5IWAI

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5iwaI00
1PKPA 4K0KI 2R3VA 2BV3A 2UXCE 2EFGA 2UUAI 4DR5I 1FI4A 4DXLA 1IBKE 3Q1QA 3CWVA 2X36A 4HYMA 4YY3I 4JI5E 4X65E 4USMA 2GS8A 3QT7A 2HHHI 5IWAE 1FNMA 3J80C 3WU6A 2UXCI 4JI1I 4NXNI 4B3ME 1N0UA 3ZKBA 3GONA 2A2CA 4FWGA 1XNRE 1N33I 4YHHE 4B3SE 4LFBE 1Z5BA 2UUCE 5BR8E 1KVKA 3QT8A 1Z0EA 4LF5I 1A6FA 3J7AM 4DPXA 2E5LE 1Z0VA 4LF8E 4DV4I 1UEKA 1HNZE 4DV0I 4XTJA 4KHPI 1XNRI 1EI1A 1RR9A 4X64E 1DARA 2V34A 5GMDA 1VISA 4LF4E 2VQEE 4AQYI 3D4JA 3LNUA 2UXBI 4JV5E 3T1HI 3OTOE 4FN5A 4JI6E 4DV6E 1XMOE 1FJGE 1HNXI 3T1YI 4JI2I 5L3JA 4DR2E 4NXME 2F4VI 4DR4E 5IT9Q 1XNQE 2WW4A 4M1KA 4DR6E 1Z0GA 4B3RE 3ZZUA 4K0KE 2OI2A 4FWDA 2UUAE 1EA6A 4EMDA 2HFUA 2J7KA 1WUUA 4JI0I 1PVGA 4WUCA 1J5EE 3PYGA 2ZM6I 4LF6E 1XMQI 4HXZA 1FWLA 2LJPA 2V8PA 2CZ9A 4YY3E 3JAMC 4JI8I 1IBMI 4B3RI 1IBLI 4I3HA 2R42A 4R1FA 4HACB 3QT5A 1Z5AA 5IT9C 4JI1E 4NXNE 4ZVIA 3B8HA 4DV2I 1RREA 1H7UA 4MYTA 1J5EI 2AJ4A 4LF6I 1N33E 2HFSA 1N36I 4DPTA 1KIJA 1S4EA 5GMEA 4GKJI 1N34I 4LF5E 4HACA 1FWKA 4DV3I 3J81C 4DV4E 3ZZ0A 4DV0E 1H7SA 4DU8A 1I94I 1HR0I 5A2QQ 4DV5I 4KHPE 4DR1I 2UUBE 2BM1A 4WUBA 4JI3I 1MU5A 4X62I 3ZM7A 1MG7A 1Z0BA 4B3TI 1K47A 1PIEA 5LMNE 4PU9A 4AQYE 2A2DA 3K1JA 2UXBE 4P7AA 4LFCI 3T1HE 3LPSA 1U2RA 1Z0TA 2DEJA 3K17A 2NPFA 1HNXE 2V2VA 1NHJA 4ED4A 3T1YE 4JI2E 4DPWA 1FKAE 2F4VE 2UUBI 4JI7I 4UT4A 4WUDA 5A2QC 4DPUA 1ZXNA 4URLA 5LMNI 4DR7I 3V5RA 2V2QA 4JI0E 2VQFI 2HKEA 1MX0A 2ZM6E 1XMQE 4GKKI 3B78A 1B62A 4JI4I 2ZITA 4JI8E 4DUZI 5LMUI 1IBME 2UU9E 1IBLE 4DPYA 4UTGA 4DUYI 4DV2E 4DV7I 4USKA 1NZ0A 4P52A 1N36E 1N32I 3V2UC 4X66I 4GKJE 1N34E 2UU9I 4DV3E 4FW9A 1HNWI 5LL6R 1H74A 1S16A 3H4LA 3B82A 1KKHA 1I94E 1HR0E 1Z0WA 1N0VC 4DV5E 2HKJA 4DV1I 2UXDI 4DR1E 4JI3E 4JYAI 1NHHA 4OX9I 4X62E 3LTOA 3F0NA 3M6AA 4JG4A 4DR3E 4B3TE 2E1RA 1NHIA 4LFCE 1ZM4A 1Z0CA 3PYFA 4LFAI 1Z59A 4LF7I 3PYEA 4JI7E 3J7AG 1QZRA 4DR3I 1XHKA 1B63A 1ELOA 4DR7E 2V2ZA 1H72C 4KQVA 3ZZTA 2VQFE 1IBKI 2Q2EB 4GKKE 4Z7CA 4JI5I 4X65I 4JI4E 4Z7YA 4DUZE 5LMUE 2HK3A 3HULA 4MYUA 2ZBKB 4LF9E 5IWAI 4PRVA 1BKNA 4B3MI 3ZKDA 4DUYE 3QT6A 4DV7E 2VF3A 1OJ4A 3WU3A 3WU4A 4YHHI 4B3SI 4LFBI 4HY1A 2UUCI 1N32E 3WU5A 5FLXQ 4PRXA 4X66E 4FWHA 5BR8I 4LF9I 2E5LI 1HNWE 1ZXMA 1ZM9A 3JAMQ 2BM0A 4RPFA 4LF8I 1HNZI 1ZM2A 4DV1E 2UXDE 1D6TA 4X64I 4JYAE 4OX9E 1H73A 4LF4I 2VQEI 4DR5E 5FLXC 4JV5I 3OTOI 2XEXA 4JI6I 4LFAE 3J80Q 4DV6I 3J81Q 1XMOI 4LF7E 1FJGI 4DR2I 4NXMI 4DR4I 2HK2A 1KTVA 4DU7A 1XNQI 4DR6I 1Z5CA 2DEIA 2X7IA 1ZM3A 3PYDA 2HHHE
chains in the Genus database with same CATH superfamily
1PKPA 4K0KI 3PRYA 2R3VA 2BV3A 2UXCE 2EFGA 1RHYA 2UUAI 3Q6NA 4DR5I 2IOQA 4MQYA 5JEAD 4LCHA 1FI4A 4DXLA 1IBKE 3Q1QA 4BA2B 3CWVA 2JEBA 2X36A 3L7ZB 4HYMA 4YY3I 4JI5E 4X65E 4IFDB 4USMA 2WP8A 1OYRA 2PNMA 2PO2A 2GS8A 3QT7A 1VI7A 2HHHI 5IWAE 1FNMA 3J80C 3WU6A 2NN6E 2UXCI 4JI1I 4IZJB 4NXNI 4B3ME 2O1UA 1N0UA 2BA1D 3ZKBA 3GONA 2A2CA 4FWGA 1XNRE 1N33I 4YHHE 4B3SE 4LFBE 1Z5BA 2UUCE 4FW6A 1E3HA 5JEAF 5BR8E 1KVKA 3QT8A 5K36E 1Z0EA 4LF5I 1A6FA 4IFDE 3J7AM 4DPXA 2E5LE 5C0XD 2BA0D 1Z0VA 4LF8E 4DV4I 1UEKA 1HNZE 1Y5YA 3P06A 4DV0I 3P3EA 2GO3A 1XXEA 4XTJA 4KHPI 1XNRI 2C39B 3M85G 2Z5BB 1EI1A 1RR9A 4X64E 1DARA 2V34A 4MDTA 5GMDA 4AIDA 2JEAB 4QNKA 1UDSA 1VISA 4LF4E 2VQEE 3UHMA 4AQYI 3D4JA 2Z5CB 3LNUA 2UXBI 4JV5E 3T1HI 3OTOE 4FN5A 4JI6E 5C0XC 4DV6E 1XMOE 1FJGE 1HNXI 3T1YI 4OO1A 2PNLA 5EKWA 4JI2I 5L3JA 4DR2E 4NXME 2F4VI 4DR4E 5IT9Q 3GLLA 1XNQE 4U3BA 2WW4A 4M1KA 4DR6E 1USVA 1Z0GA 2C38B 4B3RE 2PO1B 3P3CA 3ZZUA 1HK7A 4K0KE 5K36C 2OI2A 1OYPA 4FWDA 2UUAE 1EA6A 4EMDA 4MU3A 2HFUA 2J7KA 1WUUA 4JI0I 1PVGA 4WUCA 1J5EE 3PYGA 2ZM6I 4LF6E 1XMQI 4HXZA 2O1TA 1FWLA 2LJPA 2V8PA 2CZ9A 2J65A 4YY3E 2JEBB 3JAMC 2PO1A 4JI8I 2JT2A 2WP8B 1IBMI 4B3RI 1IBLI 4LOMA 2PO2B 4I3HA 2R42A 4R1FA 4HACB 5JEAA 3QT5A 1Z5AA 5IT9C 4JI1E 2JE6A 4NXNE 4ZVIA 3B8HA 4DV2I 1RREA 1H7UA 4MYTA 1J5EI 4OO1F 3PS2A 2AJ4A 4LF6I 1N33E 2HFSA 1N36I 4DPTA 1UDQA 3NZKA 1KIJA 1S4EA 2CGEA 5GMEA 4GKJI 1N34I 4LF5E 4HACA 1FWKA 2BA0G 4DV3I 3J81C 3HKMA 4DV4E 4FW3A 3ZZ0A 4DV0E 1H7SA 4DU8A 2F1DA 1I94I 1HR0I 5A2QQ 4FW4A 4DV5I 4KHPE 4MU1A 2O1WA 4DR1I 2UUBE 2BM1A 4IZKB 1OYSA 4WUBA 4JI3I 1MU5A 5C0XA 1YHCA 4X62I 2Z5EA 1MG7A 3ZM7A 1Z0BA 2NN6D 3DD6A 4B3TI 1K47A 1PIEA 5LMNE 4PU9A 4AM3A 4AQYE 3GMEA 5ELWA 2A2DA 3K1JA 2UXBE 4P7AA 4LFCI 3T1HE 3LPSA 1U2RA 1Z0TA 2DEJA 3K17A 2NPFA 2V2VA 1NHJA 4ED4A 3T1YE 1HNXE 4JI2E 4DPWA 4IZKA 1FKAE 3KRNA 1UDNA 2F4VE 4OO1B 2UUBI 5K36D 4JI7I 4UT4A 4WUDA 1YH8A 4IFDD 5A2QC 1ZXNA 4DPUA 5DRRA 4URLA 5LMNI 4DR7I 2GO4A 3V5RA 2V2QA 4JI0E 2NN6C 4IZJD 2VQFI 4BA1A 2HKEA 5DROA 1MX0A 2ZM6E 4AIMA 1XMQE 4GKKI 5DNXA 3B78A 3HJCA 3U1KA 1B62A 5C0XF 4JI4I 2ZITA 4JI8E 2AE8A 4DUZI 2WNRB 5LMUI 1IBME 1Y6ZA 2UU9E 1IBLE 1Y4SA 5FWKA 4OO1E 4LPFA 5JEAB 4DPYA 4IFDC 5K36F 4UTGA 2JE6B 4DUYI 4DV2E 4DV7I 4USKA 4P52A 1NZ0A 4OKGA 4MU4A 4OZEA 1N36E 3M85D 1N32I 2WNRA 3B4TA 3V2UC 4X66I 4GKJE 2IESA 1N34E 2PO0B 2UU9I 4DV3E 4FW9A 1HNWI 5LL6R 3M7ND 1H74A 1S16A 3H4LA 3B82A 1KKHA 1I94E 2BA1G 1HR0E 1E3PA 1Z0WA 5JEAE 1N0VC 4DV5E 2HKJA 4FW7A 4DV1I 2UXDI 4DR1E 4JI3E 4JYAI 1NHHA 4OX9I 2GQ0A 4X62E 2PO0A 1Y4UA 3LTOA 2C37B 2VESA 3F0NA 3M6AA 4JG4A 5C0XB 4DR3E 4B3TE 1UDOA 2E1RA 4OO1C 3CDJA 1NHIA 4LFCE 1ZM4A 1Z0CA 3PYFA 4LFAI 1Z59A 4LF7I 5K36B 1Y60A 3PYEA 3U1YA 2NN6A 2PNZB 4ISAA 4JI7E 2C37A 3Q6MA 3J7AG 1QZRA 4DR3I 1XHKA 1R6MA 1B63A 1ELOA 4DR7E 2V2ZA 1USUA 5C0XE 1H72C 4KQVA 3ZZTA 4BA2A 2VQFE 1IBKI 2Q2EB 5K36A 4GQUA 3L7ZA 4GKKE 4BA1B 4LCFA 4IFDA 5JEAC 4Z7CA 4JI5I 4X65I 2PNZA 4JI4E 4Z7YA 4DUZE 5LMUE 2HK3A 3HULA 4MYUA 2ZBKB 4LF9E 5IWAI 3CDIA 1R6LA 2BR2B 4IZJA 2IOPA 4PRVA 1BKNA 4B3MI 3ZKDA 4DUYE 3QT6A 4DV7E 2VF3A 1OJ4A 3H1CA 5EL9A 3WU3A 2O1VA 2NN6F 3WU4A 5DNLA 4YHHI 4B3SI 4LFBI 3PS3A 4HY1A 2UUCI 1N32E 3WU5A 5FLXQ 2O3ZA 4PRXA 4X66E 4FWHA 5BR8I 2BR2A 4LF9I 2E5LI 4U3DA 3M7NG 1HNWE 1ZXMA 1ZM9A 3JAMQ 2BM0A 4RPFA 4LF8I 1HNZI 4MU0A 1ZM2A 4IFDF 2C39A 4J3DA 2Z5BA 4DV1E 2UXDE 2IERA 5DRQA 2JEAA 1D6TA 4X64I 4N3OA 4JYAE 2CVEA 4OX9E 4OO1D 3K85A 1H73A 4LF4I 2VQEI 4QNJA 3P76A 2Z5CA 4LCGA 4DR5E 5DRPA 2CG9A 5FLXC 4IS9A 4JV5I 1P42A 3OTOI 2XEXA 3PS1A 4JI6I 3P3GA 4LFAE 3J80Q 3GCMA 3J81Q 4DV6I 1XMOI 4LF7E 1FJGI 4DR2I 4NXMI 4DR4I 2HK2A 4FW5A 2C38A 1KTVA 4DU7A 1XNQI 4DR6I 1Z5CA 2DEIA 2NN6B 4NBQA 2X7IA 1ZM3A 3PYDA 2HHHE
chains in the Genus database with same CATH topology
1PKPA 4K0KI 3PRYA 2R3VA 2BV3A 2UXCE 2EFGA 2UUAI 3Q6NA 4DR5I 2IOQA 1FI4A 4DXLA 1IBKE 3Q1QA 3CWVA 2X36A 4HYMA 4YY3I 4JI5E 4X65E 4USMA 2PNMA 2GS8A 3QT7A 2HHHI 5IWAE 1FNMA 3J80C 3WU6A 2UXCI 4JI1I 4IZJB 4NXNI 4B3ME 2O1UA 1N0UA 3ZKBA 3GONA 2A2CA 4FWGA 1XNRE 1N33I 4YHHE 4B3SE 4LFBE 1Z5BA 2UUCE 5BR8E 1KVKA 3QT8A 1Z0EA 4LF5I 1A6FA 3J7AM 4DPXA 2E5LE 1Z0VA 4LF8E 4DV4I 1UEKA 1HNZE 3P06A 4DV0I 4XTJA 4KHPI 1XNRI 2Z5BB 1EI1A 1RR9A 4X64E 1DARA 2V34A 5GMDA 1VISA 4LF4E 2VQEE 4AQYI 3D4JA 2Z5CB 3LNUA 2UXBI 4JV5E 3T1HI 3OTOE 4FN5A 4JI6E 4DV6E 1XMOE 1FJGE 1HNXI 3T1YI 2PNLA 4JI2I 5L3JA 4DR2E 4NXME 2F4VI 4DR4E 5IT9Q 1XNQE 2WW4A 4M1KA 4DR6E 1USVA 1Z0GA 4B3RE 3ZZUA 1HK7A 4K0KE 2OI2A 4FWDA 2UUAE 1EA6A 4EMDA 2HFUA 2J7KA 1WUUA 4JI0I 1PVGA 4WUCA 1J5EE 3PYGA 2ZM6I 4LF6E 1XMQI 4HXZA 2O1TA 1FWLA 2LJPA 2V8PA 2CZ9A 4YY3E 3JAMC 4JI8I 1IBMI 4B3RI 1IBLI 4I3HA 2R42A 4R1FA 4HACB 3QT5A 1Z5AA 5IT9C 4JI1E 4NXNE 4ZVIA 3B8HA 4DV2I 1RREA 1H7UA 4MYTA 1J5EI 2AJ4A 4LF6I 1N33E 2HFSA 1N36I 4DPTA 1KIJA 1S4EA 2CGEA 5GMEA 4GKJI 1N34I 4LF5E 4HACA 1FWKA 4DV3I 3J81C 4DV4E 3ZZ0A 4DV0E 1H7SA 4DU8A 1I94I 1HR0I 5A2QQ 4DV5I 4KHPE 2O1WA 4DR1I 2UUBE 2BM1A 4IZKB 4WUBA 4JI3I 1MU5A 4X62I 2Z5EA 1MG7A 3ZM7A 1Z0BA 4B3TI 1K47A 1PIEA 5LMNE 4PU9A 4AQYE 2A2DA 3K1JA 2UXBE 4P7AA 4LFCI 3T1HE 3LPSA 1U2RA 1Z0TA 2DEJA 3K17A 2NPFA 2V2VA 1NHJA 4ED4A 3T1YE 1HNXE 4JI2E 4DPWA 4IZKA 1FKAE 2F4VE 2UUBI 4JI7I 4UT4A 4WUDA 5A2QC 4DPUA 1ZXNA 4URLA 5LMNI 4DR7I 3V5RA 2V2QA 4JI0E 4IZJD 2VQFI 2HKEA 1MX0A 2ZM6E 1XMQE 4GKKI 3B78A 3HJCA 1B62A 4JI4I 2ZITA 4JI8E 4DUZI 5LMUI 1IBME 1Y6ZA 2UU9E 1IBLE 1Y4SA 5FWKA 4DPYA 4UTGA 4DUYI 4DV2E 4DV7I 4USKA 1NZ0A 4P52A 1N36E 1N32I 3V2UC 4X66I 4GKJE 1N34E 2UU9I 4DV3E 4FW9A 1HNWI 5LL6R 1H74A 1S16A 3H4LA 3B82A 1KKHA 1I94E 1HR0E 1Z0WA 1N0VC 4DV5E 2HKJA 4DV1I 2UXDI 4DR1E 4JI3E 4JYAI 1NHHA 4OX9I 2GQ0A 4X62E 1Y4UA 3LTOA 3F0NA 3M6AA 4JG4A 4DR3E 4B3TE 2E1RA 1NHIA 4LFCE 1ZM4A 1Z0CA 3PYFA 4LFAI 1Z59A 4LF7I 3PYEA 4JI7E 3Q6MA 3J7AG 1QZRA 4DR3I 1XHKA 1B63A 1ELOA 4DR7E 2V2ZA 1USUA 1H72C 4KQVA 3ZZTA 2VQFE 1IBKI 2Q2EB 4GKKE 4Z7CA 4JI5I 4X65I 4JI4E 4Z7YA 4DUZE 5LMUE 2HK3A 3HULA 4MYUA 2ZBKB 4LF9E 5IWAI 4IZJA 2IOPA 4PRVA 1BKNA 4B3MI 3ZKDA 4DUYE 3QT6A 4DV7E 2VF3A 1OJ4A 3WU3A 2O1VA 3WU4A 4YHHI 4B3SI 4LFBI 4HY1A 2UUCI 1N32E 3WU5A 5FLXQ 4PRXA 4X66E 4FWHA 5BR8I 4LF9I 2E5LI 1HNWE 1ZXMA 1ZM9A 3JAMQ 2BM0A 4RPFA 4LF8I 1HNZI 1ZM2A 2Z5BA 4DV1E 2UXDE 1D6TA 4X64I 4N3OA 4JYAE 4OX9E 3K85A 1H73A 4LF4I 2VQEI 2Z5CA 4DR5E 2CG9A 5FLXC 4JV5I 3OTOI 2XEXA 4JI6I 4LFAE 3J80Q 1XMOI 3J81Q 4DV6I 4LF7E 1FJGI 4DR2I 4NXMI 4DR4I 2HK2A 1KTVA 4DU7A 1XNQI 4DR6I 1Z5CA 2DEIA 2X7IA 1ZM3A 3PYDA 2HHHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKP A;  4K0K I;  2R3V A;  2BV3 A;  2UXC E;  2EFG A;  2UUA I;  4DR5 I;  1FI4 A;  4DXL A;  1IBK E;  3Q1Q A;  3CWV A;  2X36 A;  4HYM A;  4YY3 I;  4JI5 E;  4X65 E;  4USM A;  2GS8 A;  3QT7 A;  2HHH I;  5IWA E;  1FNM A;  3J80 C;  3WU6 A;  2UXC I;  4JI1 I;  4NXN I;  4B3M E;  1N0U A;  3ZKB A;  3GON A;  2A2C A;  4FWG A;  1XNR E;  1N33 I;  4YHH E;  4B3S E;  4LFB E;  1Z5B A;  2UUC E;  5BR8 E;  1KVK A;  3QT8 A;  1Z0E A;  4LF5 I;  1A6F A;  3J7A M;  4DPX A;  2E5L E;  1Z0V A;  4LF8 E;  4DV4 I;  1UEK A;  1HNZ E;  4DV0 I;  4XTJ A;  4KHP I;  1XNR I;  1EI1 A;  1RR9 A;  4X64 E;  1DAR A;  2V34 A;  5GMD A;  1VIS A;  4LF4 E;  2VQE E;  4AQY I;  3D4J A;  3LNU A;  2UXB I;  4JV5 E;  3T1H I;  3OTO E;  4FN5 A;  4JI6 E;  4DV6 E;  1XMO E;  1FJG E;  1HNX I;  3T1Y I;  4JI2 I;  5L3J A;  4DR2 E;  4NXM E;  2F4V I;  4DR4 E;  5IT9 Q;  1XNQ E;  2WW4 A;  4M1K A;  4DR6 E;  1Z0G A;  4B3R E;  3ZZU A;  4K0K E;  2OI2 A;  4FWD A;  2UUA E;  1EA6 A;  4EMD A;  2HFU A;  2J7K A;  1WUU A;  4JI0 I;  1PVG A;  4WUC A;  1J5E E;  3PYG A;  2ZM6 I;  4LF6 E;  1XMQ I;  4HXZ A;  1FWL A;  2LJP A;  2V8P A;  2CZ9 A;  4YY3 E;  3JAM C;  4JI8 I;  1IBM I;  4B3R I;  1IBL I;  4I3H A;  2R42 A;  4R1F A;  4HAC B;  3QT5 A;  1Z5A A;  5IT9 C;  4JI1 E;  4NXN E;  4ZVI A;  3B8H A;  4DV2 I;  1RRE A;  1H7U A;  4MYT A;  1J5E I;  2AJ4 A;  4LF6 I;  1N33 E;  2HFS A;  1N36 I;  4DPT A;  1KIJ A;  1S4E A;  5GME A;  4GKJ I;  1N34 I;  4LF5 E;  4HAC A;  1FWK A;  4DV3 I;  3J81 C;  4DV4 E;  3ZZ0 A;  4DV0 E;  1H7S A;  4DU8 A;  1I94 I;  1HR0 I;  5A2Q Q;  4DV5 I;  4KHP E;  4DR1 I;  2UUB E;  2BM1 A;  4WUB A;  4JI3 I;  1MU5 A;  4X62 I;  3ZM7 A;  1MG7 A;  1Z0B A;  4B3T I;  1K47 A;  1PIE A;  5LMN E;  4PU9 A;  4AQY E;  2A2D A;  3K1J A;  2UXB E;  4P7A A;  4LFC I;  3T1H E;  3LPS A;  1U2R A;  1Z0T A;  2DEJ A;  3K17 A;  2NPF A;  1HNX E;  2V2V A;  1NHJ A;  4ED4 A;  3T1Y E;  4JI2 E;  4DPW A;  1FKA E;  2F4V E;  2UUB I;  4JI7 I;  4UT4 A;  4WUD A;  5A2Q C;  4DPU A;  1ZXN A;  4URL A;  5LMN I;  4DR7 I;  3V5R A;  2V2Q A;  4JI0 E;  2VQF I;  2HKE A;  1MX0 A;  2ZM6 E;  1XMQ E;  4GKK I;  3B78 A;  1B62 A;  4JI4 I;  2ZIT A;  4JI8 E;  4DUZ I;  5LMU I;  1IBM E;  2UU9 E;  1IBL E;  4DPY A;  4UTG A;  4DUY I;  4DV2 E;  4DV7 I;  4USK A;  1NZ0 A;  4P52 A;  1N36 E;  1N32 I;  3V2U C;  4X66 I;  4GKJ E;  1N34 E;  2UU9 I;  4DV3 E;  4FW9 A;  1HNW I;  5LL6 R;  1H74 A;  1S16 A;  3H4L A;  3B82 A;  1KKH A;  1I94 E;  1HR0 E;  1Z0W A;  1N0V C;  4DV5 E;  2HKJ A;  4DV1 I;  2UXD I;  4DR1 E;  4JI3 E;  4JYA I;  1NHH A;  4OX9 I;  4X62 E;  3LTO A;  3F0N A;  3M6A A;  4JG4 A;  4DR3 E;  4B3T E;  2E1R A;  1NHI A;  4LFC E;  1ZM4 A;  1Z0C A;  3PYF A;  4LFA I;  1Z59 A;  4LF7 I;  3PYE A;  4JI7 E;  3J7A G;  1QZR A;  4DR3 I;  1XHK A;  1B63 A;  1ELO A;  4DR7 E;  2V2Z A;  1H72 C;  4KQV A;  3ZZT A;  2VQF E;  1IBK I;  2Q2E B;  4GKK E;  4Z7C A;  4JI5 I;  4X65 I;  4JI4 E;  4Z7Y A;  4DUZ E;  5LMU E;  2HK3 A;  3HUL A;  4MYU A;  2ZBK B;  4LF9 E;  5IWA I;  4PRV A;  1BKN A;  4B3M I;  3ZKD A;  4DUY E;  3QT6 A;  4DV7 E;  2VF3 A;  1OJ4 A;  3WU3 A;  3WU4 A;  4YHH I;  4B3S I;  4LFB I;  4HY1 A;  2UUC I;  1N32 E;  3WU5 A;  5FLX Q;  4PRX A;  4X66 E;  4FWH A;  5BR8 I;  4LF9 I;  2E5L I;  1HNW E;  1ZXM A;  1ZM9 A;  3JAM Q;  2BM0 A;  4RPF A;  4LF8 I;  1HNZ I;  1ZM2 A;  4DV1 E;  2UXD E;  1D6T A;  4X64 I;  4JYA E;  4OX9 E;  1H73 A;  4LF4 I;  2VQE I;  4DR5 E;  5FLX C;  4JV5 I;  3OTO I;  2XEX A;  4JI6 I;  4LFA E;  3J80 Q;  4DV6 I;  3J81 Q;  1XMO I;  4LF7 E;  1FJG I;  4DR2 I;  4NXM I;  4DR4 I;  2HK2 A;  1KTV A;  4DU7 A;  1XNQ I;  4DR6 I;  1Z5C A;  2DEI A;  2X7I A;  1ZM3 A;  3PYD A;  2HHH E; 
#chains in the Genus database with same CATH topology
 1PKP A;  4K0K I;  3PRY A;  2R3V A;  2BV3 A;  2UXC E;  2EFG A;  1RHY A;  2UUA I;  3Q6N A;  4DR5 I;  2IOQ A;  4MQY A;  5JEA D;  4LCH A;  1FI4 A;  4DXL A;  1IBK E;  3Q1Q A;  4BA2 B;  3CWV A;  2JEB A;  2X36 A;  3L7Z B;  4HYM A;  4YY3 I;  4JI5 E;  4X65 E;  4IFD B;  4USM A;  2WP8 A;  1OYR A;  2PNM A;  2PO2 A;  2GS8 A;  3QT7 A;  1VI7 A;  2HHH I;  5IWA E;  1FNM A;  3J80 C;  3WU6 A;  2NN6 E;  2UXC I;  4JI1 I;  4IZJ B;  4NXN I;  4B3M E;  2O1U A;  1N0U A;  2BA1 D;  3ZKB A;  3GON A;  2A2C A;  4FWG A;  1XNR E;  1N33 I;  4YHH E;  4B3S E;  4LFB E;  1Z5B A;  2UUC E;  4FW6 A;  1E3H A;  5JEA F;  5BR8 E;  1KVK A;  3QT8 A;  5K36 E;  1Z0E A;  4LF5 I;  1A6F A;  4IFD E;  3J7A M;  4DPX A;  2E5L E;  5C0X D;  2BA0 D;  1Z0V A;  4LF8 E;  4DV4 I;  1UEK A;  1HNZ E;  1Y5Y A;  3P06 A;  4DV0 I;  3P3E A;  2GO3 A;  1XXE A;  4XTJ A;  4KHP I;  1XNR I;  2C39 B;  3M85 G;  2Z5B B;  1EI1 A;  1RR9 A;  4X64 E;  1DAR A;  2V34 A;  4MDT A;  5GMD A;  4AID A;  2JEA B;  4QNK A;  1UDS A;  1VIS A;  4LF4 E;  2VQE E;  3UHM A;  4AQY I;  3D4J A;  2Z5C B;  3LNU A;  2UXB I;  4JV5 E;  3T1H I;  3OTO E;  4FN5 A;  4JI6 E;  5C0X C;  4DV6 E;  1XMO E;  1FJG E;  1HNX I;  3T1Y I;  4OO1 A;  2PNL A;  5EKW A;  4JI2 I;  5L3J A;  4DR2 E;  4NXM E;  2F4V I;  4DR4 E;  5IT9 Q;  3GLL A;  1XNQ E;  4U3B A;  2WW4 A;  4M1K A;  4DR6 E;  1USV A;  1Z0G A;  2C38 B;  4B3R E;  2PO1 B;  3P3C A;  3ZZU A;  1HK7 A;  4K0K E;  5K36 C;  2OI2 A;  1OYP A;  4FWD A;  2UUA E;  1EA6 A;  4EMD A;  4MU3 A;  2HFU A;  2J7K A;  1WUU A;  4JI0 I;  1PVG A;  4WUC A;  1J5E E;  3PYG A;  2ZM6 I;  4LF6 E;  1XMQ I;  4HXZ A;  2O1T A;  1FWL A;  2LJP A;  2V8P A;  2CZ9 A;  2J65 A;  4YY3 E;  2JEB B;  3JAM C;  2PO1 A;  4JI8 I;  2JT2 A;  2WP8 B;  1IBM I;  4B3R I;  1IBL I;  4LOM A;  2PO2 B;  4I3H A;  2R42 A;  4R1F A;  4HAC B;  5JEA A;  3QT5 A;  1Z5A A;  5IT9 C;  4JI1 E;  2JE6 A;  4NXN E;  4ZVI A;  3B8H A;  4DV2 I;  1RRE A;  1H7U A;  4MYT A;  1J5E I;  4OO1 F;  3PS2 A;  2AJ4 A;  4LF6 I;  1N33 E;  2HFS A;  1N36 I;  4DPT A;  1UDQ A;  3NZK A;  1KIJ A;  1S4E A;  2CGE A;  5GME A;  4GKJ I;  1N34 I;  4LF5 E;  4HAC A;  1FWK A;  2BA0 G;  4DV3 I;  3J81 C;  3HKM A;  4DV4 E;  4FW3 A;  3ZZ0 A;  4DV0 E;  1H7S A;  4DU8 A;  2F1D A;  1I94 I;  1HR0 I;  5A2Q Q;  4FW4 A;  4DV5 I;  4KHP E;  4MU1 A;  2O1W A;  4DR1 I;  2UUB E;  2BM1 A;  4IZK B;  1OYS A;  4WUB A;  4JI3 I;  1MU5 A;  5C0X A;  1YHC A;  4X62 I;  2Z5E A;  1MG7 A;  3ZM7 A;  1Z0B A;  2NN6 D;  3DD6 A;  4B3T I;  1K47 A;  1PIE A;  5LMN E;  4PU9 A;  4AM3 A;  4AQY E;  3GME A;  5ELW A;  2A2D A;  3K1J A;  2UXB E;  4P7A A;  4LFC I;  3T1H E;  3LPS A;  1U2R A;  1Z0T A;  2DEJ A;  3K17 A;  2NPF A;  2V2V A;  1NHJ A;  4ED4 A;  3T1Y E;  1HNX E;  4JI2 E;  4DPW A;  4IZK A;  1FKA E;  3KRN A;  1UDN A;  2F4V E;  4OO1 B;  2UUB I;  5K36 D;  4JI7 I;  4UT4 A;  4WUD A;  1YH8 A;  4IFD D;  5A2Q C;  1ZXN A;  4DPU A;  5DRR A;  4URL A;  5LMN I;  4DR7 I;  2GO4 A;  3V5R A;  2V2Q A;  4JI0 E;  2NN6 C;  4IZJ D;  2VQF I;  4BA1 A;  2HKE A;  5DRO A;  1MX0 A;  2ZM6 E;  4AIM A;  1XMQ E;  4GKK I;  5DNX A;  3B78 A;  3HJC A;  3U1K A;  1B62 A;  5C0X F;  4JI4 I;  2ZIT A;  4JI8 E;  2AE8 A;  4DUZ I;  2WNR B;  5LMU I;  1IBM E;  1Y6Z A;  2UU9 E;  1IBL E;  1Y4S A;  5FWK A;  4OO1 E;  4LPF A;  5JEA B;  4DPY A;  4IFD C;  5K36 F;  4UTG A;  2JE6 B;  4DUY I;  4DV2 E;  4DV7 I;  4USK A;  4P52 A;  1NZ0 A;  4OKG A;  4MU4 A;  4OZE A;  1N36 E;  3M85 D;  1N32 I;  2WNR A;  3B4T A;  3V2U C;  4X66 I;  4GKJ E;  2IES A;  1N34 E;  2PO0 B;  2UU9 I;  4DV3 E;  4FW9 A;  1HNW I;  5LL6 R;  3M7N D;  1H74 A;  1S16 A;  3H4L A;  3B82 A;  1KKH A;  1I94 E;  2BA1 G;  1HR0 E;  1E3P A;  1Z0W A;  5JEA E;  1N0V C;  4DV5 E;  2HKJ A;  4FW7 A;  4DV1 I;  2UXD I;  4DR1 E;  4JI3 E;  4JYA I;  1NHH A;  4OX9 I;  2GQ0 A;  4X62 E;  2PO0 A;  1Y4U A;  3LTO A;  2C37 B;  2VES A;  3F0N A;  3M6A A;  4JG4 A;  5C0X B;  4DR3 E;  4B3T E;  1UDO A;  2E1R A;  4OO1 C;  3CDJ A;  1NHI A;  4LFC E;  1ZM4 A;  1Z0C A;  3PYF A;  4LFA I;  1Z59 A;  4LF7 I;  5K36 B;  1Y60 A;  3PYE A;  3U1Y A;  2NN6 A;  2PNZ B;  4ISA A;  4JI7 E;  2C37 A;  3Q6M A;  3J7A G;  1QZR A;  4DR3 I;  1XHK A;  1R6M A;  1B63 A;  1ELO A;  4DR7 E;  2V2Z A;  1USU A;  5C0X E;  1H72 C;  4KQV A;  3ZZT A;  4BA2 A;  2VQF E;  1IBK I;  2Q2E B;  5K36 A;  4GQU A;  3L7Z A;  4GKK E;  4BA1 B;  4LCF A;  4IFD A;  5JEA C;  4Z7C A;  4JI5 I;  4X65 I;  2PNZ A;  4JI4 E;  4Z7Y A;  4DUZ E;  5LMU E;  2HK3 A;  3HUL A;  4MYU A;  2ZBK B;  4LF9 E;  5IWA I;  3CDI A;  1R6L A;  2BR2 B;  4IZJ A;  2IOP A;  4PRV A;  1BKN A;  4B3M I;  3ZKD A;  4DUY E;  3QT6 A;  4DV7 E;  2VF3 A;  1OJ4 A;  3H1C A;  5EL9 A;  3WU3 A;  2O1V A;  2NN6 F;  3WU4 A;  5DNL A;  4YHH I;  4B3S I;  4LFB I;  3PS3 A;  4HY1 A;  2UUC I;  1N32 E;  3WU5 A;  5FLX Q;  2O3Z A;  4PRX A;  4X66 E;  4FWH A;  5BR8 I;  2BR2 A;  4LF9 I;  2E5L I;  4U3D A;  3M7N G;  1HNW E;  1ZXM A;  1ZM9 A;  3JAM Q;  2BM0 A;  4RPF A;  4LF8 I;  1HNZ I;  4MU0 A;  1ZM2 A;  4IFD F;  2C39 A;  4J3D A;  2Z5B A;  4DV1 E;  2UXD E;  2IER A;  5DRQ A;  2JEA A;  1D6T A;  4X64 I;  4N3O A;  4JYA E;  2CVE A;  4OX9 E;  4OO1 D;  3K85 A;  1H73 A;  4LF4 I;  2VQE I;  4QNJ A;  3P76 A;  2Z5C A;  4LCG A;  4DR5 E;  5DRP A;  2CG9 A;  5FLX C;  4IS9 A;  4JV5 I;  1P42 A;  3OTO I;  2XEX A;  3PS1 A;  4JI6 I;  3P3G A;  4LFA E;  3J80 Q;  3GCM A;  3J81 Q;  4DV6 I;  1XMO I;  4LF7 E;  1FJG I;  4DR2 I;  4NXM I;  4DR4 I;  2HK2 A;  4FW5 A;  2C38 A;  1KTV A;  4DU7 A;  1XNQ I;  4DR6 I;  1Z5C A;  2DEI A;  2NN6 B;  4NBQ A;  2X7I A;  1ZM3 A;  3PYD A;  2HHH E; 
#chains in the Genus database with same CATH homology
 1PKP A;  4K0K I;  3PRY A;  2R3V A;  2BV3 A;  2UXC E;  2EFG A;  2UUA I;  3Q6N A;  4DR5 I;  2IOQ A;  1FI4 A;  4DXL A;  1IBK E;  3Q1Q A;  3CWV A;  2X36 A;  4HYM A;  4YY3 I;  4JI5 E;  4X65 E;  4USM A;  2PNM A;  2GS8 A;  3QT7 A;  2HHH I;  5IWA E;  1FNM A;  3J80 C;  3WU6 A;  2UXC I;  4JI1 I;  4IZJ B;  4NXN I;  4B3M E;  2O1U A;  1N0U A;  3ZKB A;  3GON A;  2A2C A;  4FWG A;  1XNR E;  1N33 I;  4YHH E;  4B3S E;  4LFB E;  1Z5B A;  2UUC E;  5BR8 E;  1KVK A;  3QT8 A;  1Z0E A;  4LF5 I;  1A6F A;  3J7A M;  4DPX A;  2E5L E;  1Z0V A;  4LF8 E;  4DV4 I;  1UEK A;  1HNZ E;  3P06 A;  4DV0 I;  4XTJ A;  4KHP I;  1XNR I;  2Z5B B;  1EI1 A;  1RR9 A;  4X64 E;  1DAR A;  2V34 A;  5GMD A;  1VIS A;  4LF4 E;  2VQE E;  4AQY I;  3D4J A;  2Z5C B;  3LNU A;  2UXB I;  4JV5 E;  3T1H I;  3OTO E;  4FN5 A;  4JI6 E;  4DV6 E;  1XMO E;  1FJG E;  1HNX I;  3T1Y I;  2PNL A;  4JI2 I;  5L3J A;  4DR2 E;  4NXM E;  2F4V I;  4DR4 E;  5IT9 Q;  1XNQ E;  2WW4 A;  4M1K A;  4DR6 E;  1USV A;  1Z0G A;  4B3R E;  3ZZU A;  1HK7 A;  4K0K E;  2OI2 A;  4FWD A;  2UUA E;  1EA6 A;  4EMD A;  2HFU A;  2J7K A;  1WUU A;  4JI0 I;  1PVG A;  4WUC A;  1J5E E;  3PYG A;  2ZM6 I;  4LF6 E;  1XMQ I;  4HXZ A;  2O1T A;  1FWL A;  2LJP A;  2V8P A;  2CZ9 A;  4YY3 E;  3JAM C;  4JI8 I;  1IBM I;  4B3R I;  1IBL I;  4I3H A;  2R42 A;  4R1F A;  4HAC B;  3QT5 A;  1Z5A A;  5IT9 C;  4JI1 E;  4NXN E;  4ZVI A;  3B8H A;  4DV2 I;  1RRE A;  1H7U A;  4MYT A;  1J5E I;  2AJ4 A;  4LF6 I;  1N33 E;  2HFS A;  1N36 I;  4DPT A;  1KIJ A;  1S4E A;  2CGE A;  5GME A;  4GKJ I;  1N34 I;  4LF5 E;  4HAC A;  1FWK A;  4DV3 I;  3J81 C;  4DV4 E;  3ZZ0 A;  4DV0 E;  1H7S A;  4DU8 A;  1I94 I;  1HR0 I;  5A2Q Q;  4DV5 I;  4KHP E;  2O1W A;  4DR1 I;  2UUB E;  2BM1 A;  4IZK B;  4WUB A;  4JI3 I;  1MU5 A;  4X62 I;  2Z5E A;  1MG7 A;  3ZM7 A;  1Z0B A;  4B3T I;  1K47 A;  1PIE A;  5LMN E;  4PU9 A;  4AQY E;  2A2D A;  3K1J A;  2UXB E;  4P7A A;  4LFC I;  3T1H E;  3LPS A;  1U2R A;  1Z0T A;  2DEJ A;  3K17 A;  2NPF A;  2V2V A;  1NHJ A;  4ED4 A;  3T1Y E;  1HNX E;  4JI2 E;  4DPW A;  4IZK A;  1FKA E;  2F4V E;  2UUB I;  4JI7 I;  4UT4 A;  4WUD A;  5A2Q C;  4DPU A;  1ZXN A;  4URL A;  5LMN I;  4DR7 I;  3V5R A;  2V2Q A;  4JI0 E;  4IZJ D;  2VQF I;  2HKE A;  1MX0 A;  2ZM6 E;  1XMQ E;  4GKK I;  3B78 A;  3HJC A;  1B62 A;  4JI4 I;  2ZIT A;  4JI8 E;  4DUZ I;  5LMU I;  1IBM E;  1Y6Z A;  2UU9 E;  1IBL E;  1Y4S A;  5FWK A;  4DPY A;  4UTG A;  4DUY I;  4DV2 E;  4DV7 I;  4USK A;  1NZ0 A;  4P52 A;  1N36 E;  1N32 I;  3V2U C;  4X66 I;  4GKJ E;  1N34 E;  2UU9 I;  4DV3 E;  4FW9 A;  1HNW I;  5LL6 R;  1H74 A;  1S16 A;  3H4L A;  3B82 A;  1KKH A;  1I94 E;  1HR0 E;  1Z0W A;  1N0V C;  4DV5 E;  2HKJ A;  4DV1 I;  2UXD I;  4DR1 E;  4JI3 E;  4JYA I;  1NHH A;  4OX9 I;  2GQ0 A;  4X62 E;  1Y4U A;  3LTO A;  3F0N A;  3M6A A;  4JG4 A;  4DR3 E;  4B3T E;  2E1R A;  1NHI A;  4LFC E;  1ZM4 A;  1Z0C A;  3PYF A;  4LFA I;  1Z59 A;  4LF7 I;  3PYE A;  4JI7 E;  3Q6M A;  3J7A G;  1QZR A;  4DR3 I;  1XHK A;  1B63 A;  1ELO A;  4DR7 E;  2V2Z A;  1USU A;  1H72 C;  4KQV A;  3ZZT A;  2VQF E;  1IBK I;  2Q2E B;  4GKK E;  4Z7C A;  4JI5 I;  4X65 I;  4JI4 E;  4Z7Y A;  4DUZ E;  5LMU E;  2HK3 A;  3HUL A;  4MYU A;  2ZBK B;  4LF9 E;  5IWA I;  4IZJ A;  2IOP A;  4PRV A;  1BKN A;  4B3M I;  3ZKD A;  4DUY E;  3QT6 A;  4DV7 E;  2VF3 A;  1OJ4 A;  3WU3 A;  2O1V A;  3WU4 A;  4YHH I;  4B3S I;  4LFB I;  4HY1 A;  2UUC I;  1N32 E;  3WU5 A;  5FLX Q;  4PRX A;  4X66 E;  4FWH A;  5BR8 I;  4LF9 I;  2E5L I;  1HNW E;  1ZXM A;  1ZM9 A;  3JAM Q;  2BM0 A;  4RPF A;  4LF8 I;  1HNZ I;  1ZM2 A;  2Z5B A;  4DV1 E;  2UXD E;  1D6T A;  4X64 I;  4N3O A;  4JYA E;  4OX9 E;  3K85 A;  1H73 A;  4LF4 I;  2VQE I;  2Z5C A;  4DR5 E;  2CG9 A;  5FLX C;  4JV5 I;  3OTO I;  2XEX A;  4JI6 I;  4LFA E;  3J80 Q;  1XMO I;  3J81 Q;  4DV6 I;  4LF7 E;  1FJG I;  4DR2 I;  4NXM I;  4DR4 I;  2HK2 A;  1KTV A;  4DU7 A;  1XNQ I;  4DR6 I;  1Z5C A;  2DEI A;  2X7I A;  1ZM3 A;  3PYD A;  2HHH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...