4LFAI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfaI00
2V34A 4LF9I 1Z0WA 4DPXA 1HNXI 1MU5A 4YY3I 2V2VA 1U2RA 4URLA 2J7KA 1N32I 4X66E 4B3TI 1Z0CA 4HACA 5LMNI 4JI7E 5L3JA 2E5LE 4PRXA 1IBKI 4AQYI 3ZKDA 4X62I 3PYDA 3ZKBA 3WU6A 4FWHA 4DV0E 4NXNI 2F4VE 3ZM7A 4JI2I 4FWDA 4DU8A 5LL6R 1FWLA 4JI1I 3LTOA 4RPFA 4K0KE 4MYTA 5IWAE 4WUBA 4DV5I 2VQEI 4DXLA 4DUZI 1Z59A 4LF9E 1MG7A 4JI4I 2HFUA 1N32E 4B3TE 1ZXNA 4JYAE 3QT5A 4DR2I 4DR3I 5LMNE 5A2QC 2X36A 4B3RE 2ZBKB 1IBKE 4AQYE 2HHHI 4X62E 3J81C 4R1FA 2UUBI 1B63A 3J7AM 4NXME 3WU3A 4LFAI 2DEIA 3K17A 1FNMA 4JI2E 2V2QA 5A2QQ 3T1HE 1OJ4A 4KQVA 4DV6I 3PYGA 2V8PA 4JI1E 4DV3I 1H73A 1IBLI 1H72C 3T1YI 3J81Q 2VQEE 2UUAI 4JI6I 4DUZE 4HACB 4JI4E 1N33E 2R42A 1XNRI 4DR2E 2X7IA 3CWVA 2VQFI 4DR1I 4JV5I 4P7AA 3LPSA 4X65I 1HNWI 4ED4A 4HYMA 2ZM6I 2UUBE 4DR6E 1MX0A 4DV4I 2BM1A 2UXCI 4LF5I 4DR7I 4LFAE 1NZ0A 4LF7E 1N0UA 4DU7A 4PU9A 1XNQI 4Z7CA 1VISA 1IBLE 4XTJA 2GS8A 4LF4I 1BKNA 3V5RA 4WUDA 4JI3E 5GMEA 2UUAE 2EFGA 1I94I 1FJGI 1PVGA 4OX9I 3WU5A 4PRVA 2ZITA 5BR8E 3QT7A 3OTOE 2VQFE 4USKA 4YHHI 1IBME 1Z0GA 3QT6A 5LMUI 4UT4A 4DV7I 2ZM6E 2UU9I 3M6AA 1HNXE 4YY3E 4FW9A 4KHPI 4DV4E 4LF6I 4GKKI 1N0VC 4LF5E 3JAMQ 4DR7E 1KTVA 1H7SA 1KIJA 3H4LA 3HULA 4DPYA 2WW4A 1Z5AA 4DR4I 4DV2I 3K1JA 3ZZTA 2UUCI 4LF8I 4HY1A 2CZ9A 4X64I 3B8HA 1FJGE 1ZM2A 2HFSA 4NXNE 1FKAE 1HNZI 4DPUA 3LNUA 2NPFA 4DV5E 4DPWA 4DR5I 4DV7E 2UXBI 4P52A 1FWKA 3B82A 4LF6E 2DEJA 4JG4A 4DV1I 4GKKE 5IT9Q 2HKJA 4MYUA 2Q2EB 1HR0I 1H74A 4DR3E 3B78A 4B3MI 2HHHE 4DPTA 1NHHA 4GKJI 3WU4A 4LF8E 1H7UA 1ZM3A 2BV3A 2R3VA 1KVKA 4DV6E 3Q1QA 4DV3E 3T1YE 1QZRA 4DR5E 1ZXMA 1RR9A 4JI6E 2UXBE 1XHKA 1FI4A 1XMQI 4DV1E 4JYAI 3JAMC 4ZVIA 1ELOA 4Z7YA 3V2UC 2HK3A 1HR0E 1XMOI 1XNRE 4DUYI 2A2CA 4B3RI 4M1KA 1ZM4A 2HK2A 4FWGA 5GMDA 4B3ME 1WUUA 4DR1E 4JV5E 2LJPA 3PYFA 4B3SI 1Z0EA 4GKJE 3ZZ0A 4X65E 2OI2A 1PKPA 1HNWE 4NXMI 1DARA 3F0NA 4JI8I 4JI5I 2UXCE 1B62A 1NHJA 3T1HI 1N34I 1Z0TA 3QT8A 1J5EI 3J7AG 4LFBI 1PIEA 4LFCI 1XNQE 4I3HA 4LF4E 1KKHA 1Z0VA 4HXZA 1ZM9A 2AJ4A 1N33I 1UEKA 2UXDI 1I94E 4JI0I 3D4JA 1XMQE 5IT9C 4OX9E 1NHIA 1XMOE 1A6FA 4DUYE 5FLXC 1D6TA 1N36I 1Z5BA 1EA6A 4YHHE 4B3SE 4DR6I 3PYEA 2A2DA 5LMUE 2XEXA 3ZZUA 2UU9E 4X66I 1S16A 4JI8E 4LF7I 4JI5E 4KHPE 3J80C 1EI1A 4JI7I 1K47A 2HKEA 2E1RA 1N34E 2E5LI 1J5EE 5FLXQ 4LFBE 4LFCE 3GONA 4USMA 1RREA 4WUCA 4JI3I 4DR4E 4DV2E 4FN5A 4DV0I 1Z0BA 2UUCE 2F4VI 4X64E 2BM0A 2UXDE 4JI0E 1Z5CA 4UTGA 3J80Q 1S4EA 5BR8I 2VF3A 1HNZE 3OTOI 4K0KI 1IBMI 2V2ZA 5IWAI 4EMDA 1N36E
chains in the Genus database with same CATH superfamily
2V34A 2O1TA 4LF9I 1E3HA 1Z0WA 3HJCA 4LOMA 4DPXA 1HNXI 1MU5A 3K85A 2NN6F 1U2RA 2V2VA 4URLA 4YY3I 5JEAB 3PS3A 2J7KA 1UDSA 1N32I 2CVEA 4X66E 4B3TI 1Z0CA 2IESA 2GO3A 4HACA 4MQYA 5LMNI 1OYSA 2PO1B 4JI7E 2JT2A 3Q6NA 4FW4A 5L3JA 2E5LE 4PRXA 1IBKI 4AQYI 3ZKDA 4X62I 1HK7A 4OO1F 3PYDA 1UDQA 5K36D 3M7NG 3ZKBA 3WU6A 4FWHA 2C37B 4DV0E 4NXNI 2F4VE 1Y60A 3ZM7A 4JI2I 4FWDA 4DU8A 5LL6R 1FWLA 2JEBB 4JI1I 3LTOA 4RPFA 4K0KE 5C0XB 4MYTA 5IWAE 4WUBA 4DV5I 2PO1A 2VQEI 3U1YA 4DXLA 4DUZI 1Z59A 2IOPA 4LF9E 4IFDE 4AIDA 1MG7A 4JI4I 2HFUA 5DRQA 1N32E 4B3TE 5JEAC 2C37A 1ZXNA 4JYAE 3QT5A 4DR2I 3PRYA 4DR3I 5LMNE 5A2QC 4AIMA 1UDOA 4LCFA 2X36A 4B3RE 2ZBKB 1IBKE 4AQYE 2HHHI 4X62E 2PO2A 3J81C 4R1FA 2JEBA 2UUBI 1B63A 3J7AM 5C0XA 4IFDF 5K36F 4NXME 3WU3A 4LFAI 2DEIA 3K17A 1FNMA 4JI2E 2V2QA 5A2QQ 3T1HE 1OJ4A 4U3DA 4KQVA 4DV6I 3PYGA 2V8PA 4JI1E 4DV3I 1H73A 1IBLI 5FWKA 2NN6A 1H72C 3T1YI 3J81Q 3P3CA 5ELWA 1E3PA 2GO4A 2VQEE 2Z5BB 2UUAI 4JI6I 4DUZE 5DNLA 4HACB 4JI4E 1N33E 2R42A 4OO1A 1OYPA 1VI7A 1XNRI 4DR2E 2X7IA 3CWVA 2VQFI 4DR1I 4JV5I 4OO1E 4P7AA 1Y4SA 3LPSA 4X65I 1HNWI 4ED4A 4HYMA 2ZM6I 2UUBE 2BR2A 4DR6E 1MX0A 4DV4I 4MDTA 1USVA 2BM1A 3HKMA 2UXCI 4LF5I 2AE8A 2Z5BA 4DR7I 4LFAE 1NZ0A 4LF7E 2C39A 1N0UA 4DU7A 4QNJA 5DRRA 4PU9A 1XNQI 4Z7CA 1VISA 1IBLE 4GQUA 4XTJA 5EL9A 2GS8A 1YH8A 1BKNA 4LF4I 3V5RA 4WUDA 2VESA 3GMEA 4JI3E 5EKWA 2Z5CA 5GMEA 2UUAE 2EFGA 1I94I 1FJGI 1PVGA 2PNLA 4BA1A 4IZJB 4OX9I 3WU5A 3UHMA 5DNXA 2PO2B 4PRVA 2ZITA 5BR8E 3M85G 5JEAD 3QT7A 1USUA 3OTOE 2VQFE 4IFDA 5K36A 4USKA 4YHHI 1IBME 1Z0GA 1P42A 3QT6A 5LMUI 4UT4A 4DV7I 2ZM6E 2UU9I 3M6AA 4BA2B 5K36E 2BA1D 1HNXE 4YY3E 4FW9A 3PS2A 4DV4E 3P3GA 4LF6I 4GKKI 4KHPI 1N0VC 4LF5E 3JAMQ 4DR7E 1KTVA 1H7SA 1KIJA 4U3BA 2NN6B 3H4LA 3HULA 4IZJA 4DPYA 5DROA 2WW4A 1Z5AA 4DR4I 4DV2I 3K1JA 3ZZTA 4FW7A 3Q6MA 2UUCI 4LF8I 4HY1A 2CZ9A 4OO1B 4X64I 5C0XD 3B8HA 1FJGE 1RHYA 1ZM2A 1Y4UA 2HFSA 4NXNE 1FKAE 3U1KA 4BA2A 1HNZI 4DPUA 3LNUA 4J3DA 3P76A 2BR2B 2NPFA 4LPFA 2IERA 4DV5E 3NZKA 4DPWA 4DR5I 5C0XC 4DV7E 1Y5YA 4MU1A 2UXBI 2C39B 4P52A 1FWKA 2JEAA 3PS1A 3B82A 4LF6E 2DEJA 4JG4A 4DV1I 4GKKE 2BA0D 5IT9Q 2HKJA 4MYUA 2Q2EB 3L7ZB 1HR0I 1H74A 4DR3E 2NN6C 2Z5CB 3B78A 4B3MI 2PO0B 1OYRA 2HHHE 4BA1B 1NHHA 4DPTA 4GKJI 3WU4A 4LF8E 3CDJA 2J65A 4OO1C 1R6MA 2O3ZA 1H7UA 4IFDB 5K36B 2WP8B 1ZM3A 2BV3A 2R3VA 2PNMA 4FW3A 1KVKA 5DRPA 4DV6E 2WNRA 3Q1QA 4DV3E 3L7ZA 3T1YE 4AM3A 1QZRA 1R6LA 4DR5E 1ZXMA 3CDIA 1RR9A 4IZKA 4JI6E 2UXBE 2PO0A 1XHKA 2C38A 2GQ0A 1FI4A 1XMQI 4DV1E 4JYAI 4QNKA 3JAMC 4ZVIA 4OKGA 1ELOA 4Z7YA 4MU4A 3V2UC 2HK3A 2JE6B 1HR0E 1XMOI 4ISAA 1XNRE 4DUYI 2A2CA 4B3RI 4M1KA 1ZM4A 2HK2A 4FWGA 5GMDA 4B3ME 1WUUA 4DR1E 4JV5E 2WP8A 2LJPA 4IFDD 3PYFA 4B3SI 1Z0EA 3KRNA 1Y6ZA 3ZZ0A 1UDNA 4X65E 4GKJE 3P3EA 2OI2A 1PKPA 1HNWE 4NXMI 2O1VA 1DARA 3F0NA 4JI8I 4JI5I 2UXCE 1B62A 1NHJA 5JEAA 3T1HI 1N34I 1Z0TA 2BA0G 2IOQA 3QT8A 1J5EI 3J7AG 4LFBI 1PIEA 4LFCI 4IFDC 1YHCA 5K36C 2Z5EA 4IZJD 1XNQE 3DD6A 5JEAE 4I3HA 2JE6A 2JEAB 2O1WA 4LF4E 1KKHA 1Z0VA 4HXZA 4N3OA 1ZM9A 2AJ4A 1N33I 1UEKA 2PNZB 2UXDI 1I94E 4JI0I 3D4JA 1XMQE 4LCGA 5IT9C 4OX9E 1NHIA 1XMOE 1A6FA 4DUYE 5FLXC 1D6TA 2F1DA 1N36I 3M7ND 3B4TA 5JEAF 1Z5BA 1EA6A 4YHHE 2NN6D 4B3SE 4DR6I 3PYEA 2A2DA 5LMUE 2XEXA 3ZZUA 2UU9E 4X66I 1S16A 2CGEA 4LCHA 4JI8E 4LF7I 4JI5E 4KHPE 3M85D 5C0XE 3J80C 2WNRB 1EI1A 4JI7I 1K47A 2HKEA 2E1RA 4FW5A 1N34E 2PNZA 2E5LI 1J5EE 5FLXQ 4OO1D 4IS9A 4LFBE 2CG9A 4NBQA 3GONA 4LFCE 4USMA 1RREA 4IZKB 4WUCA 4JI3I 4MU0A 2C38B 4DR4E 4DV2E 4FN5A 4DV0I 1Z0BA 2O1UA 2UUCE 2NN6E 4FW6A 2F4VI 4X64E 2BM0A 3P06A 1XXEA 2UXDE 4JI0E 1Z5CA 4UTGA 3J80Q 5C0XF 2BA1G 1S4EA 5BR8I 3GLLA 2VF3A 1HNZE 3OTOI 4OZEA 4K0KI 1IBMI 2V2ZA 5IWAI 4EMDA 3GCMA 1N36E 3H1CA 4MU3A
chains in the Genus database with same CATH topology
2V34A 2O1TA 4LF9I 1Z0WA 3HJCA 4DPXA 1HNXI 1MU5A 3K85A 2V2VA 1U2RA 4URLA 4YY3I 2J7KA 1N32I 4X66E 4B3TI 1Z0CA 4HACA 5LMNI 4JI7E 3Q6NA 5L3JA 2E5LE 4PRXA 1IBKI 4AQYI 3ZKDA 4X62I 1HK7A 3PYDA 3ZKBA 3WU6A 4FWHA 4DV0E 4NXNI 2F4VE 3ZM7A 4JI2I 4FWDA 4DU8A 5LL6R 1FWLA 4JI1I 3LTOA 4RPFA 4K0KE 4MYTA 5IWAE 4WUBA 4DV5I 2VQEI 4DXLA 4DUZI 1Z59A 2IOPA 4LF9E 1MG7A 4JI4I 2HFUA 1N32E 4B3TE 1ZXNA 4JYAE 3QT5A 4DR2I 3PRYA 4DR3I 5LMNE 5A2QC 2X36A 4B3RE 2ZBKB 1IBKE 4AQYE 2HHHI 4X62E 3J81C 4R1FA 2UUBI 1B63A 3J7AM 4NXME 3WU3A 4LFAI 2DEIA 3K17A 1FNMA 4JI2E 2V2QA 5A2QQ 3T1HE 1OJ4A 4KQVA 4DV6I 3PYGA 2V8PA 4JI1E 4DV3I 1H73A 1IBLI 5FWKA 1H72C 3T1YI 3J81Q 2VQEE 2Z5BB 2UUAI 4JI6I 4DUZE 4HACB 4JI4E 1N33E 2R42A 1XNRI 4DR2E 2X7IA 3CWVA 2VQFI 4DR1I 4JV5I 4P7AA 1Y4SA 3LPSA 4X65I 1HNWI 4ED4A 4HYMA 2ZM6I 2UUBE 4DR6E 1MX0A 4DV4I 1USVA 2BM1A 2UXCI 4LF5I 2Z5BA 4DR7I 4LFAE 1NZ0A 4LF7E 1N0UA 4DU7A 4PU9A 1XNQI 4Z7CA 1VISA 1IBLE 4XTJA 2GS8A 4LF4I 1BKNA 3V5RA 4WUDA 4JI3E 2Z5CA 5GMEA 2UUAE 2EFGA 1I94I 1FJGI 1PVGA 2PNLA 4IZJB 4OX9I 3WU5A 4PRVA 2ZITA 5BR8E 3QT7A 1USUA 3OTOE 2VQFE 4USKA 4YHHI 1IBME 1Z0GA 3QT6A 5LMUI 4UT4A 4DV7I 2ZM6E 2UU9I 3M6AA 1HNXE 4YY3E 4FW9A 4KHPI 4DV4E 4LF6I 4GKKI 1N0VC 4LF5E 3JAMQ 4DR7E 1KTVA 1H7SA 1KIJA 3H4LA 3HULA 4IZJA 4DPYA 2WW4A 1Z5AA 4DR4I 4DV2I 3K1JA 3ZZTA 2UUCI 3Q6MA 4LF8I 4HY1A 2CZ9A 4X64I 3B8HA 1FJGE 1ZM2A 1Y4UA 2HFSA 4NXNE 1FKAE 1HNZI 4DPUA 3LNUA 2NPFA 4DV5E 4DPWA 4DR5I 4DV7E 2UXBI 4P52A 1FWKA 3B82A 4LF6E 2DEJA 4JG4A 4DV1I 4GKKE 5IT9Q 2HKJA 4MYUA 2Q2EB 1HR0I 1H74A 4DR3E 3B78A 2Z5CB 4B3MI 2HHHE 4DPTA 1NHHA 4GKJI 3WU4A 4LF8E 1H7UA 1ZM3A 2BV3A 2R3VA 2PNMA 1KVKA 4DV6E 3Q1QA 4DV3E 3T1YE 1QZRA 4DR5E 1ZXMA 1RR9A 4IZKA 4JI6E 2UXBE 1XHKA 2GQ0A 1FI4A 1XMQI 4DV1E 4JYAI 3JAMC 4ZVIA 1ELOA 4Z7YA 3V2UC 2HK3A 1HR0E 1XMOI 1XNRE 4DUYI 2A2CA 4B3RI 4M1KA 1ZM4A 2HK2A 4FWGA 5GMDA 4B3ME 1WUUA 4DR1E 4JV5E 2LJPA 3PYFA 4B3SI 1Z0EA 4GKJE 1Y6ZA 3ZZ0A 4X65E 2OI2A 1PKPA 1HNWE 4NXMI 2O1VA 1DARA 3F0NA 4JI8I 4JI5I 2UXCE 1B62A 1NHJA 3T1HI 1N34I 1Z0TA 2IOQA 3QT8A 1J5EI 3J7AG 4LFBI 1PIEA 4LFCI 2Z5EA 4IZJD 1XNQE 4I3HA 2O1WA 4LF4E 1KKHA 1Z0VA 4HXZA 4N3OA 1ZM9A 2AJ4A 1N33I 1UEKA 2UXDI 1I94E 4JI0I 3D4JA 1XMQE 5IT9C 4OX9E 1NHIA 1XMOE 1A6FA 4DUYE 5FLXC 1D6TA 1N36I 1Z5BA 1EA6A 4YHHE 4B3SE 4DR6I 3PYEA 2A2DA 5LMUE 2XEXA 3ZZUA 2UU9E 4X66I 1S16A 2CGEA 4JI8E 4LF7I 4JI5E 4KHPE 3J80C 1EI1A 4JI7I 1K47A 2HKEA 2E1RA 1N34E 2E5LI 1J5EE 5FLXQ 4LFBE 2CG9A 4LFCE 3GONA 4USMA 1RREA 4IZKB 4WUCA 4JI3I 4DR4E 4DV2E 4FN5A 4DV0I 1Z0BA 2O1UA 2UUCE 2F4VI 4X64E 2BM0A 3P06A 2UXDE 4JI0E 1Z5CA 4UTGA 3J80Q 1S4EA 5BR8I 2VF3A 1HNZE 3OTOI 4K0KI 1IBMI 2V2ZA 5IWAI 4EMDA 1N36E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V34 A;  4LF9 I;  1Z0W A;  4DPX A;  1HNX I;  1MU5 A;  4YY3 I;  2V2V A;  1U2R A;  4URL A;  2J7K A;  1N32 I;  4X66 E;  4B3T I;  1Z0C A;  4HAC A;  5LMN I;  4JI7 E;  5L3J A;  2E5L E;  4PRX A;  1IBK I;  4AQY I;  3ZKD A;  4X62 I;  3PYD A;  3ZKB A;  3WU6 A;  4FWH A;  4DV0 E;  4NXN I;  2F4V E;  3ZM7 A;  4JI2 I;  4FWD A;  4DU8 A;  5LL6 R;  1FWL A;  4JI1 I;  3LTO A;  4RPF A;  4K0K E;  4MYT A;  5IWA E;  4WUB A;  4DV5 I;  2VQE I;  4DXL A;  4DUZ I;  1Z59 A;  4LF9 E;  1MG7 A;  4JI4 I;  2HFU A;  1N32 E;  4B3T E;  1ZXN A;  4JYA E;  3QT5 A;  4DR2 I;  4DR3 I;  5LMN E;  5A2Q C;  2X36 A;  4B3R E;  2ZBK B;  1IBK E;  4AQY E;  2HHH I;  4X62 E;  3J81 C;  4R1F A;  2UUB I;  1B63 A;  3J7A M;  4NXM E;  3WU3 A;  4LFA I;  2DEI A;  3K17 A;  1FNM A;  4JI2 E;  2V2Q A;  5A2Q Q;  3T1H E;  1OJ4 A;  4KQV A;  4DV6 I;  3PYG A;  2V8P A;  4JI1 E;  4DV3 I;  1H73 A;  1IBL I;  1H72 C;  3T1Y I;  3J81 Q;  2VQE E;  2UUA I;  4JI6 I;  4DUZ E;  4HAC B;  4JI4 E;  1N33 E;  2R42 A;  1XNR I;  4DR2 E;  2X7I A;  3CWV A;  2VQF I;  4DR1 I;  4JV5 I;  4P7A A;  3LPS A;  4X65 I;  1HNW I;  4ED4 A;  4HYM A;  2ZM6 I;  2UUB E;  4DR6 E;  1MX0 A;  4DV4 I;  2BM1 A;  2UXC I;  4LF5 I;  4DR7 I;  4LFA E;  1NZ0 A;  4LF7 E;  1N0U A;  4DU7 A;  4PU9 A;  1XNQ I;  4Z7C A;  1VIS A;  1IBL E;  4XTJ A;  2GS8 A;  4LF4 I;  1BKN A;  3V5R A;  4WUD A;  4JI3 E;  5GME A;  2UUA E;  2EFG A;  1I94 I;  1FJG I;  1PVG A;  4OX9 I;  3WU5 A;  4PRV A;  2ZIT A;  5BR8 E;  3QT7 A;  3OTO E;  2VQF E;  4USK A;  4YHH I;  1IBM E;  1Z0G A;  3QT6 A;  5LMU I;  4UT4 A;  4DV7 I;  2ZM6 E;  2UU9 I;  3M6A A;  1HNX E;  4YY3 E;  4FW9 A;  4KHP I;  4DV4 E;  4LF6 I;  4GKK I;  1N0V C;  4LF5 E;  3JAM Q;  4DR7 E;  1KTV A;  1H7S A;  1KIJ A;  3H4L A;  3HUL A;  4DPY A;  2WW4 A;  1Z5A A;  4DR4 I;  4DV2 I;  3K1J A;  3ZZT A;  2UUC I;  4LF8 I;  4HY1 A;  2CZ9 A;  4X64 I;  3B8H A;  1FJG E;  1ZM2 A;  2HFS A;  4NXN E;  1FKA E;  1HNZ I;  4DPU A;  3LNU A;  2NPF A;  4DV5 E;  4DPW A;  4DR5 I;  4DV7 E;  2UXB I;  4P52 A;  1FWK A;  3B82 A;  4LF6 E;  2DEJ A;  4JG4 A;  4DV1 I;  4GKK E;  5IT9 Q;  2HKJ A;  4MYU A;  2Q2E B;  1HR0 I;  1H74 A;  4DR3 E;  3B78 A;  4B3M I;  2HHH E;  4DPT A;  1NHH A;  4GKJ I;  3WU4 A;  4LF8 E;  1H7U A;  1ZM3 A;  2BV3 A;  2R3V A;  1KVK A;  4DV6 E;  3Q1Q A;  4DV3 E;  3T1Y E;  1QZR A;  4DR5 E;  1ZXM A;  1RR9 A;  4JI6 E;  2UXB E;  1XHK A;  1FI4 A;  1XMQ I;  4DV1 E;  4JYA I;  3JAM C;  4ZVI A;  1ELO A;  4Z7Y A;  3V2U C;  2HK3 A;  1HR0 E;  1XMO I;  1XNR E;  4DUY I;  2A2C A;  4B3R I;  4M1K A;  1ZM4 A;  2HK2 A;  4FWG A;  5GMD A;  4B3M E;  1WUU A;  4DR1 E;  4JV5 E;  2LJP A;  3PYF A;  4B3S I;  1Z0E A;  4GKJ E;  3ZZ0 A;  4X65 E;  2OI2 A;  1PKP A;  1HNW E;  4NXM I;  1DAR A;  3F0N A;  4JI8 I;  4JI5 I;  2UXC E;  1B62 A;  1NHJ A;  3T1H I;  1N34 I;  1Z0T A;  3QT8 A;  1J5E I;  3J7A G;  4LFB I;  1PIE A;  4LFC I;  1XNQ E;  4I3H A;  4LF4 E;  1KKH A;  1Z0V A;  4HXZ A;  1ZM9 A;  2AJ4 A;  1N33 I;  1UEK A;  2UXD I;  1I94 E;  4JI0 I;  3D4J A;  1XMQ E;  5IT9 C;  4OX9 E;  1NHI A;  1XMO E;  1A6F A;  4DUY E;  5FLX C;  1D6T A;  1N36 I;  1Z5B A;  1EA6 A;  4YHH E;  4B3S E;  4DR6 I;  3PYE A;  2A2D A;  5LMU E;  2XEX A;  3ZZU A;  2UU9 E;  4X66 I;  1S16 A;  4JI8 E;  4LF7 I;  4JI5 E;  4KHP E;  3J80 C;  1EI1 A;  4JI7 I;  1K47 A;  2HKE A;  2E1R A;  1N34 E;  2E5L I;  1J5E E;  5FLX Q;  4LFB E;  4LFC E;  3GON A;  4USM A;  1RRE A;  4WUC A;  4JI3 I;  4DR4 E;  4DV2 E;  4FN5 A;  4DV0 I;  1Z0B A;  2UUC E;  2F4V I;  4X64 E;  2BM0 A;  2UXD E;  4JI0 E;  1Z5C A;  4UTG A;  3J80 Q;  1S4E A;  5BR8 I;  2VF3 A;  1HNZ E;  3OTO I;  4K0K I;  1IBM I;  2V2Z A;  5IWA I;  4EMD A;  1N36 E; 
#chains in the Genus database with same CATH topology
 2V34 A;  2O1T A;  4LF9 I;  1E3H A;  1Z0W A;  3HJC A;  4LOM A;  4DPX A;  1HNX I;  1MU5 A;  3K85 A;  2NN6 F;  1U2R A;  2V2V A;  4URL A;  4YY3 I;  5JEA B;  3PS3 A;  2J7K A;  1UDS A;  1N32 I;  2CVE A;  4X66 E;  4B3T I;  1Z0C A;  2IES A;  2GO3 A;  4HAC A;  4MQY A;  5LMN I;  1OYS A;  2PO1 B;  4JI7 E;  2JT2 A;  3Q6N A;  4FW4 A;  5L3J A;  2E5L E;  4PRX A;  1IBK I;  4AQY I;  3ZKD A;  4X62 I;  1HK7 A;  4OO1 F;  3PYD A;  1UDQ A;  5K36 D;  3M7N G;  3ZKB A;  3WU6 A;  4FWH A;  2C37 B;  4DV0 E;  4NXN I;  2F4V E;  1Y60 A;  3ZM7 A;  4JI2 I;  4FWD A;  4DU8 A;  5LL6 R;  1FWL A;  2JEB B;  4JI1 I;  3LTO A;  4RPF A;  4K0K E;  5C0X B;  4MYT A;  5IWA E;  4WUB A;  4DV5 I;  2PO1 A;  2VQE I;  3U1Y A;  4DXL A;  4DUZ I;  1Z59 A;  2IOP A;  4LF9 E;  4IFD E;  4AID A;  1MG7 A;  4JI4 I;  2HFU A;  5DRQ A;  1N32 E;  4B3T E;  5JEA C;  2C37 A;  1ZXN A;  4JYA E;  3QT5 A;  4DR2 I;  3PRY A;  4DR3 I;  5LMN E;  5A2Q C;  4AIM A;  1UDO A;  4LCF A;  2X36 A;  4B3R E;  2ZBK B;  1IBK E;  4AQY E;  2HHH I;  4X62 E;  2PO2 A;  3J81 C;  4R1F A;  2JEB A;  2UUB I;  1B63 A;  3J7A M;  5C0X A;  4IFD F;  5K36 F;  4NXM E;  3WU3 A;  4LFA I;  2DEI A;  3K17 A;  1FNM A;  4JI2 E;  2V2Q A;  5A2Q Q;  3T1H E;  1OJ4 A;  4U3D A;  4KQV A;  4DV6 I;  3PYG A;  2V8P A;  4JI1 E;  4DV3 I;  1H73 A;  1IBL I;  5FWK A;  2NN6 A;  1H72 C;  3T1Y I;  3J81 Q;  3P3C A;  5ELW A;  1E3P A;  2GO4 A;  2VQE E;  2Z5B B;  2UUA I;  4JI6 I;  4DUZ E;  5DNL A;  4HAC B;  4JI4 E;  1N33 E;  2R42 A;  4OO1 A;  1OYP A;  1VI7 A;  1XNR I;  4DR2 E;  2X7I A;  3CWV A;  2VQF I;  4DR1 I;  4JV5 I;  4OO1 E;  4P7A A;  1Y4S A;  3LPS A;  4X65 I;  1HNW I;  4ED4 A;  4HYM A;  2ZM6 I;  2UUB E;  2BR2 A;  4DR6 E;  1MX0 A;  4DV4 I;  4MDT A;  1USV A;  2BM1 A;  3HKM A;  2UXC I;  4LF5 I;  2AE8 A;  2Z5B A;  4DR7 I;  4LFA E;  1NZ0 A;  4LF7 E;  2C39 A;  1N0U A;  4DU7 A;  4QNJ A;  5DRR A;  4PU9 A;  1XNQ I;  4Z7C A;  1VIS A;  1IBL E;  4GQU A;  4XTJ A;  5EL9 A;  2GS8 A;  1YH8 A;  1BKN A;  4LF4 I;  3V5R A;  4WUD A;  2VES A;  3GME A;  4JI3 E;  5EKW A;  2Z5C A;  5GME A;  2UUA E;  2EFG A;  1I94 I;  1FJG I;  1PVG A;  2PNL A;  4BA1 A;  4IZJ B;  4OX9 I;  3WU5 A;  3UHM A;  5DNX A;  2PO2 B;  4PRV A;  2ZIT A;  5BR8 E;  3M85 G;  5JEA D;  3QT7 A;  1USU A;  3OTO E;  2VQF E;  4IFD A;  5K36 A;  4USK A;  4YHH I;  1IBM E;  1Z0G A;  1P42 A;  3QT6 A;  5LMU I;  4UT4 A;  4DV7 I;  2ZM6 E;  2UU9 I;  3M6A A;  4BA2 B;  5K36 E;  2BA1 D;  1HNX E;  4YY3 E;  4FW9 A;  3PS2 A;  4DV4 E;  3P3G A;  4LF6 I;  4GKK I;  4KHP I;  1N0V C;  4LF5 E;  3JAM Q;  4DR7 E;  1KTV A;  1H7S A;  1KIJ A;  4U3B A;  2NN6 B;  3H4L A;  3HUL A;  4IZJ A;  4DPY A;  5DRO A;  2WW4 A;  1Z5A A;  4DR4 I;  4DV2 I;  3K1J A;  3ZZT A;  4FW7 A;  3Q6M A;  2UUC I;  4LF8 I;  4HY1 A;  2CZ9 A;  4OO1 B;  4X64 I;  5C0X D;  3B8H A;  1FJG E;  1RHY A;  1ZM2 A;  1Y4U A;  2HFS A;  4NXN E;  1FKA E;  3U1K A;  4BA2 A;  1HNZ I;  4DPU A;  3LNU A;  4J3D A;  3P76 A;  2BR2 B;  2NPF A;  4LPF A;  2IER A;  4DV5 E;  3NZK A;  4DPW A;  4DR5 I;  5C0X C;  4DV7 E;  1Y5Y A;  4MU1 A;  2UXB I;  2C39 B;  4P52 A;  1FWK A;  2JEA A;  3PS1 A;  3B82 A;  4LF6 E;  2DEJ A;  4JG4 A;  4DV1 I;  4GKK E;  2BA0 D;  5IT9 Q;  2HKJ A;  4MYU A;  2Q2E B;  3L7Z B;  1HR0 I;  1H74 A;  4DR3 E;  2NN6 C;  2Z5C B;  3B78 A;  4B3M I;  2PO0 B;  1OYR A;  2HHH E;  4BA1 B;  1NHH A;  4DPT A;  4GKJ I;  3WU4 A;  4LF8 E;  3CDJ A;  2J65 A;  4OO1 C;  1R6M A;  2O3Z A;  1H7U A;  4IFD B;  5K36 B;  2WP8 B;  1ZM3 A;  2BV3 A;  2R3V A;  2PNM A;  4FW3 A;  1KVK A;  5DRP A;  4DV6 E;  2WNR A;  3Q1Q A;  4DV3 E;  3L7Z A;  3T1Y E;  4AM3 A;  1QZR A;  1R6L A;  4DR5 E;  1ZXM A;  3CDI A;  1RR9 A;  4IZK A;  4JI6 E;  2UXB E;  2PO0 A;  1XHK A;  2C38 A;  2GQ0 A;  1FI4 A;  1XMQ I;  4DV1 E;  4JYA I;  4QNK A;  3JAM C;  4ZVI A;  4OKG A;  1ELO A;  4Z7Y A;  4MU4 A;  3V2U C;  2HK3 A;  2JE6 B;  1HR0 E;  1XMO I;  4ISA A;  1XNR E;  4DUY I;  2A2C A;  4B3R I;  4M1K A;  1ZM4 A;  2HK2 A;  4FWG A;  5GMD A;  4B3M E;  1WUU A;  4DR1 E;  4JV5 E;  2WP8 A;  2LJP A;  4IFD D;  3PYF A;  4B3S I;  1Z0E A;  3KRN A;  1Y6Z A;  3ZZ0 A;  1UDN A;  4X65 E;  4GKJ E;  3P3E A;  2OI2 A;  1PKP A;  1HNW E;  4NXM I;  2O1V A;  1DAR A;  3F0N A;  4JI8 I;  4JI5 I;  2UXC E;  1B62 A;  1NHJ A;  5JEA A;  3T1H I;  1N34 I;  1Z0T A;  2BA0 G;  2IOQ A;  3QT8 A;  1J5E I;  3J7A G;  4LFB I;  1PIE A;  4LFC I;  4IFD C;  1YHC A;  5K36 C;  2Z5E A;  4IZJ D;  1XNQ E;  3DD6 A;  5JEA E;  4I3H A;  2JE6 A;  2JEA B;  2O1W A;  4LF4 E;  1KKH A;  1Z0V A;  4HXZ A;  4N3O A;  1ZM9 A;  2AJ4 A;  1N33 I;  1UEK A;  2PNZ B;  2UXD I;  1I94 E;  4JI0 I;  3D4J A;  1XMQ E;  4LCG A;  5IT9 C;  4OX9 E;  1NHI A;  1XMO E;  1A6F A;  4DUY E;  5FLX C;  1D6T A;  2F1D A;  1N36 I;  3M7N D;  3B4T A;  5JEA F;  1Z5B A;  1EA6 A;  4YHH E;  2NN6 D;  4B3S E;  4DR6 I;  3PYE A;  2A2D A;  5LMU E;  2XEX A;  3ZZU A;  2UU9 E;  4X66 I;  1S16 A;  2CGE A;  4LCH A;  4JI8 E;  4LF7 I;  4JI5 E;  4KHP E;  3M85 D;  5C0X E;  3J80 C;  2WNR B;  1EI1 A;  4JI7 I;  1K47 A;  2HKE A;  2E1R A;  4FW5 A;  1N34 E;  2PNZ A;  2E5L I;  1J5E E;  5FLX Q;  4OO1 D;  4IS9 A;  4LFB E;  2CG9 A;  4NBQ A;  3GON A;  4LFC E;  4USM A;  1RRE A;  4IZK B;  4WUC A;  4JI3 I;  4MU0 A;  2C38 B;  4DR4 E;  4DV2 E;  4FN5 A;  4DV0 I;  1Z0B A;  2O1U A;  2UUC E;  2NN6 E;  4FW6 A;  2F4V I;  4X64 E;  2BM0 A;  3P06 A;  1XXE A;  2UXD E;  4JI0 E;  1Z5C A;  4UTG A;  3J80 Q;  5C0X F;  2BA1 G;  1S4E A;  5BR8 I;  3GLL A;  2VF3 A;  1HNZ E;  3OTO I;  4OZE A;  4K0K I;  1IBM I;  2V2Z A;  5IWA I;  4EMD A;  3GCM A;  1N36 E;  3H1C A;  4MU3 A; 
#chains in the Genus database with same CATH homology
 2V34 A;  2O1T A;  4LF9 I;  1Z0W A;  3HJC A;  4DPX A;  1HNX I;  1MU5 A;  3K85 A;  2V2V A;  1U2R A;  4URL A;  4YY3 I;  2J7K A;  1N32 I;  4X66 E;  4B3T I;  1Z0C A;  4HAC A;  5LMN I;  4JI7 E;  3Q6N A;  5L3J A;  2E5L E;  4PRX A;  1IBK I;  4AQY I;  3ZKD A;  4X62 I;  1HK7 A;  3PYD A;  3ZKB A;  3WU6 A;  4FWH A;  4DV0 E;  4NXN I;  2F4V E;  3ZM7 A;  4JI2 I;  4FWD A;  4DU8 A;  5LL6 R;  1FWL A;  4JI1 I;  3LTO A;  4RPF A;  4K0K E;  4MYT A;  5IWA E;  4WUB A;  4DV5 I;  2VQE I;  4DXL A;  4DUZ I;  1Z59 A;  2IOP A;  4LF9 E;  1MG7 A;  4JI4 I;  2HFU A;  1N32 E;  4B3T E;  1ZXN A;  4JYA E;  3QT5 A;  4DR2 I;  3PRY A;  4DR3 I;  5LMN E;  5A2Q C;  2X36 A;  4B3R E;  2ZBK B;  1IBK E;  4AQY E;  2HHH I;  4X62 E;  3J81 C;  4R1F A;  2UUB I;  1B63 A;  3J7A M;  4NXM E;  3WU3 A;  4LFA I;  2DEI A;  3K17 A;  1FNM A;  4JI2 E;  2V2Q A;  5A2Q Q;  3T1H E;  1OJ4 A;  4KQV A;  4DV6 I;  3PYG A;  2V8P A;  4JI1 E;  4DV3 I;  1H73 A;  1IBL I;  5FWK A;  1H72 C;  3T1Y I;  3J81 Q;  2VQE E;  2Z5B B;  2UUA I;  4JI6 I;  4DUZ E;  4HAC B;  4JI4 E;  1N33 E;  2R42 A;  1XNR I;  4DR2 E;  2X7I A;  3CWV A;  2VQF I;  4DR1 I;  4JV5 I;  4P7A A;  1Y4S A;  3LPS A;  4X65 I;  1HNW I;  4ED4 A;  4HYM A;  2ZM6 I;  2UUB E;  4DR6 E;  1MX0 A;  4DV4 I;  1USV A;  2BM1 A;  2UXC I;  4LF5 I;  2Z5B A;  4DR7 I;  4LFA E;  1NZ0 A;  4LF7 E;  1N0U A;  4DU7 A;  4PU9 A;  1XNQ I;  4Z7C A;  1VIS A;  1IBL E;  4XTJ A;  2GS8 A;  4LF4 I;  1BKN A;  3V5R A;  4WUD A;  4JI3 E;  2Z5C A;  5GME A;  2UUA E;  2EFG A;  1I94 I;  1FJG I;  1PVG A;  2PNL A;  4IZJ B;  4OX9 I;  3WU5 A;  4PRV A;  2ZIT A;  5BR8 E;  3QT7 A;  1USU A;  3OTO E;  2VQF E;  4USK A;  4YHH I;  1IBM E;  1Z0G A;  3QT6 A;  5LMU I;  4UT4 A;  4DV7 I;  2ZM6 E;  2UU9 I;  3M6A A;  1HNX E;  4YY3 E;  4FW9 A;  4KHP I;  4DV4 E;  4LF6 I;  4GKK I;  1N0V C;  4LF5 E;  3JAM Q;  4DR7 E;  1KTV A;  1H7S A;  1KIJ A;  3H4L A;  3HUL A;  4IZJ A;  4DPY A;  2WW4 A;  1Z5A A;  4DR4 I;  4DV2 I;  3K1J A;  3ZZT A;  2UUC I;  3Q6M A;  4LF8 I;  4HY1 A;  2CZ9 A;  4X64 I;  3B8H A;  1FJG E;  1ZM2 A;  1Y4U A;  2HFS A;  4NXN E;  1FKA E;  1HNZ I;  4DPU A;  3LNU A;  2NPF A;  4DV5 E;  4DPW A;  4DR5 I;  4DV7 E;  2UXB I;  4P52 A;  1FWK A;  3B82 A;  4LF6 E;  2DEJ A;  4JG4 A;  4DV1 I;  4GKK E;  5IT9 Q;  2HKJ A;  4MYU A;  2Q2E B;  1HR0 I;  1H74 A;  4DR3 E;  3B78 A;  2Z5C B;  4B3M I;  2HHH E;  4DPT A;  1NHH A;  4GKJ I;  3WU4 A;  4LF8 E;  1H7U A;  1ZM3 A;  2BV3 A;  2R3V A;  2PNM A;  1KVK A;  4DV6 E;  3Q1Q A;  4DV3 E;  3T1Y E;  1QZR A;  4DR5 E;  1ZXM A;  1RR9 A;  4IZK A;  4JI6 E;  2UXB E;  1XHK A;  2GQ0 A;  1FI4 A;  1XMQ I;  4DV1 E;  4JYA I;  3JAM C;  4ZVI A;  1ELO A;  4Z7Y A;  3V2U C;  2HK3 A;  1HR0 E;  1XMO I;  1XNR E;  4DUY I;  2A2C A;  4B3R I;  4M1K A;  1ZM4 A;  2HK2 A;  4FWG A;  5GMD A;  4B3M E;  1WUU A;  4DR1 E;  4JV5 E;  2LJP A;  3PYF A;  4B3S I;  1Z0E A;  4GKJ E;  1Y6Z A;  3ZZ0 A;  4X65 E;  2OI2 A;  1PKP A;  1HNW E;  4NXM I;  2O1V A;  1DAR A;  3F0N A;  4JI8 I;  4JI5 I;  2UXC E;  1B62 A;  1NHJ A;  3T1H I;  1N34 I;  1Z0T A;  2IOQ A;  3QT8 A;  1J5E I;  3J7A G;  4LFB I;  1PIE A;  4LFC I;  2Z5E A;  4IZJ D;  1XNQ E;  4I3H A;  2O1W A;  4LF4 E;  1KKH A;  1Z0V A;  4HXZ A;  4N3O A;  1ZM9 A;  2AJ4 A;  1N33 I;  1UEK A;  2UXD I;  1I94 E;  4JI0 I;  3D4J A;  1XMQ E;  5IT9 C;  4OX9 E;  1NHI A;  1XMO E;  1A6F A;  4DUY E;  5FLX C;  1D6T A;  1N36 I;  1Z5B A;  1EA6 A;  4YHH E;  4B3S E;  4DR6 I;  3PYE A;  2A2D A;  5LMU E;  2XEX A;  3ZZU A;  2UU9 E;  4X66 I;  1S16 A;  2CGE A;  4JI8 E;  4LF7 I;  4JI5 E;  4KHP E;  3J80 C;  1EI1 A;  4JI7 I;  1K47 A;  2HKE A;  2E1R A;  1N34 E;  2E5L I;  1J5E E;  5FLX Q;  4LFB E;  2CG9 A;  4LFC E;  3GON A;  4USM A;  1RRE A;  4IZK B;  4WUC A;  4JI3 I;  4DR4 E;  4DV2 E;  4FN5 A;  4DV0 I;  1Z0B A;  2O1U A;  2UUC E;  2F4V I;  4X64 E;  2BM0 A;  3P06 A;  2UXD E;  4JI0 E;  1Z5C A;  4UTG A;  3J80 Q;  1S4E A;  5BR8 I;  2VF3 A;  1HNZ E;  3OTO I;  4K0K I;  1IBM I;  2V2Z A;  5IWA I;  4EMD A;  1N36 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...