5A2QC

Structure of the hcv ires bound to the human ribosome
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
EWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5a2qC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5a2qC02
4X62E 3B82A 4PU9A 4OX9I 4JI0E 1Z59A 2VQFI 1ZXMA 2EFGA 4B3ME 3JAMC 4DR2I 2LJPA 1XMOI 4YY3E 2HKEA 1MU5A 3B78A 1N33E 1FNMA 2CZ9A 4DPXA 4FN5A 1H73A 4LFCI 4LF6E 1IBLE 4WUBA 4Z7YA 4OX9E 3QT6A 4GKJI 3PYEA 3M6AA 1XNRI 1Z0TA 2VQFE 4DUZE 4WUDA 4DUYI 4XTJA 3LTOA 3OTOI 4LF7I 2UXBI 3Q1QA 1BKNA 1Z0EA 4DR2E 2E1RA 1XMOE 1N34I 4FWDA 4JG4A 1XMQI 4JV5I 4LFCE 1Z5BA 3ZM7A 2E5LI 2DEIA 3WU4A 4GKJE 3WU6A 5IWAI 3CWVA 1NZ0A 2Q2EB 2J7KA 5A2QQ 4DUYE 1FJGI 2GS8A 4ZVIA 4X64I 3LNUA 3J80Q 3OTOE 4LF9I 4LF7E 1NHIA 5LMUI 4USKA 2UXBE 2BM1A 4LFBI 4UTGA 1Z0VA 1N34E 4DV0I 4AQYI 2NPFA 2ZBKB 2ZM6E 1XMQE 3J7AG 4LFAI 5A2QC 2BM0A 3ZZTA 4JV5E 1XHKA 3J80C 4DR4I 2E5LE 1HNWI 1XNQI 1PKPA 1H72C 1KVKA 4DU7A 4DR6I 1EA6A 5IWAE 4HYMA 1EI1A 4HACA 3WU5A 2OI2A 2ZITA 1FJGE 5LMNI 1HR0I 4X64E 4DV7I 4LF9E 1Z0CA 5LMUE 4DV6E 1U2RA 2UUAI 4LFBE 4DV3I 2VQEI 1ELOA 3T1YI 4DV0E 4AQYE 3JAMQ 4KHPI 2XEXA 4I3HA 4LF8E 4LFAE 2V2QA 2UU9I 4DR4E 4K0KI 1HNWE 1XNQE 4Z7CA 1I94I 4DR6E 2HK2A 1MG7A 4DPTA 2BV3A 4LF5I 1N32I 5LMNE 1HR0E 4DV7E 1H7SA 4DR7E 1ZM2A 2UUAE 3B8HA 1S16A 4DV3E 4X66I 2VQEE 3ZZUA 4JI7I 4KHPE 5FLXQ 5L3JA 1MX0A 4DXLA 4JYAI 2UU9E 4K0KE 2HKJA 3F0NA 1I94E 4LF5E 3K1JA 5FLXC 1N32E 1A6FA 4HY1A 3QT8A 1N0VC 5LL6R 2UUBI 4X66E 1K47A 1HNXI 4JI7E 1Z0BA 3GONA 4JYAE 1H7UA 1XNRE 1H74A 1FI4A 4YHHI 1PIEA 4JI8I 5IT9Q 2HFUA 2R42A 1IBMI 2HHHI 4PRVA 1HNZI 4DR5I 2UXCI 4UT4A 2UUBE 1HNXE 5IT9C 2HFSA 3T1HI 2A2DA 1QZRA 3PYGA 1DARA 2V34A 2F4VI 4YHHE 4JI8E 3HULA 1B63A 1D6TA 1J5EI 1KIJA 4B3SI 4MYTA 4JI5I 4B3RI 2WW4A 1IBME 4DV1I 2A2CA 4FWGA 2HHHE 4P52A 1HNZE 4DR1I 4DR5E 2UXCE 4P7AA 4KQVA 1IBKI 3T1HE 4GKKI 2F4VE 1RR9A 4DV5I 4DR3I 1J5EE 1ZM4A 4B3SE 3ZKDA 4JI5E 4B3RE 2UXDI 4R1FA 4DUZI 4DV2I 4DV1E 4JI6I 3T1YE 2DEJA 2UUCI 4DR1E 4USMA 3LPSA 4PRXA 4RPFA 4JI3I 4ED4A 1IBKE 1NHHA 4GKKE 4JI1I 2R3VA 1NHJA 1OJ4A 1RREA 5GMDA 1WUUA 3D4JA 4DV5E 2HK3A 4DR3E 4JI4I 4WUCA 3PYDA 2UXDE 4DV2E 4JI6E 1ZM9A 1PVGA 5GMEA 4HACB 2UUCE 1ZM3A 2V2VA 4JI2I 1ZXNA 4JI3E 4DPWA 2X36A 1N36I 1Z5CA 4JI1E 4X65I 1Z5AA 2ZM6I 4DPYA 5BR8I 3H4LA 1FKAE 3QT7A 1S4EA 1VISA 4DU8A 2AJ4A 2VF3A 4DV4I 4FWHA 3ZKBA 4JI4E 4B3TI 3ZZ0A 4NXNI 1FWLA 2X7IA 3WU3A 3V5RA 4NXMI 1FWKA 1KTVA 1UEKA 4URLA 3K17A 4DV6I 4JI2E 4LF4I 1N36E 4MYUA 4M1KA 4X62I 4X65E 3J81Q 4HXZA 4FW9A 4JI0I 3J7AM 5BR8E 4LF8I 4DV4E 3V2UC 4B3TE 4EMDA 4NXNE 1N0UA 4B3MI 3J81C 1Z0WA 4YY3I 4DPUA 4NXME 1Z0GA 1N33I 1KKHA 3QT5A 4DR7I 1B62A 2V2ZA 3PYFA 2V8PA 4LF4E 4LF6I 1IBLI
chains in the Genus database with same CATH superfamily
4X62E 2DB2A 1AAYA 1OYSA 1Y4SA 2YTPA 3B82A 4IFDE 4PU9A 4OX9I 2LE2A 4JI0E 2YPNA 2EN4A 3EPHA 4O24A 5F3WA 1YUJA 2GLIA 1YH8A 5AE1A 2B3TB 5KL5A 2EOSA 4OO1D 1Z59A 4LTYA 1B69A 1EH8A 2VQFI 2NN6E 3M85D 2NUGA 1DGCA 2WBUA 1ZXMA 1BBGA 5C0XD 2BA1D 3LMLA 3GLLA 3THNA 5KL4A 4HTGA 2EZ6A 1X5WA 2EMFA 2M4IA 4X9JA 2EFGA 2EM7A 2NABA 4B3ME 2N8XA 3JAMC 4DR2I 1IQOA 2EQ1A 2V88A 1A1KA 4M2ZA 2LJPA 4YY3E 4WSGA 2PO2B 2L2NA 3L7ZA 1XMOI 4OO1F 2HKEA 2ELZA 1MU5A 2C38A 2J65A 4FW3A 3B78A 1N33E 4RHBB 1FNMA 2CZ9A 3BGHA 4DPXA 1F2IG 4FN5A 4IFDD 2CPNA 2EN6A 2WNRB 1SFEA 1R6LA 1H73A 3DJWA 4LFCI 4LF6E 3P3GA 1IBLE 4WUBA 5EKWA 2EN2A 4Z7YA 4OX9E 3QT6A 2EN3A 2CT1A 4GKJI 2EPUA 2NN6D 2RQLA 3PYEA 4X8WA 4WX9A 3M6AA 1YFHA 1E3PA 1XNRI 3C6MA 1ZU1A 4WFTA 2VQFE 1J26A 4DUZE 1Z0TA 4WUDA 4DUYI 3H09A 5AASA 1USUA 4XTJA 2EPZA 4IJDA 4R2EA 1HK7A 3LTOA 3OTOI 3J7Yp 5AE2A 1BB8A 4LF7I 3GCMA 2LJUA 1BKNA 2EOJA 1Z0EA 4DR2E 4NBQA 3Q1QA 2UXBI 2EMXA 2K4VA 2K7IA 2YTOA 2EL6A 1XMOE 2B7VA 2E1RA 2VF1A 1N34I 5LLQA 3AV0A 2L8TA 1YYWA 4FWDA 2PO1A 3P06A 4JG4A 2MC6A 2C37B 3AUZA 2EMWA 4WSPA 2PNZA 2Z5EA 2EOIA 2VESA 1XMQI 4N3OA 1MGTA 3MSWA 4QNJA 4JV5I 2CGEA 2EJ4A 4LFCE 2EPOA 1Z5BA 3ZM7A 2E5LI 2DEIA 4F54A 1STUA 1X48A 3WU4A 1UN6B 2FTXB 4GKJE 1E3HA 3WU6A 1A1LA 5IWAI 2JPAA 5T6JA 3CWVA 3C6KA 1NZ0A 2J7KA 2EN1A 4DUYE 2Q2EB 5A2QQ 3Q6NA 1PJQA 2GS8A 1FJGI 4ZVIA 4X64I 3LNUA 3J80Q 3OTOE 4MU4A 4LF9I 2PO2A 4LF7E 3IWCA 1NHIA 5LMUI 2UXBE 4R2QA 4USKA 3M7NG 4BA2B 2HJJA 4R2DA 4IS1C 1DI2A 2BM1A 2F8BA 2N3GA 1Z0VA 1N34E 4UTGA 4LFBI 5K36E 2JEBB 2L3JA 5C0XC 4DV0I 4O5GA 2WNRA 2YTQA 4IZJA 1X47A 3MHSC 2EPMX 4AQYI 2NPFA 2NN6B 4ZYDA 2ZBKB 4F9BB 2ZM6E 3K85A 1XMQE 3J7AG 4LFAI 3VK6A 4F2JC 5A2QC 2BM0A 1IQSA 1QU6A 3PRYA 3ZZTA 1RC7A 4KZSA 3JTZA 3TQMA 4JV5E 1XHKA 2ADRA 1N3GA 1WXRA 3J80C 4MU1A 2E5LE 4DR4I 3GMEA 1HNWI 1UILA 1XNQI 1PKPA 1A1GA 2O1WA 3FIGA 1H72C 1KVKA 4MU3A 4DU7A 4IFDC 4DR6I 1EA6A 1T4NA 2YTDA 5IWAE 3QG5C 4HYMA 2JOBA 3K6QA 2KOUA 1G2FC 5KL7A 1EI1A 4HACA 2EM2A 3MHHC 4I8OA 1TF3A 5DNYA 2EMHA 2WP8A 2YRHA 2OI2A 2ZITA 2EWLA 1FJGE 2JEAB 1G2DC 5LMNI 1HR0I 2RSIA 2EE8A 4X64E 2NN6C 2RS7A 4DV7I 4LF9E 2VRDA 4BHCA 2MC5A 2MKDA 1Z0CA 5LMUE 2EMYA 4BC9A 2V83A 4DV6E 1X6EA 2GO4A 4N4RB 1U2RA 4LFBE 5KL6A 3EPLA 2UUAI 2ENAA 1ZBTA 1T4OA 4DV3I 5DNLA 2VQEI 1ELOA 4R2PA 3T1YI 4DV0E 4OO1A 2BR2A 3KRNA 4AQYE 3JAMQ 4KHPI 2XEXA 4F6NA 4I3HA 1NCSA 4LF8E 4LFAE 5DNXA 2D9HA 2NUFA 4M0VA 5C0XA 1X6FA 2R76A 3HJCA 2E72A 1KYQA 1UHZA 2R1FA 4DR4E 2V2QA 2UU9I 2I9IA 2O3ZA 2DMYA 1HNWE 4K0KI 1XNQE 1EKZA 3UHMA 4WYQB 4NHRA 4Z7CA 1I94I 4DR6E 2EMZA 2HK2A 1UBDC 1MG7A 2F1DA 4LCGA 4DPTA 4DMIA 1AH5A 2BV3A 4LF5I 2Z5CA 3B4TA 2LO3A 4QNKA 2YRMA 2EMKA 1KJKA 4IFDA 1N32I 5LMNE 1JK2A 1HR0E 2YTFA 4KWYA 2EPXA 1WJPA 4DV7E 2RS6A 1YYKA 1H7SA 4DR7E 5C0XF 1ZM2A 2JEBA 1XXEA 1YPNA 4R2SA 2UUAE 5JEAE 3P3CA 3B8HA 1S16A 2NN6A 4DV3E 4X66I 2VQEE 3CDIA 3ZZUA 4U3DA 4JI7I 4KHPE 1IBLI 2C39A 1UDOA 4IZKA 4LPFA 5FLXQ 2EP3A 3RMPA 5L3JA 4M9VC 1O0WA 2YT4A 1MX0A 4F9AB 4DXLA 4JYAI 2UU9E 4IFDF 5DROA 4K0KE 5K36B 4FW5A 1Y4UA 2HC5A 2N3HA 2HKJA 3F0NA 1I94E 3PS2A 2CTDA 2JEAA 3BF2A 4BHBA 3HPZA 2BBGA 2E1MA 4LF5E 2NN6F 3M85G 4LOMA 3L00A 1PJSA 3K1JA 5FLXC 1N32E 2WZOA 4MQYA 2BA0D 5JEAD 2BA1G 2EN7A 3ADGA 1A6FA 3EPKA 4HY1A 4Q35B 3DD6A 2EM5A 2EOHA 3QT8A 1Z1BA 1UDSA 2PO0A 4P78A 3P76A 1UDNA 1N0VC 2EPKX 5LL6R 3M7ND 2YTNA 2UUBI 2YTJA 2BB8A 4X66E 5AC4A 3BIDA 1K47A 1HNXI 2EQ3A 5K36C 4JI7E 3U1YA 4U3BA 2DLQA 2YSOA 4GQUA 1RQ0A 1Z0BA 3GONA 2EPPA 4JYAE 2KHXA 3HPSA 4BMJA 4MLVA 1XNRE 1H7UA 1H74A 1FI4A 5A6BD 4YHHI 1PIEA 4JI8I 1YZ9A 2GPIA 4DKKA 5A6AA 2AE8A 4BCAA 5IT9Q 1ZBQA 2LTRA 3VYYA 2LVHA 2HFUA 2M9AA 2NA2A 2JVAA 2YWQA 2R42A 5FWKA 1IBMI 3DF6A 2HHHI 4PRVA 2YU8A 1HNZI 4R2RA 4DR5I 2UXCI 1JK1A 1UDQA 3THOB 4UT4A 1RHYA 2UUBE 3HKMA 2LUQA 1HNXE 5IT9C 2HFSA 5IXMB 2JYAA 3T1HI 2A2DA 3PS3A 4BC7A 2M7QA 1QZRA 2L92A 4FW7A 3M99B 5ADZA 3L7ZB 2WCC3 5EL9A 2V89A 2MKNA 2EMGA 4R03A 1DARA 2V34A 3PYGA 4OZEA 5K36A 2F4VI 3JU0A 2EMIA 1QNTA 2EMBA 3LLHA 2EOEA 5A6JA 4YHHE 4JI8E 3HULA 5JEAB 2EMCA 1B63A 2M1SA 5K36D 2DSYA 1IMUA 3ECRA 5TSEA 1D6TA 1J5EI 2EOZA 1KIJA 4B3SI 2L3CA 4LCHA 4MYTA 4JI5I 4B3RI 2C37A 1PJTA 2Z5BB 1IBME 2WW4A 4DV1I 2LUPB 2EOYA 2A2CA 2LCEA 4F9CB 1TN9A 2EM9A 4F6MA 2HHHE 1P42A 4FWGA 1Y6ZA 3HTXA 4P52A 2EOFA 4P7DA 1HNZE 3VYXA 4DR1I 2IESA 4DR5E 2UXCE 5K36F 2ENHA 2PRTA 1PDAA 2EPCA 2J7JA 4TUIA 4P7AA 4ZYEA 2JR1A 2L6MA 4KQVA 2LTSA 3ZOQB 1WHQA 2JXPA 3H1CA 2IOPA 3IWDA 5JEAC 3T1HE 2GQ0A 1IBKI 1T4LB 4GKKI 1OYPA 3C4BA 2Q8UA 4ZYGA 1LLMC 2EM4A 1GTKA 1X49A 3KZYA 2PO1B 2NUEA 2F4VE 1NEIA 2EMLA 2LV2A 2YRKA 1RR9A 2PNZB 4DV5I 2WBTA 3KZZA 4BA2A 1ZR9A 4DR3I 4BS9A 3EQ1A 2A25A 3CDJA 5ELWA 3PS1A 1J5EE 4B3SE 1ZM4A 3ADLA 3ZKDA 4JI5E 3VHTB 2YZTA 4B3RE 2UXDI 2I13A 1YYOA 2DLKA 2H36X 4R1FA 4DUZI 4DV2I 4DV1E 4JI6I 2KONA 2V85A 3T1YE 4TUGA 4NZVA 1T38A 2JP9A 2DEJA 2UUCI 3HXLA 4DR1E 4USMA 5AC5A 4FK5C 4M30A 4LCFA 4OKGA 3LPSA 2DIXA 5A6KA 2DGCA 4PRXA 4MLQA 4RPFA 4JI3I 4Q28A 4ED4A 1IBKE 2B9DA 2EPLX 3EPJA 2EM8A 4ZYHA 1WRJA 4GKKE 1NHHA 4JI1I 4BA1B 3NZKA 4WXCA 2RTXA 2R3VA 1DQ3A 2GHFA 4J3DA 5JEAA 1NHJA 1OJ4A 4WXDA 1RREA 4IZJB 2L2KB 1RMDA 3IWBA 2DRPA 2LRSA 5GMDA 3UK3C 1WUUA 3D4JA 4DV5E 2JOXA 2JE6B 2ENCA 2FGGA 2JY9A 4O43A 2PNLA 2HK3A 1GZ6A 4DR3E 4JI4I 2EOQA 2Z5BA 4WUCA 4IS9A 3PYDA 2UXDE 2EOMA 2JT2A 4DV2E 4L5NC 4JI6E 2EM3A 2EL4A 1ZM9A 1PVGA 5GMEA 1OYRA 3F6HA 4HACB 2UUCE 1L4SA 4HEIA 2WP8B 5A6BA 5JEAF 1ZM3A 2YTIA 2V2VA 2V87A 5IV8B 2B7TA 2IERA 4JI2I 1ZXNA 4JI3E 4DPWA 4LU9A 1YUIA 2X36A 2YTEA 1N36I 2FV4B 4MDTA 2EM0A 1Z5CA 4JI1E 2LMZA 2LBSB 2ODRC 1A1JA 3KWRA 4X65I 1Z5AA 2EQ0A 2ZM6I 4DPYA 5BR8I 2IOQA 1FKAE 1SR9A 2BR2B 3H4LA 4OO1B 2CVEA 3F6GA 2EM6A 1S4EA 1VISA 3QT7A 4DU8A 2AJ4A 2VF3A 4DV4I 1T39A 4FWHA 2DMIA 2RSMA 5C0XB 2YU5A 3ZKBA 2EORA 2V8QB 4JI4E 4RH8A 4B3TI 2RPCA 3ZZ0A 1P47A 4AM3A 2EOXA 1A1HA 2JWOA 4NXNI 5DRQA 1FWLA 3BBGA 4R2AA 1R6MA 5CFFE 4GZNC 2BA0G 1Y60A 2EL5A 2X7IA 3WU3A 2V86A 3V5RA 2VE7C 4NXMI 4L8NA 1FWKA 1KTVA 1UEKA 1TF6A 2Z5CB 4URLA 3K17A 2CG9A 4IFDB 3Q6MA 4OO1C 2YSPA 3P1XA 4AIDA 4DV6I 2C38B 4JI2E 2MDGA 4MU0A 4BA1A 4LF4I 1YSAC 3U1KA 1N36E 4OOGC 4O4KA 1GQEA 4MYUA 2MDRA 4M1KA 4X62I 2O1TA 4X65E 1EH6A 3J81Q 4HXZA 4FW9A 4JI0I 3J7AM 3C4TA 5BR8E 5AE3A 1USVA 2JE6A 2EOOA 2YTGA 4LF8I 1EH7A 1MEYC 4R2CA 1BBOA 2C39B 4IZKB 2L2MA 4DV4E 2ELYA 4ISAA 2CSHA 4IZJD 1YHCA 2GO3A 2O1UA 2PNMA 2WBSA 3V2UC 5DRRA 4OO1E 2IHR1 4B3TE 1A1FA 2LT7A 4AIMA 1X6HA 4EMDA 2ODRD 4NXNE 3ADJA 1N0UA 3P3EA 5KL3A 1ZAAC 4B3MI 4FW4A 3ADIA 2HGHA 1Y5YA 3WU5A 3J81C 1Z0WA 5C0XE 2EMAA 5KL2A 4YY3I 4GEQB 3HQ1A 2LJHA 4FW6A 2EN8A 2EPRA 4NXME 1VI7A 2EPNA 2L33A 1Z0GA 4DPUA 4R8OA 5A69A 1N33I 2G7HA 1KKHA 1A1IA 3QT5A 5DRPA 4WPYA 3OMLA 2O1VA 4DR7I 1B62A 2V2ZA 3PYFA 2V8PA 1WHNA 4J8ZA 4LF4E 4BBYA 1X3CA 4LF6I 2PO0B 2EPAA
chains in the Genus database with same CATH topology
4X62E 2DB2A 1Y4SA 3B82A 4PU9A 4OX9I 2LE2A 4JI0E 5F3WA 5AE1A 2B3TB 1Z59A 4LTYA 2VQFI 2NUGA 1ZXMA 3LMLA 2EZ6A 2M4IA 2EFGA 4B3ME 3JAMC 4DR2I 2LJPA 2V88A 4M2ZA 1XMOI 4YY3E 2L2NA 2HKEA 1MU5A 3B78A 1N33E 1FNMA 2CZ9A 4DPXA 4FN5A 2CPNA 1H73A 3DJWA 4LFCI 4LF6E 1IBLE 4WUBA 4Z7YA 4OX9E 3QT6A 4GKJI 3PYEA 4X8WA 3M6AA 1XNRI 1Z0TA 4WFTA 1J26A 2VQFE 4DUZE 4WUDA 4DUYI 3H09A 5AASA 1USUA 4XTJA 1HK7A 3LTOA 3OTOI 3J7Yp 5AE2A 4LF7I 2UXBI 3Q1QA 1BKNA 1Z0EA 4DR2E 2K4VA 1XMOE 2E1RA 1N34I 2B7VA 2VF1A 3AV0A 2L8TA 1YYWA 4FWDA 3P06A 4JG4A 2MC6A 3AUZA 4WSPA 2Z5EA 1XMQI 4N3OA 3MSWA 4JV5I 2CGEA 4LFCE 1Z5BA 3ZM7A 2E5LI 2DEIA 4F54A 1STUA 1X48A 3WU4A 2FTXB 4GKJE 3WU6A 5IWAI 5T6JA 3CWVA 1NZ0A 2Q2EB 2J7KA 5A2QQ 4DUYE 1FJGI 3Q6NA 2GS8A 4ZVIA 4X64I 3LNUA 3J80Q 3OTOE 4LF9I 4LF7E 3IWCA 1NHIA 5LMUI 2UXBE 4USKA 1DI2A 2BM1A 4LFBI 4UTGA 2F8BA 2N3GA 1Z0VA 1N34E 2L3JA 4DV0I 4AQYI 4IZJA 1X47A 2NPFA 2ZBKB 4F9BB 2ZM6E 3K85A 1XMQE 3J7AG 4LFAI 3VK6A 5A2QC 2BM0A 1QU6A 3PRYA 3ZZTA 4JV5E 4KZSA 1RC7A 3JTZA 1XHKA 1WXRA 3J80C 4DR4I 2E5LE 1HNWI 1UILA 1XNQI 1PKPA 2O1WA 3FIGA 1H72C 1KVKA 4DU7A 4DR6I 1EA6A 1T4NA 5IWAE 4HYMA 2JOBA 3K6QA 2KOUA 1EI1A 4HACA 3WU5A 4I8OA 5DNYA 2OI2A 2ZITA 2EWLA 1FJGE 5LMNI 1HR0I 4X64E 2RS7A 4DV7I 4LF9E 1Z0CA 2MC5A 5LMUE 4BC9A 2V83A 4DV6E 1U2RA 2UUAI 4LFBE 1ZBTA 1T4OA 4DV3I 2VQEI 1ELOA 3T1YI 4DV0E 4AQYE 3JAMQ 4KHPI 2XEXA 4I3HA 4LF8E 4LFAE 2NUFA 4M0VA 3HJCA 2V2QA 1UHZA 4DR4E 2UU9I 2DMYA 1HNWE 4K0KI 1XNQE 1EKZA 4WYQB 4Z7CA 1I94I 4DR6E 2HK2A 1MG7A 4DPTA 4DMIA 2BV3A 4LF5I 2Z5CA 1N32I 5LMNE 1HR0E 4DV7E 2RS6A 1YYKA 1H7SA 4DR7E 1ZM2A 2UUAE 3B8HA 1S16A 4DV3E 4X66I 2VQEE 3ZZUA 4JI7I 4KHPE 4IZKA 5FLXQ 3RMPA 5L3JA 1O0WA 2YT4A 1MX0A 4DXLA 4JYAI 2UU9E 4K0KE 1Y4UA 2N3HA 2HKJA 3F0NA 1I94E 3HPZA 2E1MA 4LF5E 3K1JA 5FLXC 1N32E 2WZOA 3ADGA 1A6FA 4HY1A 3QT8A 4P78A 1N0VC 5LL6R 2UUBI 4X66E 1K47A 1HNXI 4JI7E 1RQ0A 1Z0BA 3GONA 4JYAE 2KHXA 3HPSA 4BMJA 1H7UA 1XNRE 1H74A 1FI4A 4YHHI 1PIEA 4JI8I 1YZ9A 4DKKA 4BCAA 5IT9Q 1ZBQA 2LTRA 3VYYA 2HFUA 2NA2A 2JVAA 2R42A 5FWKA 1IBMI 3DF6A 2HHHI 4PRVA 1HNZI 4DR5I 2UXCI 4UT4A 2UUBE 2LUQA 1HNXE 5IT9C 2HFSA 3T1HI 2A2DA 4BC7A 2M7QA 1QZRA 2L92A 5ADZA 2V89A 4R03A 1DARA 2V34A 3PYGA 2F4VI 3JU0A 3LLHA 4YHHE 4JI8E 3HULA 1B63A 2M1SA 2DSYA 1D6TA 1J5EI 1KIJA 4B3SI 2L3CA 4MYTA 4JI5I 4B3RI 2Z5BB 1IBME 2WW4A 4DV1I 2LUPB 2A2CA 4FWGA 4F9CB 2HHHE 4P52A 1Y6ZA 3HTXA 4P7DA 3VYXA 1HNZE 4DR1I 4DR5E 2UXCE 4TUIA 4P7AA 2JR1A 2L6MA 4KQVA 2LTSA 3ZOQB 1WHQA 2IOPA 3IWDA 1IBKI 3T1HE 2GQ0A 1T4LB 4GKKI 3C4BA 1X49A 2NUEA 2F4VE 1RR9A 4DV5I 4DR3I 4BS9A 1J5EE 4B3SE 1ZM4A 3ADLA 3ZKDA 4JI5E 4B3RE 2YZTA 2UXDI 1YYOA 2H36X 4R1FA 4DUZI 4DV2I 4DV1E 4JI6I 2KONA 2V85A 3T1YE 4TUGA 2DEJA 2UUCI 3HXLA 4DR1E 4USMA 4M30A 3LPSA 2DIXA 4PRXA 4RPFA 4JI3I 4Q28A 4ED4A 1IBKE 2B9DA 1NHHA 4GKKE 4JI1I 2RTXA 2R3VA 1DQ3A 1NHJA 1OJ4A 1RREA 4IZJB 2L2KB 3IWBA 2LRSA 5GMDA 1WUUA 3D4JA 4DV5E 2JOXA 2FGGA 2JY9A 2PNLA 2HK3A 1GZ6A 4DR3E 4JI4I 2Z5BA 4WUCA 3PYDA 2UXDE 4DV2E 4L5NC 4JI6E 1ZM9A 1PVGA 5GMEA 3F6HA 4HACB 2UUCE 1ZM3A 2V2VA 2V87A 2B7TA 4JI2I 1ZXNA 4JI3E 4DPWA 4LU9A 2X36A 1N36I 2FV4B 1Z5CA 4JI1E 2LMZA 2LBSB 2ODRC 4X65I 3KWRA 1Z5AA 2ZM6I 4DPYA 5BR8I 2IOQA 1FKAE 1SR9A 3H4LA 3QT7A 3F6GA 1S4EA 1VISA 4DU8A 2AJ4A 2VF3A 4DV4I 4FWHA 2RSMA 3ZKBA 2V8QB 4JI4E 4B3TI 3ZZ0A 4NXNI 2JWOA 1FWLA 5CFFE 2X7IA 3WU3A 2V86A 3V5RA 2VE7C 4NXMI 4L8NA 1FWKA 1KTVA 1UEKA 2Z5CB 4URLA 3K17A 2CG9A 3Q6MA 3P1XA 4DV6I 4JI2E 4LF4I 1N36E 4OOGC 1GQEA 4MYUA 2MDRA 4M1KA 4X62I 2O1TA 4X65E 3J81Q 4HXZA 4FW9A 4JI0I 3J7AM 3C4TA 5BR8E 5AE3A 1USVA 4LF8I 4IZKB 2L2MA 4DV4E 4IZJD 2O1UA 2PNMA 3V2UC 2IHR1 4B3TE 4EMDA 2ODRD 4NXNE 3ADJA 1N0UA 4B3MI 3ADIA 3J81C 1Z0WA 4YY3I 4GEQB 3HQ1A 2LJHA 4DPUA 4NXME 1Z0GA 2L33A 4R8OA 1N33I 2G7HA 1KKHA 3QT5A 4WPYA 3OMLA 2O1VA 4DR7I 1B62A 2V2ZA 3PYFA 2V8PA 1WHNA 4J8ZA 4LF4E 4BBYA 4F9AB 4LF6I 1IBLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 E;  3B82 A;  4PU9 A;  4OX9 I;  4JI0 E;  1Z59 A;  2VQF I;  1ZXM A;  2EFG A;  4B3M E;  3JAM C;  4DR2 I;  2LJP A;  1XMO I;  4YY3 E;  2HKE A;  1MU5 A;  3B78 A;  1N33 E;  1FNM A;  2CZ9 A;  4DPX A;  4FN5 A;  1H73 A;  4LFC I;  4LF6 E;  1IBL E;  4WUB A;  4Z7Y A;  4OX9 E;  3QT6 A;  4GKJ I;  3PYE A;  3M6A A;  1XNR I;  1Z0T A;  2VQF E;  4DUZ E;  4WUD A;  4DUY I;  4XTJ A;  3LTO A;  3OTO I;  4LF7 I;  2UXB I;  3Q1Q A;  1BKN A;  1Z0E A;  4DR2 E;  2E1R A;  1XMO E;  1N34 I;  4FWD A;  4JG4 A;  1XMQ I;  4JV5 I;  4LFC E;  1Z5B A;  3ZM7 A;  2E5L I;  2DEI A;  3WU4 A;  4GKJ E;  3WU6 A;  5IWA I;  3CWV A;  1NZ0 A;  2Q2E B;  2J7K A;  5A2Q Q;  4DUY E;  1FJG I;  2GS8 A;  4ZVI A;  4X64 I;  3LNU A;  3J80 Q;  3OTO E;  4LF9 I;  4LF7 E;  1NHI A;  5LMU I;  4USK A;  2UXB E;  2BM1 A;  4LFB I;  4UTG A;  1Z0V A;  1N34 E;  4DV0 I;  4AQY I;  2NPF A;  2ZBK B;  2ZM6 E;  1XMQ E;  3J7A G;  4LFA I;  5A2Q C;  2BM0 A;  3ZZT A;  4JV5 E;  1XHK A;  3J80 C;  4DR4 I;  2E5L E;  1HNW I;  1XNQ I;  1PKP A;  1H72 C;  1KVK A;  4DU7 A;  4DR6 I;  1EA6 A;  5IWA E;  4HYM A;  1EI1 A;  4HAC A;  3WU5 A;  2OI2 A;  2ZIT A;  1FJG E;  5LMN I;  1HR0 I;  4X64 E;  4DV7 I;  4LF9 E;  1Z0C A;  5LMU E;  4DV6 E;  1U2R A;  2UUA I;  4LFB E;  4DV3 I;  2VQE I;  1ELO A;  3T1Y I;  4DV0 E;  4AQY E;  3JAM Q;  4KHP I;  2XEX A;  4I3H A;  4LF8 E;  4LFA E;  2V2Q A;  2UU9 I;  4DR4 E;  4K0K I;  1HNW E;  1XNQ E;  4Z7C A;  1I94 I;  4DR6 E;  2HK2 A;  1MG7 A;  4DPT A;  2BV3 A;  4LF5 I;  1N32 I;  5LMN E;  1HR0 E;  4DV7 E;  1H7S A;  4DR7 E;  1ZM2 A;  2UUA E;  3B8H A;  1S16 A;  4DV3 E;  4X66 I;  2VQE E;  3ZZU A;  4JI7 I;  4KHP E;  5FLX Q;  5L3J A;  1MX0 A;  4DXL A;  4JYA I;  2UU9 E;  4K0K E;  2HKJ A;  3F0N A;  1I94 E;  4LF5 E;  3K1J A;  5FLX C;  1N32 E;  1A6F A;  4HY1 A;  3QT8 A;  1N0V C;  5LL6 R;  2UUB I;  4X66 E;  1K47 A;  1HNX I;  4JI7 E;  1Z0B A;  3GON A;  4JYA E;  1H7U A;  1XNR E;  1H74 A;  1FI4 A;  4YHH I;  1PIE A;  4JI8 I;  5IT9 Q;  2HFU A;  2R42 A;  1IBM I;  2HHH I;  4PRV A;  1HNZ I;  4DR5 I;  2UXC I;  4UT4 A;  2UUB E;  1HNX E;  5IT9 C;  2HFS A;  3T1H I;  2A2D A;  1QZR A;  3PYG A;  1DAR A;  2V34 A;  2F4V I;  4YHH E;  4JI8 E;  3HUL A;  1B63 A;  1D6T A;  1J5E I;  1KIJ A;  4B3S I;  4MYT A;  4JI5 I;  4B3R I;  2WW4 A;  1IBM E;  4DV1 I;  2A2C A;  4FWG A;  2HHH E;  4P52 A;  1HNZ E;  4DR1 I;  4DR5 E;  2UXC E;  4P7A A;  4KQV A;  1IBK I;  3T1H E;  4GKK I;  2F4V E;  1RR9 A;  4DV5 I;  4DR3 I;  1J5E E;  1ZM4 A;  4B3S E;  3ZKD A;  4JI5 E;  4B3R E;  2UXD I;  4R1F A;  4DUZ I;  4DV2 I;  4DV1 E;  4JI6 I;  3T1Y E;  2DEJ A;  2UUC I;  4DR1 E;  4USM A;  3LPS A;  4PRX A;  4RPF A;  4JI3 I;  4ED4 A;  1IBK E;  1NHH A;  4GKK E;  4JI1 I;  2R3V A;  1NHJ A;  1OJ4 A;  1RRE A;  5GMD A;  1WUU A;  3D4J A;  4DV5 E;  2HK3 A;  4DR3 E;  4JI4 I;  4WUC A;  3PYD A;  2UXD E;  4DV2 E;  4JI6 E;  1ZM9 A;  1PVG A;  5GME A;  4HAC B;  2UUC E;  1ZM3 A;  2V2V A;  4JI2 I;  1ZXN A;  4JI3 E;  4DPW A;  2X36 A;  1N36 I;  1Z5C A;  4JI1 E;  4X65 I;  1Z5A A;  2ZM6 I;  4DPY A;  5BR8 I;  3H4L A;  1FKA E;  3QT7 A;  1S4E A;  1VIS A;  4DU8 A;  2AJ4 A;  2VF3 A;  4DV4 I;  4FWH A;  3ZKB A;  4JI4 E;  4B3T I;  3ZZ0 A;  4NXN I;  1FWL A;  2X7I A;  3WU3 A;  3V5R A;  4NXM I;  1FWK A;  1KTV A;  1UEK A;  4URL A;  3K17 A;  4DV6 I;  4JI2 E;  4LF4 I;  1N36 E;  4MYU A;  4M1K A;  4X62 I;  4X65 E;  3J81 Q;  4HXZ A;  4FW9 A;  4JI0 I;  3J7A M;  5BR8 E;  4LF8 I;  4DV4 E;  3V2U C;  4B3T E;  4EMD A;  4NXN E;  1N0U A;  4B3M I;  3J81 C;  1Z0W A;  4YY3 I;  4DPU A;  4NXM E;  1Z0G A;  1N33 I;  1KKH A;  3QT5 A;  4DR7 I;  1B62 A;  2V2Z A;  3PYF A;  2V8P A;  4LF4 E;  4LF6 I;  1IBL I; 
#chains in the Genus database with same CATH topology
 4X62 E;  2DB2 A;  1AAY A;  1OYS A;  1Y4S A;  2YTP A;  3B82 A;  4IFD E;  4PU9 A;  4OX9 I;  2LE2 A;  4JI0 E;  2YPN A;  2EN4 A;  3EPH A;  4O24 A;  5F3W A;  1YUJ A;  2GLI A;  1YH8 A;  5AE1 A;  2B3T B;  5KL5 A;  2EOS A;  4OO1 D;  1Z59 A;  4LTY A;  1B69 A;  1EH8 A;  2VQF I;  2NN6 E;  3M85 D;  2NUG A;  1DGC A;  2WBU A;  1ZXM A;  1BBG A;  5C0X D;  2BA1 D;  3LML A;  3GLL A;  3THN A;  5KL4 A;  4HTG A;  2EZ6 A;  1X5W A;  2EMF A;  2M4I A;  4X9J A;  2EFG A;  2EM7 A;  2NAB A;  4B3M E;  2N8X A;  3JAM C;  4DR2 I;  1IQO A;  2EQ1 A;  2V88 A;  1A1K A;  4M2Z A;  2LJP A;  4YY3 E;  4WSG A;  2PO2 B;  2L2N A;  3L7Z A;  1XMO I;  4OO1 F;  2HKE A;  2ELZ A;  1MU5 A;  2C38 A;  2J65 A;  4FW3 A;  3B78 A;  1N33 E;  4RHB B;  1FNM A;  2CZ9 A;  3BGH A;  4DPX A;  1F2I G;  4FN5 A;  4IFD D;  2CPN A;  2EN6 A;  2WNR B;  1SFE A;  1R6L A;  1H73 A;  3DJW A;  4LFC I;  4LF6 E;  3P3G A;  1IBL E;  4WUB A;  5EKW A;  2EN2 A;  4Z7Y A;  4OX9 E;  3QT6 A;  2EN3 A;  2CT1 A;  4GKJ I;  2EPU A;  2NN6 D;  2RQL A;  3PYE A;  4X8W A;  4WX9 A;  3M6A A;  1YFH A;  1E3P A;  1XNR I;  3C6M A;  1ZU1 A;  4WFT A;  2VQF E;  1J26 A;  4DUZ E;  1Z0T A;  4WUD A;  4DUY I;  3H09 A;  5AAS A;  1USU A;  4XTJ A;  2EPZ A;  4IJD A;  4R2E A;  1HK7 A;  3LTO A;  3OTO I;  3J7Y p;  5AE2 A;  1BB8 A;  4LF7 I;  3GCM A;  2LJU A;  1BKN A;  2EOJ A;  1Z0E A;  4DR2 E;  4NBQ A;  3Q1Q A;  2UXB I;  2EMX A;  2K4V A;  2K7I A;  2YTO A;  2EL6 A;  1XMO E;  2B7V A;  2E1R A;  2VF1 A;  1N34 I;  5LLQ A;  3AV0 A;  2L8T A;  1YYW A;  4FWD A;  2PO1 A;  3P06 A;  4JG4 A;  2MC6 A;  2C37 B;  3AUZ A;  2EMW A;  4WSP A;  2PNZ A;  2Z5E A;  2EOI A;  2VES A;  1XMQ I;  4N3O A;  1MGT A;  3MSW A;  4QNJ A;  4JV5 I;  2CGE A;  2EJ4 A;  4LFC E;  2EPO A;  1Z5B A;  3ZM7 A;  2E5L I;  2DEI A;  4F54 A;  1STU A;  1X48 A;  3WU4 A;  1UN6 B;  2FTX B;  4GKJ E;  1E3H A;  3WU6 A;  1A1L A;  5IWA I;  2JPA A;  5T6J A;  3CWV A;  3C6K A;  1NZ0 A;  2J7K A;  2EN1 A;  4DUY E;  2Q2E B;  5A2Q Q;  3Q6N A;  1PJQ A;  2GS8 A;  1FJG I;  4ZVI A;  4X64 I;  3LNU A;  3J80 Q;  3OTO E;  4MU4 A;  4LF9 I;  2PO2 A;  4LF7 E;  3IWC A;  1NHI A;  5LMU I;  2UXB E;  4R2Q A;  4USK A;  3M7N G;  4BA2 B;  2HJJ A;  4R2D A;  4IS1 C;  1DI2 A;  2BM1 A;  2F8B A;  2N3G A;  1Z0V A;  1N34 E;  4UTG A;  4LFB I;  5K36 E;  2JEB B;  2L3J A;  5C0X C;  4DV0 I;  4O5G A;  2WNR A;  2YTQ A;  4IZJ A;  1X47 A;  3MHS C;  2EPM X;  4AQY I;  2NPF A;  2NN6 B;  4ZYD A;  2ZBK B;  4F9B B;  2ZM6 E;  3K85 A;  1XMQ E;  3J7A G;  4LFA I;  3VK6 A;  4F2J C;  5A2Q C;  2BM0 A;  1IQS A;  1QU6 A;  3PRY A;  3ZZT A;  1RC7 A;  4KZS A;  3JTZ A;  3TQM A;  4JV5 E;  1XHK A;  2ADR A;  1N3G A;  1WXR A;  3J80 C;  4MU1 A;  2E5L E;  4DR4 I;  3GME A;  1HNW I;  1UIL A;  1XNQ I;  1PKP A;  1A1G A;  2O1W A;  3FIG A;  1H72 C;  1KVK A;  4MU3 A;  4DU7 A;  4IFD C;  4DR6 I;  1EA6 A;  1T4N A;  2YTD A;  5IWA E;  3QG5 C;  4HYM A;  2JOB A;  3K6Q A;  2KOU A;  1G2F C;  5KL7 A;  1EI1 A;  4HAC A;  2EM2 A;  3MHH C;  4I8O A;  1TF3 A;  5DNY A;  2EMH A;  2WP8 A;  2YRH A;  2OI2 A;  2ZIT A;  2EWL A;  1FJG E;  2JEA B;  1G2D C;  5LMN I;  1HR0 I;  2RSI A;  2EE8 A;  4X64 E;  2NN6 C;  2RS7 A;  4DV7 I;  4LF9 E;  2VRD A;  4BHC A;  2MC5 A;  2MKD A;  1Z0C A;  5LMU E;  2EMY A;  4BC9 A;  2V83 A;  4DV6 E;  1X6E A;  2GO4 A;  4N4R B;  1U2R A;  4LFB E;  5KL6 A;  3EPL A;  2UUA I;  2ENA A;  1ZBT A;  1T4O A;  4DV3 I;  5DNL A;  2VQE I;  1ELO A;  4R2P A;  3T1Y I;  4DV0 E;  4OO1 A;  2BR2 A;  3KRN A;  4AQY E;  3JAM Q;  4KHP I;  2XEX A;  4F6N A;  4I3H A;  1NCS A;  4LF8 E;  4LFA E;  5DNX A;  2D9H A;  2NUF A;  4M0V A;  5C0X A;  1X6F A;  2R76 A;  3HJC A;  2E72 A;  1KYQ A;  1UHZ A;  2R1F A;  4DR4 E;  2V2Q A;  2UU9 I;  2I9I A;  2O3Z A;  2DMY A;  1HNW E;  4K0K I;  1XNQ E;  1EKZ A;  3UHM A;  4WYQ B;  4NHR A;  4Z7C A;  1I94 I;  4DR6 E;  2EMZ A;  2HK2 A;  1UBD C;  1MG7 A;  2F1D A;  4LCG A;  4DPT A;  4DMI A;  1AH5 A;  2BV3 A;  4LF5 I;  2Z5C A;  3B4T A;  2LO3 A;  4QNK A;  2YRM A;  2EMK A;  1KJK A;  4IFD A;  1N32 I;  5LMN E;  1JK2 A;  1HR0 E;  2YTF A;  4KWY A;  2EPX A;  1WJP A;  4DV7 E;  2RS6 A;  1YYK A;  1H7S A;  4DR7 E;  5C0X F;  1ZM2 A;  2JEB A;  1XXE A;  1YPN A;  4R2S A;  2UUA E;  5JEA E;  3P3C A;  3B8H A;  1S16 A;  2NN6 A;  4DV3 E;  4X66 I;  2VQE E;  3CDI A;  3ZZU A;  4U3D A;  4JI7 I;  4KHP E;  1IBL I;  2C39 A;  1UDO A;  4IZK A;  4LPF A;  5FLX Q;  2EP3 A;  3RMP A;  5L3J A;  4M9V C;  1O0W A;  2YT4 A;  1MX0 A;  4F9A B;  4DXL A;  4JYA I;  2UU9 E;  4IFD F;  5DRO A;  4K0K E;  5K36 B;  4FW5 A;  1Y4U A;  2HC5 A;  2N3H A;  2HKJ A;  3F0N A;  1I94 E;  3PS2 A;  2CTD A;  2JEA A;  3BF2 A;  4BHB A;  3HPZ A;  2BBG A;  2E1M A;  4LF5 E;  2NN6 F;  3M85 G;  4LOM A;  3L00 A;  1PJS A;  3K1J A;  5FLX C;  1N32 E;  2WZO A;  4MQY A;  2BA0 D;  5JEA D;  2BA1 G;  2EN7 A;  3ADG A;  1A6F A;  3EPK A;  4HY1 A;  4Q35 B;  3DD6 A;  2EM5 A;  2EOH A;  3QT8 A;  1Z1B A;  1UDS A;  2PO0 A;  4P78 A;  3P76 A;  1UDN A;  1N0V C;  2EPK X;  5LL6 R;  3M7N D;  2YTN A;  2UUB I;  2YTJ A;  2BB8 A;  4X66 E;  5AC4 A;  3BID A;  1K47 A;  1HNX I;  2EQ3 A;  5K36 C;  4JI7 E;  3U1Y A;  4U3B A;  2DLQ A;  2YSO A;  4GQU A;  1RQ0 A;  1Z0B A;  3GON A;  2EPP A;  4JYA E;  2KHX A;  3HPS A;  4BMJ A;  4MLV A;  1XNR E;  1H7U A;  1H74 A;  1FI4 A;  5A6B D;  4YHH I;  1PIE A;  4JI8 I;  1YZ9 A;  2GPI A;  4DKK A;  5A6A A;  2AE8 A;  4BCA A;  5IT9 Q;  1ZBQ A;  2LTR A;  3VYY A;  2LVH A;  2HFU A;  2M9A A;  2NA2 A;  2JVA A;  2YWQ A;  2R42 A;  5FWK A;  1IBM I;  3DF6 A;  2HHH I;  4PRV A;  2YU8 A;  1HNZ I;  4R2R A;  4DR5 I;  2UXC I;  1JK1 A;  1UDQ A;  3THO B;  4UT4 A;  1RHY A;  2UUB E;  3HKM A;  2LUQ A;  1HNX E;  5IT9 C;  2HFS A;  5IXM B;  2JYA A;  3T1H I;  2A2D A;  3PS3 A;  4BC7 A;  2M7Q A;  1QZR A;  2L92 A;  4FW7 A;  3M99 B;  5ADZ A;  3L7Z B;  2WCC 3;  5EL9 A;  2V89 A;  2MKN A;  2EMG A;  4R03 A;  1DAR A;  2V34 A;  3PYG A;  4OZE A;  5K36 A;  2F4V I;  3JU0 A;  2EMI A;  1QNT A;  2EMB A;  3LLH A;  2EOE A;  5A6J A;  4YHH E;  4JI8 E;  3HUL A;  5JEA B;  2EMC A;  1B63 A;  2M1S A;  5K36 D;  2DSY A;  1IMU A;  3ECR A;  5TSE A;  1D6T A;  1J5E I;  2EOZ A;  1KIJ A;  4B3S I;  2L3C A;  4LCH A;  4MYT A;  4JI5 I;  4B3R I;  2C37 A;  1PJT A;  2Z5B B;  1IBM E;  2WW4 A;  4DV1 I;  2LUP B;  2EOY A;  2A2C A;  2LCE A;  4F9C B;  1TN9 A;  2EM9 A;  4F6M A;  2HHH E;  1P42 A;  4FWG A;  1Y6Z A;  3HTX A;  4P52 A;  2EOF A;  4P7D A;  1HNZ E;  3VYX A;  4DR1 I;  2IES A;  4DR5 E;  2UXC E;  5K36 F;  2ENH A;  2PRT A;  1PDA A;  2EPC A;  2J7J A;  4TUI A;  4P7A A;  4ZYE A;  2JR1 A;  2L6M A;  4KQV A;  2LTS A;  3ZOQ B;  1WHQ A;  2JXP A;  3H1C A;  2IOP A;  3IWD A;  5JEA C;  3T1H E;  2GQ0 A;  1IBK I;  1T4L B;  4GKK I;  1OYP A;  3C4B A;  2Q8U A;  4ZYG A;  1LLM C;  2EM4 A;  1GTK A;  1X49 A;  3KZY A;  2PO1 B;  2NUE A;  2F4V E;  1NEI A;  2EML A;  2LV2 A;  2YRK A;  1RR9 A;  2PNZ B;  4DV5 I;  2WBT A;  3KZZ A;  4BA2 A;  1ZR9 A;  4DR3 I;  4BS9 A;  3EQ1 A;  2A25 A;  3CDJ A;  5ELW A;  3PS1 A;  1J5E E;  4B3S E;  1ZM4 A;  3ADL A;  3ZKD A;  4JI5 E;  3VHT B;  2YZT A;  4B3R E;  2UXD I;  2I13 A;  1YYO A;  2DLK A;  2H36 X;  4R1F A;  4DUZ I;  4DV2 I;  4DV1 E;  4JI6 I;  2KON A;  2V85 A;  3T1Y E;  4TUG A;  4NZV A;  1T38 A;  2JP9 A;  2DEJ A;  2UUC I;  3HXL A;  4DR1 E;  4USM A;  5AC5 A;  4FK5 C;  4M30 A;  4LCF A;  4OKG A;  3LPS A;  2DIX A;  5A6K A;  2DGC A;  4PRX A;  4MLQ A;  4RPF A;  4JI3 I;  4Q28 A;  4ED4 A;  1IBK E;  2B9D A;  2EPL X;  3EPJ A;  2EM8 A;  4ZYH A;  1WRJ A;  4GKK E;  1NHH A;  4JI1 I;  4BA1 B;  3NZK A;  4WXC A;  2RTX A;  2R3V A;  1DQ3 A;  2GHF A;  4J3D A;  5JEA A;  1NHJ A;  1OJ4 A;  4WXD A;  1RRE A;  4IZJ B;  2L2K B;  1RMD A;  3IWB A;  2DRP A;  2LRS A;  5GMD A;  3UK3 C;  1WUU A;  3D4J A;  4DV5 E;  2JOX A;  2JE6 B;  2ENC A;  2FGG A;  2JY9 A;  4O43 A;  2PNL A;  2HK3 A;  1GZ6 A;  4DR3 E;  4JI4 I;  2EOQ A;  2Z5B A;  4WUC A;  4IS9 A;  3PYD A;  2UXD E;  2EOM A;  2JT2 A;  4DV2 E;  4L5N C;  4JI6 E;  2EM3 A;  2EL4 A;  1ZM9 A;  1PVG A;  5GME A;  1OYR A;  3F6H A;  4HAC B;  2UUC E;  1L4S A;  4HEI A;  2WP8 B;  5A6B A;  5JEA F;  1ZM3 A;  2YTI A;  2V2V A;  2V87 A;  5IV8 B;  2B7T A;  2IER A;  4JI2 I;  1ZXN A;  4JI3 E;  4DPW A;  4LU9 A;  1YUI A;  2X36 A;  2YTE A;  1N36 I;  2FV4 B;  4MDT A;  2EM0 A;  1Z5C A;  4JI1 E;  2LMZ A;  2LBS B;  2ODR C;  1A1J A;  3KWR A;  4X65 I;  1Z5A A;  2EQ0 A;  2ZM6 I;  4DPY A;  5BR8 I;  2IOQ A;  1FKA E;  1SR9 A;  2BR2 B;  3H4L A;  4OO1 B;  2CVE A;  3F6G A;  2EM6 A;  1S4E A;  1VIS A;  3QT7 A;  4DU8 A;  2AJ4 A;  2VF3 A;  4DV4 I;  1T39 A;  4FWH A;  2DMI A;  2RSM A;  5C0X B;  2YU5 A;  3ZKB A;  2EOR A;  2V8Q B;  4JI4 E;  4RH8 A;  4B3T I;  2RPC A;  3ZZ0 A;  1P47 A;  4AM3 A;  2EOX A;  1A1H A;  2JWO A;  4NXN I;  5DRQ A;  1FWL A;  3BBG A;  4R2A A;  1R6M A;  5CFF E;  4GZN C;  2BA0 G;  1Y60 A;  2EL5 A;  2X7I A;  3WU3 A;  2V86 A;  3V5R A;  2VE7 C;  4NXM I;  4L8N A;  1FWK A;  1KTV A;  1UEK A;  1TF6 A;  2Z5C B;  4URL A;  3K17 A;  2CG9 A;  4IFD B;  3Q6M A;  4OO1 C;  2YSP A;  3P1X A;  4AID A;  4DV6 I;  2C38 B;  4JI2 E;  2MDG A;  4MU0 A;  4BA1 A;  4LF4 I;  1YSA C;  3U1K A;  1N36 E;  4OOG C;  4O4K A;  1GQE A;  4MYU A;  2MDR A;  4M1K A;  4X62 I;  2O1T A;  4X65 E;  1EH6 A;  3J81 Q;  4HXZ A;  4FW9 A;  4JI0 I;  3J7A M;  3C4T A;  5BR8 E;  5AE3 A;  1USV A;  2JE6 A;  2EOO A;  2YTG A;  4LF8 I;  1EH7 A;  1MEY C;  4R2C A;  1BBO A;  2C39 B;  4IZK B;  2L2M A;  4DV4 E;  2ELY A;  4ISA A;  2CSH A;  4IZJ D;  1YHC A;  2GO3 A;  2O1U A;  2PNM A;  2WBS A;  3V2U C;  5DRR A;  4OO1 E;  2IHR 1;  4B3T E;  1A1F A;  2LT7 A;  4AIM A;  1X6H A;  4EMD A;  2ODR D;  4NXN E;  3ADJ A;  1N0U A;  3P3E A;  5KL3 A;  1ZAA C;  4B3M I;  4FW4 A;  3ADI A;  2HGH A;  1Y5Y A;  3WU5 A;  3J81 C;  1Z0W A;  5C0X E;  2EMA A;  5KL2 A;  4YY3 I;  4GEQ B;  3HQ1 A;  2LJH A;  4FW6 A;  2EN8 A;  2EPR A;  4NXM E;  1VI7 A;  2EPN A;  2L33 A;  1Z0G A;  4DPU A;  4R8O A;  5A69 A;  1N33 I;  2G7H A;  1KKH A;  1A1I A;  3QT5 A;  5DRP A;  4WPY A;  3OML A;  2O1V A;  4DR7 I;  1B62 A;  2V2Z A;  3PYF A;  2V8P A;  1WHN A;  4J8Z A;  4LF4 E;  4BBY A;  1X3C A;  4LF6 I;  2PO0 B;  2EPA A; 
#chains in the Genus database with same CATH homology
 4X62 E;  2DB2 A;  1Y4S A;  3B82 A;  4PU9 A;  4OX9 I;  2LE2 A;  4JI0 E;  5F3W A;  5AE1 A;  2B3T B;  1Z59 A;  4LTY A;  2VQF I;  2NUG A;  1ZXM A;  3LML A;  2EZ6 A;  2M4I A;  2EFG A;  4B3M E;  3JAM C;  4DR2 I;  2LJP A;  2V88 A;  4M2Z A;  1XMO I;  4YY3 E;  2L2N A;  2HKE A;  1MU5 A;  3B78 A;  1N33 E;  1FNM A;  2CZ9 A;  4DPX A;  4FN5 A;  2CPN A;  1H73 A;  3DJW A;  4LFC I;  4LF6 E;  1IBL E;  4WUB A;  4Z7Y A;  4OX9 E;  3QT6 A;  4GKJ I;  3PYE A;  4X8W A;  3M6A A;  1XNR I;  1Z0T A;  4WFT A;  1J26 A;  2VQF E;  4DUZ E;  4WUD A;  4DUY I;  3H09 A;  5AAS A;  1USU A;  4XTJ A;  1HK7 A;  3LTO A;  3OTO I;  3J7Y p;  5AE2 A;  4LF7 I;  2UXB I;  3Q1Q A;  1BKN A;  1Z0E A;  4DR2 E;  2K4V A;  1XMO E;  2E1R A;  1N34 I;  2B7V A;  2VF1 A;  3AV0 A;  2L8T A;  1YYW A;  4FWD A;  3P06 A;  4JG4 A;  2MC6 A;  3AUZ A;  4WSP A;  2Z5E A;  1XMQ I;  4N3O A;  3MSW A;  4JV5 I;  2CGE A;  4LFC E;  1Z5B A;  3ZM7 A;  2E5L I;  2DEI A;  4F54 A;  1STU A;  1X48 A;  3WU4 A;  2FTX B;  4GKJ E;  3WU6 A;  5IWA I;  5T6J A;  3CWV A;  1NZ0 A;  2Q2E B;  2J7K A;  5A2Q Q;  4DUY E;  1FJG I;  3Q6N A;  2GS8 A;  4ZVI A;  4X64 I;  3LNU A;  3J80 Q;  3OTO E;  4LF9 I;  4LF7 E;  3IWC A;  1NHI A;  5LMU I;  2UXB E;  4USK A;  1DI2 A;  2BM1 A;  4LFB I;  4UTG A;  2F8B A;  2N3G A;  1Z0V A;  1N34 E;  2L3J A;  4DV0 I;  4AQY I;  4IZJ A;  1X47 A;  2NPF A;  2ZBK B;  4F9B B;  2ZM6 E;  3K85 A;  1XMQ E;  3J7A G;  4LFA I;  3VK6 A;  5A2Q C;  2BM0 A;  1QU6 A;  3PRY A;  3ZZT A;  4JV5 E;  4KZS A;  1RC7 A;  3JTZ A;  1XHK A;  1WXR A;  3J80 C;  4DR4 I;  2E5L E;  1HNW I;  1UIL A;  1XNQ I;  1PKP A;  2O1W A;  3FIG A;  1H72 C;  1KVK A;  4DU7 A;  4DR6 I;  1EA6 A;  1T4N A;  5IWA E;  4HYM A;  2JOB A;  3K6Q A;  2KOU A;  1EI1 A;  4HAC A;  3WU5 A;  4I8O A;  5DNY A;  2OI2 A;  2ZIT A;  2EWL A;  1FJG E;  5LMN I;  1HR0 I;  4X64 E;  2RS7 A;  4DV7 I;  4LF9 E;  1Z0C A;  2MC5 A;  5LMU E;  4BC9 A;  2V83 A;  4DV6 E;  1U2R A;  2UUA I;  4LFB E;  1ZBT A;  1T4O A;  4DV3 I;  2VQE I;  1ELO A;  3T1Y I;  4DV0 E;  4AQY E;  3JAM Q;  4KHP I;  2XEX A;  4I3H A;  4LF8 E;  4LFA E;  2NUF A;  4M0V A;  3HJC A;  2V2Q A;  1UHZ A;  4DR4 E;  2UU9 I;  2DMY A;  1HNW E;  4K0K I;  1XNQ E;  1EKZ A;  4WYQ B;  4Z7C A;  1I94 I;  4DR6 E;  2HK2 A;  1MG7 A;  4DPT A;  4DMI A;  2BV3 A;  4LF5 I;  2Z5C A;  1N32 I;  5LMN E;  1HR0 E;  4DV7 E;  2RS6 A;  1YYK A;  1H7S A;  4DR7 E;  1ZM2 A;  2UUA E;  3B8H A;  1S16 A;  4DV3 E;  4X66 I;  2VQE E;  3ZZU A;  4JI7 I;  4KHP E;  4IZK A;  5FLX Q;  3RMP A;  5L3J A;  1O0W A;  2YT4 A;  1MX0 A;  4DXL A;  4JYA I;  2UU9 E;  4K0K E;  1Y4U A;  2N3H A;  2HKJ A;  3F0N A;  1I94 E;  3HPZ A;  2E1M A;  4LF5 E;  3K1J A;  5FLX C;  1N32 E;  2WZO A;  3ADG A;  1A6F A;  4HY1 A;  3QT8 A;  4P78 A;  1N0V C;  5LL6 R;  2UUB I;  4X66 E;  1K47 A;  1HNX I;  4JI7 E;  1RQ0 A;  1Z0B A;  3GON A;  4JYA E;  2KHX A;  3HPS A;  4BMJ A;  1H7U A;  1XNR E;  1H74 A;  1FI4 A;  4YHH I;  1PIE A;  4JI8 I;  1YZ9 A;  4DKK A;  4BCA A;  5IT9 Q;  1ZBQ A;  2LTR A;  3VYY A;  2HFU A;  2NA2 A;  2JVA A;  2R42 A;  5FWK A;  1IBM I;  3DF6 A;  2HHH I;  4PRV A;  1HNZ I;  4DR5 I;  2UXC I;  4UT4 A;  2UUB E;  2LUQ A;  1HNX E;  5IT9 C;  2HFS A;  3T1H I;  2A2D A;  4BC7 A;  2M7Q A;  1QZR A;  2L92 A;  5ADZ A;  2V89 A;  4R03 A;  1DAR A;  2V34 A;  3PYG A;  2F4V I;  3JU0 A;  3LLH A;  4YHH E;  4JI8 E;  3HUL A;  1B63 A;  2M1S A;  2DSY A;  1D6T A;  1J5E I;  1KIJ A;  4B3S I;  2L3C A;  4MYT A;  4JI5 I;  4B3R I;  2Z5B B;  1IBM E;  2WW4 A;  4DV1 I;  2LUP B;  2A2C A;  4FWG A;  4F9C B;  2HHH E;  4P52 A;  1Y6Z A;  3HTX A;  4P7D A;  3VYX A;  1HNZ E;  4DR1 I;  4DR5 E;  2UXC E;  4TUI A;  4P7A A;  2JR1 A;  2L6M A;  4KQV A;  2LTS A;  3ZOQ B;  1WHQ A;  2IOP A;  3IWD A;  1IBK I;  3T1H E;  2GQ0 A;  1T4L B;  4GKK I;  3C4B A;  1X49 A;  2NUE A;  2F4V E;  1RR9 A;  4DV5 I;  4DR3 I;  4BS9 A;  1J5E E;  4B3S E;  1ZM4 A;  3ADL A;  3ZKD A;  4JI5 E;  4B3R E;  2YZT A;  2UXD I;  1YYO A;  2H36 X;  4R1F A;  4DUZ I;  4DV2 I;  4DV1 E;  4JI6 I;  2KON A;  2V85 A;  3T1Y E;  4TUG A;  2DEJ A;  2UUC I;  3HXL A;  4DR1 E;  4USM A;  4M30 A;  3LPS A;  2DIX A;  4PRX A;  4RPF A;  4JI3 I;  4Q28 A;  4ED4 A;  1IBK E;  2B9D A;  1NHH A;  4GKK E;  4JI1 I;  2RTX A;  2R3V A;  1DQ3 A;  1NHJ A;  1OJ4 A;  1RRE A;  4IZJ B;  2L2K B;  3IWB A;  2LRS A;  5GMD A;  1WUU A;  3D4J A;  4DV5 E;  2JOX A;  2FGG A;  2JY9 A;  2PNL A;  2HK3 A;  1GZ6 A;  4DR3 E;  4JI4 I;  2Z5B A;  4WUC A;  3PYD A;  2UXD E;  4DV2 E;  4L5N C;  4JI6 E;  1ZM9 A;  1PVG A;  5GME A;  3F6H A;  4HAC B;  2UUC E;  1ZM3 A;  2V2V A;  2V87 A;  2B7T A;  4JI2 I;  1ZXN A;  4JI3 E;  4DPW A;  4LU9 A;  2X36 A;  1N36 I;  2FV4 B;  1Z5C A;  4JI1 E;  2LMZ A;  2LBS B;  2ODR C;  4X65 I;  3KWR A;  1Z5A A;  2ZM6 I;  4DPY A;  5BR8 I;  2IOQ A;  1FKA E;  1SR9 A;  3H4L A;  3QT7 A;  3F6G A;  1S4E A;  1VIS A;  4DU8 A;  2AJ4 A;  2VF3 A;  4DV4 I;  4FWH A;  2RSM A;  3ZKB A;  2V8Q B;  4JI4 E;  4B3T I;  3ZZ0 A;  4NXN I;  2JWO A;  1FWL A;  5CFF E;  2X7I A;  3WU3 A;  2V86 A;  3V5R A;  2VE7 C;  4NXM I;  4L8N A;  1FWK A;  1KTV A;  1UEK A;  2Z5C B;  4URL A;  3K17 A;  2CG9 A;  3Q6M A;  3P1X A;  4DV6 I;  4JI2 E;  4LF4 I;  1N36 E;  4OOG C;  1GQE A;  4MYU A;  2MDR A;  4M1K A;  4X62 I;  2O1T A;  4X65 E;  3J81 Q;  4HXZ A;  4FW9 A;  4JI0 I;  3J7A M;  3C4T A;  5BR8 E;  5AE3 A;  1USV A;  4LF8 I;  4IZK B;  2L2M A;  4DV4 E;  4IZJ D;  2O1U A;  2PNM A;  3V2U C;  2IHR 1;  4B3T E;  4EMD A;  2ODR D;  4NXN E;  3ADJ A;  1N0U A;  4B3M I;  3ADI A;  3J81 C;  1Z0W A;  4YY3 I;  4GEQ B;  3HQ1 A;  2LJH A;  4DPU A;  4NXM E;  1Z0G A;  2L33 A;  4R8O A;  1N33 I;  2G7H A;  1KKH A;  3QT5 A;  4WPY A;  3OML A;  2O1V A;  4DR7 I;  1B62 A;  2V2Z A;  3PYF A;  2V8P A;  1WHN A;  4J8Z A;  4LF4 E;  4BBY A;  4F9A B;  4LF6 I;  1IBL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...