4LFAI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfaI00
4LF9E 3WU3A 2R42A 4DUZE 4DR7I 2A2DA 4DV0I 2UUBE 1XMOE 1XNRE 1NHIA 4DV5I 4JI4I 1HNXI 1K47A 2BM1A 2UXCE 2BM0A 4DV6E 4X65E 4DV7E 3ZM7A 4KHPE 1N36E 4LFBE 1I94I 4LF7E 1J5EI 3PYEA 3J80C 2UXDE 4DR2E 2UUCI 3B78A 3QT6A 4DR4I 2CZ9A 4YHHE 4Z7CA 2HHHI 2V34A 2VQEI 3V2UC 3GONA 4JI1I 4HACB 4B3ME 1N34I 5IWAI 3ZZUA 1XMQI 4DUYE 4ZVIA 3QT7A 4DR1I 1FNMA 3WU5A 4DR5E 5LMUI 4GKJI 1HR0E 4P52A 4JYAE 4X66I 1WUUA 1IBME 4JI8I 1KIJA 1DARA 4DV1I 4DPUA 2VQFE 2UUAE 2DEIA 1FKAE 4DR6I 3PYDA 4LF8I 1FJGI 4FN5A 1B63A 5LMNE 4EMDA 1FI4A 1Z5CA 5FLXQ 3J81Q 3WU4A 1HNWI 2ZBKB 3LPSA 1N33E 2UU9E 1ELOA 4DV3E 3ZKDA 4B3SE 4JI5I 3JAMC 1S16A 1ZXMA 4M1KA 1N32I 1MX0A 3WU6A 4YY3I 3T1YI 2V2VA 4K0KI 4XTJA 5IT9Q 1NZ0A 4DPWA 1H7SA 4AQYE 2J7KA 1ZM9A 4FW9A 1QZRA 1Z0WA 1KKHA 4FWDA 5A2QC 2WW4A 4DPYA 4LF4I 3H4LA 4X64I 2UUBI 1ZM3A 1H7UA 4DV2I 2HKJA 3LNUA 3Q1QA 4DV6I 1H74A 1XNQE 3OTOI 3B8HA 2HFUA 4B3TI 1XHKA 3B82A 1OJ4A 2F4VI 4LFCE 4WUBA 4P7AA 4NXNI 4JI7I 4DR7E 1PIEA 5BR8I 2V8PA 3T1HI 2VF3A 4DV5E 4B3MI 2ZM6I 1HNXE 1Z0VA 1BKNA 1IBKI 2HK2A 1I94E 4JI2I 1J5EE 4B3RE 4DXLA 4WUDA 2EFGA 4Z7YA 4UTGA 4DV4I 2UUCE 4DR4E 1HR0I 4PRXA 2GS8A 2VQEE 3V5RA 1B62A 1Z0EA 1H73A 1HNZI 4JI1E 1FWKA 2NPFA 4X62I 1N0UA 1PVGA 1N34E 4NXME 1XMQE 1FWLA 1A6FA 3QT8A 2V2ZA 3D4JA 5LMUE 4JV5I 2UXBI 1Z59A 1ZXNA 4FWHA 4GKJE 4LF5I 4DV3I 2AJ4A 4B3SI 4X66E 1IBLI 4JI0I 4JI8E 1EI1A 4WUCA 1MU5A 4DR6E 3F0NA 1ZM2A 1NHHA 2A2CA 4LFAI 2V2QA 4HACA 5GMEA 4AQYI 2E5LI 4JI3E 4RPFA 2BV3A 5IT9C 1EA6A 1Z0GA 2HK3A 4LF9I 4R1FA 2LJPA 4DUZI 4DR3E 5L3JA 4LF6E 4FWGA 1HNWE 3JAMQ 2Q2EB 1XMOI 1XNRI 4USMA 4JI5E 4DU8A 2UXCI 4HXZA 2OI2A 1RR9A 4JI6E 4X65I 4DV7I 4GKKE 1Z0CA 4KHPI 1N32E 2XEXA 4HYMA 3QT5A 1N36I 4LFBI 4YY3E 3T1YE 4LF7I 4K0KE 2HKEA 2HFSA 2UXDI 4DR2I 5A2QQ 1PKPA 4PRVA 4YHHI 4OX9E 2X36A 3ZZTA 1Z0BA 4LF4E 3M6AA 4X64E 4DV2E 1H72C 4DV0E 3OTOE 3CWVA 4JI4E 4MYUA 4B3TE 4B3RI 1VISA 3J80Q 4DUYI 2ZITA 2F4VE 4DPTA 4DR5I 3K17A 3PYFA 4DPXA 4NXNE 1RREA 5GMDA 1S4EA 4I3HA 4JI7E 1N0VC 2DEJA 4URLA 2HHHE 1MG7A 3J7AM 4JYAI 4JG4A 5BR8E 3T1HE 1IBMI 2ZM6E 2VQFI 2UUAI 4NXMI 2R3VA 1IBKE 1Z5BA 3J7AG 4JI2E 4USKA 5IWAE 5LMNI 4DV4E 1D6TA 3PYGA 4DR1E 3K1JA 2X7IA 1UEKA 1N33I 5FLXC 5LL6R 4HY1A 3J81C 2UU9I 1KVKA 1HNZE 4ED4A 4KQVA 4DV1E 4X62E 4JI3I 4LF8E 4DU7A 1Z0TA 1FJGE 4DR3I 4PU9A 1Z5AA 4LF6I 4JV5E 2UXBE 3ZKBA 2E1RA 4LF5E 1IBLE 4JI0E 4JI6I 1NHJA 4UT4A 3LTOA 1XNQI 4GKKI 3HULA 4MYTA 3ZZ0A 1KTVA 1ZM4A 4LFAE 1U2RA 2E5LE 4OX9I 4LFCI
chains in the Genus database with same CATH superfamily
4LF9E 3WU3A 2R42A 4DUZE 4DR7I 2NN6A 2A2DA 5FWKA 4DV0I 2UUBE 1XMOE 1XNRE 1NHIA 4DV5I 4JI4I 1HNXI 1K47A 2BM1A 2UXCE 2BM0A 4DV6E 4FW3A 4X65E 4DV7E 3CDIA 3ZM7A 4KHPE 1N36E 4LFBE 4OO1B 1I94I 4LF7E 3UHMA 1J5EI 3PYEA 3J80C 2UXDE 4DR2E 2UUCI 1R6MA 3B78A 3QT6A 4DR4I 2CZ9A 4YHHE 4Z7CA 1OYSA 2HHHI 2PO1A 4OZEA 4U3BA 4FW6A 2V34A 1UDNA 2VQEI 5DNLA 4LOMA 1UDQA 3V2UC 4MU0A 4BA2A 2C38A 3GONA 4JI1I 2GO3A 5K36D 4HACB 2Z5BA 1UDOA 2Z5CB 3M85G 4B3ME 4FW4A 4IFDD 1N34I 4AM3A 2BA0D 5JEAA 5IWAI 3GCMA 2PNZB 3ZZUA 1XMQI 2CG9A 4DUYE 4ZVIA 3QT7A 4DR1I 1FNMA 3WU5A 4DR5E 2IESA 4LCFA 5LMUI 1USUA 2PO2B 1OYRA 4GKJI 1Y60A 4IZJD 1HR0E 4ISAA 4P52A 3GLLA 2VESA 4JYAE 4X66I 1E3PA 1WUUA 1IBME 4JI8I 1KIJA 1DARA 4DV1I 3U1KA 4QNJA 4DPUA 2VQFE 2UUAE 2DEIA 4GQUA 1FKAE 4IFDA 4DR6I 4IZKA 3PYDA 4LF8I 4AIDA 4NBQA 3Q6NA 2O1TA 5DRQA 1FJGI 2C39A 4FN5A 1B63A 5LMNE 2WNRA 4EMDA 2BR2A 1FI4A 1Z5CA 5FLXQ 3J81Q 3WU4A 2PO0A 1HNWI 2ZBKB 2JEAA 3LPSA 1N33E 2JEBA 2UU9E 1ELOA 4DV3E 3ZKDA 2PNLA 3L7ZB 4B3SE 4OKGA 4JI5I 4LCHA 3JAMC 4MDTA 5C0XE 1S16A 1ZXMA 3PS2A 4M1KA 2GQ0A 3KRNA 1N32I 1MX0A 3WU6A 5C0XF 4YY3I 3T1YI 2V2VA 4K0KI 4XTJA 5IT9Q 1NZ0A 3GMEA 1H7SA 3P3GA 4DPWA 4AQYE 2J7KA 1ZM9A 4FW9A 2C38B 4QNKA 2O3ZA 4FW7A 1QZRA 1YH8A 2Z5BB 5C0XC 2BA1G 1Z0WA 1KKHA 4FWDA 5A2QC 2WW4A 4DPYA 4LF4I 2C37B 3H4LA 5JEAC 1ZM3A 4X64I 2UUBI 1H7UA 4DV2I 1UDSA 2HKJA 3LNUA 5JEAB 3Q1QA 4OO1E 2J65A 2Z5EA 4DV6I 1H74A 1XNQE 3OTOI 3B8HA 2HFUA 2CVEA 4LPFA 3M85D 4B3TI 1R6LA 1XHKA 3Q6MA 4OO1C 3B82A 3P06A 1OJ4A 2F4VI 4LFCE 4BA1A 4WUBA 2O1VA 4P7AA 4NXNI 4JI7I 4IZKB 4DR7E 1PIEA 5BR8I 2V8PA 3T1HI 2VF3A 3M7NG 5C0XD 2C39B 4DV5E 4B3MI 2ZM6I 1HNXE 1Z0VA 1OYPA 1BKNA 1IBKI 2PO0B 2HK2A 2JEAB 1I94E 4JI2I 1J5EE 2JEBB 4B3RE 4DXLA 1USVA 2EFGA 4WUDA 4Z7YA 4UTGA 4DV4I 2UUCE 4J3DA 4DR4E 1HR0I 4PRXA 2GS8A 4OO1D 2IOPA 2VQEE 3V5RA 2NN6E 1B62A 1Z0EA 1H73A 1HNZI 4JI1E 1FWKA 4MU3A 5K36A 1P42A 2NPFA 4X62I 1N0UA 1PVGA 1N34E 5EL9A 2O1UA 4NXME 2NN6C 2NN6B 1XMQE 1FWLA 1A6FA 3QT8A 2V2ZA 3D4JA 5LMUE 4JV5I 2UXBI 1Z59A 1ZXNA 4FWHA 4GKJE 4IZJA 2BA1D 4LF5I 4DV3I 2AJ4A 4B3SI 4X66E 1IBLI 4JI0I 4JI8E 1EI1A 1VI7A 1E3HA 4WUCA 1MU5A 4BA1B 4DR6E 3F0NA 5ELWA 1ZM2A 1NHHA 2A2CA 4LFAI 2V2QA 2PO1B 4HACA 5GMEA 4AQYI 1Y4UA 2E5LI 4JI3E 4RPFA 5JEAE 2BV3A 2JT2A 5IT9C 1EA6A 1Z0GA 2HK3A 5JEAF 4R1FA 4LF9I 4BA2B 2LJPA 4DUZI 4DR3E 2PNZA 5L3JA 4LF6E 4FWGA 1HK7A 1HNWE 3JAMQ 2WP8A 2Q2EB 1XMOI 2PO2A 1XNRI 4USMA 4JI5E 4DU8A 3M7ND 2UXCI 4HXZA 2OI2A 1RR9A 4JI6E 4OO1F 4X65I 4DV7I 4GKKE 1Z0CA 3U1YA 2CGEA 4KHPI 1N32E 2XEXA 4HYMA 3QT5A 1N36I 4LFBI 4YY3E 3T1YE 4LF7I 4K0KE 3HJCA 2HKEA 3P3EA 2HFSA 2UXDI 3NZKA 4DR2I 4IS9A 5A2QQ 1Y4SA 5K36C 1PKPA 4PRVA 3PS3A 5DRPA 5K36B 2F1DA 2JE6A 4YHHI 4OX9E 2X36A 3ZZTA 1Z0BA 2GO4A 4U3DA 4LF4E 4IFDC 3M6AA 4IFDB 4X64E 4DV2E 1RHYA 2O1WA 1H72C 2AE8A 4DV0E 3OTOE 3CWVA 3P76A 4JI4E 4MYUA 2WNRB 4B3TE 5JEAD 5DRRA 2BR2B 4IZJB 4MU1A 2PNMA 4B3RI 3L7ZA 1VISA 3J80Q 4DUYI 2ZITA 2F4VE 4DPTA 4DR5I 3K17A 3HKMA 3PYFA 4DPXA 1Y5YA 4NXNE 1RREA 5GMDA 1S4EA 4I3HA 4JI7E 1N0VC 2DEJA 3DD6A 4URLA 2HHHE 1MG7A 3J7AM 4JYAI 5DNXA 4JG4A 5BR8E 3T1HE 1IBMI 5C0XA 3B4TA 5EKWA 4MU4A 4AIMA 2ZM6E 2VQFI 2UUAI 2NN6F 2C37A 4NXMI 2R3VA 1IBKE 1Z5BA 3J7AG 4JI2E 4USKA 2WP8B 5IWAE 5LMNI 4DV4E 1D6TA 3CDJA 3PYGA 4DR1E 2IOQA 4N3OA 3K1JA 4OO1A 2X7IA 1UEKA 1N33I 5FLXC 5LL6R 4HY1A 3J81C 2UU9I 1KVKA 1HNZE 3H1CA 4ED4A 4KQVA 4DV1E 2JE6B 2BA0G 4X62E 4JI3I 4LF8E 1Y6ZA 4DU7A 1Z0TA 3PS1A 5DROA 1FJGE 2Z5CA 4DR3I 4PU9A 1Z5AA 4LF6I 4JV5E 3PRYA 2UXBE 1YHCA 3ZKBA 4FW5A 2E1RA 4LF5E 2NN6D 1IBLE 4JI0E 4JI6I 1NHJA 4UT4A 3LTOA 1XNQI 4GKKI 3HULA 5K36E 4LCGA 4MYTA 3ZZ0A 1KTVA 1ZM4A 5K36F 3K85A 4MQYA 4LFAE 1U2RA 4IFDE 2IERA 2E5LE 1XXEA 4OX9I 3P3CA 4LFCI 4IFDF 5C0XB
chains in the Genus database with same CATH topology
4LF9E 3WU3A 2R42A 4DUZE 4DR7I 2A2DA 5FWKA 4DV0I 2UUBE 1XMOE 1XNRE 1NHIA 4DV5I 4JI4I 1HNXI 1K47A 2BM1A 2UXCE 2BM0A 4DV6E 4X65E 4DV7E 3ZM7A 4KHPE 1N36E 4LFBE 1I94I 4LF7E 1J5EI 3PYEA 3J80C 2UXDE 4DR2E 2UUCI 3B78A 3QT6A 4DR4I 2CZ9A 4YHHE 4Z7CA 2HHHI 2V34A 2VQEI 3V2UC 3GONA 4JI1I 4HACB 2Z5BA 2Z5CB 4B3ME 1N34I 5IWAI 3ZZUA 1XMQI 2CG9A 4DUYE 4ZVIA 3QT7A 4DR1I 1FNMA 3WU5A 4DR5E 5LMUI 1USUA 4GKJI 4IZJD 1HR0E 4P52A 4JYAE 4X66I 1WUUA 1IBME 4JI8I 1KIJA 1DARA 4DV1I 4DPUA 2VQFE 2UUAE 2DEIA 1FKAE 4DR6I 4IZKA 3PYDA 4LF8I 3Q6NA 2O1TA 1FJGI 4FN5A 1B63A 5LMNE 4EMDA 1FI4A 1Z5CA 5FLXQ 3J81Q 3WU4A 1HNWI 2ZBKB 3LPSA 1N33E 2UU9E 1ELOA 4DV3E 3ZKDA 2PNLA 4B3SE 4JI5I 3JAMC 1S16A 1ZXMA 4M1KA 2GQ0A 1N32I 1MX0A 3WU6A 4YY3I 3T1YI 2V2VA 4K0KI 4XTJA 5IT9Q 1NZ0A 4DPWA 1H7SA 4AQYE 2J7KA 1ZM9A 4FW9A 1QZRA 2Z5BB 1Z0WA 1KKHA 4FWDA 5A2QC 2WW4A 4DPYA 4LF4I 3H4LA 4X64I 2UUBI 1ZM3A 1H7UA 4DV2I 2HKJA 3LNUA 3Q1QA 2Z5EA 4DV6I 1H74A 1XNQE 3OTOI 3B8HA 2HFUA 4B3TI 1XHKA 3Q6MA 3B82A 3P06A 1OJ4A 2F4VI 4LFCE 4WUBA 2O1VA 4P7AA 4NXNI 4JI7I 4IZKB 4DR7E 1PIEA 5BR8I 2V8PA 3T1HI 2VF3A 4DV5E 4B3MI 2ZM6I 1HNXE 1Z0VA 1BKNA 1IBKI 2HK2A 1I94E 4JI2I 1J5EE 4B3RE 4DXLA 1USVA 2EFGA 4WUDA 4Z7YA 4UTGA 4DV4I 2UUCE 4DR4E 1HR0I 4PRXA 2GS8A 2IOPA 2VQEE 3V5RA 1B62A 1Z0EA 1H73A 1HNZI 4JI1E 1FWKA 2NPFA 4X62I 1N0UA 1PVGA 1N34E 2O1UA 4NXME 1XMQE 1FWLA 1A6FA 3QT8A 2V2ZA 3D4JA 5LMUE 4JV5I 2UXBI 1Z59A 1ZXNA 4FWHA 4GKJE 4IZJA 4LF5I 4DV3I 2AJ4A 4B3SI 4X66E 1IBLI 4JI0I 4JI8E 1EI1A 4WUCA 1MU5A 4DR6E 3F0NA 1ZM2A 1NHHA 2A2CA 4LFAI 2V2QA 4HACA 5GMEA 4AQYI 1Y4UA 2E5LI 4JI3E 4RPFA 2BV3A 5IT9C 1EA6A 1Z0GA 2HK3A 4LF9I 4R1FA 2LJPA 4DUZI 4DR3E 5L3JA 4LF6E 4FWGA 1HK7A 1HNWE 3JAMQ 2Q2EB 1XMOI 1XNRI 4USMA 4JI5E 4DU8A 2UXCI 4HXZA 2OI2A 1RR9A 4JI6E 4X65I 4DV7I 4GKKE 1Z0CA 2CGEA 4KHPI 1N32E 1N36I 2XEXA 4HYMA 3QT5A 4LFBI 4YY3E 3T1YE 4LF7I 4K0KE 3HJCA 2HKEA 2HFSA 2UXDI 4DR2I 5A2QQ 1Y4SA 1PKPA 4PRVA 4YHHI 4OX9E 2X36A 3ZZTA 1Z0BA 4LF4E 3M6AA 4X64E 4DV2E 2O1WA 1H72C 4DV0E 3OTOE 3CWVA 4JI4E 4MYUA 4B3TE 4IZJB 4B3RI 2PNMA 1VISA 3J80Q 4DUYI 2ZITA 2F4VE 4DPTA 4DR5I 3K17A 3PYFA 4DPXA 4NXNE 1RREA 5GMDA 1S4EA 4I3HA 4JI7E 1N0VC 2DEJA 4URLA 2HHHE 1MG7A 3J7AM 4JYAI 4JG4A 5BR8E 3T1HE 1IBMI 2ZM6E 2VQFI 2UUAI 4NXMI 2R3VA 1IBKE 1Z5BA 3J7AG 4JI2E 4USKA 5IWAE 5LMNI 4DV4E 1D6TA 3PYGA 4DR1E 2IOQA 4N3OA 3K1JA 2X7IA 1UEKA 1N33I 5FLXC 5LL6R 4HY1A 3J81C 2UU9I 1KVKA 1HNZE 4ED4A 4KQVA 4DV1E 4X62E 4JI3I 4LF8E 1Y6ZA 4DU7A 1Z0TA 1FJGE 2Z5CA 4DR3I 4PU9A 1Z5AA 4LF6I 4JV5E 3PRYA 2UXBE 3ZKBA 2E1RA 4LF5E 1IBLE 4JI0E 4JI6I 1NHJA 4UT4A 3LTOA 1XNQI 4GKKI 3HULA 4MYTA 3ZZ0A 1KTVA 1ZM4A 3K85A 4LFAE 1U2RA 2E5LE 4OX9I 4LFCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 E;  3WU3 A;  2R42 A;  4DUZ E;  4DR7 I;  2A2D A;  4DV0 I;  2UUB E;  1XMO E;  1XNR E;  1NHI A;  4DV5 I;  4JI4 I;  1HNX I;  1K47 A;  2BM1 A;  2UXC E;  2BM0 A;  4DV6 E;  4X65 E;  4DV7 E;  3ZM7 A;  4KHP E;  1N36 E;  4LFB E;  1I94 I;  4LF7 E;  1J5E I;  3PYE A;  3J80 C;  2UXD E;  4DR2 E;  2UUC I;  3B78 A;  3QT6 A;  4DR4 I;  2CZ9 A;  4YHH E;  4Z7C A;  2HHH I;  2V34 A;  2VQE I;  3V2U C;  3GON A;  4JI1 I;  4HAC B;  4B3M E;  1N34 I;  5IWA I;  3ZZU A;  1XMQ I;  4DUY E;  4ZVI A;  3QT7 A;  4DR1 I;  1FNM A;  3WU5 A;  4DR5 E;  5LMU I;  4GKJ I;  1HR0 E;  4P52 A;  4JYA E;  4X66 I;  1WUU A;  1IBM E;  4JI8 I;  1KIJ A;  1DAR A;  4DV1 I;  4DPU A;  2VQF E;  2UUA E;  2DEI A;  1FKA E;  4DR6 I;  3PYD A;  4LF8 I;  1FJG I;  4FN5 A;  1B63 A;  5LMN E;  4EMD A;  1FI4 A;  1Z5C A;  5FLX Q;  3J81 Q;  3WU4 A;  1HNW I;  2ZBK B;  3LPS A;  1N33 E;  2UU9 E;  1ELO A;  4DV3 E;  3ZKD A;  4B3S E;  4JI5 I;  3JAM C;  1S16 A;  1ZXM A;  4M1K A;  1N32 I;  1MX0 A;  3WU6 A;  4YY3 I;  3T1Y I;  2V2V A;  4K0K I;  4XTJ A;  5IT9 Q;  1NZ0 A;  4DPW A;  1H7S A;  4AQY E;  2J7K A;  1ZM9 A;  4FW9 A;  1QZR A;  1Z0W A;  1KKH A;  4FWD A;  5A2Q C;  2WW4 A;  4DPY A;  4LF4 I;  3H4L A;  4X64 I;  2UUB I;  1ZM3 A;  1H7U A;  4DV2 I;  2HKJ A;  3LNU A;  3Q1Q A;  4DV6 I;  1H74 A;  1XNQ E;  3OTO I;  3B8H A;  2HFU A;  4B3T I;  1XHK A;  3B82 A;  1OJ4 A;  2F4V I;  4LFC E;  4WUB A;  4P7A A;  4NXN I;  4JI7 I;  4DR7 E;  1PIE A;  5BR8 I;  2V8P A;  3T1H I;  2VF3 A;  4DV5 E;  4B3M I;  2ZM6 I;  1HNX E;  1Z0V A;  1BKN A;  1IBK I;  2HK2 A;  1I94 E;  4JI2 I;  1J5E E;  4B3R E;  4DXL A;  4WUD A;  2EFG A;  4Z7Y A;  4UTG A;  4DV4 I;  2UUC E;  4DR4 E;  1HR0 I;  4PRX A;  2GS8 A;  2VQE E;  3V5R A;  1B62 A;  1Z0E A;  1H73 A;  1HNZ I;  4JI1 E;  1FWK A;  2NPF A;  4X62 I;  1N0U A;  1PVG A;  1N34 E;  4NXM E;  1XMQ E;  1FWL A;  1A6F A;  3QT8 A;  2V2Z A;  3D4J A;  5LMU E;  4JV5 I;  2UXB I;  1Z59 A;  1ZXN A;  4FWH A;  4GKJ E;  4LF5 I;  4DV3 I;  2AJ4 A;  4B3S I;  4X66 E;  1IBL I;  4JI0 I;  4JI8 E;  1EI1 A;  4WUC A;  1MU5 A;  4DR6 E;  3F0N A;  1ZM2 A;  1NHH A;  2A2C A;  4LFA I;  2V2Q A;  4HAC A;  5GME A;  4AQY I;  2E5L I;  4JI3 E;  4RPF A;  2BV3 A;  5IT9 C;  1EA6 A;  1Z0G A;  2HK3 A;  4LF9 I;  4R1F A;  2LJP A;  4DUZ I;  4DR3 E;  5L3J A;  4LF6 E;  4FWG A;  1HNW E;  3JAM Q;  2Q2E B;  1XMO I;  1XNR I;  4USM A;  4JI5 E;  4DU8 A;  2UXC I;  4HXZ A;  2OI2 A;  1RR9 A;  4JI6 E;  4X65 I;  4DV7 I;  4GKK E;  1Z0C A;  4KHP I;  1N32 E;  2XEX A;  4HYM A;  3QT5 A;  1N36 I;  4LFB I;  4YY3 E;  3T1Y E;  4LF7 I;  4K0K E;  2HKE A;  2HFS A;  2UXD I;  4DR2 I;  5A2Q Q;  1PKP A;  4PRV A;  4YHH I;  4OX9 E;  2X36 A;  3ZZT A;  1Z0B A;  4LF4 E;  3M6A A;  4X64 E;  4DV2 E;  1H72 C;  4DV0 E;  3OTO E;  3CWV A;  4JI4 E;  4MYU A;  4B3T E;  4B3R I;  1VIS A;  3J80 Q;  4DUY I;  2ZIT A;  2F4V E;  4DPT A;  4DR5 I;  3K17 A;  3PYF A;  4DPX A;  4NXN E;  1RRE A;  5GMD A;  1S4E A;  4I3H A;  4JI7 E;  1N0V C;  2DEJ A;  4URL A;  2HHH E;  1MG7 A;  3J7A M;  4JYA I;  4JG4 A;  5BR8 E;  3T1H E;  1IBM I;  2ZM6 E;  2VQF I;  2UUA I;  4NXM I;  2R3V A;  1IBK E;  1Z5B A;  3J7A G;  4JI2 E;  4USK A;  5IWA E;  5LMN I;  4DV4 E;  1D6T A;  3PYG A;  4DR1 E;  3K1J A;  2X7I A;  1UEK A;  1N33 I;  5FLX C;  5LL6 R;  4HY1 A;  3J81 C;  2UU9 I;  1KVK A;  1HNZ E;  4ED4 A;  4KQV A;  4DV1 E;  4X62 E;  4JI3 I;  4LF8 E;  4DU7 A;  1Z0T A;  1FJG E;  4DR3 I;  4PU9 A;  1Z5A A;  4LF6 I;  4JV5 E;  2UXB E;  3ZKB A;  2E1R A;  4LF5 E;  1IBL E;  4JI0 E;  4JI6 I;  1NHJ A;  4UT4 A;  3LTO A;  1XNQ I;  4GKK I;  3HUL A;  4MYT A;  3ZZ0 A;  1KTV A;  1ZM4 A;  4LFA E;  1U2R A;  2E5L E;  4OX9 I;  4LFC I; 
#chains in the Genus database with same CATH topology
 4LF9 E;  3WU3 A;  2R42 A;  4DUZ E;  4DR7 I;  2NN6 A;  2A2D A;  5FWK A;  4DV0 I;  2UUB E;  1XMO E;  1XNR E;  1NHI A;  4DV5 I;  4JI4 I;  1HNX I;  1K47 A;  2BM1 A;  2UXC E;  2BM0 A;  4DV6 E;  4FW3 A;  4X65 E;  4DV7 E;  3CDI A;  3ZM7 A;  4KHP E;  1N36 E;  4LFB E;  4OO1 B;  1I94 I;  4LF7 E;  3UHM A;  1J5E I;  3PYE A;  3J80 C;  2UXD E;  4DR2 E;  2UUC I;  1R6M A;  3B78 A;  3QT6 A;  4DR4 I;  2CZ9 A;  4YHH E;  4Z7C A;  1OYS A;  2HHH I;  2PO1 A;  4OZE A;  4U3B A;  4FW6 A;  2V34 A;  1UDN A;  2VQE I;  5DNL A;  4LOM A;  1UDQ A;  3V2U C;  4MU0 A;  4BA2 A;  2C38 A;  3GON A;  4JI1 I;  2GO3 A;  5K36 D;  4HAC B;  2Z5B A;  1UDO A;  2Z5C B;  3M85 G;  4B3M E;  4FW4 A;  4IFD D;  1N34 I;  4AM3 A;  2BA0 D;  5JEA A;  5IWA I;  3GCM A;  2PNZ B;  3ZZU A;  1XMQ I;  2CG9 A;  4DUY E;  4ZVI A;  3QT7 A;  4DR1 I;  1FNM A;  3WU5 A;  4DR5 E;  2IES A;  4LCF A;  5LMU I;  1USU A;  2PO2 B;  1OYR A;  4GKJ I;  1Y60 A;  4IZJ D;  1HR0 E;  4ISA A;  4P52 A;  3GLL A;  2VES A;  4JYA E;  4X66 I;  1E3P A;  1WUU A;  1IBM E;  4JI8 I;  1KIJ A;  1DAR A;  4DV1 I;  3U1K A;  4QNJ A;  4DPU A;  2VQF E;  2UUA E;  2DEI A;  4GQU A;  1FKA E;  4IFD A;  4DR6 I;  4IZK A;  3PYD A;  4LF8 I;  4AID A;  4NBQ A;  3Q6N A;  2O1T A;  5DRQ A;  1FJG I;  2C39 A;  4FN5 A;  1B63 A;  5LMN E;  2WNR A;  4EMD A;  2BR2 A;  1FI4 A;  1Z5C A;  5FLX Q;  3J81 Q;  3WU4 A;  2PO0 A;  1HNW I;  2ZBK B;  2JEA A;  3LPS A;  1N33 E;  2JEB A;  2UU9 E;  1ELO A;  4DV3 E;  3ZKD A;  2PNL A;  3L7Z B;  4B3S E;  4OKG A;  4JI5 I;  4LCH A;  3JAM C;  4MDT A;  5C0X E;  1S16 A;  1ZXM A;  3PS2 A;  4M1K A;  2GQ0 A;  3KRN A;  1N32 I;  1MX0 A;  3WU6 A;  5C0X F;  4YY3 I;  3T1Y I;  2V2V A;  4K0K I;  4XTJ A;  5IT9 Q;  1NZ0 A;  3GME A;  1H7S A;  3P3G A;  4DPW A;  4AQY E;  2J7K A;  1ZM9 A;  4FW9 A;  2C38 B;  4QNK A;  2O3Z A;  4FW7 A;  1QZR A;  1YH8 A;  2Z5B B;  5C0X C;  2BA1 G;  1Z0W A;  1KKH A;  4FWD A;  5A2Q C;  2WW4 A;  4DPY A;  4LF4 I;  2C37 B;  3H4L A;  5JEA C;  1ZM3 A;  4X64 I;  2UUB I;  1H7U A;  4DV2 I;  1UDS A;  2HKJ A;  3LNU A;  5JEA B;  3Q1Q A;  4OO1 E;  2J65 A;  2Z5E A;  4DV6 I;  1H74 A;  1XNQ E;  3OTO I;  3B8H A;  2HFU A;  2CVE A;  4LPF A;  3M85 D;  4B3T I;  1R6L A;  1XHK A;  3Q6M A;  4OO1 C;  3B82 A;  3P06 A;  1OJ4 A;  2F4V I;  4LFC E;  4BA1 A;  4WUB A;  2O1V A;  4P7A A;  4NXN I;  4JI7 I;  4IZK B;  4DR7 E;  1PIE A;  5BR8 I;  2V8P A;  3T1H I;  2VF3 A;  3M7N G;  5C0X D;  2C39 B;  4DV5 E;  4B3M I;  2ZM6 I;  1HNX E;  1Z0V A;  1OYP A;  1BKN A;  1IBK I;  2PO0 B;  2HK2 A;  2JEA B;  1I94 E;  4JI2 I;  1J5E E;  2JEB B;  4B3R E;  4DXL A;  1USV A;  2EFG A;  4WUD A;  4Z7Y A;  4UTG A;  4DV4 I;  2UUC E;  4J3D A;  4DR4 E;  1HR0 I;  4PRX A;  2GS8 A;  4OO1 D;  2IOP A;  2VQE E;  3V5R A;  2NN6 E;  1B62 A;  1Z0E A;  1H73 A;  1HNZ I;  4JI1 E;  1FWK A;  4MU3 A;  5K36 A;  1P42 A;  2NPF A;  4X62 I;  1N0U A;  1PVG A;  1N34 E;  5EL9 A;  2O1U A;  4NXM E;  2NN6 C;  2NN6 B;  1XMQ E;  1FWL A;  1A6F A;  3QT8 A;  2V2Z A;  3D4J A;  5LMU E;  4JV5 I;  2UXB I;  1Z59 A;  1ZXN A;  4FWH A;  4GKJ E;  4IZJ A;  2BA1 D;  4LF5 I;  4DV3 I;  2AJ4 A;  4B3S I;  4X66 E;  1IBL I;  4JI0 I;  4JI8 E;  1EI1 A;  1VI7 A;  1E3H A;  4WUC A;  1MU5 A;  4BA1 B;  4DR6 E;  3F0N A;  5ELW A;  1ZM2 A;  1NHH A;  2A2C A;  4LFA I;  2V2Q A;  2PO1 B;  4HAC A;  5GME A;  4AQY I;  1Y4U A;  2E5L I;  4JI3 E;  4RPF A;  5JEA E;  2BV3 A;  2JT2 A;  5IT9 C;  1EA6 A;  1Z0G A;  2HK3 A;  5JEA F;  4R1F A;  4LF9 I;  4BA2 B;  2LJP A;  4DUZ I;  4DR3 E;  2PNZ A;  5L3J A;  4LF6 E;  4FWG A;  1HK7 A;  1HNW E;  3JAM Q;  2WP8 A;  2Q2E B;  1XMO I;  2PO2 A;  1XNR I;  4USM A;  4JI5 E;  4DU8 A;  3M7N D;  2UXC I;  4HXZ A;  2OI2 A;  1RR9 A;  4JI6 E;  4OO1 F;  4X65 I;  4DV7 I;  4GKK E;  1Z0C A;  3U1Y A;  2CGE A;  4KHP I;  1N32 E;  2XEX A;  4HYM A;  3QT5 A;  1N36 I;  4LFB I;  4YY3 E;  3T1Y E;  4LF7 I;  4K0K E;  3HJC A;  2HKE A;  3P3E A;  2HFS A;  2UXD I;  3NZK A;  4DR2 I;  4IS9 A;  5A2Q Q;  1Y4S A;  5K36 C;  1PKP A;  4PRV A;  3PS3 A;  5DRP A;  5K36 B;  2F1D A;  2JE6 A;  4YHH I;  4OX9 E;  2X36 A;  3ZZT A;  1Z0B A;  2GO4 A;  4U3D A;  4LF4 E;  4IFD C;  3M6A A;  4IFD B;  4X64 E;  4DV2 E;  1RHY A;  2O1W A;  1H72 C;  2AE8 A;  4DV0 E;  3OTO E;  3CWV A;  3P76 A;  4JI4 E;  4MYU A;  2WNR B;  4B3T E;  5JEA D;  5DRR A;  2BR2 B;  4IZJ B;  4MU1 A;  2PNM A;  4B3R I;  3L7Z A;  1VIS A;  3J80 Q;  4DUY I;  2ZIT A;  2F4V E;  4DPT A;  4DR5 I;  3K17 A;  3HKM A;  3PYF A;  4DPX A;  1Y5Y A;  4NXN E;  1RRE A;  5GMD A;  1S4E A;  4I3H A;  4JI7 E;  1N0V C;  2DEJ A;  3DD6 A;  4URL A;  2HHH E;  1MG7 A;  3J7A M;  4JYA I;  5DNX A;  4JG4 A;  5BR8 E;  3T1H E;  1IBM I;  5C0X A;  3B4T A;  5EKW A;  4MU4 A;  4AIM A;  2ZM6 E;  2VQF I;  2UUA I;  2NN6 F;  2C37 A;  4NXM I;  2R3V A;  1IBK E;  1Z5B A;  3J7A G;  4JI2 E;  4USK A;  2WP8 B;  5IWA E;  5LMN I;  4DV4 E;  1D6T A;  3CDJ A;  3PYG A;  4DR1 E;  2IOQ A;  4N3O A;  3K1J A;  4OO1 A;  2X7I A;  1UEK A;  1N33 I;  5FLX C;  5LL6 R;  4HY1 A;  3J81 C;  2UU9 I;  1KVK A;  1HNZ E;  3H1C A;  4ED4 A;  4KQV A;  4DV1 E;  2JE6 B;  2BA0 G;  4X62 E;  4JI3 I;  4LF8 E;  1Y6Z A;  4DU7 A;  1Z0T A;  3PS1 A;  5DRO A;  1FJG E;  2Z5C A;  4DR3 I;  4PU9 A;  1Z5A A;  4LF6 I;  4JV5 E;  3PRY A;  2UXB E;  1YHC A;  3ZKB A;  4FW5 A;  2E1R A;  4LF5 E;  2NN6 D;  1IBL E;  4JI0 E;  4JI6 I;  1NHJ A;  4UT4 A;  3LTO A;  1XNQ I;  4GKK I;  3HUL A;  5K36 E;  4LCG A;  4MYT A;  3ZZ0 A;  1KTV A;  1ZM4 A;  5K36 F;  3K85 A;  4MQY A;  4LFA E;  1U2R A;  4IFD E;  2IER A;  2E5L E;  1XXE A;  4OX9 I;  3P3C A;  4LFC I;  4IFD F;  5C0X B; 
#chains in the Genus database with same CATH homology
 4LF9 E;  3WU3 A;  2R42 A;  4DUZ E;  4DR7 I;  2A2D A;  5FWK A;  4DV0 I;  2UUB E;  1XMO E;  1XNR E;  1NHI A;  4DV5 I;  4JI4 I;  1HNX I;  1K47 A;  2BM1 A;  2UXC E;  2BM0 A;  4DV6 E;  4X65 E;  4DV7 E;  3ZM7 A;  4KHP E;  1N36 E;  4LFB E;  1I94 I;  4LF7 E;  1J5E I;  3PYE A;  3J80 C;  2UXD E;  4DR2 E;  2UUC I;  3B78 A;  3QT6 A;  4DR4 I;  2CZ9 A;  4YHH E;  4Z7C A;  2HHH I;  2V34 A;  2VQE I;  3V2U C;  3GON A;  4JI1 I;  4HAC B;  2Z5B A;  2Z5C B;  4B3M E;  1N34 I;  5IWA I;  3ZZU A;  1XMQ I;  2CG9 A;  4DUY E;  4ZVI A;  3QT7 A;  4DR1 I;  1FNM A;  3WU5 A;  4DR5 E;  5LMU I;  1USU A;  4GKJ I;  4IZJ D;  1HR0 E;  4P52 A;  4JYA E;  4X66 I;  1WUU A;  1IBM E;  4JI8 I;  1KIJ A;  1DAR A;  4DV1 I;  4DPU A;  2VQF E;  2UUA E;  2DEI A;  1FKA E;  4DR6 I;  4IZK A;  3PYD A;  4LF8 I;  3Q6N A;  2O1T A;  1FJG I;  4FN5 A;  1B63 A;  5LMN E;  4EMD A;  1FI4 A;  1Z5C A;  5FLX Q;  3J81 Q;  3WU4 A;  1HNW I;  2ZBK B;  3LPS A;  1N33 E;  2UU9 E;  1ELO A;  4DV3 E;  3ZKD A;  2PNL A;  4B3S E;  4JI5 I;  3JAM C;  1S16 A;  1ZXM A;  4M1K A;  2GQ0 A;  1N32 I;  1MX0 A;  3WU6 A;  4YY3 I;  3T1Y I;  2V2V A;  4K0K I;  4XTJ A;  5IT9 Q;  1NZ0 A;  4DPW A;  1H7S A;  4AQY E;  2J7K A;  1ZM9 A;  4FW9 A;  1QZR A;  2Z5B B;  1Z0W A;  1KKH A;  4FWD A;  5A2Q C;  2WW4 A;  4DPY A;  4LF4 I;  3H4L A;  4X64 I;  2UUB I;  1ZM3 A;  1H7U A;  4DV2 I;  2HKJ A;  3LNU A;  3Q1Q A;  2Z5E A;  4DV6 I;  1H74 A;  1XNQ E;  3OTO I;  3B8H A;  2HFU A;  4B3T I;  1XHK A;  3Q6M A;  3B82 A;  3P06 A;  1OJ4 A;  2F4V I;  4LFC E;  4WUB A;  2O1V A;  4P7A A;  4NXN I;  4JI7 I;  4IZK B;  4DR7 E;  1PIE A;  5BR8 I;  2V8P A;  3T1H I;  2VF3 A;  4DV5 E;  4B3M I;  2ZM6 I;  1HNX E;  1Z0V A;  1BKN A;  1IBK I;  2HK2 A;  1I94 E;  4JI2 I;  1J5E E;  4B3R E;  4DXL A;  1USV A;  2EFG A;  4WUD A;  4Z7Y A;  4UTG A;  4DV4 I;  2UUC E;  4DR4 E;  1HR0 I;  4PRX A;  2GS8 A;  2IOP A;  2VQE E;  3V5R A;  1B62 A;  1Z0E A;  1H73 A;  1HNZ I;  4JI1 E;  1FWK A;  2NPF A;  4X62 I;  1N0U A;  1PVG A;  1N34 E;  2O1U A;  4NXM E;  1XMQ E;  1FWL A;  1A6F A;  3QT8 A;  2V2Z A;  3D4J A;  5LMU E;  4JV5 I;  2UXB I;  1Z59 A;  1ZXN A;  4FWH A;  4GKJ E;  4IZJ A;  4LF5 I;  4DV3 I;  2AJ4 A;  4B3S I;  4X66 E;  1IBL I;  4JI0 I;  4JI8 E;  1EI1 A;  4WUC A;  1MU5 A;  4DR6 E;  3F0N A;  1ZM2 A;  1NHH A;  2A2C A;  4LFA I;  2V2Q A;  4HAC A;  5GME A;  4AQY I;  1Y4U A;  2E5L I;  4JI3 E;  4RPF A;  2BV3 A;  5IT9 C;  1EA6 A;  1Z0G A;  2HK3 A;  4LF9 I;  4R1F A;  2LJP A;  4DUZ I;  4DR3 E;  5L3J A;  4LF6 E;  4FWG A;  1HK7 A;  1HNW E;  3JAM Q;  2Q2E B;  1XMO I;  1XNR I;  4USM A;  4JI5 E;  4DU8 A;  2UXC I;  4HXZ A;  2OI2 A;  1RR9 A;  4JI6 E;  4X65 I;  4DV7 I;  4GKK E;  1Z0C A;  2CGE A;  4KHP I;  1N32 E;  1N36 I;  2XEX A;  4HYM A;  3QT5 A;  4LFB I;  4YY3 E;  3T1Y E;  4LF7 I;  4K0K E;  3HJC A;  2HKE A;  2HFS A;  2UXD I;  4DR2 I;  5A2Q Q;  1Y4S A;  1PKP A;  4PRV A;  4YHH I;  4OX9 E;  2X36 A;  3ZZT A;  1Z0B A;  4LF4 E;  3M6A A;  4X64 E;  4DV2 E;  2O1W A;  1H72 C;  4DV0 E;  3OTO E;  3CWV A;  4JI4 E;  4MYU A;  4B3T E;  4IZJ B;  4B3R I;  2PNM A;  1VIS A;  3J80 Q;  4DUY I;  2ZIT A;  2F4V E;  4DPT A;  4DR5 I;  3K17 A;  3PYF A;  4DPX A;  4NXN E;  1RRE A;  5GMD A;  1S4E A;  4I3H A;  4JI7 E;  1N0V C;  2DEJ A;  4URL A;  2HHH E;  1MG7 A;  3J7A M;  4JYA I;  4JG4 A;  5BR8 E;  3T1H E;  1IBM I;  2ZM6 E;  2VQF I;  2UUA I;  4NXM I;  2R3V A;  1IBK E;  1Z5B A;  3J7A G;  4JI2 E;  4USK A;  5IWA E;  5LMN I;  4DV4 E;  1D6T A;  3PYG A;  4DR1 E;  2IOQ A;  4N3O A;  3K1J A;  2X7I A;  1UEK A;  1N33 I;  5FLX C;  5LL6 R;  4HY1 A;  3J81 C;  2UU9 I;  1KVK A;  1HNZ E;  4ED4 A;  4KQV A;  4DV1 E;  4X62 E;  4JI3 I;  4LF8 E;  1Y6Z A;  4DU7 A;  1Z0T A;  1FJG E;  2Z5C A;  4DR3 I;  4PU9 A;  1Z5A A;  4LF6 I;  4JV5 E;  3PRY A;  2UXB E;  3ZKB A;  2E1R A;  4LF5 E;  1IBL E;  4JI0 E;  4JI6 I;  1NHJ A;  4UT4 A;  3LTO A;  1XNQ I;  4GKK I;  3HUL A;  4MYT A;  3ZZ0 A;  1KTV A;  1ZM4 A;  3K85 A;  4LFA E;  1U2R A;  2E5L E;  4OX9 I;  4LFC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...