2UXBI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxbI00
4X64E 1K47A 1B62A 4DR5I 5LMNE 2V2ZA 1HNXE 1WUUA 4DPWA 4JV5E 5FLXQ 5L3JA 4DU7A 1Z0GA 3T1HI 4JI2E 4HXZA 4FWHA 1FWLA 1Z0VA 1ZXNA 4UT4A 1Z5CA 4JI8I 2BV3A 4DV2I 1FJGI 4YY3I 1Z59A 2A2DA 5IWAI 2V2QA 3Q1QA 3OTOE 4AQYI 4R1FA 1A6FA 2F4VE 3LNUA 1H7UA 4DV1I 1XMQI 4DUZE 1HNZE 2X36A 2HK2A 1ZM3A 4B3ME 4JI7E 1HNWE 2UXCE 4DV3I 3V5RA 5BR8I 4LF7I 1MX0A 3J80C 4DUYE 4DR4I 1IBLE 1XMOI 3WU3A 2HHHI 4GKJI 1VISA 2ZM6E 2VQEE 4UTGA 4NXNI 4JI6I 1NHHA 1KTVA 1Z5BA 3ZZUA 2HK3A 4LFBI 4FWGA 2UXBE 1N32E 1NZ0A 4OX9I 1H73A 4B3SI 4DXLA 3K1JA 3J80Q 3JAMQ 4KHPI 4X66I 1IBKE 4DU8A 2UXDI 1HR0I 1IBME 4JYAI 4DPTA 1N33E 1NHIA 1S16A 2CZ9A 4ED4A 4YHHI 4K0KI 1KKHA 4RPFA 4JI1I 4DR6I 3K17A 1N36I 2HKEA 4HACA 4DR1I 4JI4E 2E5LE 2ZBKB 4LFCI 1J5EE 5LMUI 4GKKI 4DV0E 1S4EA 2ZITA 1XNQE 4JI5E 3J81Q 4DV7I 4B3TE 3WU5A 4PU9A 4JI0E 4DR7I 2VQFI 2UUAI 4LF8I 3WU6A 4KQVA 4HY1A 1NHJA 2HKJA 4DR2E 4LF5E 4URLA 3B82A 4X64I 1FI4A 4DR5E 1H74A 5LMNI 4DV1E 3WU4A 1Z0BA 3V2UC 4DUZI 1Z0CA 2LJPA 3T1YI 4JV5I 3QT6A 4DV5E 4LFAI 4NXMI 3T1HE 1MU5A 4DPXA 2E1RA 4DUYI 4DV6E 1ZXMA 2UUBI 2R42A 1IBLI 4X62I 1U2RA 4GKJE 4USMA 5GMEA 2J7KA 4FWDA 2HFSA 4DPYA 3ZKDA 4MYUA 4Z7YA 1N32I 4LF6I 4X65E 1Z0WA 1XNRI 4B3RE 1EI1A 4WUBA 4DR3E 2WW4A 1ZM4A 3H4LA 4DV3E 3LTOA 1HR0E 4FN5A 2UUCE 5BR8E 4DV4I 1N0VC 4DR4E 3J7AM 1PVGA 4JI3I 4NXNE 2NPFA 1FWKA 4P52A 5A2QQ 4LF4I 4LFCE 3QT7A 2DEJA 2HFUA 2OI2A 4DPUA 4B3SE 1H72C 1I94E 1ZM9A 1PIEA 3ZM7A 4X66E 1QZRA 1XNQI 1OJ4A 1Z0EA 2UXDE 1XHKA 1PKPA 4USKA 4JI5I 3B8HA 3ZZ0A 4ZVIA 1B63A 1KVKA 3J81C 4LF8E 4DR6E 3PYDA 4I3HA 3PYEA 5IT9C 2R3VA 2BM0A 2V34A 4JI8E 4JI4I 2E5LI 2UU9E 4YY3E 2A2CA 4PRXA 4JG4A 1N34E 4GKKE 5IWAE 1RR9A 4LF9E 4Z7CA 3OTOI 4AQYE 4WUDA 5IT9Q 2VF3A 1XMQE 3ZZTA 1HNXI 1ELOA 3T1YE 4XTJA 1DARA 4B3MI 4JI7I 2UXCI 4DV5I 4LFAE 1BKNA 4DR7E 3B78A 2VQFE 2UUAE 4DV6I 2UUBE 4JI2I 3D4JA 4X62E 3JAMC 1MG7A 1KIJA 1XMOE 3ZKBA 4DV2E 3PYFA 1FJGE 5A2QC 1RREA 3QT8A 4LF5I 1FKAE 3F0NA 2UXBI 4X65I 2F4VI 1XNRE 1HNZI 2BM1A 4B3RI 2DEIA 1HNWI 1IBKI 1H7SA 2V2VA 5GMDA 4NXME 2GS8A 4JYAE 1ZM2A 4LF7E 3J7AG 1N33I 2EFGA 1Z0TA 4M1KA 4EMDA 4JI3E 4K0KE 2HHHE 2ZM6I 2VQEI 4JI6E 1N36E 2XEXA 4MYTA 1FNMA 4FW9A 4LF4E 4DR1E 4LFBE 4LF6E 3CWVA 4OX9E 4PRVA 4DV0I 4WUCA 1N0UA 4DR3I 4KHPE 4HYMA 3GONA 1EA6A 2UUCI 1Z5AA 4DV7E 4DV4E 4B3TI 1IBMI 2Q2EB 1UEKA 5FLXC 2V8PA 3M6AA 4JI0I 2X7IA 4YHHE 3PYGA 3HULA 4P7AA 4JI1E 3QT5A 3LPSA 2UU9I 4DR2I 2AJ4A 1N34I 1J5EI 1I94I 5LL6R 4HACB 5LMUE 1D6TA 4LF9I
chains in the Genus database with same CATH superfamily
4X64E 1K47A 1B62A 4DR5I 5DNLA 2CG9A 5LMNE 2V2ZA 1HNXE 1USUA 1WUUA 1R6MA 2PO1B 4DPWA 4JV5E 5FLXQ 5L3JA 4DU7A 1Z0GA 3T1HI 4JI2E 4HXZA 4FWHA 5JEAA 1FWLA 1Z0VA 1ZXNA 4QNJA 4UT4A 1Z5CA 2WP8B 4JI8I 2BV3A 4DV2I 4OO1F 1FJGI 4FW4A 4YY3I 1Z59A 2A2DA 5IWAI 2V2QA 3Q1QA 2O3ZA 2Z5EA 3OTOE 4AQYI 1Y4UA 4R1FA 1A6FA 2F4VE 3LNUA 1H7UA 4DV1I 3HKMA 1XMQI 4DUZE 1HNZE 2X36A 2HK2A 3P76A 1ZM3A 4B3ME 3Q6NA 4JI7E 1HNWE 2UXCE 4DV3I 4GQUA 3CDJA 3V5RA 5BR8I 2PNMA 4LF7I 1MX0A 3J80C 4DUYE 4DR4I 1IBLE 5JEAB 1XMOI 3WU3A 2HHHI 4GKJI 1VISA 2ZM6E 2VQEE 4UTGA 4NXNI 4JI6I 1NHHA 1KTVA 4OKGA 1Z5BA 3ZZUA 2HK3A 4LCGA 4FWGA 4LFBI 1YHCA 2UXBE 2JEBB 1N32E 2NN6A 4IZKA 1NZ0A 4OX9I 1H73A 4B3SI 2NN6C 4FW3A 2IOQA 4DXLA 3K1JA 5JEAF 3J80Q 1Y6ZA 2JEBA 3JAMQ 4KHPI 4X66I 1IBKE 4DU8A 2UXDI 1HR0I 3M85D 1E3HA 1IBME 4JYAI 5C0XA 2IOPA 4DPTA 1N33E 1NHIA 1S16A 2CZ9A 4BA1B 5FWKA 4ED4A 4YHHI 4K0KI 1KKHA 1XXEA 4RPFA 4JI1I 4DR6I 5K36F 3K17A 3CDIA 1N36I 2HKEA 3HJCA 4HACA 4DR1I 2BR2B 2PO2A 2O1VA 4JI4E 4BA1A 2E5LE 2ZBKB 4LFCI 1J5EE 1UDNA 5LMUI 4GKKI 3DD6A 4DV0E 1S4EA 2ZITA 3UHMA 5K36E 1UDOA 1RHYA 1XNQE 3GCMA 4JI5E 5DNXA 3J81Q 4DV7I 4B3TE 4OO1B 1OYSA 2JT2A 4AIDA 3WU5A 4PU9A 5ELWA 4LCFA 4JI0E 4DR7I 5C0XF 2VQFI 3H1CA 2UUAI 4LF8I 1UDSA 2PNZB 3L7ZA 3WU6A 2JE6B 4KQVA 4HY1A 2NN6E 1NHJA 2HKJA 1P42A 4DR2E 4LF5E 4URLA 3B82A 1R6LA 4X64I 1FI4A 2PNZA 4DR5E 1H74A 5LMNI 4DV1E 3WU4A 1Z0BA 5EKWA 3V2UC 4DUZI 1Z0CA 2O1WA 2LJPA 2NN6F 3T1YI 4MDTA 4JV5I 3QT6A 4DV5E 4ISAA 4LFAI 4NXMI 3T1HE 3U1YA 1MU5A 4DPXA 2E1RA 2C39A 4DUYI 4DV6E 1ZXMA 2UUBI 2R42A 1OYPA 4X62I 1IBLI 1U2RA 4IFDC 2O1TA 4GKJE 4USMA 5GMEA 2J7KA 4FWDA 4U3DA 2HFSA 5K36C 4DPYA 5JEAE 4IFDE 3ZKDA 4MYUA 4J3DA 4Z7YA 2CGEA 1N32I 4LF6I 4OO1D 5JEAC 4X65E 4IZJD 2GO3A 4IFDB 3K85A 1Z0WA 2BA0D 1XNRI 4BA2A 4B3RE 1EI1A 4WUBA 4DR3E 2WNRB 2WW4A 1ZM4A 3H4LA 4DV3E 3B4TA 3Q6MA 3LTOA 1HR0E 4FN5A 2UUCE 5BR8E 4DV4I 2JEAB 5K36D 1N0VC 2WNRA 4DR4E 3J7AM 1PVGA 4BA2B 2AE8A 2GO4A 1USVA 4JI3I 2Z5CA 4NXNE 2NPFA 1FWKA 4P52A 5K36B 2IESA 2PNLA 2BA0G 5A2QQ 3L7ZB 4LF4I 4LFCE 3QT7A 2DEJA 2HFUA 2OI2A 4DPUA 4B3SE 2BA1G 1H72C 1I94E 4LCHA 1ZM9A 3KRNA 1PIEA 4FW5A 3ZM7A 4X66E 1QZRA 1XNQI 1OJ4A 1Z0EA 2UXDE 1XHKA 1PKPA 4USKA 4IFDD 2F1DA 4OO1E 4JI5I 3PS1A 3PS2A 4MU4A 2C37B 3B8HA 4OO1C 3ZZ0A 4ZVIA 3GMEA 1B63A 1KVKA 3J81C 4LF8E 4DR6E 3PYDA 4I3HA 3PYEA 2WP8A 4MU3A 5IT9C 3GLLA 4NBQA 4OO1A 3PRYA 1YH8A 4IZJA 2R3VA 2BM0A 2V34A 4JI8E 4JI4I 2E5LI 2O1UA 2UU9E 2PO0B 4LPFA 4YY3E 2A2CA 4PRXA 4JG4A 4U3BA 1N34E 4GKKE 5IWAE 1RR9A 4LF9E 4Z7CA 3OTOI 4AQYE 4WUDA 5IT9Q 4MU0A 2VF3A 4N3OA 4AM3A 1XMQE 3ZZTA 1HNXI 1ELOA 2PO0A 3T1YE 4XTJA 1DARA 4FW6A 4B3MI 3P3CA 4JI7I 2UXCI 4DV5I 4LFAE 1Y60A 1BKNA 4DR7E 2NN6D 3B78A 2VQFE 2UUAE 4IFDF 1VI7A 3M7ND 4DV6I 2UUBE 4JI2I 3D4JA 4X62E 3JAMC 1MG7A 1KIJA 1Y4SA 5DROA 1XMOE 3ZKBA 4DV2E 2IERA 3M85G 4IZJB 3PYFA 1FJGE 5A2QC 1RREA 3QT8A 4LF5I 1FKAE 3F0NA 2UXBI 4X65I 4IZKB 2C39B 2F4VI 2PO2B 3PS3A 2VESA 5K36A 1XNRE 1HNZI 2BM1A 4B3RI 2DEIA 1HNWI 2C38A 2Z5BA 4LOMA 3P06A 1IBKI 1H7SA 2V2VA 4OZEA 5GMDA 4NXME 2GS8A 5C0XB 4JYAE 1ZM2A 4LF7E 3J7AG 2JE6A 1N33I 2EFGA 1Y5YA 1Z0TA 2NN6B 4M1KA 4EMDA 4JI3E 4IS9A 4K0KE 2C37A 4QNKA 2HHHE 2ZM6I 2GQ0A 2VQEI 4JI6E 1N36E 2XEXA 4MYTA 2J65A 1FNMA 4FW9A 4LF4E 4DR1E 5JEAD 4LFBE 4LF6E 1OYRA 5C0XE 4AIMA 5DRRA 3CWVA 4OX9E 4PRVA 4DV0I 3M7NG 5EL9A 5C0XC 4WUCA 1E3PA 1N0UA 2BA1D 4DR3I 4KHPE 2Z5CB 4HYMA 3GONA 1EA6A 4MQYA 3U1KA 2PO1A 2UUCI 1Z5AA 4DV7E 4DV4E 4B3TI 1IBMI 3P3GA 2Q2EB 1UEKA 2BR2A 2JEAA 2CVEA 5FLXC 4MU1A 2V8PA 3M6AA 4JI0I 2X7IA 4YHHE 1HK7A 3PYGA 3HULA 4FW7A 4P7AA 4JI1E 5DRPA 3NZKA 3P3EA 2C38B 2Z5BB 5DRQA 5C0XD 3QT5A 4IFDA 3LPSA 2UU9I 4DR2I 1UDQA 2AJ4A 1N34I 1J5EI 1I94I 5LL6R 4HACB 5LMUE 1D6TA 4LF9I
chains in the Genus database with same CATH topology
4X64E 1K47A 1B62A 4DR5I 2CG9A 5LMNE 2V2ZA 1HNXE 1USUA 1WUUA 4DPWA 4JV5E 5FLXQ 5L3JA 4DU7A 1Z0GA 3T1HI 4JI2E 4HXZA 4FWHA 1FWLA 1Z0VA 1ZXNA 4UT4A 1Z5CA 4JI8I 2BV3A 4DV2I 1FJGI 4YY3I 1Z59A 2A2DA 5IWAI 2V2QA 3Q1QA 2Z5EA 3OTOE 4AQYI 1Y4UA 4R1FA 1A6FA 2F4VE 3LNUA 1H7UA 4DV1I 1XMQI 4DUZE 1HNZE 2X36A 2HK2A 1ZM3A 4B3ME 3Q6NA 4JI7E 1HNWE 2UXCE 4DV3I 3V5RA 5BR8I 2PNMA 4LF7I 1MX0A 3J80C 4DUYE 4DR4I 1IBLE 1XMOI 3WU3A 2HHHI 4GKJI 1VISA 2ZM6E 2VQEE 4UTGA 4NXNI 4JI6I 1NHHA 1KTVA 1Z5BA 3ZZUA 2HK3A 4LFBI 4FWGA 2UXBE 1N32E 4IZKA 1NZ0A 4OX9I 1H73A 4B3SI 2IOQA 4DXLA 3K1JA 3J80Q 1Y6ZA 3JAMQ 4KHPI 4X66I 1IBKE 4DU8A 2UXDI 1HR0I 1IBME 4JYAI 2IOPA 4DPTA 1N33E 1NHIA 1S16A 2CZ9A 5FWKA 4ED4A 4YHHI 4K0KI 1KKHA 4RPFA 4JI1I 4DR6I 3K17A 1N36I 2HKEA 3HJCA 4HACA 4DR1I 2O1VA 4JI4E 2E5LE 2ZBKB 4LFCI 1J5EE 5LMUI 4GKKI 4DV0E 1S4EA 2ZITA 1XNQE 4JI5E 3J81Q 4DV7I 4B3TE 3WU5A 4PU9A 4JI0E 4DR7I 2VQFI 2UUAI 4LF8I 3WU6A 4KQVA 4HY1A 1NHJA 2HKJA 4DR2E 4LF5E 4URLA 3B82A 4X64I 1FI4A 4DR5E 1H74A 5LMNI 4DV1E 3WU4A 1Z0BA 3V2UC 4DUZI 1Z0CA 2O1WA 2LJPA 3T1YI 4JV5I 3QT6A 4DV5E 4LFAI 4NXMI 3T1HE 1MU5A 4DPXA 2E1RA 4DUYI 4DV6E 1ZXMA 2UUBI 2R42A 1IBLI 4X62I 1U2RA 2O1TA 4GKJE 4USMA 5GMEA 2J7KA 4FWDA 2HFSA 4DPYA 3ZKDA 4MYUA 4Z7YA 2CGEA 1N32I 4LF6I 4X65E 4IZJD 3K85A 1Z0WA 1XNRI 4B3RE 1EI1A 4WUBA 4DR3E 2WW4A 1ZM4A 3H4LA 4DV3E 3Q6MA 3LTOA 1HR0E 4FN5A 2UUCE 5BR8E 4DV4I 1N0VC 4DR4E 3J7AM 1PVGA 1USVA 4JI3I 2Z5CA 4NXNE 2NPFA 1FWKA 4P52A 2PNLA 5A2QQ 4LF4I 4LFCE 3QT7A 2DEJA 2HFUA 2OI2A 4DPUA 4B3SE 1H72C 1I94E 1ZM9A 1PIEA 3ZM7A 4X66E 1QZRA 1XNQI 1OJ4A 1Z0EA 2UXDE 1XHKA 1PKPA 4USKA 4JI5I 3B8HA 3ZZ0A 4ZVIA 1B63A 1KVKA 3J81C 4LF8E 4DR6E 3PYDA 4I3HA 3PYEA 5IT9C 3PRYA 4IZJA 2R3VA 2BM0A 2V34A 4JI8E 4JI4I 2E5LI 2O1UA 2UU9E 4YY3E 2A2CA 4PRXA 4JG4A 1N34E 4GKKE 5IWAE 1RR9A 4LF9E 4Z7CA 3OTOI 4AQYE 4WUDA 5IT9Q 2VF3A 4N3OA 1XMQE 3ZZTA 1HNXI 1ELOA 3T1YE 4XTJA 1DARA 4B3MI 4JI7I 2UXCI 4DV5I 4LFAE 1BKNA 4DR7E 3B78A 2VQFE 2UUAE 4DV6I 2UUBE 4JI2I 3D4JA 4X62E 3JAMC 1MG7A 1KIJA 1Y4SA 1XMOE 3ZKBA 4DV2E 4IZJB 3PYFA 1FJGE 5A2QC 1RREA 3QT8A 4LF5I 1FKAE 3F0NA 2UXBI 4X65I 4IZKB 2F4VI 1XNRE 1HNZI 2BM1A 4B3RI 2DEIA 1HNWI 2Z5BA 3P06A 1IBKI 1H7SA 2V2VA 5GMDA 4NXME 2GS8A 4JYAE 1ZM2A 4LF7E 3J7AG 1N33I 2EFGA 1Z0TA 4M1KA 4EMDA 4JI3E 4K0KE 2HHHE 2ZM6I 2GQ0A 2VQEI 4JI6E 1N36E 2XEXA 4MYTA 1FNMA 4FW9A 4LF4E 4DR1E 4LFBE 4LF6E 3CWVA 4OX9E 4PRVA 4DV0I 4WUCA 1N0UA 4DR3I 4KHPE 2Z5CB 4HYMA 3GONA 1EA6A 2UUCI 1Z5AA 4DV7E 4DV4E 4B3TI 1IBMI 2Q2EB 1UEKA 5FLXC 2V8PA 3M6AA 4JI0I 2X7IA 4YHHE 1HK7A 3PYGA 3HULA 4P7AA 4JI1E 2Z5BB 3QT5A 3LPSA 2UU9I 4DR2I 2AJ4A 1N34I 1J5EI 1I94I 5LL6R 4HACB 5LMUE 1D6TA 4LF9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 E;  1K47 A;  1B62 A;  4DR5 I;  5LMN E;  2V2Z A;  1HNX E;  1WUU A;  4DPW A;  4JV5 E;  5FLX Q;  5L3J A;  4DU7 A;  1Z0G A;  3T1H I;  4JI2 E;  4HXZ A;  4FWH A;  1FWL A;  1Z0V A;  1ZXN A;  4UT4 A;  1Z5C A;  4JI8 I;  2BV3 A;  4DV2 I;  1FJG I;  4YY3 I;  1Z59 A;  2A2D A;  5IWA I;  2V2Q A;  3Q1Q A;  3OTO E;  4AQY I;  4R1F A;  1A6F A;  2F4V E;  3LNU A;  1H7U A;  4DV1 I;  1XMQ I;  4DUZ E;  1HNZ E;  2X36 A;  2HK2 A;  1ZM3 A;  4B3M E;  4JI7 E;  1HNW E;  2UXC E;  4DV3 I;  3V5R A;  5BR8 I;  4LF7 I;  1MX0 A;  3J80 C;  4DUY E;  4DR4 I;  1IBL E;  1XMO I;  3WU3 A;  2HHH I;  4GKJ I;  1VIS A;  2ZM6 E;  2VQE E;  4UTG A;  4NXN I;  4JI6 I;  1NHH A;  1KTV A;  1Z5B A;  3ZZU A;  2HK3 A;  4LFB I;  4FWG A;  2UXB E;  1N32 E;  1NZ0 A;  4OX9 I;  1H73 A;  4B3S I;  4DXL A;  3K1J A;  3J80 Q;  3JAM Q;  4KHP I;  4X66 I;  1IBK E;  4DU8 A;  2UXD I;  1HR0 I;  1IBM E;  4JYA I;  4DPT A;  1N33 E;  1NHI A;  1S16 A;  2CZ9 A;  4ED4 A;  4YHH I;  4K0K I;  1KKH A;  4RPF A;  4JI1 I;  4DR6 I;  3K17 A;  1N36 I;  2HKE A;  4HAC A;  4DR1 I;  4JI4 E;  2E5L E;  2ZBK B;  4LFC I;  1J5E E;  5LMU I;  4GKK I;  4DV0 E;  1S4E A;  2ZIT A;  1XNQ E;  4JI5 E;  3J81 Q;  4DV7 I;  4B3T E;  3WU5 A;  4PU9 A;  4JI0 E;  4DR7 I;  2VQF I;  2UUA I;  4LF8 I;  3WU6 A;  4KQV A;  4HY1 A;  1NHJ A;  2HKJ A;  4DR2 E;  4LF5 E;  4URL A;  3B82 A;  4X64 I;  1FI4 A;  4DR5 E;  1H74 A;  5LMN I;  4DV1 E;  3WU4 A;  1Z0B A;  3V2U C;  4DUZ I;  1Z0C A;  2LJP A;  3T1Y I;  4JV5 I;  3QT6 A;  4DV5 E;  4LFA I;  4NXM I;  3T1H E;  1MU5 A;  4DPX A;  2E1R A;  4DUY I;  4DV6 E;  1ZXM A;  2UUB I;  2R42 A;  1IBL I;  4X62 I;  1U2R A;  4GKJ E;  4USM A;  5GME A;  2J7K A;  4FWD A;  2HFS A;  4DPY A;  3ZKD A;  4MYU A;  4Z7Y A;  1N32 I;  4LF6 I;  4X65 E;  1Z0W A;  1XNR I;  4B3R E;  1EI1 A;  4WUB A;  4DR3 E;  2WW4 A;  1ZM4 A;  3H4L A;  4DV3 E;  3LTO A;  1HR0 E;  4FN5 A;  2UUC E;  5BR8 E;  4DV4 I;  1N0V C;  4DR4 E;  3J7A M;  1PVG A;  4JI3 I;  4NXN E;  2NPF A;  1FWK A;  4P52 A;  5A2Q Q;  4LF4 I;  4LFC E;  3QT7 A;  2DEJ A;  2HFU A;  2OI2 A;  4DPU A;  4B3S E;  1H72 C;  1I94 E;  1ZM9 A;  1PIE A;  3ZM7 A;  4X66 E;  1QZR A;  1XNQ I;  1OJ4 A;  1Z0E A;  2UXD E;  1XHK A;  1PKP A;  4USK A;  4JI5 I;  3B8H A;  3ZZ0 A;  4ZVI A;  1B63 A;  1KVK A;  3J81 C;  4LF8 E;  4DR6 E;  3PYD A;  4I3H A;  3PYE A;  5IT9 C;  2R3V A;  2BM0 A;  2V34 A;  4JI8 E;  4JI4 I;  2E5L I;  2UU9 E;  4YY3 E;  2A2C A;  4PRX A;  4JG4 A;  1N34 E;  4GKK E;  5IWA E;  1RR9 A;  4LF9 E;  4Z7C A;  3OTO I;  4AQY E;  4WUD A;  5IT9 Q;  2VF3 A;  1XMQ E;  3ZZT A;  1HNX I;  1ELO A;  3T1Y E;  4XTJ A;  1DAR A;  4B3M I;  4JI7 I;  2UXC I;  4DV5 I;  4LFA E;  1BKN A;  4DR7 E;  3B78 A;  2VQF E;  2UUA E;  4DV6 I;  2UUB E;  4JI2 I;  3D4J A;  4X62 E;  3JAM C;  1MG7 A;  1KIJ A;  1XMO E;  3ZKB A;  4DV2 E;  3PYF A;  1FJG E;  5A2Q C;  1RRE A;  3QT8 A;  4LF5 I;  1FKA E;  3F0N A;  2UXB I;  4X65 I;  2F4V I;  1XNR E;  1HNZ I;  2BM1 A;  4B3R I;  2DEI A;  1HNW I;  1IBK I;  1H7S A;  2V2V A;  5GMD A;  4NXM E;  2GS8 A;  4JYA E;  1ZM2 A;  4LF7 E;  3J7A G;  1N33 I;  2EFG A;  1Z0T A;  4M1K A;  4EMD A;  4JI3 E;  4K0K E;  2HHH E;  2ZM6 I;  2VQE I;  4JI6 E;  1N36 E;  2XEX A;  4MYT A;  1FNM A;  4FW9 A;  4LF4 E;  4DR1 E;  4LFB E;  4LF6 E;  3CWV A;  4OX9 E;  4PRV A;  4DV0 I;  4WUC A;  1N0U A;  4DR3 I;  4KHP E;  4HYM A;  3GON A;  1EA6 A;  2UUC I;  1Z5A A;  4DV7 E;  4DV4 E;  4B3T I;  1IBM I;  2Q2E B;  1UEK A;  5FLX C;  2V8P A;  3M6A A;  4JI0 I;  2X7I A;  4YHH E;  3PYG A;  3HUL A;  4P7A A;  4JI1 E;  3QT5 A;  3LPS A;  2UU9 I;  4DR2 I;  2AJ4 A;  1N34 I;  1J5E I;  1I94 I;  5LL6 R;  4HAC B;  5LMU E;  1D6T A;  4LF9 I; 
#chains in the Genus database with same CATH topology
 4X64 E;  1K47 A;  1B62 A;  4DR5 I;  5DNL A;  2CG9 A;  5LMN E;  2V2Z A;  1HNX E;  1USU A;  1WUU A;  1R6M A;  2PO1 B;  4DPW A;  4JV5 E;  5FLX Q;  5L3J A;  4DU7 A;  1Z0G A;  3T1H I;  4JI2 E;  4HXZ A;  4FWH A;  5JEA A;  1FWL A;  1Z0V A;  1ZXN A;  4QNJ A;  4UT4 A;  1Z5C A;  2WP8 B;  4JI8 I;  2BV3 A;  4DV2 I;  4OO1 F;  1FJG I;  4FW4 A;  4YY3 I;  1Z59 A;  2A2D A;  5IWA I;  2V2Q A;  3Q1Q A;  2O3Z A;  2Z5E A;  3OTO E;  4AQY I;  1Y4U A;  4R1F A;  1A6F A;  2F4V E;  3LNU A;  1H7U A;  4DV1 I;  3HKM A;  1XMQ I;  4DUZ E;  1HNZ E;  2X36 A;  2HK2 A;  3P76 A;  1ZM3 A;  4B3M E;  3Q6N A;  4JI7 E;  1HNW E;  2UXC E;  4DV3 I;  4GQU A;  3CDJ A;  3V5R A;  5BR8 I;  2PNM A;  4LF7 I;  1MX0 A;  3J80 C;  4DUY E;  4DR4 I;  1IBL E;  5JEA B;  1XMO I;  3WU3 A;  2HHH I;  4GKJ I;  1VIS A;  2ZM6 E;  2VQE E;  4UTG A;  4NXN I;  4JI6 I;  1NHH A;  1KTV A;  4OKG A;  1Z5B A;  3ZZU A;  2HK3 A;  4LCG A;  4FWG A;  4LFB I;  1YHC A;  2UXB E;  2JEB B;  1N32 E;  2NN6 A;  4IZK A;  1NZ0 A;  4OX9 I;  1H73 A;  4B3S I;  2NN6 C;  4FW3 A;  2IOQ A;  4DXL A;  3K1J A;  5JEA F;  3J80 Q;  1Y6Z A;  2JEB A;  3JAM Q;  4KHP I;  4X66 I;  1IBK E;  4DU8 A;  2UXD I;  1HR0 I;  3M85 D;  1E3H A;  1IBM E;  4JYA I;  5C0X A;  2IOP A;  4DPT A;  1N33 E;  1NHI A;  1S16 A;  2CZ9 A;  4BA1 B;  5FWK A;  4ED4 A;  4YHH I;  4K0K I;  1KKH A;  1XXE A;  4RPF A;  4JI1 I;  4DR6 I;  5K36 F;  3K17 A;  3CDI A;  1N36 I;  2HKE A;  3HJC A;  4HAC A;  4DR1 I;  2BR2 B;  2PO2 A;  2O1V A;  4JI4 E;  4BA1 A;  2E5L E;  2ZBK B;  4LFC I;  1J5E E;  1UDN A;  5LMU I;  4GKK I;  3DD6 A;  4DV0 E;  1S4E A;  2ZIT A;  3UHM A;  5K36 E;  1UDO A;  1RHY A;  1XNQ E;  3GCM A;  4JI5 E;  5DNX A;  3J81 Q;  4DV7 I;  4B3T E;  4OO1 B;  1OYS A;  2JT2 A;  4AID A;  3WU5 A;  4PU9 A;  5ELW A;  4LCF A;  4JI0 E;  4DR7 I;  5C0X F;  2VQF I;  3H1C A;  2UUA I;  4LF8 I;  1UDS A;  2PNZ B;  3L7Z A;  3WU6 A;  2JE6 B;  4KQV A;  4HY1 A;  2NN6 E;  1NHJ A;  2HKJ A;  1P42 A;  4DR2 E;  4LF5 E;  4URL A;  3B82 A;  1R6L A;  4X64 I;  1FI4 A;  2PNZ A;  4DR5 E;  1H74 A;  5LMN I;  4DV1 E;  3WU4 A;  1Z0B A;  5EKW A;  3V2U C;  4DUZ I;  1Z0C A;  2O1W A;  2LJP A;  2NN6 F;  3T1Y I;  4MDT A;  4JV5 I;  3QT6 A;  4DV5 E;  4ISA A;  4LFA I;  4NXM I;  3T1H E;  3U1Y A;  1MU5 A;  4DPX A;  2E1R A;  2C39 A;  4DUY I;  4DV6 E;  1ZXM A;  2UUB I;  2R42 A;  1OYP A;  4X62 I;  1IBL I;  1U2R A;  4IFD C;  2O1T A;  4GKJ E;  4USM A;  5GME A;  2J7K A;  4FWD A;  4U3D A;  2HFS A;  5K36 C;  4DPY A;  5JEA E;  4IFD E;  3ZKD A;  4MYU A;  4J3D A;  4Z7Y A;  2CGE A;  1N32 I;  4LF6 I;  4OO1 D;  5JEA C;  4X65 E;  4IZJ D;  2GO3 A;  4IFD B;  3K85 A;  1Z0W A;  2BA0 D;  1XNR I;  4BA2 A;  4B3R E;  1EI1 A;  4WUB A;  4DR3 E;  2WNR B;  2WW4 A;  1ZM4 A;  3H4L A;  4DV3 E;  3B4T A;  3Q6M A;  3LTO A;  1HR0 E;  4FN5 A;  2UUC E;  5BR8 E;  4DV4 I;  2JEA B;  5K36 D;  1N0V C;  2WNR A;  4DR4 E;  3J7A M;  1PVG A;  4BA2 B;  2AE8 A;  2GO4 A;  1USV A;  4JI3 I;  2Z5C A;  4NXN E;  2NPF A;  1FWK A;  4P52 A;  5K36 B;  2IES A;  2PNL A;  2BA0 G;  5A2Q Q;  3L7Z B;  4LF4 I;  4LFC E;  3QT7 A;  2DEJ A;  2HFU A;  2OI2 A;  4DPU A;  4B3S E;  2BA1 G;  1H72 C;  1I94 E;  4LCH A;  1ZM9 A;  3KRN A;  1PIE A;  4FW5 A;  3ZM7 A;  4X66 E;  1QZR A;  1XNQ I;  1OJ4 A;  1Z0E A;  2UXD E;  1XHK A;  1PKP A;  4USK A;  4IFD D;  2F1D A;  4OO1 E;  4JI5 I;  3PS1 A;  3PS2 A;  4MU4 A;  2C37 B;  3B8H A;  4OO1 C;  3ZZ0 A;  4ZVI A;  3GME A;  1B63 A;  1KVK A;  3J81 C;  4LF8 E;  4DR6 E;  3PYD A;  4I3H A;  3PYE A;  2WP8 A;  4MU3 A;  5IT9 C;  3GLL A;  4NBQ A;  4OO1 A;  3PRY A;  1YH8 A;  4IZJ A;  2R3V A;  2BM0 A;  2V34 A;  4JI8 E;  4JI4 I;  2E5L I;  2O1U A;  2UU9 E;  2PO0 B;  4LPF A;  4YY3 E;  2A2C A;  4PRX A;  4JG4 A;  4U3B A;  1N34 E;  4GKK E;  5IWA E;  1RR9 A;  4LF9 E;  4Z7C A;  3OTO I;  4AQY E;  4WUD A;  5IT9 Q;  4MU0 A;  2VF3 A;  4N3O A;  4AM3 A;  1XMQ E;  3ZZT A;  1HNX I;  1ELO A;  2PO0 A;  3T1Y E;  4XTJ A;  1DAR A;  4FW6 A;  4B3M I;  3P3C A;  4JI7 I;  2UXC I;  4DV5 I;  4LFA E;  1Y60 A;  1BKN A;  4DR7 E;  2NN6 D;  3B78 A;  2VQF E;  2UUA E;  4IFD F;  1VI7 A;  3M7N D;  4DV6 I;  2UUB E;  4JI2 I;  3D4J A;  4X62 E;  3JAM C;  1MG7 A;  1KIJ A;  1Y4S A;  5DRO A;  1XMO E;  3ZKB A;  4DV2 E;  2IER A;  3M85 G;  4IZJ B;  3PYF A;  1FJG E;  5A2Q C;  1RRE A;  3QT8 A;  4LF5 I;  1FKA E;  3F0N A;  2UXB I;  4X65 I;  4IZK B;  2C39 B;  2F4V I;  2PO2 B;  3PS3 A;  2VES A;  5K36 A;  1XNR E;  1HNZ I;  2BM1 A;  4B3R I;  2DEI A;  1HNW I;  2C38 A;  2Z5B A;  4LOM A;  3P06 A;  1IBK I;  1H7S A;  2V2V A;  4OZE A;  5GMD A;  4NXM E;  2GS8 A;  5C0X B;  4JYA E;  1ZM2 A;  4LF7 E;  3J7A G;  2JE6 A;  1N33 I;  2EFG A;  1Y5Y A;  1Z0T A;  2NN6 B;  4M1K A;  4EMD A;  4JI3 E;  4IS9 A;  4K0K E;  2C37 A;  4QNK A;  2HHH E;  2ZM6 I;  2GQ0 A;  2VQE I;  4JI6 E;  1N36 E;  2XEX A;  4MYT A;  2J65 A;  1FNM A;  4FW9 A;  4LF4 E;  4DR1 E;  5JEA D;  4LFB E;  4LF6 E;  1OYR A;  5C0X E;  4AIM A;  5DRR A;  3CWV A;  4OX9 E;  4PRV A;  4DV0 I;  3M7N G;  5EL9 A;  5C0X C;  4WUC A;  1E3P A;  1N0U A;  2BA1 D;  4DR3 I;  4KHP E;  2Z5C B;  4HYM A;  3GON A;  1EA6 A;  4MQY A;  3U1K A;  2PO1 A;  2UUC I;  1Z5A A;  4DV7 E;  4DV4 E;  4B3T I;  1IBM I;  3P3G A;  2Q2E B;  1UEK A;  2BR2 A;  2JEA A;  2CVE A;  5FLX C;  4MU1 A;  2V8P A;  3M6A A;  4JI0 I;  2X7I A;  4YHH E;  1HK7 A;  3PYG A;  3HUL A;  4FW7 A;  4P7A A;  4JI1 E;  5DRP A;  3NZK A;  3P3E A;  2C38 B;  2Z5B B;  5DRQ A;  5C0X D;  3QT5 A;  4IFD A;  3LPS A;  2UU9 I;  4DR2 I;  1UDQ A;  2AJ4 A;  1N34 I;  1J5E I;  1I94 I;  5LL6 R;  4HAC B;  5LMU E;  1D6T A;  4LF9 I; 
#chains in the Genus database with same CATH homology
 4X64 E;  1K47 A;  1B62 A;  4DR5 I;  2CG9 A;  5LMN E;  2V2Z A;  1HNX E;  1USU A;  1WUU A;  4DPW A;  4JV5 E;  5FLX Q;  5L3J A;  4DU7 A;  1Z0G A;  3T1H I;  4JI2 E;  4HXZ A;  4FWH A;  1FWL A;  1Z0V A;  1ZXN A;  4UT4 A;  1Z5C A;  4JI8 I;  2BV3 A;  4DV2 I;  1FJG I;  4YY3 I;  1Z59 A;  2A2D A;  5IWA I;  2V2Q A;  3Q1Q A;  2Z5E A;  3OTO E;  4AQY I;  1Y4U A;  4R1F A;  1A6F A;  2F4V E;  3LNU A;  1H7U A;  4DV1 I;  1XMQ I;  4DUZ E;  1HNZ E;  2X36 A;  2HK2 A;  1ZM3 A;  4B3M E;  3Q6N A;  4JI7 E;  1HNW E;  2UXC E;  4DV3 I;  3V5R A;  5BR8 I;  2PNM A;  4LF7 I;  1MX0 A;  3J80 C;  4DUY E;  4DR4 I;  1IBL E;  1XMO I;  3WU3 A;  2HHH I;  4GKJ I;  1VIS A;  2ZM6 E;  2VQE E;  4UTG A;  4NXN I;  4JI6 I;  1NHH A;  1KTV A;  1Z5B A;  3ZZU A;  2HK3 A;  4LFB I;  4FWG A;  2UXB E;  1N32 E;  4IZK A;  1NZ0 A;  4OX9 I;  1H73 A;  4B3S I;  2IOQ A;  4DXL A;  3K1J A;  3J80 Q;  1Y6Z A;  3JAM Q;  4KHP I;  4X66 I;  1IBK E;  4DU8 A;  2UXD I;  1HR0 I;  1IBM E;  4JYA I;  2IOP A;  4DPT A;  1N33 E;  1NHI A;  1S16 A;  2CZ9 A;  5FWK A;  4ED4 A;  4YHH I;  4K0K I;  1KKH A;  4RPF A;  4JI1 I;  4DR6 I;  3K17 A;  1N36 I;  2HKE A;  3HJC A;  4HAC A;  4DR1 I;  2O1V A;  4JI4 E;  2E5L E;  2ZBK B;  4LFC I;  1J5E E;  5LMU I;  4GKK I;  4DV0 E;  1S4E A;  2ZIT A;  1XNQ E;  4JI5 E;  3J81 Q;  4DV7 I;  4B3T E;  3WU5 A;  4PU9 A;  4JI0 E;  4DR7 I;  2VQF I;  2UUA I;  4LF8 I;  3WU6 A;  4KQV A;  4HY1 A;  1NHJ A;  2HKJ A;  4DR2 E;  4LF5 E;  4URL A;  3B82 A;  4X64 I;  1FI4 A;  4DR5 E;  1H74 A;  5LMN I;  4DV1 E;  3WU4 A;  1Z0B A;  3V2U C;  4DUZ I;  1Z0C A;  2O1W A;  2LJP A;  3T1Y I;  4JV5 I;  3QT6 A;  4DV5 E;  4LFA I;  4NXM I;  3T1H E;  1MU5 A;  4DPX A;  2E1R A;  4DUY I;  4DV6 E;  1ZXM A;  2UUB I;  2R42 A;  1IBL I;  4X62 I;  1U2R A;  2O1T A;  4GKJ E;  4USM A;  5GME A;  2J7K A;  4FWD A;  2HFS A;  4DPY A;  3ZKD A;  4MYU A;  4Z7Y A;  2CGE A;  1N32 I;  4LF6 I;  4X65 E;  4IZJ D;  3K85 A;  1Z0W A;  1XNR I;  4B3R E;  1EI1 A;  4WUB A;  4DR3 E;  2WW4 A;  1ZM4 A;  3H4L A;  4DV3 E;  3Q6M A;  3LTO A;  1HR0 E;  4FN5 A;  2UUC E;  5BR8 E;  4DV4 I;  1N0V C;  4DR4 E;  3J7A M;  1PVG A;  1USV A;  4JI3 I;  2Z5C A;  4NXN E;  2NPF A;  1FWK A;  4P52 A;  2PNL A;  5A2Q Q;  4LF4 I;  4LFC E;  3QT7 A;  2DEJ A;  2HFU A;  2OI2 A;  4DPU A;  4B3S E;  1H72 C;  1I94 E;  1ZM9 A;  1PIE A;  3ZM7 A;  4X66 E;  1QZR A;  1XNQ I;  1OJ4 A;  1Z0E A;  2UXD E;  1XHK A;  1PKP A;  4USK A;  4JI5 I;  3B8H A;  3ZZ0 A;  4ZVI A;  1B63 A;  1KVK A;  3J81 C;  4LF8 E;  4DR6 E;  3PYD A;  4I3H A;  3PYE A;  5IT9 C;  3PRY A;  4IZJ A;  2R3V A;  2BM0 A;  2V34 A;  4JI8 E;  4JI4 I;  2E5L I;  2O1U A;  2UU9 E;  4YY3 E;  2A2C A;  4PRX A;  4JG4 A;  1N34 E;  4GKK E;  5IWA E;  1RR9 A;  4LF9 E;  4Z7C A;  3OTO I;  4AQY E;  4WUD A;  5IT9 Q;  2VF3 A;  4N3O A;  1XMQ E;  3ZZT A;  1HNX I;  1ELO A;  3T1Y E;  4XTJ A;  1DAR A;  4B3M I;  4JI7 I;  2UXC I;  4DV5 I;  4LFA E;  1BKN A;  4DR7 E;  3B78 A;  2VQF E;  2UUA E;  4DV6 I;  2UUB E;  4JI2 I;  3D4J A;  4X62 E;  3JAM C;  1MG7 A;  1KIJ A;  1Y4S A;  1XMO E;  3ZKB A;  4DV2 E;  4IZJ B;  3PYF A;  1FJG E;  5A2Q C;  1RRE A;  3QT8 A;  4LF5 I;  1FKA E;  3F0N A;  2UXB I;  4X65 I;  4IZK B;  2F4V I;  1XNR E;  1HNZ I;  2BM1 A;  4B3R I;  2DEI A;  1HNW I;  2Z5B A;  3P06 A;  1IBK I;  1H7S A;  2V2V A;  5GMD A;  4NXM E;  2GS8 A;  4JYA E;  1ZM2 A;  4LF7 E;  3J7A G;  1N33 I;  2EFG A;  1Z0T A;  4M1K A;  4EMD A;  4JI3 E;  4K0K E;  2HHH E;  2ZM6 I;  2GQ0 A;  2VQE I;  4JI6 E;  1N36 E;  2XEX A;  4MYT A;  1FNM A;  4FW9 A;  4LF4 E;  4DR1 E;  4LFB E;  4LF6 E;  3CWV A;  4OX9 E;  4PRV A;  4DV0 I;  4WUC A;  1N0U A;  4DR3 I;  4KHP E;  2Z5C B;  4HYM A;  3GON A;  1EA6 A;  2UUC I;  1Z5A A;  4DV7 E;  4DV4 E;  4B3T I;  1IBM I;  2Q2E B;  1UEK A;  5FLX C;  2V8P A;  3M6A A;  4JI0 I;  2X7I A;  4YHH E;  1HK7 A;  3PYG A;  3HUL A;  4P7A A;  4JI1 E;  2Z5B B;  3QT5 A;  3LPS A;  2UU9 I;  4DR2 I;  2AJ4 A;  1N34 I;  1J5E I;  1I94 I;  5LL6 R;  4HAC B;  5LMU E;  1D6T A;  4LF9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...