5IWAI

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5iwaI00
1I94E 3GONA 3T1HI 1N36I 4K0KI 2WW4A 3PYFA 4X66E 3PYEA 4JV5I 4USKA 4JI4I 4LF5E 3V5RA 4LF7I 3LPSA 1XNRI 4URLA 2E5LE 4DUYE 5BR8E 4X65I 1H73A 4DR4I 2BV3A 1IBLE 3PYGA 1XMOI 1J5EI 4LF4I 4NXNI 3PYDA 2ZM6E 4PRXA 5IWAI 4LF6I 4M1KA 4DR7E 3JAMQ 1XNQE 1HNXE 4DR2I 4DR6I 3J80C 3QT8A 3HULA 2UXBI 1B63A 1ZXNA 1S16A 2VQEI 3M6AA 2EFGA 4JI2E 4DV3I 1IBME 1Z0EA 4PU9A 1PVGA 3J7AG 1K47A 1N33E 2HKJA 1H74A 3CWVA 2AJ4A 4B3TI 5LMUE 4JI7E 4LFBI 4LFAI 2A2CA 5A2QQ 2F4VE 3JAMC 1NZ0A 1HNZE 4X62I 4DV2E 1HNWI 3T1YE 1FI4A 4DV5E 4HACA 4X64I 2NPFA 1A6FA 4DPWA 4WUBA 4AQYI 3T1HE 1FKAE 1N36E 2R3VA 2UU9I 2V2QA 4B3RI 4JI5I 4KHPI 4JV5E 1BKNA 4JI4E 3QT6A 3J81Q 4DV4I 4WUCA 4DR4E 1ZXMA 4DR5I 1XMOE 5FLXC 1Z5AA 5LL6R 1J5EE 4NXNE 4P7AA 4JI6I 1RREA 1MX0A 4B3SI 4GKKI 4GKJI 3QT7A 5IWAE 1N0UA 2UUCE 4LF6E 2DEIA 1IBKI 1EI1A 4NXMI 4DU8A 4LF8E 4I3HA 4JG4A 4DV6I 1XMQI 4DR2E 2UUAI 2V34A 1FJGI 1NHIA 1DARA 1HR0I 1U2RA 4MYUA 2VQEE 1KIJA 4DV3E 2X7IA 2VQFI 4DV0I 1N34I 1ZM2A 2J7KA 4RPFA 4JI3E 1FWLA 1XHKA 1Z5BA 4B3TE 2OI2A 4LFCI 2V8PA 4LFAE 1WUUA 4ED4A 3K17A 2UXDI 4X62E 1HNWE 5LMNI 4DV7I 1S4EA 4B3MI 4FN5A 3B82A 4YY3I 4X64E 4UT4A 4JI0I 4DR3I 2E1RA 1Z5CA 2UU9E 1OJ4A 4LF9I 4LF5I 4XTJA 4B3RE 4JI5E 2E5LI 4KHPE 2V2VA 4KQVA 4HY1A 4FW9A 4DV4E 1H7SA 2UUBI 1H72C 4FWGA 5IT9Q 4DR5E 3F0NA 4JI8I 1N32I 3J7AM 2CZ9A 4OX9I 2HHHI 4JI6E 1EA6A 4B3SE 1FNMA 2V2ZA 4GKKE 4GKJE 4JYAI 3ZKBA 4DUZI 3OTOI 2ZITA 1IBKE 4NXME 2DEJA 4K0KE 1N0VC 4WUDA 1ZM3A 4DV6E 1XMQE 1Z0WA 2LJPA 2ZBKB 4LF7E 2UUAE 1XNRE 1FJGE 4X65E 3V2UC 1HR0E 2HFUA 1NHHA 3WU6A 1NHJA 4DPTA 2VQFE 4LF4E 4DV0E 1N34E 5IT9C 2HFSA 5GMDA 4DV1I 2R42A 5A2QC 4YHHI 4USMA 2A2DA 4JI1I 3B78A 4LFCE 3WU3A 3D4JA 3H4LA 4DR6E 4EMDA 2UXDE 2UXCI 5LMNE 4DV7E 2UXBE 4B3ME 3J81C 4YY3E 1KTVA 2X36A 4DR3E 5GMEA 4JI0E 1H7UA 1ZM4A 3J80Q 1MU5A 3LTOA 4LF9E 2HKEA 4MYTA 3QT5A 1QZRA 4FWHA 4LFBE 4PRVA 2BM0A 1MG7A 2UUBE 3LNUA 4DR1I 1Z0CA 4JI8E 1N32E 4OX9E 2HHHE 1ZM9A 1I94I 2Q2EB 1KVKA 4ZVIA 1Z0TA 3ZZTA 1FWKA 2UUCI 4AQYE 3ZKDA 2HK3A 4JYAE 3K1JA 4DUZE 3OTOE 3B8HA 4LF8I 4X66I 1Z59A 3WU5A 1KKHA 4DUYI 5BR8I 4FWDA 2HK2A 2GS8A 3ZZUA 4DPUA 1IBLI 1ELOA 4Z7YA 3ZM7A 3ZZ0A 3Q1QA 1UEKA 2ZM6I 4DV1E 4JI3I 4R1FA 4DXLA 4HYMA 4YHHE 4JI1E 5FLXQ 4DR7I 2VF3A 1D6TA 1RR9A 1XNQI 1HNXI 4DU7A 1VISA 5L3JA 1Z0VA 4UTGA 2XEXA 1Z0BA 2UXCE 4HXZA 4JI2I 2BM1A 1IBMI 4DPYA 4DPXA 1N33I 4HACB 4Z7CA 1PIEA 4P52A 5LMUI 4JI7I 1PKPA 1Z0GA 1B62A 2F4VI 3WU4A 1HNZI 4DV2I 4DR1E 3T1YI 4DV5I
chains in the Genus database with same CATH superfamily
1I94E 3GONA 3T1HI 1N36I 2C39B 4K0KI 4LCGA 2WW4A 3PYFA 4X66E 3PYEA 4JV5I 4USKA 2O1VA 4JI4I 4LF5E 3V5RA 4LF7I 4BA1B 3LPSA 1XNRI 4URLA 2E5LE 4DUYE 2Z5CB 5BR8E 4X65I 1H73A 2VESA 4DR4I 2BV3A 1IBLE 5JEAB 3PYGA 3B4TA 1XMOI 4AIDA 2J65A 4LPFA 2JE6B 2PNLA 4ISAA 1J5EI 4LF4I 4NXNI 3PYDA 4IFDD 2ZM6E 4OO1D 4PRXA 5IWAI 4LF6I 4M1KA 2O3ZA 3CDIA 4DR7E 3JAMQ 5JEAC 3K85A 1XNQE 1HNXE 5DRQA 4DR2I 4DR6I 3J80C 4IZJD 3QT8A 3HULA 4MDTA 2UXBI 1B63A 1ZXNA 3L7ZA 1S16A 2NN6E 2VQEI 3M6AA 2IESA 2EFGA 4JI2E 4DV3I 4QNKA 1IBME 1Z0EA 4PU9A 1PVGA 3J7AG 2C37A 1K47A 1N33E 2HKJA 1H74A 3CWVA 2AJ4A 5C0XB 4B3TI 5LMUE 4JI7E 4BA2B 4LFBI 4LFAI 2C37B 2NN6A 4U3BA 2BR2A 4FW5A 4AM3A 2A2CA 5A2QQ 2IERA 2F4VE 3JAMC 5JEAD 1NZ0A 1HNZE 2PNZB 4X62I 4DV2E 1HNWI 3GLLA 3T1YE 1FI4A 4DV5E 4HACA 4LCHA 4X64I 1OYRA 2NPFA 3P06A 1A6FA 4DPWA 4WUBA 4AQYI 5C0XC 3T1HE 1FKAE 1N36E 2NN6F 2R3VA 4IFDB 2UU9I 4OO1B 4MU4A 4IZJA 2PO2B 4FW6A 2V2QA 4B3RI 4JI5I 4KHPI 4JV5E 1BKNA 3HJCA 4JI4E 1VI7A 2IOQA 3PRYA 3QT6A 2Z5BB 3J81Q 2JEAA 5JEAE 4DV4I 4WUCA 4DR4E 2WP8B 1ZXMA 4DR5I 1XMOE 3M7NG 5FLXC 1Z5AA 2C39A 5LL6R 1J5EE 2C38B 4NXNE 4P7AA 5DNLA 4JI6I 1RREA 1MX0A 4FW7A 4B3SI 2AE8A 4GKKI 4BA1A 4GKJI 3QT7A 5IWAE 1N0UA 2Z5CA 2UUCE 4LF6E 2DEIA 1IBKI 1Y5YA 1EI1A 4NXMI 4DU8A 5JEAA 5C0XD 4LF8E 2O1TA 4I3HA 4JG4A 2JE6A 4DV6I 1XMQI 5K36C 4DR2E 3M7ND 2JT2A 2UUAI 2V34A 2PNMA 1FJGI 1NHIA 1DARA 1HR0I 1U2RA 4MYUA 2VQEE 1KIJA 3P3EA 4DV3E 2X7IA 2VQFI 4DV0I 1N34I 1ZM2A 3PS3A 2J7KA 4RPFA 4JI3E 5C0XE 1FWLA 1XHKA 1Z5BA 4B3TE 2OI2A 4LFCI 2V8PA 4LFAE 1WUUA 4FW4A 2BA1G 3PS2A 4LOMA 4ED4A 3U1YA 3K17A 2UXDI 4X62E 4MU3A 1HNWE 1YH8A 5K36D 2WNRB 5LMNI 4DV7I 1S4EA 4B3MI 4FN5A 3B82A 5EKWA 4YY3I 4X64E 2PO1B 5C0XA 4IFDE 4UT4A 4JI0I 4OO1E 4DR3I 4BA2A 2E1RA 1Z5CA 4MU1A 2UU9E 1OJ4A 4LF9I 4LF5I 2CVEA 4XTJA 2BA1D 4B3RE 2PNZA 4JI5E 2E5LI 4KHPE 2V2VA 4KQVA 1Y6ZA 4HY1A 4FW9A 1E3HA 4N3OA 4DV4E 1H7SA 2UUBI 1H72C 4OKGA 4FWGA 1Y4UA 5DROA 5IT9Q 4DR5E 3F0NA 4IFDA 2CGEA 3GMEA 4OO1A 4JI8I 1N32I 3J7AM 2CZ9A 4OX9I 2HHHI 4JI6E 2PO2A 3UHMA 1EA6A 4B3SE 1FNMA 4QNJA 2V2ZA 4GKKE 2Z5BA 5DRRA 4GKJE 4JYAI 3ZKBA 4DUZI 3OTOI 3Q6NA 2ZITA 4IZKB 1IBKE 4NXME 2WP8A 2DEJA 4K0KE 4IFDF 4OO1F 1N0VC 4WUDA 1ZM3A 4DV6E 1XMQE 1Z0WA 2LJPA 2C38A 2ZBKB 2CG9A 4LF7E 2UUAE 1XNRE 1FJGE 4U3DA 4X65E 2JEBB 3V2UC 1HR0E 1Y4SA 2HFUA 1NHHA 2BA0G 3WU6A 5K36B 1NHJA 4DPTA 1XXEA 2VQFE 4LF4E 5ELWA 4DV0E 1N34E 3GCMA 2HFSA 5GMDA 4DV1I 5IT9C 1R6LA 2R42A 5A2QC 1RHYA 1UDQA 4USMA 4YHHI 1UDOA 2A2DA 4JI1I 3B78A 4LFCE 2NN6C 3WU3A 3D4JA 4LCFA 3H4LA 4DR6E 2BA0D 2GO3A 1P42A 4EMDA 2UXDE 2UXCI 3KRNA 5LMNE 1OYSA 4DV7E 2UXBE 4B3ME 3J81C 2GO4A 4YY3E 2Z5EA 5JEAF 1KTVA 2X36A 4DR3E 5GMEA 4JI0E 1H7UA 1ZM4A 4FW3A 3J80Q 1MU5A 3LTOA 4LF9E 2PO0B 2HKEA 3P76A 3CDJA 4MYTA 3NZKA 1UDSA 2WNRA 3QT5A 1QZRA 4NBQA 4FWHA 3M85G 3H1CA 4LFBE 4PRVA 2BM0A 1MG7A 2PO1A 2UUBE 3LNUA 4DR1I 4GQUA 1USVA 2NN6D 1Z0CA 4JI8E 1N32E 4OX9E 2HHHE 1ZM9A 1I94I 2Q2EB 1KVKA 4ZVIA 1Z0TA 3ZZTA 1FWKA 2UUCI 1OYPA 2O1UA 4AQYE 3ZKDA 2HK3A 4JYAE 3K1JA 5FWKA 4DUZE 1YHCA 1R6MA 3OTOE 3B8HA 4LF8I 3M85D 4X66I 3PS1A 1Z59A 3WU5A 4MQYA 1KKHA 4DUYI 5BR8I 4FWDA 2HK2A 2GS8A 3ZZUA 4AIMA 4DPUA 3Q6MA 1HK7A 4OZEA 3P3CA 1IBLI 5C0XF 1E3PA 5K36E 1ELOA 4Z7YA 3ZM7A 3ZZ0A 4IZKA 5DRPA 3Q1QA 1UEKA 2ZM6I 4DV1E 4JI3I 4R1FA 3L7ZB 2F1DA 3U1KA 5DNXA 4DXLA 4HYMA 4YHHE 4JI1E 5FLXQ 4DR7I 2VF3A 2JEBA 1D6TA 1RR9A 1XNQI 1HNXI 4DU7A 1VISA 2GQ0A 1Z0VA 4UTGA 5L3JA 5K36A 3HKMA 1USUA 2XEXA 1Z0BA 3P3GA 2IOPA 2UXCE 4HXZA 4JI2I 3DD6A 2BM1A 2NN6B 2BR2B 1IBMI 4DPYA 4DPXA 5K36F 1N33I 1UDNA 1Y60A 4HACB 4Z7CA 1PIEA 4P52A 4J3DA 5EL9A 5LMUI 4IS9A 4JI7I 1PKPA 1Z0GA 1B62A 4IZJB 2F4VI 3WU4A 1HNZI 4IFDC 4DV2I 4DR1E 4OO1C 2O1WA 3T1YI 4MU0A 4DV5I 2JEAB 2PO0A
chains in the Genus database with same CATH topology
1I94E 3GONA 3T1HI 1N36I 4K0KI 2WW4A 3PYFA 4X66E 3PYEA 4JV5I 4USKA 2O1VA 4JI4I 4LF5E 3V5RA 4LF7I 3LPSA 1XNRI 4URLA 2E5LE 4DUYE 2Z5CB 5BR8E 4X65I 1H73A 4DR4I 2BV3A 1IBLE 3PYGA 1XMOI 2PNLA 1J5EI 4LF4I 4NXNI 3PYDA 2ZM6E 4PRXA 5IWAI 4LF6I 4M1KA 4DR7E 3JAMQ 3K85A 1XNQE 1HNXE 4DR2I 4DR6I 3J80C 4IZJD 3QT8A 3HULA 2UXBI 1B63A 1ZXNA 1S16A 2VQEI 3M6AA 2EFGA 4JI2E 4DV3I 1IBME 1Z0EA 4PU9A 1PVGA 3J7AG 1K47A 1N33E 2HKJA 1H74A 3CWVA 2AJ4A 4B3TI 5LMUE 4JI7E 4LFBI 4LFAI 2A2CA 5A2QQ 2F4VE 3JAMC 1NZ0A 1HNZE 4X62I 4DV2E 1HNWI 3T1YE 1FI4A 4DV5E 4HACA 4X64I 2NPFA 3P06A 1A6FA 4DPWA 4WUBA 4AQYI 3T1HE 1FKAE 1N36E 2R3VA 2UU9I 4IZJA 2V2QA 4B3RI 4JI5I 4KHPI 4JV5E 1BKNA 3HJCA 4JI4E 2IOQA 3PRYA 3QT6A 2Z5BB 3J81Q 4DV4I 4WUCA 4DR4E 1ZXMA 4DR5I 1XMOE 5FLXC 1Z5AA 5LL6R 1J5EE 4NXNE 4P7AA 4JI6I 1RREA 1MX0A 4B3SI 4GKKI 4GKJI 3QT7A 5IWAE 1N0UA 2Z5CA 2UUCE 4LF6E 2DEIA 1IBKI 1EI1A 4NXMI 4DU8A 4LF8E 2O1TA 4I3HA 4JG4A 4DV6I 1XMQI 4DR2E 2UUAI 2V34A 2PNMA 1FJGI 1NHIA 1DARA 1HR0I 1U2RA 4MYUA 2VQEE 1KIJA 4DV3E 2X7IA 2VQFI 4DV0I 1N34I 1ZM2A 2J7KA 4RPFA 4JI3E 1FWLA 1XHKA 1Z5BA 4B3TE 2OI2A 4LFCI 2V8PA 4LFAE 1WUUA 4ED4A 3K17A 2UXDI 4X62E 1HNWE 5LMNI 4DV7I 1S4EA 4B3MI 4FN5A 3B82A 4YY3I 4X64E 4UT4A 4JI0I 4DR3I 2E1RA 1Z5CA 2UU9E 1OJ4A 4LF9I 4LF5I 4XTJA 4B3RE 4JI5E 2E5LI 4KHPE 2V2VA 4KQVA 1Y6ZA 4HY1A 4FW9A 4N3OA 4DV4E 1H7SA 2UUBI 1H72C 4FWGA 1Y4UA 5IT9Q 4DR5E 3F0NA 2CGEA 4JI8I 1N32I 3J7AM 2CZ9A 4OX9I 2HHHI 4JI6E 1EA6A 4B3SE 1FNMA 2V2ZA 4GKKE 2Z5BA 4GKJE 4JYAI 3ZKBA 4DUZI 3OTOI 3Q6NA 2ZITA 4IZKB 1IBKE 4NXME 2DEJA 4K0KE 1N0VC 4WUDA 1ZM3A 4DV6E 1XMQE 1Z0WA 2LJPA 2ZBKB 2CG9A 4LF7E 2UUAE 1XNRE 1FJGE 4X65E 3V2UC 1HR0E 1Y4SA 2HFUA 1NHHA 3WU6A 1NHJA 4DPTA 2VQFE 4LF4E 4DV0E 1N34E 5IT9C 2HFSA 5GMDA 4DV1I 2R42A 5A2QC 4YHHI 4USMA 2A2DA 4JI1I 3B78A 4LFCE 3WU3A 3D4JA 3H4LA 4DR6E 4EMDA 2UXDE 2UXCI 5LMNE 4DV7E 2UXBE 4B3ME 3J81C 4YY3E 2Z5EA 1KTVA 2X36A 4DR3E 5GMEA 4JI0E 1H7UA 1ZM4A 3J80Q 1MU5A 3LTOA 4LF9E 2HKEA 4MYTA 3QT5A 1QZRA 4FWHA 4LFBE 4PRVA 2BM0A 1MG7A 2UUBE 3LNUA 4DR1I 1USVA 1Z0CA 4JI8E 1N32E 4OX9E 2HHHE 1ZM9A 1I94I 2Q2EB 1KVKA 4ZVIA 1Z0TA 3ZZTA 1FWKA 2UUCI 2O1UA 4AQYE 3ZKDA 2HK3A 4JYAE 3K1JA 5FWKA 4DUZE 3OTOE 3B8HA 4LF8I 4X66I 1Z59A 3WU5A 1KKHA 4DUYI 5BR8I 4FWDA 2HK2A 2GS8A 3ZZUA 4DPUA 3Q6MA 1HK7A 1IBLI 1ELOA 4Z7YA 3ZM7A 3ZZ0A 4IZKA 3Q1QA 1UEKA 2ZM6I 4DV1E 4JI3I 4R1FA 4DXLA 4HYMA 4YHHE 4JI1E 5FLXQ 4DR7I 2VF3A 1D6TA 1RR9A 1XNQI 1HNXI 4DU7A 1VISA 2GQ0A 1Z0VA 4UTGA 5L3JA 1USUA 2XEXA 1Z0BA 2IOPA 2UXCE 4HXZA 4JI2I 2BM1A 1IBMI 4DPYA 4DPXA 1N33I 4HACB 4Z7CA 1PIEA 4P52A 5LMUI 4JI7I 1PKPA 1Z0GA 1B62A 4IZJB 2F4VI 3WU4A 1HNZI 4DV2I 4DR1E 2O1WA 3T1YI 4DV5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 E;  3GON A;  3T1H I;  1N36 I;  4K0K I;  2WW4 A;  3PYF A;  4X66 E;  3PYE A;  4JV5 I;  4USK A;  4JI4 I;  4LF5 E;  3V5R A;  4LF7 I;  3LPS A;  1XNR I;  4URL A;  2E5L E;  4DUY E;  5BR8 E;  4X65 I;  1H73 A;  4DR4 I;  2BV3 A;  1IBL E;  3PYG A;  1XMO I;  1J5E I;  4LF4 I;  4NXN I;  3PYD A;  2ZM6 E;  4PRX A;  5IWA I;  4LF6 I;  4M1K A;  4DR7 E;  3JAM Q;  1XNQ E;  1HNX E;  4DR2 I;  4DR6 I;  3J80 C;  3QT8 A;  3HUL A;  2UXB I;  1B63 A;  1ZXN A;  1S16 A;  2VQE I;  3M6A A;  2EFG A;  4JI2 E;  4DV3 I;  1IBM E;  1Z0E A;  4PU9 A;  1PVG A;  3J7A G;  1K47 A;  1N33 E;  2HKJ A;  1H74 A;  3CWV A;  2AJ4 A;  4B3T I;  5LMU E;  4JI7 E;  4LFB I;  4LFA I;  2A2C A;  5A2Q Q;  2F4V E;  3JAM C;  1NZ0 A;  1HNZ E;  4X62 I;  4DV2 E;  1HNW I;  3T1Y E;  1FI4 A;  4DV5 E;  4HAC A;  4X64 I;  2NPF A;  1A6F A;  4DPW A;  4WUB A;  4AQY I;  3T1H E;  1FKA E;  1N36 E;  2R3V A;  2UU9 I;  2V2Q A;  4B3R I;  4JI5 I;  4KHP I;  4JV5 E;  1BKN A;  4JI4 E;  3QT6 A;  3J81 Q;  4DV4 I;  4WUC A;  4DR4 E;  1ZXM A;  4DR5 I;  1XMO E;  5FLX C;  1Z5A A;  5LL6 R;  1J5E E;  4NXN E;  4P7A A;  4JI6 I;  1RRE A;  1MX0 A;  4B3S I;  4GKK I;  4GKJ I;  3QT7 A;  5IWA E;  1N0U A;  2UUC E;  4LF6 E;  2DEI A;  1IBK I;  1EI1 A;  4NXM I;  4DU8 A;  4LF8 E;  4I3H A;  4JG4 A;  4DV6 I;  1XMQ I;  4DR2 E;  2UUA I;  2V34 A;  1FJG I;  1NHI A;  1DAR A;  1HR0 I;  1U2R A;  4MYU A;  2VQE E;  1KIJ A;  4DV3 E;  2X7I A;  2VQF I;  4DV0 I;  1N34 I;  1ZM2 A;  2J7K A;  4RPF A;  4JI3 E;  1FWL A;  1XHK A;  1Z5B A;  4B3T E;  2OI2 A;  4LFC I;  2V8P A;  4LFA E;  1WUU A;  4ED4 A;  3K17 A;  2UXD I;  4X62 E;  1HNW E;  5LMN I;  4DV7 I;  1S4E A;  4B3M I;  4FN5 A;  3B82 A;  4YY3 I;  4X64 E;  4UT4 A;  4JI0 I;  4DR3 I;  2E1R A;  1Z5C A;  2UU9 E;  1OJ4 A;  4LF9 I;  4LF5 I;  4XTJ A;  4B3R E;  4JI5 E;  2E5L I;  4KHP E;  2V2V A;  4KQV A;  4HY1 A;  4FW9 A;  4DV4 E;  1H7S A;  2UUB I;  1H72 C;  4FWG A;  5IT9 Q;  4DR5 E;  3F0N A;  4JI8 I;  1N32 I;  3J7A M;  2CZ9 A;  4OX9 I;  2HHH I;  4JI6 E;  1EA6 A;  4B3S E;  1FNM A;  2V2Z A;  4GKK E;  4GKJ E;  4JYA I;  3ZKB A;  4DUZ I;  3OTO I;  2ZIT A;  1IBK E;  4NXM E;  2DEJ A;  4K0K E;  1N0V C;  4WUD A;  1ZM3 A;  4DV6 E;  1XMQ E;  1Z0W A;  2LJP A;  2ZBK B;  4LF7 E;  2UUA E;  1XNR E;  1FJG E;  4X65 E;  3V2U C;  1HR0 E;  2HFU A;  1NHH A;  3WU6 A;  1NHJ A;  4DPT A;  2VQF E;  4LF4 E;  4DV0 E;  1N34 E;  5IT9 C;  2HFS A;  5GMD A;  4DV1 I;  2R42 A;  5A2Q C;  4YHH I;  4USM A;  2A2D A;  4JI1 I;  3B78 A;  4LFC E;  3WU3 A;  3D4J A;  3H4L A;  4DR6 E;  4EMD A;  2UXD E;  2UXC I;  5LMN E;  4DV7 E;  2UXB E;  4B3M E;  3J81 C;  4YY3 E;  1KTV A;  2X36 A;  4DR3 E;  5GME A;  4JI0 E;  1H7U A;  1ZM4 A;  3J80 Q;  1MU5 A;  3LTO A;  4LF9 E;  2HKE A;  4MYT A;  3QT5 A;  1QZR A;  4FWH A;  4LFB E;  4PRV A;  2BM0 A;  1MG7 A;  2UUB E;  3LNU A;  4DR1 I;  1Z0C A;  4JI8 E;  1N32 E;  4OX9 E;  2HHH E;  1ZM9 A;  1I94 I;  2Q2E B;  1KVK A;  4ZVI A;  1Z0T A;  3ZZT A;  1FWK A;  2UUC I;  4AQY E;  3ZKD A;  2HK3 A;  4JYA E;  3K1J A;  4DUZ E;  3OTO E;  3B8H A;  4LF8 I;  4X66 I;  1Z59 A;  3WU5 A;  1KKH A;  4DUY I;  5BR8 I;  4FWD A;  2HK2 A;  2GS8 A;  3ZZU A;  4DPU A;  1IBL I;  1ELO A;  4Z7Y A;  3ZM7 A;  3ZZ0 A;  3Q1Q A;  1UEK A;  2ZM6 I;  4DV1 E;  4JI3 I;  4R1F A;  4DXL A;  4HYM A;  4YHH E;  4JI1 E;  5FLX Q;  4DR7 I;  2VF3 A;  1D6T A;  1RR9 A;  1XNQ I;  1HNX I;  4DU7 A;  1VIS A;  5L3J A;  1Z0V A;  4UTG A;  2XEX A;  1Z0B A;  2UXC E;  4HXZ A;  4JI2 I;  2BM1 A;  1IBM I;  4DPY A;  4DPX A;  1N33 I;  4HAC B;  4Z7C A;  1PIE A;  4P52 A;  5LMU I;  4JI7 I;  1PKP A;  1Z0G A;  1B62 A;  2F4V I;  3WU4 A;  1HNZ I;  4DV2 I;  4DR1 E;  3T1Y I;  4DV5 I; 
#chains in the Genus database with same CATH topology
 1I94 E;  3GON A;  3T1H I;  1N36 I;  2C39 B;  4K0K I;  4LCG A;  2WW4 A;  3PYF A;  4X66 E;  3PYE A;  4JV5 I;  4USK A;  2O1V A;  4JI4 I;  4LF5 E;  3V5R A;  4LF7 I;  4BA1 B;  3LPS A;  1XNR I;  4URL A;  2E5L E;  4DUY E;  2Z5C B;  5BR8 E;  4X65 I;  1H73 A;  2VES A;  4DR4 I;  2BV3 A;  1IBL E;  5JEA B;  3PYG A;  3B4T A;  1XMO I;  4AID A;  2J65 A;  4LPF A;  2JE6 B;  2PNL A;  4ISA A;  1J5E I;  4LF4 I;  4NXN I;  3PYD A;  4IFD D;  2ZM6 E;  4OO1 D;  4PRX A;  5IWA I;  4LF6 I;  4M1K A;  2O3Z A;  3CDI A;  4DR7 E;  3JAM Q;  5JEA C;  3K85 A;  1XNQ E;  1HNX E;  5DRQ A;  4DR2 I;  4DR6 I;  3J80 C;  4IZJ D;  3QT8 A;  3HUL A;  4MDT A;  2UXB I;  1B63 A;  1ZXN A;  3L7Z A;  1S16 A;  2NN6 E;  2VQE I;  3M6A A;  2IES A;  2EFG A;  4JI2 E;  4DV3 I;  4QNK A;  1IBM E;  1Z0E A;  4PU9 A;  1PVG A;  3J7A G;  2C37 A;  1K47 A;  1N33 E;  2HKJ A;  1H74 A;  3CWV A;  2AJ4 A;  5C0X B;  4B3T I;  5LMU E;  4JI7 E;  4BA2 B;  4LFB I;  4LFA I;  2C37 B;  2NN6 A;  4U3B A;  2BR2 A;  4FW5 A;  4AM3 A;  2A2C A;  5A2Q Q;  2IER A;  2F4V E;  3JAM C;  5JEA D;  1NZ0 A;  1HNZ E;  2PNZ B;  4X62 I;  4DV2 E;  1HNW I;  3GLL A;  3T1Y E;  1FI4 A;  4DV5 E;  4HAC A;  4LCH A;  4X64 I;  1OYR A;  2NPF A;  3P06 A;  1A6F A;  4DPW A;  4WUB A;  4AQY I;  5C0X C;  3T1H E;  1FKA E;  1N36 E;  2NN6 F;  2R3V A;  4IFD B;  2UU9 I;  4OO1 B;  4MU4 A;  4IZJ A;  2PO2 B;  4FW6 A;  2V2Q A;  4B3R I;  4JI5 I;  4KHP I;  4JV5 E;  1BKN A;  3HJC A;  4JI4 E;  1VI7 A;  2IOQ A;  3PRY A;  3QT6 A;  2Z5B B;  3J81 Q;  2JEA A;  5JEA E;  4DV4 I;  4WUC A;  4DR4 E;  2WP8 B;  1ZXM A;  4DR5 I;  1XMO E;  3M7N G;  5FLX C;  1Z5A A;  2C39 A;  5LL6 R;  1J5E E;  2C38 B;  4NXN E;  4P7A A;  5DNL A;  4JI6 I;  1RRE A;  1MX0 A;  4FW7 A;  4B3S I;  2AE8 A;  4GKK I;  4BA1 A;  4GKJ I;  3QT7 A;  5IWA E;  1N0U A;  2Z5C A;  2UUC E;  4LF6 E;  2DEI A;  1IBK I;  1Y5Y A;  1EI1 A;  4NXM I;  4DU8 A;  5JEA A;  5C0X D;  4LF8 E;  2O1T A;  4I3H A;  4JG4 A;  2JE6 A;  4DV6 I;  1XMQ I;  5K36 C;  4DR2 E;  3M7N D;  2JT2 A;  2UUA I;  2V34 A;  2PNM A;  1FJG I;  1NHI A;  1DAR A;  1HR0 I;  1U2R A;  4MYU A;  2VQE E;  1KIJ A;  3P3E A;  4DV3 E;  2X7I A;  2VQF I;  4DV0 I;  1N34 I;  1ZM2 A;  3PS3 A;  2J7K A;  4RPF A;  4JI3 E;  5C0X E;  1FWL A;  1XHK A;  1Z5B A;  4B3T E;  2OI2 A;  4LFC I;  2V8P A;  4LFA E;  1WUU A;  4FW4 A;  2BA1 G;  3PS2 A;  4LOM A;  4ED4 A;  3U1Y A;  3K17 A;  2UXD I;  4X62 E;  4MU3 A;  1HNW E;  1YH8 A;  5K36 D;  2WNR B;  5LMN I;  4DV7 I;  1S4E A;  4B3M I;  4FN5 A;  3B82 A;  5EKW A;  4YY3 I;  4X64 E;  2PO1 B;  5C0X A;  4IFD E;  4UT4 A;  4JI0 I;  4OO1 E;  4DR3 I;  4BA2 A;  2E1R A;  1Z5C A;  4MU1 A;  2UU9 E;  1OJ4 A;  4LF9 I;  4LF5 I;  2CVE A;  4XTJ A;  2BA1 D;  4B3R E;  2PNZ A;  4JI5 E;  2E5L I;  4KHP E;  2V2V A;  4KQV A;  1Y6Z A;  4HY1 A;  4FW9 A;  1E3H A;  4N3O A;  4DV4 E;  1H7S A;  2UUB I;  1H72 C;  4OKG A;  4FWG A;  1Y4U A;  5DRO A;  5IT9 Q;  4DR5 E;  3F0N A;  4IFD A;  2CGE A;  3GME A;  4OO1 A;  4JI8 I;  1N32 I;  3J7A M;  2CZ9 A;  4OX9 I;  2HHH I;  4JI6 E;  2PO2 A;  3UHM A;  1EA6 A;  4B3S E;  1FNM A;  4QNJ A;  2V2Z A;  4GKK E;  2Z5B A;  5DRR A;  4GKJ E;  4JYA I;  3ZKB A;  4DUZ I;  3OTO I;  3Q6N A;  2ZIT A;  4IZK B;  1IBK E;  4NXM E;  2WP8 A;  2DEJ A;  4K0K E;  4IFD F;  4OO1 F;  1N0V C;  4WUD A;  1ZM3 A;  4DV6 E;  1XMQ E;  1Z0W A;  2LJP A;  2C38 A;  2ZBK B;  2CG9 A;  4LF7 E;  2UUA E;  1XNR E;  1FJG E;  4U3D A;  4X65 E;  2JEB B;  3V2U C;  1HR0 E;  1Y4S A;  2HFU A;  1NHH A;  2BA0 G;  3WU6 A;  5K36 B;  1NHJ A;  4DPT A;  1XXE A;  2VQF E;  4LF4 E;  5ELW A;  4DV0 E;  1N34 E;  3GCM A;  2HFS A;  5GMD A;  4DV1 I;  5IT9 C;  1R6L A;  2R42 A;  5A2Q C;  1RHY A;  1UDQ A;  4USM A;  4YHH I;  1UDO A;  2A2D A;  4JI1 I;  3B78 A;  4LFC E;  2NN6 C;  3WU3 A;  3D4J A;  4LCF A;  3H4L A;  4DR6 E;  2BA0 D;  2GO3 A;  1P42 A;  4EMD A;  2UXD E;  2UXC I;  3KRN A;  5LMN E;  1OYS A;  4DV7 E;  2UXB E;  4B3M E;  3J81 C;  2GO4 A;  4YY3 E;  2Z5E A;  5JEA F;  1KTV A;  2X36 A;  4DR3 E;  5GME A;  4JI0 E;  1H7U A;  1ZM4 A;  4FW3 A;  3J80 Q;  1MU5 A;  3LTO A;  4LF9 E;  2PO0 B;  2HKE A;  3P76 A;  3CDJ A;  4MYT A;  3NZK A;  1UDS A;  2WNR A;  3QT5 A;  1QZR A;  4NBQ A;  4FWH A;  3M85 G;  3H1C A;  4LFB E;  4PRV A;  2BM0 A;  1MG7 A;  2PO1 A;  2UUB E;  3LNU A;  4DR1 I;  4GQU A;  1USV A;  2NN6 D;  1Z0C A;  4JI8 E;  1N32 E;  4OX9 E;  2HHH E;  1ZM9 A;  1I94 I;  2Q2E B;  1KVK A;  4ZVI A;  1Z0T A;  3ZZT A;  1FWK A;  2UUC I;  1OYP A;  2O1U A;  4AQY E;  3ZKD A;  2HK3 A;  4JYA E;  3K1J A;  5FWK A;  4DUZ E;  1YHC A;  1R6M A;  3OTO E;  3B8H A;  4LF8 I;  3M85 D;  4X66 I;  3PS1 A;  1Z59 A;  3WU5 A;  4MQY A;  1KKH A;  4DUY I;  5BR8 I;  4FWD A;  2HK2 A;  2GS8 A;  3ZZU A;  4AIM A;  4DPU A;  3Q6M A;  1HK7 A;  4OZE A;  3P3C A;  1IBL I;  5C0X F;  1E3P A;  5K36 E;  1ELO A;  4Z7Y A;  3ZM7 A;  3ZZ0 A;  4IZK A;  5DRP A;  3Q1Q A;  1UEK A;  2ZM6 I;  4DV1 E;  4JI3 I;  4R1F A;  3L7Z B;  2F1D A;  3U1K A;  5DNX A;  4DXL A;  4HYM A;  4YHH E;  4JI1 E;  5FLX Q;  4DR7 I;  2VF3 A;  2JEB A;  1D6T A;  1RR9 A;  1XNQ I;  1HNX I;  4DU7 A;  1VIS A;  2GQ0 A;  1Z0V A;  4UTG A;  5L3J A;  5K36 A;  3HKM A;  1USU A;  2XEX A;  1Z0B A;  3P3G A;  2IOP A;  2UXC E;  4HXZ A;  4JI2 I;  3DD6 A;  2BM1 A;  2NN6 B;  2BR2 B;  1IBM I;  4DPY A;  4DPX A;  5K36 F;  1N33 I;  1UDN A;  1Y60 A;  4HAC B;  4Z7C A;  1PIE A;  4P52 A;  4J3D A;  5EL9 A;  5LMU I;  4IS9 A;  4JI7 I;  1PKP A;  1Z0G A;  1B62 A;  4IZJ B;  2F4V I;  3WU4 A;  1HNZ I;  4IFD C;  4DV2 I;  4DR1 E;  4OO1 C;  2O1W A;  3T1Y I;  4MU0 A;  4DV5 I;  2JEA B;  2PO0 A; 
#chains in the Genus database with same CATH homology
 1I94 E;  3GON A;  3T1H I;  1N36 I;  4K0K I;  2WW4 A;  3PYF A;  4X66 E;  3PYE A;  4JV5 I;  4USK A;  2O1V A;  4JI4 I;  4LF5 E;  3V5R A;  4LF7 I;  3LPS A;  1XNR I;  4URL A;  2E5L E;  4DUY E;  2Z5C B;  5BR8 E;  4X65 I;  1H73 A;  4DR4 I;  2BV3 A;  1IBL E;  3PYG A;  1XMO I;  2PNL A;  1J5E I;  4LF4 I;  4NXN I;  3PYD A;  2ZM6 E;  4PRX A;  5IWA I;  4LF6 I;  4M1K A;  4DR7 E;  3JAM Q;  3K85 A;  1XNQ E;  1HNX E;  4DR2 I;  4DR6 I;  3J80 C;  4IZJ D;  3QT8 A;  3HUL A;  2UXB I;  1B63 A;  1ZXN A;  1S16 A;  2VQE I;  3M6A A;  2EFG A;  4JI2 E;  4DV3 I;  1IBM E;  1Z0E A;  4PU9 A;  1PVG A;  3J7A G;  1K47 A;  1N33 E;  2HKJ A;  1H74 A;  3CWV A;  2AJ4 A;  4B3T I;  5LMU E;  4JI7 E;  4LFB I;  4LFA I;  2A2C A;  5A2Q Q;  2F4V E;  3JAM C;  1NZ0 A;  1HNZ E;  4X62 I;  4DV2 E;  1HNW I;  3T1Y E;  1FI4 A;  4DV5 E;  4HAC A;  4X64 I;  2NPF A;  3P06 A;  1A6F A;  4DPW A;  4WUB A;  4AQY I;  3T1H E;  1FKA E;  1N36 E;  2R3V A;  2UU9 I;  4IZJ A;  2V2Q A;  4B3R I;  4JI5 I;  4KHP I;  4JV5 E;  1BKN A;  3HJC A;  4JI4 E;  2IOQ A;  3PRY A;  3QT6 A;  2Z5B B;  3J81 Q;  4DV4 I;  4WUC A;  4DR4 E;  1ZXM A;  4DR5 I;  1XMO E;  5FLX C;  1Z5A A;  5LL6 R;  1J5E E;  4NXN E;  4P7A A;  4JI6 I;  1RRE A;  1MX0 A;  4B3S I;  4GKK I;  4GKJ I;  3QT7 A;  5IWA E;  1N0U A;  2Z5C A;  2UUC E;  4LF6 E;  2DEI A;  1IBK I;  1EI1 A;  4NXM I;  4DU8 A;  4LF8 E;  2O1T A;  4I3H A;  4JG4 A;  4DV6 I;  1XMQ I;  4DR2 E;  2UUA I;  2V34 A;  2PNM A;  1FJG I;  1NHI A;  1DAR A;  1HR0 I;  1U2R A;  4MYU A;  2VQE E;  1KIJ A;  4DV3 E;  2X7I A;  2VQF I;  4DV0 I;  1N34 I;  1ZM2 A;  2J7K A;  4RPF A;  4JI3 E;  1FWL A;  1XHK A;  1Z5B A;  4B3T E;  2OI2 A;  4LFC I;  2V8P A;  4LFA E;  1WUU A;  4ED4 A;  3K17 A;  2UXD I;  4X62 E;  1HNW E;  5LMN I;  4DV7 I;  1S4E A;  4B3M I;  4FN5 A;  3B82 A;  4YY3 I;  4X64 E;  4UT4 A;  4JI0 I;  4DR3 I;  2E1R A;  1Z5C A;  2UU9 E;  1OJ4 A;  4LF9 I;  4LF5 I;  4XTJ A;  4B3R E;  4JI5 E;  2E5L I;  4KHP E;  2V2V A;  4KQV A;  1Y6Z A;  4HY1 A;  4FW9 A;  4N3O A;  4DV4 E;  1H7S A;  2UUB I;  1H72 C;  4FWG A;  1Y4U A;  5IT9 Q;  4DR5 E;  3F0N A;  2CGE A;  4JI8 I;  1N32 I;  3J7A M;  2CZ9 A;  4OX9 I;  2HHH I;  4JI6 E;  1EA6 A;  4B3S E;  1FNM A;  2V2Z A;  4GKK E;  2Z5B A;  4GKJ E;  4JYA I;  3ZKB A;  4DUZ I;  3OTO I;  3Q6N A;  2ZIT A;  4IZK B;  1IBK E;  4NXM E;  2DEJ A;  4K0K E;  1N0V C;  4WUD A;  1ZM3 A;  4DV6 E;  1XMQ E;  1Z0W A;  2LJP A;  2ZBK B;  2CG9 A;  4LF7 E;  2UUA E;  1XNR E;  1FJG E;  4X65 E;  3V2U C;  1HR0 E;  1Y4S A;  2HFU A;  1NHH A;  3WU6 A;  1NHJ A;  4DPT A;  2VQF E;  4LF4 E;  4DV0 E;  1N34 E;  5IT9 C;  2HFS A;  5GMD A;  4DV1 I;  2R42 A;  5A2Q C;  4YHH I;  4USM A;  2A2D A;  4JI1 I;  3B78 A;  4LFC E;  3WU3 A;  3D4J A;  3H4L A;  4DR6 E;  4EMD A;  2UXD E;  2UXC I;  5LMN E;  4DV7 E;  2UXB E;  4B3M E;  3J81 C;  4YY3 E;  2Z5E A;  1KTV A;  2X36 A;  4DR3 E;  5GME A;  4JI0 E;  1H7U A;  1ZM4 A;  3J80 Q;  1MU5 A;  3LTO A;  4LF9 E;  2HKE A;  4MYT A;  3QT5 A;  1QZR A;  4FWH A;  4LFB E;  4PRV A;  2BM0 A;  1MG7 A;  2UUB E;  3LNU A;  4DR1 I;  1USV A;  1Z0C A;  4JI8 E;  1N32 E;  4OX9 E;  2HHH E;  1ZM9 A;  1I94 I;  2Q2E B;  1KVK A;  4ZVI A;  1Z0T A;  3ZZT A;  1FWK A;  2UUC I;  2O1U A;  4AQY E;  3ZKD A;  2HK3 A;  4JYA E;  3K1J A;  5FWK A;  4DUZ E;  3OTO E;  3B8H A;  4LF8 I;  4X66 I;  1Z59 A;  3WU5 A;  1KKH A;  4DUY I;  5BR8 I;  4FWD A;  2HK2 A;  2GS8 A;  3ZZU A;  4DPU A;  3Q6M A;  1HK7 A;  1IBL I;  1ELO A;  4Z7Y A;  3ZM7 A;  3ZZ0 A;  4IZK A;  3Q1Q A;  1UEK A;  2ZM6 I;  4DV1 E;  4JI3 I;  4R1F A;  4DXL A;  4HYM A;  4YHH E;  4JI1 E;  5FLX Q;  4DR7 I;  2VF3 A;  1D6T A;  1RR9 A;  1XNQ I;  1HNX I;  4DU7 A;  1VIS A;  2GQ0 A;  1Z0V A;  4UTG A;  5L3J A;  1USU A;  2XEX A;  1Z0B A;  2IOP A;  2UXC E;  4HXZ A;  4JI2 I;  2BM1 A;  1IBM I;  4DPY A;  4DPX A;  1N33 I;  4HAC B;  4Z7C A;  1PIE A;  4P52 A;  5LMU I;  4JI7 I;  1PKP A;  1Z0G A;  1B62 A;  4IZJ B;  2F4V I;  3WU4 A;  1HNZ I;  4DV2 I;  4DR1 E;  2O1W A;  3T1Y I;  4DV5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...