5A2QC

Structure of the hcv ires bound to the human ribosome
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
b'EWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S RRNA
publication title Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5a2qC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5a2qC02
1A6FA 5BR8E 2DEIA 4NXME 4XTJA 4LFAI 5GMEA 4YY3I 2LJPA 1FJGE 4DV4I 4DV7I 1PIEA 4USKA 2VQEE 4JI3I 4EMDA 4B3SE 1FKAE 4K0KE 2DEJA 4DUZE 1N0UA 3QT5A 2HKEA 4GKJI 1D6TA 4JV5E 4URLA 4NXMI 2BV3A 1FI4A 4LF8E 2F4VE 4FWDA 2HFUA 1Z59A 1H73A 3K1JA 1Z0WA 1H7SA 1FJGI 1Z0EA 4I3HA 1MX0A 5IWAE 1FWKA 1PKPA 3JAMQ 1J5EI 1I94I 3ZKDA 3WU3A 2E5LI 2UUCE 2NPFA 1N34E 2HHHI 2ZBKB 4LF7I 4DR3E 4K0KI 1N36E 4LF8I 1RR9A 1BKNA 1NHIA 3J80C 3T1HI 4PU9A 3ZKBA 1PVGA 4LFBE 5LMNI 2UUCI 1Z0CA 1S16A 3ZZ0A 4YHHE 1S4EA 1Z0VA 1K47A 4DR6I 4DV2E 4LF4E 3LTOA 3M6AA 4WUCA 3V2UC 5LMUI 1ZXMA 2OI2A 4DV6E 2R3VA 4Z7CA 1EI1A 4NXNI 3J7AM 4B3TE 1QZRA 2UXBE 4MYTA 2UUAI 4AQYE 5A2QQ 3J81C 4LF6I 1MG7A 1KTVA 1IBKE 1ZM3A 4UTGA 5GMDA 1Z0GA 2A2DA 3LNUA 4X62I 5L3JA 1IBME 4B3TI 4JI8E 4Z7YA 4AQYI 2R42A 4LF9E 2HK2A 1HR0E 4DR5E 4DPWA 2UU9I 4DV5I 2CZ9A 3J7AG 4X65I 1HNXI 4HACB 4WUBA 1N32E 4DUYE 2VQFI 1Z0BA 1Z5AA 4DR7E 3B78A 1HNWE 3ZZUA 4JYAE 2UXCE 5BR8I 4JI2E 3ZM7A 2V2ZA 2V2VA 4DV1E 3K17A 4JI1E 2V2QA 4DUYI 4DV3E 3WU6A 2VQEI 4DR7I 3T1YE 5FLXC 1ZM4A 4B3SI 1XMOE 3H4LA 4DPXA 2UXCI 4B3ME 4RPFA 4DUZI 4JV5I 2F4VI 1B63A 4HACA 1XNQE 3QT8A 1IBLE 4OX9E 4X64E 4KHPE 2ZM6E 5IWAI 4HYMA 3T1YI 2Q2EB 2V8PA 1N34I 3Q1QA 3QT6A 4DR3I 4DV0E 1N36I 4DXLA 4JI7E 1XNQI 4UT4A 4DR2E 3WU4A 4JI4E 1IBLI 4JI6E 1UEKA 1KKHA 4DR1E 1B62A 2ZM6I 4LFBI 2BM0A 1WUUA 1XMQE 4B3RE 3LPSA 4LFCE 4YHHI 1ZXNA 4KQVA 4DV0I 2UUBE 4DV2I 4LF4I 4JI7I 4DV6I 1N33E 2XEXA 3B82A 4DPYA 2X36A 2UXBI 1XHKA 1VISA 3ZZTA 4FWHA 3OTOE 1Z5CA 1IBKI 2ZITA 4LFAE 3PYEA 4DU7A 4HXZA 4DV4E 1IBMI 4JI8I 4JI3E 4MYUA 3F0NA 4LF9I 1ELOA 5IT9C 1HR0I 4DR5I 4FW9A 4PRXA 3J80Q 4GKJE 3D4JA 3OTOI 2UXDE 4JI5E 5A2QC 2V34A 1NZ0A 1N32I 1MU5A 1J5EE 1I94E 2E5LE 2HHHE 1HNWI 4LF7E 1NHHA 4GKKE 4JYAI 1HNZE 3HULA 2UXDI 4JI2I 4JI5I 4DU8A 3T1HE 4DV1I 4JI1I 4WUDA 3J81Q 4FWGA 4DV3I 1NHJA 5LMNE 3B8HA 4P7AA 1Z5BA 2HFSA 1XMOI 4GKKI 2VF3A 4DR6E 1HNZI 4B3MI 5LMUE 4DPTA 3PYDA 1OJ4A 4NXNE 4OX9I 1H7UA 4M1KA 4X64I 2WW4A 4KHPI 2GS8A 1U2RA 1XNRE 2HKJA 3V5RA 2UUAE 4LF5E 2HK3A 4LF6E 4FN5A 4X66E 3PYFA 3JAMC 1Z0TA 4USMA 1DARA 1EA6A 1KIJA 4X62E 1H72C 4DR4E 4DR2I 1ZM9A 4JI4I 4ED4A 4JI6I 5IT9Q 2X7IA 4ZVIA 4DR1I 2BM1A 1XNRI 3GONA 4JI0E 2J7KA 1RREA 4HY1A 1FWLA 3WU5A 3PYGA 4LF5I 4R1FA 2E1RA 1XMQI 4B3RI 4PRVA 4LFCI 4JG4A 1FNMA 5LL6R 4X66I 2UUBI 2UU9E 1H74A 4DV5E 2EFGA 1KVKA 5FLXQ 4DR4I 1N33I 4YY3E 2AJ4A 4X65E 1ZM2A 2A2CA 1HNXE 2VQFE 3QT7A 4P52A 4JI0I 4DPUA 4DV7E 1N0VC 3CWVA
chains in the Genus database with same CATH superfamily
2EOFA 4MU3A 2EPPA 2EP3A 1A6FA 1TN9A 1N3GA 2JVAA 4AM3A 4R8OA 5BR8E 2GHFA 1USVA 4NXME 2DEIA 2RS6A 2MC6A 3AUZA 4XTJA 3BGHA 5JEAA 4NHRA 4LFAI 3Q6NA 5GMEA 4YY3I 4ZYEA 2IERA 2LJPA 1RC7A 2EOSA 2K7IA 1A1KA 2AE8A 1FJGE 2YTFA 2Q8UA 4DV4I 4DV7I 1PIEA 4USKA 2VQEE 2PO1A 3RMPA 2EM9A 2HC5A 4JI3I 4EMDA 4B3SE 2EMLA 2C38A 1ZAAC 1FKAE 2LE2A 1OYPA 1UN6B 4R2RA 4K0KE 1X6FA 5AE3A 2DEJA 2EMIA 4DUZE 1N0UA 1YHCA 2EQ1A 2HKEA 3QT5A 4JV5E 4GKJI 4URLA 4NXMI 2M7QA 2EPOA 2BV3A 4MU1A 2EQ3A 2JOBA 4LF8E 2YTDA 2F4VE 1FI4A 2NN6B 4FWDA 5K36C 2ENCA 1X3CA 2MDRA 4WXCA 2HFUA 1Z59A 1H73A 3K1JA 4X8WA 4R2QA 1H7SA 1Z0WA 5C0XB 4KWYA 2EPZA 3JTZA 1FJGI 1AH5A 1UHZA 1Z0EA 5EKWA 1YYOA 5IWAE 1PKPA 1FWKA 1MX0A 4M0VA 4I3HA 2FTXB 1G2DC 2PO2B 3JAMQ 3F6GA 2C37B 1J5EI 1YYWA 1I94I 4FK5C 2ODRD 5A6JA 2UUCE 2EN4A 4L8NA 2NPFA 1UDNA 2JE6B 1N34E 3WU3A 2ZBKB 2E5LI 2HHHI 1NCSA 3P06A 4M2ZA 3M85D 4DR3E 4LF7I 4K0KI 1VI7A 2WNRB 1N36E 4BC9A 4OO1C 3FIGA 4LF8I 1RR9A 4IFDA 2EPXA 5AE2A 1BKNA 2DLKA 1NHIA 1STUA 3ECRA 2O1WA 2GO4A 5FWKA 4LCHA 4F9CB 3EPLA 3J80C 3P3GA 1PDAA 3T1HI 2HGHA 1PJQA 2A25A 4TUGA 4PU9A 2M9AA 1ZR9A 2EOMA 1JK1A 4J3DA 3ZKBA 1PVGA 4LFBE 3C6KA 4WPYA 5LMNI 3M7NG 2E72A 2ENAA 1Z0CA 5LLQA 1S16A 2UUCI 2NA2A 2EN6A 3ZZ0A 4R2EA 1RQ0A 4YHHE 1DI2A 1P42A 1S4EA 1Z0VA 1K47A 1SR9A 2EPLX 2C39A 3ADJA 1EH8A 5T6JA 4BC7A 4DV2E 1T4OA 2EPKX 2YTIA 4LF4E 2JEBA 1EKZA 3LTOA 3LLHA 3M6AA 4WUCA 3P3EA 4WX9A 5C0XA 2IOQA 1GZ6A 1F2IG 5K36F 2LMZA 3V2UC 4DV6E 2EM3A 1ZXMA 2NN6F 2OI2A 2PO2A 2R3VA 4Z7CA 2C37A 5LMUI 1SFEA 1ZBTA 4FW7A 4FW4A 2GO3A 1EI1A 4NXNI 3J7AM 2EMGA 5JEAB 2LCEA 2VE7C 2NN6D 4WYQB 2MDGA 4B3TE 3K85A 4MU4A 1QZRA 2BB8A 1X48A 1PJSA 2WNRA 2UXBE 3UHMA 4MYTA 2UUAI 5TSEA 5K36E 3ADIA 2ELZA 2EN1A 3IWBA 3THNA 5KL3A 4AQYE 2NN6E 5A2QQ 5C0XD 2EL4A 3J81C 2L2MA 1KJKA 3DD6A 1MG7A 4LF6I 2V86A 4N4RB 1KTVA 3BBGA 1GTKA 1UDOA 1IBKE 4OO1F 2JT2A 1ZM3A 2C38B 4UTGA 5GMDA 3P1XA 1Z0GA 2A2DA 3UK3C 2YRKA 2EZ6A 3LNUA 1A1GA 4R2AA 2BA0D 2L8TA 4X62I 2ODRC 3DJWA 2YSOA 3EPHA 1A1IA 5L3JA 1IBME 3NZKA 2LJHA 2M1SA 2LT7A 1MEYC 4B3TI 1WHQA 3KZZA 4IS9A 2WBTA 2N3GA 1X47A 4JI8E 1YSAC 1Y6ZA 1A1LA 4Z7YA 4OO1E 2BA1D 3TQMA 2L3CA 4AQYI 4L5NC 4WSPA 2R42A 4LF9E 4BA1B 1HR0E 2HK2A 4DR5E 4DPWA 1B69A 4O5GA 4R03A 3OMLA 4GQUA 2M4IA 2UU9I 4DV5I 4MDTA 2CZ9A 5AASA 2D9HA 2DRPA 2CSHA 1JK2A 3J7AG 4X65I 5KL6A 1HNXI 1Y4UA 1LLMC 1N32E 4HACB 4WUBA 4DUYE 2VQFI 4IFDB 2YT4A 1Z0BA 1UDQA 2CGEA 3CDIA 2L33A 5JEAF 2V8QB 1WXRA 2VRDA 4DR7E 1Z5AA 1YYKA 2EL6A 2G7HA 2NUGA 1RHYA 2J65A 3B78A 1HNWE 2EMBA 3HXLA 5DROA 2EPUA 3ZZUA 4JYAE 4P7DA 2B3TB 5A6KA 3Q6MA 2UXCE 5JEAD 4BHCA 5BR8I 4JI2E 3ZM7A 3PS2A 3HPZA 2V2ZA 2NN6C 5JEAE 2V88A 1EH6A 2JP9A 3CDJA 2C39B 2V2VA 2LUQA 2JEBB 2YTEA 2PRTA 1T4LB 3MSWA 3U1KA 4DV1E 2O1VA 2DMIA 2EMHA 2EOYA 2YSPA 3J7Yp 4JI1E 2V2QA 3K17A 2JR1A 5C0XC 4DV3E 4DUYI 4BA1A 4I8OA 2WBSA 2YRMA 3MHSC 4IZKB 3WU6A 1IMUA 2H36X 5KL2A 1NEIA 1E3PA 2VQEI 3T1YE 5FLXC 4DR7I 3PS1A 1ZM4A 4R2SA 1XMOE 3IWCA 4B3SI 4HEIA 3H4LA 3U1YA 4DPXA 2UXCI 4B3ME 4RPFA 4DUZI 3F6HA 2O1TA 4U3DA 4JV5I 3HKMA 1B63A 2F4VI 4HACA 4R2DA 2Z5BB 1XNQE 2IESA 3QT8A 4LU9A 5DRQA 1IBLE 1OYSA 1ZBQA 2VESA 2EE8A 1X5WA 4OX9E 4X64E 4KHPE 3L7ZB 2ZM6E 5IWAI 1L4SA 3KRNA 1A1FA 3GLLA 4HYMA 4IFDF 1IQOA 2Q2EB 4F9BB 3T1YI 2CPNA 4J8ZA 2I9IA 5DRPA 2V8PA 3HJCA 2EJ4A 1N34I 3Q1QA 3QT6A 2PNZA 2EORA 2EOJA 3BIDA 2EMAA 4DR3I 1DQ3A 4IFDD 3L00A 2EOOA 4DV0E 2HJJA 1N36I 1BB8A 4JI7E 4DXLA 4HTGA 4M9VC 2VF1A 2GQ0A 2Z5CB 4IFDE 2B7VA 4WSGA 5EL9A 2L6MA 1XNQI 4UT4A 1T39A 4IZKA 4DR2E 3WU4A 4JI4E 1IBLI 4JI6E 4ZYDA 1UEKA 1KKHA 2N8XA 5A6BA 4DR1E 1YZ9A 1B62A 2CT1A 3B4TA 2ZM6I 4FW3A 5C0XF 3DF6A 3EPJA 3M7ND 4LFBI 5JEAC 2YPNA 2BM0A 1UDSA 2V87A 2MKNA 1WUUA 4AIDA 1XMQE 4B3RE 4NZVA 3H09A 4LFCE 3LPSA 2FV4B 4YHHI 1ZXNA 2EM4A 2BR2B 2Z5BA 2EN3A 4Q28A 4X9JA 4KQVA 4DV0I 2UUBE 4DV2I 4LF4I 1T4NA 4JI7I 4IZJB 2EN8A 5ADZA 5C0XE 1X49A 2NUEA 4RHBB 3L7ZA 2JOXA 2EL5A 4WFTA 1N33E 2BA0G 4DV6I 2V89A 2XEXA 2JPAA 2E1MA 4OKGA 1Y60A 1EH7A 4F6NA 1TF3A 2F8BA 3ADLA 3B82A 5KL7A 4DPYA 5AC4A 2IHR1 4BMJA 1R6MA 2L2KB 4BS9A 2X36A 2WCC3 3P76A 1UILA 5AE1A 2UXBI 4R2CA 2GLIA 2Z5CA 4BA2B 1XHKA 4Q35B 1Z1BA 1VISA 2EPCA 3H1CA 2YRHA 3ZZTA 2DMYA 1TF6A 2LTSA 2ADRA 3OTOE 4FWHA 1Z5CA 1IBKI 4WXDA 2EMCA 2ZITA 4LFAE 2RPCA 2CTDA 1QNTA 2YTPA 5DRRA 2LUPB 2EM2A 3PYEA 2DSYA 4DU7A 4HXZA 2YU8A 3PRYA 5IXMB 4ZYHA 4DV4E 4DMIA 4NBQA 2JWOA 1IBMI 1BBGA 3KZYA 4IFDC 2V83A 3ZOQB 2YU5A 3P3CA 1YPNA 2BR2A 4JI8I 4JI3E 3JU0A 4OOGC 1A1HA 4IZJA 4MYUA 3F0NA 2RS7A 5CFFE 2O1UA 4BHBA 4LF9I 1ELOA 2LTRA 2YTNA 3K6QA 5IT9C 1G2FC 1HR0I 4FW9A 4GKJE 4PRXA 3J80Q 4DR5I 3D4JA 3OTOI 2UXDE 2CG9A 2EMFA 2YTJA 4JI5E 2RQLA 4LCGA 1OYRA 2J7JA 2EMYA 2LO3A 2PNZB 5A2QC 2WP8A 4MQYA 2KHXA 5DNYA 2I13A 1X6HA 2B9DA 2V34A 4M30A 1NZ0A 4TUIA 2KOUA 1N32I 4IZJD 1MU5A 4BA2A 1E3HA 4F9AB 5A69A 1J5EE 3VYXA 1I94E 2WZOA 5A6AA 4R2PA 1WJPA 2E5LE 3HTXA 2HHHE 1IQSA 2GPIA 2FGGA 5DNLA 3C4TA 5KL4A 1HNWI 4LF7E 3GMEA 3BF2A 1NHHA 2EPNA 3KWRA 4GKKE 3M85G 4JYAI 1HNZE 1R6LA 3HULA 2UXDI 3LMLA 5K36B 1USUA 2EM6A 4JI2I 4JI5I 2EOIA 5IV8B 3VK6A 4DU8A 4QNKA 1O0WA 4KZSA 1X6EA 3EPKA 2JEAB 1A1JA 3T1HE 2R1FA 2RTXA 2DGCA 2MC5A 4DV1I 3M99B 3C6MA 4JI1I 4WUDA 3J81Q 4FWGA 4DV3I 1NHJA 5LMNE 4U3BA 2YWQA 2EPAA 2ENHA 3B8HA 2EMZA 2R76A 1KYQA 1RMDA 2EN7A 2EOXA 1P47A 1GQEA 4P7AA 2EMWA 2L2NA 1Z5BA 1QU6A 2HFSA 5DNXA 1XMOI 3HPSA 4DR6E 2VF3A 1HNZI 4GKKI 4OO1B 2YTQA 1WHNA 2EMKA 4B3MI 2F1DA 1YFHA 4F54A 2WBUA 2L92A 3ZKDA 4MLVA 2PO0B 4QNJA 5LMUE 1ZU1A 4MU0A 1MGTA 4DPTA 1UBDC 4F6MA 4AIMA 1WRJA 3PYDA 1OJ4A 2EM7A 4IJDA 5AC5A 2DB2A 4NXNE 4OX9I 1H7UA 4P78A 1XXEA 4M1KA 2WW4A 4X64I 2EOEA 2GS8A 4KHPI 1XNRE 2EOHA 3VYYA 2YTOA 1U2RA 2HKJA 2Z5EA 2ELYA 2JY9A 4ZYGA 1D6TA 4N3OA 4O4KA 4O24A 2RSIA 5K36A 4F2JC 2PNLA 2UUAE 3V5RA 2LRSA 2EPRA 4LF5E 2NN6A 4RH8A 4LF6E 2HK3A 4FW5A 4GEQB 1HK7A 2JXPA 4FN5A 4MLQA 3THOB 4X66E 3PYFA 3JAMC 2EQ0A 1Z0TA 2JEAA 1AAYA 2LV2A 4USMA 1DARA 1EA6A 1KIJA 5A6BD 2EPMX 4ISAA 4X62E 4LPFA 2JYAA 1H72C 2LVHA 3AV0A 4DR4E 4LOMA 4DR2I 1YUIA 1ZM9A 2JE6A 4JI4I 2NUFA 4GZNC 1T38A 2KONA 2IOPA 4ED4A 4JI6I 2X7IA 4ZVIA 4DR6I 4DR1I 2EMXA 2EWLA 5K36D 1Y5YA 5IT9Q 2BM1A 1XNRI 2YTGA 2K4VA 4BCAA 4JI0E 1RREA 2J7KA 2WP8B 4LTYA 3GONA 4OZEA 1YH8A 3ADGA 4HY1A 4OO1A 2CVEA 1Y4SA 1FWLA 2EM5A 2EOZA 5KL5A 3WU5A 2EM0A 3PYGA 4LF5I 2DLQA 2YZTA 4DKKA 4R1FA 2LJUA 2BA1G 2E1RA 5ELWA 1XMQI 3IWDA 4B3RI 4PRVA 2PO0A 3EQ1A 2RSMA 2L3JA 4JG4A 2EM8A 2MKDA 2N3HA 1FNMA 1J26A 2PO1B 5LL6R 3VHTB 3C4BA 4LFCI 4X66I 2UUBI 4O43A 1PJTA 2V85A 2UU9E 2EOQA 4DV5E 1YUJA 1BBOA 1H74A 4FW6A 2LBSB 2B7TA 1DGCA 3QG5C 2EFGA 2EN2A 3PS3A 4IS1C 1KVKA 4LCFA 5FLXQ 4DR4I 4BBYA 4YY3E 1N33I 4X65E 2AJ4A 3GCMA 1HNXE 2A2CA 2NABA 1ZM2A 4OO1D 2VQFE 3QT7A 4P52A 2BBGA 3MHHC 4JI0I 2DIXA 4DPUA 4DV7E 2PNMA 3HQ1A 2O3ZA 5F3WA 1N0VC 3CWVA
chains in the Genus database with same CATH topology
1A6FA 2JVAA 4R8OA 5BR8E 1USVA 4NXME 2DEIA 2RS6A 2MC6A 3AUZA 4XTJA 4LFAI 3Q6NA 5GMEA 4YY3I 2LJPA 1RC7A 1FJGE 4DV4I 4DV7I 1PIEA 4USKA 2VQEE 3RMPA 4JI3I 4EMDA 4B3SE 1FKAE 2LE2A 4K0KE 5AE3A 2DEJA 4DUZE 1N0UA 3QT5A 2HKEA 4GKJI 1D6TA 4JV5E 4URLA 4NXMI 2M7QA 2BV3A 1FI4A 2JOBA 4LF8E 2F4VE 4FWDA 2MDRA 2HFUA 1Z59A 1H73A 3K1JA 4X8WA 1Z0WA 1H7SA 3JTZA 1FJGI 1UHZA 1Z0EA 4I3HA 1YYOA 5IWAE 1PKPA 1FWKA 1MX0A 4M0VA 2FTXB 3JAMQ 3F6GA 1J5EI 1YYWA 1I94I 2ODRD 3ZKDA 2UUCE 3WU3A 4L8NA 2NPFA 2E5LI 1N34E 2HHHI 2ZBKB 3P06A 4M2ZA 4LF7I 4DR3E 4K0KI 1N36E 4BC9A 3FIGA 4LF8I 1RR9A 5AE2A 1BKNA 1NHIA 1STUA 2O1WA 5FWKA 4F9CB 3J80C 3T1HI 4TUGA 4PU9A 3ZKBA 1PVGA 4LFBE 4WPYA 5LMNI 2UUCI 1Z0CA 1S16A 2NA2A 3ZZ0A 1RQ0A 4YHHE 1DI2A 1S4EA 1Z0VA 1K47A 1SR9A 4DR6I 3ADJA 5T6JA 4BC7A 4DV2E 1T4OA 4LF4E 1EKZA 3LTOA 3LLHA 3M6AA 4WUCA 2IOQA 1GZ6A 2LMZA 3V2UC 4DV6E 1ZXMA 2OI2A 5LMUI 2R3VA 4Z7CA 1ZBTA 1EI1A 4NXNI 3J7AM 2VE7C 4WYQB 4B3TE 3K85A 1QZRA 1X48A 2UXBE 4MYTA 2UUAI 3ADIA 4AQYE 3IWBA 5A2QQ 3J81C 2L2MA 4LF6I 1MG7A 2V86A 1KTVA 1IBKE 1ZM3A 4UTGA 5GMDA 3P1XA 1Z0GA 2A2DA 3LNUA 2EZ6A 4X62I 2L8TA 2ODRC 3DJWA 5L3JA 1IBME 2LJHA 2M1SA 4B3TI 1WHQA 2N3GA 1X47A 4JI8E 1Y6ZA 4Z7YA 2L3CA 4AQYI 4L5NC 4WSPA 2R42A 4LF9E 1HR0E 2HK2A 4DR5E 4DPWA 4R03A 3OMLA 2M4IA 2UU9I 4DV5I 2CZ9A 5AASA 3J7AG 4X65I 1HNXI 1Y4UA 1N32E 4HACB 4WUBA 4DUYE 2VQFI 2YT4A 1Z0BA 2CGEA 2L33A 2V8QB 1WXRA 4DR7E 1Z5AA 1YYKA 2G7HA 2NUGA 3B78A 1HNWE 3HXLA 3ZZUA 4JYAE 4P7DA 2B3TB 3Q6MA 2UXCE 5BR8I 4JI2E 3ZM7A 3HPZA 2V2ZA 2V88A 2V2VA 2LUQA 1T4LB 3MSWA 4DV1E 2O1VA 3K17A 3J7Yp 4JI1E 2V2QA 4DUYI 2JR1A 4DV3E 4I8OA 3WU6A 4IZKB 2H36X 2VQEI 4DR7I 3T1YE 5FLXC 1ZM4A 4B3SI 1XMOE 3IWCA 3H4LA 4DPXA 2UXCI 4B3ME 4RPFA 4DUZI 3F6HA 2O1TA 4JV5I 2F4VI 1B63A 4HACA 2Z5BB 1XNQE 3QT8A 4LU9A 1IBLE 1ZBQA 4OX9E 4X64E 4KHPE 2ZM6E 5IWAI 4HYMA 2Q2EB 4F9BB 3T1YI 2CPNA 4J8ZA 2V8PA 3HJCA 1N34I 3Q1QA 3QT6A 4DR3I 1DQ3A 4DV0E 1N36I 4DXLA 4JI7E 2GQ0A 2VF1A 2Z5CB 2B7VA 2L6MA 1XNQI 4UT4A 4IZKA 4DR2E 3WU4A 4JI4E 1IBLI 4JI6E 1UEKA 1KKHA 4DR1E 1YZ9A 1B62A 2ZM6I 3DF6A 4LFBI 2BM0A 2V87A 1WUUA 1XMQE 4B3RE 3H09A 4LFCE 3LPSA 2FV4B 4YHHI 1ZXNA 2Z5BA 4KQVA 4Q28A 4DV0I 2UUBE 4DV2I 4LF4I 1T4NA 4JI7I 4IZJB 5ADZA 1X49A 2NUEA 2JOXA 4WFTA 1N33E 4DV6I 2V89A 2XEXA 2E1MA 2F8BA 3ADLA 3B82A 4DPYA 2IHR1 4BMJA 2L2KB 4BS9A 2X36A 1UILA 5AE1A 2UXBI 2Z5CA 1XHKA 1VISA 3ZZTA 2DMYA 2LTSA 3OTOE 4FWHA 1Z5CA 1IBKI 2ZITA 4LFAE 2LUPB 3PYEA 2DSYA 4DU7A 4HXZA 3PRYA 4DV4E 4DMIA 2JWOA 1IBMI 2V83A 3ZOQB 4JI8I 4JI3E 3JU0A 4OOGC 4IZJA 4MYUA 3F0NA 2RS7A 5CFFE 2O1UA 4LF9I 1ELOA 2LTRA 3K6QA 5IT9C 1HR0I 4FW9A 4GKJE 4PRXA 3J80Q 4DR5I 3D4JA 3OTOI 2UXDE 2CG9A 4JI5E 5A2QC 2KHXA 5DNYA 2B9DA 2V34A 4M30A 1NZ0A 4TUIA 2KOUA 1N32I 4IZJD 1MU5A 4F9AB 1J5EE 3VYXA 1I94E 2WZOA 3HTXA 2E5LE 2HHHE 2FGGA 3C4TA 1HNWI 4LF7E 1NHHA 3KWRA 4GKKE 4JYAI 1HNZE 3HULA 2UXDI 3LMLA 1USUA 4JI2I 4JI5I 3VK6A 4DU8A 1O0WA 4KZSA 3T1HE 2RTXA 2MC5A 4DV1I 4JI1I 4WUDA 3J81Q 4FWGA 4DV3I 1NHJA 5LMNE 3B8HA 1GQEA 4P7AA 2L2NA 1Z5BA 2HFSA 1QU6A 1XMOI 4GKKI 3HPSA 4DR6E 2VF3A 1HNZI 1WHNA 4B3MI 4F54A 2L92A 5LMUE 4DPTA 3PYDA 1OJ4A 2DB2A 4NXNE 4OX9I 1H7UA 4P78A 4M1KA 4X64I 2WW4A 4KHPI 2GS8A 1XNRE 1U2RA 3VYYA 2HKJA 2Z5EA 2JY9A 4N3OA 2PNLA 2UUAE 3V5RA 2LRSA 4LF5E 4LF6E 2HK3A 4GEQB 1HK7A 4FN5A 4X66E 3PYFA 3JAMC 1Z0TA 4USMA 1DARA 1EA6A 1KIJA 4X62E 1H72C 3AV0A 4DR4E 4DR2I 1ZM9A 4JI4I 2NUFA 4ED4A 4JI6I 2KONA 2IOPA 5IT9Q 2X7IA 4ZVIA 4DR1I 2EWLA 2BM1A 1XNRI 3GONA 2K4VA 4BCAA 4JI0E 1RREA 2J7KA 4LTYA 3ADGA 4HY1A 1Y4SA 1FWLA 3WU5A 3PYGA 4LF5I 2YZTA 4DKKA 4R1FA 2E1RA 1XMQI 3IWDA 4B3RI 4PRVA 4LFCI 4JG4A 2RSMA 2L3JA 2N3HA 1FNMA 1J26A 5LL6R 3C4BA 4X66I 2UUBI 2V85A 2UU9E 4DV5E 1H74A 2LBSB 2B7TA 2EFGA 1KVKA 5FLXQ 4DR4I 4BBYA 4YY3E 1N33I 4X65E 2AJ4A 1HNXE 2A2CA 1ZM2A 2VQFE 3QT7A 4P52A 4JI0I 2DIXA 4DPUA 4DV7E 2PNMA 3HQ1A 5F3WA 1N0VC 3CWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6F A;  5BR8 E;  2DEI A;  4NXM E;  4XTJ A;  4LFA I;  5GME A;  4YY3 I;  2LJP A;  1FJG E;  4DV4 I;  4DV7 I;  1PIE A;  4USK A;  2VQE E;  4JI3 I;  4EMD A;  4B3S E;  1FKA E;  4K0K E;  2DEJ A;  4DUZ E;  1N0U A;  3QT5 A;  2HKE A;  4GKJ I;  1D6T A;  4JV5 E;  4URL A;  4NXM I;  2BV3 A;  1FI4 A;  4LF8 E;  2F4V E;  4FWD A;  2HFU A;  1Z59 A;  1H73 A;  3K1J A;  1Z0W A;  1H7S A;  1FJG I;  1Z0E A;  4I3H A;  1MX0 A;  5IWA E;  1FWK A;  1PKP A;  3JAM Q;  1J5E I;  1I94 I;  3ZKD A;  3WU3 A;  2E5L I;  2UUC E;  2NPF A;  1N34 E;  2HHH I;  2ZBK B;  4LF7 I;  4DR3 E;  4K0K I;  1N36 E;  4LF8 I;  1RR9 A;  1BKN A;  1NHI A;  3J80 C;  3T1H I;  4PU9 A;  3ZKB A;  1PVG A;  4LFB E;  5LMN I;  2UUC I;  1Z0C A;  1S16 A;  3ZZ0 A;  4YHH E;  1S4E A;  1Z0V A;  1K47 A;  4DR6 I;  4DV2 E;  4LF4 E;  3LTO A;  3M6A A;  4WUC A;  3V2U C;  5LMU I;  1ZXM A;  2OI2 A;  4DV6 E;  2R3V A;  4Z7C A;  1EI1 A;  4NXN I;  3J7A M;  4B3T E;  1QZR A;  2UXB E;  4MYT A;  2UUA I;  4AQY E;  5A2Q Q;  3J81 C;  4LF6 I;  1MG7 A;  1KTV A;  1IBK E;  1ZM3 A;  4UTG A;  5GMD A;  1Z0G A;  2A2D A;  3LNU A;  4X62 I;  5L3J A;  1IBM E;  4B3T I;  4JI8 E;  4Z7Y A;  4AQY I;  2R42 A;  4LF9 E;  2HK2 A;  1HR0 E;  4DR5 E;  4DPW A;  2UU9 I;  4DV5 I;  2CZ9 A;  3J7A G;  4X65 I;  1HNX I;  4HAC B;  4WUB A;  1N32 E;  4DUY E;  2VQF I;  1Z0B A;  1Z5A A;  4DR7 E;  3B78 A;  1HNW E;  3ZZU A;  4JYA E;  2UXC E;  5BR8 I;  4JI2 E;  3ZM7 A;  2V2Z A;  2V2V A;  4DV1 E;  3K17 A;  4JI1 E;  2V2Q A;  4DUY I;  4DV3 E;  3WU6 A;  2VQE I;  4DR7 I;  3T1Y E;  5FLX C;  1ZM4 A;  4B3S I;  1XMO E;  3H4L A;  4DPX A;  2UXC I;  4B3M E;  4RPF A;  4DUZ I;  4JV5 I;  2F4V I;  1B63 A;  4HAC A;  1XNQ E;  3QT8 A;  1IBL E;  4OX9 E;  4X64 E;  4KHP E;  2ZM6 E;  5IWA I;  4HYM A;  3T1Y I;  2Q2E B;  2V8P A;  1N34 I;  3Q1Q A;  3QT6 A;  4DR3 I;  4DV0 E;  1N36 I;  4DXL A;  4JI7 E;  1XNQ I;  4UT4 A;  4DR2 E;  3WU4 A;  4JI4 E;  1IBL I;  4JI6 E;  1UEK A;  1KKH A;  4DR1 E;  1B62 A;  2ZM6 I;  4LFB I;  2BM0 A;  1WUU A;  1XMQ E;  4B3R E;  3LPS A;  4LFC E;  4YHH I;  1ZXN A;  4KQV A;  4DV0 I;  2UUB E;  4DV2 I;  4LF4 I;  4JI7 I;  4DV6 I;  1N33 E;  2XEX A;  3B82 A;  4DPY A;  2X36 A;  2UXB I;  1XHK A;  1VIS A;  3ZZT A;  4FWH A;  3OTO E;  1Z5C A;  1IBK I;  2ZIT A;  4LFA E;  3PYE A;  4DU7 A;  4HXZ A;  4DV4 E;  1IBM I;  4JI8 I;  4JI3 E;  4MYU A;  3F0N A;  4LF9 I;  1ELO A;  5IT9 C;  1HR0 I;  4DR5 I;  4FW9 A;  4PRX A;  3J80 Q;  4GKJ E;  3D4J A;  3OTO I;  2UXD E;  4JI5 E;  5A2Q C;  2V34 A;  1NZ0 A;  1N32 I;  1MU5 A;  1J5E E;  1I94 E;  2E5L E;  2HHH E;  1HNW I;  4LF7 E;  1NHH A;  4GKK E;  4JYA I;  1HNZ E;  3HUL A;  2UXD I;  4JI2 I;  4JI5 I;  4DU8 A;  3T1H E;  4DV1 I;  4JI1 I;  4WUD A;  3J81 Q;  4FWG A;  4DV3 I;  1NHJ A;  5LMN E;  3B8H A;  4P7A A;  1Z5B A;  2HFS A;  1XMO I;  4GKK I;  2VF3 A;  4DR6 E;  1HNZ I;  4B3M I;  5LMU E;  4DPT A;  3PYD A;  1OJ4 A;  4NXN E;  4OX9 I;  1H7U A;  4M1K A;  4X64 I;  2WW4 A;  4KHP I;  2GS8 A;  1U2R A;  1XNR E;  2HKJ A;  3V5R A;  2UUA E;  4LF5 E;  2HK3 A;  4LF6 E;  4FN5 A;  4X66 E;  3PYF A;  3JAM C;  1Z0T A;  4USM A;  1DAR A;  1EA6 A;  1KIJ A;  4X62 E;  1H72 C;  4DR4 E;  4DR2 I;  1ZM9 A;  4JI4 I;  4ED4 A;  4JI6 I;  5IT9 Q;  2X7I A;  4ZVI A;  4DR1 I;  2BM1 A;  1XNR I;  3GON A;  4JI0 E;  2J7K A;  1RRE A;  4HY1 A;  1FWL A;  3WU5 A;  3PYG A;  4LF5 I;  4R1F A;  2E1R A;  1XMQ I;  4B3R I;  4PRV A;  4LFC I;  4JG4 A;  1FNM A;  5LL6 R;  4X66 I;  2UUB I;  2UU9 E;  1H74 A;  4DV5 E;  2EFG A;  1KVK A;  5FLX Q;  4DR4 I;  1N33 I;  4YY3 E;  2AJ4 A;  4X65 E;  1ZM2 A;  2A2C A;  1HNX E;  2VQF E;  3QT7 A;  4P52 A;  4JI0 I;  4DPU A;  4DV7 E;  1N0V C;  3CWV A; 
#chains in the Genus database with same CATH topology
 2EOF A;  4MU3 A;  2EPP A;  2EP3 A;  1A6F A;  1TN9 A;  1N3G A;  2JVA A;  4AM3 A;  4R8O A;  5BR8 E;  2GHF A;  1USV A;  4NXM E;  2DEI A;  2RS6 A;  2MC6 A;  3AUZ A;  4XTJ A;  3BGH A;  5JEA A;  4NHR A;  4LFA I;  3Q6N A;  5GME A;  4YY3 I;  4ZYE A;  2IER A;  2LJP A;  1RC7 A;  2EOS A;  2K7I A;  1A1K A;  2AE8 A;  1FJG E;  2YTF A;  2Q8U A;  4DV4 I;  4DV7 I;  1PIE A;  4USK A;  2VQE E;  2PO1 A;  3RMP A;  2EM9 A;  2HC5 A;  4JI3 I;  4EMD A;  4B3S E;  2EML A;  2C38 A;  1ZAA C;  1FKA E;  2LE2 A;  1OYP A;  1UN6 B;  4R2R A;  4K0K E;  1X6F A;  5AE3 A;  2DEJ A;  2EMI A;  4DUZ E;  1N0U A;  1YHC A;  2EQ1 A;  2HKE A;  3QT5 A;  4JV5 E;  4GKJ I;  4URL A;  4NXM I;  2M7Q A;  2EPO A;  2BV3 A;  4MU1 A;  2EQ3 A;  2JOB A;  4LF8 E;  2YTD A;  2F4V E;  1FI4 A;  2NN6 B;  4FWD A;  5K36 C;  2ENC A;  1X3C A;  2MDR A;  4WXC A;  2HFU A;  1Z59 A;  1H73 A;  3K1J A;  4X8W A;  4R2Q A;  1H7S A;  1Z0W A;  5C0X B;  4KWY A;  2EPZ A;  3JTZ A;  1FJG I;  1AH5 A;  1UHZ A;  1Z0E A;  5EKW A;  1YYO A;  5IWA E;  1PKP A;  1FWK A;  1MX0 A;  4M0V A;  4I3H A;  2FTX B;  1G2D C;  2PO2 B;  3JAM Q;  3F6G A;  2C37 B;  1J5E I;  1YYW A;  1I94 I;  4FK5 C;  2ODR D;  5A6J A;  2UUC E;  2EN4 A;  4L8N A;  2NPF A;  1UDN A;  2JE6 B;  1N34 E;  3WU3 A;  2ZBK B;  2E5L I;  2HHH I;  1NCS A;  3P06 A;  4M2Z A;  3M85 D;  4DR3 E;  4LF7 I;  4K0K I;  1VI7 A;  2WNR B;  1N36 E;  4BC9 A;  4OO1 C;  3FIG A;  4LF8 I;  1RR9 A;  4IFD A;  2EPX A;  5AE2 A;  1BKN A;  2DLK A;  1NHI A;  1STU A;  3ECR A;  2O1W A;  2GO4 A;  5FWK A;  4LCH A;  4F9C B;  3EPL A;  3J80 C;  3P3G A;  1PDA A;  3T1H I;  2HGH A;  1PJQ A;  2A25 A;  4TUG A;  4PU9 A;  2M9A A;  1ZR9 A;  2EOM A;  1JK1 A;  4J3D A;  3ZKB A;  1PVG A;  4LFB E;  3C6K A;  4WPY A;  5LMN I;  3M7N G;  2E72 A;  2ENA A;  1Z0C A;  5LLQ A;  1S16 A;  2UUC I;  2NA2 A;  2EN6 A;  3ZZ0 A;  4R2E A;  1RQ0 A;  4YHH E;  1DI2 A;  1P42 A;  1S4E A;  1Z0V A;  1K47 A;  1SR9 A;  2EPL X;  2C39 A;  3ADJ A;  1EH8 A;  5T6J A;  4BC7 A;  4DV2 E;  1T4O A;  2EPK X;  2YTI A;  4LF4 E;  2JEB A;  1EKZ A;  3LTO A;  3LLH A;  3M6A A;  4WUC A;  3P3E A;  4WX9 A;  5C0X A;  2IOQ A;  1GZ6 A;  1F2I G;  5K36 F;  2LMZ A;  3V2U C;  4DV6 E;  2EM3 A;  1ZXM A;  2NN6 F;  2OI2 A;  2PO2 A;  2R3V A;  4Z7C A;  2C37 A;  5LMU I;  1SFE A;  1ZBT A;  4FW7 A;  4FW4 A;  2GO3 A;  1EI1 A;  4NXN I;  3J7A M;  2EMG A;  5JEA B;  2LCE A;  2VE7 C;  2NN6 D;  4WYQ B;  2MDG A;  4B3T E;  3K85 A;  4MU4 A;  1QZR A;  2BB8 A;  1X48 A;  1PJS A;  2WNR A;  2UXB E;  3UHM A;  4MYT A;  2UUA I;  5TSE A;  5K36 E;  3ADI A;  2ELZ A;  2EN1 A;  3IWB A;  3THN A;  5KL3 A;  4AQY E;  2NN6 E;  5A2Q Q;  5C0X D;  2EL4 A;  3J81 C;  2L2M A;  1KJK A;  3DD6 A;  1MG7 A;  4LF6 I;  2V86 A;  4N4R B;  1KTV A;  3BBG A;  1GTK A;  1UDO A;  1IBK E;  4OO1 F;  2JT2 A;  1ZM3 A;  2C38 B;  4UTG A;  5GMD A;  3P1X A;  1Z0G A;  2A2D A;  3UK3 C;  2YRK A;  2EZ6 A;  3LNU A;  1A1G A;  4R2A A;  2BA0 D;  2L8T A;  4X62 I;  2ODR C;  3DJW A;  2YSO A;  3EPH A;  1A1I A;  5L3J A;  1IBM E;  3NZK A;  2LJH A;  2M1S A;  2LT7 A;  1MEY C;  4B3T I;  1WHQ A;  3KZZ A;  4IS9 A;  2WBT A;  2N3G A;  1X47 A;  4JI8 E;  1YSA C;  1Y6Z A;  1A1L A;  4Z7Y A;  4OO1 E;  2BA1 D;  3TQM A;  2L3C A;  4AQY I;  4L5N C;  4WSP A;  2R42 A;  4LF9 E;  4BA1 B;  1HR0 E;  2HK2 A;  4DR5 E;  4DPW A;  1B69 A;  4O5G A;  4R03 A;  3OML A;  4GQU A;  2M4I A;  2UU9 I;  4DV5 I;  4MDT A;  2CZ9 A;  5AAS A;  2D9H A;  2DRP A;  2CSH A;  1JK2 A;  3J7A G;  4X65 I;  5KL6 A;  1HNX I;  1Y4U A;  1LLM C;  1N32 E;  4HAC B;  4WUB A;  4DUY E;  2VQF I;  4IFD B;  2YT4 A;  1Z0B A;  1UDQ A;  2CGE A;  3CDI A;  2L33 A;  5JEA F;  2V8Q B;  1WXR A;  2VRD A;  4DR7 E;  1Z5A A;  1YYK A;  2EL6 A;  2G7H A;  2NUG A;  1RHY A;  2J65 A;  3B78 A;  1HNW E;  2EMB A;  3HXL A;  5DRO A;  2EPU A;  3ZZU A;  4JYA E;  4P7D A;  2B3T B;  5A6K A;  3Q6M A;  2UXC E;  5JEA D;  4BHC A;  5BR8 I;  4JI2 E;  3ZM7 A;  3PS2 A;  3HPZ A;  2V2Z A;  2NN6 C;  5JEA E;  2V88 A;  1EH6 A;  2JP9 A;  3CDJ A;  2C39 B;  2V2V A;  2LUQ A;  2JEB B;  2YTE A;  2PRT A;  1T4L B;  3MSW A;  3U1K A;  4DV1 E;  2O1V A;  2DMI A;  2EMH A;  2EOY A;  2YSP A;  3J7Y p;  4JI1 E;  2V2Q A;  3K17 A;  2JR1 A;  5C0X C;  4DV3 E;  4DUY I;  4BA1 A;  4I8O A;  2WBS A;  2YRM A;  3MHS C;  4IZK B;  3WU6 A;  1IMU A;  2H36 X;  5KL2 A;  1NEI A;  1E3P A;  2VQE I;  3T1Y E;  5FLX C;  4DR7 I;  3PS1 A;  1ZM4 A;  4R2S A;  1XMO E;  3IWC A;  4B3S I;  4HEI A;  3H4L A;  3U1Y A;  4DPX A;  2UXC I;  4B3M E;  4RPF A;  4DUZ I;  3F6H A;  2O1T A;  4U3D A;  4JV5 I;  3HKM A;  1B63 A;  2F4V I;  4HAC A;  4R2D A;  2Z5B B;  1XNQ E;  2IES A;  3QT8 A;  4LU9 A;  5DRQ A;  1IBL E;  1OYS A;  1ZBQ A;  2VES A;  2EE8 A;  1X5W A;  4OX9 E;  4X64 E;  4KHP E;  3L7Z B;  2ZM6 E;  5IWA I;  1L4S A;  3KRN A;  1A1F A;  3GLL A;  4HYM A;  4IFD F;  1IQO A;  2Q2E B;  4F9B B;  3T1Y I;  2CPN A;  4J8Z A;  2I9I A;  5DRP A;  2V8P A;  3HJC A;  2EJ4 A;  1N34 I;  3Q1Q A;  3QT6 A;  2PNZ A;  2EOR A;  2EOJ A;  3BID A;  2EMA A;  4DR3 I;  1DQ3 A;  4IFD D;  3L00 A;  2EOO A;  4DV0 E;  2HJJ A;  1N36 I;  1BB8 A;  4JI7 E;  4DXL A;  4HTG A;  4M9V C;  2VF1 A;  2GQ0 A;  2Z5C B;  4IFD E;  2B7V A;  4WSG A;  5EL9 A;  2L6M A;  1XNQ I;  4UT4 A;  1T39 A;  4IZK A;  4DR2 E;  3WU4 A;  4JI4 E;  1IBL I;  4JI6 E;  4ZYD A;  1UEK A;  1KKH A;  2N8X A;  5A6B A;  4DR1 E;  1YZ9 A;  1B62 A;  2CT1 A;  3B4T A;  2ZM6 I;  4FW3 A;  5C0X F;  3DF6 A;  3EPJ A;  3M7N D;  4LFB I;  5JEA C;  2YPN A;  2BM0 A;  1UDS A;  2V87 A;  2MKN A;  1WUU A;  4AID A;  1XMQ E;  4B3R E;  4NZV A;  3H09 A;  4LFC E;  3LPS A;  2FV4 B;  4YHH I;  1ZXN A;  2EM4 A;  2BR2 B;  2Z5B A;  2EN3 A;  4Q28 A;  4X9J A;  4KQV A;  4DV0 I;  2UUB E;  4DV2 I;  4LF4 I;  1T4N A;  4JI7 I;  4IZJ B;  2EN8 A;  5ADZ A;  5C0X E;  1X49 A;  2NUE A;  4RHB B;  3L7Z A;  2JOX A;  2EL5 A;  4WFT A;  1N33 E;  2BA0 G;  4DV6 I;  2V89 A;  2XEX A;  2JPA A;  2E1M A;  4OKG A;  1Y60 A;  1EH7 A;  4F6N A;  1TF3 A;  2F8B A;  3ADL A;  3B82 A;  5KL7 A;  4DPY A;  5AC4 A;  2IHR 1;  4BMJ A;  1R6M A;  2L2K B;  4BS9 A;  2X36 A;  2WCC 3;  3P76 A;  1UIL A;  5AE1 A;  2UXB I;  4R2C A;  2GLI A;  2Z5C A;  4BA2 B;  1XHK A;  4Q35 B;  1Z1B A;  1VIS A;  2EPC A;  3H1C A;  2YRH A;  3ZZT A;  2DMY A;  1TF6 A;  2LTS A;  2ADR A;  3OTO E;  4FWH A;  1Z5C A;  1IBK I;  4WXD A;  2EMC A;  2ZIT A;  4LFA E;  2RPC A;  2CTD A;  1QNT A;  2YTP A;  5DRR A;  2LUP B;  2EM2 A;  3PYE A;  2DSY A;  4DU7 A;  4HXZ A;  2YU8 A;  3PRY A;  5IXM B;  4ZYH A;  4DV4 E;  4DMI A;  4NBQ A;  2JWO A;  1IBM I;  1BBG A;  3KZY A;  4IFD C;  2V83 A;  3ZOQ B;  2YU5 A;  3P3C A;  1YPN A;  2BR2 A;  4JI8 I;  4JI3 E;  3JU0 A;  4OOG C;  1A1H A;  4IZJ A;  4MYU A;  3F0N A;  2RS7 A;  5CFF E;  2O1U A;  4BHB A;  4LF9 I;  1ELO A;  2LTR A;  2YTN A;  3K6Q A;  5IT9 C;  1G2F C;  1HR0 I;  4FW9 A;  4GKJ E;  4PRX A;  3J80 Q;  4DR5 I;  3D4J A;  3OTO I;  2UXD E;  2CG9 A;  2EMF A;  2YTJ A;  4JI5 E;  2RQL A;  4LCG A;  1OYR A;  2J7J A;  2EMY A;  2LO3 A;  2PNZ B;  5A2Q C;  2WP8 A;  4MQY A;  2KHX A;  5DNY A;  2I13 A;  1X6H A;  2B9D A;  2V34 A;  4M30 A;  1NZ0 A;  4TUI A;  2KOU A;  1N32 I;  4IZJ D;  1MU5 A;  4BA2 A;  1E3H A;  4F9A B;  5A69 A;  1J5E E;  3VYX A;  1I94 E;  2WZO A;  5A6A A;  4R2P A;  1WJP A;  2E5L E;  3HTX A;  2HHH E;  1IQS A;  2GPI A;  2FGG A;  5DNL A;  3C4T A;  5KL4 A;  1HNW I;  4LF7 E;  3GME A;  3BF2 A;  1NHH A;  2EPN A;  3KWR A;  4GKK E;  3M85 G;  4JYA I;  1HNZ E;  1R6L A;  3HUL A;  2UXD I;  3LML A;  5K36 B;  1USU A;  2EM6 A;  4JI2 I;  4JI5 I;  2EOI A;  5IV8 B;  3VK6 A;  4DU8 A;  4QNK A;  1O0W A;  4KZS A;  1X6E A;  3EPK A;  2JEA B;  1A1J A;  3T1H E;  2R1F A;  2RTX A;  2DGC A;  2MC5 A;  4DV1 I;  3M99 B;  3C6M A;  4JI1 I;  4WUD A;  3J81 Q;  4FWG A;  4DV3 I;  1NHJ A;  5LMN E;  4U3B A;  2YWQ A;  2EPA A;  2ENH A;  3B8H A;  2EMZ A;  2R76 A;  1KYQ A;  1RMD A;  2EN7 A;  2EOX A;  1P47 A;  1GQE A;  4P7A A;  2EMW A;  2L2N A;  1Z5B A;  1QU6 A;  2HFS A;  5DNX A;  1XMO I;  3HPS A;  4DR6 E;  2VF3 A;  1HNZ I;  4GKK I;  4OO1 B;  2YTQ A;  1WHN A;  2EMK A;  4B3M I;  2F1D A;  1YFH A;  4F54 A;  2WBU A;  2L92 A;  3ZKD A;  4MLV A;  2PO0 B;  4QNJ A;  5LMU E;  1ZU1 A;  4MU0 A;  1MGT A;  4DPT A;  1UBD C;  4F6M A;  4AIM A;  1WRJ A;  3PYD A;  1OJ4 A;  2EM7 A;  4IJD A;  5AC5 A;  2DB2 A;  4NXN E;  4OX9 I;  1H7U A;  4P78 A;  1XXE A;  4M1K A;  2WW4 A;  4X64 I;  2EOE A;  2GS8 A;  4KHP I;  1XNR E;  2EOH A;  3VYY A;  2YTO A;  1U2R A;  2HKJ A;  2Z5E A;  2ELY A;  2JY9 A;  4ZYG A;  1D6T A;  4N3O A;  4O4K A;  4O24 A;  2RSI A;  5K36 A;  4F2J C;  2PNL A;  2UUA E;  3V5R A;  2LRS A;  2EPR A;  4LF5 E;  2NN6 A;  4RH8 A;  4LF6 E;  2HK3 A;  4FW5 A;  4GEQ B;  1HK7 A;  2JXP A;  4FN5 A;  4MLQ A;  3THO B;  4X66 E;  3PYF A;  3JAM C;  2EQ0 A;  1Z0T A;  2JEA A;  1AAY A;  2LV2 A;  4USM A;  1DAR A;  1EA6 A;  1KIJ A;  5A6B D;  2EPM X;  4ISA A;  4X62 E;  4LPF A;  2JYA A;  1H72 C;  2LVH A;  3AV0 A;  4DR4 E;  4LOM A;  4DR2 I;  1YUI A;  1ZM9 A;  2JE6 A;  4JI4 I;  2NUF A;  4GZN C;  1T38 A;  2KON A;  2IOP A;  4ED4 A;  4JI6 I;  2X7I A;  4ZVI A;  4DR6 I;  4DR1 I;  2EMX A;  2EWL A;  5K36 D;  1Y5Y A;  5IT9 Q;  2BM1 A;  1XNR I;  2YTG A;  2K4V A;  4BCA A;  4JI0 E;  1RRE A;  2J7K A;  2WP8 B;  4LTY A;  3GON A;  4OZE A;  1YH8 A;  3ADG A;  4HY1 A;  4OO1 A;  2CVE A;  1Y4S A;  1FWL A;  2EM5 A;  2EOZ A;  5KL5 A;  3WU5 A;  2EM0 A;  3PYG A;  4LF5 I;  2DLQ A;  2YZT A;  4DKK A;  4R1F A;  2LJU A;  2BA1 G;  2E1R A;  5ELW A;  1XMQ I;  3IWD A;  4B3R I;  4PRV A;  2PO0 A;  3EQ1 A;  2RSM A;  2L3J A;  4JG4 A;  2EM8 A;  2MKD A;  2N3H A;  1FNM A;  1J26 A;  2PO1 B;  5LL6 R;  3VHT B;  3C4B A;  4LFC I;  4X66 I;  2UUB I;  4O43 A;  1PJT A;  2V85 A;  2UU9 E;  2EOQ A;  4DV5 E;  1YUJ A;  1BBO A;  1H74 A;  4FW6 A;  2LBS B;  2B7T A;  1DGC A;  3QG5 C;  2EFG A;  2EN2 A;  3PS3 A;  4IS1 C;  1KVK A;  4LCF A;  5FLX Q;  4DR4 I;  4BBY A;  4YY3 E;  1N33 I;  4X65 E;  2AJ4 A;  3GCM A;  1HNX E;  2A2C A;  2NAB A;  1ZM2 A;  4OO1 D;  2VQF E;  3QT7 A;  4P52 A;  2BBG A;  3MHH C;  4JI0 I;  2DIX A;  4DPU A;  4DV7 E;  2PNM A;  3HQ1 A;  2O3Z A;  5F3W A;  1N0V C;  3CWV A; 
#chains in the Genus database with same CATH homology
 1A6F A;  2JVA A;  4R8O A;  5BR8 E;  1USV A;  4NXM E;  2DEI A;  2RS6 A;  2MC6 A;  3AUZ A;  4XTJ A;  4LFA I;  3Q6N A;  5GME A;  4YY3 I;  2LJP A;  1RC7 A;  1FJG E;  4DV4 I;  4DV7 I;  1PIE A;  4USK A;  2VQE E;  3RMP A;  4JI3 I;  4EMD A;  4B3S E;  1FKA E;  2LE2 A;  4K0K E;  5AE3 A;  2DEJ A;  4DUZ E;  1N0U A;  3QT5 A;  2HKE A;  4GKJ I;  1D6T A;  4JV5 E;  4URL A;  4NXM I;  2M7Q A;  2BV3 A;  1FI4 A;  2JOB A;  4LF8 E;  2F4V E;  4FWD A;  2MDR A;  2HFU A;  1Z59 A;  1H73 A;  3K1J A;  4X8W A;  1Z0W A;  1H7S A;  3JTZ A;  1FJG I;  1UHZ A;  1Z0E A;  4I3H A;  1YYO A;  5IWA E;  1PKP A;  1FWK A;  1MX0 A;  4M0V A;  2FTX B;  3JAM Q;  3F6G A;  1J5E I;  1YYW A;  1I94 I;  2ODR D;  3ZKD A;  2UUC E;  3WU3 A;  4L8N A;  2NPF A;  2E5L I;  1N34 E;  2HHH I;  2ZBK B;  3P06 A;  4M2Z A;  4LF7 I;  4DR3 E;  4K0K I;  1N36 E;  4BC9 A;  3FIG A;  4LF8 I;  1RR9 A;  5AE2 A;  1BKN A;  1NHI A;  1STU A;  2O1W A;  5FWK A;  4F9C B;  3J80 C;  3T1H I;  4TUG A;  4PU9 A;  3ZKB A;  1PVG A;  4LFB E;  4WPY A;  5LMN I;  2UUC I;  1Z0C A;  1S16 A;  2NA2 A;  3ZZ0 A;  1RQ0 A;  4YHH E;  1DI2 A;  1S4E A;  1Z0V A;  1K47 A;  1SR9 A;  4DR6 I;  3ADJ A;  5T6J A;  4BC7 A;  4DV2 E;  1T4O A;  4LF4 E;  1EKZ A;  3LTO A;  3LLH A;  3M6A A;  4WUC A;  2IOQ A;  1GZ6 A;  2LMZ A;  3V2U C;  4DV6 E;  1ZXM A;  2OI2 A;  5LMU I;  2R3V A;  4Z7C A;  1ZBT A;  1EI1 A;  4NXN I;  3J7A M;  2VE7 C;  4WYQ B;  4B3T E;  3K85 A;  1QZR A;  1X48 A;  2UXB E;  4MYT A;  2UUA I;  3ADI A;  4AQY E;  3IWB A;  5A2Q Q;  3J81 C;  2L2M A;  4LF6 I;  1MG7 A;  2V86 A;  1KTV A;  1IBK E;  1ZM3 A;  4UTG A;  5GMD A;  3P1X A;  1Z0G A;  2A2D A;  3LNU A;  2EZ6 A;  4X62 I;  2L8T A;  2ODR C;  3DJW A;  5L3J A;  1IBM E;  2LJH A;  2M1S A;  4B3T I;  1WHQ A;  2N3G A;  1X47 A;  4JI8 E;  1Y6Z A;  4Z7Y A;  2L3C A;  4AQY I;  4L5N C;  4WSP A;  2R42 A;  4LF9 E;  1HR0 E;  2HK2 A;  4DR5 E;  4DPW A;  4R03 A;  3OML A;  2M4I A;  2UU9 I;  4DV5 I;  2CZ9 A;  5AAS A;  3J7A G;  4X65 I;  1HNX I;  1Y4U A;  1N32 E;  4HAC B;  4WUB A;  4DUY E;  2VQF I;  2YT4 A;  1Z0B A;  2CGE A;  2L33 A;  2V8Q B;  1WXR A;  4DR7 E;  1Z5A A;  1YYK A;  2G7H A;  2NUG A;  3B78 A;  1HNW E;  3HXL A;  3ZZU A;  4JYA E;  4P7D A;  2B3T B;  3Q6M A;  2UXC E;  5BR8 I;  4JI2 E;  3ZM7 A;  3HPZ A;  2V2Z A;  2V88 A;  2V2V A;  2LUQ A;  1T4L B;  3MSW A;  4DV1 E;  2O1V A;  3K17 A;  3J7Y p;  4JI1 E;  2V2Q A;  4DUY I;  2JR1 A;  4DV3 E;  4I8O A;  3WU6 A;  4IZK B;  2H36 X;  2VQE I;  4DR7 I;  3T1Y E;  5FLX C;  1ZM4 A;  4B3S I;  1XMO E;  3IWC A;  3H4L A;  4DPX A;  2UXC I;  4B3M E;  4RPF A;  4DUZ I;  3F6H A;  2O1T A;  4JV5 I;  2F4V I;  1B63 A;  4HAC A;  2Z5B B;  1XNQ E;  3QT8 A;  4LU9 A;  1IBL E;  1ZBQ A;  4OX9 E;  4X64 E;  4KHP E;  2ZM6 E;  5IWA I;  4HYM A;  2Q2E B;  4F9B B;  3T1Y I;  2CPN A;  4J8Z A;  2V8P A;  3HJC A;  1N34 I;  3Q1Q A;  3QT6 A;  4DR3 I;  1DQ3 A;  4DV0 E;  1N36 I;  4DXL A;  4JI7 E;  2GQ0 A;  2VF1 A;  2Z5C B;  2B7V A;  2L6M A;  1XNQ I;  4UT4 A;  4IZK A;  4DR2 E;  3WU4 A;  4JI4 E;  1IBL I;  4JI6 E;  1UEK A;  1KKH A;  4DR1 E;  1YZ9 A;  1B62 A;  2ZM6 I;  3DF6 A;  4LFB I;  2BM0 A;  2V87 A;  1WUU A;  1XMQ E;  4B3R E;  3H09 A;  4LFC E;  3LPS A;  2FV4 B;  4YHH I;  1ZXN A;  2Z5B A;  4KQV A;  4Q28 A;  4DV0 I;  2UUB E;  4DV2 I;  4LF4 I;  1T4N A;  4JI7 I;  4IZJ B;  5ADZ A;  1X49 A;  2NUE A;  2JOX A;  4WFT A;  1N33 E;  4DV6 I;  2V89 A;  2XEX A;  2E1M A;  2F8B A;  3ADL A;  3B82 A;  4DPY A;  2IHR 1;  4BMJ A;  2L2K B;  4BS9 A;  2X36 A;  1UIL A;  5AE1 A;  2UXB I;  2Z5C A;  1XHK A;  1VIS A;  3ZZT A;  2DMY A;  2LTS A;  3OTO E;  4FWH A;  1Z5C A;  1IBK I;  2ZIT A;  4LFA E;  2LUP B;  3PYE A;  2DSY A;  4DU7 A;  4HXZ A;  3PRY A;  4DV4 E;  4DMI A;  2JWO A;  1IBM I;  2V83 A;  3ZOQ B;  4JI8 I;  4JI3 E;  3JU0 A;  4OOG C;  4IZJ A;  4MYU A;  3F0N A;  2RS7 A;  5CFF E;  2O1U A;  4LF9 I;  1ELO A;  2LTR A;  3K6Q A;  5IT9 C;  1HR0 I;  4FW9 A;  4GKJ E;  4PRX A;  3J80 Q;  4DR5 I;  3D4J A;  3OTO I;  2UXD E;  2CG9 A;  4JI5 E;  5A2Q C;  2KHX A;  5DNY A;  2B9D A;  2V34 A;  4M30 A;  1NZ0 A;  4TUI A;  2KOU A;  1N32 I;  4IZJ D;  1MU5 A;  4F9A B;  1J5E E;  3VYX A;  1I94 E;  2WZO A;  3HTX A;  2E5L E;  2HHH E;  2FGG A;  3C4T A;  1HNW I;  4LF7 E;  1NHH A;  3KWR A;  4GKK E;  4JYA I;  1HNZ E;  3HUL A;  2UXD I;  3LML A;  1USU A;  4JI2 I;  4JI5 I;  3VK6 A;  4DU8 A;  1O0W A;  4KZS A;  3T1H E;  2RTX A;  2MC5 A;  4DV1 I;  4JI1 I;  4WUD A;  3J81 Q;  4FWG A;  4DV3 I;  1NHJ A;  5LMN E;  3B8H A;  1GQE A;  4P7A A;  2L2N A;  1Z5B A;  2HFS A;  1QU6 A;  1XMO I;  4GKK I;  3HPS A;  4DR6 E;  2VF3 A;  1HNZ I;  1WHN A;  4B3M I;  4F54 A;  2L92 A;  5LMU E;  4DPT A;  3PYD A;  1OJ4 A;  2DB2 A;  4NXN E;  4OX9 I;  1H7U A;  4P78 A;  4M1K A;  4X64 I;  2WW4 A;  4KHP I;  2GS8 A;  1XNR E;  1U2R A;  3VYY A;  2HKJ A;  2Z5E A;  2JY9 A;  4N3O A;  2PNL A;  2UUA E;  3V5R A;  2LRS A;  4LF5 E;  4LF6 E;  2HK3 A;  4GEQ B;  1HK7 A;  4FN5 A;  4X66 E;  3PYF A;  3JAM C;  1Z0T A;  4USM A;  1DAR A;  1EA6 A;  1KIJ A;  4X62 E;  1H72 C;  3AV0 A;  4DR4 E;  4DR2 I;  1ZM9 A;  4JI4 I;  2NUF A;  4ED4 A;  4JI6 I;  2KON A;  2IOP A;  5IT9 Q;  2X7I A;  4ZVI A;  4DR1 I;  2EWL A;  2BM1 A;  1XNR I;  3GON A;  2K4V A;  4BCA A;  4JI0 E;  1RRE A;  2J7K A;  4LTY A;  3ADG A;  4HY1 A;  1Y4S A;  1FWL A;  3WU5 A;  3PYG A;  4LF5 I;  2YZT A;  4DKK A;  4R1F A;  2E1R A;  1XMQ I;  3IWD A;  4B3R I;  4PRV A;  4LFC I;  4JG4 A;  2RSM A;  2L3J A;  2N3H A;  1FNM A;  1J26 A;  5LL6 R;  3C4B A;  4X66 I;  2UUB I;  2V85 A;  2UU9 E;  4DV5 E;  1H74 A;  2LBS B;  2B7T A;  2EFG A;  1KVK A;  5FLX Q;  4DR4 I;  4BBY A;  4YY3 E;  1N33 I;  4X65 E;  2AJ4 A;  1HNX E;  2A2C A;  1ZM2 A;  2VQF E;  3QT7 A;  4P52 A;  4JI0 I;  2DIX A;  4DPU A;  4DV7 E;  2PNM A;  3HQ1 A;  5F3W A;  1N0V C;  3CWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...