5IWAI

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5iwaI00
4DR3I 1N0UA 1ZXNA 4LF9I 1Z0EA 4DR4I 1H72C 1S4EA 4B3MI 1IBKE 2UUBE 4P7AA 1XNQE 4DV3E 4B3TI 3Q1QA 1RR9A 4USMA 2HHHE 1FWLA 2HFSA 1B63A 3B8HA 1OJ4A 1D6TA 4FN5A 1Z0TA 1WUUA 4LFCE 4LF6E 4LFAE 4DR2I 4JI2I 4B3RI 1IBLE 4NXMI 3QT6A 1IBME 1N36E 3T1HI 1HR0I 1HNWE 4JI7E 4JI1I 1NHIA 1ELOA 1XMQI 5LMUI 2CZ9A 4X65E 4DR5I 4UT4A 5L3JA 4HACB 2XEXA 3K1JA 4GKKI 1UEKA 2OI2A 5IWAI 2UUAE 4OX9E 1K47A 5GMEA 1FJGE 4DUYE 1PIEA 3LNUA 3J81Q 1NZ0A 1XNRI 1N33E 5GMDA 1Z0WA 2V8PA 1EA6A 4JI0I 4YHHE 4DR1E 4FWDA 3M6AA 2AJ4A 4X64E 1MX0A 1N32I 1HNZE 2Q2EB 5BR8E 3QT7A 4LF7I 4DR3E 4LF9E 4DR4E 2HKEA 4B3ME 3WU4A 1Z0CA 3J7AM 1ZXMA 4B3TE 1DARA 4DPTA 4JV5I 2J7KA 4DR7I 1EI1A 4NXNI 2VQFI 3ZKDA 3CWVA 3JAMC 2VF3A 3PYDA 4HXZA 4X66I 4K0KI 4LF8I 4JI8I 1FKAE 4DR2E 4JI2E 4B3RE 4NXME 4KQVA 4YY3I 3T1HE 2EFGA 4M1KA 1HR0E 4DV0I 2HK2A 4P52A 4DPYA 4LF5I 3B82A 4LFBI 4JI1E 1PVGA 1Z0VA 1XMQE 5A2QQ 1KVKA 5LMUE 4DR5E 4GKKE 1BKNA 3JAMQ 2UU9I 5IWAE 4EMDA 1H73A 4DPUA 4PRVA 4DU8A 4DV6I 3ZZUA 1XNRE 4HACA 4PRXA 1FWKA 4KHPI 1KKHA 3ZZ0A 4XTJA 4JI0E 2DEIA 3F0NA 1ZM3A 2V2QA 1N32E 1S16A 4URLA 2ZITA 4LF7E 2BM0A 2DEJA 3PYGA 4DUZI 2V2VA 4AQYI 3OTOI 1FNMA 1XHKA 2VQEI 4DV4I 4DV7I 3ZM7A 4JV5E 4JI3I 1PKPA 2HFUA 4B3SI 4DR7E 2BV3A 1Z0GA 3B78A 3WU3A 4JI4I 3T1YI 2HK3A 4NXNE 1U2RA 1Z5AA 2VQFE 4X66E 4K0KE 2R3VA 4DR6E 1ZM9A 4DU7A 4LF8E 4JI8E 3ZKBA 2X7IA 2LJPA 4YY3E 5LMNI 4DV0E 1N0VC 4MYTA 4X65I 4Z7CA 5LL6R 1RREA 4WUCA 4I3HA 4LF5E 4LFBE 4WUBA 4DV1I 4LF4I 1XMOI 3J7AG 4X62I 1HNXI 2E5LI 1NHJA 2V34A 1B62A 3V5RA 1J5EI 4DV2I 4FWGA 2UU9E 2WW4A 4DV6E 3HULA 4JI6I 2UXDI 2ZM6I 2ZBKB 3WU6A 4FW9A 1Z0BA 4JI5I 1N34I 2X36A 4KHPE 4DPXA 1H7SA 2UXCI 1I94I 3V2UC 4USKA 1FI4A 2UXBI 5IT9C 4PU9A 4GKJI 2F4VI 4DUZE 4UTGA 3J80C 4AQYE 2HKJA 3OTOE 4JYAI 2VQEE 4DV4E 4DV7E 4HY1A 4DV5I 3K17A 4JI3E 5FLXC 4FWHA 2UUCI 4B3SE 4RPFA 4JI4E 3T1YE 3J81C 4R1FA 4DXLA 1MG7A 2V2ZA 1H7UA 3LPSA 1IBKI 2UUBI 1Z59A 1XNQI 3QT5A 4DV3I 1QZRA 2HHHI 2R42A 3WU5A 4JG4A 4Z7YA 5IT9Q 5LMNE 1KTVA 3PYFA 1ZM2A 3J80Q 4DV1E 4LF4E 1XMOE 2GS8A 3PYEA 4X62E 1HNXE 3D4JA 1H74A 4LFCI 1Z5BA 2E5LE 4LF6I 4LFAI 5FLXQ 1IBLI 1IBMI 4DPWA 1N36I 3H4LA 2NPFA 1J5EE 2A2DA 4DV2E 1VISA 1MU5A 1HNWI 4JI7I 3ZZTA 1Z5CA 3GONA 4JI6E 2UXDE 4WUDA 2ZM6E 2E1RA 4JI5E 1N34E 2UXCE 1I94E 2UUAI 1A6FA 4OX9I 1FJGI 2A2CA 4DUYI 2UXBE 1ZM4A 3QT8A 4GKJE 5A2QC 3LTOA 2F4VE 1N33I 4HYMA 4JYAE 4MYUA 1KIJA 4ED4A 4YHHI 4DR1I 4DV5E 4DR6I 1NHHA 4X64I 4ZVIA 2UUCE 1HNZI 5BR8I 2BM1A
chains in the Genus database with same CATH superfamily
4DR3I 1N0UA 1ZXNA 2Z5CB 5JEAF 4LF9I 1Z0EA 4DR4I 1H72C 1S4EA 4B3MI 1IBKE 4FW3A 2UUBE 4P7AA 1XNQE 4DV3E 4B3TI 3Q1QA 1RR9A 4MU0A 4IFDF 4USMA 2HHHE 5K36A 1FWLA 2HFSA 1Y4UA 1B63A 4OKGA 3B8HA 1OJ4A 1D6TA 2JT2A 2IOPA 3DD6A 4FN5A 1Z0TA 1WUUA 1XXEA 4QNKA 4LFCE 4IFDC 1Y60A 5EL9A 4LF6E 2O1UA 3P76A 2PNZB 4LFAE 4DR2I 2IOQA 4JI2I 4B3RI 1IBLE 4NXMI 3QT6A 1IBME 1N36E 3T1HI 1HR0I 2PO2B 1HNWE 4JI7E 2CGEA 4JI1I 1NHIA 1RHYA 1ELOA 1XMQI 5LMUI 2CZ9A 4X65E 2NN6E 4DR5I 4UT4A 5L3JA 2O1TA 4HACB 2XEXA 3K1JA 2NN6D 2Z5EA 4GKKI 4LCGA 1UEKA 2GO3A 2OI2A 5IWAI 5C0XB 2WP8B 2UUAE 4OX9E 2PO0B 1K47A 5GMEA 1FJGE 1UDSA 4DUYE 1PIEA 3LNUA 2VESA 1HK7A 3J81Q 2C37B 1NZ0A 2C39A 1XNRI 1N33E 2GO4A 2NN6A 5JEAE 1Y5YA 5GMDA 1USUA 1Z0WA 2V8PA 1EA6A 4GQUA 1OYPA 5JEAD 4JI0I 5DNXA 4YHHE 4DR1E 4FWDA 3M6AA 2AJ4A 4X64E 1MX0A 3M85D 3M7NG 1N32I 1HNZE 2Q2EB 5BR8E 1USVA 3QT7A 4BA1A 4LF7I 4DR3E 3PS1A 2BA1D 4LF9E 4DR4E 2HKEA 4B3ME 1Y4SA 5JEAA 4N3OA 3WU4A 1P42A 1Z0CA 2IERA 2PO1B 3J7AM 2JE6A 1ZXMA 4B3TE 1DARA 4DPTA 2JEBA 5EKWA 4JV5I 2J7KA 4IZKA 3L7ZB 4DR7I 1EI1A 3P3EA 4NXNI 2VQFI 3KRNA 3ZKDA 3CWVA 3JAMC 2VF3A 3PYDA 4HXZA 3P3CA 4X66I 4K0KI 2Z5CA 4IFDB 4U3DA 3B4TA 4LF8I 4JI8I 1FKAE 4IZJB 4DR2E 4JI2E 4B3RE 4NXME 4KQVA 4YY3I 3T1HE 2EFGA 4M1KA 1HR0E 4DV0I 2HK2A 1YHCA 4P52A 4AIMA 4DPYA 1UDOA 4LCHA 3GMEA 4LF5I 3B82A 2CVEA 4LFBI 2BR2B 4JI1E 1PVGA 1Z0VA 1XMQE 5A2QQ 1KVKA 5LMUE 3M85G 1R6MA 4DR5E 5DROA 2O3ZA 2PNZA 1UDNA 1OYRA 2BA1G 3HJCA 4GKKE 1BKNA 3U1YA 3JAMQ 2UU9I 5C0XE 2PO2A 5IWAE 4EMDA 1H73A 3P06A 3M7ND 2J65A 4DPUA 4PRVA 4DU8A 4DV6I 5C0XD 4OO1F 3NZKA 3Q6NA 3ZZUA 1XNRE 4FW6A 4HACA 4PRXA 1FWKA 4KHPI 1KKHA 4FW7A 3ZZ0A 4XTJA 4JI0E 2DEIA 3F0NA 1ZM3A 2V2QA 3U1KA 5C0XA 4OO1C 2WP8A 2F1DA 4IS9A 3GLLA 2GQ0A 1N32E 1S16A 4URLA 2ZITA 5K36F 4LF7E 2BM0A 2C37A 5DRRA 2DEJA 3PYGA 4DUZI 2V2VA 3UHMA 4AQYI 3OTOI 1FNMA 3PS3A 1XHKA 4LCFA 2VQEI 4DV4I 4DV7I 3ZM7A 4JV5E 4JI3I 5K36C 2O1WA 1PKPA 2HFUA 4B3SI 4OZEA 4DR7E 2BV3A 1Z0GA 3B78A 3WU3A 4JI4I 4U3BA 2HK3A 4LOMA 4LPFA 3T1YI 1Y6ZA 4NXNE 1U2RA 1Z5AA 2VQFE 2C38B 4X66E 4K0KE 2R3VA 4IFDE 4DR6E 5FWKA 1ZM9A 2Z5BA 4DU7A 4LF8E 2WNRB 4JI8E 2BA0G 3ZKBA 4IFDD 2PO1A 4FW5A 4AIDA 2X7IA 4QNJA 2LJPA 4YY3E 5LMNI 4IZJD 4DV0E 1N0VC 3L7ZA 4MYTA 2O1VA 4X65I 5DRQA 4Z7CA 5LL6R 1RREA 4WUCA 4I3HA 2JEAB 4LF5E 4LFBE 4WUBA 4DV1I 4LF4I 4ISAA 1XMOI 4X62I 3J7AG 1HNXI 4BA2A 4IFDA 2PNMA 4OO1E 2E5LI 1NHJA 2V34A 1B62A 4IZJA 3V5RA 1J5EI 4DV2I 4FWGA 2UU9E 2WW4A 3H1CA 2BR2A 4MDTA 4DV6E 3HULA 2JE6B 4JI6I 2UXDI 4MU4A 5K36E 2JEBB 1OYSA 2ZM6I 4IZKB 2ZBKB 3WU6A 2NN6C 4FW9A 1Z0BA 4JI5I 3K85A 2X36A 1N34I 4KHPE 1R6LA 4OO1B 4DPXA 1H7SA 4AM3A 2UXCI 1I94I 4J3DA 3V2UC 4USKA 2IESA 1FI4A 5ELWA 2UXBI 5IT9C 4PU9A 4GKJI 3PS2A 2F4VI 4MU1A 4DUZE 4UTGA 1YH8A 3J80C 4AQYE 2HKJA 3OTOE 5DNLA 2BA0D 5JEAC 4JYAI 2VQEE 4DV4E 4DV7E 5K36B 3PRYA 5DRPA 4HY1A 4DV5I 3K17A 4JI3E 5FLXC 4FWHA 4MQYA 2UUCI 4RPFA 4B3SE 3GCMA 4JI4E 3T1YE 3J81C 4R1FA 4DXLA 1MG7A 2V2ZA 1H7UA 3LPSA 3CDIA 3Q6MA 2PO0A 1IBKI 2UUBI 1Z59A 1XNQI 3QT5A 4DV3I 1QZRA 2HHHI 1E3HA 2R42A 3WU5A 4JG4A 4NBQA 4Z7YA 5IT9Q 5LMNE 1KTVA 3PYFA 1ZM2A 3J80Q 2C38A 4DV1E 4LF4E 1XMOE 2GS8A 3PYEA 4X62E 1HNXE 3D4JA 1H74A 4LFCI 1Z5BA 4FW4A 2E5LE 4LF6I 2WNRA 4LFAI 5FLXQ 1IBLI 1IBMI 4DPWA 1N36I 3H4LA 2NPFA 1J5EE 2A2DA 4DV2E 1VISA 1MU5A 1HNWI 4JI7I 3HKMA 3ZZTA 2JEAA 1VI7A 1Z5CA 2AE8A 1UDQA 1E3PA 2C39B 3GONA 4JI6E 2UXDE 5C0XF 2NN6B 4WUDA 2ZM6E 2E1RA 4JI5E 1N34E 2UXCE 1I94E 2Z5BB 2UUAI 3CDJA 1A6FA 5C0XC 4OX9I 2PNLA 4OO1D 1FJGI 2A2CA 4DUYI 2UXBE 1ZM4A 4BA1B 2NN6F 3QT8A 4GKJE 5A2QC 3LTOA 2F4VE 1N33I 4HYMA 5JEAB 2CG9A 3P3GA 4MYUA 4JYAE 1KIJA 4ED4A 4OO1A 4YHHI 4DR1I 4DV5E 4DR6I 1NHHA 4BA2B 4MU3A 4X64I 4ZVIA 2UUCE 1HNZI 5K36D 5BR8I 2BM1A
chains in the Genus database with same CATH topology
4DR3I 1N0UA 1ZXNA 2Z5CB 4LF9I 1Z0EA 4DR4I 1H72C 1S4EA 4B3MI 1IBKE 2UUBE 4P7AA 1XNQE 4DV3E 4B3TI 3Q1QA 1RR9A 4USMA 2HHHE 1FWLA 2HFSA 1Y4UA 1B63A 3B8HA 1OJ4A 1D6TA 4FN5A 2IOPA 1Z0TA 1WUUA 4LFCE 4LF6E 2O1UA 4LFAE 4DR2I 2IOQA 4JI2I 4B3RI 1IBLE 4NXMI 3QT6A 1IBME 1N36E 3T1HI 1HR0I 1HNWE 4JI7E 2CGEA 4JI1I 1NHIA 1ELOA 1XMQI 5LMUI 2CZ9A 4X65E 4DR5I 4UT4A 5L3JA 2O1TA 4HACB 2XEXA 3K1JA 2Z5EA 4GKKI 1UEKA 2OI2A 5IWAI 2UUAE 4OX9E 1K47A 5GMEA 1FJGE 4DUYE 1PIEA 3LNUA 1HK7A 3J81Q 1NZ0A 1XNRI 1N33E 5GMDA 1USUA 1Z0WA 2V8PA 1EA6A 4JI0I 4YHHE 4DR1E 4FWDA 3M6AA 2AJ4A 4X64E 1MX0A 1N32I 1HNZE 2Q2EB 5BR8E 1USVA 3QT7A 4LF7I 4DR3E 4LF9E 4DR4E 2HKEA 4B3ME 1Y4SA 4N3OA 3WU4A 1Z0CA 3J7AM 1ZXMA 4B3TE 1DARA 4DPTA 4JV5I 2J7KA 4IZKA 4DR7I 1EI1A 4NXNI 2VQFI 3ZKDA 3CWVA 3JAMC 2VF3A 3PYDA 4HXZA 4X66I 4K0KI 2Z5CA 4LF8I 4JI8I 1FKAE 4IZJB 4DR2E 4JI2E 4B3RE 4NXME 4KQVA 4YY3I 3T1HE 2EFGA 4M1KA 1HR0E 4DV0I 2HK2A 4P52A 4DPYA 4LF5I 3B82A 4LFBI 4JI1E 1PVGA 1Z0VA 1XMQE 5A2QQ 1KVKA 5LMUE 4DR5E 3HJCA 4GKKE 1BKNA 3JAMQ 2UU9I 5IWAE 4EMDA 1H73A 3P06A 4DPUA 4PRVA 4DU8A 4DV6I 3Q6NA 3ZZUA 1XNRE 4HACA 4PRXA 1FWKA 4KHPI 1KKHA 3ZZ0A 4XTJA 4JI0E 2DEIA 3F0NA 1ZM3A 2V2QA 2GQ0A 1N32E 1S16A 4URLA 2ZITA 4LF7E 2BM0A 2DEJA 3PYGA 4DUZI 2V2VA 4AQYI 3OTOI 1FNMA 1XHKA 2VQEI 4DV4I 4DV7I 3ZM7A 4JV5E 4JI3I 2O1WA 1PKPA 2HFUA 4B3SI 4DR7E 2BV3A 1Z0GA 3B78A 3WU3A 4JI4I 3T1YI 2HK3A 1Y6ZA 4NXNE 1U2RA 1Z5AA 2VQFE 4X66E 4K0KE 2R3VA 4DR6E 5FWKA 1ZM9A 2Z5BA 4DU7A 4LF8E 4JI8E 3ZKBA 2X7IA 2LJPA 4YY3E 5LMNI 4IZJD 4DV0E 1N0VC 4MYTA 2O1VA 4X65I 4Z7CA 5LL6R 1RREA 4WUCA 4I3HA 4LF5E 4LFBE 4WUBA 4DV1I 4LF4I 1XMOI 3J7AG 4X62I 1HNXI 2PNMA 2E5LI 1NHJA 2V34A 1B62A 4IZJA 3V5RA 1J5EI 4DV2I 4FWGA 2UU9E 2WW4A 4DV6E 3HULA 4JI6I 2UXDI 2ZM6I 4IZKB 2ZBKB 3WU6A 4FW9A 1Z0BA 4JI5I 3K85A 2X36A 1N34I 4KHPE 4DPXA 1H7SA 2UXCI 1I94I 3V2UC 4USKA 1FI4A 2UXBI 5IT9C 4PU9A 4GKJI 2F4VI 4DUZE 4UTGA 3J80C 4AQYE 2HKJA 3OTOE 4JYAI 2VQEE 4DV4E 4DV7E 3PRYA 4HY1A 4DV5I 3K17A 4JI3E 5FLXC 4FWHA 2UUCI 4B3SE 4RPFA 4JI4E 3T1YE 3J81C 4R1FA 4DXLA 1MG7A 2V2ZA 1H7UA 3LPSA 3Q6MA 1IBKI 2UUBI 1Z59A 1XNQI 3QT5A 4DV3I 1QZRA 2HHHI 2R42A 3WU5A 4JG4A 4Z7YA 5IT9Q 5LMNE 1KTVA 3PYFA 1ZM2A 3J80Q 4DV1E 4LF4E 1XMOE 2GS8A 3PYEA 4X62E 1HNXE 3D4JA 1H74A 4LFCI 1Z5BA 2E5LE 4LF6I 4LFAI 5FLXQ 1IBLI 1IBMI 4DPWA 1N36I 3H4LA 2NPFA 1J5EE 2A2DA 4DV2E 1VISA 1MU5A 1HNWI 4JI7I 3ZZTA 1Z5CA 3GONA 4JI6E 2UXDE 4WUDA 2ZM6E 2E1RA 4JI5E 1N34E 2UXCE 1I94E 2Z5BB 2UUAI 1A6FA 4OX9I 2PNLA 1FJGI 2A2CA 4DUYI 2UXBE 1ZM4A 3QT8A 4GKJE 5A2QC 3LTOA 2F4VE 1N33I 4HYMA 2CG9A 4JYAE 4MYUA 1KIJA 4ED4A 4YHHI 4DR1I 4DV5E 4DR6I 1NHHA 4X64I 4ZVIA 2UUCE 1HNZI 5BR8I 2BM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 I;  1N0U A;  1ZXN A;  4LF9 I;  1Z0E A;  4DR4 I;  1H72 C;  1S4E A;  4B3M I;  1IBK E;  2UUB E;  4P7A A;  1XNQ E;  4DV3 E;  4B3T I;  3Q1Q A;  1RR9 A;  4USM A;  2HHH E;  1FWL A;  2HFS A;  1B63 A;  3B8H A;  1OJ4 A;  1D6T A;  4FN5 A;  1Z0T A;  1WUU A;  4LFC E;  4LF6 E;  4LFA E;  4DR2 I;  4JI2 I;  4B3R I;  1IBL E;  4NXM I;  3QT6 A;  1IBM E;  1N36 E;  3T1H I;  1HR0 I;  1HNW E;  4JI7 E;  4JI1 I;  1NHI A;  1ELO A;  1XMQ I;  5LMU I;  2CZ9 A;  4X65 E;  4DR5 I;  4UT4 A;  5L3J A;  4HAC B;  2XEX A;  3K1J A;  4GKK I;  1UEK A;  2OI2 A;  5IWA I;  2UUA E;  4OX9 E;  1K47 A;  5GME A;  1FJG E;  4DUY E;  1PIE A;  3LNU A;  3J81 Q;  1NZ0 A;  1XNR I;  1N33 E;  5GMD A;  1Z0W A;  2V8P A;  1EA6 A;  4JI0 I;  4YHH E;  4DR1 E;  4FWD A;  3M6A A;  2AJ4 A;  4X64 E;  1MX0 A;  1N32 I;  1HNZ E;  2Q2E B;  5BR8 E;  3QT7 A;  4LF7 I;  4DR3 E;  4LF9 E;  4DR4 E;  2HKE A;  4B3M E;  3WU4 A;  1Z0C A;  3J7A M;  1ZXM A;  4B3T E;  1DAR A;  4DPT A;  4JV5 I;  2J7K A;  4DR7 I;  1EI1 A;  4NXN I;  2VQF I;  3ZKD A;  3CWV A;  3JAM C;  2VF3 A;  3PYD A;  4HXZ A;  4X66 I;  4K0K I;  4LF8 I;  4JI8 I;  1FKA E;  4DR2 E;  4JI2 E;  4B3R E;  4NXM E;  4KQV A;  4YY3 I;  3T1H E;  2EFG A;  4M1K A;  1HR0 E;  4DV0 I;  2HK2 A;  4P52 A;  4DPY A;  4LF5 I;  3B82 A;  4LFB I;  4JI1 E;  1PVG A;  1Z0V A;  1XMQ E;  5A2Q Q;  1KVK A;  5LMU E;  4DR5 E;  4GKK E;  1BKN A;  3JAM Q;  2UU9 I;  5IWA E;  4EMD A;  1H73 A;  4DPU A;  4PRV A;  4DU8 A;  4DV6 I;  3ZZU A;  1XNR E;  4HAC A;  4PRX A;  1FWK A;  4KHP I;  1KKH A;  3ZZ0 A;  4XTJ A;  4JI0 E;  2DEI A;  3F0N A;  1ZM3 A;  2V2Q A;  1N32 E;  1S16 A;  4URL A;  2ZIT A;  4LF7 E;  2BM0 A;  2DEJ A;  3PYG A;  4DUZ I;  2V2V A;  4AQY I;  3OTO I;  1FNM A;  1XHK A;  2VQE I;  4DV4 I;  4DV7 I;  3ZM7 A;  4JV5 E;  4JI3 I;  1PKP A;  2HFU A;  4B3S I;  4DR7 E;  2BV3 A;  1Z0G A;  3B78 A;  3WU3 A;  4JI4 I;  3T1Y I;  2HK3 A;  4NXN E;  1U2R A;  1Z5A A;  2VQF E;  4X66 E;  4K0K E;  2R3V A;  4DR6 E;  1ZM9 A;  4DU7 A;  4LF8 E;  4JI8 E;  3ZKB A;  2X7I A;  2LJP A;  4YY3 E;  5LMN I;  4DV0 E;  1N0V C;  4MYT A;  4X65 I;  4Z7C A;  5LL6 R;  1RRE A;  4WUC A;  4I3H A;  4LF5 E;  4LFB E;  4WUB A;  4DV1 I;  4LF4 I;  1XMO I;  3J7A G;  4X62 I;  1HNX I;  2E5L I;  1NHJ A;  2V34 A;  1B62 A;  3V5R A;  1J5E I;  4DV2 I;  4FWG A;  2UU9 E;  2WW4 A;  4DV6 E;  3HUL A;  4JI6 I;  2UXD I;  2ZM6 I;  2ZBK B;  3WU6 A;  4FW9 A;  1Z0B A;  4JI5 I;  1N34 I;  2X36 A;  4KHP E;  4DPX A;  1H7S A;  2UXC I;  1I94 I;  3V2U C;  4USK A;  1FI4 A;  2UXB I;  5IT9 C;  4PU9 A;  4GKJ I;  2F4V I;  4DUZ E;  4UTG A;  3J80 C;  4AQY E;  2HKJ A;  3OTO E;  4JYA I;  2VQE E;  4DV4 E;  4DV7 E;  4HY1 A;  4DV5 I;  3K17 A;  4JI3 E;  5FLX C;  4FWH A;  2UUC I;  4B3S E;  4RPF A;  4JI4 E;  3T1Y E;  3J81 C;  4R1F A;  4DXL A;  1MG7 A;  2V2Z A;  1H7U A;  3LPS A;  1IBK I;  2UUB I;  1Z59 A;  1XNQ I;  3QT5 A;  4DV3 I;  1QZR A;  2HHH I;  2R42 A;  3WU5 A;  4JG4 A;  4Z7Y A;  5IT9 Q;  5LMN E;  1KTV A;  3PYF A;  1ZM2 A;  3J80 Q;  4DV1 E;  4LF4 E;  1XMO E;  2GS8 A;  3PYE A;  4X62 E;  1HNX E;  3D4J A;  1H74 A;  4LFC I;  1Z5B A;  2E5L E;  4LF6 I;  4LFA I;  5FLX Q;  1IBL I;  1IBM I;  4DPW A;  1N36 I;  3H4L A;  2NPF A;  1J5E E;  2A2D A;  4DV2 E;  1VIS A;  1MU5 A;  1HNW I;  4JI7 I;  3ZZT A;  1Z5C A;  3GON A;  4JI6 E;  2UXD E;  4WUD A;  2ZM6 E;  2E1R A;  4JI5 E;  1N34 E;  2UXC E;  1I94 E;  2UUA I;  1A6F A;  4OX9 I;  1FJG I;  2A2C A;  4DUY I;  2UXB E;  1ZM4 A;  3QT8 A;  4GKJ E;  5A2Q C;  3LTO A;  2F4V E;  1N33 I;  4HYM A;  4JYA E;  4MYU A;  1KIJ A;  4ED4 A;  4YHH I;  4DR1 I;  4DV5 E;  4DR6 I;  1NHH A;  4X64 I;  4ZVI A;  2UUC E;  1HNZ I;  5BR8 I;  2BM1 A; 
#chains in the Genus database with same CATH topology
 4DR3 I;  1N0U A;  1ZXN A;  2Z5C B;  5JEA F;  4LF9 I;  1Z0E A;  4DR4 I;  1H72 C;  1S4E A;  4B3M I;  1IBK E;  4FW3 A;  2UUB E;  4P7A A;  1XNQ E;  4DV3 E;  4B3T I;  3Q1Q A;  1RR9 A;  4MU0 A;  4IFD F;  4USM A;  2HHH E;  5K36 A;  1FWL A;  2HFS A;  1Y4U A;  1B63 A;  4OKG A;  3B8H A;  1OJ4 A;  1D6T A;  2JT2 A;  2IOP A;  3DD6 A;  4FN5 A;  1Z0T A;  1WUU A;  1XXE A;  4QNK A;  4LFC E;  4IFD C;  1Y60 A;  5EL9 A;  4LF6 E;  2O1U A;  3P76 A;  2PNZ B;  4LFA E;  4DR2 I;  2IOQ A;  4JI2 I;  4B3R I;  1IBL E;  4NXM I;  3QT6 A;  1IBM E;  1N36 E;  3T1H I;  1HR0 I;  2PO2 B;  1HNW E;  4JI7 E;  2CGE A;  4JI1 I;  1NHI A;  1RHY A;  1ELO A;  1XMQ I;  5LMU I;  2CZ9 A;  4X65 E;  2NN6 E;  4DR5 I;  4UT4 A;  5L3J A;  2O1T A;  4HAC B;  2XEX A;  3K1J A;  2NN6 D;  2Z5E A;  4GKK I;  4LCG A;  1UEK A;  2GO3 A;  2OI2 A;  5IWA I;  5C0X B;  2WP8 B;  2UUA E;  4OX9 E;  2PO0 B;  1K47 A;  5GME A;  1FJG E;  1UDS A;  4DUY E;  1PIE A;  3LNU A;  2VES A;  1HK7 A;  3J81 Q;  2C37 B;  1NZ0 A;  2C39 A;  1XNR I;  1N33 E;  2GO4 A;  2NN6 A;  5JEA E;  1Y5Y A;  5GMD A;  1USU A;  1Z0W A;  2V8P A;  1EA6 A;  4GQU A;  1OYP A;  5JEA D;  4JI0 I;  5DNX A;  4YHH E;  4DR1 E;  4FWD A;  3M6A A;  2AJ4 A;  4X64 E;  1MX0 A;  3M85 D;  3M7N G;  1N32 I;  1HNZ E;  2Q2E B;  5BR8 E;  1USV A;  3QT7 A;  4BA1 A;  4LF7 I;  4DR3 E;  3PS1 A;  2BA1 D;  4LF9 E;  4DR4 E;  2HKE A;  4B3M E;  1Y4S A;  5JEA A;  4N3O A;  3WU4 A;  1P42 A;  1Z0C A;  2IER A;  2PO1 B;  3J7A M;  2JE6 A;  1ZXM A;  4B3T E;  1DAR A;  4DPT A;  2JEB A;  5EKW A;  4JV5 I;  2J7K A;  4IZK A;  3L7Z B;  4DR7 I;  1EI1 A;  3P3E A;  4NXN I;  2VQF I;  3KRN A;  3ZKD A;  3CWV A;  3JAM C;  2VF3 A;  3PYD A;  4HXZ A;  3P3C A;  4X66 I;  4K0K I;  2Z5C A;  4IFD B;  4U3D A;  3B4T A;  4LF8 I;  4JI8 I;  1FKA E;  4IZJ B;  4DR2 E;  4JI2 E;  4B3R E;  4NXM E;  4KQV A;  4YY3 I;  3T1H E;  2EFG A;  4M1K A;  1HR0 E;  4DV0 I;  2HK2 A;  1YHC A;  4P52 A;  4AIM A;  4DPY A;  1UDO A;  4LCH A;  3GME A;  4LF5 I;  3B82 A;  2CVE A;  4LFB I;  2BR2 B;  4JI1 E;  1PVG A;  1Z0V A;  1XMQ E;  5A2Q Q;  1KVK A;  5LMU E;  3M85 G;  1R6M A;  4DR5 E;  5DRO A;  2O3Z A;  2PNZ A;  1UDN A;  1OYR A;  2BA1 G;  3HJC A;  4GKK E;  1BKN A;  3U1Y A;  3JAM Q;  2UU9 I;  5C0X E;  2PO2 A;  5IWA E;  4EMD A;  1H73 A;  3P06 A;  3M7N D;  2J65 A;  4DPU A;  4PRV A;  4DU8 A;  4DV6 I;  5C0X D;  4OO1 F;  3NZK A;  3Q6N A;  3ZZU A;  1XNR E;  4FW6 A;  4HAC A;  4PRX A;  1FWK A;  4KHP I;  1KKH A;  4FW7 A;  3ZZ0 A;  4XTJ A;  4JI0 E;  2DEI A;  3F0N A;  1ZM3 A;  2V2Q A;  3U1K A;  5C0X A;  4OO1 C;  2WP8 A;  2F1D A;  4IS9 A;  3GLL A;  2GQ0 A;  1N32 E;  1S16 A;  4URL A;  2ZIT A;  5K36 F;  4LF7 E;  2BM0 A;  2C37 A;  5DRR A;  2DEJ A;  3PYG A;  4DUZ I;  2V2V A;  3UHM A;  4AQY I;  3OTO I;  1FNM A;  3PS3 A;  1XHK A;  4LCF A;  2VQE I;  4DV4 I;  4DV7 I;  3ZM7 A;  4JV5 E;  4JI3 I;  5K36 C;  2O1W A;  1PKP A;  2HFU A;  4B3S I;  4OZE A;  4DR7 E;  2BV3 A;  1Z0G A;  3B78 A;  3WU3 A;  4JI4 I;  4U3B A;  2HK3 A;  4LOM A;  4LPF A;  3T1Y I;  1Y6Z A;  4NXN E;  1U2R A;  1Z5A A;  2VQF E;  2C38 B;  4X66 E;  4K0K E;  2R3V A;  4IFD E;  4DR6 E;  5FWK A;  1ZM9 A;  2Z5B A;  4DU7 A;  4LF8 E;  2WNR B;  4JI8 E;  2BA0 G;  3ZKB A;  4IFD D;  2PO1 A;  4FW5 A;  4AID A;  2X7I A;  4QNJ A;  2LJP A;  4YY3 E;  5LMN I;  4IZJ D;  4DV0 E;  1N0V C;  3L7Z A;  4MYT A;  2O1V A;  4X65 I;  5DRQ A;  4Z7C A;  5LL6 R;  1RRE A;  4WUC A;  4I3H A;  2JEA B;  4LF5 E;  4LFB E;  4WUB A;  4DV1 I;  4LF4 I;  4ISA A;  1XMO I;  4X62 I;  3J7A G;  1HNX I;  4BA2 A;  4IFD A;  2PNM A;  4OO1 E;  2E5L I;  1NHJ A;  2V34 A;  1B62 A;  4IZJ A;  3V5R A;  1J5E I;  4DV2 I;  4FWG A;  2UU9 E;  2WW4 A;  3H1C A;  2BR2 A;  4MDT A;  4DV6 E;  3HUL A;  2JE6 B;  4JI6 I;  2UXD I;  4MU4 A;  5K36 E;  2JEB B;  1OYS A;  2ZM6 I;  4IZK B;  2ZBK B;  3WU6 A;  2NN6 C;  4FW9 A;  1Z0B A;  4JI5 I;  3K85 A;  2X36 A;  1N34 I;  4KHP E;  1R6L A;  4OO1 B;  4DPX A;  1H7S A;  4AM3 A;  2UXC I;  1I94 I;  4J3D A;  3V2U C;  4USK A;  2IES A;  1FI4 A;  5ELW A;  2UXB I;  5IT9 C;  4PU9 A;  4GKJ I;  3PS2 A;  2F4V I;  4MU1 A;  4DUZ E;  4UTG A;  1YH8 A;  3J80 C;  4AQY E;  2HKJ A;  3OTO E;  5DNL A;  2BA0 D;  5JEA C;  4JYA I;  2VQE E;  4DV4 E;  4DV7 E;  5K36 B;  3PRY A;  5DRP A;  4HY1 A;  4DV5 I;  3K17 A;  4JI3 E;  5FLX C;  4FWH A;  4MQY A;  2UUC I;  4RPF A;  4B3S E;  3GCM A;  4JI4 E;  3T1Y E;  3J81 C;  4R1F A;  4DXL A;  1MG7 A;  2V2Z A;  1H7U A;  3LPS A;  3CDI A;  3Q6M A;  2PO0 A;  1IBK I;  2UUB I;  1Z59 A;  1XNQ I;  3QT5 A;  4DV3 I;  1QZR A;  2HHH I;  1E3H A;  2R42 A;  3WU5 A;  4JG4 A;  4NBQ A;  4Z7Y A;  5IT9 Q;  5LMN E;  1KTV A;  3PYF A;  1ZM2 A;  3J80 Q;  2C38 A;  4DV1 E;  4LF4 E;  1XMO E;  2GS8 A;  3PYE A;  4X62 E;  1HNX E;  3D4J A;  1H74 A;  4LFC I;  1Z5B A;  4FW4 A;  2E5L E;  4LF6 I;  2WNR A;  4LFA I;  5FLX Q;  1IBL I;  1IBM I;  4DPW A;  1N36 I;  3H4L A;  2NPF A;  1J5E E;  2A2D A;  4DV2 E;  1VIS A;  1MU5 A;  1HNW I;  4JI7 I;  3HKM A;  3ZZT A;  2JEA A;  1VI7 A;  1Z5C A;  2AE8 A;  1UDQ A;  1E3P A;  2C39 B;  3GON A;  4JI6 E;  2UXD E;  5C0X F;  2NN6 B;  4WUD A;  2ZM6 E;  2E1R A;  4JI5 E;  1N34 E;  2UXC E;  1I94 E;  2Z5B B;  2UUA I;  3CDJ A;  1A6F A;  5C0X C;  4OX9 I;  2PNL A;  4OO1 D;  1FJG I;  2A2C A;  4DUY I;  2UXB E;  1ZM4 A;  4BA1 B;  2NN6 F;  3QT8 A;  4GKJ E;  5A2Q C;  3LTO A;  2F4V E;  1N33 I;  4HYM A;  5JEA B;  2CG9 A;  3P3G A;  4MYU A;  4JYA E;  1KIJ A;  4ED4 A;  4OO1 A;  4YHH I;  4DR1 I;  4DV5 E;  4DR6 I;  1NHH A;  4BA2 B;  4MU3 A;  4X64 I;  4ZVI A;  2UUC E;  1HNZ I;  5K36 D;  5BR8 I;  2BM1 A; 
#chains in the Genus database with same CATH homology
 4DR3 I;  1N0U A;  1ZXN A;  2Z5C B;  4LF9 I;  1Z0E A;  4DR4 I;  1H72 C;  1S4E A;  4B3M I;  1IBK E;  2UUB E;  4P7A A;  1XNQ E;  4DV3 E;  4B3T I;  3Q1Q A;  1RR9 A;  4USM A;  2HHH E;  1FWL A;  2HFS A;  1Y4U A;  1B63 A;  3B8H A;  1OJ4 A;  1D6T A;  4FN5 A;  2IOP A;  1Z0T A;  1WUU A;  4LFC E;  4LF6 E;  2O1U A;  4LFA E;  4DR2 I;  2IOQ A;  4JI2 I;  4B3R I;  1IBL E;  4NXM I;  3QT6 A;  1IBM E;  1N36 E;  3T1H I;  1HR0 I;  1HNW E;  4JI7 E;  2CGE A;  4JI1 I;  1NHI A;  1ELO A;  1XMQ I;  5LMU I;  2CZ9 A;  4X65 E;  4DR5 I;  4UT4 A;  5L3J A;  2O1T A;  4HAC B;  2XEX A;  3K1J A;  2Z5E A;  4GKK I;  1UEK A;  2OI2 A;  5IWA I;  2UUA E;  4OX9 E;  1K47 A;  5GME A;  1FJG E;  4DUY E;  1PIE A;  3LNU A;  1HK7 A;  3J81 Q;  1NZ0 A;  1XNR I;  1N33 E;  5GMD A;  1USU A;  1Z0W A;  2V8P A;  1EA6 A;  4JI0 I;  4YHH E;  4DR1 E;  4FWD A;  3M6A A;  2AJ4 A;  4X64 E;  1MX0 A;  1N32 I;  1HNZ E;  2Q2E B;  5BR8 E;  1USV A;  3QT7 A;  4LF7 I;  4DR3 E;  4LF9 E;  4DR4 E;  2HKE A;  4B3M E;  1Y4S A;  4N3O A;  3WU4 A;  1Z0C A;  3J7A M;  1ZXM A;  4B3T E;  1DAR A;  4DPT A;  4JV5 I;  2J7K A;  4IZK A;  4DR7 I;  1EI1 A;  4NXN I;  2VQF I;  3ZKD A;  3CWV A;  3JAM C;  2VF3 A;  3PYD A;  4HXZ A;  4X66 I;  4K0K I;  2Z5C A;  4LF8 I;  4JI8 I;  1FKA E;  4IZJ B;  4DR2 E;  4JI2 E;  4B3R E;  4NXM E;  4KQV A;  4YY3 I;  3T1H E;  2EFG A;  4M1K A;  1HR0 E;  4DV0 I;  2HK2 A;  4P52 A;  4DPY A;  4LF5 I;  3B82 A;  4LFB I;  4JI1 E;  1PVG A;  1Z0V A;  1XMQ E;  5A2Q Q;  1KVK A;  5LMU E;  4DR5 E;  3HJC A;  4GKK E;  1BKN A;  3JAM Q;  2UU9 I;  5IWA E;  4EMD A;  1H73 A;  3P06 A;  4DPU A;  4PRV A;  4DU8 A;  4DV6 I;  3Q6N A;  3ZZU A;  1XNR E;  4HAC A;  4PRX A;  1FWK A;  4KHP I;  1KKH A;  3ZZ0 A;  4XTJ A;  4JI0 E;  2DEI A;  3F0N A;  1ZM3 A;  2V2Q A;  2GQ0 A;  1N32 E;  1S16 A;  4URL A;  2ZIT A;  4LF7 E;  2BM0 A;  2DEJ A;  3PYG A;  4DUZ I;  2V2V A;  4AQY I;  3OTO I;  1FNM A;  1XHK A;  2VQE I;  4DV4 I;  4DV7 I;  3ZM7 A;  4JV5 E;  4JI3 I;  2O1W A;  1PKP A;  2HFU A;  4B3S I;  4DR7 E;  2BV3 A;  1Z0G A;  3B78 A;  3WU3 A;  4JI4 I;  3T1Y I;  2HK3 A;  1Y6Z A;  4NXN E;  1U2R A;  1Z5A A;  2VQF E;  4X66 E;  4K0K E;  2R3V A;  4DR6 E;  5FWK A;  1ZM9 A;  2Z5B A;  4DU7 A;  4LF8 E;  4JI8 E;  3ZKB A;  2X7I A;  2LJP A;  4YY3 E;  5LMN I;  4IZJ D;  4DV0 E;  1N0V C;  4MYT A;  2O1V A;  4X65 I;  4Z7C A;  5LL6 R;  1RRE A;  4WUC A;  4I3H A;  4LF5 E;  4LFB E;  4WUB A;  4DV1 I;  4LF4 I;  1XMO I;  3J7A G;  4X62 I;  1HNX I;  2PNM A;  2E5L I;  1NHJ A;  2V34 A;  1B62 A;  4IZJ A;  3V5R A;  1J5E I;  4DV2 I;  4FWG A;  2UU9 E;  2WW4 A;  4DV6 E;  3HUL A;  4JI6 I;  2UXD I;  2ZM6 I;  4IZK B;  2ZBK B;  3WU6 A;  4FW9 A;  1Z0B A;  4JI5 I;  3K85 A;  2X36 A;  1N34 I;  4KHP E;  4DPX A;  1H7S A;  2UXC I;  1I94 I;  3V2U C;  4USK A;  1FI4 A;  2UXB I;  5IT9 C;  4PU9 A;  4GKJ I;  2F4V I;  4DUZ E;  4UTG A;  3J80 C;  4AQY E;  2HKJ A;  3OTO E;  4JYA I;  2VQE E;  4DV4 E;  4DV7 E;  3PRY A;  4HY1 A;  4DV5 I;  3K17 A;  4JI3 E;  5FLX C;  4FWH A;  2UUC I;  4B3S E;  4RPF A;  4JI4 E;  3T1Y E;  3J81 C;  4R1F A;  4DXL A;  1MG7 A;  2V2Z A;  1H7U A;  3LPS A;  3Q6M A;  1IBK I;  2UUB I;  1Z59 A;  1XNQ I;  3QT5 A;  4DV3 I;  1QZR A;  2HHH I;  2R42 A;  3WU5 A;  4JG4 A;  4Z7Y A;  5IT9 Q;  5LMN E;  1KTV A;  3PYF A;  1ZM2 A;  3J80 Q;  4DV1 E;  4LF4 E;  1XMO E;  2GS8 A;  3PYE A;  4X62 E;  1HNX E;  3D4J A;  1H74 A;  4LFC I;  1Z5B A;  2E5L E;  4LF6 I;  4LFA I;  5FLX Q;  1IBL I;  1IBM I;  4DPW A;  1N36 I;  3H4L A;  2NPF A;  1J5E E;  2A2D A;  4DV2 E;  1VIS A;  1MU5 A;  1HNW I;  4JI7 I;  3ZZT A;  1Z5C A;  3GON A;  4JI6 E;  2UXD E;  4WUD A;  2ZM6 E;  2E1R A;  4JI5 E;  1N34 E;  2UXC E;  1I94 E;  2Z5B B;  2UUA I;  1A6F A;  4OX9 I;  2PNL A;  1FJG I;  2A2C A;  4DUY I;  2UXB E;  1ZM4 A;  3QT8 A;  4GKJ E;  5A2Q C;  3LTO A;  2F4V E;  1N33 I;  4HYM A;  2CG9 A;  4JYA E;  4MYU A;  1KIJ A;  4ED4 A;  4YHH I;  4DR1 I;  4DV5 E;  4DR6 I;  1NHH A;  4X64 I;  4ZVI A;  2UUC E;  1HNZ I;  5BR8 I;  2BM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...