2UXBI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxbI00
2F4VE 4DV5I 1KIJA 4UTGA 4NXME 4NXMI 3K17A 5IWAE 3QT6A 4DR2E 5IWAI 2UXCE 2V2VA 4HY1A 4DR5I 1XNQI 3H4LA 4USKA 3ZKBA 4JI1I 1ELOA 3LNUA 1UEKA 2X36A 3V5RA 1N34I 4GKKI 1H72C 4LF6I 2DEIA 2A2CA 1XMOI 4LF5E 4HACB 4LF5I 1PKPA 1IBKI 1NHHA 3WU6A 2HHHE 4KHPE 4JI6E 3T1HI 4WUDA 1Z0EA 1ZM9A 3ZZ0A 4X66I 1H74A 2E1RA 4USMA 4LFCE 4B3ME 2BM1A 3LPSA 1FNMA 1K47A 4DV4E 1XMQE 1N0UA 1HNZI 1IBLE 4DR4E 1XHKA 4RPFA 4DUYI 4FWHA 4DV1E 4LFAE 1B63A 4DPUA 2VQFE 4P52A 1VISA 1Z0TA 4GKKE 4AQYI 3K1JA 1KVKA 4DV7E 4B3RE 1Z5CA 4Z7YA 1N32I 1KKHA 1RR9A 2V34A 2UXCI 5GMEA 4DV3I 2R42A 4FW9A 1H7SA 2VF3A 4JI7I 1H7UA 5IT9C 1HNXI 4DV6E 1ZM2A 1Z0WA 4GKJI 1A6FA 1Z59A 1N36E 2OI2A 4GKJE 3QT8A 4NXNI 1OJ4A 4DV4I 1ZM3A 1PIEA 3WU3A 4LF9E 3LTOA 2UU9E 4B3TE 1D6TA 4DUYE 1EI1A 5BR8E 1I94I 3QT7A 1HNWI 1HNWE 4LFCI 4JI3E 2J7KA 4JI3I 5IT9Q 3T1YE 2V8PA 4X62E 2HK3A 1FI4A 2BM0A 4ZVIA 4HXZA 4X64I 4M1KA 3J7AM 5A2QC 2AJ4A 2UXBI 2UXDI 2BV3A 1HNZE 2UUCE 4B3RI 1Z0GA 4LF7E 1N32E 2EFGA 4P7AA 4JV5I 4JV5E 4MYUA 4DV1I 4DPTA 3PYEA 4DV3E 1Z0BA 4DU7A 4WUBA 3PYGA 1Z5BA 4JI7E 4ED4A 1B62A 4DV0I 1HNXE 4AQYE 5LMUE 1MG7A 5LMUI 4I3HA 1N36I 4JI0E 4DUZI 2UUAE 1N0VC 4NXNE 4DR6E 4OX9I 1IBKE 4OX9E 4DR1E 4K0KE 1BKNA 2HFUA 4PRXA 2VQEI 2VQEE 3J7AG 4Z7CA 3B82A 3HULA 4PRVA 3ZZUA 4LF8I 2UUBI 4JI4E 3PYDA 5GMDA 1ZXMA 1IBLI 2UUCI 2A2DA 1FWLA 5L3JA 4B3TI 1IBME 1Z0CA 1DARA 3QT5A 4JYAE 4URLA 2XEXA 4YY3I 4YY3E 2DEJA 3PYFA 3ZKDA 1NHJA 4DPXA 4FN5A 1KTVA 4HYMA 4DV7I 4B3SI 2F4VI 2ZITA 1Z5AA 4DV5E 3Q1QA 4LF7I 4EMDA 4DR1I 1XNRE 3JAMQ 1ZXNA 4DPWA 2E5LI 2E5LE 1FJGE 1XNQE 1HR0I 3M6AA 3D4JA 4FWGA 4FWDA 3WU5A 4DR7I 4DV6I 4JI2E 4DV0E 3ZZTA 4DUZE 1ZM4A 4LF6E 2GS8A 4DR6I 4X65E 2V2QA 4X65I 4LF9I 3B78A 1PVGA 4JI8E 2UU9I 3V2UC 3ZM7A 4JI6I 1S16A 4JI5E 4K0KI 4JI5I 1MU5A 4LF4I 5A2QQ 2ZM6E 3T1YI 2ZM6I 2LJPA 1J5EE 2UUBE 2R3VA 4JI4I 4X64E 4LFBE 2UXBE 3WU4A 1FKAE 1QZRA 3OTOI 1XMQI 1IBMI 2HKEA 4WUCA 1FJGI 3B8HA 4HACA 2VQFI 4DR7E 4DXLA 1RREA 1N34E 4JI0I 2Q2EB 5LMNI 2UUAI 5LMNE 1XMOE 1S4EA 3JAMC 4B3SE 5FLXQ 5FLXC 2HHHI 4KHPI 4XTJA 3F0NA 4DR2I 1XNRI 1MX0A 2NPFA 4R1FA 4X66E 4LF4E 3J81Q 3J80C 4DR5E 1U2RA 1HR0E 4B3MI 4PU9A 4JI1E 1FWKA 3GONA 2V2ZA 4YHHI 4DV2E 4LF8E 4JI2I 4DR3I 4YHHE 4DV2I 4DR3E 1N33I 2X7IA 4MYTA 1N33E 2ZBKB 1EA6A 2WW4A 4DU8A 3OTOE 4KQVA 4DR4I 4JI8I 2HFSA 3T1HE 4UT4A 5LL6R 1H73A 5BR8I 1I94E 3CWVA 4JYAI 2HK2A 2CZ9A 4LFAI 4DPYA 4X62I 1NZ0A 1WUUA 1J5EI 1NHIA 4JG4A 3J80Q 3J81C 4LFBI 2HKJA 2UXDE 1Z0VA
chains in the Genus database with same CATH superfamily
2F4VE 4DV5I 1KIJA 1VI7A 2PO2A 4UTGA 4NXME 4NXMI 3K17A 5IWAE 2VESA 3QT6A 4DR2E 5IWAI 2UXCE 2WP8A 2V2VA 4HY1A 4DR5I 1XNQI 2GO3A 4IZJA 3H4LA 3L7ZB 4USKA 3P76A 3ZKBA 4JI1I 2PNZA 1ELOA 3LNUA 3P3GA 5EL9A 1UEKA 2X36A 3V5RA 1N34I 4GKKI 2C38B 5DRQA 3GMEA 1H72C 3U1YA 4LF6I 2DEIA 2A2CA 2NN6B 1XMOI 4HACB 4LF5E 4LF5I 1PKPA 4FW3A 5C0XB 1IBKI 1NHHA 1USUA 3P3EA 4J3DA 5EKWA 3WU6A 2HHHE 4KHPE 5JEAD 4JI6E 3T1HI 4WUDA 1Z0EA 2J65A 1ZM9A 2BR2B 3ZZ0A 4X66I 1H74A 3M85G 3DD6A 5K36C 2E1RA 4USMA 4LFCE 3U1KA 2NN6E 4B3ME 2BM1A 4MU1A 2JEAB 1R6MA 3P3CA 4FW7A 3LPSA 1FNMA 1UDSA 4OO1C 2C39B 1K47A 1HK7A 4DV4E 4LCGA 4FW5A 1XMQE 1N0UA 2NN6A 2C37B 1HNZI 1IBLE 4DR4E 1XHKA 4RPFA 4DUYI 4FWHA 4IZKB 4DV1E 4LFAE 1B63A 4DPUA 2VQFE 2BA1G 4P52A 1VISA 5JEAE 1USVA 1Z0TA 4GKKE 1YH8A 4AQYI 3K1JA 4MU3A 5C0XC 1KVKA 2NN6C 3CDIA 4DV7E 3KRNA 4B3RE 1Z5CA 3H1CA 4Z7YA 1N32I 1KKHA 1RR9A 2V34A 2IOQA 2UXCI 1E3PA 2PO0B 5GMEA 2O1VA 5C0XF 4DV3I 2R42A 4ISAA 2NN6F 4FW9A 4LCHA 1H7SA 2VF3A 4FW6A 4JI7I 1Y6ZA 1H7UA 2PNLA 5IT9C 1HNXI 4DV6E 1ZM2A 1Z0WA 4GKJI 4LOMA 1A6FA 1Z59A 3HJCA 1N36E 2OI2A 4GKJE 3QT8A 4NXNI 2PO0A 1OJ4A 3PS2A 4DV4I 1PIEA 1ZM3A 3WU3A 4LF9E 2Z5BB 4OKGA 3LTOA 4IZJD 2UU9E 4B3TE 1D6TA 2O1UA 4DUYE 1EI1A 5BR8E 1I94I 3QT7A 1HNWI 1HNWE 5DRRA 4LFCI 4AIMA 4JI3E 2J7KA 4JI3I 5IT9Q 3T1YE 2V8PA 4X62E 3Q6MA 2HK3A 1FI4A 2JEAA 2BM0A 4ZVIA 2GQ0A 4HXZA 2PO1B 4OO1E 4IZKA 4X64I 4M1KA 3J7AM 5A2QC 2AJ4A 2UXBI 2UXDI 2BV3A 2IESA 1Y60A 2WNRA 5DNLA 1HNZE 2UUCE 4B3RI 1Z0GA 4LF7E 2Z5BA 1N32E 2EFGA 4P7AA 4IFDE 2JEBB 4JV5I 3CDJA 2BA0G 4JV5E 5C0XE 1R6LA 4MYUA 4DV1I 4BA1B 4DPTA 3PYEA 4DV3E 1Z0BA 4DU7A 4WUBA 5JEAF 2JE6A 3PS3A 2JE6B 3PYGA 1Z5BA 4JI7E 4AIDA 4ED4A 1B62A 5K36B 4DV0I 1OYSA 1HNXE 3K85A 4AQYE 5LMUE 1MG7A 5LMUI 4I3HA 1N36I 4JI0E 4AM3A 4DUZI 2UUAE 1N0VC 4NXNE 4DR6E 4OX9I 1IBKE 4OX9E 2CVEA 1Y5YA 3P06A 2PO2B 4DR1E 4K0KE 4IFDC 1BKNA 2HFUA 4PRXA 2VQEI 4BA2B 2VQEE 3J7AG 3M85D 2C39A 2PO1A 3B82A 4Z7CA 3HULA 4PRVA 3ZZUA 5JEAC 2C38A 4LF8I 2UUBI 4JI4E 1RHYA 3PYDA 5GMDA 1ZXMA 3M7NG 1IBLI 2UUCI 2A2DA 1FWLA 5L3JA 4B3TI 4MU4A 1IBME 4GQUA 1Z0CA 4OO1B 4IFDF 4OO1D 1P42A 2BA0D 1DARA 3QT5A 4JYAE 4URLA 2JT2A 2XEXA 4QNJA 4YY3I 4MQYA 2PNZB 4YY3E 5DNXA 4IFDB 4OO1F 2DEJA 3PYFA 3ZKDA 1NHJA 4BA1A 2CG9A 4DPXA 4FN5A 4LCFA 1UDQA 4MDTA 1KTVA 4HYMA 4DV7I 2C37A 4B3SI 2F4VI 2ZITA 1Z5AA 3PS1A 4DV5E 3Q1QA 4LF7I 4EMDA 4DR1I 5DROA 4FW4A 1XNRE 3JAMQ 4IFDA 1ZXNA 4DPWA 2E5LI 5C0XD 2E5LE 1FJGE 1XNQE 1HR0I 2NN6D 3M6AA 3D4JA 4FWGA 4FWDA 1Y4SA 3WU5A 4DR7I 4DV6I 4JI2E 4DV0E 5K36A 4QNKA 4IZJB 3L7ZA 5K36D 3ZZTA 4DUZE 1ZM4A 5FWKA 4LF6E 2GS8A 4DR6I 4U3DA 4X65E 2V2QA 2WNRB 4X65I 4LF9I 3B78A 1PVGA 4JI8E 2UU9I 3V2UC 3ZM7A 4JI6I 1S16A 4JI5E 4K0KI 5C0XA 4JI5I 1MU5A 4LF4I 5A2QQ 2O3ZA 5JEAA 4U3BA 3GLLA 2ZM6E 3T1YI 1E3HA 2ZM6I 4OZEA 2LJPA 1J5EE 5K36F 5DRPA 2PNMA 2R3VA 2UUBE 4JI4I 4X64E 4LFBE 2UXBE 3WU4A 5JEAB 1FKAE 1QZRA 3PRYA 2Z5CA 2CGEA 3OTOI 1XMQI 2BR2A 1IBMI 5ELWA 2HKEA 3Q6NA 4N3OA 4WUCA 2BA1D 1FJGI 3B8HA 4HACA 2VQFI 1UDNA 4DR7E 4DXLA 1YHCA 2Z5EA 2JEBA 1RREA 1N34E 4IS9A 4MU0A 4JI0I 2O1WA 2Q2EB 5LMNI 2UUAI 2WP8B 5LMNE 1XMOE 1S4EA 3JAMC 4B3SE 5FLXQ 4LPFA 5FLXC 2HHHI 4KHPI 4NBQA 4XTJA 3F0NA 4DR2I 1XNRI 1MX0A 2AE8A 2NPFA 4R1FA 4X66E 4LF4E 3J81Q 3J80C 4DR5E 3GCMA 1U2RA 1HR0E 4B3MI 4PU9A 4JI1E 1FWKA 3GONA 2F1DA 2V2ZA 1XXEA 2IOPA 4YHHI 4DV2E 4LF8E 2IERA 4JI2I 4DR3I 4YHHE 4DV2I 4IFDD 4DR3E 5K36E 1N33I 2X7IA 4MYTA 1N33E 2ZBKB 1EA6A 2WW4A 4DU8A 3OTOE 3M7ND 4KQVA 4DR4I 4JI8I 2HFSA 3B4TA 3T1HE 4UT4A 5LL6R 3UHMA 1H73A 2O1TA 5BR8I 1I94E 1Y4UA 3CWVA 4JYAI 1OYRA 2HK2A 2CZ9A 4LFAI 3HKMA 1UDOA 2Z5CB 4DPYA 3NZKA 4X62I 1NZ0A 1WUUA 4OO1A 2GO4A 1J5EI 1NHIA 4JG4A 3J80Q 3J81C 4LFBI 4BA2A 2HKJA 2UXDE 1OYPA 1Z0VA
chains in the Genus database with same CATH topology
2F4VE 4DV5I 1KIJA 4UTGA 4NXME 4NXMI 3K17A 5IWAE 3QT6A 4DR2E 5IWAI 2UXCE 2V2VA 4HY1A 4DR5I 1XNQI 4IZJA 3H4LA 4USKA 3ZKBA 4JI1I 1ELOA 3LNUA 1UEKA 2X36A 3V5RA 1N34I 4GKKI 1H72C 4LF6I 2DEIA 2A2CA 1XMOI 4LF5E 4HACB 4LF5I 1PKPA 1IBKI 1NHHA 1USUA 3WU6A 2HHHE 4KHPE 4JI6E 3T1HI 4WUDA 1Z0EA 1ZM9A 3ZZ0A 4X66I 1H74A 2E1RA 4USMA 4LFCE 4B3ME 2BM1A 3LPSA 1FNMA 1K47A 1HK7A 4DV4E 1XMQE 1N0UA 1HNZI 1IBLE 4DR4E 1XHKA 4RPFA 4DUYI 4FWHA 4IZKB 4DV1E 4LFAE 1B63A 4DPUA 2VQFE 4P52A 1VISA 1USVA 1Z0TA 4GKKE 4AQYI 3K1JA 1KVKA 4DV7E 4B3RE 1Z5CA 4Z7YA 1N32I 1KKHA 1RR9A 2V34A 2IOQA 2UXCI 5GMEA 2O1VA 4DV3I 2R42A 4FW9A 1H7SA 2VF3A 4JI7I 1Y6ZA 1H7UA 2PNLA 5IT9C 1HNXI 4DV6E 1ZM2A 1Z0WA 4GKJI 1A6FA 1Z59A 3HJCA 1N36E 2OI2A 4GKJE 3QT8A 4NXNI 1OJ4A 4DV4I 1ZM3A 1PIEA 3WU3A 4LF9E 2Z5BB 3LTOA 4IZJD 2UU9E 4B3TE 1D6TA 2O1UA 4DUYE 1EI1A 5BR8E 1I94I 3QT7A 1HNWI 1HNWE 4LFCI 4JI3E 2J7KA 4JI3I 5IT9Q 3T1YE 2V8PA 4X62E 3Q6MA 2HK3A 1FI4A 2BM0A 4ZVIA 2GQ0A 4HXZA 4IZKA 4X64I 4M1KA 3J7AM 5A2QC 2AJ4A 2UXBI 2UXDI 2BV3A 1HNZE 2UUCE 4B3RI 1Z0GA 4LF7E 2Z5BA 1N32E 2EFGA 4P7AA 4JV5I 4JV5E 4MYUA 4DV1I 4DPTA 3PYEA 4DV3E 1Z0BA 4DU7A 4WUBA 3PYGA 1Z5BA 4JI7E 4ED4A 1B62A 4DV0I 1HNXE 3K85A 4AQYE 5LMUE 1MG7A 5LMUI 4I3HA 1N36I 4JI0E 4DUZI 2UUAE 1N0VC 4NXNE 4DR6E 4OX9I 1IBKE 4OX9E 3P06A 4DR1E 4K0KE 1BKNA 2HFUA 4PRXA 2VQEI 2VQEE 3J7AG 4Z7CA 3B82A 3HULA 4PRVA 3ZZUA 4LF8I 2UUBI 4JI4E 3PYDA 5GMDA 1ZXMA 1IBLI 2UUCI 2A2DA 1FWLA 5L3JA 4B3TI 1IBME 1Z0CA 1DARA 3QT5A 4JYAE 4URLA 2XEXA 4YY3I 4YY3E 2DEJA 3PYFA 3ZKDA 1NHJA 2CG9A 4DPXA 4FN5A 1KTVA 4HYMA 4DV7I 4B3SI 2F4VI 2ZITA 1Z5AA 4DV5E 3Q1QA 4LF7I 4EMDA 4DR1I 1XNRE 3JAMQ 1ZXNA 4DPWA 2E5LI 2E5LE 1FJGE 1XNQE 1HR0I 3M6AA 3D4JA 4FWGA 4FWDA 1Y4SA 3WU5A 4DR7I 4DV6I 4JI2E 4DV0E 4IZJB 3ZZTA 4DUZE 1ZM4A 5FWKA 4LF6E 2GS8A 4DR6I 4X65E 2V2QA 4X65I 4LF9I 3B78A 1PVGA 4JI8E 2UU9I 3V2UC 3ZM7A 4JI6I 1S16A 4JI5E 4K0KI 4JI5I 1MU5A 4LF4I 5A2QQ 2ZM6E 3T1YI 2ZM6I 2LJPA 1J5EE 2PNMA 2UUBE 2R3VA 4JI4I 4X64E 4LFBE 2UXBE 3WU4A 1FKAE 1QZRA 3PRYA 2Z5CA 2CGEA 3OTOI 1XMQI 1IBMI 2HKEA 3Q6NA 4N3OA 4WUCA 1FJGI 3B8HA 4HACA 2VQFI 4DR7E 4DXLA 2Z5EA 1RREA 1N34E 4JI0I 2O1WA 2Q2EB 5LMNI 2UUAI 5LMNE 1XMOE 1S4EA 3JAMC 4B3SE 5FLXQ 5FLXC 2HHHI 4KHPI 4XTJA 3F0NA 4DR2I 1XNRI 1MX0A 2NPFA 4R1FA 4X66E 4LF4E 3J81Q 3J80C 4DR5E 1U2RA 1HR0E 4B3MI 4PU9A 4JI1E 1FWKA 3GONA 2V2ZA 2IOPA 4YHHI 4DV2E 4LF8E 4JI2I 4DR3I 4YHHE 4DV2I 4DR3E 1N33I 2X7IA 4MYTA 1N33E 2ZBKB 1EA6A 2WW4A 4DU8A 3OTOE 4KQVA 4DR4I 4JI8I 2HFSA 3T1HE 4UT4A 5LL6R 1I94E 1H73A 2O1TA 5BR8I 1Y4UA 3CWVA 4JYAI 2HK2A 2CZ9A 4LFAI 2Z5CB 4DPYA 4X62I 1NZ0A 1WUUA 1J5EI 1NHIA 4JG4A 3J80Q 3J81C 4LFBI 2HKJA 2UXDE 1Z0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V E;  4DV5 I;  1KIJ A;  4UTG A;  4NXM E;  4NXM I;  3K17 A;  5IWA E;  3QT6 A;  4DR2 E;  5IWA I;  2UXC E;  2V2V A;  4HY1 A;  4DR5 I;  1XNQ I;  3H4L A;  4USK A;  3ZKB A;  4JI1 I;  1ELO A;  3LNU A;  1UEK A;  2X36 A;  3V5R A;  1N34 I;  4GKK I;  1H72 C;  4LF6 I;  2DEI A;  2A2C A;  1XMO I;  4LF5 E;  4HAC B;  4LF5 I;  1PKP A;  1IBK I;  1NHH A;  3WU6 A;  2HHH E;  4KHP E;  4JI6 E;  3T1H I;  4WUD A;  1Z0E A;  1ZM9 A;  3ZZ0 A;  4X66 I;  1H74 A;  2E1R A;  4USM A;  4LFC E;  4B3M E;  2BM1 A;  3LPS A;  1FNM A;  1K47 A;  4DV4 E;  1XMQ E;  1N0U A;  1HNZ I;  1IBL E;  4DR4 E;  1XHK A;  4RPF A;  4DUY I;  4FWH A;  4DV1 E;  4LFA E;  1B63 A;  4DPU A;  2VQF E;  4P52 A;  1VIS A;  1Z0T A;  4GKK E;  4AQY I;  3K1J A;  1KVK A;  4DV7 E;  4B3R E;  1Z5C A;  4Z7Y A;  1N32 I;  1KKH A;  1RR9 A;  2V34 A;  2UXC I;  5GME A;  4DV3 I;  2R42 A;  4FW9 A;  1H7S A;  2VF3 A;  4JI7 I;  1H7U A;  5IT9 C;  1HNX I;  4DV6 E;  1ZM2 A;  1Z0W A;  4GKJ I;  1A6F A;  1Z59 A;  1N36 E;  2OI2 A;  4GKJ E;  3QT8 A;  4NXN I;  1OJ4 A;  4DV4 I;  1ZM3 A;  1PIE A;  3WU3 A;  4LF9 E;  3LTO A;  2UU9 E;  4B3T E;  1D6T A;  4DUY E;  1EI1 A;  5BR8 E;  1I94 I;  3QT7 A;  1HNW I;  1HNW E;  4LFC I;  4JI3 E;  2J7K A;  4JI3 I;  5IT9 Q;  3T1Y E;  2V8P A;  4X62 E;  2HK3 A;  1FI4 A;  2BM0 A;  4ZVI A;  4HXZ A;  4X64 I;  4M1K A;  3J7A M;  5A2Q C;  2AJ4 A;  2UXB I;  2UXD I;  2BV3 A;  1HNZ E;  2UUC E;  4B3R I;  1Z0G A;  4LF7 E;  1N32 E;  2EFG A;  4P7A A;  4JV5 I;  4JV5 E;  4MYU A;  4DV1 I;  4DPT A;  3PYE A;  4DV3 E;  1Z0B A;  4DU7 A;  4WUB A;  3PYG A;  1Z5B A;  4JI7 E;  4ED4 A;  1B62 A;  4DV0 I;  1HNX E;  4AQY E;  5LMU E;  1MG7 A;  5LMU I;  4I3H A;  1N36 I;  4JI0 E;  4DUZ I;  2UUA E;  1N0V C;  4NXN E;  4DR6 E;  4OX9 I;  1IBK E;  4OX9 E;  4DR1 E;  4K0K E;  1BKN A;  2HFU A;  4PRX A;  2VQE I;  2VQE E;  3J7A G;  4Z7C A;  3B82 A;  3HUL A;  4PRV A;  3ZZU A;  4LF8 I;  2UUB I;  4JI4 E;  3PYD A;  5GMD A;  1ZXM A;  1IBL I;  2UUC I;  2A2D A;  1FWL A;  5L3J A;  4B3T I;  1IBM E;  1Z0C A;  1DAR A;  3QT5 A;  4JYA E;  4URL A;  2XEX A;  4YY3 I;  4YY3 E;  2DEJ A;  3PYF A;  3ZKD A;  1NHJ A;  4DPX A;  4FN5 A;  1KTV A;  4HYM A;  4DV7 I;  4B3S I;  2F4V I;  2ZIT A;  1Z5A A;  4DV5 E;  3Q1Q A;  4LF7 I;  4EMD A;  4DR1 I;  1XNR E;  3JAM Q;  1ZXN A;  4DPW A;  2E5L I;  2E5L E;  1FJG E;  1XNQ E;  1HR0 I;  3M6A A;  3D4J A;  4FWG A;  4FWD A;  3WU5 A;  4DR7 I;  4DV6 I;  4JI2 E;  4DV0 E;  3ZZT A;  4DUZ E;  1ZM4 A;  4LF6 E;  2GS8 A;  4DR6 I;  4X65 E;  2V2Q A;  4X65 I;  4LF9 I;  3B78 A;  1PVG A;  4JI8 E;  2UU9 I;  3V2U C;  3ZM7 A;  4JI6 I;  1S16 A;  4JI5 E;  4K0K I;  4JI5 I;  1MU5 A;  4LF4 I;  5A2Q Q;  2ZM6 E;  3T1Y I;  2ZM6 I;  2LJP A;  1J5E E;  2UUB E;  2R3V A;  4JI4 I;  4X64 E;  4LFB E;  2UXB E;  3WU4 A;  1FKA E;  1QZR A;  3OTO I;  1XMQ I;  1IBM I;  2HKE A;  4WUC A;  1FJG I;  3B8H A;  4HAC A;  2VQF I;  4DR7 E;  4DXL A;  1RRE A;  1N34 E;  4JI0 I;  2Q2E B;  5LMN I;  2UUA I;  5LMN E;  1XMO E;  1S4E A;  3JAM C;  4B3S E;  5FLX Q;  5FLX C;  2HHH I;  4KHP I;  4XTJ A;  3F0N A;  4DR2 I;  1XNR I;  1MX0 A;  2NPF A;  4R1F A;  4X66 E;  4LF4 E;  3J81 Q;  3J80 C;  4DR5 E;  1U2R A;  1HR0 E;  4B3M I;  4PU9 A;  4JI1 E;  1FWK A;  3GON A;  2V2Z A;  4YHH I;  4DV2 E;  4LF8 E;  4JI2 I;  4DR3 I;  4YHH E;  4DV2 I;  4DR3 E;  1N33 I;  2X7I A;  4MYT A;  1N33 E;  2ZBK B;  1EA6 A;  2WW4 A;  4DU8 A;  3OTO E;  4KQV A;  4DR4 I;  4JI8 I;  2HFS A;  3T1H E;  4UT4 A;  5LL6 R;  1H73 A;  5BR8 I;  1I94 E;  3CWV A;  4JYA I;  2HK2 A;  2CZ9 A;  4LFA I;  4DPY A;  4X62 I;  1NZ0 A;  1WUU A;  1J5E I;  1NHI A;  4JG4 A;  3J80 Q;  3J81 C;  4LFB I;  2HKJ A;  2UXD E;  1Z0V A; 
#chains in the Genus database with same CATH topology
 2F4V E;  4DV5 I;  1KIJ A;  1VI7 A;  2PO2 A;  4UTG A;  4NXM E;  4NXM I;  3K17 A;  5IWA E;  2VES A;  3QT6 A;  4DR2 E;  5IWA I;  2UXC E;  2WP8 A;  2V2V A;  4HY1 A;  4DR5 I;  1XNQ I;  2GO3 A;  4IZJ A;  3H4L A;  3L7Z B;  4USK A;  3P76 A;  3ZKB A;  4JI1 I;  2PNZ A;  1ELO A;  3LNU A;  3P3G A;  5EL9 A;  1UEK A;  2X36 A;  3V5R A;  1N34 I;  4GKK I;  2C38 B;  5DRQ A;  3GME A;  1H72 C;  3U1Y A;  4LF6 I;  2DEI A;  2A2C A;  2NN6 B;  1XMO I;  4HAC B;  4LF5 E;  4LF5 I;  1PKP A;  4FW3 A;  5C0X B;  1IBK I;  1NHH A;  1USU A;  3P3E A;  4J3D A;  5EKW A;  3WU6 A;  2HHH E;  4KHP E;  5JEA D;  4JI6 E;  3T1H I;  4WUD A;  1Z0E A;  2J65 A;  1ZM9 A;  2BR2 B;  3ZZ0 A;  4X66 I;  1H74 A;  3M85 G;  3DD6 A;  5K36 C;  2E1R A;  4USM A;  4LFC E;  3U1K A;  2NN6 E;  4B3M E;  2BM1 A;  4MU1 A;  2JEA B;  1R6M A;  3P3C A;  4FW7 A;  3LPS A;  1FNM A;  1UDS A;  4OO1 C;  2C39 B;  1K47 A;  1HK7 A;  4DV4 E;  4LCG A;  4FW5 A;  1XMQ E;  1N0U A;  2NN6 A;  2C37 B;  1HNZ I;  1IBL E;  4DR4 E;  1XHK A;  4RPF A;  4DUY I;  4FWH A;  4IZK B;  4DV1 E;  4LFA E;  1B63 A;  4DPU A;  2VQF E;  2BA1 G;  4P52 A;  1VIS A;  5JEA E;  1USV A;  1Z0T A;  4GKK E;  1YH8 A;  4AQY I;  3K1J A;  4MU3 A;  5C0X C;  1KVK A;  2NN6 C;  3CDI A;  4DV7 E;  3KRN A;  4B3R E;  1Z5C A;  3H1C A;  4Z7Y A;  1N32 I;  1KKH A;  1RR9 A;  2V34 A;  2IOQ A;  2UXC I;  1E3P A;  2PO0 B;  5GME A;  2O1V A;  5C0X F;  4DV3 I;  2R42 A;  4ISA A;  2NN6 F;  4FW9 A;  4LCH A;  1H7S A;  2VF3 A;  4FW6 A;  4JI7 I;  1Y6Z A;  1H7U A;  2PNL A;  5IT9 C;  1HNX I;  4DV6 E;  1ZM2 A;  1Z0W A;  4GKJ I;  4LOM A;  1A6F A;  1Z59 A;  3HJC A;  1N36 E;  2OI2 A;  4GKJ E;  3QT8 A;  4NXN I;  2PO0 A;  1OJ4 A;  3PS2 A;  4DV4 I;  1PIE A;  1ZM3 A;  3WU3 A;  4LF9 E;  2Z5B B;  4OKG A;  3LTO A;  4IZJ D;  2UU9 E;  4B3T E;  1D6T A;  2O1U A;  4DUY E;  1EI1 A;  5BR8 E;  1I94 I;  3QT7 A;  1HNW I;  1HNW E;  5DRR A;  4LFC I;  4AIM A;  4JI3 E;  2J7K A;  4JI3 I;  5IT9 Q;  3T1Y E;  2V8P A;  4X62 E;  3Q6M A;  2HK3 A;  1FI4 A;  2JEA A;  2BM0 A;  4ZVI A;  2GQ0 A;  4HXZ A;  2PO1 B;  4OO1 E;  4IZK A;  4X64 I;  4M1K A;  3J7A M;  5A2Q C;  2AJ4 A;  2UXB I;  2UXD I;  2BV3 A;  2IES A;  1Y60 A;  2WNR A;  5DNL A;  1HNZ E;  2UUC E;  4B3R I;  1Z0G A;  4LF7 E;  2Z5B A;  1N32 E;  2EFG A;  4P7A A;  4IFD E;  2JEB B;  4JV5 I;  3CDJ A;  2BA0 G;  4JV5 E;  5C0X E;  1R6L A;  4MYU A;  4DV1 I;  4BA1 B;  4DPT A;  3PYE A;  4DV3 E;  1Z0B A;  4DU7 A;  4WUB A;  5JEA F;  2JE6 A;  3PS3 A;  2JE6 B;  3PYG A;  1Z5B A;  4JI7 E;  4AID A;  4ED4 A;  1B62 A;  5K36 B;  4DV0 I;  1OYS A;  1HNX E;  3K85 A;  4AQY E;  5LMU E;  1MG7 A;  5LMU I;  4I3H A;  1N36 I;  4JI0 E;  4AM3 A;  4DUZ I;  2UUA E;  1N0V C;  4NXN E;  4DR6 E;  4OX9 I;  1IBK E;  4OX9 E;  2CVE A;  1Y5Y A;  3P06 A;  2PO2 B;  4DR1 E;  4K0K E;  4IFD C;  1BKN A;  2HFU A;  4PRX A;  2VQE I;  4BA2 B;  2VQE E;  3J7A G;  3M85 D;  2C39 A;  2PO1 A;  3B82 A;  4Z7C A;  3HUL A;  4PRV A;  3ZZU A;  5JEA C;  2C38 A;  4LF8 I;  2UUB I;  4JI4 E;  1RHY A;  3PYD A;  5GMD A;  1ZXM A;  3M7N G;  1IBL I;  2UUC I;  2A2D A;  1FWL A;  5L3J A;  4B3T I;  4MU4 A;  1IBM E;  4GQU A;  1Z0C A;  4OO1 B;  4IFD F;  4OO1 D;  1P42 A;  2BA0 D;  1DAR A;  3QT5 A;  4JYA E;  4URL A;  2JT2 A;  2XEX A;  4QNJ A;  4YY3 I;  4MQY A;  2PNZ B;  4YY3 E;  5DNX A;  4IFD B;  4OO1 F;  2DEJ A;  3PYF A;  3ZKD A;  1NHJ A;  4BA1 A;  2CG9 A;  4DPX A;  4FN5 A;  4LCF A;  1UDQ A;  4MDT A;  1KTV A;  4HYM A;  4DV7 I;  2C37 A;  4B3S I;  2F4V I;  2ZIT A;  1Z5A A;  3PS1 A;  4DV5 E;  3Q1Q A;  4LF7 I;  4EMD A;  4DR1 I;  5DRO A;  4FW4 A;  1XNR E;  3JAM Q;  4IFD A;  1ZXN A;  4DPW A;  2E5L I;  5C0X D;  2E5L E;  1FJG E;  1XNQ E;  1HR0 I;  2NN6 D;  3M6A A;  3D4J A;  4FWG A;  4FWD A;  1Y4S A;  3WU5 A;  4DR7 I;  4DV6 I;  4JI2 E;  4DV0 E;  5K36 A;  4QNK A;  4IZJ B;  3L7Z A;  5K36 D;  3ZZT A;  4DUZ E;  1ZM4 A;  5FWK A;  4LF6 E;  2GS8 A;  4DR6 I;  4U3D A;  4X65 E;  2V2Q A;  2WNR B;  4X65 I;  4LF9 I;  3B78 A;  1PVG A;  4JI8 E;  2UU9 I;  3V2U C;  3ZM7 A;  4JI6 I;  1S16 A;  4JI5 E;  4K0K I;  5C0X A;  4JI5 I;  1MU5 A;  4LF4 I;  5A2Q Q;  2O3Z A;  5JEA A;  4U3B A;  3GLL A;  2ZM6 E;  3T1Y I;  1E3H A;  2ZM6 I;  4OZE A;  2LJP A;  1J5E E;  5K36 F;  5DRP A;  2PNM A;  2R3V A;  2UUB E;  4JI4 I;  4X64 E;  4LFB E;  2UXB E;  3WU4 A;  5JEA B;  1FKA E;  1QZR A;  3PRY A;  2Z5C A;  2CGE A;  3OTO I;  1XMQ I;  2BR2 A;  1IBM I;  5ELW A;  2HKE A;  3Q6N A;  4N3O A;  4WUC A;  2BA1 D;  1FJG I;  3B8H A;  4HAC A;  2VQF I;  1UDN A;  4DR7 E;  4DXL A;  1YHC A;  2Z5E A;  2JEB A;  1RRE A;  1N34 E;  4IS9 A;  4MU0 A;  4JI0 I;  2O1W A;  2Q2E B;  5LMN I;  2UUA I;  2WP8 B;  5LMN E;  1XMO E;  1S4E A;  3JAM C;  4B3S E;  5FLX Q;  4LPF A;  5FLX C;  2HHH I;  4KHP I;  4NBQ A;  4XTJ A;  3F0N A;  4DR2 I;  1XNR I;  1MX0 A;  2AE8 A;  2NPF A;  4R1F A;  4X66 E;  4LF4 E;  3J81 Q;  3J80 C;  4DR5 E;  3GCM A;  1U2R A;  1HR0 E;  4B3M I;  4PU9 A;  4JI1 E;  1FWK A;  3GON A;  2F1D A;  2V2Z A;  1XXE A;  2IOP A;  4YHH I;  4DV2 E;  4LF8 E;  2IER A;  4JI2 I;  4DR3 I;  4YHH E;  4DV2 I;  4IFD D;  4DR3 E;  5K36 E;  1N33 I;  2X7I A;  4MYT A;  1N33 E;  2ZBK B;  1EA6 A;  2WW4 A;  4DU8 A;  3OTO E;  3M7N D;  4KQV A;  4DR4 I;  4JI8 I;  2HFS A;  3B4T A;  3T1H E;  4UT4 A;  5LL6 R;  3UHM A;  1H73 A;  2O1T A;  5BR8 I;  1I94 E;  1Y4U A;  3CWV A;  4JYA I;  1OYR A;  2HK2 A;  2CZ9 A;  4LFA I;  3HKM A;  1UDO A;  2Z5C B;  4DPY A;  3NZK A;  4X62 I;  1NZ0 A;  1WUU A;  4OO1 A;  2GO4 A;  1J5E I;  1NHI A;  4JG4 A;  3J80 Q;  3J81 C;  4LFB I;  4BA2 A;  2HKJ A;  2UXD E;  1OYP A;  1Z0V A; 
#chains in the Genus database with same CATH homology
 2F4V E;  4DV5 I;  1KIJ A;  4UTG A;  4NXM E;  4NXM I;  3K17 A;  5IWA E;  3QT6 A;  4DR2 E;  5IWA I;  2UXC E;  2V2V A;  4HY1 A;  4DR5 I;  1XNQ I;  4IZJ A;  3H4L A;  4USK A;  3ZKB A;  4JI1 I;  1ELO A;  3LNU A;  1UEK A;  2X36 A;  3V5R A;  1N34 I;  4GKK I;  1H72 C;  4LF6 I;  2DEI A;  2A2C A;  1XMO I;  4LF5 E;  4HAC B;  4LF5 I;  1PKP A;  1IBK I;  1NHH A;  1USU A;  3WU6 A;  2HHH E;  4KHP E;  4JI6 E;  3T1H I;  4WUD A;  1Z0E A;  1ZM9 A;  3ZZ0 A;  4X66 I;  1H74 A;  2E1R A;  4USM A;  4LFC E;  4B3M E;  2BM1 A;  3LPS A;  1FNM A;  1K47 A;  1HK7 A;  4DV4 E;  1XMQ E;  1N0U A;  1HNZ I;  1IBL E;  4DR4 E;  1XHK A;  4RPF A;  4DUY I;  4FWH A;  4IZK B;  4DV1 E;  4LFA E;  1B63 A;  4DPU A;  2VQF E;  4P52 A;  1VIS A;  1USV A;  1Z0T A;  4GKK E;  4AQY I;  3K1J A;  1KVK A;  4DV7 E;  4B3R E;  1Z5C A;  4Z7Y A;  1N32 I;  1KKH A;  1RR9 A;  2V34 A;  2IOQ A;  2UXC I;  5GME A;  2O1V A;  4DV3 I;  2R42 A;  4FW9 A;  1H7S A;  2VF3 A;  4JI7 I;  1Y6Z A;  1H7U A;  2PNL A;  5IT9 C;  1HNX I;  4DV6 E;  1ZM2 A;  1Z0W A;  4GKJ I;  1A6F A;  1Z59 A;  3HJC A;  1N36 E;  2OI2 A;  4GKJ E;  3QT8 A;  4NXN I;  1OJ4 A;  4DV4 I;  1ZM3 A;  1PIE A;  3WU3 A;  4LF9 E;  2Z5B B;  3LTO A;  4IZJ D;  2UU9 E;  4B3T E;  1D6T A;  2O1U A;  4DUY E;  1EI1 A;  5BR8 E;  1I94 I;  3QT7 A;  1HNW I;  1HNW E;  4LFC I;  4JI3 E;  2J7K A;  4JI3 I;  5IT9 Q;  3T1Y E;  2V8P A;  4X62 E;  3Q6M A;  2HK3 A;  1FI4 A;  2BM0 A;  4ZVI A;  2GQ0 A;  4HXZ A;  4IZK A;  4X64 I;  4M1K A;  3J7A M;  5A2Q C;  2AJ4 A;  2UXB I;  2UXD I;  2BV3 A;  1HNZ E;  2UUC E;  4B3R I;  1Z0G A;  4LF7 E;  2Z5B A;  1N32 E;  2EFG A;  4P7A A;  4JV5 I;  4JV5 E;  4MYU A;  4DV1 I;  4DPT A;  3PYE A;  4DV3 E;  1Z0B A;  4DU7 A;  4WUB A;  3PYG A;  1Z5B A;  4JI7 E;  4ED4 A;  1B62 A;  4DV0 I;  1HNX E;  3K85 A;  4AQY E;  5LMU E;  1MG7 A;  5LMU I;  4I3H A;  1N36 I;  4JI0 E;  4DUZ I;  2UUA E;  1N0V C;  4NXN E;  4DR6 E;  4OX9 I;  1IBK E;  4OX9 E;  3P06 A;  4DR1 E;  4K0K E;  1BKN A;  2HFU A;  4PRX A;  2VQE I;  2VQE E;  3J7A G;  4Z7C A;  3B82 A;  3HUL A;  4PRV A;  3ZZU A;  4LF8 I;  2UUB I;  4JI4 E;  3PYD A;  5GMD A;  1ZXM A;  1IBL I;  2UUC I;  2A2D A;  1FWL A;  5L3J A;  4B3T I;  1IBM E;  1Z0C A;  1DAR A;  3QT5 A;  4JYA E;  4URL A;  2XEX A;  4YY3 I;  4YY3 E;  2DEJ A;  3PYF A;  3ZKD A;  1NHJ A;  2CG9 A;  4DPX A;  4FN5 A;  1KTV A;  4HYM A;  4DV7 I;  4B3S I;  2F4V I;  2ZIT A;  1Z5A A;  4DV5 E;  3Q1Q A;  4LF7 I;  4EMD A;  4DR1 I;  1XNR E;  3JAM Q;  1ZXN A;  4DPW A;  2E5L I;  2E5L E;  1FJG E;  1XNQ E;  1HR0 I;  3M6A A;  3D4J A;  4FWG A;  4FWD A;  1Y4S A;  3WU5 A;  4DR7 I;  4DV6 I;  4JI2 E;  4DV0 E;  4IZJ B;  3ZZT A;  4DUZ E;  1ZM4 A;  5FWK A;  4LF6 E;  2GS8 A;  4DR6 I;  4X65 E;  2V2Q A;  4X65 I;  4LF9 I;  3B78 A;  1PVG A;  4JI8 E;  2UU9 I;  3V2U C;  3ZM7 A;  4JI6 I;  1S16 A;  4JI5 E;  4K0K I;  4JI5 I;  1MU5 A;  4LF4 I;  5A2Q Q;  2ZM6 E;  3T1Y I;  2ZM6 I;  2LJP A;  1J5E E;  2PNM A;  2UUB E;  2R3V A;  4JI4 I;  4X64 E;  4LFB E;  2UXB E;  3WU4 A;  1FKA E;  1QZR A;  3PRY A;  2Z5C A;  2CGE A;  3OTO I;  1XMQ I;  1IBM I;  2HKE A;  3Q6N A;  4N3O A;  4WUC A;  1FJG I;  3B8H A;  4HAC A;  2VQF I;  4DR7 E;  4DXL A;  2Z5E A;  1RRE A;  1N34 E;  4JI0 I;  2O1W A;  2Q2E B;  5LMN I;  2UUA I;  5LMN E;  1XMO E;  1S4E A;  3JAM C;  4B3S E;  5FLX Q;  5FLX C;  2HHH I;  4KHP I;  4XTJ A;  3F0N A;  4DR2 I;  1XNR I;  1MX0 A;  2NPF A;  4R1F A;  4X66 E;  4LF4 E;  3J81 Q;  3J80 C;  4DR5 E;  1U2R A;  1HR0 E;  4B3M I;  4PU9 A;  4JI1 E;  1FWK A;  3GON A;  2V2Z A;  2IOP A;  4YHH I;  4DV2 E;  4LF8 E;  4JI2 I;  4DR3 I;  4YHH E;  4DV2 I;  4DR3 E;  1N33 I;  2X7I A;  4MYT A;  1N33 E;  2ZBK B;  1EA6 A;  2WW4 A;  4DU8 A;  3OTO E;  4KQV A;  4DR4 I;  4JI8 I;  2HFS A;  3T1H E;  4UT4 A;  5LL6 R;  1I94 E;  1H73 A;  2O1T A;  5BR8 I;  1Y4U A;  3CWV A;  4JYA I;  2HK2 A;  2CZ9 A;  4LFA I;  2Z5C B;  4DPY A;  4X62 I;  1NZ0 A;  1WUU A;  1J5E I;  1NHI A;  4JG4 A;  3J80 Q;  3J81 C;  4LFB I;  2HKJ A;  2UXD E;  1Z0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...