 E;  4OX9 I;  2F4V E;  2AE8 A;  3PS3 A;  5ELW A;  4AM3 A;  1IBM E;  2C38 A;  4B3R I;  2ZBK B;  1P42 A;  1PKP A;  2UUA E;  1Z5C A;  1E3H A;  1H72 C;  4PU9 A;  2Z5B A;  5EKW A;  2Z5E A;  1Z0G A;  1Y6Z A;  2O3Z A;  4DR3 I;  4BA2 B;  1N36 E;  1KVK A;  2ZIT A;  3OTO I;  4JYA I;  3WU5 A;  1HNX E;  4LF9 I;  3V2U C;  1UDO A;  3CDJ A;  4B3S I;  4OZE A;  1Y4U A;  5LMU I;  3ZKD A;  1HK7 A;  4U3D A;  4GKJ E;  2NN6 C;  4MU0 A;  3GCM A;  1XNR E;  4DV0 E;  2HHH I;  4HAC A;  3QT7 A;  3ZZU A;  2UUC I;  1RR9 A;  4MDT A;  1D6T A;  1Y60 A;  4JI3 E;  5IWA E;  1XNQ E;  3J81 Q;  2UU9 I;  1EI1 A;  4AQY I;  5DRR A;  5BR8 I;  2DEJ A;  4DV3 I;  4JI6 I;  4JI5 E;  3T1H E;  4WUB A;  5EL9 A;  1RHY A;  4KHP E;  2VQF I;  2BV3 A;  1KIJ A;  3J80 C;  1IBK I;  3PYG A;  1N0V C;  2PO0 B;  4AID A;  4DV2 E;  2J7K A;  3HJC A;  4FW3 A;  2WP8 B;  2IES A;  4DUZ I;  1XMQ I;  4MU4 A;  1H74 A;  1NHH A;  1S16 A;  1I94 I;  2JE6 B;  5K36 C;  4LF7 E;  3CWV A;  4DV6 I;  3PYD A;  2BA1 D;  4P52 A;  4DR5 I;  5JEA B;  4DUY I;  4JI4 E;  1NHJ A;  4YHH I;  1HR0 E;  1OJ4 A;  4P7A A;  2BM1 A;  4IZK B;  2IOQ A;  2NN6 D;  4DV7 E;  4FWG A;  3L7Z A;  4IFD B;  2JT2 A;  4X62 I;  2C38 B;  4HXZ A;  1Z5A A;  1K47 A;  2Z5B B;  3LPS A;  2PO0 A;  4DV5 I;  2NN6 F;  4URL A;  4OO1 B;  1FWK A;  3GLL A;  2WP8 A;  3P76 A;  4FW7 A;  4DPT A;  5A2Q Q;  2ZM6 E;  5DRQ A;  4DR7 I;  2O1T A;  3M7N G;  2PNL A;  2JE6 A;  4JI7 I;  3QT8 A;  4QNK A;  2E5L E;  3P3E A;  4IZJ A;  1N34 E;  4JV5 E;  1OYS A;  3PS1 A;  4OX9 E;  5JEA A;  1WUU A;  5IT9 Q;  2V34 A;  4B3R E;  4X64 E;  2A2C A;  4X66 I;  4NXM E;  5K36 D;  3T1Y E;  2IOP A;  1XXE A;  4IFD A;  2WNR B;  1ZM4 A;  2AJ4 A;  3OTO E;  3Q1Q A;  4RPF A;  4LF9 E;  4LFB I;  2DEI A;  4X65 I;  4DU7 A;  4B3S E;  4FW9 A;  4LFC I;  4Z7C A;  4NXN I;  4IS9 A;  4OO1 A;  4DR1 E;  4FW6 A;  2HFS A;  2GS8 A;  4FWD A;  2V2V A;  4JI2 I;  5C0X C;  2J65 A;  4DV4 I;  5FLX Q;  3B4T A;  2HHH E;  4WUC A;  1N33 I;  2UUC E;  1S4E A;  4B3M I;  3WU6 A;  2IER A;  2BA0 G;  4LF6 I;  1Z5B A;  1KKH A;  2PNZ A;  4JG4 A;  1UEK A;  2UU9 E;  3Q6M A;  3J81 C;  1YHC A;  5BR8 E;  3B8H A;  1A6F A; 
#chains in the Genus database with same CATH homology
 4DV1 I;  2OI2 A;  1Z0C A;  1HNZ E;  4DV3 E;  4JI6 E;  4B3T E;  1Z59 A;  3HUL A;  5LMN E;  4LF5 E;  2VQF E;  4DR2 E;  2X36 A;  1N0U A;  1N36 I;  2E1R A;  3JAM Q;  1HNX I;  1ZM2 A;  1NZ0 A;  3PYE A;  1Y4S A;  1FWL A;  2R3V A;  4DUZ E;  2CZ9 A;  1Z0E A;  1I94 E;  4DV6 E;  4DV0 I;  4DR6 I;  4USM A;  4YY3 I;  3WU4 A;  4K0K I;  4DUY E;  1XMO I;  4YHH E;  2HFU A;  4IZJ B;  4JI1 I;  4JI3 I;  5IWA I;  3GON A;  3J7A G;  2UXB E;  4HYM A;  4JI8 I;  1H73 A;  4N3O A;  1EA6 A;  3ZZ0 A;  4JI5 I;  2Z5C A;  4KHP I;  1U2R A;  2O1U A;  4DV5 E;  1RRE A;  4Z7Y A;  5LL6 R;  2UXD E;  2GQ0 A;  4DV2 I;  2EFG A;  3B78 A;  1IBL I;  4DPU A;  1ZM3 A;  1H7S A;  1MU5 A;  4DR7 E;  5A2Q C;  4DR4 E;  2VQE I;  3ZM7 A;  3K1J A;  4KQV A;  2O1V A;  2Q2E B;  5GME A;  4GKK I;  2LJP A;  3WU3 A;  4JI4 I;  2HK3 A;  4DXL A;  2V2Q A;  5IT9 C;  1ZM9 A;  1HNW E;  2UXC I;  4WUD A;  1FJG E;  4MYU A;  4UTG A;  1XHK A;  3H4L A;  1Z0T A;  4ED4 A;  4DPX A;  1Z0W A;  4LFB E;  4X65 E;  3Q6N A;  2HKE A;  4DR3 E;  4LFC E;  3K85 A;  4R1F A;  5FWK A;  4JYA E;  3PRY A;  2V8P A;  2ZM6 I;  1MG7 A;  1FNM A;  4JI2 E;  4EMD A;  3D4J A;  4DV4 E;  5FLX C;  4LF4 I;  5LMU E;  4JI0 I;  1N32 I;  4LF6 E;  3P06 A;  3K17 A;  1J5E I;  2UUB I;  4X64 I;  4DV1 E;  4LFA I;  4NXM I;  1B63 A;  4LF8 I;  3T1Y I;  2F4V I;  3QT5 A;  3LTO A;  4AQY E;  1IBM I;  2UUA I;  3JAM C;  3F0N A;  1ELO A;  2CGE A;  3ZKB A;  4DPW A;  4DR1 I;  2Z5C B;  1IBK E;  4ZVI A;  2CG9 A;  4DPY A;  5L3J A;  4I3H A;  3LNU A;  2BM0 A;  3V5R A;  4DR6 E;  4YY3 E;  1ZXN A;  4K0K E;  1XMQ E;  1PVG A;  1XMO E;  4GKJ I;  2XEX A;  1XNR I;  4JI1 E;  2NPF A;  2WW4 A;  3QT6 A;  4DU8 A;  2PNM A;  4DR5 E;  4JI8 E;  1Z0B A;  1HNZ I;  4FWH A;  1DAR A;  3B82 A;  4PRV A;  4B3T I;  5LMN I;  4LF5 I;  1XNQ I;  3ZZT A;  4DR2 I;  1BKN A;  4X62 E;  1IBL E;  1KTV A;  3T1H I;  2O1W A;  4XTJ A;  1PIE A;  3J80 Q;  4IZJ D;  1USU A;  2VQE E;  1H7U A;  4UT4 A;  4GKK E;  2HKJ A;  4JI7 E;  3PYF A;  2UXC E;  4LF7 I;  1NHI A;  1Z0V A;  2A2D A;  4USK A;  2R42 A;  4MYT A;  2UXB I;  4HY1 A;  1HR0 I;  4X66 E;  2VF3 A;  4M1K A;  2X7I A;  4FN5 A;  4DV7 I;  4PRX A;  1QZR A;  2UXD I;  1FI4 A;  3J7A M;  1VIS A;  4NXN E;  4DR4 I;  4LF4 E;  4JI0 E;  1N32 E;  1B62 A;  1USV A;  3M6A A;  1J5E E;  1N33 E;  4IZK A;  2V2Z A;  1MX0 A;  4HAC B;  2UUB E;  1HNW I;  2E5L I;  4LFA E;  5GMD A;  1FJG I;  1ZXM A;  1FKA E;  1N34 I;  4B3M E;  4JV5 I;  2HK2 A;  4LF8 E;  4OX9 I;  2F4V E;  1IBM E;  4B3R I;  2ZBK B;  1PKP A;  2UUA E;  1Z5C A;  1H72 C;  4PU9 A;  2Z5B A;  2Z5E A;  1Z0G A;  1Y6Z A;  4DR3 I;  1N36 E;  1KVK A;  2ZIT A;  3OTO I;  4JYA I;  3WU5 A;  1HNX E;  4LF9 I;  3V2U C;  4B3S I;  1Y4U A;  5LMU I;  3ZKD A;  1HK7 A;  4GKJ E;  1XNR E;  4DV0 E;  2HHH I;  4HAC A;  3QT7 A;  3ZZU A;  2UUC I;  1RR9 A;  1D6T A;  4JI3 E;  5IWA E;  1XNQ E;  3J81 Q;  2UU9 I;  1EI1 A;  4AQY I;  5BR8 I;  2DEJ A;  4DV3 I;  4JI6 I;  4JI5 E;  3T1H E;  4WUB A;  4KHP E;  2VQF I;  2BV3 A;  1KIJ A;  3J80 C;  1IBK I;  3PYG A;  1N0V C;  4DV2 E;  2J7K A;  3HJC A;  4DUZ I;  1XMQ I;  1H74 A;  1NHH A;  1S16 A;  1I94 I;  4LF7 E;  3CWV A;  4DV6 I;  3PYD A;  4P52 A;  4DR5 I;  4DUY I;  4JI4 E;  1NHJ A;  4YHH I;  1HR0 E;  1OJ4 A;  4P7A A;  2BM1 A;  4IZK B;  2IOQ A;  4DV7 E;  4FWG A;  4X62 I;  4HXZ A;  1Z5A A;  1K47 A;  2Z5B B;  3LPS A;  4DV5 I;  4URL A;  1FWK A;  4DPT A;  5A2Q Q;  2ZM6 E;  4DR7 I;  2O1T A;  2PNL A;  4JI7 I;  3QT8 A;  2E5L E;  4IZJ A;  1N34 E;  4JV5 E;  4OX9 E;  1WUU A;  5IT9 Q;  2V34 A;  4B3R E;  4X64 E;  2A2C A;  4X66 I;  4NXM E;  3T1Y E;  2IOP A;  1ZM4 A;  2AJ4 A;  3OTO E;  3Q1Q A;  4RPF A;  4LF9 E;  4LFB I;  2DEI A;  4X65 I;  4DU7 A;  4B3S E;  4FW9 A;  4LFC I;  4Z7C A;  4NXN I;  4DR1 E;  2HFS A;  2GS8 A;  4FWD A;  2V2V A;  4JI2 I;  4DV4 I;  5FLX Q;  2HHH E;  4WUC A;  1N33 I;  2UUC E;  1S4E A;  4B3M I;  3WU6 A;  4LF6 I;  1Z5B A;  1KKH A;  4JG4 A;  1UEK A;  2UU9 E;  3Q6M A;  3J81 C;  5BR8 E;  3B8H A;  1A6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...