5A2QC

Structure of the hcv ires bound to the human ribosome
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
EWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 18S RRNA
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5a2qC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5a2qC02
1KIJA 1NHIA 1A6FA 4DR2E 4X66E 4WUCA 2UUAE 4M1KA 1MX0A 2F4VE 1H7SA 4USKA 4DUZE 4JV5I 1KVKA 1B63A 4DU7A 4DR2I 2DEIA 4DV4I 1FJGE 3HULA 1D6TA 4DV6E 4LFBI 5A2QC 2F4VI 5LL6R 4JI8I 2V8PA 2DEJA 4X65I 5LMUI 1HNZI 4GKKE 4Z7YA 4DR6I 3B78A 3QT7A 5FLXC 4YY3E 4JI7E 4JYAE 1Z5CA 1HR0I 4DPUA 1HNWE 2ZBKB 5BR8I 1Z0VA 1ELOA 1BKNA 4JG4A 5FLXQ 1IBME 1MG7A 4JI4E 1EA6A 1FKAE 3T1HI 4GKJE 4JI7I 1XNQE 4DR3E 4YHHI 2UXDE 4DV3I 1N36I 3J7AM 2BV3A 4DPXA 1RREA 3ZKDA 3JAMQ 1Z0EA 4PRXA 4DV2I 4JI6I 4B3RI 3OTOE 3T1YE 4DPYA 2HK3A 4NXNE 4X66I 2E5LI 1N0VC 1KKHA 1J5EE 1Z0WA 2UUCE 2CZ9A 3CWVA 1I94I 2UXBI 2UXCI 1XHKA 4LF7I 4XTJA 4PU9A 4DUZI 4B3SI 3J81C 4MYTA 4DV6I 2ZITA 2R42A 1B62A 3ZZUA 2UUBE 1PIEA 2OI2A 4FN5A 4DV5I 3Q1QA 2E1RA 4WUBA 1NZ0A 3PYDA 2VQFI 4LFAI 2ZM6E 1NHHA 2HKEA 2X7IA 4JI0E 3ZZTA 4UT4A 1Z5BA 4YY3I 3PYEA 1HNWI 2VQEI 4FWHA 4LF9I 5BR8E 4B3TI 1H7UA 1MU5A 2WW4A 1ZXNA 3B8HA 1EI1A 3WU3A 1U2RA 2V34A 4P7AA 4X64E 2Q2EB 3K1JA 4GKJI 1IBLI 3GONA 4DR4E 4HACA 2VQEE 4DV7E 3H4LA 3J7AG 4DV0E 3QT8A 1VISA 1H73A 4DV2E 4JI6E 2X36A 5IWAI 4X64I 4USMA 1FNMA 4LF4E 4LF6I 1XNRI 4X65E 4DPTA 4P52A 2UXBE 5LMUE 4DV1I 1Z0TA 4HYMA 4KQVA 4WUDA 4DU8A 4LF4I 1HR0E 3ZKBA 1ZM9A 4AQYE 5IT9Q 4JI3E 3ZM7A 4LFBE 2XEXA 4JI8E 1Z0CA 4DV5E 1FWKA 3J80C 1XMOE 2VQFE 2LJPA 4DR1I 4LFAE 4YHHE 1N33E 2UXDI 4AQYI 4JI0I 1WUUA 2HFUA 3D4JA 4FWGA 4UTGA 4B3RE 4LF9E 4RPFA 3PYGA 1XMOI 1HNXE 1IBKE 2HHHE 4LF5E 1N33I 2BM0A 1OJ4A 4ED4A 4R1FA 4DR5I 1S4EA 4JI4I 4DR7E 1N34E 1XNQI 1IBLE 3ZZ0A 1QZRA 2UU9E 1S16A 4DV7I 1N32I 4HACB 2A2DA 2A2CA 1HNXI 2HHHI 4LF5I 3LPSA 2HK2A 3K17A 2UUAI 4JI2E 1XMQE 4DR7I 5GMEA 1N34I 4LFCE 2E5LE 1N32E 4LF8E 3LTOA 2ZM6I 3V2UC 4JI5E 4FWDA 2V2ZA 1H72C 4JI3I 4FW9A 1HNZE 4GKKI 2HFSA 2EFGA 3LNUA 4ZVIA 4OX9E 3F0NA 4B3ME 4DR1E 1DARA 4DR4I 3PYFA 5LMNE 2GS8A 3WU5A 2R3VA 5A2QQ 5IT9C 4HY1A 1UEKA 2J7KA 4B3TE 2BM1A 3T1HE 4B3MI 1Z5AA 1Z0BA 5GMDA 1IBKI 1PVGA 4KHPI 2NPFA 4PRVA 1Z0GA 4DV3E 1N36E 4DUYI 4K0KE 4X62E 4JYAI 1RR9A 2V2QA 1K47A 2AJ4A 4MYUA 2UU9I 1ZM3A 4NXNI 4KHPE 3B82A 1J5EI 5IWAE 1I94E 1H74A 1XMQI 4K0KI 4X62I 4LF7E 4DR3I 4LF6E 1XNRE 1NHJA 4JV5E 3JAMC 3QT5A 4DV1E 4DV4E 1FJGI 4LF8I 3WU6A 4URLA 3OTOI 3T1YI 4HXZA 1N0UA 4JI5I 2HKJA 2UUCI 1ZXMA 4DPWA 4NXMI 1FWLA 3V5RA 1FI4A 2UXCE 1PKPA 1KTVA 4DR6E 3WU4A 4B3SE 4JI1E 3J81Q 1Z59A 4OX9I 5L3JA 3J80Q 5LMNI 1ZM4A 4NXME 3QT6A 4EMDA 2UUBI 1IBMI 2V2VA 3M6AA 4JI2I 4JI1I 4LFCI 1ZM2A 2VF3A 4I3HA 4DR5E 4Z7CA 4DUYE 4DV0I 4DXLA
chains in the Genus database with same CATH superfamily
2GHFA 4MLVA 2EOJA 2RPCA 1IQSA 2FGGA 1RQ0A 3PS2A 1KIJA 2F1DA 2CPNA 1NHIA 1A6FA 4DR2E 2V88A 4X66E 1OYPA 1IMUA 3BIDA 4WUCA 2EQ0A 2DGCA 1RMDA 2UUAE 2EL5A 2YTQA 4R2AA 4M1KA 5A6BD 2JWOA 1MX0A 2EQ1A 1OYRA 2YTDA 2F4VE 1J26A 4KWYA 2HJJA 1H7SA 1AAYA 2G7HA 4DUZE 4USKA 1UDNA 3ADIA 4JV5I 1KVKA 1B63A 2RSMA 2V2QA 4DU7A 3M99B 2LV2A 2C37A 5DRPA 2DEIA 4DR2I 1E3HA 5C0XA 1FJGE 2BA1D 3TQMA 2EMYA 2NN6E 4DV4I 3HULA 1G2DC 1UILA 4DV6E 1D6TA 2YRMA 4IZKB 2V89A 2ENAA 4LFBI 5A2QC 2WP8B 2IHR1 2F4VI 5LL6R 4R2QA 4FW4A 2YSOA 4JI8I 5JEAB 1YYWA 2V8PA 2DEJA 4X65I 2EM7A 2Z5CB 4R8OA 2EOSA 3GMEA 4MU1A 5LMUI 4TUGA 2BA0D 2GPIA 4GKKE 1HNZI 4LCHA 4Z7YA 2D9HA 4DR6I 3B78A 4OO1D 2EMCA 4IFDF 1WHQA 5JEAC 2PO2A 3KZYA 4TUIA 3P3CA 5FLXC 3QT7A 3IWCA 2EN6A 4YY3E 4JI7E 1A1HA 4JYAE 1Z5CA 4FW5A 1HR0I 1R6LA 4DPUA 1HNWE 2ZBKB 5AE1A 2JXPA 5BR8I 2DMYA 1Z0VA 1BKNA 2N3GA 1A1KA 1ELOA 2PNLA 3VYYA 3J7Yp 4JG4A 2YRKA 1BBOA 5FLXQ 5K36E 3P76A 1IBME 1GQEA 4BBYA 3B4TA 4FW3A 1MG7A 1JK2A 3CDIA 2JVAA 1WXRA 5AE3A 4JI4E 1EA6A 1FKAE 2CT1A 3C6MA 2JY9A 4IS9A 3T1HI 5K36A 4GKJE 2YTOA 3F6HA 4JI7I 1XNQE 2EN7A 4DR3E 4YHHI 3P1XA 2UXDE 3HPSA 4WYQB 1YUJA 2EM0A 1UDQA 4DV3I 1N36I 1YPNA 3KWRA 2IESA 2PRTA 3J7AM 1UHZA 2BV3A 3EQ1A 2AE8A 2EPLX 4DPXA 1RREA 3ZKDA 3JAMQ 1Z0EA 2I13A 1WJPA 1UN6B 4PRXA 2LCEA 4DV2I 4JI6I 4IFDC 5K36C 1KJKA 4B3RI 2L2KB 3OTOE 3T1YE 5K36F 2JE6A 5EL9A 2LUPB 4NXNE 2HK3A 4DPYA 3HQ1A 1X6HA 4U3BA 3GCMA 2YU8A 2ENCA 4X66I 1N0VC 1KKHA 2E5LI 2YPNA 2JOBA 1N3GA 1J5EE 1Z0WA 2UUCE 2CZ9A 3CWVA 1I94I 2NN6D 2ADRA 1YFHA 3M7ND 1MEYC 4BCAA 4BS9A 2UXBI 2E72A 2RS6A 4R2SA 2UXCI 1XHKA 1OYSA 5DRQA 2O1UA 2K4VA 4LF7I 4WXDA 5JEAE 4XTJA 4Q28A 2M7QA 4PU9A 4O24A 4DUZI 2V86A 3EPHA 4B3SI 2EPNA 1P42A 2O1TA 4NBQA 2DSYA 3J81C 4QNKA 2V87A 3Q6NA 2N8XA 1G2FC 1A1IA 4MYTA 4L8NA 4OOGC 3U1KA 2LUQA 2L6MA 1X47A 4WSPA 4GQUA 3L00A 4DV6I 2RTXA 2ZITA 3BF2A 2FTXB 2R42A 1B62A 3PRYA 3C4BA 2UUBE 3ZZUA 2EOYA 1PIEA 2CSHA 2OI2A 2FV4B 4FN5A 4DV5I 4ZYGA 3Q1QA 2E1RA 4WUBA 5ADZA 1NZ0A 4ISAA 4BA2B 5A69A 2EM2A 3PYDA 4RHBB 2CG9A 2VQFI 2HC5A 3MSWA 4LFAI 3ADGA 5TSEA 4KZSA 5KL2A 3BBGA 2ZM6E 3FIGA 1NHHA 2HKEA 2X7IA 3C6KA 4N4RB 1Y6ZA 4JI0E 4U3DA 3ZZTA 3EPKA 1Y5YA 3THOB 4F2JC 2YTNA 3GLLA 1Z5BA 4UT4A 3PYEA 4YY3I 1X6EA 2NUFA 2YTIA 1T4NA 2R1FA 4R03A 2B7TA 2VQEI 4FWHA 1HNWI 4BMJA 2EPRA 4LF9I 5BR8E 4B3TI 3IWBA 3JTZA 4P7DA 2GO4A 2V85A 1H7UA 4GEQB 1MU5A 2RS7A 3C4TA 4X9JA 2WW4A 3P3GA 2VF1A 1ZXNA 3B8HA 1EI1A 2RSIA 5EKWA 1U2RA 1PJQA 3WU3A 2K7IA 2V34A 2KHXA 2VRDA 4P7AA 4X64E 2Q2EB 3K1JA 4GKJI 1IBLI 3OMLA 1F2IG 3GONA 4DR4E 3VK6A 2EMIA 4RH8A 2PNZB 4HACA 3VYXA 2VQEE 4DV7E 4N3OA 4BA2A 3H4LA 1BBGA 3L7ZB 1PJTA 3J7AG 5T6JA 4DV0E 2LBSB 1IQOA 3H09A 3QT8A 2LVHA 4F54A 1P47A 5AC4A 1VISA 4DV2E 4JI6E 1H73A 4FW6A 5DNYA 2NN6F 4R2CA 2BR2B 2X36A 2PO0B 2DMIA 5IWAI 1A1FA 2B7VA 3HXLA 2EMHA 2EPXA 4R2EA 2LRSA 4USMA 4X64I 4LCGA 4LF4E 5A6AA 1FNMA 2YTGA 4LF6I 1XNRI 4X65E 3PS1A 2EMLA 2V83A 2O1VA 4AIDA 4P52A 4HEIA 4BC9A 2UXBE 3HPZA 2WNRA 1X3CA 5LMUE 2IERA 4DV1I 2JT2A 1T39A 4R2PA 1Z0TA 4IZJD 4NHRA 1QU6A 4ZYHA 4HYMA 4MU0A 5K36B 4M30A 2B3TB 1YYKA 4KQVA 4WUDA 2EOXA 4DKKA 3H1CA 4LCFA 2BA1G 2YRHA 4IJDA 2Z5BB 4DU8A 4Q35B 4LF4I 1BB8A 2EM9A 1HR0E 2JR1A 3ZKBA 4LOMA 1ZM9A 4MDTA 4MQYA 2DLQA 4AQYE 4O43A 3U1YA 5IT9Q 4JI3E 4OO1F 3ZM7A 4LFBE 2XEXA 4JI8E 1Z0CA 5JEAA 2DB2A 2EN1A 3LMLA 4DV5E 4OO1E 1FWKA 2BR2A 1X48A 4R2DA 2DIXA 2PO0A 3ADLA 2JEAB 2B9DA 3J80C 1XMOE 2VQFE 2LJPA 4DR1I 4LFAE 2LTSA 3LLHA 4YHHE 4DPTA 1N33E 2UXDI 2CGEA 2KONA 1GZ6A 3BGHA 2VE7C 5C0XD 1YSAC 4WXCA 1KYQA 2WNRB 4AQYI 2O3ZA 4JI0I 2M1SA 2DLKA 1WUUA 1DGCA 2BB8A 2HFUA 5IXMB 3D4JA 3M85G 1A1GA 5DRRA 4FWGA 4UTGA 3JU0A 4B3RE 3AV0A 4LF9E 1DQ3A 4RPFA 2F8BA 3PYGA 2EMXA 1XMOI 2EPZA 1EH6A 1RC7A 2JPAA 1HNXE 1IBKE 2HHHE 2WZOA 2MKNA 4LF5E 1N33I 2BM0A 2EOHA 2JEAA 1OJ4A 4ED4A 4R1FA 4DR5I 1ZAAC 3DJWA 2PO1B 3HTXA 1S4EA 4JI4I 5A6JA 2EJ4A 2EMWA 4DR7E 5JEAF 1Y60A 1N34E 1LLMC 1XNQI 1IBLE 4GZNC 2EMZA 4P78A 1SFEA 2MC5A 4LU9A 4ZYEA 2L92A 1T4LB 1JK1A 2UU9E 1QZRA 1S16A 3ZZ0A 4DV7I 1N32I 3K85A 2PNZA 4HACB 2A2DA 2A2CA 2LTRA 5DNLA 1Z1BA 1HNXI 1O0WA 2HHHI 4LF5I 1ZU1A 4AIMA 3LPSA 2EQ3A 2HK2A 2YSPA 3K17A 2UUAI 2L3JA 2YT4A 4JI2E 1USVA 1XMQE 4DR7I 4R2RA 5GMEA 1N34I 2O1WA 2L33A 5KL6A 4LFCE 2E5LE 2EOOA 2EMAA 4ZYDA 5C0XF 5KL7A 1N32E 2LO3A 4JYAI 2EL4A 2IOPA 4O4KA 3P06A 2LE2A 3RMPA 2C37B 4O5GA 3NZKA 3ADJA 2NUGA 4LF8E 3LTOA 2CVEA 2WBUA 2J7JA 2ZM6I 2V8QB 3V2UC 4IFDD 2YU5A 4JI5E 4M2ZA 3DF6A 2J65A 1STUA 4FWDA 2YZTA 2WP8A 5AC5A 2LJHA 1T38A 1UDOA 2Z5EA 3L7ZA 2Z5BA 2I9IA 4FK5C 2EMGA 2V2ZA 2Z5CA 4HTGA 1H72C 4JI3I 2EOFA 2H36X 1HNZE 4FW9A 4GKKI 2HFSA 2L2NA 2EFGA 2EM6A 4X8WA 2C39A 2LMZA 2EOMA 2M4IA 2EN2A 3LNUA 2NN6B 4MU4A 4ZVIA 5KL5A 4OO1B 5F3WA 5K36D 2EPPA 2ODRD 3PS3A 1B69A 2L2MA 4OX9E 3F0NA 4B3ME 4DR1E 4F6NA 1DARA 2EPMX 4DR4I 2MDGA 2M9AA 3PYFA 5FWKA 5LMNE 2GS8A 3WU5A 2R3VA 2EM3A 1ZBTA 1EKZA 5A2QQ 2RQLA 2ELYA 2NUEA 2EE8A 5IT9C 4HY1A 3QG5C 2L3CA 3F6GA 2C38A 1UEKA 4IFDE 2NA2A 5KL3A 1UBDC 1ZBQA 2J7KA 2YTFA 4B3TE 2BM1A 3KRNA 4QNJA 1EH7A 2MDRA 2WCC3 3T1HE 4M0VA 1L4SA 1YYOA 2E1MA 2PNMA 4B3MI 1Z5AA 1Z0BA 5GMDA 1T4OA 1ZR9A 1IBKI 1PVGA 4KHPI 2EPAA 2NPFA 4PRVA 1Z0GA 2DRPA 4DV3E 4F9BB 1N36E 1PJSA 2EOQA 1TF6A 2GQ0A 5C0XB 4DUYI 1YHCA 2YWQA 2EM8A 4K0KE 2EPUA 3HKMA 3UK3C 5ELWA 2EZ6A 4X62E 1GTKA 2EPOA 2EPCA 3AUZA 4F9CB 1HK7A 1K47A 1PDAA 1NCSA 4IS1C 1RR9A 1MGTA 2EWLA 1USUA 2GO3A 4WFTA 2AJ4A 2NN6C 4MYUA 2UU9I 2R76A 4OO1A 1ZM3A 1DI2A 2YTJA 2JE6B 2JEBA 1QNTA 4NXNI 4AM3A 2ENHA 1A1JA 1YH8A 2MKDA 2EMBA 4L5NC 1E3PA 3MHSC 2HGHA 5LLQA 4KHPE 4WSGA 5KL4A 2L8TA 2LJUA 3B82A 1J5EI 1NEIA 5AASA 4OKGA 2Q8UA 3THNA 5IWAE 4IFDA 1I94E 2EM4A 1R6MA 5CFFE 1H74A 3P3EA 1XMQI 4K0KI 2YTPA 2EP3A 4X62I 1RHYA 1XXEA 4LF7E 4DR3I 2A25A 5AE2A 3EPLA 4LF6E 2EN4A 1XNRE 4LPFA 1WRJA 3MHHC 4F6MA 4BHBA 1NHJA 4JV5E 3UHMA 3JAMC 3QT5A 2WBSA 1X6FA 2EMFA 3ECRA 2EPKX 4DV1E 3K6QA 3DD6A 3VHTB 4DV4E 1FJGI 4LF8I 2ELZA 3KZZA 4WPYA 4BHCA 4IZKA 3WU6A 4OZEA 4URLA 1A1LA 3OTOI 3T1YI 2NABA 1EH8A 2JYAA 5IV8B 1TF3A 4HXZA 1N0UA 5A6BA 2HKJA 4I8OA 5C0XC 4JI5I 3HJCA 2GLIA 4BA1B 2EL6A 4FW7A 2UUCI 2EN8A 2JP9A 1ZXMA 4DPWA 1FWLA 2N3HA 2JEBB 2EORA 3V5RA 4NXMI 1FI4A 2UXCE 1VI7A 1PKPA 2PO2B 4IZJB 2BBGA 1KTVA 4DR6E 4J8ZA 4J3DA 1UDSA 1X5WA 2LT7A 4M9VC 3CDJA 3WU4A 4IFDB 4B3SE 3Q6MA 4JI1E 2C39B 3J81Q 1Z59A 4OX9I 2NN6A 1TN9A 4MLQA 2YTEA 5L3JA 3ZOQB 3J80Q 5LMNI 3EPJA 1ZM4A 4NXME 2VESA 2KOUA 3QT6A 4WX9A 4EMDA 2UUBI 2EM5A 3IWDA 2EOZA 4OO1C 1IBMI 2EN3A 2V2VA 4LTYA 5JEAD 2IOQA 1X49A 3M6AA 2JOXA 2EMKA 2ODRC 2C38B 4JI1I 2WBTA 5DROA 1YUIA 5DNXA 4JI2I 2EOEA 4F9AB 4DMIA 4MU3A 4LFCI 4BA1A 1ZM2A 2VF3A 4I3HA 1SR9A 4NZVA 1Y4UA 1Y4SA 4DR5E 2PO1A 4Z7CA 4BC7A 4DUYE 3M85D 1AH5A 4IZJA 5A6KA 2EOIA 1WHNA 5C0XE 3M7NG 2BA0G 2CTDA 4DV0I 4DXLA 2MC6A 1YZ9A
chains in the Genus database with same CATH topology
2FGGA 1RQ0A 1KIJA 2CPNA 1NHIA 1A6FA 4DR2E 2V88A 4X66E 4WUCA 2UUAE 4M1KA 2JWOA 1MX0A 1J26A 2F4VE 1H7SA 2G7HA 4DUZE 4USKA 3ADIA 4JV5I 1KVKA 1B63A 2RSMA 4DU7A 4DR2I 2DEIA 1FJGE 4DV4I 3HULA 1UILA 4DV6E 1D6TA 4IZKB 2V89A 4LFBI 5A2QC 2F4VI 2IHR1 2MC6A 5LL6R 4JI8I 1YYWA 2V8PA 2DEJA 4X65I 2Z5CB 4R8OA 5LMUI 4TUGA 4GKKE 1HNZI 4Z7YA 4DR6I 3B78A 1WHQA 4TUIA 3QT7A 5FLXC 3IWCA 4YY3E 4JI7E 4JYAE 1Z5CA 1HR0I 4DPUA 1HNWE 2ZBKB 5AE1A 5BR8I 2DMYA 1Z0VA 1BKNA 2N3GA 1ELOA 2PNLA 3VYYA 3J7Yp 4JG4A 5FLXQ 1IBME 1GQEA 4BBYA 1MG7A 2JVAA 1WXRA 5AE3A 4JI4E 1EA6A 1FKAE 3T1HI 2JY9A 4GKJE 3F6HA 4JI7I 1XNQE 4DR3E 4YHHI 3P1XA 2UXDE 3HPSA 4WYQB 4DV3I 1N36I 3J7AM 3KWRA 1UHZA 2BV3A 4DPXA 1RREA 3ZKDA 3JAMQ 1Z0EA 4PRXA 4DV2I 4JI6I 4B3RI 2L2KB 3OTOE 3T1YE 2LUPB 4NXNE 2HK3A 4DPYA 3HQ1A 4X66I 1N0VC 1KKHA 2E5LI 2JOBA 1J5EE 1Z0WA 2UUCE 2CZ9A 3CWVA 1I94I 2UXBI 4BCAA 4BS9A 2RS6A 2UXCI 1XHKA 2O1UA 2K4VA 4LF7I 4XTJA 4Q28A 2M7QA 4PU9A 4DUZI 2V86A 4B3SI 2O1TA 2DSYA 3J81C 2V87A 3Q6NA 4MYTA 4L8NA 4OOGC 2LUQA 2L6MA 1X47A 4WSPA 4DV6I 2RTXA 2ZITA 2FTXB 2R42A 1B62A 3PRYA 3C4BA 2UUBE 3ZZUA 1PIEA 2OI2A 2FV4B 4FN5A 4DV5I 3Q1QA 2E1RA 4WUBA 5ADZA 1NZ0A 3PYDA 2CG9A 2VQFI 3MSWA 4LFAI 3ADGA 4KZSA 2ZM6E 3FIGA 1NHHA 2HKEA 2X7IA 1Y6ZA 4JI0E 3ZZTA 4UT4A 1Z5BA 4YY3I 3PYEA 2NUFA 1T4NA 1HNWI 4R03A 2B7TA 2VQEI 4FWHA 4BMJA 4LF9I 5BR8E 4B3TI 3IWBA 3JTZA 4P7DA 2V85A 1H7UA 4GEQB 1MU5A 2RS7A 3C4TA 2WW4A 2VF1A 1ZXNA 3B8HA 1EI1A 3WU3A 1U2RA 2V34A 2KHXA 4P7AA 4X64E 2Q2EB 3K1JA 4GKJI 1IBLI 3OMLA 3GONA 4DR4E 3VK6A 4HACA 3VYXA 2VQEE 4DV7E 4N3OA 3H4LA 3J7AG 5T6JA 4DV0E 2LBSB 3H09A 3QT8A 4F54A 1VISA 4DV2E 4JI6E 1H73A 5DNYA 2X36A 5IWAI 2B7VA 3HXLA 4X64I 2LRSA 4USMA 4LF4E 1FNMA 4LF6I 1XNRI 4X65E 4DPTA 2V83A 2O1VA 4P52A 4BC9A 2UXBE 3HPZA 5LMUE 4DV1I 4IZJD 1Z0TA 1QU6A 4HYMA 4M30A 2B3TB 1YYKA 4KQVA 4WUDA 4DKKA 2Z5BB 4DU8A 4LF4I 1HR0E 2JR1A 3ZKBA 1ZM9A 4AQYE 5IT9Q 4JI3E 3ZM7A 4LFBE 2XEXA 4JI8E 1Z0CA 2DB2A 3LMLA 4DV5E 1FWKA 1X48A 2DIXA 3ADLA 2B9DA 3J80C 1XMOE 2VQFE 2LJPA 4DR1I 4LFAE 2LTSA 3LLHA 4YHHE 1N33E 2UXDI 2CGEA 2KONA 1GZ6A 2VE7C 4AQYI 4JI0I 2M1SA 1WUUA 2HFUA 3D4JA 4FWGA 4UTGA 3JU0A 4B3RE 3AV0A 4LF9E 1DQ3A 4RPFA 2F8BA 3PYGA 1XMOI 1RC7A 1HNXE 1IBKE 2HHHE 2WZOA 4LF5E 1N33I 2BM0A 1OJ4A 4ED4A 4R1FA 4DR5I 3DJWA 3HTXA 1S4EA 4JI4I 4DR7E 1N34E 1XNQI 1IBLE 4P78A 2MC5A 4LU9A 1T4LB 2L92A 2UU9E 1QZRA 1S16A 3ZZ0A 4DV7I 1N32I 3K85A 4HACB 2A2DA 2A2CA 2LTRA 1HNXI 2HHHI 1O0WA 4LF5I 3LPSA 2HK2A 3K17A 2UUAI 2L3JA 2YT4A 4JI2E 1USVA 1XMQE 4DR7I 5GMEA 1N34I 2O1WA 2L33A 4LFCE 2E5LE 1N32E 2IOPA 3P06A 2LE2A 3RMPA 3ADJA 2NUGA 4LF8E 3LTOA 2ZM6I 2V8QB 3V2UC 4JI5E 4M2ZA 3DF6A 1STUA 4FWDA 2YZTA 2LJHA 2Z5EA 2Z5BA 2V2ZA 2Z5CA 1H72C 4JI3I 2H36X 1HNZE 4FW9A 4GKKI 2HFSA 2L2NA 2EFGA 4IZJB 4X8WA 2LMZA 3LNUA 2M4IA 4ZVIA 5F3WA 2ODRD 2L2MA 4OX9E 3F0NA 4B3ME 4DR1E 1DARA 4DR4I 3PYFA 5FWKA 5LMNE 2GS8A 3WU5A 2R3VA 1ZBTA 5A2QQ 2NUEA 5IT9C 4HY1A 2L3CA 3F6GA 1UEKA 2NA2A 2J7KA 1ZBQA 4B3TE 2BM1A 2PNMA 2MDRA 3T1HE 4M0VA 1YYOA 2E1MA 4B3MI 1Z5AA 1Z0BA 5GMDA 1T4OA 1IBKI 1PVGA 4KHPI 2NPFA 4PRVA 1Z0GA 4DV3E 4F9BB 1N36E 2GQ0A 4DUYI 4K0KE 2EZ6A 4X62E 4JYAI 4F9CB 1HK7A 3AUZA 1RR9A 1K47A 2V2QA 2EWLA 1USUA 4WFTA 2AJ4A 4MYUA 2UU9I 1ZM3A 1DI2A 4NXNI 4L5NC 4KHPE 3B82A 2L8TA 1J5EI 5AASA 5IWAE 1I94E 5CFFE 1H74A 1XMQI 4K0KI 4X62I 4LF7E 4DR3I 5AE2A 4LF6E 1XNRE 1NHJA 4JV5E 3JAMC 3QT5A 4DV1E 3K6QA 4DV4E 1FJGI 4LF8I 3WU6A 4WPYA 4URLA 4IZKA 3OTOI 3T1YI 4HXZA 1N0UA 4JI5I 2HKJA 4I8OA 3HJCA 2UUCI 1ZXMA 4DPWA 4NXMI 1FWLA 2N3HA 3V5RA 1FI4A 2UXCE 1PKPA 1KTVA 4DR6E 4J8ZA 3WU4A 4B3SE 3Q6MA 4JI1E 3J81Q 1Z59A 4OX9I 5L3JA 3ZOQB 3J80Q 5LMNI 1ZM4A 4NXME 2KOUA 3QT6A 4EMDA 2UUBI 3IWDA 1IBMI 2V2VA 4LTYA 2IOQA 1X49A 3M6AA 2JOXA 2ODRC 4JI1I 4JI2I 4F9AB 4DMIA 4LFCI 1ZM2A 2VF3A 4I3HA 1SR9A 1Y4UA 1Y4SA 4DR5E 4Z7CA 4BC7A 4DUYE 4IZJA 1WHNA 4DV0I 4DXLA 1EKZA 1YZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIJ A;  1NHI A;  1A6F A;  4DR2 E;  4X66 E;  4WUC A;  2UUA E;  4M1K A;  1MX0 A;  2F4V E;  1H7S A;  4USK A;  4DUZ E;  4JV5 I;  1KVK A;  1B63 A;  4DU7 A;  4DR2 I;  2DEI A;  4DV4 I;  1FJG E;  3HUL A;  1D6T A;  4DV6 E;  4LFB I;  5A2Q C;  2F4V I;  5LL6 R;  4JI8 I;  2V8P A;  2DEJ A;  4X65 I;  5LMU I;  1HNZ I;  4GKK E;  4Z7Y A;  4DR6 I;  3B78 A;  3QT7 A;  5FLX C;  4YY3 E;  4JI7 E;  4JYA E;  1Z5C A;  1HR0 I;  4DPU A;  1HNW E;  2ZBK B;  5BR8 I;  1Z0V A;  1ELO A;  1BKN A;  4JG4 A;  5FLX Q;  1IBM E;  1MG7 A;  4JI4 E;  1EA6 A;  1FKA E;  3T1H I;  4GKJ E;  4JI7 I;  1XNQ E;  4DR3 E;  4YHH I;  2UXD E;  4DV3 I;  1N36 I;  3J7A M;  2BV3 A;  4DPX A;  1RRE A;  3ZKD A;  3JAM Q;  1Z0E A;  4PRX A;  4DV2 I;  4JI6 I;  4B3R I;  3OTO E;  3T1Y E;  4DPY A;  2HK3 A;  4NXN E;  4X66 I;  2E5L I;  1N0V C;  1KKH A;  1J5E E;  1Z0W A;  2UUC E;  2CZ9 A;  3CWV A;  1I94 I;  2UXB I;  2UXC I;  1XHK A;  4LF7 I;  4XTJ A;  4PU9 A;  4DUZ I;  4B3S I;  3J81 C;  4MYT A;  4DV6 I;  2ZIT A;  2R42 A;  1B62 A;  3ZZU A;  2UUB E;  1PIE A;  2OI2 A;  4FN5 A;  4DV5 I;  3Q1Q A;  2E1R A;  4WUB A;  1NZ0 A;  3PYD A;  2VQF I;  4LFA I;  2ZM6 E;  1NHH A;  2HKE A;  2X7I A;  4JI0 E;  3ZZT A;  4UT4 A;  1Z5B A;  4YY3 I;  3PYE A;  1HNW I;  2VQE I;  4FWH A;  4LF9 I;  5BR8 E;  4B3T I;  1H7U A;  1MU5 A;  2WW4 A;  1ZXN A;  3B8H A;  1EI1 A;  3WU3 A;  1U2R A;  2V34 A;  4P7A A;  4X64 E;  2Q2E B;  3K1J A;  4GKJ I;  1IBL I;  3GON A;  4DR4 E;  4HAC A;  2VQE E;  4DV7 E;  3H4L A;  3J7A G;  4DV0 E;  3QT8 A;  1VIS A;  1H73 A;  4DV2 E;  4JI6 E;  2X36 A;  5IWA I;  4X64 I;  4USM A;  1FNM A;  4LF4 E;  4LF6 I;  1XNR I;  4X65 E;  4DPT A;  4P52 A;  2UXB E;  5LMU E;  4DV1 I;  1Z0T A;  4HYM A;  4KQV A;  4WUD A;  4DU8 A;  4LF4 I;  1HR0 E;  3ZKB A;  1ZM9 A;  4AQY E;  5IT9 Q;  4JI3 E;  3ZM7 A;  4LFB E;  2XEX A;  4JI8 E;  1Z0C A;  4DV5 E;  1FWK A;  3J80 C;  1XMO E;  2VQF E;  2LJP A;  4DR1 I;  4LFA E;  4YHH E;  1N33 E;  2UXD I;  4AQY I;  4JI0 I;  1WUU A;  2HFU A;  3D4J A;  4FWG A;  4UTG A;  4B3R E;  4LF9 E;  4RPF A;  3PYG A;  1XMO I;  1HNX E;  1IBK E;  2HHH E;  4LF5 E;  1N33 I;  2BM0 A;  1OJ4 A;  4ED4 A;  4R1F A;  4DR5 I;  1S4E A;  4JI4 I;  4DR7 E;  1N34 E;  1XNQ I;  1IBL E;  3ZZ0 A;  1QZR A;  2UU9 E;  1S16 A;  4DV7 I;  1N32 I;  4HAC B;  2A2D A;  2A2C A;  1HNX I;  2HHH I;  4LF5 I;  3LPS A;  2HK2 A;  3K17 A;  2UUA I;  4JI2 E;  1XMQ E;  4DR7 I;  5GME A;  1N34 I;  4LFC E;  2E5L E;  1N32 E;  4LF8 E;  3LTO A;  2ZM6 I;  3V2U C;  4JI5 E;  4FWD A;  2V2Z A;  1H72 C;  4JI3 I;  4FW9 A;  1HNZ E;  4GKK I;  2HFS A;  2EFG A;  3LNU A;  4ZVI A;  4OX9 E;  3F0N A;  4B3M E;  4DR1 E;  1DAR A;  4DR4 I;  3PYF A;  5LMN E;  2GS8 A;  3WU5 A;  2R3V A;  5A2Q Q;  5IT9 C;  4HY1 A;  1UEK A;  2J7K A;  4B3T E;  2BM1 A;  3T1H E;  4B3M I;  1Z5A A;  1Z0B A;  5GMD A;  1IBK I;  1PVG A;  4KHP I;  2NPF A;  4PRV A;  1Z0G A;  4DV3 E;  1N36 E;  4DUY I;  4K0K E;  4X62 E;  4JYA I;  1RR9 A;  2V2Q A;  1K47 A;  2AJ4 A;  4MYU A;  2UU9 I;  1ZM3 A;  4NXN I;  4KHP E;  3B82 A;  1J5E I;  5IWA E;  1I94 E;  1H74 A;  1XMQ I;  4K0K I;  4X62 I;  4LF7 E;  4DR3 I;  4LF6 E;  1XNR E;  1NHJ A;  4JV5 E;  3JAM C;  3QT5 A;  4DV1 E;  4DV4 E;  1FJG I;  4LF8 I;  3WU6 A;  4URL A;  3OTO I;  3T1Y I;  4HXZ A;  1N0U A;  4JI5 I;  2HKJ A;  2UUC I;  1ZXM A;  4DPW A;  4NXM I;  1FWL A;  3V5R A;  1FI4 A;  2UXC E;  1PKP A;  1KTV A;  4DR6 E;  3WU4 A;  4B3S E;  4JI1 E;  3J81 Q;  1Z59 A;  4OX9 I;  5L3J A;  3J80 Q;  5LMN I;  1ZM4 A;  4NXM E;  3QT6 A;  4EMD A;  2UUB I;  1IBM I;  2V2V A;  3M6A A;  4JI2 I;  4JI1 I;  4LFC I;  1ZM2 A;  2VF3 A;  4I3H A;  4DR5 E;  4Z7C A;  4DUY E;  4DV0 I;  4DXL A; 
#chains in the Genus database with same CATH topology
 2GHF A;  4MLV A;  2EOJ A;  2RPC A;  1IQS A;  2FGG A;  1RQ0 A;  3PS2 A;  1KIJ A;  2F1D A;  2CPN A;  1NHI A;  1A6F A;  4DR2 E;  2V88 A;  4X66 E;  1OYP A;  1IMU A;  3BID A;  4WUC A;  2EQ0 A;  2DGC A;  1RMD A;  2UUA E;  2EL5 A;  2YTQ A;  4R2A A;  4M1K A;  5A6B D;  2JWO A;  1MX0 A;  2EQ1 A;  1OYR A;  2YTD A;  2F4V E;  1J26 A;  4KWY A;  2HJJ A;  1H7S A;  1AAY A;  2G7H A;  4DUZ E;  4USK A;  1UDN A;  3ADI A;  4JV5 I;  1KVK A;  1B63 A;  2RSM A;  2V2Q A;  4DU7 A;  3M99 B;  2LV2 A;  2C37 A;  5DRP A;  2DEI A;  4DR2 I;  1E3H A;  5C0X A;  1FJG E;  2BA1 D;  3TQM A;  2EMY A;  2NN6 E;  4DV4 I;  3HUL A;  1G2D C;  1UIL A;  4DV6 E;  1D6T A;  2YRM A;  4IZK B;  2V89 A;  2ENA A;  4LFB I;  5A2Q C;  2WP8 B;  2IHR 1;  2F4V I;  5LL6 R;  4R2Q A;  4FW4 A;  2YSO A;  4JI8 I;  5JEA B;  1YYW A;  2V8P A;  2DEJ A;  4X65 I;  2EM7 A;  2Z5C B;  4R8O A;  2EOS A;  3GME A;  4MU1 A;  5LMU I;  4TUG A;  2BA0 D;  2GPI A;  4GKK E;  1HNZ I;  4LCH A;  4Z7Y A;  2D9H A;  4DR6 I;  3B78 A;  4OO1 D;  2EMC A;  4IFD F;  1WHQ A;  5JEA C;  2PO2 A;  3KZY A;  4TUI A;  3P3C A;  5FLX C;  3QT7 A;  3IWC A;  2EN6 A;  4YY3 E;  4JI7 E;  1A1H A;  4JYA E;  1Z5C A;  4FW5 A;  1HR0 I;  1R6L A;  4DPU A;  1HNW E;  2ZBK B;  5AE1 A;  2JXP A;  5BR8 I;  2DMY A;  1Z0V A;  1BKN A;  2N3G A;  1A1K A;  1ELO A;  2PNL A;  3VYY A;  3J7Y p;  4JG4 A;  2YRK A;  1BBO A;  5FLX Q;  5K36 E;  3P76 A;  1IBM E;  1GQE A;  4BBY A;  3B4T A;  4FW3 A;  1MG7 A;  1JK2 A;  3CDI A;  2JVA A;  1WXR A;  5AE3 A;  4JI4 E;  1EA6 A;  1FKA E;  2CT1 A;  3C6M A;  2JY9 A;  4IS9 A;  3T1H I;  5K36 A;  4GKJ E;  2YTO A;  3F6H A;  4JI7 I;  1XNQ E;  2EN7 A;  4DR3 E;  4YHH I;  3P1X A;  2UXD E;  3HPS A;  4WYQ B;  1YUJ A;  2EM0 A;  1UDQ A;  4DV3 I;  1N36 I;  1YPN A;  3KWR A;  2IES A;  2PRT A;  3J7A M;  1UHZ A;  2BV3 A;  3EQ1 A;  2AE8 A;  2EPL X;  4DPX A;  1RRE A;  3ZKD A;  3JAM Q;  1Z0E A;  2I13 A;  1WJP A;  1UN6 B;  4PRX A;  2LCE A;  4DV2 I;  4JI6 I;  4IFD C;  5K36 C;  1KJK A;  4B3R I;  2L2K B;  3OTO E;  3T1Y E;  5K36 F;  2JE6 A;  5EL9 A;  2LUP B;  4NXN E;  2HK3 A;  4DPY A;  3HQ1 A;  1X6H A;  4U3B A;  3GCM A;  2YU8 A;  2ENC A;  4X66 I;  1N0V C;  1KKH A;  2E5L I;  2YPN A;  2JOB A;  1N3G A;  1J5E E;  1Z0W A;  2UUC E;  2CZ9 A;  3CWV A;  1I94 I;  2NN6 D;  2ADR A;  1YFH A;  3M7N D;  1MEY C;  4BCA A;  4BS9 A;  2UXB I;  2E72 A;  2RS6 A;  4R2S A;  2UXC I;  1XHK A;  1OYS A;  5DRQ A;  2O1U A;  2K4V A;  4LF7 I;  4WXD A;  5JEA E;  4XTJ A;  4Q28 A;  2M7Q A;  4PU9 A;  4O24 A;  4DUZ I;  2V86 A;  3EPH A;  4B3S I;  2EPN A;  1P42 A;  2O1T A;  4NBQ A;  2DSY A;  3J81 C;  4QNK A;  2V87 A;  3Q6N A;  2N8X A;  1G2F C;  1A1I A;  4MYT A;  4L8N A;  4OOG C;  3U1K A;  2LUQ A;  2L6M A;  1X47 A;  4WSP A;  4GQU A;  3L00 A;  4DV6 I;  2RTX A;  2ZIT A;  3BF2 A;  2FTX B;  2R42 A;  1B62 A;  3PRY A;  3C4B A;  2UUB E;  3ZZU A;  2EOY A;  1PIE A;  2CSH A;  2OI2 A;  2FV4 B;  4FN5 A;  4DV5 I;  4ZYG A;  3Q1Q A;  2E1R A;  4WUB A;  5ADZ A;  1NZ0 A;  4ISA A;  4BA2 B;  5A69 A;  2EM2 A;  3PYD A;  4RHB B;  2CG9 A;  2VQF I;  2HC5 A;  3MSW A;  4LFA I;  3ADG A;  5TSE A;  4KZS A;  5KL2 A;  3BBG A;  2ZM6 E;  3FIG A;  1NHH A;  2HKE A;  2X7I A;  3C6K A;  4N4R B;  1Y6Z A;  4JI0 E;  4U3D A;  3ZZT A;  3EPK A;  1Y5Y A;  3THO B;  4F2J C;  2YTN A;  3GLL A;  1Z5B A;  4UT4 A;  3PYE A;  4YY3 I;  1X6E A;  2NUF A;  2YTI A;  1T4N A;  2R1F A;  4R03 A;  2B7T A;  2VQE I;  4FWH A;  1HNW I;  4BMJ A;  2EPR A;  4LF9 I;  5BR8 E;  4B3T I;  3IWB A;  3JTZ A;  4P7D A;  2GO4 A;  2V85 A;  1H7U A;  4GEQ B;  1MU5 A;  2RS7 A;  3C4T A;  4X9J A;  2WW4 A;  3P3G A;  2VF1 A;  1ZXN A;  3B8H A;  1EI1 A;  2RSI A;  5EKW A;  1U2R A;  1PJQ A;  3WU3 A;  2K7I A;  2V34 A;  2KHX A;  2VRD A;  4P7A A;  4X64 E;  2Q2E B;  3K1J A;  4GKJ I;  1IBL I;  3OML A;  1F2I G;  3GON A;  4DR4 E;  3VK6 A;  2EMI A;  4RH8 A;  2PNZ B;  4HAC A;  3VYX A;  2VQE E;  4DV7 E;  4N3O A;  4BA2 A;  3H4L A;  1BBG A;  3L7Z B;  1PJT A;  3J7A G;  5T6J A;  4DV0 E;  2LBS B;  1IQO A;  3H09 A;  3QT8 A;  2LVH A;  4F54 A;  1P47 A;  5AC4 A;  1VIS A;  4DV2 E;  4JI6 E;  1H73 A;  4FW6 A;  5DNY A;  2NN6 F;  4R2C A;  2BR2 B;  2X36 A;  2PO0 B;  2DMI A;  5IWA I;  1A1F A;  2B7V A;  3HXL A;  2EMH A;  2EPX A;  4R2E A;  2LRS A;  4USM A;  4X64 I;  4LCG A;  4LF4 E;  5A6A A;  1FNM A;  2YTG A;  4LF6 I;  1XNR I;  4X65 E;  3PS1 A;  2EML A;  2V83 A;  2O1V A;  4AID A;  4P52 A;  4HEI A;  4BC9 A;  2UXB E;  3HPZ A;  2WNR A;  1X3C A;  5LMU E;  2IER A;  4DV1 I;  2JT2 A;  1T39 A;  4R2P A;  1Z0T A;  4IZJ D;  4NHR A;  1QU6 A;  4ZYH A;  4HYM A;  4MU0 A;  5K36 B;  4M30 A;  2B3T B;  1YYK A;  4KQV A;  4WUD A;  2EOX A;  4DKK A;  3H1C A;  4LCF A;  2BA1 G;  2YRH A;  4IJD A;  2Z5B B;  4DU8 A;  4Q35 B;  4LF4 I;  1BB8 A;  2EM9 A;  1HR0 E;  2JR1 A;  3ZKB A;  4LOM A;  1ZM9 A;  4MDT A;  4MQY A;  2DLQ A;  4AQY E;  4O43 A;  3U1Y A;  5IT9 Q;  4JI3 E;  4OO1 F;  3ZM7 A;  4LFB E;  2XEX A;  4JI8 E;  1Z0C A;  5JEA A;  2DB2 A;  2EN1 A;  3LML A;  4DV5 E;  4OO1 E;  1FWK A;  2BR2 A;  1X48 A;  4R2D A;  2DIX A;  2PO0 A;  3ADL A;  2JEA B;  2B9D A;  3J80 C;  1XMO E;  2VQF E;  2LJP A;  4DR1 I;  4LFA E;  2LTS A;  3LLH A;  4YHH E;  4DPT A;  1N33 E;  2UXD I;  2CGE A;  2KON A;  1GZ6 A;  3BGH A;  2VE7 C;  5C0X D;  1YSA C;  4WXC A;  1KYQ A;  2WNR B;  4AQY I;  2O3Z A;  4JI0 I;  2M1S A;  2DLK A;  1WUU A;  1DGC A;  2BB8 A;  2HFU A;  5IXM B;  3D4J A;  3M85 G;  1A1G A;  5DRR A;  4FWG A;  4UTG A;  3JU0 A;  4B3R E;  3AV0 A;  4LF9 E;  1DQ3 A;  4RPF A;  2F8B A;  3PYG A;  2EMX A;  1XMO I;  2EPZ A;  1EH6 A;  1RC7 A;  2JPA A;  1HNX E;  1IBK E;  2HHH E;  2WZO A;  2MKN A;  4LF5 E;  1N33 I;  2BM0 A;  2EOH A;  2JEA A;  1OJ4 A;  4ED4 A;  4R1F A;  4DR5 I;  1ZAA C;  3DJW A;  2PO1 B;  3HTX A;  1S4E A;  4JI4 I;  5A6J A;  2EJ4 A;  2EMW A;  4DR7 E;  5JEA F;  1Y60 A;  1N34 E;  1LLM C;  1XNQ I;  1IBL E;  4GZN C;  2EMZ A;  4P78 A;  1SFE A;  2MC5 A;  4LU9 A;  4ZYE A;  2L92 A;  1T4L B;  1JK1 A;  2UU9 E;  1QZR A;  1S16 A;  3ZZ0 A;  4DV7 I;  1N32 I;  3K85 A;  2PNZ A;  4HAC B;  2A2D A;  2A2C A;  2LTR A;  5DNL A;  1Z1B A;  1HNX I;  1O0W A;  2HHH I;  4LF5 I;  1ZU1 A;  4AIM A;  3LPS A;  2EQ3 A;  2HK2 A;  2YSP A;  3K17 A;  2UUA I;  2L3J A;  2YT4 A;  4JI2 E;  1USV A;  1XMQ E;  4DR7 I;  4R2R A;  5GME A;  1N34 I;  2O1W A;  2L33 A;  5KL6 A;  4LFC E;  2E5L E;  2EOO A;  2EMA A;  4ZYD A;  5C0X F;  5KL7 A;  1N32 E;  2LO3 A;  4JYA I;  2EL4 A;  2IOP A;  4O4K A;  3P06 A;  2LE2 A;  3RMP A;  2C37 B;  4O5G A;  3NZK A;  3ADJ A;  2NUG A;  4LF8 E;  3LTO A;  2CVE A;  2WBU A;  2J7J A;  2ZM6 I;  2V8Q B;  3V2U C;  4IFD D;  2YU5 A;  4JI5 E;  4M2Z A;  3DF6 A;  2J65 A;  1STU A;  4FWD A;  2YZT A;  2WP8 A;  5AC5 A;  2LJH A;  1T38 A;  1UDO A;  2Z5E A;  3L7Z A;  2Z5B A;  2I9I A;  4FK5 C;  2EMG A;  2V2Z A;  2Z5C A;  4HTG A;  1H72 C;  4JI3 I;  2EOF A;  2H36 X;  1HNZ E;  4FW9 A;  4GKK I;  2HFS A;  2L2N A;  2EFG A;  2EM6 A;  4X8W A;  2C39 A;  2LMZ A;  2EOM A;  2M4I A;  2EN2 A;  3LNU A;  2NN6 B;  4MU4 A;  4ZVI A;  5KL5 A;  4OO1 B;  5F3W A;  5K36 D;  2EPP A;  2ODR D;  3PS3 A;  1B69 A;  2L2M A;  4OX9 E;  3F0N A;  4B3M E;  4DR1 E;  4F6N A;  1DAR A;  2EPM X;  4DR4 I;  2MDG A;  2M9A A;  3PYF A;  5FWK A;  5LMN E;  2GS8 A;  3WU5 A;  2R3V A;  2EM3 A;  1ZBT A;  1EKZ A;  5A2Q Q;  2RQL A;  2ELY A;  2NUE A;  2EE8 A;  5IT9 C;  4HY1 A;  3QG5 C;  2L3C A;  3F6G A;  2C38 A;  1UEK A;  4IFD E;  2NA2 A;  5KL3 A;  1UBD C;  1ZBQ A;  2J7K A;  2YTF A;  4B3T E;  2BM1 A;  3KRN A;  4QNJ A;  1EH7 A;  2MDR A;  2WCC 3;  3T1H E;  4M0V A;  1L4S A;  1YYO A;  2E1M A;  2PNM A;  4B3M I;  1Z5A A;  1Z0B A;  5GMD A;  1T4O A;  1ZR9 A;  1IBK I;  1PVG A;  4KHP I;  2EPA A;  2NPF A;  4PRV A;  1Z0G A;  2DRP A;  4DV3 E;  4F9B B;  1N36 E;  1PJS A;  2EOQ A;  1TF6 A;  2GQ0 A;  5C0X B;  4DUY I;  1YHC A;  2YWQ A;  2EM8 A;  4K0K E;  2EPU A;  3HKM A;  3UK3 C;  5ELW A;  2EZ6 A;  4X62 E;  1GTK A;  2EPO A;  2EPC A;  3AUZ A;  4F9C B;  1HK7 A;  1K47 A;  1PDA A;  1NCS A;  4IS1 C;  1RR9 A;  1MGT A;  2EWL A;  1USU A;  2GO3 A;  4WFT A;  2AJ4 A;  2NN6 C;  4MYU A;  2UU9 I;  2R76 A;  4OO1 A;  1ZM3 A;  1DI2 A;  2YTJ A;  2JE6 B;  2JEB A;  1QNT A;  4NXN I;  4AM3 A;  2ENH A;  1A1J A;  1YH8 A;  2MKD A;  2EMB A;  4L5N C;  1E3P A;  3MHS C;  2HGH A;  5LLQ A;  4KHP E;  4WSG A;  5KL4 A;  2L8T A;  2LJU A;  3B82 A;  1J5E I;  1NEI A;  5AAS A;  4OKG A;  2Q8U A;  3THN A;  5IWA E;  4IFD A;  1I94 E;  2EM4 A;  1R6M A;  5CFF E;  1H74 A;  3P3E A;  1XMQ I;  4K0K I;  2YTP A;  2EP3 A;  4X62 I;  1RHY A;  1XXE A;  4LF7 E;  4DR3 I;  2A25 A;  5AE2 A;  3EPL A;  4LF6 E;  2EN4 A;  1XNR E;  4LPF A;  1WRJ A;  3MHH C;  4F6M A;  4BHB A;  1NHJ A;  4JV5 E;  3UHM A;  3JAM C;  3QT5 A;  2WBS A;  1X6F A;  2EMF A;  3ECR A;  2EPK X;  4DV1 E;  3K6Q A;  3DD6 A;  3VHT B;  4DV4 E;  1FJG I;  4LF8 I;  2ELZ A;  3KZZ A;  4WPY A;  4BHC A;  4IZK A;  3WU6 A;  4OZE A;  4URL A;  1A1L A;  3OTO I;  3T1Y I;  2NAB A;  1EH8 A;  2JYA A;  5IV8 B;  1TF3 A;  4HXZ A;  1N0U A;  5A6B A;  2HKJ A;  4I8O A;  5C0X C;  4JI5 I;  3HJC A;  2GLI A;  4BA1 B;  2EL6 A;  4FW7 A;  2UUC I;  2EN8 A;  2JP9 A;  1ZXM A;  4DPW A;  1FWL A;  2N3H A;  2JEB B;  2EOR A;  3V5R A;  4NXM I;  1FI4 A;  2UXC E;  1VI7 A;  1PKP A;  2PO2 B;  4IZJ B;  2BBG A;  1KTV A;  4DR6 E;  4J8Z A;  4J3D A;  1UDS A;  1X5W A;  2LT7 A;  4M9V C;  3CDJ A;  3WU4 A;  4IFD B;  4B3S E;  3Q6M A;  4JI1 E;  2C39 B;  3J81 Q;  1Z59 A;  4OX9 I;  2NN6 A;  1TN9 A;  4MLQ A;  2YTE A;  5L3J A;  3ZOQ B;  3J80 Q;  5LMN I;  3EPJ A;  1ZM4 A;  4NXM E;  2VES A;  2KOU A;  3QT6 A;  4WX9 A;  4EMD A;  2UUB I;  2EM5 A;  3IWD A;  2EOZ A;  4OO1 C;  1IBM I;  2EN3 A;  2V2V A;  4LTY A;  5JEA D;  2IOQ A;  1X49 A;  3M6A A;  2JOX A;  2EMK A;  2ODR C;  2C38 B;  4JI1 I;  2WBT A;  5DRO A;  1YUI A;  5DNX A;  4JI2 I;  2EOE A;  4F9A B;  4DMI A;  4MU3 A;  4LFC I;  4BA1 A;  1ZM2 A;  2VF3 A;  4I3H A;  1SR9 A;  4NZV A;  1Y4U A;  1Y4S A;  4DR5 E;  2PO1 A;  4Z7C A;  4BC7 A;  4DUY E;  3M85 D;  1AH5 A;  4IZJ A;  5A6K A;  2EOI A;  1WHN A;  5C0X E;  3M7N G;  2BA0 G;  2CTD A;  4DV0 I;  4DXL A;  2MC6 A;  1YZ9 A; 
#chains in the Genus database with same CATH homology
 2FGG A;  1RQ0 A;  1KIJ A;  2CPN A;  1NHI A;  1A6F A;  4DR2 E;  2V88 A;  4X66 E;  4WUC A;  2UUA E;  4M1K A;  2JWO A;  1MX0 A;  1J26 A;  2F4V E;  1H7S A;  2G7H A;  4DUZ E;  4USK A;  3ADI A;  4JV5 I;  1KVK A;  1B63 A;  2RSM A;  4DU7 A;  4DR2 I;  2DEI A;  1FJG E;  4DV4 I;  3HUL A;  1UIL A;  4DV6 E;  1D6T A;  4IZK B;  2V89 A;  4LFB I;  5A2Q C;  2F4V I;  2IHR 1;  2MC6 A;  5LL6 R;  4JI8 I;  1YYW A;  2V8P A;  2DEJ A;  4X65 I;  2Z5C B;  4R8O A;  5LMU I;  4TUG A;  4GKK E;  1HNZ I;  4Z7Y A;  4DR6 I;  3B78 A;  1WHQ A;  4TUI A;  3QT7 A;  5FLX C;  3IWC A;  4YY3 E;  4JI7 E;  4JYA E;  1Z5C A;  1HR0 I;  4DPU A;  1HNW E;  2ZBK B;  5AE1 A;  5BR8 I;  2DMY A;  1Z0V A;  1BKN A;  2N3G A;  1ELO A;  2PNL A;  3VYY A;  3J7Y p;  4JG4 A;  5FLX Q;  1IBM E;  1GQE A;  4BBY A;  1MG7 A;  2JVA A;  1WXR A;  5AE3 A;  4JI4 E;  1EA6 A;  1FKA E;  3T1H I;  2JY9 A;  4GKJ E;  3F6H A;  4JI7 I;  1XNQ E;  4DR3 E;  4YHH I;  3P1X A;  2UXD E;  3HPS A;  4WYQ B;  4DV3 I;  1N36 I;  3J7A M;  3KWR A;  1UHZ A;  2BV3 A;  4DPX A;  1RRE A;  3ZKD A;  3JAM Q;  1Z0E A;  4PRX A;  4DV2 I;  4JI6 I;  4B3R I;  2L2K B;  3OTO E;  3T1Y E;  2LUP B;  4NXN E;  2HK3 A;  4DPY A;  3HQ1 A;  4X66 I;  1N0V C;  1KKH A;  2E5L I;  2JOB A;  1J5E E;  1Z0W A;  2UUC E;  2CZ9 A;  3CWV A;  1I94 I;  2UXB I;  4BCA A;  4BS9 A;  2RS6 A;  2UXC I;  1XHK A;  2O1U A;  2K4V A;  4LF7 I;  4XTJ A;  4Q28 A;  2M7Q A;  4PU9 A;  4DUZ I;  2V86 A;  4B3S I;  2O1T A;  2DSY A;  3J81 C;  2V87 A;  3Q6N A;  4MYT A;  4L8N A;  4OOG C;  2LUQ A;  2L6M A;  1X47 A;  4WSP A;  4DV6 I;  2RTX A;  2ZIT A;  2FTX B;  2R42 A;  1B62 A;  3PRY A;  3C4B A;  2UUB E;  3ZZU A;  1PIE A;  2OI2 A;  2FV4 B;  4FN5 A;  4DV5 I;  3Q1Q A;  2E1R A;  4WUB A;  5ADZ A;  1NZ0 A;  3PYD A;  2CG9 A;  2VQF I;  3MSW A;  4LFA I;  3ADG A;  4KZS A;  2ZM6 E;  3FIG A;  1NHH A;  2HKE A;  2X7I A;  1Y6Z A;  4JI0 E;  3ZZT A;  4UT4 A;  1Z5B A;  4YY3 I;  3PYE A;  2NUF A;  1T4N A;  1HNW I;  4R03 A;  2B7T A;  2VQE I;  4FWH A;  4BMJ A;  4LF9 I;  5BR8 E;  4B3T I;  3IWB A;  3JTZ A;  4P7D A;  2V85 A;  1H7U A;  4GEQ B;  1MU5 A;  2RS7 A;  3C4T A;  2WW4 A;  2VF1 A;  1ZXN A;  3B8H A;  1EI1 A;  3WU3 A;  1U2R A;  2V34 A;  2KHX A;  4P7A A;  4X64 E;  2Q2E B;  3K1J A;  4GKJ I;  1IBL I;  3OML A;  3GON A;  4DR4 E;  3VK6 A;  4HAC A;  3VYX A;  2VQE E;  4DV7 E;  4N3O A;  3H4L A;  3J7A G;  5T6J A;  4DV0 E;  2LBS B;  3H09 A;  3QT8 A;  4F54 A;  1VIS A;  4DV2 E;  4JI6 E;  1H73 A;  5DNY A;  2X36 A;  5IWA I;  2B7V A;  3HXL A;  4X64 I;  2LRS A;  4USM A;  4LF4 E;  1FNM A;  4LF6 I;  1XNR I;  4X65 E;  4DPT A;  2V83 A;  2O1V A;  4P52 A;  4BC9 A;  2UXB E;  3HPZ A;  5LMU E;  4DV1 I;  4IZJ D;  1Z0T A;  1QU6 A;  4HYM A;  4M30 A;  2B3T B;  1YYK A;  4KQV A;  4WUD A;  4DKK A;  2Z5B B;  4DU8 A;  4LF4 I;  1HR0 E;  2JR1 A;  3ZKB A;  1ZM9 A;  4AQY E;  5IT9 Q;  4JI3 E;  3ZM7 A;  4LFB E;  2XEX A;  4JI8 E;  1Z0C A;  2DB2 A;  3LML A;  4DV5 E;  1FWK A;  1X48 A;  2DIX A;  3ADL A;  2B9D A;  3J80 C;  1XMO E;  2VQF E;  2LJP A;  4DR1 I;  4LFA E;  2LTS A;  3LLH A;  4YHH E;  1N33 E;  2UXD I;  2CGE A;  2KON A;  1GZ6 A;  2VE7 C;  4AQY I;  4JI0 I;  2M1S A;  1WUU A;  2HFU A;  3D4J A;  4FWG A;  4UTG A;  3JU0 A;  4B3R E;  3AV0 A;  4LF9 E;  1DQ3 A;  4RPF A;  2F8B A;  3PYG A;  1XMO I;  1RC7 A;  1HNX E;  1IBK E;  2HHH E;  2WZO A;  4LF5 E;  1N33 I;  2BM0 A;  1OJ4 A;  4ED4 A;  4R1F A;  4DR5 I;  3DJW A;  3HTX A;  1S4E A;  4JI4 I;  4DR7 E;  1N34 E;  1XNQ I;  1IBL E;  4P78 A;  2MC5 A;  4LU9 A;  1T4L B;  2L92 A;  2UU9 E;  1QZR A;  1S16 A;  3ZZ0 A;  4DV7 I;  1N32 I;  3K85 A;  4HAC B;  2A2D A;  2A2C A;  2LTR A;  1HNX I;  2HHH I;  1O0W A;  4LF5 I;  3LPS A;  2HK2 A;  3K17 A;  2UUA I;  2L3J A;  2YT4 A;  4JI2 E;  1USV A;  1XMQ E;  4DR7 I;  5GME A;  1N34 I;  2O1W A;  2L33 A;  4LFC E;  2E5L E;  1N32 E;  2IOP A;  3P06 A;  2LE2 A;  3RMP A;  3ADJ A;  2NUG A;  4LF8 E;  3LTO A;  2ZM6 I;  2V8Q B;  3V2U C;  4JI5 E;  4M2Z A;  3DF6 A;  1STU A;  4FWD A;  2YZT A;  2LJH A;  2Z5E A;  2Z5B A;  2V2Z A;  2Z5C A;  1H72 C;  4JI3 I;  2H36 X;  1HNZ E;  4FW9 A;  4GKK I;  2HFS A;  2L2N A;  2EFG A;  4IZJ B;  4X8W A;  2LMZ A;  3LNU A;  2M4I A;  4ZVI A;  5F3W A;  2ODR D;  2L2M A;  4OX9 E;  3F0N A;  4B3M E;  4DR1 E;  1DAR A;  4DR4 I;  3PYF A;  5FWK A;  5LMN E;  2GS8 A;  3WU5 A;  2R3V A;  1ZBT A;  5A2Q Q;  2NUE A;  5IT9 C;  4HY1 A;  2L3C A;  3F6G A;  1UEK A;  2NA2 A;  2J7K A;  1ZBQ A;  4B3T E;  2BM1 A;  2PNM A;  2MDR A;  3T1H E;  4M0V A;  1YYO A;  2E1M A;  4B3M I;  1Z5A A;  1Z0B A;  5GMD A;  1T4O A;  1IBK I;  1PVG A;  4KHP I;  2NPF A;  4PRV A;  1Z0G A;  4DV3 E;  4F9B B;  1N36 E;  2GQ0 A;  4DUY I;  4K0K E;  2EZ6 A;  4X62 E;  4JYA I;  4F9C B;  1HK7 A;  3AUZ A;  1RR9 A;  1K47 A;  2V2Q A;  2EWL A;  1USU A;  4WFT A;  2AJ4 A;  4MYU A;  2UU9 I;  1ZM3 A;  1DI2 A;  4NXN I;  4L5N C;  4KHP E;  3B82 A;  2L8T A;  1J5E I;  5AAS A;  5IWA E;  1I94 E;  5CFF E;  1H74 A;  1XMQ I;  4K0K I;  4X62 I;  4LF7 E;  4DR3 I;  5AE2 A;  4LF6 E;  1XNR E;  1NHJ A;  4JV5 E;  3JAM C;  3QT5 A;  4DV1 E;  3K6Q A;  4DV4 E;  1FJG I;  4LF8 I;  3WU6 A;  4WPY A;  4URL A;  4IZK A;  3OTO I;  3T1Y I;  4HXZ A;  1N0U A;  4JI5 I;  2HKJ A;  4I8O A;  3HJC A;  2UUC I;  1ZXM A;  4DPW A;  4NXM I;  1FWL A;  2N3H A;  3V5R A;  1FI4 A;  2UXC E;  1PKP A;  1KTV A;  4DR6 E;  4J8Z A;  3WU4 A;  4B3S E;  3Q6M A;  4JI1 E;  3J81 Q;  1Z59 A;  4OX9 I;  5L3J A;  3ZOQ B;  3J80 Q;  5LMN I;  1ZM4 A;  4NXM E;  2KOU A;  3QT6 A;  4EMD A;  2UUB I;  3IWD A;  1IBM I;  2V2V A;  4LTY A;  2IOQ A;  1X49 A;  3M6A A;  2JOX A;  2ODR C;  4JI1 I;  4JI2 I;  4F9A B;  4DMI A;  4LFC I;  1ZM2 A;  2VF3 A;  4I3H A;  1SR9 A;  1Y4U A;  1Y4S A;  4DR5 E;  4Z7C A;  4BC7 A;  4DUY E;  4IZJ A;  1WHN A;  4DV0 I;  4DXL A;  1EKZ A;  1YZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...