4LFAI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfaI00
1ELOA 2UXBE 1XNRE 3HULA 4LF8I 4DR4E 1H7UA 1S16A 2Q2EB 4B3RE 4JG4A 3Q1QA 5IT9Q 3T1HI 1Z0GA 1H74A 4LF7E 1EA6A 2BM0A 2NPFA 4NXNE 2VQFE 4M1KA 3OTOI 1DARA 4X65E 4LF6I 4JI8I 4K0KI 4DR6I 2HKEA 5BR8E 4JI7E 2UXBI 4ZVIA 1IBKE 2HK3A 1XNRI 2GS8A 3J80C 3CWVA 1Z5BA 4DR4I 1ZM3A 4DUYE 4B3RI 4PRXA 5A2QQ 3M6AA 4LF7I 4LF5E 4NXNI 3WU6A 2VQFI 1NHIA 4X65I 1FWLA 1HNWE 4FWHA 4P7AA 2ZM6E 1NHHA 2VQEE 2UU9E 1HNZE 1N0VC 4GKKE 1N36E 5BR8I 4JI7I 1VISA 4KHPE 1IBKI 3F0NA 4FWGA 5GMEA 5FLXQ 4DUYI 2EFGA 4XTJA 4B3SE 4JI1E 4DV3E 5GMDA 4YY3I 1HNWI 1N0UA 2ZM6I 2VQEI 3JAMQ 2UU9I 1NHJA 4DR5E 1HNZI 4ED4A 1FKAE 4GKKI 1N36I 3QT6A 4DV2E 4DV1E 4KHPI 2HKJA 4KQVA 2BV3A 4JI6E 4B3SI 3H4LA 2UXDE 4JI1I 3ZZ0A 4HY1A 3B8HA 3B78A 4DV3I 4X62I 3OTOE 4I3HA 4LF6E 1I94E 2R42A 2J7KA 4NXME 4DR6E 4UT4A 4DR5I 4LFAE 4YHHE 4DV2I 4DV1I 2V2VA 4HACB 4Z7YA 4LF9E 1B63A 3T1YE 4RPFA 1N34E 4P52A 2DEIA 3LNUA 1KVKA 4DPUA 4JI6I 4DV6E 4DR2E 1WUUA 2UXDI 2UUBE 2LJPA 3J7AM 4R1FA 4JI5I 2ZBKB 3D4JA 1ZM4A 2WW4A 1I94I 1H7SA 1K47A 4NXMI 4LFAI 4YHHI 3WU3A 5IT9C 4LF9I 3T1YI 1N34I 2HFUA 4DV6I 4HYMA 2A2DA 5IWAE 4DR2I 2A2CA 3LTOA 2UUBI 1UEKA 4JI3E 2UXCE 4YY3E 4USMA 2XEXA 4Z7CA 4DR3E 1FI4A 1MU5A 4FWDA 1FNMA 1A6FA 4USKA 2OI2A 5A2QC 2UUCE 3B82A 1PIEA 4WUBA 3ZKDA 2AJ4A 4DR7E 5IWAI 4URLA 4B3TE 4OX9E 4JI3I 2UXCI 4X62E 5LMUE 3ZZUA 4DR3I 4JV5E 1Z0BA 1IBLE 4DXLA 2F4VE 5FLXC 1ZXMA 1KTVA 3LPSA 4X64E 2UUCI 1HNXE 1IBME 1Z0CA 1KKHA 1HR0E 4DR7I 1XNQE 3ZZTA 2R3VA 1U2RA 1PKPA 4FW9A 2CZ9A 4B3TI 4OX9I 1N32E 4JI5E 3JAMC 4UTGA 4LFBE 2E1RA 3QT5A 2UUAE 5LMUI 2V2QA 4JV5I 3WU5A 4GKJE 1BKNA 1XMQI 1IBLI 5L3JA 2F4VI 1S4EA 1Z5AA 4X64I 1KIJA 2V34A 1HNXI 4DR1E 1ZXNA 1FJGE 1IBMI 1ZM2A 3PYFA 1HR0I 1N33E 3PYDA 4DUZE 1XMOE 1XNQI 1Z0EA 4PRVA 1N32I 4DV5E 4LFBI 3J81Q 1B62A 1FWKA 2BM1A 4X66E 2UUAI 1RR9A 2VF3A 4GKJI 3K17A 2E5LI 4HXZA 4MYTA 3J80Q 2HK2A 3V5RA 4DR1I 4JYAE 1FJGI 2HHHE 1H72C 1N33I 1H73A 1Z5CA 3J81C 4HACA 4JI2E 4DUZI 3K1JA 1XMOI 1J5EE 1MX0A 4DV5I 2X36A 4X66I 4DU8A 3V2UC 4B3ME 5LMNE 4DPWA 2X7IA 3ZKBA 3PYEA 1QZRA 4WUDA 4DU7A 2ZITA 1NZ0A 4DV0E 4JYAI 1ZM9A 2HHHI 4DPXA 4PU9A 1OJ4A 4JI2I 2DEJA 4DPYA 4JI4E 1J5EI 4DV7E 4JI0E 4LFCE 2HFSA 4AQYE 1XMQE 4B3MI 4EMDA 5LMNI 4LF4E 2V2ZA 4LF5I 4DV0I 4DPTA 4FN5A 3ZM7A 4WUCA 1PVGA 1Z59A 1XHKA 4DV4E 4MYUA 1EI1A 4JI4I 4DV7I 4JI0I 3WU4A 4LFCI 4LF8E 1Z0VA 1Z0TA 3GONA 4AQYI 2E5LE 4LF4I 5LL6R 3T1HE 1RREA 3PYGA 1D6TA 4DV4I 1Z0WA 4JI8E 3J7AG 4K0KE 2V8PA 3QT8A 3QT7A 1MG7A
chains in the Genus database with same CATH superfamily
1ELOA 2UXBE 1P42A 1XNRE 3HULA 2J65A 4LF8I 4OO1C 5K36C 4DR4E 1H7UA 4MDTA 1S16A 2Q2EB 4B3RE 4IFDE 3PS3A 4JG4A 2O3ZA 3Q1QA 5IT9Q 3T1HI 1Z0GA 2NN6E 1H74A 4LF7E 1HK7A 1EA6A 2BM0A 5JEAC 4IFDD 2NPFA 4NXNE 2VQFE 4M1KA 4N3OA 3OTOI 1DARA 4X65E 4LF6I 4JI8I 4K0KI 1Y4UA 4DR6I 2C39B 2NN6F 4LOMA 2HKEA 5BR8E 4JI7E 2UXBI 4ZVIA 2HK3A 5DNXA 1IBKE 1XNRI 2GS8A 2NN6A 3J80C 3CDJA 3CWVA 1Z5BA 3HJCA 4MU3A 4DR4I 1ZM3A 4DUYE 4B3RI 4PRXA 2JEBA 5A2QQ 3HKMA 3M6AA 4LF7I 4LF5E 5EKWA 5C0XE 2PNZA 4NXNI 3WU6A 2VQFI 1NHIA 1YHCA 4X65I 1FWLA 1HNWE 4FWHA 4P7AA 2ZM6E 1NHHA 2VQEE 2BA0D 2UU9E 1HNZE 1N0VC 1Y6ZA 4GKKE 1N36E 4MQYA 5C0XF 4OO1B 3KRNA 2WNRA 5BR8I 1VISA 4JI7I 5K36B 4KHPE 1IBKI 2O1VA 3F0NA 4FWGA 5GMEA 5FLXQ 5C0XA 4DUYI 2EFGA 1UDQA 4XTJA 4B3SE 2IERA 3GMEA 4JI1E 4IFDC 4DV3E 5GMDA 4YY3I 1HNWI 1N0UA 2ZM6I 2VQEI 3JAMQ 2UU9I 1NHJA 4DR5E 1HNZI 4ED4A 1FKAE 4GKKI 1N36I 3QT6A 4MU0A 4DV2E 4DV1E 2Z5CA 4KHPI 2HKJA 4IZJD 2PNMA 4KQVA 2BV3A 4LCGA 4JI6E 4B3SI 2JE6A 3H4LA 1YH8A 4IS9A 4LCHA 5JEAF 2UXDE 4JI1I 3ZZ0A 4HY1A 3B8HA 3B78A 4DV3I 4X62I 3OTOE 1XXEA 4I3HA 4LF6E 1I94E 2R42A 2J7KA 4NXME 2VESA 4DR6E 4UT4A 4DR5I 4LFAE 4YHHE 5DNLA 3B4TA 4DV2I 4DV1I 2V2VA 4HACB 4Z7YA 4FW6A 4LF9E 1B63A 1E3HA 3T1YE 4RPFA 2CGEA 1N34E 2PO1B 4P52A 2PO0A 1R6LA 3K85A 2DEIA 1OYSA 4BA2B 2BA1G 3LNUA 1KVKA 4DPUA 4JI6I 4DV6E 2Z5BA 2IESA 4DR2E 4IFDB 1WUUA 2UXDI 2UUBE 2LJPA 3J7AM 4R1FA 4JI5I 2ZBKB 3D4JA 1ZM4A 2NN6D 2WW4A 2JEBB 4AIMA 1I94I 1H7SA 1K47A 4NXMI 5DRRA 4LFAI 4YHHI 2PNZB 3WU3A 5IT9C 4LF9I 3T1YI 3P3EA 1N34I 5ELWA 1USVA 2HFUA 3Q6NA 4DV6I 4HYMA 2A2DA 5IWAE 4DR2I 2A2CA 3LTOA 2UUBI 4QNJA 1UEKA 2PO2A 3PRYA 4JI3E 2UXCE 4YY3E 4USMA 5C0XB 2XEXA 4Z7CA 4DR3E 4J3DA 1FI4A 5C0XD 4ISAA 1MU5A 2PNLA 4FWDA 1FNMA 1A6FA 3GCMA 5DRPA 4USKA 2OI2A 5A2QC 2UUCE 2C39A 3B82A 3M7NG 1PIEA 4WUBA 2BR2A 3ZKDA 2AJ4A 1USUA 4DR7E 5IWAI 4URLA 2O1WA 4B3TE 4OX9E 4JI3I 2UXCI 4X62E 2NN6C 5LMUE 3ZZUA 2JE6B 4DR3I 2WP8B 3P76A 4JV5E 1Z0BA 2JEAA 1IBLE 5JEAE 4DXLA 2F4VE 3L7ZA 5FLXC 1ZXMA 4IZJB 1KTVA 3LPSA 4X64E 2UUCI 1HNXE 2C37B 4MU4A 4OO1F 5K36F 4OZEA 5JEAD 1IBME 1Z0CA 1KKHA 1Y60A 1HR0E 3M7ND 4DR7I 2O1UA 4OO1A 5K36A 1XNQE 3U1YA 1Y4SA 1U2RA 2R3VA 3ZZTA 1PKPA 4FW9A 2CVEA 2CZ9A 3Q6MA 4B3TI 4OX9I 1N32E 4JI5E 3JAMC 4UTGA 2PO0B 4LFBE 2E1RA 3QT5A 5JEAA 2UUAE 5LMUI 2Z5BB 2V2QA 5C0XC 4JV5I 3WU5A 4GKJE 1E3PA 1BKNA 1XMQI 1IBLI 2IOPA 5L3JA 2F4VI 4QNKA 1S4EA 1Z5AA 3PS1A 2C38A 4BA1A 4X64I 1KIJA 2V34A 1HNXI 2GO4A 4DR1E 1ZXNA 1FJGE 3P3GA 1IBMI 1ZM2A 4GQUA 3PYFA 1HR0I 4OKGA 1N33E 3PYDA 4IZKA 4DUZE 1XMOE 1Z0EA 1XNQI 4PRVA 1N32I 2NN6B 4FW7A 4DV5E 4LFBI 3J81Q 1B62A 1FWKA 2BM1A 3U1KA 4X66E 2UUAI 1OYRA 1RR9A 2VF3A 4GKJI 3K17A 2O1TA 2PO2B 2E5LI 4HXZA 2Z5EA 4MYTA 3J80Q 2HK2A 3CDIA 3V5RA 4DR1I 4JYAE 1FJGI 4FW5A 2HHHE 1UDSA 1H72C 2BA0G 1N33I 1H73A 1Z5CA 3J81C 4HACA 4JI2E 4FW3A 2BA1D 4DUZI 3K1JA 1XMOI 2WNRB 2AE8A 2PO1A 4AM3A 4LPFA 4IFDF 2IOQA 1J5EE 4BA2A 1MX0A 4DV5I 2BR2B 4MU1A 2CG9A 4IFDA 2X36A 3GLLA 4X66I 4DU8A 3NZKA 4LCFA 3V2UC 4B3ME 5LMNE 4NBQA 4DPWA 2X7IA 3ZKBA 3PYEA 1QZRA 5EL9A 4WUDA 4U3BA 4DU7A 2ZITA 1NZ0A 4DV0E 4JYAI 1ZM9A 2HHHI 2JEAB 4DPXA 4FW4A 3UHMA 4PU9A 3L7ZB 1OJ4A 4JI2I 2DEJA 4DPYA 1UDOA 4JI4E 2Z5CB 1J5EI 4DV7E 4JI0E 4OO1E 5K36E 4LFCE 2HFSA 2GO3A 4AQYE 4OO1D 5K36D 1XMQE 4B3MI 4EMDA 3PS2A 5LMNI 4LF4E 3M85G 5JEAB 2V2ZA 3H1CA 4LF5I 4DV0I 4DPTA 4FN5A 3ZM7A 4WUCA 1PVGA 1Z59A 1XHKA 4DV4E 2C38B 4MYUA 5DRQA 1EI1A 4BA1B 4JI4I 4AIDA 2JT2A 4DV7I 5DROA 4JI0I 1UDNA 3P3CA 3WU4A 4LFCI 4IZKB 4LF8E 1Z0VA 1Z0TA 3GONA 4AQYI 5FWKA 2E5LE 4LF4I 5LL6R 3P06A 3T1HE 1Y5YA 2WP8A 1RHYA 1RREA 3M85D 3PYGA 4U3DA 1D6TA 4DV4I 4IZJA 1Z0WA 1R6MA 2C37A 1OYPA 2GQ0A 4JI8E 3J7AG 4K0KE 1VI7A 2V8PA 3QT8A 2F1DA 3QT7A 1MG7A 3DD6A
chains in the Genus database with same CATH topology
1ELOA 2UXBE 1XNRE 3HULA 4LF8I 4DR4E 1H7UA 1S16A 2Q2EB 4B3RE 4JG4A 3Q1QA 5IT9Q 3T1HI 1Z0GA 1H74A 4LF7E 1HK7A 1EA6A 2BM0A 2NPFA 4NXNE 2VQFE 4M1KA 4N3OA 3OTOI 1DARA 4X65E 4LF6I 4JI8I 4K0KI 1Y4UA 4DR6I 2HKEA 5BR8E 4JI7E 2UXBI 4ZVIA 2HK3A 1IBKE 1XNRI 2GS8A 3J80C 3CWVA 1Z5BA 3HJCA 4DR4I 1ZM3A 4DUYE 4B3RI 4PRXA 5A2QQ 3M6AA 4LF7I 4LF5E 4NXNI 3WU6A 2VQFI 1NHIA 4X65I 1FWLA 1HNWE 4FWHA 4P7AA 2ZM6E 1NHHA 2VQEE 2UU9E 1HNZE 1N0VC 1Y6ZA 4GKKE 1N36E 5BR8I 4JI7I 1VISA 4KHPE 1IBKI 2O1VA 3F0NA 4FWGA 5GMEA 5FLXQ 4DUYI 2EFGA 4XTJA 4B3SE 4JI1E 4DV3E 5GMDA 4YY3I 1HNWI 1N0UA 2ZM6I 2VQEI 3JAMQ 2UU9I 1NHJA 4DR5E 1HNZI 4ED4A 1FKAE 4GKKI 1N36I 3QT6A 4DV2E 4DV1E 2Z5CA 4KHPI 2HKJA 4IZJD 2PNMA 4KQVA 2BV3A 4JI6E 4B3SI 3H4LA 2UXDE 4JI1I 3ZZ0A 4HY1A 3B8HA 3B78A 4DV3I 4X62I 3OTOE 4I3HA 4LF6E 1I94E 2R42A 2J7KA 4NXME 4DR6E 4UT4A 4DR5I 4LFAE 4YHHE 4DV2I 4DV1I 2V2VA 4HACB 4Z7YA 4LF9E 1B63A 3T1YE 4RPFA 2CGEA 1N34E 4P52A 3K85A 2DEIA 3LNUA 1KVKA 4DPUA 4JI6I 4DV6E 2Z5BA 4DR2E 1WUUA 2UXDI 2UUBE 2LJPA 3J7AM 4R1FA 4JI5I 2ZBKB 3D4JA 1ZM4A 2WW4A 1I94I 1H7SA 1K47A 4NXMI 4LFAI 4YHHI 3WU3A 5IT9C 4LF9I 3T1YI 1N34I 1USVA 2HFUA 3Q6NA 4DV6I 4HYMA 2A2DA 5IWAE 4DR2I 2A2CA 3LTOA 2UUBI 1UEKA 3PRYA 4JI3E 2UXCE 4YY3E 4USMA 2XEXA 4Z7CA 4DR3E 1FI4A 1MU5A 2PNLA 4FWDA 1FNMA 1A6FA 4USKA 2OI2A 5A2QC 2UUCE 3B82A 1PIEA 4WUBA 3ZKDA 2AJ4A 1USUA 4DR7E 5IWAI 4URLA 2O1WA 4B3TE 4OX9E 4JI3I 2UXCI 4X62E 5LMUE 3ZZUA 4DR3I 4JV5E 1Z0BA 1IBLE 4DXLA 2F4VE 5FLXC 1ZXMA 4IZJB 1KTVA 3LPSA 4X64E 2UUCI 1HNXE 1IBME 1Z0CA 1KKHA 1HR0E 4DR7I 2O1UA 1XNQE 3ZZTA 1Y4SA 1U2RA 2R3VA 1PKPA 3Q6MA 2CZ9A 4FW9A 4B3TI 4OX9I 1N32E 4JI5E 3JAMC 4UTGA 4LFBE 2E1RA 3QT5A 2UUAE 5LMUI 2Z5BB 2V2QA 4JV5I 3WU5A 4GKJE 1BKNA 1XMQI 1IBLI 2IOPA 5L3JA 2F4VI 1S4EA 1Z5AA 4X64I 1KIJA 2V34A 1HNXI 4DR1E 1ZXNA 1FJGE 1IBMI 1ZM2A 3PYFA 1HR0I 1N33E 3PYDA 4IZKA 4DUZE 1XMOE 1Z0EA 1XNQI 4PRVA 1N32I 4DV5E 4LFBI 3J81Q 1B62A 1FWKA 2BM1A 4X66E 2UUAI 1RR9A 2VF3A 4GKJI 3K17A 2O1TA 2E5LI 4HXZA 2Z5EA 4MYTA 3J80Q 2HK2A 3V5RA 4DR1I 4JYAE 1FJGI 2HHHE 1H72C 1N33I 1H73A 1Z5CA 3J81C 4HACA 4JI2E 4DUZI 3K1JA 1XMOI 1J5EE 2IOQA 1MX0A 4DV5I 2CG9A 2X36A 4X66I 4DU8A 3V2UC 4B3ME 5LMNE 4DPWA 2X7IA 3ZKBA 3PYEA 1QZRA 4WUDA 4DU7A 2ZITA 1NZ0A 4DV0E 4JYAI 1ZM9A 2HHHI 4DPXA 4PU9A 1OJ4A 4JI2I 2DEJA 4DPYA 4JI4E 2Z5CB 1J5EI 4DV7E 4JI0E 4LFCE 2HFSA 4AQYE 1XMQE 4B3MI 4EMDA 5LMNI 4LF4E 2V2ZA 4LF5I 4DV0I 4DPTA 4FN5A 3ZM7A 4WUCA 1PVGA 1Z59A 1XHKA 4DV4E 4MYUA 1EI1A 4JI4I 4DV7I 4JI0I 3WU4A 4LFCI 4IZKB 4LF8E 1Z0VA 1Z0TA 3GONA 4AQYI 5FWKA 2E5LE 4LF4I 5LL6R 3P06A 3T1HE 1RREA 3PYGA 1D6TA 4DV4I 4IZJA 1Z0WA 2GQ0A 4JI8E 3J7AG 4K0KE 2V8PA 3QT8A 3QT7A 1MG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELO A;  2UXB E;  1XNR E;  3HUL A;  4LF8 I;  4DR4 E;  1H7U A;  1S16 A;  2Q2E B;  4B3R E;  4JG4 A;  3Q1Q A;  5IT9 Q;  3T1H I;  1Z0G A;  1H74 A;  4LF7 E;  1EA6 A;  2BM0 A;  2NPF A;  4NXN E;  2VQF E;  4M1K A;  3OTO I;  1DAR A;  4X65 E;  4LF6 I;  4JI8 I;  4K0K I;  4DR6 I;  2HKE A;  5BR8 E;  4JI7 E;  2UXB I;  4ZVI A;  1IBK E;  2HK3 A;  1XNR I;  2GS8 A;  3J80 C;  3CWV A;  1Z5B A;  4DR4 I;  1ZM3 A;  4DUY E;  4B3R I;  4PRX A;  5A2Q Q;  3M6A A;  4LF7 I;  4LF5 E;  4NXN I;  3WU6 A;  2VQF I;  1NHI A;  4X65 I;  1FWL A;  1HNW E;  4FWH A;  4P7A A;  2ZM6 E;  1NHH A;  2VQE E;  2UU9 E;  1HNZ E;  1N0V C;  4GKK E;  1N36 E;  5BR8 I;  4JI7 I;  1VIS A;  4KHP E;  1IBK I;  3F0N A;  4FWG A;  5GME A;  5FLX Q;  4DUY I;  2EFG A;  4XTJ A;  4B3S E;  4JI1 E;  4DV3 E;  5GMD A;  4YY3 I;  1HNW I;  1N0U A;  2ZM6 I;  2VQE I;  3JAM Q;  2UU9 I;  1NHJ A;  4DR5 E;  1HNZ I;  4ED4 A;  1FKA E;  4GKK I;  1N36 I;  3QT6 A;  4DV2 E;  4DV1 E;  4KHP I;  2HKJ A;  4KQV A;  2BV3 A;  4JI6 E;  4B3S I;  3H4L A;  2UXD E;  4JI1 I;  3ZZ0 A;  4HY1 A;  3B8H A;  3B78 A;  4DV3 I;  4X62 I;  3OTO E;  4I3H A;  4LF6 E;  1I94 E;  2R42 A;  2J7K A;  4NXM E;  4DR6 E;  4UT4 A;  4DR5 I;  4LFA E;  4YHH E;  4DV2 I;  4DV1 I;  2V2V A;  4HAC B;  4Z7Y A;  4LF9 E;  1B63 A;  3T1Y E;  4RPF A;  1N34 E;  4P52 A;  2DEI A;  3LNU A;  1KVK A;  4DPU A;  4JI6 I;  4DV6 E;  4DR2 E;  1WUU A;  2UXD I;  2UUB E;  2LJP A;  3J7A M;  4R1F A;  4JI5 I;  2ZBK B;  3D4J A;  1ZM4 A;  2WW4 A;  1I94 I;  1H7S A;  1K47 A;  4NXM I;  4LFA I;  4YHH I;  3WU3 A;  5IT9 C;  4LF9 I;  3T1Y I;  1N34 I;  2HFU A;  4DV6 I;  4HYM A;  2A2D A;  5IWA E;  4DR2 I;  2A2C A;  3LTO A;  2UUB I;  1UEK A;  4JI3 E;  2UXC E;  4YY3 E;  4USM A;  2XEX A;  4Z7C A;  4DR3 E;  1FI4 A;  1MU5 A;  4FWD A;  1FNM A;  1A6F A;  4USK A;  2OI2 A;  5A2Q C;  2UUC E;  3B82 A;  1PIE A;  4WUB A;  3ZKD A;  2AJ4 A;  4DR7 E;  5IWA I;  4URL A;  4B3T E;  4OX9 E;  4JI3 I;  2UXC I;  4X62 E;  5LMU E;  3ZZU A;  4DR3 I;  4JV5 E;  1Z0B A;  1IBL E;  4DXL A;  2F4V E;  5FLX C;  1ZXM A;  1KTV A;  3LPS A;  4X64 E;  2UUC I;  1HNX E;  1IBM E;  1Z0C A;  1KKH A;  1HR0 E;  4DR7 I;  1XNQ E;  3ZZT A;  2R3V A;  1U2R A;  1PKP A;  4FW9 A;  2CZ9 A;  4B3T I;  4OX9 I;  1N32 E;  4JI5 E;  3JAM C;  4UTG A;  4LFB E;  2E1R A;  3QT5 A;  2UUA E;  5LMU I;  2V2Q A;  4JV5 I;  3WU5 A;  4GKJ E;  1BKN A;  1XMQ I;  1IBL I;  5L3J A;  2F4V I;  1S4E A;  1Z5A A;  4X64 I;  1KIJ A;  2V34 A;  1HNX I;  4DR1 E;  1ZXN A;  1FJG E;  1IBM I;  1ZM2 A;  3PYF A;  1HR0 I;  1N33 E;  3PYD A;  4DUZ E;  1XMO E;  1XNQ I;  1Z0E A;  4PRV A;  1N32 I;  4DV5 E;  4LFB I;  3J81 Q;  1B62 A;  1FWK A;  2BM1 A;  4X66 E;  2UUA I;  1RR9 A;  2VF3 A;  4GKJ I;  3K17 A;  2E5L I;  4HXZ A;  4MYT A;  3J80 Q;  2HK2 A;  3V5R A;  4DR1 I;  4JYA E;  1FJG I;  2HHH E;  1H72 C;  1N33 I;  1H73 A;  1Z5C A;  3J81 C;  4HAC A;  4JI2 E;  4DUZ I;  3K1J A;  1XMO I;  1J5E E;  1MX0 A;  4DV5 I;  2X36 A;  4X66 I;  4DU8 A;  3V2U C;  4B3M E;  5LMN E;  4DPW A;  2X7I A;  3ZKB A;  3PYE A;  1QZR A;  4WUD A;  4DU7 A;  2ZIT A;  1NZ0 A;  4DV0 E;  4JYA I;  1ZM9 A;  2HHH I;  4DPX A;  4PU9 A;  1OJ4 A;  4JI2 I;  2DEJ A;  4DPY A;  4JI4 E;  1J5E I;  4DV7 E;  4JI0 E;  4LFC E;  2HFS A;  4AQY E;  1XMQ E;  4B3M I;  4EMD A;  5LMN I;  4LF4 E;  2V2Z A;  4LF5 I;  4DV0 I;  4DPT A;  4FN5 A;  3ZM7 A;  4WUC A;  1PVG A;  1Z59 A;  1XHK A;  4DV4 E;  4MYU A;  1EI1 A;  4JI4 I;  4DV7 I;  4JI0 I;  3WU4 A;  4LFC I;  4LF8 E;  1Z0V A;  1Z0T A;  3GON A;  4AQY I;  2E5L E;  4LF4 I;  5LL6 R;  3T1H E;  1RRE A;  3PYG A;  1D6T A;  4DV4 I;  1Z0W A;  4JI8 E;  3J7A G;  4K0K E;  2V8P A;  3QT8 A;  3QT7 A;  1MG7 A; 
#chains in the Genus database with same CATH topology
 1ELO A;  2UXB E;  1P42 A;  1XNR E;  3HUL A;  2J65 A;  4LF8 I;  4OO1 C;  5K36 C;  4DR4 E;  1H7U A;  4MDT A;  1S16 A;  2Q2E B;  4B3R E;  4IFD E;  3PS3 A;  4JG4 A;  2O3Z A;  3Q1Q A;  5IT9 Q;  3T1H I;  1Z0G A;  2NN6 E;  1H74 A;  4LF7 E;  1HK7 A;  1EA6 A;  2BM0 A;  5JEA C;  4IFD D;  2NPF A;  4NXN E;  2VQF E;  4M1K A;  4N3O A;  3OTO I;  1DAR A;  4X65 E;  4LF6 I;  4JI8 I;  4K0K I;  1Y4U A;  4DR6 I;  2C39 B;  2NN6 F;  4LOM A;  2HKE A;  5BR8 E;  4JI7 E;  2UXB I;  4ZVI A;  2HK3 A;  5DNX A;  1IBK E;  1XNR I;  2GS8 A;  2NN6 A;  3J80 C;  3CDJ A;  3CWV A;  1Z5B A;  3HJC A;  4MU3 A;  4DR4 I;  1ZM3 A;  4DUY E;  4B3R I;  4PRX A;  2JEB A;  5A2Q Q;  3HKM A;  3M6A A;  4LF7 I;  4LF5 E;  5EKW A;  5C0X E;  2PNZ A;  4NXN I;  3WU6 A;  2VQF I;  1NHI A;  1YHC A;  4X65 I;  1FWL A;  1HNW E;  4FWH A;  4P7A A;  2ZM6 E;  1NHH A;  2VQE E;  2BA0 D;  2UU9 E;  1HNZ E;  1N0V C;  1Y6Z A;  4GKK E;  1N36 E;  4MQY A;  5C0X F;  4OO1 B;  3KRN A;  2WNR A;  5BR8 I;  1VIS A;  4JI7 I;  5K36 B;  4KHP E;  1IBK I;  2O1V A;  3F0N A;  4FWG A;  5GME A;  5FLX Q;  5C0X A;  4DUY I;  2EFG A;  1UDQ A;  4XTJ A;  4B3S E;  2IER A;  3GME A;  4JI1 E;  4IFD C;  4DV3 E;  5GMD A;  4YY3 I;  1HNW I;  1N0U A;  2ZM6 I;  2VQE I;  3JAM Q;  2UU9 I;  1NHJ A;  4DR5 E;  1HNZ I;  4ED4 A;  1FKA E;  4GKK I;  1N36 I;  3QT6 A;  4MU0 A;  4DV2 E;  4DV1 E;  2Z5C A;  4KHP I;  2HKJ A;  4IZJ D;  2PNM A;  4KQV A;  2BV3 A;  4LCG A;  4JI6 E;  4B3S I;  2JE6 A;  3H4L A;  1YH8 A;  4IS9 A;  4LCH A;  5JEA F;  2UXD E;  4JI1 I;  3ZZ0 A;  4HY1 A;  3B8H A;  3B78 A;  4DV3 I;  4X62 I;  3OTO E;  1XXE A;  4I3H A;  4LF6 E;  1I94 E;  2R42 A;  2J7K A;  4NXM E;  2VES A;  4DR6 E;  4UT4 A;  4DR5 I;  4LFA E;  4YHH E;  5DNL A;  3B4T A;  4DV2 I;  4DV1 I;  2V2V A;  4HAC B;  4Z7Y A;  4FW6 A;  4LF9 E;  1B63 A;  1E3H A;  3T1Y E;  4RPF A;  2CGE A;  1N34 E;  2PO1 B;  4P52 A;  2PO0 A;  1R6L A;  3K85 A;  2DEI A;  1OYS A;  4BA2 B;  2BA1 G;  3LNU A;  1KVK A;  4DPU A;  4JI6 I;  4DV6 E;  2Z5B A;  2IES A;  4DR2 E;  4IFD B;  1WUU A;  2UXD I;  2UUB E;  2LJP A;  3J7A M;  4R1F A;  4JI5 I;  2ZBK B;  3D4J A;  1ZM4 A;  2NN6 D;  2WW4 A;  2JEB B;  4AIM A;  1I94 I;  1H7S A;  1K47 A;  4NXM I;  5DRR A;  4LFA I;  4YHH I;  2PNZ B;  3WU3 A;  5IT9 C;  4LF9 I;  3T1Y I;  3P3E A;  1N34 I;  5ELW A;  1USV A;  2HFU A;  3Q6N A;  4DV6 I;  4HYM A;  2A2D A;  5IWA E;  4DR2 I;  2A2C A;  3LTO A;  2UUB I;  4QNJ A;  1UEK A;  2PO2 A;  3PRY A;  4JI3 E;  2UXC E;  4YY3 E;  4USM A;  5C0X B;  2XEX A;  4Z7C A;  4DR3 E;  4J3D A;  1FI4 A;  5C0X D;  4ISA A;  1MU5 A;  2PNL A;  4FWD A;  1FNM A;  1A6F A;  3GCM A;  5DRP A;  4USK A;  2OI2 A;  5A2Q C;  2UUC E;  2C39 A;  3B82 A;  3M7N G;  1PIE A;  4WUB A;  2BR2 A;  3ZKD A;  2AJ4 A;  1USU A;  4DR7 E;  5IWA I;  4URL A;  2O1W A;  4B3T E;  4OX9 E;  4JI3 I;  2UXC I;  4X62 E;  2NN6 C;  5LMU E;  3ZZU A;  2JE6 B;  4DR3 I;  2WP8 B;  3P76 A;  4JV5 E;  1Z0B A;  2JEA A;  1IBL E;  5JEA E;  4DXL A;  2F4V E;  3L7Z A;  5FLX C;  1ZXM A;  4IZJ B;  1KTV A;  3LPS A;  4X64 E;  2UUC I;  1HNX E;  2C37 B;  4MU4 A;  4OO1 F;  5K36 F;  4OZE A;  5JEA D;  1IBM E;  1Z0C A;  1KKH A;  1Y60 A;  1HR0 E;  3M7N D;  4DR7 I;  2O1U A;  4OO1 A;  5K36 A;  1XNQ E;  3U1Y A;  1Y4S A;  1U2R A;  2R3V A;  3ZZT A;  1PKP A;  4FW9 A;  2CVE A;  2CZ9 A;  3Q6M A;  4B3T I;  4OX9 I;  1N32 E;  4JI5 E;  3JAM C;  4UTG A;  2PO0 B;  4LFB E;  2E1R A;  3QT5 A;  5JEA A;  2UUA E;  5LMU I;  2Z5B B;  2V2Q A;  5C0X C;  4JV5 I;  3WU5 A;  4GKJ E;  1E3P A;  1BKN A;  1XMQ I;  1IBL I;  2IOP A;  5L3J A;  2F4V I;  4QNK A;  1S4E A;  1Z5A A;  3PS1 A;  2C38 A;  4BA1 A;  4X64 I;  1KIJ A;  2V34 A;  1HNX I;  2GO4 A;  4DR1 E;  1ZXN A;  1FJG E;  3P3G A;  1IBM I;  1ZM2 A;  4GQU A;  3PYF A;  1HR0 I;  4OKG A;  1N33 E;  3PYD A;  4IZK A;  4DUZ E;  1XMO E;  1Z0E A;  1XNQ I;  4PRV A;  1N32 I;  2NN6 B;  4FW7 A;  4DV5 E;  4LFB I;  3J81 Q;  1B62 A;  1FWK A;  2BM1 A;  3U1K A;  4X66 E;  2UUA I;  1OYR A;  1RR9 A;  2VF3 A;  4GKJ I;  3K17 A;  2O1T A;  2PO2 B;  2E5L I;  4HXZ A;  2Z5E A;  4MYT A;  3J80 Q;  2HK2 A;  3CDI A;  3V5R A;  4DR1 I;  4JYA E;  1FJG I;  4FW5 A;  2HHH E;  1UDS A;  1H72 C;  2BA0 G;  1N33 I;  1H73 A;  1Z5C A;  3J81 C;  4HAC A;  4JI2 E;  4FW3 A;  2BA1 D;  4DUZ I;  3K1J A;  1XMO I;  2WNR B;  2AE8 A;  2PO1 A;  4AM3 A;  4LPF A;  4IFD F;  2IOQ A;  1J5E E;  4BA2 A;  1MX0 A;  4DV5 I;  2BR2 B;  4MU1 A;  2CG9 A;  4IFD A;  2X36 A;  3GLL A;  4X66 I;  4DU8 A;  3NZK A;  4LCF A;  3V2U C;  4B3M E;  5LMN E;  4NBQ A;  4DPW A;  2X7I A;  3ZKB A;  3PYE A;  1QZR A;  5EL9 A;  4WUD A;  4U3B A;  4DU7 A;  2ZIT A;  1NZ0 A;  4DV0 E;  4JYA I;  1ZM9 A;  2HHH I;  2JEA B;  4DPX A;  4FW4 A;  3UHM A;  4PU9 A;  3L7Z B;  1OJ4 A;  4JI2 I;  2DEJ A;  4DPY A;  1UDO A;  4JI4 E;  2Z5C B;  1J5E I;  4DV7 E;  4JI0 E;  4OO1 E;  5K36 E;  4LFC E;  2HFS A;  2GO3 A;  4AQY E;  4OO1 D;  5K36 D;  1XMQ E;  4B3M I;  4EMD A;  3PS2 A;  5LMN I;  4LF4 E;  3M85 G;  5JEA B;  2V2Z A;  3H1C A;  4LF5 I;  4DV0 I;  4DPT A;  4FN5 A;  3ZM7 A;  4WUC A;  1PVG A;  1Z59 A;  1XHK A;  4DV4 E;  2C38 B;  4MYU A;  5DRQ A;  1EI1 A;  4BA1 B;  4JI4 I;  4AID A;  2JT2 A;  4DV7 I;  5DRO A;  4JI0 I;  1UDN A;  3P3C A;  3WU4 A;  4LFC I;  4IZK B;  4LF8 E;  1Z0V A;  1Z0T A;  3GON A;  4AQY I;  5FWK A;  2E5L E;  4LF4 I;  5LL6 R;  3P06 A;  3T1H E;  1Y5Y A;  2WP8 A;  1RHY A;  1RRE A;  3M85 D;  3PYG A;  4U3D A;  1D6T A;  4DV4 I;  4IZJ A;  1Z0W A;  1R6M A;  2C37 A;  1OYP A;  2GQ0 A;  4JI8 E;  3J7A G;  4K0K E;  1VI7 A;  2V8P A;  3QT8 A;  2F1D A;  3QT7 A;  1MG7 A;  3DD6 A; 
#chains in the Genus database with same CATH homology
 1ELO A;  2UXB E;  1XNR E;  3HUL A;  4LF8 I;  4DR4 E;  1H7U A;  1S16 A;  2Q2E B;  4B3R E;  4JG4 A;  3Q1Q A;  5IT9 Q;  3T1H I;  1Z0G A;  1H74 A;  4LF7 E;  1HK7 A;  1EA6 A;  2BM0 A;  2NPF A;  4NXN E;  2VQF E;  4M1K A;  4N3O A;  3OTO I;  1DAR A;  4X65 E;  4LF6 I;  4JI8 I;  4K0K I;  1Y4U A;  4DR6 I;  2HKE A;  5BR8 E;  4JI7 E;  2UXB I;  4ZVI A;  2HK3 A;  1IBK E;  1XNR I;  2GS8 A;  3J80 C;  3CWV A;  1Z5B A;  3HJC A;  4DR4 I;  1ZM3 A;  4DUY E;  4B3R I;  4PRX A;  5A2Q Q;  3M6A A;  4LF7 I;  4LF5 E;  4NXN I;  3WU6 A;  2VQF I;  1NHI A;  4X65 I;  1FWL A;  1HNW E;  4FWH A;  4P7A A;  2ZM6 E;  1NHH A;  2VQE E;  2UU9 E;  1HNZ E;  1N0V C;  1Y6Z A;  4GKK E;  1N36 E;  5BR8 I;  4JI7 I;  1VIS A;  4KHP E;  1IBK I;  2O1V A;  3F0N A;  4FWG A;  5GME A;  5FLX Q;  4DUY I;  2EFG A;  4XTJ A;  4B3S E;  4JI1 E;  4DV3 E;  5GMD A;  4YY3 I;  1HNW I;  1N0U A;  2ZM6 I;  2VQE I;  3JAM Q;  2UU9 I;  1NHJ A;  4DR5 E;  1HNZ I;  4ED4 A;  1FKA E;  4GKK I;  1N36 I;  3QT6 A;  4DV2 E;  4DV1 E;  2Z5C A;  4KHP I;  2HKJ A;  4IZJ D;  2PNM A;  4KQV A;  2BV3 A;  4JI6 E;  4B3S I;  3H4L A;  2UXD E;  4JI1 I;  3ZZ0 A;  4HY1 A;  3B8H A;  3B78 A;  4DV3 I;  4X62 I;  3OTO E;  4I3H A;  4LF6 E;  1I94 E;  2R42 A;  2J7K A;  4NXM E;  4DR6 E;  4UT4 A;  4DR5 I;  4LFA E;  4YHH E;  4DV2 I;  4DV1 I;  2V2V A;  4HAC B;  4Z7Y A;  4LF9 E;  1B63 A;  3T1Y E;  4RPF A;  2CGE A;  1N34 E;  4P52 A;  3K85 A;  2DEI A;  3LNU A;  1KVK A;  4DPU A;  4JI6 I;  4DV6 E;  2Z5B A;  4DR2 E;  1WUU A;  2UXD I;  2UUB E;  2LJP A;  3J7A M;  4R1F A;  4JI5 I;  2ZBK B;  3D4J A;  1ZM4 A;  2WW4 A;  1I94 I;  1H7S A;  1K47 A;  4NXM I;  4LFA I;  4YHH I;  3WU3 A;  5IT9 C;  4LF9 I;  3T1Y I;  1N34 I;  1USV A;  2HFU A;  3Q6N A;  4DV6 I;  4HYM A;  2A2D A;  5IWA E;  4DR2 I;  2A2C A;  3LTO A;  2UUB I;  1UEK A;  3PRY A;  4JI3 E;  2UXC E;  4YY3 E;  4USM A;  2XEX A;  4Z7C A;  4DR3 E;  1FI4 A;  1MU5 A;  2PNL A;  4FWD A;  1FNM A;  1A6F A;  4USK A;  2OI2 A;  5A2Q C;  2UUC E;  3B82 A;  1PIE A;  4WUB A;  3ZKD A;  2AJ4 A;  1USU A;  4DR7 E;  5IWA I;  4URL A;  2O1W A;  4B3T E;  4OX9 E;  4JI3 I;  2UXC I;  4X62 E;  5LMU E;  3ZZU A;  4DR3 I;  4JV5 E;  1Z0B A;  1IBL E;  4DXL A;  2F4V E;  5FLX C;  1ZXM A;  4IZJ B;  1KTV A;  3LPS A;  4X64 E;  2UUC I;  1HNX E;  1IBM E;  1Z0C A;  1KKH A;  1HR0 E;  4DR7 I;  2O1U A;  1XNQ E;  3ZZT A;  1Y4S A;  1U2R A;  2R3V A;  1PKP A;  3Q6M A;  2CZ9 A;  4FW9 A;  4B3T I;  4OX9 I;  1N32 E;  4JI5 E;  3JAM C;  4UTG A;  4LFB E;  2E1R A;  3QT5 A;  2UUA E;  5LMU I;  2Z5B B;  2V2Q A;  4JV5 I;  3WU5 A;  4GKJ E;  1BKN A;  1XMQ I;  1IBL I;  2IOP A;  5L3J A;  2F4V I;  1S4E A;  1Z5A A;  4X64 I;  1KIJ A;  2V34 A;  1HNX I;  4DR1 E;  1ZXN A;  1FJG E;  1IBM I;  1ZM2 A;  3PYF A;  1HR0 I;  1N33 E;  3PYD A;  4IZK A;  4DUZ E;  1XMO E;  1Z0E A;  1XNQ I;  4PRV A;  1N32 I;  4DV5 E;  4LFB I;  3J81 Q;  1B62 A;  1FWK A;  2BM1 A;  4X66 E;  2UUA I;  1RR9 A;  2VF3 A;  4GKJ I;  3K17 A;  2O1T A;  2E5L I;  4HXZ A;  2Z5E A;  4MYT A;  3J80 Q;  2HK2 A;  3V5R A;  4DR1 I;  4JYA E;  1FJG I;  2HHH E;  1H72 C;  1N33 I;  1H73 A;  1Z5C A;  3J81 C;  4HAC A;  4JI2 E;  4DUZ I;  3K1J A;  1XMO I;  1J5E E;  2IOQ A;  1MX0 A;  4DV5 I;  2CG9 A;  2X36 A;  4X66 I;  4DU8 A;  3V2U C;  4B3M E;  5LMN E;  4DPW A;  2X7I A;  3ZKB A;  3PYE A;  1QZR A;  4WUD A;  4DU7 A;  2ZIT A;  1NZ0 A;  4DV0 E;  4JYA I;  1ZM9 A;  2HHH I;  4DPX A;  4PU9 A;  1OJ4 A;  4JI2 I;  2DEJ A;  4DPY A;  4JI4 E;  2Z5C B;  1J5E I;  4DV7 E;  4JI0 E;  4LFC E;  2HFS A;  4AQY E;  1XMQ E;  4B3M I;  4EMD A;  5LMN I;  4LF4 E;  2V2Z A;  4LF5 I;  4DV0 I;  4DPT A;  4FN5 A;  3ZM7 A;  4WUC A;  1PVG A;  1Z59 A;  1XHK A;  4DV4 E;  4MYU A;  1EI1 A;  4JI4 I;  4DV7 I;  4JI0 I;  3WU4 A;  4LFC I;  4IZK B;  4LF8 E;  1Z0V A;  1Z0T A;  3GON A;  4AQY I;  5FWK A;  2E5L E;  4LF4 I;  5LL6 R;  3P06 A;  3T1H E;  1RRE A;  3PYG A;  1D6T A;  4DV4 I;  4IZJ A;  1Z0W A;  2GQ0 A;  4JI8 E;  3J7A G;  4K0K E;  2V8P A;  3QT8 A;  3QT7 A;  1MG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...