4LFAI

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lfaI00
2V2QA 3OTOE 1MU5A 1ZM2A 1ZM4A 4JI8I 1I94I 3T1HI 5LMNI 4NXME 2UUBE 1Z0EA 1IBKE 3JAMQ 1H7UA 4JI1I 4X66E 4MYUA 5FLXC 4GKKI 1KIJA 1NHIA 2V34A 3ZKDA 1HNZE 4DR1I 3WU6A 1KKHA 4JV5E 2UXCI 4P7AA 2UXBE 4DPXA 2UU9I 1HR0I 2E1RA 4JI7I 4LF6E 4DR5I 2BM0A 2E5LI 2R3VA 4UT4A 3PYDA 2HKJA 3B78A 4EMDA 4LF4E 4KHPI 1MG7A 4NXNI 5L3JA 2HFSA 1A6FA 1HNXE 5IWAE 5IT9Q 5LL6R 3J80Q 2ZM6I 1J5EE 1PVGA 4LF5I 4DPTA 2UUAI 1N0VC 3T1YI 5LMUE 1B63A 4JI4E 1XMQI 4DV4I 2A2CA 1N32E 1Z0VA 3B8HA 1N0UA 1H74A 1FI4A 4LF8I 1N36E 4LFCE 1RR9A 4DR4E 4DV2I 4DXLA 4DV5I 3M6AA 1ELOA 1DARA 4AQYE 4X65E 1S4EA 4DUYI 4HY1A 1XHKA 3H4LA 1IBLI 4YHHI 4DR7I 4DU8A 1XMOE 4K0KI 1H72C 4B3MI 4DR6E 4URLA 1H73A 2BM1A 4GKJI 4DV0I 1N34E 5BR8E 4DV7E 4X64I 1PIEA 3OTOI 1Z0CA 3GONA 1N33E 1H7SA 4NXMI 2UUBI 5A2QQ 1IBKI 4FN5A 4X66I 4WUDA 4DV1E 3QT7A 3HULA 1IBME 1EA6A 1S16A 1HNZI 1ZM3A 1ZM9A 2AJ4A 3D4JA 3K1JA 3ZZTA 4JV5I 1MX0A 1K47A 2ZBKB 2UXBI 4JI1E 4JYAE 4LF6I 4PRVA 4YY3E 1D6TA 1HNWE 4LFBE 2VQEE 2LJPA 4ED4A 4LF4I 4UTGA 4DV6E 4JI3E 3JAMC 4JG4A 1NHHA 5IWAI 1HNXI 4B3SE 2WW4A 4DR3E 4WUBA 2X36A 4X62E 4Z7YA 1J5EI 1ZXNA 1Z0BA 3J81Q 4B3TE 5LMUI 4JI4I 1WUUA 2V8PA 1N32I 4PU9A 4LF7E 4PRXA 4FWHA 1KTVA 1FJGE 3WU4A 4OX9E 1UEKA 2HHHE 1RREA 1N36I 3J7AG 4JI2E 2UXDE 2CZ9A 4LFCI 4USKA 1XMQE 4DR4I 4FWDA 3J80C 4AQYI 2V2ZA 4X65I 4DUZE 1XMOI 4RPFA 4DR6I 2XEXA 4JI5E 1Z0GA 1KVKA 2UUCE 4DV2E 2HK3A 1XNQE 1Z59A 2EFGA 3PYEA 4DR2E 4FW9A 1N34I 5BR8I 4DV7I 5GMDA 2F4VE 1Z5AA 5FLXQ 4LF9E 3ZKBA 3ZM7A 4JI6E 4XTJA 1N33I 4DV3E 1OJ4A 4USMA 4B3RE 4HACA 3Q1QA 4DV1I 4JI0E 2VQFE 4WUCA 4LFAE 1XNRE 1U2RA 1Z0WA 1FKAE 1IBMI 2ZITA 1FWLA 4JI8E 2HFUA 1Z5BA 1I94E 3T1HE 4M1KA 2VF3A 1VISA 5LMNE 4ZVIA 4DPUA 1FWKA 4JYAI 1Z0TA 4YY3I 4GKKE 2GS8A 1HNWI 4HYMA 4LFBI 1NZ0A 2VQEI 4P52A 4DR1E 4DV6I 5A2QC 2UXCE 4FWGA 4JI3I 4B3SI 2UU9E 1HR0E 4DR3I 4JI7E 4HXZA 4DR5E 2J7KA 3QT8A 4X62I 3LNUA 2E5LE 2DEIA 4KQVA 5GMEA 1ZXMA 4DU7A 4KHPE 4B3TI 4MYTA 1FNMA 2A2DA 4NXNE 4R1FA 3PYFA 2HKEA 3WU3A 2DEJA 4LF7I 2V2VA 1FJGI 3LTOA 1BKNA 2BV3A 2ZM6E 4OX9I 4I3HA 4DPWA 2X7IA 3QT5A 2HHHI 1QZRA 4JI2I 2UXDI 4LF5E 2UUAE 3T1YE 1EI1A 4DV4E 5IT9C 2OI2A 1NHJA 2R42A 3F0NA 4DUZI 3J7AM 3WU5A 3J81C 4LF8E 4HACB 1B62A 1XNRI 4JI5I 4Z7CA 2UUCI 3QT6A 4DPYA 1XNQI 4DV5E 4DR2I 4DUYE 1IBLE 1PKPA 3B82A 4YHHE 2F4VI 2HK2A 4DR7E 4K0KE 4LF9I 3K17A 3PYGA 2NPFA 4JI6I 4B3ME 4DV3I 3LPSA 4B3RI 4GKJE 4DV0E 3CWVA 2Q2EB 1Z5CA 3V2UC 3V5RA 3ZZUA 4JI0I 3ZZ0A 2VQFI 4LFAI 4X64E
chains in the Genus database with same CATH superfamily
2V2QA 2C37B 3OTOE 1MU5A 1ZM2A 1OYPA 1ZM4A 4JI8I 3GCMA 1I94I 3T1HI 4AIMA 5LMNI 4NXME 4QNJA 4U3BA 2UUBE 1Z0EA 4MU1A 5DRQA 1IBKE 3JAMQ 1H7UA 4JI1I 4X66E 3GLLA 2IERA 2VESA 1Y4UA 4MYUA 5FLXC 4GKKI 1KIJA 3B4TA 4IFDF 5DNLA 1USUA 1NHIA 2C39A 2V34A 2O1WA 5JEAC 3ZKDA 4DR1I 1HNZE 3WU6A 1KKHA 4IS9A 3UHMA 4JV5E 2UXCI 4P7AA 4IFDD 2UXBE 2O1VA 4LCGA 4DPXA 1VI7A 2UU9I 1HR0I 2E1RA 4JI7I 4LF6E 4DR5I 4OZEA 4BA1B 4OO1F 2BM0A 2E5LI 2JE6A 2R3VA 4UT4A 2NN6B 3PYDA 3CDIA 5JEAA 2HKJA 3B78A 4EMDA 2C38B 4LF4E 4KHPI 4IZJB 4OO1D 1MG7A 4NXNI 2GO4A 5L3JA 3L7ZA 2HFSA 1A6FA 5IWAE 1HNXE 3H1CA 5IT9Q 5DRRA 5LL6R 3J80Q 2O3ZA 2ZM6I 2PNZB 1J5EE 1PVGA 1UDOA 4LF5I 4DPTA 2UUAI 1N0VC 3P06A 3T1YI 5LMUE 1B63A 4JI4E 4MDTA 1XMQI 4DV4I 2A2CA 4ISAA 1N32E 2JEBA 4MQYA 1Z0VA 3B8HA 1N0UA 1E3PA 1H74A 3M85G 5K36E 1FI4A 4LF8I 1N36E 4LFCE 1RR9A 2BA0G 4DR4E 4DV2I 4DXLA 4DV5I 3M6AA 1ELOA 1DARA 4IFDC 4AQYE 4X65E 1S4EA 3Q6MA 4OKGA 4DUYI 4MU0A 4HY1A 1XHKA 3GMEA 3H4LA 1IBLI 2J65A 4YHHI 4DR7I 4DU8A 1XMOE 2BR2A 4K0KI 4IZKA 1H72C 1HK7A 4B3MI 4DR6E 4FW6A 2PO2B 4URLA 1H73A 2BM1A 3P76A 4OO1C 5K36B 4GKJI 1RHYA 1UDQA 4DV0I 4IFDA 2C39B 4MU4A 1N34E 5BR8E 4DV7E 4X64I 1PIEA 2GQ0A 3OTOI 1Z0CA 3HJCA 3GONA 2O1UA 1N33E 1H7SA 4NXMI 4OO1A 2UUBI 5A2QQ 2NN6E 1IBKI 4FN5A 4X66I 1Y5YA 4IZJD 4WUDA 4DV1E 3P3EA 3QT7A 5C0XE 3HULA 2CVEA 1IBME 3L7ZB 2BA1D 1USVA 1EA6A 1S16A 3CDJA 3K85A 4AIDA 1OYRA 1HNZI 1ZM3A 1ZM9A 2AJ4A 3D4JA 3K1JA 3ZZTA 4JV5I 1MX0A 1K47A 2ZBKB 2UXBI 4JI1E 4JYAE 4LF6I 4GQUA 4J3DA 4PRVA 2PO1A 4YY3E 1D6TA 1Y6ZA 1HNWE 4LFBE 2VQEE 2LJPA 4ED4A 4LF4I 4UTGA 4DV6E 1R6LA 4QNKA 2C37A 5C0XB 4JI3E 3JAMC 4JG4A 1NHHA 3PS1A 5IWAI 1HNXI 4B3SE 2JEAB 2WW4A 4DR3E 4WUBA 2PO0A 1R6MA 2X36A 4X62E 4Z7YA 1J5EI 1ZXNA 1Z0BA 3J81Q 2Z5CA 1E3HA 4FW4A 5DROA 2Z5EA 4B3TE 5LMUI 4JI4I 1WUUA 3KRNA 4FW7A 5K36F 2V8PA 2BR2B 4IZKB 1N32I 4PU9A 4LF7E 4NBQA 4PRXA 4FWHA 1KTVA 1FJGE 3HKMA 2GO3A 2CG9A 3WU4A 5K36D 4OX9E 4BA2A 1UEKA 2HHHE 1RREA 2Z5BB 2WP8B 4IFDB 1N36I 3J7AG 4JI2E 2UXDE 4U3DA 2CZ9A 4LFCI 3U1YA 4USKA 1XMQE 4DR4I 4FWDA 3M7ND 3J80C 2C38A 4AQYI 2V2ZA 2WNRA 4IZJA 4X65I 4DUZE 1OYSA 2PNLA 1XMOI 5JEAE 3PS2A 4RPFA 4DR6I 2XEXA 4JI5E 1Z0GA 1KVKA 2UUCE 4DV2E 2HK3A 1XNQE 1Z59A 2EFGA 3PYEA 4DR2E 4FW9A 1N34I 5BR8I 4DV7I 1YH8A 5GMDA 2CGEA 2F4VE 1Z5AA 2NN6F 5FLXQ 4LF9E 3ZKBA 3ZM7A 4JI6E 4XTJA 1N33I 4DV3E 3PRYA 1OJ4A 4USMA 5C0XF 4B3RE 4HACA 2PNMA 2NN6D 3Q1QA 2JE6B 4LOMA 5JEAB 5DNXA 4DV1I 4JI0E 2VQFE 4WUCA 4LFAE 5C0XD 1XNRE 1U2RA 1Z0WA 1Y4SA 2BA1G 3U1KA 1FKAE 1IBMI 2ZITA 1FWLA 5K36C 4JI8E 2HFUA 1Z5BA 1I94E 3T1HE 4M1KA 1Y60A 2PO0B 2VF3A 1VISA 5LMNE 4ZVIA 3P3CA 4DPUA 1FWKA 4LPFA 4JYAI 2Z5CB 4MU3A 2PO2A 1Z0TA 4YY3I 4GKKE 3Q6NA 2JT2A 5K36A 2GS8A 1HNWI 4HYMA 4LFBI 1NZ0A 2VQEI 3P3GA 2JEBB 4P52A 4DR1E 4DV6I 5A2QC 2UXCE 4FWGA 4JI3I 4BA2B 4IFDE 4B3SI 2UU9E 5DRPA 1HR0E 4DR3I 4JI7E 4HXZA 4DR5E 2J7KA 3QT8A 4X62I 2IOPA 3LNUA 1P42A 2E5LE 2DEIA 4KQVA 5GMEA 1ZXMA 2F1DA 4DU7A 2IESA 4KHPE 4B3TI 4MYTA 2WNRB 4OO1E 1FNMA 2A2DA 4NXNE 4R1FA 3PYFA 2HKEA 3WU3A 2DEJA 4LF7I 2V2VA 5EL9A 2NN6C 4FW3A 1FJGI 3LTOA 4LCFA 1BKNA 2BV3A 2ZM6E 4OX9I 4I3HA 4N3OA 2X7IA 3QT5A 5ELWA 4DPWA 5C0XC 2HHHI 1QZRA 4JI2I 1YHCA 2UXDI 4BA1A 4LF5E 2UUAE 3T1YE 1EI1A 4DV4E 3M7NG 5IT9C 2OI2A 2NN6A 5JEAF 1NHJA 5EKWA 2R42A 3F0NA 4DUZI 3J7AM 3WU5A 3PS3A 5C0XA 4OO1B 2O1TA 3M85D 3J81C 4LF8E 4HACB 1B62A 5JEAD 2JEAA 1XNRI 4JI5I 4Z7CA 3DD6A 1UDNA 2UUCI 2PNZA 3QT6A 2BA0D 4DPYA 1XNQI 4DV5E 4DR2I 2AE8A 4DUYE 1UDSA 1IBLE 1PKPA 3B82A 4YHHE 2F4VI 2HK2A 4DR7E 4K0KE 1XXEA 3K17A 4LF9I 5FWKA 4LCHA 3NZKA 3PYGA 2NPFA 4JI6I 4B3ME 4DV3I 2PO1B 2IOQA 3LPSA 4AM3A 4B3RI 2Z5BA 2WP8A 4GKJE 4DV0E 3CWVA 2Q2EB 1Z5CA 4FW5A 3V2UC 3V5RA 3ZZUA 4JI0I 3ZZ0A 2VQFI 4LFAI 4X64E
chains in the Genus database with same CATH topology
2V2QA 3OTOE 1MU5A 1ZM2A 1ZM4A 4JI8I 1I94I 3T1HI 5LMNI 4NXME 2UUBE 1Z0EA 1IBKE 3JAMQ 1H7UA 4JI1I 4X66E 1Y4UA 4MYUA 5FLXC 4GKKI 1KIJA 1USUA 1NHIA 2V34A 2O1WA 3ZKDA 1HNZE 4DR1I 3WU6A 1KKHA 4JV5E 2UXCI 4P7AA 2UXBE 2O1VA 4DPXA 2UU9I 1HR0I 2E1RA 4JI7I 4LF6E 4DR5I 2BM0A 2E5LI 2R3VA 4UT4A 3PYDA 2HKJA 3B78A 4EMDA 4LF4E 4KHPI 4IZJB 1MG7A 4NXNI 5L3JA 2HFSA 1A6FA 5IWAE 1HNXE 5IT9Q 5LL6R 3J80Q 2ZM6I 1J5EE 1PVGA 4LF5I 4DPTA 2UUAI 1N0VC 3P06A 3T1YI 5LMUE 1B63A 4JI4E 1XMQI 4DV4I 2A2CA 1N32E 1Z0VA 3B8HA 1N0UA 1H74A 1FI4A 4LF8I 1N36E 4LFCE 1RR9A 4DR4E 4DV2I 4DXLA 4DV5I 3M6AA 1ELOA 1DARA 4AQYE 4X65E 1S4EA 3Q6MA 4DUYI 4HY1A 1XHKA 3H4LA 1IBLI 4YHHI 4DR7I 4DU8A 1XMOE 4K0KI 4IZKA 1HK7A 1H72C 4B3MI 4DR6E 4URLA 1H73A 2BM1A 4GKJI 4DV0I 1N34E 5BR8E 4DV7E 4X64I 1PIEA 2GQ0A 3OTOI 1Z0CA 3HJCA 3GONA 2O1UA 1N33E 1H7SA 4NXMI 2UUBI 5A2QQ 1IBKI 4FN5A 4X66I 4IZJD 4WUDA 4DV1E 3QT7A 3HULA 1IBME 1USVA 1EA6A 1S16A 3K85A 1HNZI 1ZM3A 1ZM9A 2AJ4A 3D4JA 3K1JA 3ZZTA 4JV5I 1MX0A 1K47A 2ZBKB 2UXBI 4JI1E 4JYAE 4LF6I 4PRVA 4YY3E 1D6TA 1Y6ZA 1HNWE 4LFBE 2VQEE 2LJPA 4ED4A 4LF4I 4UTGA 4DV6E 4JI3E 3JAMC 4JG4A 1NHHA 5IWAI 1HNXI 4B3SE 2WW4A 4DR3E 4WUBA 2X36A 4X62E 4Z7YA 1J5EI 1ZXNA 1Z0BA 3J81Q 2Z5CA 2Z5EA 4B3TE 5LMUI 4JI4I 1WUUA 2V8PA 4IZKB 1N32I 4PU9A 4LF7E 4PRXA 4FWHA 1KTVA 1FJGE 2CG9A 3WU4A 4OX9E 1UEKA 2HHHE 1RREA 2Z5BB 1N36I 3J7AG 4JI2E 2UXDE 2CZ9A 4LFCI 4USKA 1XMQE 4DR4I 4FWDA 3J80C 4AQYI 2V2ZA 4IZJA 4X65I 4DUZE 2PNLA 1XMOI 4RPFA 4DR6I 2XEXA 4JI5E 1Z0GA 1KVKA 2UUCE 4DV2E 2HK3A 1XNQE 1Z59A 2EFGA 3PYEA 4DR2E 4FW9A 1N34I 5BR8I 4DV7I 5GMDA 2CGEA 2F4VE 1Z5AA 5FLXQ 4LF9E 3ZKBA 3ZM7A 4JI6E 4XTJA 1N33I 4DV3E 3PRYA 1OJ4A 4USMA 4B3RE 4HACA 2PNMA 3Q1QA 4DV1I 4JI0E 2VQFE 4WUCA 4LFAE 1XNRE 1U2RA 1Z0WA 1Y4SA 1FKAE 1IBMI 2ZITA 1FWLA 4JI8E 2HFUA 1Z5BA 1I94E 3T1HE 4M1KA 2VF3A 1VISA 5LMNE 4ZVIA 4DPUA 1FWKA 4JYAI 2Z5CB 1Z0TA 4YY3I 4GKKE 3Q6NA 2GS8A 1HNWI 4HYMA 4LFBI 1NZ0A 2VQEI 4P52A 4DR1E 4DV6I 5A2QC 2UXCE 4FWGA 4JI3I 4B3SI 2UU9E 1HR0E 4DR3I 4JI7E 4HXZA 4DR5E 2J7KA 3QT8A 4X62I 2IOPA 3LNUA 2E5LE 2DEIA 4KQVA 5GMEA 1ZXMA 4DU7A 4KHPE 4B3TI 4MYTA 1FNMA 2A2DA 4NXNE 4R1FA 3PYFA 2HKEA 3WU3A 2DEJA 4LF7I 2V2VA 1FJGI 3LTOA 1BKNA 2BV3A 2ZM6E 4OX9I 4I3HA 4N3OA 2X7IA 3QT5A 4DPWA 2HHHI 1QZRA 4JI2I 2UXDI 4LF5E 2UUAE 3T1YE 1EI1A 4DV4E 5IT9C 2OI2A 1NHJA 2R42A 3F0NA 4DUZI 3J7AM 3WU5A 2O1TA 3J81C 4LF8E 4HACB 1B62A 1XNRI 4JI5I 4Z7CA 2UUCI 3QT6A 4DPYA 1XNQI 4DV5E 4DR2I 4DUYE 1IBLE 1PKPA 3B82A 4YHHE 2F4VI 2HK2A 4DR7E 4K0KE 4LF9I 3K17A 5FWKA 3PYGA 2NPFA 4JI6I 4B3ME 4DV3I 2IOQA 3LPSA 4B3RI 2Z5BA 4GKJE 4DV0E 3CWVA 2Q2EB 1Z5CA 3V2UC 3V5RA 3ZZUA 4JI0I 3ZZ0A 2VQFI 4LFAI 4X64E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2Q A;  3OTO E;  1MU5 A;  1ZM2 A;  1ZM4 A;  4JI8 I;  1I94 I;  3T1H I;  5LMN I;  4NXM E;  2UUB E;  1Z0E A;  1IBK E;  3JAM Q;  1H7U A;  4JI1 I;  4X66 E;  4MYU A;  5FLX C;  4GKK I;  1KIJ A;  1NHI A;  2V34 A;  3ZKD A;  1HNZ E;  4DR1 I;  3WU6 A;  1KKH A;  4JV5 E;  2UXC I;  4P7A A;  2UXB E;  4DPX A;  2UU9 I;  1HR0 I;  2E1R A;  4JI7 I;  4LF6 E;  4DR5 I;  2BM0 A;  2E5L I;  2R3V A;  4UT4 A;  3PYD A;  2HKJ A;  3B78 A;  4EMD A;  4LF4 E;  4KHP I;  1MG7 A;  4NXN I;  5L3J A;  2HFS A;  1A6F A;  1HNX E;  5IWA E;  5IT9 Q;  5LL6 R;  3J80 Q;  2ZM6 I;  1J5E E;  1PVG A;  4LF5 I;  4DPT A;  2UUA I;  1N0V C;  3T1Y I;  5LMU E;  1B63 A;  4JI4 E;  1XMQ I;  4DV4 I;  2A2C A;  1N32 E;  1Z0V A;  3B8H A;  1N0U A;  1H74 A;  1FI4 A;  4LF8 I;  1N36 E;  4LFC E;  1RR9 A;  4DR4 E;  4DV2 I;  4DXL A;  4DV5 I;  3M6A A;  1ELO A;  1DAR A;  4AQY E;  4X65 E;  1S4E A;  4DUY I;  4HY1 A;  1XHK A;  3H4L A;  1IBL I;  4YHH I;  4DR7 I;  4DU8 A;  1XMO E;  4K0K I;  1H72 C;  4B3M I;  4DR6 E;  4URL A;  1H73 A;  2BM1 A;  4GKJ I;  4DV0 I;  1N34 E;  5BR8 E;  4DV7 E;  4X64 I;  1PIE A;  3OTO I;  1Z0C A;  3GON A;  1N33 E;  1H7S A;  4NXM I;  2UUB I;  5A2Q Q;  1IBK I;  4FN5 A;  4X66 I;  4WUD A;  4DV1 E;  3QT7 A;  3HUL A;  1IBM E;  1EA6 A;  1S16 A;  1HNZ I;  1ZM3 A;  1ZM9 A;  2AJ4 A;  3D4J A;  3K1J A;  3ZZT A;  4JV5 I;  1MX0 A;  1K47 A;  2ZBK B;  2UXB I;  4JI1 E;  4JYA E;  4LF6 I;  4PRV A;  4YY3 E;  1D6T A;  1HNW E;  4LFB E;  2VQE E;  2LJP A;  4ED4 A;  4LF4 I;  4UTG A;  4DV6 E;  4JI3 E;  3JAM C;  4JG4 A;  1NHH A;  5IWA I;  1HNX I;  4B3S E;  2WW4 A;  4DR3 E;  4WUB A;  2X36 A;  4X62 E;  4Z7Y A;  1J5E I;  1ZXN A;  1Z0B A;  3J81 Q;  4B3T E;  5LMU I;  4JI4 I;  1WUU A;  2V8P A;  1N32 I;  4PU9 A;  4LF7 E;  4PRX A;  4FWH A;  1KTV A;  1FJG E;  3WU4 A;  4OX9 E;  1UEK A;  2HHH E;  1RRE A;  1N36 I;  3J7A G;  4JI2 E;  2UXD E;  2CZ9 A;  4LFC I;  4USK A;  1XMQ E;  4DR4 I;  4FWD A;  3J80 C;  4AQY I;  2V2Z A;  4X65 I;  4DUZ E;  1XMO I;  4RPF A;  4DR6 I;  2XEX A;  4JI5 E;  1Z0G A;  1KVK A;  2UUC E;  4DV2 E;  2HK3 A;  1XNQ E;  1Z59 A;  2EFG A;  3PYE A;  4DR2 E;  4FW9 A;  1N34 I;  5BR8 I;  4DV7 I;  5GMD A;  2F4V E;  1Z5A A;  5FLX Q;  4LF9 E;  3ZKB A;  3ZM7 A;  4JI6 E;  4XTJ A;  1N33 I;  4DV3 E;  1OJ4 A;  4USM A;  4B3R E;  4HAC A;  3Q1Q A;  4DV1 I;  4JI0 E;  2VQF E;  4WUC A;  4LFA E;  1XNR E;  1U2R A;  1Z0W A;  1FKA E;  1IBM I;  2ZIT A;  1FWL A;  4JI8 E;  2HFU A;  1Z5B A;  1I94 E;  3T1H E;  4M1K A;  2VF3 A;  1VIS A;  5LMN E;  4ZVI A;  4DPU A;  1FWK A;  4JYA I;  1Z0T A;  4YY3 I;  4GKK E;  2GS8 A;  1HNW I;  4HYM A;  4LFB I;  1NZ0 A;  2VQE I;  4P52 A;  4DR1 E;  4DV6 I;  5A2Q C;  2UXC E;  4FWG A;  4JI3 I;  4B3S I;  2UU9 E;  1HR0 E;  4DR3 I;  4JI7 E;  4HXZ A;  4DR5 E;  2J7K A;  3QT8 A;  4X62 I;  3LNU A;  2E5L E;  2DEI A;  4KQV A;  5GME A;  1ZXM A;  4DU7 A;  4KHP E;  4B3T I;  4MYT A;  1FNM A;  2A2D A;  4NXN E;  4R1F A;  3PYF A;  2HKE A;  3WU3 A;  2DEJ A;  4LF7 I;  2V2V A;  1FJG I;  3LTO A;  1BKN A;  2BV3 A;  2ZM6 E;  4OX9 I;  4I3H A;  4DPW A;  2X7I A;  3QT5 A;  2HHH I;  1QZR A;  4JI2 I;  2UXD I;  4LF5 E;  2UUA E;  3T1Y E;  1EI1 A;  4DV4 E;  5IT9 C;  2OI2 A;  1NHJ A;  2R42 A;  3F0N A;  4DUZ I;  3J7A M;  3WU5 A;  3J81 C;  4LF8 E;  4HAC B;  1B62 A;  1XNR I;  4JI5 I;  4Z7C A;  2UUC I;  3QT6 A;  4DPY A;  1XNQ I;  4DV5 E;  4DR2 I;  4DUY E;  1IBL E;  1PKP A;  3B82 A;  4YHH E;  2F4V I;  2HK2 A;  4DR7 E;  4K0K E;  4LF9 I;  3K17 A;  3PYG A;  2NPF A;  4JI6 I;  4B3M E;  4DV3 I;  3LPS A;  4B3R I;  4GKJ E;  4DV0 E;  3CWV A;  2Q2E B;  1Z5C A;  3V2U C;  3V5R A;  3ZZU A;  4JI0 I;  3ZZ0 A;  2VQF I;  4LFA I;  4X64 E; 
#chains in the Genus database with same CATH topology
 2V2Q A;  2C37 B;  3OTO E;  1MU5 A;  1ZM2 A;  1OYP A;  1ZM4 A;  4JI8 I;  3GCM A;  1I94 I;  3T1H I;  4AIM A;  5LMN I;  4NXM E;  4QNJ A;  4U3B A;  2UUB E;  1Z0E A;  4MU1 A;  5DRQ A;  1IBK E;  3JAM Q;  1H7U A;  4JI1 I;  4X66 E;  3GLL A;  2IER A;  2VES A;  1Y4U A;  4MYU A;  5FLX C;  4GKK I;  1KIJ A;  3B4T A;  4IFD F;  5DNL A;  1USU A;  1NHI A;  2C39 A;  2V34 A;  2O1W A;  5JEA C;  3ZKD A;  4DR1 I;  1HNZ E;  3WU6 A;  1KKH A;  4IS9 A;  3UHM A;  4JV5 E;  2UXC I;  4P7A A;  4IFD D;  2UXB E;  2O1V A;  4LCG A;  4DPX A;  1VI7 A;  2UU9 I;  1HR0 I;  2E1R A;  4JI7 I;  4LF6 E;  4DR5 I;  4OZE A;  4BA1 B;  4OO1 F;  2BM0 A;  2E5L I;  2JE6 A;  2R3V A;  4UT4 A;  2NN6 B;  3PYD A;  3CDI A;  5JEA A;  2HKJ A;  3B78 A;  4EMD A;  2C38 B;  4LF4 E;  4KHP I;  4IZJ B;  4OO1 D;  1MG7 A;  4NXN I;  2GO4 A;  5L3J A;  3L7Z A;  2HFS A;  1A6F A;  5IWA E;  1HNX E;  3H1C A;  5IT9 Q;  5DRR A;  5LL6 R;  3J80 Q;  2O3Z A;  2ZM6 I;  2PNZ B;  1J5E E;  1PVG A;  1UDO A;  4LF5 I;  4DPT A;  2UUA I;  1N0V C;  3P06 A;  3T1Y I;  5LMU E;  1B63 A;  4JI4 E;  4MDT A;  1XMQ I;  4DV4 I;  2A2C A;  4ISA A;  1N32 E;  2JEB A;  4MQY A;  1Z0V A;  3B8H A;  1N0U A;  1E3P A;  1H74 A;  3M85 G;  5K36 E;  1FI4 A;  4LF8 I;  1N36 E;  4LFC E;  1RR9 A;  2BA0 G;  4DR4 E;  4DV2 I;  4DXL A;  4DV5 I;  3M6A A;  1ELO A;  1DAR A;  4IFD C;  4AQY E;  4X65 E;  1S4E A;  3Q6M A;  4OKG A;  4DUY I;  4MU0 A;  4HY1 A;  1XHK A;  3GME A;  3H4L A;  1IBL I;  2J65 A;  4YHH I;  4DR7 I;  4DU8 A;  1XMO E;  2BR2 A;  4K0K I;  4IZK A;  1H72 C;  1HK7 A;  4B3M I;  4DR6 E;  4FW6 A;  2PO2 B;  4URL A;  1H73 A;  2BM1 A;  3P76 A;  4OO1 C;  5K36 B;  4GKJ I;  1RHY A;  1UDQ A;  4DV0 I;  4IFD A;  2C39 B;  4MU4 A;  1N34 E;  5BR8 E;  4DV7 E;  4X64 I;  1PIE A;  2GQ0 A;  3OTO I;  1Z0C A;  3HJC A;  3GON A;  2O1U A;  1N33 E;  1H7S A;  4NXM I;  4OO1 A;  2UUB I;  5A2Q Q;  2NN6 E;  1IBK I;  4FN5 A;  4X66 I;  1Y5Y A;  4IZJ D;  4WUD A;  4DV1 E;  3P3E A;  3QT7 A;  5C0X E;  3HUL A;  2CVE A;  1IBM E;  3L7Z B;  2BA1 D;  1USV A;  1EA6 A;  1S16 A;  3CDJ A;  3K85 A;  4AID A;  1OYR A;  1HNZ I;  1ZM3 A;  1ZM9 A;  2AJ4 A;  3D4J A;  3K1J A;  3ZZT A;  4JV5 I;  1MX0 A;  1K47 A;  2ZBK B;  2UXB I;  4JI1 E;  4JYA E;  4LF6 I;  4GQU A;  4J3D A;  4PRV A;  2PO1 A;  4YY3 E;  1D6T A;  1Y6Z A;  1HNW E;  4LFB E;  2VQE E;  2LJP A;  4ED4 A;  4LF4 I;  4UTG A;  4DV6 E;  1R6L A;  4QNK A;  2C37 A;  5C0X B;  4JI3 E;  3JAM C;  4JG4 A;  1NHH A;  3PS1 A;  5IWA I;  1HNX I;  4B3S E;  2JEA B;  2WW4 A;  4DR3 E;  4WUB A;  2PO0 A;  1R6M A;  2X36 A;  4X62 E;  4Z7Y A;  1J5E I;  1ZXN A;  1Z0B A;  3J81 Q;  2Z5C A;  1E3H A;  4FW4 A;  5DRO A;  2Z5E A;  4B3T E;  5LMU I;  4JI4 I;  1WUU A;  3KRN A;  4FW7 A;  5K36 F;  2V8P A;  2BR2 B;  4IZK B;  1N32 I;  4PU9 A;  4LF7 E;  4NBQ A;  4PRX A;  4FWH A;  1KTV A;  1FJG E;  3HKM A;  2GO3 A;  2CG9 A;  3WU4 A;  5K36 D;  4OX9 E;  4BA2 A;  1UEK A;  2HHH E;  1RRE A;  2Z5B B;  2WP8 B;  4IFD B;  1N36 I;  3J7A G;  4JI2 E;  2UXD E;  4U3D A;  2CZ9 A;  4LFC I;  3U1Y A;  4USK A;  1XMQ E;  4DR4 I;  4FWD A;  3M7N D;  3J80 C;  2C38 A;  4AQY I;  2V2Z A;  2WNR A;  4IZJ A;  4X65 I;  4DUZ E;  1OYS A;  2PNL A;  1XMO I;  5JEA E;  3PS2 A;  4RPF A;  4DR6 I;  2XEX A;  4JI5 E;  1Z0G A;  1KVK A;  2UUC E;  4DV2 E;  2HK3 A;  1XNQ E;  1Z59 A;  2EFG A;  3PYE A;  4DR2 E;  4FW9 A;  1N34 I;  5BR8 I;  4DV7 I;  1YH8 A;  5GMD A;  2CGE A;  2F4V E;  1Z5A A;  2NN6 F;  5FLX Q;  4LF9 E;  3ZKB A;  3ZM7 A;  4JI6 E;  4XTJ A;  1N33 I;  4DV3 E;  3PRY A;  1OJ4 A;  4USM A;  5C0X F;  4B3R E;  4HAC A;  2PNM A;  2NN6 D;  3Q1Q A;  2JE6 B;  4LOM A;  5JEA B;  5DNX A;  4DV1 I;  4JI0 E;  2VQF E;  4WUC A;  4LFA E;  5C0X D;  1XNR E;  1U2R A;  1Z0W A;  1Y4S A;  2BA1 G;  3U1K A;  1FKA E;  1IBM I;  2ZIT A;  1FWL A;  5K36 C;  4JI8 E;  2HFU A;  1Z5B A;  1I94 E;  3T1H E;  4M1K A;  1Y60 A;  2PO0 B;  2VF3 A;  1VIS A;  5LMN E;  4ZVI A;  3P3C A;  4DPU A;  1FWK A;  4LPF A;  4JYA I;  2Z5C B;  4MU3 A;  2PO2 A;  1Z0T A;  4YY3 I;  4GKK E;  3Q6N A;  2JT2 A;  5K36 A;  2GS8 A;  1HNW I;  4HYM A;  4LFB I;  1NZ0 A;  2VQE I;  3P3G A;  2JEB B;  4P52 A;  4DR1 E;  4DV6 I;  5A2Q C;  2UXC E;  4FWG A;  4JI3 I;  4BA2 B;  4IFD E;  4B3S I;  2UU9 E;  5DRP A;  1HR0 E;  4DR3 I;  4JI7 E;  4HXZ A;  4DR5 E;  2J7K A;  3QT8 A;  4X62 I;  2IOP A;  3LNU A;  1P42 A;  2E5L E;  2DEI A;  4KQV A;  5GME A;  1ZXM A;  2F1D A;  4DU7 A;  2IES A;  4KHP E;  4B3T I;  4MYT A;  2WNR B;  4OO1 E;  1FNM A;  2A2D A;  4NXN E;  4R1F A;  3PYF A;  2HKE A;  3WU3 A;  2DEJ A;  4LF7 I;  2V2V A;  5EL9 A;  2NN6 C;  4FW3 A;  1FJG I;  3LTO A;  4LCF A;  1BKN A;  2BV3 A;  2ZM6 E;  4OX9 I;  4I3H A;  4N3O A;  2X7I A;  3QT5 A;  5ELW A;  4DPW A;  5C0X C;  2HHH I;  1QZR A;  4JI2 I;  1YHC A;  2UXD I;  4BA1 A;  4LF5 E;  2UUA E;  3T1Y E;  1EI1 A;  4DV4 E;  3M7N G;  5IT9 C;  2OI2 A;  2NN6 A;  5JEA F;  1NHJ A;  5EKW A;  2R42 A;  3F0N A;  4DUZ I;  3J7A M;  3WU5 A;  3PS3 A;  5C0X A;  4OO1 B;  2O1T A;  3M85 D;  3J81 C;  4LF8 E;  4HAC B;  1B62 A;  5JEA D;  2JEA A;  1XNR I;  4JI5 I;  4Z7C A;  3DD6 A;  1UDN A;  2UUC I;  2PNZ A;  3QT6 A;  2BA0 D;  4DPY A;  1XNQ I;  4DV5 E;  4DR2 I;  2AE8 A;  4DUY E;  1UDS A;  1IBL E;  1PKP A;  3B82 A;  4YHH E;  2F4V I;  2HK2 A;  4DR7 E;  4K0K E;  1XXE A;  3K17 A;  4LF9 I;  5FWK A;  4LCH A;  3NZK A;  3PYG A;  2NPF A;  4JI6 I;  4B3M E;  4DV3 I;  2PO1 B;  2IOQ A;  3LPS A;  4AM3 A;  4B3R I;  2Z5B A;  2WP8 A;  4GKJ E;  4DV0 E;  3CWV A;  2Q2E B;  1Z5C A;  4FW5 A;  3V2U C;  3V5R A;  3ZZU A;  4JI0 I;  3ZZ0 A;  2VQF I;  4LFA I;  4X64 E; 
#chains in the Genus database with same CATH homology
 2V2Q A;  3OTO E;  1MU5 A;  1ZM2 A;  1ZM4 A;  4JI8 I;  1I94 I;  3T1H I;  5LMN I;  4NXM E;  2UUB E;  1Z0E A;  1IBK E;  3JAM Q;  1H7U A;  4JI1 I;  4X66 E;  1Y4U A;  4MYU A;  5FLX C;  4GKK I;  1KIJ A;  1USU A;  1NHI A;  2V34 A;  2O1W A;  3ZKD A;  1HNZ E;  4DR1 I;  3WU6 A;  1KKH A;  4JV5 E;  2UXC I;  4P7A A;  2UXB E;  2O1V A;  4DPX A;  2UU9 I;  1HR0 I;  2E1R A;  4JI7 I;  4LF6 E;  4DR5 I;  2BM0 A;  2E5L I;  2R3V A;  4UT4 A;  3PYD A;  2HKJ A;  3B78 A;  4EMD A;  4LF4 E;  4KHP I;  4IZJ B;  1MG7 A;  4NXN I;  5L3J A;  2HFS A;  1A6F A;  5IWA E;  1HNX E;  5IT9 Q;  5LL6 R;  3J80 Q;  2ZM6 I;  1J5E E;  1PVG A;  4LF5 I;  4DPT A;  2UUA I;  1N0V C;  3P06 A;  3T1Y I;  5LMU E;  1B63 A;  4JI4 E;  1XMQ I;  4DV4 I;  2A2C A;  1N32 E;  1Z0V A;  3B8H A;  1N0U A;  1H74 A;  1FI4 A;  4LF8 I;  1N36 E;  4LFC E;  1RR9 A;  4DR4 E;  4DV2 I;  4DXL A;  4DV5 I;  3M6A A;  1ELO A;  1DAR A;  4AQY E;  4X65 E;  1S4E A;  3Q6M A;  4DUY I;  4HY1 A;  1XHK A;  3H4L A;  1IBL I;  4YHH I;  4DR7 I;  4DU8 A;  1XMO E;  4K0K I;  4IZK A;  1HK7 A;  1H72 C;  4B3M I;  4DR6 E;  4URL A;  1H73 A;  2BM1 A;  4GKJ I;  4DV0 I;  1N34 E;  5BR8 E;  4DV7 E;  4X64 I;  1PIE A;  2GQ0 A;  3OTO I;  1Z0C A;  3HJC A;  3GON A;  2O1U A;  1N33 E;  1H7S A;  4NXM I;  2UUB I;  5A2Q Q;  1IBK I;  4FN5 A;  4X66 I;  4IZJ D;  4WUD A;  4DV1 E;  3QT7 A;  3HUL A;  1IBM E;  1USV A;  1EA6 A;  1S16 A;  3K85 A;  1HNZ I;  1ZM3 A;  1ZM9 A;  2AJ4 A;  3D4J A;  3K1J A;  3ZZT A;  4JV5 I;  1MX0 A;  1K47 A;  2ZBK B;  2UXB I;  4JI1 E;  4JYA E;  4LF6 I;  4PRV A;  4YY3 E;  1D6T A;  1Y6Z A;  1HNW E;  4LFB E;  2VQE E;  2LJP A;  4ED4 A;  4LF4 I;  4UTG A;  4DV6 E;  4JI3 E;  3JAM C;  4JG4 A;  1NHH A;  5IWA I;  1HNX I;  4B3S E;  2WW4 A;  4DR3 E;  4WUB A;  2X36 A;  4X62 E;  4Z7Y A;  1J5E I;  1ZXN A;  1Z0B A;  3J81 Q;  2Z5C A;  2Z5E A;  4B3T E;  5LMU I;  4JI4 I;  1WUU A;  2V8P A;  4IZK B;  1N32 I;  4PU9 A;  4LF7 E;  4PRX A;  4FWH A;  1KTV A;  1FJG E;  2CG9 A;  3WU4 A;  4OX9 E;  1UEK A;  2HHH E;  1RRE A;  2Z5B B;  1N36 I;  3J7A G;  4JI2 E;  2UXD E;  2CZ9 A;  4LFC I;  4USK A;  1XMQ E;  4DR4 I;  4FWD A;  3J80 C;  4AQY I;  2V2Z A;  4IZJ A;  4X65 I;  4DUZ E;  2PNL A;  1XMO I;  4RPF A;  4DR6 I;  2XEX A;  4JI5 E;  1Z0G A;  1KVK A;  2UUC E;  4DV2 E;  2HK3 A;  1XNQ E;  1Z59 A;  2EFG A;  3PYE A;  4DR2 E;  4FW9 A;  1N34 I;  5BR8 I;  4DV7 I;  5GMD A;  2CGE A;  2F4V E;  1Z5A A;  5FLX Q;  4LF9 E;  3ZKB A;  3ZM7 A;  4JI6 E;  4XTJ A;  1N33 I;  4DV3 E;  3PRY A;  1OJ4 A;  4USM A;  4B3R E;  4HAC A;  2PNM A;  3Q1Q A;  4DV1 I;  4JI0 E;  2VQF E;  4WUC A;  4LFA E;  1XNR E;  1U2R A;  1Z0W A;  1Y4S A;  1FKA E;  1IBM I;  2ZIT A;  1FWL A;  4JI8 E;  2HFU A;  1Z5B A;  1I94 E;  3T1H E;  4M1K A;  2VF3 A;  1VIS A;  5LMN E;  4ZVI A;  4DPU A;  1FWK A;  4JYA I;  2Z5C B;  1Z0T A;  4YY3 I;  4GKK E;  3Q6N A;  2GS8 A;  1HNW I;  4HYM A;  4LFB I;  1NZ0 A;  2VQE I;  4P52 A;  4DR1 E;  4DV6 I;  5A2Q C;  2UXC E;  4FWG A;  4JI3 I;  4B3S I;  2UU9 E;  1HR0 E;  4DR3 I;  4JI7 E;  4HXZ A;  4DR5 E;  2J7K A;  3QT8 A;  4X62 I;  2IOP A;  3LNU A;  2E5L E;  2DEI A;  4KQV A;  5GME A;  1ZXM A;  4DU7 A;  4KHP E;  4B3T I;  4MYT A;  1FNM A;  2A2D A;  4NXN E;  4R1F A;  3PYF A;  2HKE A;  3WU3 A;  2DEJ A;  4LF7 I;  2V2V A;  1FJG I;  3LTO A;  1BKN A;  2BV3 A;  2ZM6 E;  4OX9 I;  4I3H A;  4N3O A;  2X7I A;  3QT5 A;  4DPW A;  2HHH I;  1QZR A;  4JI2 I;  2UXD I;  4LF5 E;  2UUA E;  3T1Y E;  1EI1 A;  4DV4 E;  5IT9 C;  2OI2 A;  1NHJ A;  2R42 A;  3F0N A;  4DUZ I;  3J7A M;  3WU5 A;  2O1T A;  3J81 C;  4LF8 E;  4HAC B;  1B62 A;  1XNR I;  4JI5 I;  4Z7C A;  2UUC I;  3QT6 A;  4DPY A;  1XNQ I;  4DV5 E;  4DR2 I;  4DUY E;  1IBL E;  1PKP A;  3B82 A;  4YHH E;  2F4V I;  2HK2 A;  4DR7 E;  4K0K E;  4LF9 I;  3K17 A;  5FWK A;  3PYG A;  2NPF A;  4JI6 I;  4B3M E;  4DV3 I;  2IOQ A;  3LPS A;  4B3R I;  2Z5B A;  4GKJ E;  4DV0 E;  3CWV A;  2Q2E B;  1Z5C A;  3V2U C;  3V5R A;  3ZZU A;  4JI0 I;  3ZZ0 A;  2VQF I;  4LFA I;  4X64 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...