5A2QC

Structure of the hcv ires bound to the human ribosome
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
EWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5a2qC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5a2qC02
2LJPA 2UU9E 1H72C 3Q1QA 4DUYI 5IWAE 1FWKA 1FKAE 4B3SI 4FN5A 1I94E 4HXZA 4GKKE 4KHPI 2VQFI 2HHHE 2V34A 2HKJA 4WUDA 3WU5A 4YHHI 4LFAE 2OI2A 4JV5E 1N36E 4B3MI 4MYUA 1XMQE 2F4VI 4JI8E 1XMOI 1N0VC 4PU9A 3OTOI 3WU3A 1MU5A 3JAMQ 4JI6E 4USKA 2R42A 1N33E 4DUZE 5A2QC 4DV4I 3J80C 2A2DA 1A6FA 2X36A 3QT6A 3LTOA 2UXCI 1IBME 4DR6I 4JI7E 4WUBA 2A2CA 2ZM6I 4P7AA 3PYEA 1H7SA 4LF7I 2XEXA 2HK3A 4JI1I 4USMA 4B3TE 1RR9A 4PRVA 2BM0A 3PYGA 2UXDE 3LPSA 4NXME 1ZM2A 4DR7I 4LF4I 2HKEA 4DV0I 4LF5I 4LF6I 4DXLA 4WUCA 4DR5I 4NXNE 1J5EE 4OX9I 4DR1I 4X64E 4UTGA 4UT4A 2Q2EB 4DV2I 2VQEI 2R3VA 3PYFA 2E5LE 4JI2I 4X66I 1RREA 4JI0I 3F0NA 4HACA 4DV5E 2V2ZA 5FLXQ 2UUBE 2VF3A 1HNZI 3K17A 5LMUI 2UXBI 1ZM4A 3T1HE 3J7AG 4JI4E 4JG4A 2ZBKB 4R1FA 1FWLA 3B82A 3QT7A 1XNQE 4MYTA 4Z7CA 2UUCI 4DV6E 1N34E 4JYAI 3JAMC 3ZKDA 2V2QA 4LF8I 1Z0EA 1N0UA 4DR4I 2ZITA 1XNRI 1OJ4A 5LMNI 4GKJE 4ZVIA 1XHKA 4B3RI 4HACB 3V5RA 4JI5E 4XTJA 2UU9I 5LL6R 5GMEA 1FI4A 1U2RA 5IWAI 4DR2E 2HFSA 4DV7E 1FJGE 1UEKA 5BR8E 1I94I 3M6AA 4DPYA 4GKKI 5GMDA 1B63A 2HHHI 1WUUA 1HNWE 4LFAI 1Z5AA 3ZM7A 1N36I 4JV5I 1Z0WA 4LFBE 2V2VA 4KQVA 1XMQI 1EA6A 1H7UA 1IBKE 1Z5CA 4JI8I 5FLXC 1KTVA 1Z0GA 1N32E 4M1KA 4EMDA 4JI6I 3J7AM 2UUAE 4AQYE 1N33I 2HFUA 4DUZI 1IBLE 2EFGA 1FNMA 1ZM3A 4HY1A 1IBMI 4JI3E 4JI7I 1NHHA 4LFCE 1EI1A 4X62E 1H74A 4B3TI 1NZ0A 2DEIA 2UXDI 4NXMI 3ZZTA 4P52A 4X65E 1D6TA 4DV1E 1S16A 1HR0E 2BV3A 3CWVA 4NXNI 4FWDA 1J5EI 4K0KE 4X64I 3T1YE 3B8HA 4YY3E 3ZZ0A 1Z0BA 4URLA 4DR3E 4DV3E 2NPFA 2E5LI 3J81C 1Z5BA 1KKHA 1VISA 4DV5I 4DUYE 2UUBI 2DEJA 4B3SE 4LF9E 4ED4A 3T1HI 1PIEA 4KHPE 2VQFE 5IT9Q 4JI4I 4YHHE 1XNQI 3B78A 4B3ME 2F4VE 1Z0CA 4DU8A 1KVKA 1ZXNA 3GONA 4DV6I 1DARA 1N34I 2AJ4A 2J7KA 1XMOE 3OTOE 3J81Q 4I3HA 4LF9I 1Z0VA 3LNUA 4DV4E 1BKNA 1ZM9A 2UXCE 3ZZUA 4DR6E 4GKJI 1PVGA 4RPFA 2GS8A 4DPWA 2ZM6E 4JI5I 2E1RA 4LF7E 4JI1E 1K47A 1B62A 4PRXA 3QT8A 2HK2A 4DR7E 1NHIA 4LF4E 4DR2I 4Z7YA 4DV0E 4LF5E 3H4LA 4LF6E 4DR5E 4DV7I 3ZKBA 1FJGI 5BR8I 4OX9E 2CZ9A 4DR1E 3HULA 1Z0TA 2WW4A 1ELOA 1KIJA 1HNWI 4DV2E 2VQEE 5L3JA 4LFBI 1Z59A 4JI2E 4HYMA 3QT5A 3K1JA 1MG7A 1IBKI 4X66E 4JI0E 1HNXE 1N32I 1MX0A 1QZRA 1HNZE 2UUAI 4AQYI 1IBLI 5IT9C 5LMUE 2UXBE 5A2QQ 3J80Q 4JI3I 4LFCI 4FWHA 4X62I 4DPUA 4DPXA 4FW9A 4DPTA 2UUCE 4FWGA 4DU7A 3PYDA 4JYAE 1HNXI 4LF8E 2V8PA 1ZXMA 1H73A 4X65I 2X7IA 1PKPA 4DV1I 4DR4E 3WU4A 1S4EA 2BM1A 1HR0I 1XNRE 1NHJA 3WU6A 4K0KI 5LMNE 3T1YI 4YY3I 4B3RE 4DR3I 3D4JA 4DV3I 3V2UC
chains in the Genus database with same CATH superfamily
1DQ3A 1YFHA 1NEIA 2CPNA 1ZR9A 4P7DA 2LJPA 1RMDA 1YYWA 5DRQA 5JEAC 2UU9E 4MQYA 4F2JC 3P3CA 2RQLA 4O5GA 3P1XA 1H72C 2JVAA 4DUYI 3Q1QA 5IWAE 1WJPA 4P78A 5DNLA 1FWKA 3HXLA 4M0VA 1LLMC 2EM2A 1JK1A 1FKAE 3RMPA 1Y6ZA 2Z5CB 4B3SI 2CSHA 2MDRA 2PNMA 3C6KA 1IMUA 1L4SA 5DNYA 2BA1G 1I94E 4FN5A 3P06A 3CDIA 4GQUA 4GKKE 2H36X 4HXZA 1YUJA 4KHPI 2VQFI 5KL3A 2HHHE 2HC5A 2V34A 5TSEA 2HKJA 2NN6B 2Q8UA 4WUDA 2EN7A 3WU5A 2CGEA 3M99B 3L7ZA 4YHHI 4LFAE 5K36C 2OI2A 1WRJA 1JK2A 5CFFE 1X6EA 1N36E 4JV5E 2EOYA 1X6HA 2EPUA 2YRKA 1XMQE 4MYUA 4B3MI 2FGGA 2F4VI 3JTZA 4IFDB 1UDNA 4BA1A 2CG9A 4JI8E 4OO1C 1X3CA 2WNRA 2EPKX 2IOQA 2LRSA 4R2SA 1XMOI 2DLQA 2NABA 1N0VC 3KRNA 4L5NC 4PU9A 3OTOI 3IWCA 4MU1A 1T4NA 3EPHA 2PRTA 3WU3A 1MU5A 3JAMQ 4J8ZA 4JI6E 1VI7A 4IZKA 2EMWA 4IS1C 4USKA 5AE3A 5JEAF 2EOOA 2LCEA 2WCC3 1N33E 2R42A 4DUZE 5A2QC 1RHYA 2JWOA 1UHZA 4DV4I 4IFDD 3J80C 2A2DA 1A6FA 2X36A 1T4LB 3QT6A 4O4KA 2EPZA 3LTOA 2UXCI 1BB8A 1WXRA 1IBME 4N4RB 2LUQA 4DR6I 3ADJA 4HTGA 4JI7E 1YSAC 1BBOA 2JE6A 2A2CA 3K85A 4WUBA 3K6QA 1J26A 2ZM6I 1USUA 1KYQA 1STUA 2EPAA 4P7AA 1RQ0A 2J7JA 3PYEA 1H7SA 3U1KA 4LF7I 2EMKA 2EOZA 4ZYDA 2WBUA 2HK3A 2XEXA 4NBQA 4LCFA 3GLLA 4JI1I 4B3TE 4USMA 4BHCA 1RR9A 4PRVA 2BM0A 3PYGA 1IQOA 2EOSA 3F6GA 2UXDE 4DKKA 2EN3A 4NXME 1OYPA 4IJDA 1ZM2A 3LPSA 2B9DA 4DR7I 4LF4I 5JEAA 2HKEA 4DV0I 2AE8A 2MC5A 2LBSB 4LF5I 4OO1F 4AIMA 5JEAE 2EOXA 4HEIA 3L7ZB 4DXLA 4LF6I 4WUCA 3MHHC 4DR5I 1T39A 3F6HA 2R1FA 5AC4A 5IXMB 4NXNE 4M9VC 1J5EE 4OX9I 4DR1I 4X64E 4UTGA 4BA1B 4UT4A 2Q2EB 1NCSA 1ZU1A 4QNJA 2NA2A 3BGHA 3H1CA 4DV2I 2VQEI 2R3VA 2JPAA 1Y4SA 2DRPA 3PYFA 2E5LE 2O1WA 4IZKB 4JI2I 4I8OA 5K36A 2V8QB 2EM0A 2ENAA 4X66I 2EM8A 5K36E 2PNZB 5KL4A 1T38A 1RREA 2GHFA 3F0NA 4JI0I 4DV5E 4HACA 4WSGA 2NN6A 2V2ZA 3C6MA 2DLKA 2UUBE 5FLXQ 2VF3A 2EN1A 2JOBA 1HNZI 3DF6A 4MU4A 4OO1E 2JE6B 3K17A 2EJ4A 5LMUI 2UXBI 1ZM4A 1EH8A 3T1HE 2RSIA 5A6BA 2E1MA 3HPSA 1A1FA 3J7AG 5DNXA 4JI4E 2BA0G 1EH6A 2BA1D 4JG4A 4U3DA 2ZBKB 2PO2A 3AV0A 4R1FA 1FWLA 3B82A 2EQ1A 3QT7A 1O0WA 2JR1A 3LMLA 5JEAB 4FK5C 1XNQE 2LV2A 5KL2A 4R2AA 4FW4A 4MYTA 4Z7CA 1X47A 2UUCI 4DV6E 2EM6A 1N34E 4JYAI 4BS9A 2EORA 3JAMC 2WBSA 4KZSA 3ZKDA 2V2QA 1ZBTA 4LF8I 5F3WA 1Z0EA 2PNLA 1X49A 2HGHA 2EOHA 2YTJA 2CT1A 4LPFA 1TF3A 1N0UA 1GQEA 4R03A 1EKZA 2EOQA 5JEAD 2LJHA 5LLQA 4DR4I 2JXPA 1YYOA 2Z5BA 2YTFA 2ZITA 4BMJA 2EP3A 1XNRI 2M9AA 2C37A 2GQ0A 5DRRA 2LUPB 5K36B 1X5WA 3KWRA 4GKJE 3KZZA 1OJ4A 5LMNI 1WHQA 2ELYA 4ZVIA 5T6JA 2VF1A 2ADRA 1XHKA 4B3RI 4HACB 3BIDA 3V5RA 4JI5E 4OO1B 2FTXB 5KL7A 4XTJA 1AAYA 2EWLA 2EM7A 4R2EA 4LU9A 5KL5A 2EN6A 4WXCA 2BR2A 5IV8B 4J3DA 2EMAA 2JY9A 2UU9I 4R2DA 5K36D 2M1SA 4FW3A 2K4VA 1SR9A 3FIGA 5LL6R 3ZOQB 4DR2E 2L3JA 3C4BA 1FI4A 1U2RA 1PDAA 2DIXA 4DMIA 3B4TA 2HFSA 5IWAI 2NN6D 4BCAA 2EMYA 2ENCA 4DV7E 1FJGE 2PO2B 1UEKA 2WP8A 3IWDA 5BR8E 1I94I 3M6AA 2EOEA 5ELWA 4DPYA 4GKKI 2JP9A 2JEAA 4FW5A 5GMDA 2PNZA 1B63A 1UN6B 3ADLA 2HHHI 5DROA 1A1GA 3DD6A 1WUUA 1PJSA 2L33A 5A6BD 4M30A 3UHMA 1HNWE 4LFAI 1Z5AA 4TUGA 3ZM7A 4MU0A 4LFBE 1Z0WA 1N36I 4JV5I 2EN4A 2MDGA 2V2VA 4KQVA 2EM4A 1EA6A 4R2CA 3HKMA 1XMQI 2RTXA 1H7UA 1AH5A 2EM9A 2EOJA 1IBKE 1Z5CA 3HTXA 4JI8I 2Z5BB 5FLXC 3P76A 2VRDA 3DJWA 3TQMA 2EMFA 1MGTA 3ADIA 1KTVA 2C37B 1Z0GA 5AE2A 1N32E 2IHR1 1KJKA 3BBGA 4M1KA 4EMDA 4JI6I 3J7Yp 3J7AM 2UUAE 2EM5A 1X6FA 4LTYA 4AQYE 1N33I 3EPLA 2HFUA 2YTPA 4DUZI 1IBLE 4AM3A 4WYQB 2EFGA 2JEBA 2EQ3A 2DGCA 1GZ6A 4ZYGA 1FNMA 2BB8A 2L6MA 2BR2B 1ZM3A 2CTDA 2LMZA 4HY1A 1IBMI 4JI3E 4MU3A 2IESA 4JI7I 2E72A 1NHHA 4LFCE 2YPNA 2YTIA 1EI1A 2EN2A 4X62E 2EPNA 2YTNA 3EPKA 4MLVA 2R76A 2ODRC 1H74A 2BA0D 1IQSA 4B3TI 1NZ0A 2WP8B 2DEIA 2KONA 2O1VA 3Q6NA 4NXMI 4WX9A 2JEAB 2UXDI 3THNA 2DB2A 3ZZTA 4X65E 3VYYA 4P52A 3M85D 3KZYA 1D6TA 4DV1E 2EPCA 2G7HA 2I9IA 1S16A 2YTQA 2I13A 1A1JA 1YYKA 4OO1A 5C0XC 2YTEA 1HR0E 2CVEA 2EPXA 4AIDA 1YPNA 2BV3A 3CWVA 4BA2A 4NXNI 4K0KE 4FWDA 1T4OA 1J5EI 4X64I 3T1YE 1YHCA 3B8HA 4YY3E 4BHBA 5A69A 2V87A 4F54A 2EPLX 4MLQA 4WPYA 4DR3E 5A6JA 1Z0BA 3BF2A 2IOPA 3ZZ0A 4NHRA 4DV3E 4URLA 2PO0A 4O43A 4R2PA 2NPFA 2E5LI 3THOB 4BC9A 4X9JA 3J81C 2MKDA 1Z5BA 1KKHA 3CDJA 2EL5A 3GMEA 4U3BA 3JU0A 5AC5A 2JEBB 3M85G 4BBYA 2LE2A 1VISA 2GO3A 2O3ZA 4DV5I 3EPJA 4X8WA 4DUYE 2DMIA 2EE8A 3PS1A 2EPMX 4F9CB 1A1HA 2UUBI 2C38A 2DEJA 1E3HA 2VESA 2LVHA 2EOIA 5AE1A 4B3SE 4LF9E 1BBGA 1Y4UA 2L3CA 4F9AB 1Y60A 3ADGA 4ED4A 3T1HI 4ISAA 1PIEA 4KHPE 2VQFE 5IT9Q 3AUZA 5C0XF 2EOMA 2VE7C 3PS3A 2YTDA 4JI4I 3GCMA 4YHHE 1QU6A 4WFTA 2J65A 1P42A 1XNQI 2WBTA 4F6MA 2RS7A 3B78A 2EMHA 2EMBA 3OMLA 1B69A 4B3ME 2F4VE 1Z0CA 1N3GA 2C39A 4DU8A 1KVKA 1G2FC 1USVA 1ZXNA 3GONA 1DARA 4DV6I 1N34I 4Q35B 2AJ4A 3MSWA 1DI2A 2J7KA 3M7ND 1XMOE 4BA2B 2YSPA 2IERA 4OOGC 3OTOE 2PO1A 1RC7A 1PJTA 3J81Q 2B7TA 2KHXA 4I3HA 4LF9I 1DGCA 4O24A 4WSPA 1MEYC 1E3PA 4KWYA 1Z0VA 3LNUA 2YU8A 2EM3A 4DV4E 2LTSA 4ZYEA 3P3GA 4OO1D 1BKNA 1ZM9A 2PO0B 5C0XA 4OZEA 2UXCE 3P3EA 3ZZUA 4DR6E 4GKJI 1YZ9A 5C0XE 1PVGA 4L8NA 2NUEA 2L8TA 5A6KA 4RPFA 2GS8A 4DPWA 4LCHA 2EN8A 2ZM6E 4JI5I 1PJQA 2JYAA 2YTOA 4BC7A 2EMXA 2C38B 1Y5YA 2NN6C 1UDOA 2E1RA 2N3GA 3C4TA 4LF7E 3M7NG 2GPIA 2V88A 3PS2A 4GEQB 4JI1E 3ECRA 1K47A 1B62A 4QNKA 2JOXA 2NUGA 4NZVA 4PRXA 4WXDA 2LJUA 3QT8A 2HK2A 4IFDC 2K7IA 2EMIA 2M7QA 1X48A 4DR7E 4LF4E 1NHIA 4DR2I 2O1TA 3LLHA 4Z7YA 2O1UA 4R8OA 3PRYA 4DV0E 1OYSA 2YU5A 3EQ1A 4LF5E 2V89A 1OYRA 3H4LA 4LF6E 1SFEA 4DR5E 1R6MA 3ZKBA 4DV7I 1FJGI 3HJCA 2HJJA 4FW7A 4MDTA 3U1YA 1P47A 5BR8I 2C39B 4OX9E 5GMEA 2CZ9A 1WHNA 4DR1E 3HULA 2MC6A 2GO4A 1Z0TA 4M2ZA 2WW4A 4RHBB 2MKNA 4IZJA 1ELOA 1KIJA 2EPRA 1HNWI 2YZTA 2EL4A 5AASA 2VQEE 4DV2E 5L3JA 2PO1B 4LFBI 3H09A 1Z59A 4JI2E 2V85A 2WZOA 2RS6A 3QT5A 4HYMA 5K36F 3K1JA 4FW6A 4N3OA 2YWQA 2RPCA 2L92A 1MG7A 1IBKI 4X66E 3Q6MA 2GLIA 1UILA 4OKGA 1EH7A 3VYXA 4JI0E 2YRMA 2NN6F 5C0XB 2YTGA 1HNXE 3VK6A 3HPZA 2LO3A 5DRPA 5ADZA 1N32I 5FWKA 1MX0A 1HNZE 1QZRA 2L2NA 2ODRD 1YH8A 2Z5EA 3NZKA 4AQYI 2UUAI 2ELZA 1G2DC 2FV4B 4R2RA 3L00A 1IBLI 4IFDF 2YRHA 2EZ6A 4F6NA 5IT9C 2F8BA 3HQ1A 1UDSA 5LMUE 2UXBE 5A2QQ 2BBGA 2WNRB 3IWBA 2B7VA 2YSOA 4LOMA 3J80Q 4IS9A 2EMZA 5C0XD 2A25A 4JI3I 4RH8A 4Q28A 2EQ0A 2EPPA 5EKWA 2Z5CA 1TN9A 4LFCI 3MHSC 4FWHA 4X62I 2N3HA 4DPUA 2RSMA 1A1LA 4FW9A 5EL9A 4DPXA 4DPTA 1A1KA 2F1DA 2V86A 2ENHA 2UUCE 5KL6A 2EMCA 4ZYHA 4FWGA 4JYAE 2JT2A 3PYDA 1HK7A 4DU7A 1HNXI 2DSYA 4LF8E 1F2IG 2V8PA 2NN6E 1ZXMA 3QG5C 4GZNC 1H73A 4X65I 1A1IA 2X7IA 1YUIA 1UDQA 1PKPA 1ZAAC 4IZJB 4DV1I 1R6LA 4IFDA 4DR4E 4TUIA 1S4EA 2D9HA 2BM1A 2DMYA 3WU4A 1HR0I 4R2QA 2YT4A 4IFDE 2LTRA 2L2MA 2EL6A 1XNRE 2L2KB 1NHJA 1QNTA 2V83A 2N8XA 2M4IA 2EMGA 1ZBQA 5A6AA 3WU6A 4K0KI 1Z1BA 2EMLA 5LMNE 1XXEA 3VHTB 3T1YI 2EOFA 3UK3C 1GTKA 1TF6A 2EPOA 4YY3I 4B3RE 4F9BB 2B3TB 2KOUA 2NUFA 2LT7A 4LCGA 1UBDC 4IZJD 4DR3I 3D4JA 4DV3I 3V2UC
chains in the Genus database with same CATH topology
1DQ3A 2CPNA 4P7DA 2LJPA 1YYWA 2UU9E 3P1XA 1H72C 2JVAA 4DUYI 3Q1QA 5IWAE 4P78A 1FWKA 3HXLA 4M0VA 1FKAE 3RMPA 1Y6ZA 2Z5CB 4B3SI 2MDRA 2PNMA 5DNYA 1I94E 4FN5A 3P06A 4GKKE 2H36X 4HXZA 4KHPI 2VQFI 2HHHE 2V34A 2HKJA 4WUDA 3WU5A 2CGEA 4YHHI 4LFAE 2OI2A 5CFFE 4JV5E 1N36E 4B3MI 1XMQE 4MYUA 2FGGA 2F4VI 3JTZA 2CG9A 4JI8E 2IOQA 2LRSA 1XMOI 1N0VC 4PU9A 4L5NC 3OTOI 3IWCA 3WU3A 1T4NA 1MU5A 3JAMQ 4J8ZA 4JI6E 4IZKA 4USKA 5AE3A 1N33E 2R42A 4DUZE 5A2QC 2JWOA 1UHZA 4DV4I 3J80C 2A2DA 1A6FA 2X36A 1T4LB 3QT6A 3LTOA 2UXCI 1WXRA 1IBME 2LUQA 4DR6I 3ADJA 4JI7E 4WUBA 2A2CA 3K85A 3K6QA 1J26A 2ZM6I 1USUA 1STUA 4P7AA 1RQ0A 3PYEA 1H7SA 4LF7I 2XEXA 2HK3A 4JI1I 4B3TE 4USMA 1RR9A 4PRVA 2BM0A 3PYGA 3F6GA 2UXDE 4DKKA 4NXME 3LPSA 1ZM2A 2B9DA 4DR7I 4LF4I 2HKEA 4DV0I 2MC5A 2LBSB 4LF5I 4LF6I 4DXLA 4WUCA 4DR5I 3F6HA 4NXNE 1J5EE 4OX9I 4DR1I 4X64E 4UTGA 4UT4A 2Q2EB 2NA2A 4DV2I 2VQEI 2R3VA 1Y4SA 3PYFA 2E5LE 2O1WA 4IZKB 4JI2I 4I8OA 2V8QB 4X66I 1RREA 4JI0I 3F0NA 4DV5E 4HACA 2V2ZA 2UUBE 5FLXQ 2VF3A 2JOBA 1HNZI 3DF6A 3K17A 5LMUI 2UXBI 1ZM4A 3T1HE 2E1MA 3HPSA 3J7AG 4JI4E 4JG4A 2ZBKB 4R1FA 3AV0A 1FWLA 3B82A 3QT7A 1O0WA 2JR1A 3LMLA 1XNQE 4MYTA 4Z7CA 1X47A 2UUCI 4DV6E 1N34E 4JYAI 4BS9A 3JAMC 4KZSA 3ZKDA 2V2QA 1ZBTA 4LF8I 5F3WA 1Z0EA 2PNLA 1X49A 1N0UA 1GQEA 4R03A 1EKZA 4DR4I 2LJHA 1YYOA 2Z5BA 2ZITA 4BMJA 1XNRI 2GQ0A 2LUPB 3KWRA 4GKJE 1OJ4A 5LMNI 1WHQA 4ZVIA 5T6JA 2VF1A 1XHKA 4B3RI 4HACB 3V5RA 4JI5E 2FTXB 4XTJA 2EWLA 4LU9A 2JY9A 2UU9I 2M1SA 2K4VA 1SR9A 3FIGA 5LL6R 3ZOQB 4DR2E 2L3JA 3C4BA 1FI4A 1U2RA 2DIXA 5GMEA 4DMIA 5IWAI 2HFSA 4BCAA 4DV7E 1FJGE 1UEKA 3IWDA 5BR8E 1I94I 3M6AA 4DPYA 4GKKI 5GMDA 1B63A 3ADLA 2HHHI 1WUUA 2L33A 4M30A 1HNWE 4LFAI 1Z5AA 4TUGA 3ZM7A 1N36I 4LFBE 1Z0WA 4JV5I 2V2VA 4KQVA 1XMQI 1EA6A 2RTXA 1H7UA 1IBKE 1Z5CA 3HTXA 4JI8I 2Z5BB 5FLXC 3DJWA 3ADIA 1KTVA 1Z0GA 5AE2A 1N32E 2IHR1 4M1KA 4EMDA 4JI6I 3J7Yp 3J7AM 2UUAE 4LTYA 4AQYE 1N33I 2HFUA 4DUZI 1IBLE 4WYQB 2EFGA 1GZ6A 1FNMA 2L6MA 1ZM3A 2LMZA 4HY1A 1IBMI 4JI3E 4JI7I 1NHHA 4LFCE 1EI1A 4X62E 2ODRC 1H74A 4B3TI 1NZ0A 2DEIA 2KONA 2O1VA 3Q6NA 4NXMI 2UXDI 3ZZTA 2DB2A 4X65E 3VYYA 4P52A 1D6TA 4DV1E 2G7HA 1S16A 1YYKA 1HR0E 2BV3A 3CWVA 4NXNI 4K0KE 4FWDA 1T4OA 1J5EI 4X64I 3T1YE 3B8HA 4YY3E 2V87A 4F54A 4WPYA 4DR3E 1Z0BA 2IOPA 3ZZ0A 4URLA 4DV3E 2NPFA 2E5LI 4BC9A 3J81C 1Z5BA 1KKHA 3JU0A 4BBYA 2LE2A 1VISA 4DV5I 4X8WA 4DUYE 4F9CB 2UUBI 2DEJA 5AE1A 4B3SE 4LF9E 1Y4UA 2L3CA 4F9AB 3ADGA 4ED4A 3T1HI 1PIEA 4KHPE 2VQFE 5IT9Q 3AUZA 2VE7C 4JI4I 4YHHE 1QU6A 4WFTA 1XNQI 2RS7A 3B78A 3OMLA 4B3ME 2F4VE 1Z0CA 4DU8A 1KVKA 1USVA 1ZXNA 3GONA 4DV6I 1DARA 1N34I 2AJ4A 3MSWA 1DI2A 2J7KA 1XMOE 4OOGC 3OTOE 1RC7A 3J81Q 2B7TA 2KHXA 4I3HA 4LF9I 4WSPA 1Z0VA 3LNUA 4DV4E 2LTSA 1BKNA 1ZM9A 2UXCE 3ZZUA 4DR6E 4GKJI 1YZ9A 1PVGA 2NUEA 4L8NA 2L8TA 4RPFA 2GS8A 4DPWA 2ZM6E 4JI5I 4BC7A 2E1RA 2N3GA 3C4TA 4LF7E 2V88A 4GEQB 4JI1E 1K47A 1B62A 2JOXA 2NUGA 4PRXA 3QT8A 2HK2A 2M7QA 1X48A 4DR7E 4LF4E 1NHIA 4DR2I 2O1TA 3LLHA 4Z7YA 2O1UA 4R8OA 3PRYA 4DV0E 4LF5E 2V89A 3H4LA 4LF6E 4DR5E 4DV7I 3ZKBA 1FJGI 3HJCA 5BR8I 4OX9E 2CZ9A 1WHNA 4DR1E 3HULA 2MC6A 1Z0TA 4M2ZA 2WW4A 4IZJA 1ELOA 1KIJA 1HNWI 2YZTA 5AASA 2VQEE 4DV2E 5L3JA 4LFBI 3H09A 1Z59A 4JI2E 2V85A 2WZOA 2RS6A 3QT5A 4HYMA 3K1JA 4N3OA 2L92A 1MG7A 1IBKI 4X66E 3Q6MA 1UILA 3VYXA 4JI0E 1HNXE 3VK6A 3HPZA 1N32I 5ADZA 5FWKA 1MX0A 1HNZE 1QZRA 2ODRD 2L2NA 2Z5EA 2UUAI 4AQYI 2FV4B 1IBLI 2EZ6A 5IT9C 2F8BA 3HQ1A 5LMUE 2UXBE 5A2QQ 3IWBA 2B7VA 3J80Q 4JI3I 4Q28A 4LFCI 2Z5CA 4FWHA 4X62I 2N3HA 4DPUA 2RSMA 4DPXA 4FW9A 4DPTA 2V86A 2UUCE 4FWGA 4DU7A 4JYAE 3PYDA 1HK7A 1HNXI 2DSYA 4LF8E 2V8PA 1ZXMA 1H73A 4X65I 2X7IA 1PKPA 4IZJB 4DV1I 4DR4E 4TUIA 1S4EA 2BM1A 3WU4A 2DMYA 1HR0I 2YT4A 2LTRA 2L2MA 1XNRE 2L2KB 1NHJA 2V83A 2M4IA 3WU6A 1ZBQA 4K0KI 5LMNE 3T1YI 4YY3I 4B3RE 4F9BB 2B3TB 2KOUA 2NUFA 4IZJD 4DR3I 3D4JA 4DV3I 3V2UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJP A;  2UU9 E;  1H72 C;  3Q1Q A;  4DUY I;  5IWA E;  1FWK A;  1FKA E;  4B3S I;  4FN5 A;  1I94 E;  4HXZ A;  4GKK E;  4KHP I;  2VQF I;  2HHH E;  2V34 A;  2HKJ A;  4WUD A;  3WU5 A;  4YHH I;  4LFA E;  2OI2 A;  4JV5 E;  1N36 E;  4B3M I;  4MYU A;  1XMQ E;  2F4V I;  4JI8 E;  1XMO I;  1N0V C;  4PU9 A;  3OTO I;  3WU3 A;  1MU5 A;  3JAM Q;  4JI6 E;  4USK A;  2R42 A;  1N33 E;  4DUZ E;  5A2Q C;  4DV4 I;  3J80 C;  2A2D A;  1A6F A;  2X36 A;  3QT6 A;  3LTO A;  2UXC I;  1IBM E;  4DR6 I;  4JI7 E;  4WUB A;  2A2C A;  2ZM6 I;  4P7A A;  3PYE A;  1H7S A;  4LF7 I;  2XEX A;  2HK3 A;  4JI1 I;  4USM A;  4B3T E;  1RR9 A;  4PRV A;  2BM0 A;  3PYG A;  2UXD E;  3LPS A;  4NXM E;  1ZM2 A;  4DR7 I;  4LF4 I;  2HKE A;  4DV0 I;  4LF5 I;  4LF6 I;  4DXL A;  4WUC A;  4DR5 I;  4NXN E;  1J5E E;  4OX9 I;  4DR1 I;  4X64 E;  4UTG A;  4UT4 A;  2Q2E B;  4DV2 I;  2VQE I;  2R3V A;  3PYF A;  2E5L E;  4JI2 I;  4X66 I;  1RRE A;  4JI0 I;  3F0N A;  4HAC A;  4DV5 E;  2V2Z A;  5FLX Q;  2UUB E;  2VF3 A;  1HNZ I;  3K17 A;  5LMU I;  2UXB I;  1ZM4 A;  3T1H E;  3J7A G;  4JI4 E;  4JG4 A;  2ZBK B;  4R1F A;  1FWL A;  3B82 A;  3QT7 A;  1XNQ E;  4MYT A;  4Z7C A;  2UUC I;  4DV6 E;  1N34 E;  4JYA I;  3JAM C;  3ZKD A;  2V2Q A;  4LF8 I;  1Z0E A;  1N0U A;  4DR4 I;  2ZIT A;  1XNR I;  1OJ4 A;  5LMN I;  4GKJ E;  4ZVI A;  1XHK A;  4B3R I;  4HAC B;  3V5R A;  4JI5 E;  4XTJ A;  2UU9 I;  5LL6 R;  5GME A;  1FI4 A;  1U2R A;  5IWA I;  4DR2 E;  2HFS A;  4DV7 E;  1FJG E;  1UEK A;  5BR8 E;  1I94 I;  3M6A A;  4DPY A;  4GKK I;  5GMD A;  1B63 A;  2HHH I;  1WUU A;  1HNW E;  4LFA I;  1Z5A A;  3ZM7 A;  1N36 I;  4JV5 I;  1Z0W A;  4LFB E;  2V2V A;  4KQV A;  1XMQ I;  1EA6 A;  1H7U A;  1IBK E;  1Z5C A;  4JI8 I;  5FLX C;  1KTV A;  1Z0G A;  1N32 E;  4M1K A;  4EMD A;  4JI6 I;  3J7A M;  2UUA E;  4AQY E;  1N33 I;  2HFU A;  4DUZ I;  1IBL E;  2EFG A;  1FNM A;  1ZM3 A;  4HY1 A;  1IBM I;  4JI3 E;  4JI7 I;  1NHH A;  4LFC E;  1EI1 A;  4X62 E;  1H74 A;  4B3T I;  1NZ0 A;  2DEI A;  2UXD I;  4NXM I;  3ZZT A;  4P52 A;  4X65 E;  1D6T A;  4DV1 E;  1S16 A;  1HR0 E;  2BV3 A;  3CWV A;  4NXN I;  4FWD A;  1J5E I;  4K0K E;  4X64 I;  3T1Y E;  3B8H A;  4YY3 E;  3ZZ0 A;  1Z0B A;  4URL A;  4DR3 E;  4DV3 E;  2NPF A;  2E5L I;  3J81 C;  1Z5B A;  1KKH A;  1VIS A;  4DV5 I;  4DUY E;  2UUB I;  2DEJ A;  4B3S E;  4LF9 E;  4ED4 A;  3T1H I;  1PIE A;  4KHP E;  2VQF E;  5IT9 Q;  4JI4 I;  4YHH E;  1XNQ I;  3B78 A;  4B3M E;  2F4V E;  1Z0C A;  4DU8 A;  1KVK A;  1ZXN A;  3GON A;  4DV6 I;  1DAR A;  1N34 I;  2AJ4 A;  2J7K A;  1XMO E;  3OTO E;  3J81 Q;  4I3H A;  4LF9 I;  1Z0V A;  3LNU A;  4DV4 E;  1BKN A;  1ZM9 A;  2UXC E;  3ZZU A;  4DR6 E;  4GKJ I;  1PVG A;  4RPF A;  2GS8 A;  4DPW A;  2ZM6 E;  4JI5 I;  2E1R A;  4LF7 E;  4JI1 E;  1K47 A;  1B62 A;  4PRX A;  3QT8 A;  2HK2 A;  4DR7 E;  1NHI A;  4LF4 E;  4DR2 I;  4Z7Y A;  4DV0 E;  4LF5 E;  3H4L A;  4LF6 E;  4DR5 E;  4DV7 I;  3ZKB A;  1FJG I;  5BR8 I;  4OX9 E;  2CZ9 A;  4DR1 E;  3HUL A;  1Z0T A;  2WW4 A;  1ELO A;  1KIJ A;  1HNW I;  4DV2 E;  2VQE E;  5L3J A;  4LFB I;  1Z59 A;  4JI2 E;  4HYM A;  3QT5 A;  3K1J A;  1MG7 A;  1IBK I;  4X66 E;  4JI0 E;  1HNX E;  1N32 I;  1MX0 A;  1QZR A;  1HNZ E;  2UUA I;  4AQY I;  1IBL I;  5IT9 C;  5LMU E;  2UXB E;  5A2Q Q;  3J80 Q;  4JI3 I;  4LFC I;  4FWH A;  4X62 I;  4DPU A;  4DPX A;  4FW9 A;  4DPT A;  2UUC E;  4FWG A;  4DU7 A;  3PYD A;  4JYA E;  1HNX I;  4LF8 E;  2V8P A;  1ZXM A;  1H73 A;  4X65 I;  2X7I A;  1PKP A;  4DV1 I;  4DR4 E;  3WU4 A;  1S4E A;  2BM1 A;  1HR0 I;  1XNR E;  1NHJ A;  3WU6 A;  4K0K I;  5LMN E;  3T1Y I;  4YY3 I;  4B3R E;  4DR3 I;  3D4J A;  4DV3 I;  3V2U C; 
#chains in the Genus database with same CATH topology
 1DQ3 A;  1YFH A;  1NEI A;  2CPN A;  1ZR9 A;  4P7D A;  2LJP A;  1RMD A;  1YYW A;  5DRQ A;  5JEA C;  2UU9 E;  4MQY A;  4F2J C;  3P3C A;  2RQL A;  4O5G A;  3P1X A;  1H72 C;  2JVA A;  4DUY I;  3Q1Q A;  5IWA E;  1WJP A;  4P78 A;  5DNL A;  1FWK A;  3HXL A;  4M0V A;  1LLM C;  2EM2 A;  1JK1 A;  1FKA E;  3RMP A;  1Y6Z A;  2Z5C B;  4B3S I;  2CSH A;  2MDR A;  2PNM A;  3C6K A;  1IMU A;  1L4S A;  5DNY A;  2BA1 G;  1I94 E;  4FN5 A;  3P06 A;  3CDI A;  4GQU A;  4GKK E;  2H36 X;  4HXZ A;  1YUJ A;  4KHP I;  2VQF I;  5KL3 A;  2HHH E;  2HC5 A;  2V34 A;  5TSE A;  2HKJ A;  2NN6 B;  2Q8U A;  4WUD A;  2EN7 A;  3WU5 A;  2CGE A;  3M99 B;  3L7Z A;  4YHH I;  4LFA E;  5K36 C;  2OI2 A;  1WRJ A;  1JK2 A;  5CFF E;  1X6E A;  1N36 E;  4JV5 E;  2EOY A;  1X6H A;  2EPU A;  2YRK A;  1XMQ E;  4MYU A;  4B3M I;  2FGG A;  2F4V I;  3JTZ A;  4IFD B;  1UDN A;  4BA1 A;  2CG9 A;  4JI8 E;  4OO1 C;  1X3C A;  2WNR A;  2EPK X;  2IOQ A;  2LRS A;  4R2S A;  1XMO I;  2DLQ A;  2NAB A;  1N0V C;  3KRN A;  4L5N C;  4PU9 A;  3OTO I;  3IWC A;  4MU1 A;  1T4N A;  3EPH A;  2PRT A;  3WU3 A;  1MU5 A;  3JAM Q;  4J8Z A;  4JI6 E;  1VI7 A;  4IZK A;  2EMW A;  4IS1 C;  4USK A;  5AE3 A;  5JEA F;  2EOO A;  2LCE A;  2WCC 3;  1N33 E;  2R42 A;  4DUZ E;  5A2Q C;  1RHY A;  2JWO A;  1UHZ A;  4DV4 I;  4IFD D;  3J80 C;  2A2D A;  1A6F A;  2X36 A;  1T4L B;  3QT6 A;  4O4K A;  2EPZ A;  3LTO A;  2UXC I;  1BB8 A;  1WXR A;  1IBM E;  4N4R B;  2LUQ A;  4DR6 I;  3ADJ A;  4HTG A;  4JI7 E;  1YSA C;  1BBO A;  2JE6 A;  2A2C A;  3K85 A;  4WUB A;  3K6Q A;  1J26 A;  2ZM6 I;  1USU A;  1KYQ A;  1STU A;  2EPA A;  4P7A A;  1RQ0 A;  2J7J A;  3PYE A;  1H7S A;  3U1K A;  4LF7 I;  2EMK A;  2EOZ A;  4ZYD A;  2WBU A;  2HK3 A;  2XEX A;  4NBQ A;  4LCF A;  3GLL A;  4JI1 I;  4B3T E;  4USM A;  4BHC A;  1RR9 A;  4PRV A;  2BM0 A;  3PYG A;  1IQO A;  2EOS A;  3F6G A;  2UXD E;  4DKK A;  2EN3 A;  4NXM E;  1OYP A;  4IJD A;  1ZM2 A;  3LPS A;  2B9D A;  4DR7 I;  4LF4 I;  5JEA A;  2HKE A;  4DV0 I;  2AE8 A;  2MC5 A;  2LBS B;  4LF5 I;  4OO1 F;  4AIM A;  5JEA E;  2EOX A;  4HEI A;  3L7Z B;  4DXL A;  4LF6 I;  4WUC A;  3MHH C;  4DR5 I;  1T39 A;  3F6H A;  2R1F A;  5AC4 A;  5IXM B;  4NXN E;  4M9V C;  1J5E E;  4OX9 I;  4DR1 I;  4X64 E;  4UTG A;  4BA1 B;  4UT4 A;  2Q2E B;  1NCS A;  1ZU1 A;  4QNJ A;  2NA2 A;  3BGH A;  3H1C A;  4DV2 I;  2VQE I;  2R3V A;  2JPA A;  1Y4S A;  2DRP A;  3PYF A;  2E5L E;  2O1W A;  4IZK B;  4JI2 I;  4I8O A;  5K36 A;  2V8Q B;  2EM0 A;  2ENA A;  4X66 I;  2EM8 A;  5K36 E;  2PNZ B;  5KL4 A;  1T38 A;  1RRE A;  2GHF A;  3F0N A;  4JI0 I;  4DV5 E;  4HAC A;  4WSG A;  2NN6 A;  2V2Z A;  3C6M A;  2DLK A;  2UUB E;  5FLX Q;  2VF3 A;  2EN1 A;  2JOB A;  1HNZ I;  3DF6 A;  4MU4 A;  4OO1 E;  2JE6 B;  3K17 A;  2EJ4 A;  5LMU I;  2UXB I;  1ZM4 A;  1EH8 A;  3T1H E;  2RSI A;  5A6B A;  2E1M A;  3HPS A;  1A1F A;  3J7A G;  5DNX A;  4JI4 E;  2BA0 G;  1EH6 A;  2BA1 D;  4JG4 A;  4U3D A;  2ZBK B;  2PO2 A;  3AV0 A;  4R1F A;  1FWL A;  3B82 A;  2EQ1 A;  3QT7 A;  1O0W A;  2JR1 A;  3LML A;  5JEA B;  4FK5 C;  1XNQ E;  2LV2 A;  5KL2 A;  4R2A A;  4FW4 A;  4MYT A;  4Z7C A;  1X47 A;  2UUC I;  4DV6 E;  2EM6 A;  1N34 E;  4JYA I;  4BS9 A;  2EOR A;  3JAM C;  2WBS A;  4KZS A;  3ZKD A;  2V2Q A;  1ZBT A;  4LF8 I;  5F3W A;  1Z0E A;  2PNL A;  1X49 A;  2HGH A;  2EOH A;  2YTJ A;  2CT1 A;  4LPF A;  1TF3 A;  1N0U A;  1GQE A;  4R03 A;  1EKZ A;  2EOQ A;  5JEA D;  2LJH A;  5LLQ A;  4DR4 I;  2JXP A;  1YYO A;  2Z5B A;  2YTF A;  2ZIT A;  4BMJ A;  2EP3 A;  1XNR I;  2M9A A;  2C37 A;  2GQ0 A;  5DRR A;  2LUP B;  5K36 B;  1X5W A;  3KWR A;  4GKJ E;  3KZZ A;  1OJ4 A;  5LMN I;  1WHQ A;  2ELY A;  4ZVI A;  5T6J A;  2VF1 A;  2ADR A;  1XHK A;  4B3R I;  4HAC B;  3BID A;  3V5R A;  4JI5 E;  4OO1 B;  2FTX B;  5KL7 A;  4XTJ A;  1AAY A;  2EWL A;  2EM7 A;  4R2E A;  4LU9 A;  5KL5 A;  2EN6 A;  4WXC A;  2BR2 A;  5IV8 B;  4J3D A;  2EMA A;  2JY9 A;  2UU9 I;  4R2D A;  5K36 D;  2M1S A;  4FW3 A;  2K4V A;  1SR9 A;  3FIG A;  5LL6 R;  3ZOQ B;  4DR2 E;  2L3J A;  3C4B A;  1FI4 A;  1U2R A;  1PDA A;  2DIX A;  4DMI A;  3B4T A;  2HFS A;  5IWA I;  2NN6 D;  4BCA A;  2EMY A;  2ENC A;  4DV7 E;  1FJG E;  2PO2 B;  1UEK A;  2WP8 A;  3IWD A;  5BR8 E;  1I94 I;  3M6A A;  2EOE A;  5ELW A;  4DPY A;  4GKK I;  2JP9 A;  2JEA A;  4FW5 A;  5GMD A;  2PNZ A;  1B63 A;  1UN6 B;  3ADL A;  2HHH I;  5DRO A;  1A1G A;  3DD6 A;  1WUU A;  1PJS A;  2L33 A;  5A6B D;  4M30 A;  3UHM A;  1HNW E;  4LFA I;  1Z5A A;  4TUG A;  3ZM7 A;  4MU0 A;  4LFB E;  1Z0W A;  1N36 I;  4JV5 I;  2EN4 A;  2MDG A;  2V2V A;  4KQV A;  2EM4 A;  1EA6 A;  4R2C A;  3HKM A;  1XMQ I;  2RTX A;  1H7U A;  1AH5 A;  2EM9 A;  2EOJ A;  1IBK E;  1Z5C A;  3HTX A;  4JI8 I;  2Z5B B;  5FLX C;  3P76 A;  2VRD A;  3DJW A;  3TQM A;  2EMF A;  1MGT A;  3ADI A;  1KTV A;  2C37 B;  1Z0G A;  5AE2 A;  1N32 E;  2IHR 1;  1KJK A;  3BBG A;  4M1K A;  4EMD A;  4JI6 I;  3J7Y p;  3J7A M;  2UUA E;  2EM5 A;  1X6F A;  4LTY A;  4AQY E;  1N33 I;  3EPL A;  2HFU A;  2YTP A;  4DUZ I;  1IBL E;  4AM3 A;  4WYQ B;  2EFG A;  2JEB A;  2EQ3 A;  2DGC A;  1GZ6 A;  4ZYG A;  1FNM A;  2BB8 A;  2L6M A;  2BR2 B;  1ZM3 A;  2CTD A;  2LMZ A;  4HY1 A;  1IBM I;  4JI3 E;  4MU3 A;  2IES A;  4JI7 I;  2E72 A;  1NHH A;  4LFC E;  2YPN A;  2YTI A;  1EI1 A;  2EN2 A;  4X62 E;  2EPN A;  2YTN A;  3EPK A;  4MLV A;  2R76 A;  2ODR C;  1H74 A;  2BA0 D;  1IQS A;  4B3T I;  1NZ0 A;  2WP8 B;  2DEI A;  2KON A;  2O1V A;  3Q6N A;  4NXM I;  4WX9 A;  2JEA B;  2UXD I;  3THN A;  2DB2 A;  3ZZT A;  4X65 E;  3VYY A;  4P52 A;  3M85 D;  3KZY A;  1D6T A;  4DV1 E;  2EPC A;  2G7H A;  2I9I A;  1S16 A;  2YTQ A;  2I13 A;  1A1J A;  1YYK A;  4OO1 A;  5C0X C;  2YTE A;  1HR0 E;  2CVE A;  2EPX A;  4AID A;  1YPN A;  2BV3 A;  3CWV A;  4BA2 A;  4NXN I;  4K0K E;  4FWD A;  1T4O A;  1J5E I;  4X64 I;  3T1Y E;  1YHC A;  3B8H A;  4YY3 E;  4BHB A;  5A69 A;  2V87 A;  4F54 A;  2EPL X;  4MLQ A;  4WPY A;  4DR3 E;  5A6J A;  1Z0B A;  3BF2 A;  2IOP A;  3ZZ0 A;  4NHR A;  4DV3 E;  4URL A;  2PO0 A;  4O43 A;  4R2P A;  2NPF A;  2E5L I;  3THO B;  4BC9 A;  4X9J A;  3J81 C;  2MKD A;  1Z5B A;  1KKH A;  3CDJ A;  2EL5 A;  3GME A;  4U3B A;  3JU0 A;  5AC5 A;  2JEB B;  3M85 G;  4BBY A;  2LE2 A;  1VIS A;  2GO3 A;  2O3Z A;  4DV5 I;  3EPJ A;  4X8W A;  4DUY E;  2DMI A;  2EE8 A;  3PS1 A;  2EPM X;  4F9C B;  1A1H A;  2UUB I;  2C38 A;  2DEJ A;  1E3H A;  2VES A;  2LVH A;  2EOI A;  5AE1 A;  4B3S E;  4LF9 E;  1BBG A;  1Y4U A;  2L3C A;  4F9A B;  1Y60 A;  3ADG A;  4ED4 A;  3T1H I;  4ISA A;  1PIE A;  4KHP E;  2VQF E;  5IT9 Q;  3AUZ A;  5C0X F;  2EOM A;  2VE7 C;  3PS3 A;  2YTD A;  4JI4 I;  3GCM A;  4YHH E;  1QU6 A;  4WFT A;  2J65 A;  1P42 A;  1XNQ I;  2WBT A;  4F6M A;  2RS7 A;  3B78 A;  2EMH A;  2EMB A;  3OML A;  1B69 A;  4B3M E;  2F4V E;  1Z0C A;  1N3G A;  2C39 A;  4DU8 A;  1KVK A;  1G2F C;  1USV A;  1ZXN A;  3GON A;  1DAR A;  4DV6 I;  1N34 I;  4Q35 B;  2AJ4 A;  3MSW A;  1DI2 A;  2J7K A;  3M7N D;  1XMO E;  4BA2 B;  2YSP A;  2IER A;  4OOG C;  3OTO E;  2PO1 A;  1RC7 A;  1PJT A;  3J81 Q;  2B7T A;  2KHX A;  4I3H A;  4LF9 I;  1DGC A;  4O24 A;  4WSP A;  1MEY C;  1E3P A;  4KWY A;  1Z0V A;  3LNU A;  2YU8 A;  2EM3 A;  4DV4 E;  2LTS A;  4ZYE A;  3P3G A;  4OO1 D;  1BKN A;  1ZM9 A;  2PO0 B;  5C0X A;  4OZE A;  2UXC E;  3P3E A;  3ZZU A;  4DR6 E;  4GKJ I;  1YZ9 A;  5C0X E;  1PVG A;  4L8N A;  2NUE A;  2L8T A;  5A6K A;  4RPF A;  2GS8 A;  4DPW A;  4LCH A;  2EN8 A;  2ZM6 E;  4JI5 I;  1PJQ A;  2JYA A;  2YTO A;  4BC7 A;  2EMX A;  2C38 B;  1Y5Y A;  2NN6 C;  1UDO A;  2E1R A;  2N3G A;  3C4T A;  4LF7 E;  3M7N G;  2GPI A;  2V88 A;  3PS2 A;  4GEQ B;  4JI1 E;  3ECR A;  1K47 A;  1B62 A;  4QNK A;  2JOX A;  2NUG A;  4NZV A;  4PRX A;  4WXD A;  2LJU A;  3QT8 A;  2HK2 A;  4IFD C;  2K7I A;  2EMI A;  2M7Q A;  1X48 A;  4DR7 E;  4LF4 E;  1NHI A;  4DR2 I;  2O1T A;  3LLH A;  4Z7Y A;  2O1U A;  4R8O A;  3PRY A;  4DV0 E;  1OYS A;  2YU5 A;  3EQ1 A;  4LF5 E;  2V89 A;  1OYR A;  3H4L A;  4LF6 E;  1SFE A;  4DR5 E;  1R6M A;  3ZKB A;  4DV7 I;  1FJG I;  3HJC A;  2HJJ A;  4FW7 A;  4MDT A;  3U1Y A;  1P47 A;  5BR8 I;  2C39 B;  4OX9 E;  5GME A;  2CZ9 A;  1WHN A;  4DR1 E;  3HUL A;  2MC6 A;  2GO4 A;  1Z0T A;  4M2Z A;  2WW4 A;  4RHB B;  2MKN A;  4IZJ A;  1ELO A;  1KIJ A;  2EPR A;  1HNW I;  2YZT A;  2EL4 A;  5AAS A;  2VQE E;  4DV2 E;  5L3J A;  2PO1 B;  4LFB I;  3H09 A;  1Z59 A;  4JI2 E;  2V85 A;  2WZO A;  2RS6 A;  3QT5 A;  4HYM A;  5K36 F;  3K1J A;  4FW6 A;  4N3O A;  2YWQ A;  2RPC A;  2L92 A;  1MG7 A;  1IBK I;  4X66 E;  3Q6M A;  2GLI A;  1UIL A;  4OKG A;  1EH7 A;  3VYX A;  4JI0 E;  2YRM A;  2NN6 F;  5C0X B;  2YTG A;  1HNX E;  3VK6 A;  3HPZ A;  2LO3 A;  5DRP A;  5ADZ A;  1N32 I;  5FWK A;  1MX0 A;  1HNZ E;  1QZR A;  2L2N A;  2ODR D;  1YH8 A;  2Z5E A;  3NZK A;  4AQY I;  2UUA I;  2ELZ A;  1G2D C;  2FV4 B;  4R2R A;  3L00 A;  1IBL I;  4IFD F;  2YRH A;  2EZ6 A;  4F6N A;  5IT9 C;  2F8B A;  3HQ1 A;  1UDS A;  5LMU E;  2UXB E;  5A2Q Q;  2BBG A;  2WNR B;  3IWB A;  2B7V A;  2YSO A;  4LOM A;  3J80 Q;  4IS9 A;  2EMZ A;  5C0X D;  2A25 A;  4JI3 I;  4RH8 A;  4Q28 A;  2EQ0 A;  2EPP A;  5EKW A;  2Z5C A;  1TN9 A;  4LFC I;  3MHS C;  4FWH A;  4X62 I;  2N3H A;  4DPU A;  2RSM A;  1A1L A;  4FW9 A;  5EL9 A;  4DPX A;  4DPT A;  1A1K A;  2F1D A;  2V86 A;  2ENH A;  2UUC E;  5KL6 A;  2EMC A;  4ZYH A;  4FWG A;  4JYA E;  2JT2 A;  3PYD A;  1HK7 A;  4DU7 A;  1HNX I;  2DSY A;  4LF8 E;  1F2I G;  2V8P A;  2NN6 E;  1ZXM A;  3QG5 C;  4GZN C;  1H73 A;  4X65 I;  1A1I A;  2X7I A;  1YUI A;  1UDQ A;  1PKP A;  1ZAA C;  4IZJ B;  4DV1 I;  1R6L A;  4IFD A;  4DR4 E;  4TUI A;  1S4E A;  2D9H A;  2BM1 A;  2DMY A;  3WU4 A;  1HR0 I;  4R2Q A;  2YT4 A;  4IFD E;  2LTR A;  2L2M A;  2EL6 A;  1XNR E;  2L2K B;  1NHJ A;  1QNT A;  2V83 A;  2N8X A;  2M4I A;  2EMG A;  1ZBQ A;  5A6A A;  3WU6 A;  4K0K I;  1Z1B A;  2EML A;  5LMN E;  1XXE A;  3VHT B;  3T1Y I;  2EOF A;  3UK3 C;  1GTK A;  1TF6 A;  2EPO A;  4YY3 I;  4B3R E;  4F9B B;  2B3T B;  2KOU A;  2NUF A;  2LT7 A;  4LCG A;  1UBD C;  4IZJ D;  4DR3 I;  3D4J A;  4DV3 I;  3V2U C; 
#chains in the Genus database with same CATH homology
 1DQ3 A;  2CPN A;  4P7D A;  2LJP A;  1YYW A;  2UU9 E;  3P1X A;  1H72 C;  2JVA A;  4DUY I;  3Q1Q A;  5IWA E;  4P78 A;  1FWK A;  3HXL A;  4M0V A;  1FKA E;  3RMP A;  1Y6Z A;  2Z5C B;  4B3S I;  2MDR A;  2PNM A;  5DNY A;  1I94 E;  4FN5 A;  3P06 A;  4GKK E;  2H36 X;  4HXZ A;  4KHP I;  2VQF I;  2HHH E;  2V34 A;  2HKJ A;  4WUD A;  3WU5 A;  2CGE A;  4YHH I;  4LFA E;  2OI2 A;  5CFF E;  4JV5 E;  1N36 E;  4B3M I;  1XMQ E;  4MYU A;  2FGG A;  2F4V I;  3JTZ A;  2CG9 A;  4JI8 E;  2IOQ A;  2LRS A;  1XMO I;  1N0V C;  4PU9 A;  4L5N C;  3OTO I;  3IWC A;  3WU3 A;  1T4N A;  1MU5 A;  3JAM Q;  4J8Z A;  4JI6 E;  4IZK A;  4USK A;  5AE3 A;  1N33 E;  2R42 A;  4DUZ E;  5A2Q C;  2JWO A;  1UHZ A;  4DV4 I;  3J80 C;  2A2D A;  1A6F A;  2X36 A;  1T4L B;  3QT6 A;  3LTO A;  2UXC I;  1WXR A;  1IBM E;  2LUQ A;  4DR6 I;  3ADJ A;  4JI7 E;  4WUB A;  2A2C A;  3K85 A;  3K6Q A;  1J26 A;  2ZM6 I;  1USU A;  1STU A;  4P7A A;  1RQ0 A;  3PYE A;  1H7S A;  4LF7 I;  2XEX A;  2HK3 A;  4JI1 I;  4B3T E;  4USM A;  1RR9 A;  4PRV A;  2BM0 A;  3PYG A;  3F6G A;  2UXD E;  4DKK A;  4NXM E;  3LPS A;  1ZM2 A;  2B9D A;  4DR7 I;  4LF4 I;  2HKE A;  4DV0 I;  2MC5 A;  2LBS B;  4LF5 I;  4LF6 I;  4DXL A;  4WUC A;  4DR5 I;  3F6H A;  4NXN E;  1J5E E;  4OX9 I;  4DR1 I;  4X64 E;  4UTG A;  4UT4 A;  2Q2E B;  2NA2 A;  4DV2 I;  2VQE I;  2R3V A;  1Y4S A;  3PYF A;  2E5L E;  2O1W A;  4IZK B;  4JI2 I;  4I8O A;  2V8Q B;  4X66 I;  1RRE A;  4JI0 I;  3F0N A;  4DV5 E;  4HAC A;  2V2Z A;  2UUB E;  5FLX Q;  2VF3 A;  2JOB A;  1HNZ I;  3DF6 A;  3K17 A;  5LMU I;  2UXB I;  1ZM4 A;  3T1H E;  2E1M A;  3HPS A;  3J7A G;  4JI4 E;  4JG4 A;  2ZBK B;  4R1F A;  3AV0 A;  1FWL A;  3B82 A;  3QT7 A;  1O0W A;  2JR1 A;  3LML A;  1XNQ E;  4MYT A;  4Z7C A;  1X47 A;  2UUC I;  4DV6 E;  1N34 E;  4JYA I;  4BS9 A;  3JAM C;  4KZS A;  3ZKD A;  2V2Q A;  1ZBT A;  4LF8 I;  5F3W A;  1Z0E A;  2PNL A;  1X49 A;  1N0U A;  1GQE A;  4R03 A;  1EKZ A;  4DR4 I;  2LJH A;  1YYO A;  2Z5B A;  2ZIT A;  4BMJ A;  1XNR I;  2GQ0 A;  2LUP B;  3KWR A;  4GKJ E;  1OJ4 A;  5LMN I;  1WHQ A;  4ZVI A;  5T6J A;  2VF1 A;  1XHK A;  4B3R I;  4HAC B;  3V5R A;  4JI5 E;  2FTX B;  4XTJ A;  2EWL A;  4LU9 A;  2JY9 A;  2UU9 I;  2M1S A;  2K4V A;  1SR9 A;  3FIG A;  5LL6 R;  3ZOQ B;  4DR2 E;  2L3J A;  3C4B A;  1FI4 A;  1U2R A;  2DIX A;  5GME A;  4DMI A;  5IWA I;  2HFS A;  4BCA A;  4DV7 E;  1FJG E;  1UEK A;  3IWD A;  5BR8 E;  1I94 I;  3M6A A;  4DPY A;  4GKK I;  5GMD A;  1B63 A;  3ADL A;  2HHH I;  1WUU A;  2L33 A;  4M30 A;  1HNW E;  4LFA I;  1Z5A A;  4TUG A;  3ZM7 A;  1N36 I;  4LFB E;  1Z0W A;  4JV5 I;  2V2V A;  4KQV A;  1XMQ I;  1EA6 A;  2RTX A;  1H7U A;  1IBK E;  1Z5C A;  3HTX A;  4JI8 I;  2Z5B B;  5FLX C;  3DJW A;  3ADI A;  1KTV A;  1Z0G A;  5AE2 A;  1N32 E;  2IHR 1;  4M1K A;  4EMD A;  4JI6 I;  3J7Y p;  3J7A M;  2UUA E;  4LTY A;  4AQY E;  1N33 I;  2HFU A;  4DUZ I;  1IBL E;  4WYQ B;  2EFG A;  1GZ6 A;  1FNM A;  2L6M A;  1ZM3 A;  2LMZ A;  4HY1 A;  1IBM I;  4JI3 E;  4JI7 I;  1NHH A;  4LFC E;  1EI1 A;  4X62 E;  2ODR C;  1H74 A;  4B3T I;  1NZ0 A;  2DEI A;  2KON A;  2O1V A;  3Q6N A;  4NXM I;  2UXD I;  3ZZT A;  2DB2 A;  4X65 E;  3VYY A;  4P52 A;  1D6T A;  4DV1 E;  2G7H A;  1S16 A;  1YYK A;  1HR0 E;  2BV3 A;  3CWV A;  4NXN I;  4K0K E;  4FWD A;  1T4O A;  1J5E I;  4X64 I;  3T1Y E;  3B8H A;  4YY3 E;  2V87 A;  4F54 A;  4WPY A;  4DR3 E;  1Z0B A;  2IOP A;  3ZZ0 A;  4URL A;  4DV3 E;  2NPF A;  2E5L I;  4BC9 A;  3J81 C;  1Z5B A;  1KKH A;  3JU0 A;  4BBY A;  2LE2 A;  1VIS A;  4DV5 I;  4X8W A;  4DUY E;  4F9C B;  2UUB I;  2DEJ A;  5AE1 A;  4B3S E;  4LF9 E;  1Y4U A;  2L3C A;  4F9A B;  3ADG A;  4ED4 A;  3T1H I;  1PIE A;  4KHP E;  2VQF E;  5IT9 Q;  3AUZ A;  2VE7 C;  4JI4 I;  4YHH E;  1QU6 A;  4WFT A;  1XNQ I;  2RS7 A;  3B78 A;  3OML A;  4B3M E;  2F4V E;  1Z0C A;  4DU8 A;  1KVK A;  1USV A;  1ZXN A;  3GON A;  4DV6 I;  1DAR A;  1N34 I;  2AJ4 A;  3MSW A;  1DI2 A;  2J7K A;  1XMO E;  4OOG C;  3OTO E;  1RC7 A;  3J81 Q;  2B7T A;  2KHX A;  4I3H A;  4LF9 I;  4WSP A;  1Z0V A;  3LNU A;  4DV4 E;  2LTS A;  1BKN A;  1ZM9 A;  2UXC E;  3ZZU A;  4DR6 E;  4GKJ I;  1YZ9 A;  1PVG A;  2NUE A;  4L8N A;  2L8T A;  4RPF A;  2GS8 A;  4DPW A;  2ZM6 E;  4JI5 I;  4BC7 A;  2E1R A;  2N3G A;  3C4T A;  4LF7 E;  2V88 A;  4GEQ B;  4JI1 E;  1K47 A;  1B62 A;  2JOX A;  2NUG A;  4PRX A;  3QT8 A;  2HK2 A;  2M7Q A;  1X48 A;  4DR7 E;  4LF4 E;  1NHI A;  4DR2 I;  2O1T A;  3LLH A;  4Z7Y A;  2O1U A;  4R8O A;  3PRY A;  4DV0 E;  4LF5 E;  2V89 A;  3H4L A;  4LF6 E;  4DR5 E;  4DV7 I;  3ZKB A;  1FJG I;  3HJC A;  5BR8 I;  4OX9 E;  2CZ9 A;  1WHN A;  4DR1 E;  3HUL A;  2MC6 A;  1Z0T A;  4M2Z A;  2WW4 A;  4IZJ A;  1ELO A;  1KIJ A;  1HNW I;  2YZT A;  5AAS A;  2VQE E;  4DV2 E;  5L3J A;  4LFB I;  3H09 A;  1Z59 A;  4JI2 E;  2V85 A;  2WZO A;  2RS6 A;  3QT5 A;  4HYM A;  3K1J A;  4N3O A;  2L92 A;  1MG7 A;  1IBK I;  4X66 E;  3Q6M A;  1UIL A;  3VYX A;  4JI0 E;  1HNX E;  3VK6 A;  3HPZ A;  1N32 I;  5ADZ A;  5FWK A;  1MX0 A;  1HNZ E;  1QZR A;  2ODR D;  2L2N A;  2Z5E A;  2UUA I;  4AQY I;  2FV4 B;  1IBL I;  2EZ6 A;  5IT9 C;  2F8B A;  3HQ1 A;  5LMU E;  2UXB E;  5A2Q Q;  3IWB A;  2B7V A;  3J80 Q;  4JI3 I;  4Q28 A;  4LFC I;  2Z5C A;  4FWH A;  4X62 I;  2N3H A;  4DPU A;  2RSM A;  4DPX A;  4FW9 A;  4DPT A;  2V86 A;  2UUC E;  4FWG A;  4DU7 A;  4JYA E;  3PYD A;  1HK7 A;  1HNX I;  2DSY A;  4LF8 E;  2V8P A;  1ZXM A;  1H73 A;  4X65 I;  2X7I A;  1PKP A;  4IZJ B;  4DV1 I;  4DR4 E;  4TUI A;  1S4E A;  2BM1 A;  3WU4 A;  2DMY A;  1HR0 I;  2YT4 A;  2LTR A;  2L2M A;  1XNR E;  2L2K B;  1NHJ A;  2V83 A;  2M4I A;  3WU6 A;  1ZBQ A;  4K0K I;  5LMN E;  3T1Y I;  4YY3 I;  4B3R E;  4F9B B;  2B3T B;  2KOU A;  2NUF A;  4IZJ D;  4DR3 I;  3D4J A;  4DV3 I;  3V2U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...