5IWAI

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5iwaI00
1H73A 4USMA 2VF3A 1Z0EA 3OTOI 4HXZA 1IBME 2UXBE 1N33E 2ZM6I 1XNRE 4DV7I 4DR5E 2V34A 1XNQE 4LF5E 4PRVA 3PYEA 1HNZI 4DV3I 4DR1I 4FN5A 4DV1I 4NXME 1B63A 4YY3E 4JI2E 4JI5I 4P7AA 1S4EA 1D6TA 1ZM9A 5GMEA 1N34I 2UUCI 3J7AM 4LFAI 2J7KA 2VQFI 3CWVA 4JYAI 1ZXMA 1PKPA 4LFCI 3PYDA 4Z7CA 4DV4I 4JI4I 5A2QC 1XMOI 1NHJA 2HFSA 1IBKE 4B3MI 4EMDA 4DV2I 4URLA 4JV5I 4DUYE 2F4VI 2HKJA 4HACB 1KIJA 1FJGE 4WUCA 3B78A 2UU9I 2HHHI 1J5EE 3K17A 3J7AG 1ZXNA 4JI3I 4YHHI 3OTOE 4B3SE 1NHHA 4DUZI 1XMQI 4DV7E 2HK3A 2R42A 4JG4A 1EA6A 3T1YI 1EI1A 5LMNI 4DPUA 1HNZE 4DV3E 4DR1E 1ELOA 1IBLI 3PYFA 1QZRA 4I3HA 1HNXI 4ED4A 4DPTA 1N34E 4GKJI 2UUCE 3ZKBA 2UXDE 4LFAE 4B3TE 4K0KE 1Z0GA 3GONA 2VQFE 3K1JA 4FWDA 5L3JA 3QT5A 4LFCE 4OX9I 3JAMC 3WU5A 4MYUA 4GKKI 4JI4E 4NXNI 1WUUA 2R3VA 1Z5AA 1MG7A 5IT9Q 1XMOE 1MX0A 4ZVIA 4B3ME 4DV2E 4DR3I 3WU4A 4UTGA 4JV5E 1Z5BA 3D4JA 3J81Q 1FKAE 2F4VE 4XTJA 2V8PA 4DV6I 4DU7A 4X64I 2UU9E 2DEJA 2X7IA 2HHHE 5IWAI 4FWGA 2EFGA 4DR6E 2UUAI 4HACA 4JI3E 4UT4A 2AJ4A 4YHHE 4R1FA 1KKHA 1N32E 4USKA 1I94I 2VQEI 1XMQE 3F0NA 4JI1I 4DPWA 3T1YE 5LMNE 4DR2I 2ZITA 3QT7A 4PRXA 1IBLE 3J80Q 5LL6R 1FI4A 2UXCE 1RREA 1HNXE 1FWKA 4PU9A 4JI6I 1N36I 4DR4I 4GKJE 4LF9I 2Q2EB 1FNMA 1BKNA 4OX9E 1H7SA 4MYTA 1H72C 2E5LI 3QT6A 4LF7I 4GKKE 4NXNE 5BR8I 4LFBI 1UEKA 3V2UC 4WUBA 4DR3E 5GMDA 4DR7I 5FLXC 1MU5A 2ZM6E 4LF4I 4DV6E 1HR0I 4DR5I 3B82A 4DV1E 5IWAE 3QT8A 4KHPI 3LTOA 1N0VC 4B3RI 3WU3A 4JI5E 4YY3I 5A2QQ 1Z0VA 2VQEE 2V2VA 2BV3A 4X66I 4JI1E 4JYAE 4AQYI 4JI7I 4DPYA 4DV0I 1OJ4A 4JI6E 1N36E 3LPSA 4DV4E 4DR4E 1N0UA 4LF9E 1VISA 3ZZTA 3T1HI 4X65I 1IBKI 4JI0I 4DU8A 1K47A 2CZ9A 1NZ0A 1HNWI 2V2ZA 5LMUI 4DUYI 1KVKA 2HKEA 2E5LE 1Z5CA 4LF7E 4LF6I 5BR8E 1J5EI 2NPFA 1DARA 4X62I 4P52A 4DR7E 4B3SI 4DUZE 4M1KA 2A2DA 4LF4E 1ZM4A 2ZBKB 4KQVA 1HR0E 4DPXA 1H7UA 4FWHA 3B8HA 2HK2A 2V2QA 3JAMQ 4KHPE 4B3RE 1H74A 2DEIA 2UUBI 3WU6A 4DV5I 3HULA 2UXDI 4X66E 2A2CA 3LNUA 4Z7YA 4B3TI 1ZM3A 3PYGA 4K0KI 3H4LA 3V5RA 4AQYE 4LF8I 4JI7E 4FW9A 4JI8I 1Z0TA 4DV0E 1Z59A 2HFUA 1NHIA 1Z0CA 1U2RA 3T1HE 2BM0A 4X65E 4JI0E 1KTVA 4DXLA 3Q1QA 3ZZ0A 1HNWE 5LMUE 1B62A 1IBMI 2LJPA 2UXBI 1N33I 1XNRI 4HYMA 4X64E 4LF6E 1XNQI 4LF5I 1XHKA 2E1RA 2WW4A 4NXMI 2UUAE 4DR6I 4X62E 5IT9C 1FWLA 4JI2I 1I94E 1N32I 2OI2A 3J81C 1Z0WA 1Z0BA 4DR2E 1ZM2A 1A6FA 3ZZUA 3M6AA 2BM1A 2UXCI 1PVGA 2UUBE 4DV5E 2X36A 1S16A 3ZM7A 4HY1A 5FLXQ 4LF8E 4JI8E 2XEXA 1PIEA 3J80C 4WUDA 1FJGI 1RR9A 4RPFA 3ZKDA 4LFBE 2GS8A
chains in the Genus database with same CATH superfamily
1H73A 4USMA 2PNLA 2VF3A 1Z0EA 1XXEA 3OTOI 4HXZA 1IBME 2CG9A 2Z5CA 2UXBE 3HKMA 1N33E 1E3PA 2ZM6I 1XNRE 4DV7I 4DR5E 2O1TA 2V34A 1XNQE 4LF5E 2JT2A 4PRVA 3PYEA 1HNZI 4DV3I 4DR1I 4FN5A 4DV1I 4NXME 2BR2A 1B63A 5DROA 1R6LA 5K36F 4YY3E 4JI2E 4JI5I 4P7AA 1S4EA 1D6TA 1ZM9A 5GMEA 5JEAC 1E3HA 4LCFA 1N34I 2UUCI 3J7AM 4LFAI 2J7KA 4IFDE 3U1KA 4FW6A 2VQFI 2NN6B 3CWVA 4JYAI 1ZXMA 4N3OA 1PKPA 1YHCA 5DNXA 5C0XF 4LFCI 3M85D 3PS1A 3PYDA 4Z7CA 4DV4I 2PO1A 4FW4A 4JI4I 4BA2B 5A2QC 1XMOI 1NHJA 2HFSA 1IBKE 2WP8B 4B3MI 4EMDA 4DV2I 1R6MA 2PO2A 4URLA 4LPFA 1Y5YA 4JV5I 4DUYE 5C0XB 2F4VI 2HKJA 1Y60A 4HACB 1KIJA 1FJGE 4WUCA 3B78A 4IFDA 4LCGA 2C37A 2UU9I 2O1VA 2HHHI 1J5EE 3K17A 4GQUA 3J7AG 4LOMA 1ZXNA 4JI3I 2IESA 4YHHI 3OTOE 4B3SE 2C38A 1NHHA 4DUZI 1XMQI 4DV7E 2HK3A 2R42A 4JG4A 3L7ZB 1EA6A 3T1YI 1EI1A 4QNJA 2NN6E 4DPUA 5LMNI 4IFDF 1HNZE 4DV3E 4DR1E 1ELOA 1IBLI 3PYFA 5DRRA 5K36E 1QZRA 4I3HA 1Y4SA 1HNXI 2PNZB 4ED4A 4DPTA 2IOQA 3PS3A 1N34E 4GKJI 2WNRB 2UUCE 3ZKBA 2UXDE 4LFAE 4IFDD 5JEAB 4B3TE 4K0KE 1Z0GA 3GONA 1P42A 2VQFE 3K1JA 4FWDA 5C0XE 5L3JA 3QT5A 4LFCE 4U3BA 4OX9I 3JAMC 2GQ0A 3WU5A 4IS9A 4MYUA 2IOPA 4GKKI 2PO0B 2NN6A 4JI4E 4NXNI 1WUUA 2R3VA 1MG7A 1Z5AA 5IT9Q 1XMOE 1MX0A 5DRQA 4ZVIA 1YH8A 4B3ME 5K36A 4DV2E 1UDNA 4DR3I 3WU4A 4UTGA 4JV5E 1Z5BA 3D4JA 3J81Q 1FKAE 2F4VE 4OO1B 4XTJA 4BA2A 2V8PA 4DV6I 2WP8A 4DU7A 4X64I 4BA1A 2UU9E 2DEJA 2NN6F 3H1CA 2X7IA 2HHHE 5DRPA 5IWAI 4FWGA 2EFGA 4DR6E 5C0XA 2UUAI 4HACA 2F1DA 4JI3E 4UT4A 2AJ4A 4YHHE 4R1FA 1VI7A 1KKHA 1N32E 4USKA 1I94I 2VQEI 2Z5BB 1XMQE 4MU0A 5JEAE 2NN6D 3F0NA 4JI1I 4DPWA 3T1YE 5LMNE 4DR2I 2ZITA 3QT7A 4PRXA 1IBLE 2BA0D 5LL6R 1FI4A 3J80Q 5K36D 2UXCE 1RREA 4LCHA 2O1WA 1HNXE 3B4TA 1FWKA 4PU9A 4JI6I 1N36I 4DR4I 4J3DA 4GKJE 3Q6NA 4LF9I 2Q2EB 1FNMA 4OZEA 4IFDC 1OYSA 4AM3A 3DD6A 2PNZA 5C0XD 3M85G 4OO1E 2WNRA 1BKNA 4OX9E 1H7SA 4IZJB 1H72C 4MYTA 5JEAA 2E5LI 3QT6A 4LF7I 4GKKE 3P76A 4NXNE 5BR8I 4LFBI 1UEKA 1OYPA 3GLLA 3V2UC 5FWKA 4WUBA 5ELWA 4DR3E 5GMDA 3P3EA 2PO0A 4DR7I 2BR2B 4AIMA 4IZKB 1MU5A 5FLXC 2ZM6E 4LF4I 4DV6E 3K85A 1HR0I 1USUA 5JEAF 4DR5I 4QNKA 2JE6B 3B82A 3GMEA 3KRNA 5IWAE 4DV1E 1USVA 3QT8A 4OO1A 4KHPI 3LTOA 1N0VC 4B3RI 3WU3A 4JI5E 4YY3I 5A2QQ 1Z0VA 3P3CA 4ISAA 2VQEE 5JEAD 2V2VA 1Y6ZA 2BV3A 2JEBB 2NN6C 4X66I 4JI1E 3M7ND 2IERA 4FW7A 4MU4A 4JYAE 4AQYI 4NBQA 5K36C 4JI7I 2Z5BA 4OO1F 4DPYA 4DV0I 1OJ4A 4JI6E 2JEAB 1N36E 3LPSA 2PO2B 1HK7A 4DV4E 4DR4E 1N0UA 4LF9E 1VISA 3ZZTA 4FW3A 3T1HI 4X65I 2AE8A 1IBKI 4JI0I 4FW5A 4DU8A 1K47A 5C0XC 3UHMA 4OO1D 2CZ9A 1NZ0A 1UDQA 2V2ZA 5LMUI 1HNWI 4DUYI 1KVKA 2HKEA 2E5LE 1Z5CA 4LF7E 4LF6I 5BR8E 1J5EI 2NPFA 4IZJA 1DARA 4X62I 4MDTA 4P52A 2GO3A 4DR7E 2PNMA 4B3SI 4DUZE 2O1UA 2A2DA 4M1KA 4LF4E 1ZM4A 2ZBKB 2C39B 4KQVA 1HR0E 4U3DA 4DPXA 4FWHA 1H7UA 3B8HA 2HK2A 2V2QA 3JAMQ 3U1YA 4KHPE 4IZKA 3CDJA 5DNLA 4B3RE 1H74A 2DEIA 2UUBI 2Z5EA 3P06A 3WU6A 4DV5I 3L7ZA 2JE6A 3HULA 3NZKA 2UXDI 4X66E 2A2CA 4Z7YA 3LNUA 4MQYA 4B3TI 1ZM3A 2BA0G 2CGEA 3PYGA 4K0KI 3H4LA 3V5RA 4AQYE 4LF8I 4IZJD 4JI7E 4FW9A 4JI8I 1Z0TA 4DV0E 5K36B 1Y4UA 2JEBA 1Z59A 2HFUA 1NHIA 5EL9A 1Z0CA 2Z5CB 3PRYA 1U2RA 3T1HE 1UDSA 2BM0A 4X65E 1RHYA 4JI0E 1KTVA 4DXLA 2JEAA 3Q1QA 3ZZ0A 4BA1B 4OO1C 1HNWE 5LMUE 1B62A 1IBMI 2LJPA 2UXBI 1N33I 1XNRI 4HYMA 1UDOA 4X64E 4LF6E 1XNQI 4LF5I 1XHKA 2E1RA 2WW4A 4NXMI 2UUAE 3P3GA 4DR6I 3GCMA 4X62E 5IT9C 1FWLA 4JI2I 1I94E 1N32I 3HJCA 4MU1A 2CVEA 2OI2A 3J81C 1Z0WA 2VESA 4OKGA 1Z0BA 4DR2E 2PO1B 1ZM2A 3PS2A 1A6FA 3ZZUA 3M6AA 2BM1A 4MU3A 2UXCI 2C39A 1PVGA 3Q6MA 2UUBE 2J65A 4DV5E 2O3ZA 2X36A 1S16A 4AIDA 3M7NG 2BA1D 3ZM7A 5EKWA 4HY1A 4IFDB 2C37B 5FLXQ 3CDIA 1OYRA 4LF8E 4JI8E 2XEXA 1PIEA 3J80C 4WUDA 1FJGI 2GO4A 1RR9A 4RPFA 2BA1G 2C38B 3ZKDA 4LFBE 2GS8A
chains in the Genus database with same CATH topology
1H73A 4USMA 2PNLA 2VF3A 1Z0EA 3OTOI 4HXZA 1IBME 2CG9A 2Z5CA 2UXBE 1N33E 2ZM6I 1XNRE 4DV7I 4DR5E 2O1TA 2V34A 1XNQE 4LF5E 4PRVA 3PYEA 1HNZI 4DV3I 4DR1I 4FN5A 4DV1I 4NXME 1B63A 4YY3E 4JI2E 4JI5I 4P7AA 1S4EA 1D6TA 1ZM9A 5GMEA 1N34I 2UUCI 3J7AM 4LFAI 2J7KA 2VQFI 3CWVA 4JYAI 1ZXMA 4N3OA 1PKPA 4LFCI 3PYDA 4Z7CA 4DV4I 4JI4I 5A2QC 1XMOI 1NHJA 2HFSA 1IBKE 4B3MI 4EMDA 4DV2I 4URLA 4JV5I 4DUYE 2F4VI 2HKJA 4HACB 1KIJA 1FJGE 4WUCA 3B78A 2UU9I 2O1VA 2HHHI 1J5EE 3K17A 3J7AG 1ZXNA 4JI3I 4YHHI 3OTOE 4B3SE 1NHHA 4DUZI 1XMQI 4DV7E 2HK3A 2R42A 4JG4A 1EA6A 3T1YI 1EI1A 5LMNI 4DPUA 1HNZE 4DV3E 4DR1E 1ELOA 1IBLI 3PYFA 1QZRA 4I3HA 1Y4SA 1HNXI 4ED4A 4DPTA 2IOQA 1N34E 4GKJI 2UUCE 3ZKBA 2UXDE 4LFAE 4B3TE 4K0KE 1Z0GA 3GONA 2VQFE 3K1JA 4FWDA 5L3JA 3QT5A 4LFCE 4OX9I 3JAMC 2GQ0A 3WU5A 4MYUA 2IOPA 4GKKI 4JI4E 4NXNI 1WUUA 2R3VA 1Z5AA 1MG7A 5IT9Q 1XMOE 1MX0A 4ZVIA 4B3ME 4DV2E 4DR3I 3WU4A 4UTGA 4JV5E 1Z5BA 3D4JA 3J81Q 1FKAE 2F4VE 4XTJA 2V8PA 4DV6I 4DU7A 4X64I 2UU9E 2DEJA 2X7IA 2HHHE 5IWAI 4FWGA 2EFGA 4DR6E 2UUAI 4HACA 4JI3E 4UT4A 2AJ4A 4YHHE 4R1FA 1KKHA 1N32E 4USKA 1I94I 2VQEI 2Z5BB 1XMQE 3F0NA 4JI1I 4DPWA 3T1YE 5LMNE 4DR2I 2ZITA 3QT7A 4PRXA 1IBLE 3J80Q 5LL6R 1FI4A 2UXCE 1RREA 2O1WA 1HNXE 1FWKA 4PU9A 4JI6I 1N36I 4DR4I 4GKJE 3Q6NA 4LF9I 2Q2EB 1FNMA 1BKNA 4OX9E 1H7SA 4IZJB 1H72C 4MYTA 2E5LI 3QT6A 4LF7I 4GKKE 4NXNE 5BR8I 4LFBI 1UEKA 3V2UC 5FWKA 4WUBA 4DR3E 5GMDA 4DR7I 4IZKB 1MU5A 5FLXC 2ZM6E 4LF4I 4DV6E 3K85A 1HR0I 1USUA 4DR5I 3B82A 4DV1E 5IWAE 1USVA 3QT8A 4KHPI 3LTOA 1N0VC 4B3RI 3WU3A 4JI5E 4YY3I 5A2QQ 1Z0VA 2VQEE 2V2VA 1Y6ZA 2BV3A 4X66I 4JI1E 4JYAE 4AQYI 4JI7I 2Z5BA 4DPYA 4DV0I 1OJ4A 4JI6E 1N36E 3LPSA 1HK7A 4DV4E 4DR4E 1N0UA 4LF9E 1VISA 3ZZTA 3T1HI 4X65I 1IBKI 4JI0I 4DU8A 1K47A 2CZ9A 1NZ0A 1HNWI 2V2ZA 5LMUI 4DUYI 1KVKA 2HKEA 2E5LE 1Z5CA 4LF7E 4LF6I 5BR8E 1J5EI 2NPFA 4IZJA 1DARA 4X62I 4P52A 4DR7E 2PNMA 4B3SI 4DUZE 2O1UA 2A2DA 4M1KA 4LF4E 1ZM4A 2ZBKB 4KQVA 1HR0E 4DPXA 1H7UA 4FWHA 3B8HA 2HK2A 2V2QA 3JAMQ 4KHPE 4IZKA 4B3RE 1H74A 2DEIA 2UUBI 2Z5EA 3P06A 3WU6A 4DV5I 3HULA 2UXDI 4X66E 2A2CA 3LNUA 4Z7YA 4B3TI 1ZM3A 2CGEA 3PYGA 4K0KI 3H4LA 3V5RA 4AQYE 4LF8I 4IZJD 4JI7E 4FW9A 4JI8I 1Z0TA 4DV0E 1Y4UA 1Z59A 2HFUA 1NHIA 1Z0CA 2Z5CB 3PRYA 1U2RA 3T1HE 2BM0A 4X65E 4JI0E 1KTVA 4DXLA 3Q1QA 3ZZ0A 1HNWE 5LMUE 1B62A 1IBMI 2LJPA 2UXBI 1N33I 1XNRI 4HYMA 4X64E 4LF6E 1XNQI 4LF5I 1XHKA 2E1RA 2WW4A 4NXMI 2UUAE 4DR6I 4X62E 5IT9C 1FWLA 4JI2I 1I94E 1N32I 3HJCA 2OI2A 3J81C 1Z0WA 1Z0BA 4DR2E 1ZM2A 1A6FA 3ZZUA 3M6AA 2BM1A 2UXCI 1PVGA 3Q6MA 2UUBE 4DV5E 2X36A 1S16A 3ZM7A 4HY1A 5FLXQ 4LF8E 4JI8E 2XEXA 1PIEA 3J80C 4WUDA 1FJGI 1RR9A 4RPFA 3ZKDA 4LFBE 2GS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H73 A;  4USM A;  2VF3 A;  1Z0E A;  3OTO I;  4HXZ A;  1IBM E;  2UXB E;  1N33 E;  2ZM6 I;  1XNR E;  4DV7 I;  4DR5 E;  2V34 A;  1XNQ E;  4LF5 E;  4PRV A;  3PYE A;  1HNZ I;  4DV3 I;  4DR1 I;  4FN5 A;  4DV1 I;  4NXM E;  1B63 A;  4YY3 E;  4JI2 E;  4JI5 I;  4P7A A;  1S4E A;  1D6T A;  1ZM9 A;  5GME A;  1N34 I;  2UUC I;  3J7A M;  4LFA I;  2J7K A;  2VQF I;  3CWV A;  4JYA I;  1ZXM A;  1PKP A;  4LFC I;  3PYD A;  4Z7C A;  4DV4 I;  4JI4 I;  5A2Q C;  1XMO I;  1NHJ A;  2HFS A;  1IBK E;  4B3M I;  4EMD A;  4DV2 I;  4URL A;  4JV5 I;  4DUY E;  2F4V I;  2HKJ A;  4HAC B;  1KIJ A;  1FJG E;  4WUC A;  3B78 A;  2UU9 I;  2HHH I;  1J5E E;  3K17 A;  3J7A G;  1ZXN A;  4JI3 I;  4YHH I;  3OTO E;  4B3S E;  1NHH A;  4DUZ I;  1XMQ I;  4DV7 E;  2HK3 A;  2R42 A;  4JG4 A;  1EA6 A;  3T1Y I;  1EI1 A;  5LMN I;  4DPU A;  1HNZ E;  4DV3 E;  4DR1 E;  1ELO A;  1IBL I;  3PYF A;  1QZR A;  4I3H A;  1HNX I;  4ED4 A;  4DPT A;  1N34 E;  4GKJ I;  2UUC E;  3ZKB A;  2UXD E;  4LFA E;  4B3T E;  4K0K E;  1Z0G A;  3GON A;  2VQF E;  3K1J A;  4FWD A;  5L3J A;  3QT5 A;  4LFC E;  4OX9 I;  3JAM C;  3WU5 A;  4MYU A;  4GKK I;  4JI4 E;  4NXN I;  1WUU A;  2R3V A;  1Z5A A;  1MG7 A;  5IT9 Q;  1XMO E;  1MX0 A;  4ZVI A;  4B3M E;  4DV2 E;  4DR3 I;  3WU4 A;  4UTG A;  4JV5 E;  1Z5B A;  3D4J A;  3J81 Q;  1FKA E;  2F4V E;  4XTJ A;  2V8P A;  4DV6 I;  4DU7 A;  4X64 I;  2UU9 E;  2DEJ A;  2X7I A;  2HHH E;  5IWA I;  4FWG A;  2EFG A;  4DR6 E;  2UUA I;  4HAC A;  4JI3 E;  4UT4 A;  2AJ4 A;  4YHH E;  4R1F A;  1KKH A;  1N32 E;  4USK A;  1I94 I;  2VQE I;  1XMQ E;  3F0N A;  4JI1 I;  4DPW A;  3T1Y E;  5LMN E;  4DR2 I;  2ZIT A;  3QT7 A;  4PRX A;  1IBL E;  3J80 Q;  5LL6 R;  1FI4 A;  2UXC E;  1RRE A;  1HNX E;  1FWK A;  4PU9 A;  4JI6 I;  1N36 I;  4DR4 I;  4GKJ E;  4LF9 I;  2Q2E B;  1FNM A;  1BKN A;  4OX9 E;  1H7S A;  4MYT A;  1H72 C;  2E5L I;  3QT6 A;  4LF7 I;  4GKK E;  4NXN E;  5BR8 I;  4LFB I;  1UEK A;  3V2U C;  4WUB A;  4DR3 E;  5GMD A;  4DR7 I;  5FLX C;  1MU5 A;  2ZM6 E;  4LF4 I;  4DV6 E;  1HR0 I;  4DR5 I;  3B82 A;  4DV1 E;  5IWA E;  3QT8 A;  4KHP I;  3LTO A;  1N0V C;  4B3R I;  3WU3 A;  4JI5 E;  4YY3 I;  5A2Q Q;  1Z0V A;  2VQE E;  2V2V A;  2BV3 A;  4X66 I;  4JI1 E;  4JYA E;  4AQY I;  4JI7 I;  4DPY A;  4DV0 I;  1OJ4 A;  4JI6 E;  1N36 E;  3LPS A;  4DV4 E;  4DR4 E;  1N0U A;  4LF9 E;  1VIS A;  3ZZT A;  3T1H I;  4X65 I;  1IBK I;  4JI0 I;  4DU8 A;  1K47 A;  2CZ9 A;  1NZ0 A;  1HNW I;  2V2Z A;  5LMU I;  4DUY I;  1KVK A;  2HKE A;  2E5L E;  1Z5C A;  4LF7 E;  4LF6 I;  5BR8 E;  1J5E I;  2NPF A;  1DAR A;  4X62 I;  4P52 A;  4DR7 E;  4B3S I;  4DUZ E;  4M1K A;  2A2D A;  4LF4 E;  1ZM4 A;  2ZBK B;  4KQV A;  1HR0 E;  4DPX A;  1H7U A;  4FWH A;  3B8H A;  2HK2 A;  2V2Q A;  3JAM Q;  4KHP E;  4B3R E;  1H74 A;  2DEI A;  2UUB I;  3WU6 A;  4DV5 I;  3HUL A;  2UXD I;  4X66 E;  2A2C A;  3LNU A;  4Z7Y A;  4B3T I;  1ZM3 A;  3PYG A;  4K0K I;  3H4L A;  3V5R A;  4AQY E;  4LF8 I;  4JI7 E;  4FW9 A;  4JI8 I;  1Z0T A;  4DV0 E;  1Z59 A;  2HFU A;  1NHI A;  1Z0C A;  1U2R A;  3T1H E;  2BM0 A;  4X65 E;  4JI0 E;  1KTV A;  4DXL A;  3Q1Q A;  3ZZ0 A;  1HNW E;  5LMU E;  1B62 A;  1IBM I;  2LJP A;  2UXB I;  1N33 I;  1XNR I;  4HYM A;  4X64 E;  4LF6 E;  1XNQ I;  4LF5 I;  1XHK A;  2E1R A;  2WW4 A;  4NXM I;  2UUA E;  4DR6 I;  4X62 E;  5IT9 C;  1FWL A;  4JI2 I;  1I94 E;  1N32 I;  2OI2 A;  3J81 C;  1Z0W A;  1Z0B A;  4DR2 E;  1ZM2 A;  1A6F A;  3ZZU A;  3M6A A;  2BM1 A;  2UXC I;  1PVG A;  2UUB E;  4DV5 E;  2X36 A;  1S16 A;  3ZM7 A;  4HY1 A;  5FLX Q;  4LF8 E;  4JI8 E;  2XEX A;  1PIE A;  3J80 C;  4WUD A;  1FJG I;  1RR9 A;  4RPF A;  3ZKD A;  4LFB E;  2GS8 A; 
#chains in the Genus database with same CATH topology
 1H73 A;  4USM A;  2PNL A;  2VF3 A;  1Z0E A;  1XXE A;  3OTO I;  4HXZ A;  1IBM E;  2CG9 A;  2Z5C A;  2UXB E;  3HKM A;  1N33 E;  1E3P A;  2ZM6 I;  1XNR E;  4DV7 I;  4DR5 E;  2O1T A;  2V34 A;  1XNQ E;  4LF5 E;  2JT2 A;  4PRV A;  3PYE A;  1HNZ I;  4DV3 I;  4DR1 I;  4FN5 A;  4DV1 I;  4NXM E;  2BR2 A;  1B63 A;  5DRO A;  1R6L A;  5K36 F;  4YY3 E;  4JI2 E;  4JI5 I;  4P7A A;  1S4E A;  1D6T A;  1ZM9 A;  5GME A;  5JEA C;  1E3H A;  4LCF A;  1N34 I;  2UUC I;  3J7A M;  4LFA I;  2J7K A;  4IFD E;  3U1K A;  4FW6 A;  2VQF I;  2NN6 B;  3CWV A;  4JYA I;  1ZXM A;  4N3O A;  1PKP A;  1YHC A;  5DNX A;  5C0X F;  4LFC I;  3M85 D;  3PS1 A;  3PYD A;  4Z7C A;  4DV4 I;  2PO1 A;  4FW4 A;  4JI4 I;  4BA2 B;  5A2Q C;  1XMO I;  1NHJ A;  2HFS A;  1IBK E;  2WP8 B;  4B3M I;  4EMD A;  4DV2 I;  1R6M A;  2PO2 A;  4URL A;  4LPF A;  1Y5Y A;  4JV5 I;  4DUY E;  5C0X B;  2F4V I;  2HKJ A;  1Y60 A;  4HAC B;  1KIJ A;  1FJG E;  4WUC A;  3B78 A;  4IFD A;  4LCG A;  2C37 A;  2UU9 I;  2O1V A;  2HHH I;  1J5E E;  3K17 A;  4GQU A;  3J7A G;  4LOM A;  1ZXN A;  4JI3 I;  2IES A;  4YHH I;  3OTO E;  4B3S E;  2C38 A;  1NHH A;  4DUZ I;  1XMQ I;  4DV7 E;  2HK3 A;  2R42 A;  4JG4 A;  3L7Z B;  1EA6 A;  3T1Y I;  1EI1 A;  4QNJ A;  2NN6 E;  4DPU A;  5LMN I;  4IFD F;  1HNZ E;  4DV3 E;  4DR1 E;  1ELO A;  1IBL I;  3PYF A;  5DRR A;  5K36 E;  1QZR A;  4I3H A;  1Y4S A;  1HNX I;  2PNZ B;  4ED4 A;  4DPT A;  2IOQ A;  3PS3 A;  1N34 E;  4GKJ I;  2WNR B;  2UUC E;  3ZKB A;  2UXD E;  4LFA E;  4IFD D;  5JEA B;  4B3T E;  4K0K E;  1Z0G A;  3GON A;  1P42 A;  2VQF E;  3K1J A;  4FWD A;  5C0X E;  5L3J A;  3QT5 A;  4LFC E;  4U3B A;  4OX9 I;  3JAM C;  2GQ0 A;  3WU5 A;  4IS9 A;  4MYU A;  2IOP A;  4GKK I;  2PO0 B;  2NN6 A;  4JI4 E;  4NXN I;  1WUU A;  2R3V A;  1MG7 A;  1Z5A A;  5IT9 Q;  1XMO E;  1MX0 A;  5DRQ A;  4ZVI A;  1YH8 A;  4B3M E;  5K36 A;  4DV2 E;  1UDN A;  4DR3 I;  3WU4 A;  4UTG A;  4JV5 E;  1Z5B A;  3D4J A;  3J81 Q;  1FKA E;  2F4V E;  4OO1 B;  4XTJ A;  4BA2 A;  2V8P A;  4DV6 I;  2WP8 A;  4DU7 A;  4X64 I;  4BA1 A;  2UU9 E;  2DEJ A;  2NN6 F;  3H1C A;  2X7I A;  2HHH E;  5DRP A;  5IWA I;  4FWG A;  2EFG A;  4DR6 E;  5C0X A;  2UUA I;  4HAC A;  2F1D A;  4JI3 E;  4UT4 A;  2AJ4 A;  4YHH E;  4R1F A;  1VI7 A;  1KKH A;  1N32 E;  4USK A;  1I94 I;  2VQE I;  2Z5B B;  1XMQ E;  4MU0 A;  5JEA E;  2NN6 D;  3F0N A;  4JI1 I;  4DPW A;  3T1Y E;  5LMN E;  4DR2 I;  2ZIT A;  3QT7 A;  4PRX A;  1IBL E;  2BA0 D;  5LL6 R;  1FI4 A;  3J80 Q;  5K36 D;  2UXC E;  1RRE A;  4LCH A;  2O1W A;  1HNX E;  3B4T A;  1FWK A;  4PU9 A;  4JI6 I;  1N36 I;  4DR4 I;  4J3D A;  4GKJ E;  3Q6N A;  4LF9 I;  2Q2E B;  1FNM A;  4OZE A;  4IFD C;  1OYS A;  4AM3 A;  3DD6 A;  2PNZ A;  5C0X D;  3M85 G;  4OO1 E;  2WNR A;  1BKN A;  4OX9 E;  1H7S A;  4IZJ B;  1H72 C;  4MYT A;  5JEA A;  2E5L I;  3QT6 A;  4LF7 I;  4GKK E;  3P76 A;  4NXN E;  5BR8 I;  4LFB I;  1UEK A;  1OYP A;  3GLL A;  3V2U C;  5FWK A;  4WUB A;  5ELW A;  4DR3 E;  5GMD A;  3P3E A;  2PO0 A;  4DR7 I;  2BR2 B;  4AIM A;  4IZK B;  1MU5 A;  5FLX C;  2ZM6 E;  4LF4 I;  4DV6 E;  3K85 A;  1HR0 I;  1USU A;  5JEA F;  4DR5 I;  4QNK A;  2JE6 B;  3B82 A;  3GME A;  3KRN A;  5IWA E;  4DV1 E;  1USV A;  3QT8 A;  4OO1 A;  4KHP I;  3LTO A;  1N0V C;  4B3R I;  3WU3 A;  4JI5 E;  4YY3 I;  5A2Q Q;  1Z0V A;  3P3C A;  4ISA A;  2VQE E;  5JEA D;  2V2V A;  1Y6Z A;  2BV3 A;  2JEB B;  2NN6 C;  4X66 I;  4JI1 E;  3M7N D;  2IER A;  4FW7 A;  4MU4 A;  4JYA E;  4AQY I;  4NBQ A;  5K36 C;  4JI7 I;  2Z5B A;  4OO1 F;  4DPY A;  4DV0 I;  1OJ4 A;  4JI6 E;  2JEA B;  1N36 E;  3LPS A;  2PO2 B;  1HK7 A;  4DV4 E;  4DR4 E;  1N0U A;  4LF9 E;  1VIS A;  3ZZT A;  4FW3 A;  3T1H I;  4X65 I;  2AE8 A;  1IBK I;  4JI0 I;  4FW5 A;  4DU8 A;  1K47 A;  5C0X C;  3UHM A;  4OO1 D;  2CZ9 A;  1NZ0 A;  1UDQ A;  2V2Z A;  5LMU I;  1HNW I;  4DUY I;  1KVK A;  2HKE A;  2E5L E;  1Z5C A;  4LF7 E;  4LF6 I;  5BR8 E;  1J5E I;  2NPF A;  4IZJ A;  1DAR A;  4X62 I;  4MDT A;  4P52 A;  2GO3 A;  4DR7 E;  2PNM A;  4B3S I;  4DUZ E;  2O1U A;  2A2D A;  4M1K A;  4LF4 E;  1ZM4 A;  2ZBK B;  2C39 B;  4KQV A;  1HR0 E;  4U3D A;  4DPX A;  4FWH A;  1H7U A;  3B8H A;  2HK2 A;  2V2Q A;  3JAM Q;  3U1Y A;  4KHP E;  4IZK A;  3CDJ A;  5DNL A;  4B3R E;  1H74 A;  2DEI A;  2UUB I;  2Z5E A;  3P06 A;  3WU6 A;  4DV5 I;  3L7Z A;  2JE6 A;  3HUL A;  3NZK A;  2UXD I;  4X66 E;  2A2C A;  4Z7Y A;  3LNU A;  4MQY A;  4B3T I;  1ZM3 A;  2BA0 G;  2CGE A;  3PYG A;  4K0K I;  3H4L A;  3V5R A;  4AQY E;  4LF8 I;  4IZJ D;  4JI7 E;  4FW9 A;  4JI8 I;  1Z0T A;  4DV0 E;  5K36 B;  1Y4U A;  2JEB A;  1Z59 A;  2HFU A;  1NHI A;  5EL9 A;  1Z0C A;  2Z5C B;  3PRY A;  1U2R A;  3T1H E;  1UDS A;  2BM0 A;  4X65 E;  1RHY A;  4JI0 E;  1KTV A;  4DXL A;  2JEA A;  3Q1Q A;  3ZZ0 A;  4BA1 B;  4OO1 C;  1HNW E;  5LMU E;  1B62 A;  1IBM I;  2LJP A;  2UXB I;  1N33 I;  1XNR I;  4HYM A;  1UDO A;  4X64 E;  4LF6 E;  1XNQ I;  4LF5 I;  1XHK A;  2E1R A;  2WW4 A;  4NXM I;  2UUA E;  3P3G A;  4DR6 I;  3GCM A;  4X62 E;  5IT9 C;  1FWL A;  4JI2 I;  1I94 E;  1N32 I;  3HJC A;  4MU1 A;  2CVE A;  2OI2 A;  3J81 C;  1Z0W A;  2VES A;  4OKG A;  1Z0B A;  4DR2 E;  2PO1 B;  1ZM2 A;  3PS2 A;  1A6F A;  3ZZU A;  3M6A A;  2BM1 A;  4MU3 A;  2UXC I;  2C39 A;  1PVG A;  3Q6M A;  2UUB E;  2J65 A;  4DV5 E;  2O3Z A;  2X36 A;  1S16 A;  4AID A;  3M7N G;  2BA1 D;  3ZM7 A;  5EKW A;  4HY1 A;  4IFD B;  2C37 B;  5FLX Q;  3CDI A;  1OYR A;  4LF8 E;  4JI8 E;  2XEX A;  1PIE A;  3J80 C;  4WUD A;  1FJG I;  2GO4 A;  1RR9 A;  4RPF A;  2BA1 G;  2C38 B;  3ZKD A;  4LFB E;  2GS8 A; 
#chains in the Genus database with same CATH homology
 1H73 A;  4USM A;  2PNL A;  2VF3 A;  1Z0E A;  3OTO I;  4HXZ A;  1IBM E;  2CG9 A;  2Z5C A;  2UXB E;  1N33 E;  2ZM6 I;  1XNR E;  4DV7 I;  4DR5 E;  2O1T A;  2V34 A;  1XNQ E;  4LF5 E;  4PRV A;  3PYE A;  1HNZ I;  4DV3 I;  4DR1 I;  4FN5 A;  4DV1 I;  4NXM E;  1B63 A;  4YY3 E;  4JI2 E;  4JI5 I;  4P7A A;  1S4E A;  1D6T A;  1ZM9 A;  5GME A;  1N34 I;  2UUC I;  3J7A M;  4LFA I;  2J7K A;  2VQF I;  3CWV A;  4JYA I;  1ZXM A;  4N3O A;  1PKP A;  4LFC I;  3PYD A;  4Z7C A;  4DV4 I;  4JI4 I;  5A2Q C;  1XMO I;  1NHJ A;  2HFS A;  1IBK E;  4B3M I;  4EMD A;  4DV2 I;  4URL A;  4JV5 I;  4DUY E;  2F4V I;  2HKJ A;  4HAC B;  1KIJ A;  1FJG E;  4WUC A;  3B78 A;  2UU9 I;  2O1V A;  2HHH I;  1J5E E;  3K17 A;  3J7A G;  1ZXN A;  4JI3 I;  4YHH I;  3OTO E;  4B3S E;  1NHH A;  4DUZ I;  1XMQ I;  4DV7 E;  2HK3 A;  2R42 A;  4JG4 A;  1EA6 A;  3T1Y I;  1EI1 A;  5LMN I;  4DPU A;  1HNZ E;  4DV3 E;  4DR1 E;  1ELO A;  1IBL I;  3PYF A;  1QZR A;  4I3H A;  1Y4S A;  1HNX I;  4ED4 A;  4DPT A;  2IOQ A;  1N34 E;  4GKJ I;  2UUC E;  3ZKB A;  2UXD E;  4LFA E;  4B3T E;  4K0K E;  1Z0G A;  3GON A;  2VQF E;  3K1J A;  4FWD A;  5L3J A;  3QT5 A;  4LFC E;  4OX9 I;  3JAM C;  2GQ0 A;  3WU5 A;  4MYU A;  2IOP A;  4GKK I;  4JI4 E;  4NXN I;  1WUU A;  2R3V A;  1Z5A A;  1MG7 A;  5IT9 Q;  1XMO E;  1MX0 A;  4ZVI A;  4B3M E;  4DV2 E;  4DR3 I;  3WU4 A;  4UTG A;  4JV5 E;  1Z5B A;  3D4J A;  3J81 Q;  1FKA E;  2F4V E;  4XTJ A;  2V8P A;  4DV6 I;  4DU7 A;  4X64 I;  2UU9 E;  2DEJ A;  2X7I A;  2HHH E;  5IWA I;  4FWG A;  2EFG A;  4DR6 E;  2UUA I;  4HAC A;  4JI3 E;  4UT4 A;  2AJ4 A;  4YHH E;  4R1F A;  1KKH A;  1N32 E;  4USK A;  1I94 I;  2VQE I;  2Z5B B;  1XMQ E;  3F0N A;  4JI1 I;  4DPW A;  3T1Y E;  5LMN E;  4DR2 I;  2ZIT A;  3QT7 A;  4PRX A;  1IBL E;  3J80 Q;  5LL6 R;  1FI4 A;  2UXC E;  1RRE A;  2O1W A;  1HNX E;  1FWK A;  4PU9 A;  4JI6 I;  1N36 I;  4DR4 I;  4GKJ E;  3Q6N A;  4LF9 I;  2Q2E B;  1FNM A;  1BKN A;  4OX9 E;  1H7S A;  4IZJ B;  1H72 C;  4MYT A;  2E5L I;  3QT6 A;  4LF7 I;  4GKK E;  4NXN E;  5BR8 I;  4LFB I;  1UEK A;  3V2U C;  5FWK A;  4WUB A;  4DR3 E;  5GMD A;  4DR7 I;  4IZK B;  1MU5 A;  5FLX C;  2ZM6 E;  4LF4 I;  4DV6 E;  3K85 A;  1HR0 I;  1USU A;  4DR5 I;  3B82 A;  4DV1 E;  5IWA E;  1USV A;  3QT8 A;  4KHP I;  3LTO A;  1N0V C;  4B3R I;  3WU3 A;  4JI5 E;  4YY3 I;  5A2Q Q;  1Z0V A;  2VQE E;  2V2V A;  1Y6Z A;  2BV3 A;  4X66 I;  4JI1 E;  4JYA E;  4AQY I;  4JI7 I;  2Z5B A;  4DPY A;  4DV0 I;  1OJ4 A;  4JI6 E;  1N36 E;  3LPS A;  1HK7 A;  4DV4 E;  4DR4 E;  1N0U A;  4LF9 E;  1VIS A;  3ZZT A;  3T1H I;  4X65 I;  1IBK I;  4JI0 I;  4DU8 A;  1K47 A;  2CZ9 A;  1NZ0 A;  1HNW I;  2V2Z A;  5LMU I;  4DUY I;  1KVK A;  2HKE A;  2E5L E;  1Z5C A;  4LF7 E;  4LF6 I;  5BR8 E;  1J5E I;  2NPF A;  4IZJ A;  1DAR A;  4X62 I;  4P52 A;  4DR7 E;  2PNM A;  4B3S I;  4DUZ E;  2O1U A;  2A2D A;  4M1K A;  4LF4 E;  1ZM4 A;  2ZBK B;  4KQV A;  1HR0 E;  4DPX A;  1H7U A;  4FWH A;  3B8H A;  2HK2 A;  2V2Q A;  3JAM Q;  4KHP E;  4IZK A;  4B3R E;  1H74 A;  2DEI A;  2UUB I;  2Z5E A;  3P06 A;  3WU6 A;  4DV5 I;  3HUL A;  2UXD I;  4X66 E;  2A2C A;  3LNU A;  4Z7Y A;  4B3T I;  1ZM3 A;  2CGE A;  3PYG A;  4K0K I;  3H4L A;  3V5R A;  4AQY E;  4LF8 I;  4IZJ D;  4JI7 E;  4FW9 A;  4JI8 I;  1Z0T A;  4DV0 E;  1Y4U A;  1Z59 A;  2HFU A;  1NHI A;  1Z0C A;  2Z5C B;  3PRY A;  1U2R A;  3T1H E;  2BM0 A;  4X65 E;  4JI0 E;  1KTV A;  4DXL A;  3Q1Q A;  3ZZ0 A;  1HNW E;  5LMU E;  1B62 A;  1IBM I;  2LJP A;  2UXB I;  1N33 I;  1XNR I;  4HYM A;  4X64 E;  4LF6 E;  1XNQ I;  4LF5 I;  1XHK A;  2E1R A;  2WW4 A;  4NXM I;  2UUA E;  4DR6 I;  4X62 E;  5IT9 C;  1FWL A;  4JI2 I;  1I94 E;  1N32 I;  3HJC A;  2OI2 A;  3J81 C;  1Z0W A;  1Z0B A;  4DR2 E;  1ZM2 A;  1A6F A;  3ZZU A;  3M6A A;  2BM1 A;  2UXC I;  1PVG A;  3Q6M A;  2UUB E;  4DV5 E;  2X36 A;  1S16 A;  3ZM7 A;  4HY1 A;  5FLX Q;  4LF8 E;  4JI8 E;  2XEX A;  1PIE A;  3J80 C;  4WUD A;  1FJG I;  1RR9 A;  4RPF A;  3ZKD A;  4LFB E;  2GS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...