4K0KI

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4k0kI00
1PVGA 1Z59A 1VISA 4WUDA 4YY3I 1Z0EA 4X62I 4JI3E 1HNZI 4UT4A 1N32I 1ZXNA 1N33I 1N0VC 3HULA 4DR3E 5A2QQ 4JI2I 1H74A 1I94I 3V2UC 1KTVA 3PYEA 3ZZTA 4NXNE 3F0NA 2UXBE 3PYDA 2X7IA 4RPFA 1XMOI 1RREA 3J81C 4Z7YA 4JI5I 1NZ0A 4LFBI 4GKKI 2E1RA 4XTJA 1FNMA 2HFUA 1N36E 4DR6E 4LF4I 2AJ4A 4JI0I 4DPUA 4UTGA 4ED4A 4HYMA 1XMQE 1IBKI 1PIEA 2UXCE 5BR8E 3J7AG 3ZZUA 1OJ4A 2ZM6I 3LTOA 1HR0I 2UXDI 2BM1A 1FJGI 2OI2A 4B3RE 2HKEA 1FWLA 2LJPA 4KHPE 4DR5I 4DV3I 2V2QA 2F4VI 4WUCA 1XNQE 1HNWE 4JI6E 4B3SI 4JI7I 1XNRI 4DR1I 3ZKBA 1N34E 4P52A 4PU9A 3Q1QA 3T1YI 3LPSA 4JI1E 4AQYE 2HHHI 2UUAE 3K1JA 4DUZI 4DR2I 4M1KA 3J81Q 1Z0VA 3QT7A 1IBLE 1HNXI 4X65E 4K0KE 4KQVA 4LF9E 2J7KA 1S16A 4JI3I 4LF7E 5LMUE 4DU7A 5LMNE 4DV0E 4DUYE 4JV5E 4NXNI 1Z5BA 2UXBI 2ZITA 4B3TE 4FN5A 2E5LI 1Z0CA 4X64I 4LF8E 1EA6A 4MYUA 4MYTA 1N36I 1Z0WA 3LNUA 4DV4E 1NHHA 2NPFA 1XMQI 1ZM9A 4JI4E 3QT6A 4R1FA 4JI8E 2Q2EB 4X66E 2UXCI 1J5EE 5BR8I 3WU5A 4NXME 3WU6A 2VQFI 4DV1E 1ELOA 4DV5E 1ZM4A 4DV6I 4DR7E 4ZVIA 1H73A 3ZM7A 5GMEA 4B3RI 3B78A 3WU3A 4KHPI 5GMDA 4LF6E 1XNQI 1HNWI 1HNZE 1N32E 2R3VA 1KIJA 1N34I 4URLA 4FWHA 1ZM2A 4GKJE 4AQYI 2X36A 1PKPA 2VF3A 2UUAI 3PYGA 3OTOE 1H7SA 4LF5I 1IBLI 4X65I 4DV7E 1Z5CA 4LFCE 4JI5E 2WW4A 4K0KI 3ZKDA 4LFBE 4B3ME 2UUBE 2UUCE 1QZRA 1FWKA 2HK2A 4LF4E 4LF7I 4JI0E 3QT5A 2XEXA 3V5RA 4DR4E 5LMNI 4DV2E 1IBKE 2GS8A 4DV0I 1MU5A 1BKNA 4YHHE 4JV5I 4USKA 2UXDE 4DPXA 4JYAE 1N0UA 4B3TI 1FJGE 1MG7A 3H4LA 2A2CA 1IBME 1U2RA 4LF8I 4HY1A 4DV4I 4DR3I 4USMA 2A2DA 2F4VE 5IWAE 4B3SE 4DU8A 4JI4I 1NHJA 4JI8I 2UU9E 4X66I 4WUBA 1J5EI 4NXMI 3B8HA 3PYFA 2V2ZA 3B82A 1ZXMA 3T1HE 5IT9C 4DV1I 4I3HA 4DV5I 1FI4A 4DR6I 4DR7I 4DR2E 1HNXE 4DPYA 3J7AM 4PRXA 3WU4A 4OX9E 1KVKA 3K17A 4LF6I 2ZBKB 1RR9A 1A6FA 3QT8A 1EI1A 3J80C 2HKJA 4EMDA 3JAMC 3ZZ0A 4GKJI 2BM0A 4HXZA 4LFAE 1WUUA 2V8PA 2VQEE 4DPWA 4Z7CA 3OTOI 1UEKA 4YY3E 1B62A 4FW9A 4DV7I 2E5LE 4DXLA 4X62E 4LFCI 4JI6I 1H7UA 4X64E 4B3MI 4HACB 4PRVA 2UUBI 1N33E 2UUCI 5L3JA 5FLXC 1B63A 4JI2E 1I94E 4JI1I 4DR4I 4DV2I 1NHIA 1KKHA 1XMOE 1K47A 2BV3A 4YHHI 1S4EA 4FWGA 4JYAI 2VQFE 4JG4A 4GKKE 5IT9Q 4LF9I 1Z5AA 2V34A 2R42A 4DV6E 1FKAE 2HFSA 1IBMI 5LMUI 3M6AA 4P7AA 5A2QC 5IWAI 4DUYI 3CWVA 2HK3A 2CZ9A 3J80Q 2ZM6E 1HR0E 2UU9I 1XHKA 3JAMQ 3T1HI 4FWDA 4HACA 1Z0BA 3D4JA 4LF5E 4DR5E 1DARA 4DV3E 3GONA 4OX9I 4JI7E 1H72C 1ZM3A 1XNRE 2V2VA 4DR1E 1Z0GA 1D6TA 5LL6R 1Z0TA 3T1YE 5FLXQ 2HHHE 4DUZE 2DEIA 4LFAI 4DPTA 2EFGA 2VQEI 1MX0A 2DEJA
chains in the Genus database with same CATH superfamily
1PVGA 1Z59A 1USVA 4QNJA 4N3OA 1VISA 4WUDA 4YY3I 4OO1D 2IOQA 2GO4A 1Z0EA 2C38A 4X62I 4JI3E 1HNZI 4UT4A 1N32I 1ZXNA 1UDOA 4FW3A 1N33I 1Y6ZA 1N0VC 3HULA 2NN6B 4DR3E 5A2QQ 4LOMA 1VI7A 4JI2I 1H74A 1I94I 2PO1A 3V2UC 1KTVA 3PYEA 3ZZTA 4NXNE 4IZJA 3DD6A 3F0NA 3PYDA 2UXBE 2X7IA 4RPFA 5K36D 5JEAF 1XMOI 1RREA 3J81C 3PS2A 5DRPA 4Z7YA 2PNZA 5DROA 4BA1A 1Y4UA 4JI5I 1NZ0A 2PNLA 2C39B 4LFBI 4GKKI 2E1RA 4XTJA 2BA1D 1FNMA 2HFUA 1N36E 4DR6E 4LF4I 2AJ4A 4JI0I 4DPUA 4UTGA 2CVEA 4ED4A 2NN6C 4HYMA 1XMQE 2JEAA 1IBKI 1PIEA 2AE8A 1R6MA 2UXCE 5JEAB 2CGEA 2IERA 5BR8E 3J7AG 1USUA 3ZZUA 4IFDE 1OJ4A 2PO2B 3LTOA 4AIDA 2ZM6I 1HR0I 2BM1A 2UXDI 2F1DA 1FJGI 2OI2A 2WP8B 4B3RE 2HKEA 1FWLA 2LJPA 4OKGA 4KHPE 2Z5EA 1HK7A 4DR5I 2NN6A 4DV3I 2V2QA 2F4VI 4WUCA 1XNQE 3U1KA 1HNWE 5JEAC 4JI6E 4B3SI 2BA0D 4JI7I 1XNRI 4DR1I 3ZKBA 1N34E 4P52A 4PU9A 3Q1QA 3GMEA 3T1YI 3LPSA 2PO1B 4JI1E 5C0XD 2GO3A 4AQYE 2HHHI 4IZJB 4U3DA 2UUAE 3K1JA 4DUZI 2BA1G 4M1KA 4DR2I 3J81Q 1Z0VA 3QT7A 1IBLE 1HNXI 4X65E 4IFDA 4K0KE 4KQVA 4LF9E 1UDQA 2J7KA 1S16A 4JI3I 4LF7E 5JEAA 1RHYA 5LMUE 3P3EA 4DU7A 4IZKB 2PO2A 5LMNE 2NN6D 4DV0E 1UDSA 4DUYE 2WP8A 4J3DA 4JV5E 4NXNI 1Z5BA 2UXBI 2ZITA 1OYRA 1P42A 4B3TE 2CG9A 4LCHA 4FN5A 2E5LI 1Z0CA 5DRQA 4X64I 4LF8E 1EA6A 4MYUA 4MYTA 2BA0G 1N36I 1Z0WA 3LNUA 4MU0A 4DV4E 4IFDF 1NHHA 2NPFA 3B4TA 1XMQI 1ZM9A 4JI4E 3QT6A 4R1FA 4JI8E 2C37A 2Q2EB 4LCGA 4X66E 2UXCI 2JT2A 1J5EE 5BR8I 3WU5A 1YH8A 4NXME 3M85D 3WU6A 1Y5YA 2VQFI 4DV1E 1ELOA 4FW7A 1ZM4A 4DV5E 3H1CA 4AIMA 4DV6I 4DR7E 4ZVIA 1H73A 3ZM7A 5GMEA 4B3RI 5ELWA 4IFDB 3B78A 5DNXA 3WU3A 4IZKA 4KHPI 2O1UA 5GMDA 4LF6E 1XNQI 1HNWI 1HNZE 1N32E 2R3VA 1KIJA 1N34I 4URLA 4OO1E 3K85A 4FWHA 1ZM2A 4GKJE 4QNKA 4LCFA 1OYPA 2GQ0A 4AQYI 3CDJA 2X36A 4IZJD 1PKPA 2VF3A 2UUAI 4IFDC 3PYGA 1H7SA 3OTOE 2O1WA 4LF5I 1IBLI 4GQUA 4X65I 3GCMA 1Z5CA 4DV7E 5DNLA 2WNRB 4LFCE 4JI5E 2WW4A 4FW6A 5EL9A 4K0KI 3P76A 3P06A 3ZKDA 4LFBE 4B3ME 3P3GA 2UUBE 5K36E 2UUCE 1QZRA 1FWKA 2PO0A 2HK2A 4LF4E 4LF7I 4JI0E 1OYSA 3QT5A 3Q6MA 2XEXA 3V5RA 2JEBB 3M85G 4DR4E 4OZEA 5LMNI 4DV2E 1IBKE 2C37B 2GS8A 4DV0I 3P3CA 1MU5A 1BKNA 4YHHE 4JV5I 4USKA 3Q6NA 2UXDE 4DPXA 4JYAE 1N0UA 4B3TI 4OO1A 4MU3A 1FJGE 1XXEA 1MG7A 3H4LA 5C0XF 1YHCA 2O1TA 2A2CA 1IBME 1U2RA 4LF8I 4HY1A 3HJCA 4DV4I 4DR3I 4USMA 2A2DA 2F4VE 5IWAE 4MDTA 4B3SE 3CDIA 4DU8A 4JI4I 1NHJA 4JI8I 2UU9E 4X66I 1E3HA 4WUBA 1J5EI 4MU1A 4NXMI 3B8HA 3PYFA 2V2ZA 3B82A 2WNRA 1ZXMA 3KRNA 5C0XB 3T1HE 5IT9C 4DV1I 4I3HA 4DV5I 2PNMA 3M7ND 1FI4A 4DR6I 4DR7I 2BR2A 4DR2E 3PS3A 1HNXE 4OO1F 4IFDD 4DPYA 3J7AM 4PRXA 5C0XE 3GLLA 3WU4A 4OX9E 1KVKA 2JEBA 3K17A 4BA2A 1R6LA 2PO0B 4LF6I 1Y4SA 2O3ZA 2ZBKB 1RR9A 1A6FA 2Z5BB 3QT8A 5JEAD 1EI1A 3J80C 5C0XC 2HKJA 4EMDA 3JAMC 3ZZ0A 4GKJI 2BM0A 4HXZA 4FW5A 3PS1A 4MQYA 4LFAE 1WUUA 2IESA 2V8PA 4DPWA 2VQEE 5K36F 2Z5CA 2JE6A 4Z7CA 4OO1B 3OTOI 1UEKA 4IS9A 4YY3E 1B62A 1UDNA 2NN6E 4FW9A 4DV7I 3L7ZA 2E5LE 4DXLA 4X62E 4LFCI 1E3PA 4JI6I 1H7UA 4X64E 4B3MI 4HACB 4PRVA 2UUBI 1N33E 2UUCI 3PRYA 4LPFA 5L3JA 5FLXC 1B63A 2O1VA 4JI2E 3U1YA 1Y60A 1I94E 4NBQA 4JI1I 4DR4I 5C0XA 2J65A 4DV2I 4ISAA 4U3BA 1NHIA 5K36B 4OO1C 1KKHA 1XMOE 3M7NG 1K47A 2BV3A 4YHHI 1S4EA 4FWGA 4JYAI 2VQFE 4JG4A 4GKKE 5IT9Q 4LF9I 1Z5AA 5DRRA 2BR2B 2R42A 2V34A 4DV6E 1FKAE 2HFSA 5JEAE 1IBMI 2Z5BA 5LMUI 3M6AA 4P7AA 4BA2B 2C38B 5A2QC 5K36C 5IWAI 4DUYI 3CWVA 2HK3A 2CZ9A 3J80Q 2ZM6E 1HR0E 2UU9I 1XHKA 3JAMQ 4MU4A 3T1HI 2C39A 5FWKA 2Z5CB 4FWDA 4HACA 2JE6B 1Z0BA 3D4JA 4LF5E 2IOPA 3L7ZB 1DARA 4DR5E 2PNZB 3HKMA 4DV3E 4BA1B 3GONA 4OX9I 4FW4A 1H72C 4JI7E 1ZM3A 1XNRE 2V2VA 4DR1E 1Z0GA 5K36A 4AM3A 3UHMA 1D6TA 5LL6R 1Z0TA 3NZKA 3T1YE 5FLXQ 2JEAB 2VESA 2NN6F 2HHHE 4DUZE 5EKWA 2DEIA 4LFAI 4DPTA 2EFGA 2VQEI 1MX0A 2DEJA
chains in the Genus database with same CATH topology
1PVGA 1Z59A 1USVA 4N3OA 1VISA 4WUDA 4YY3I 2IOQA 1Z0EA 4X62I 4JI3E 1HNZI 4UT4A 1N32I 1ZXNA 1N33I 1Y6ZA 1N0VC 3HULA 4DR3E 5A2QQ 4JI2I 1H74A 1I94I 3V2UC 1KTVA 3PYEA 3ZZTA 4NXNE 4IZJA 3F0NA 2UXBE 3PYDA 2X7IA 4RPFA 1XMOI 1RREA 3J81C 4Z7YA 1Y4UA 4JI5I 1NZ0A 2PNLA 4LFBI 4GKKI 2E1RA 4XTJA 1FNMA 2HFUA 1N36E 4DR6E 4LF4I 2AJ4A 4JI0I 4DPUA 4UTGA 4ED4A 4HYMA 1XMQE 1IBKI 1PIEA 2UXCE 2CGEA 5BR8E 3J7AG 1USUA 3ZZUA 1OJ4A 2ZM6I 3LTOA 1HR0I 2UXDI 2BM1A 1FJGI 2OI2A 4B3RE 2HKEA 1FWLA 2LJPA 4KHPE 2Z5EA 1HK7A 4DR5I 4DV3I 2V2QA 2F4VI 4WUCA 1XNQE 1HNWE 4JI6E 4B3SI 4JI7I 1XNRI 4DR1I 3ZKBA 1N34E 4P52A 4PU9A 3Q1QA 3T1YI 3LPSA 4JI1E 4AQYE 2HHHI 4IZJB 2UUAE 3K1JA 4DUZI 4DR2I 4M1KA 3J81Q 1Z0VA 3QT7A 1IBLE 1HNXI 4X65E 4K0KE 4KQVA 4LF9E 2J7KA 1S16A 4JI3I 4LF7E 5LMUE 4DU7A 4IZKB 5LMNE 4DV0E 4DUYE 4JV5E 4NXNI 1Z5BA 2UXBI 2ZITA 4B3TE 2CG9A 4FN5A 2E5LI 1Z0CA 4X64I 4LF8E 1EA6A 4MYUA 4MYTA 1N36I 1Z0WA 3LNUA 4DV4E 1NHHA 2NPFA 1XMQI 1ZM9A 4JI4E 3QT6A 4R1FA 4JI8E 2Q2EB 4X66E 2UXCI 1J5EE 5BR8I 3WU5A 4NXME 3WU6A 2VQFI 4DV1E 1ELOA 4DV5E 1ZM4A 4DV6I 4DR7E 4ZVIA 1H73A 3ZM7A 5GMEA 4B3RI 3B78A 3WU3A 4IZKA 4KHPI 2O1UA 5GMDA 4LF6E 1XNQI 1HNWI 1HNZE 1N32E 2R3VA 1KIJA 1N34I 4URLA 3K85A 4FWHA 1ZM2A 4GKJE 2GQ0A 4AQYI 2X36A 4IZJD 1PKPA 2VF3A 2UUAI 3PYGA 3OTOE 1H7SA 2O1WA 4LF5I 1IBLI 4X65I 4DV7E 1Z5CA 4LFCE 4JI5E 2WW4A 4K0KI 3P06A 3ZKDA 4LFBE 4B3ME 2UUBE 2UUCE 1QZRA 1FWKA 2HK2A 4LF4E 4LF7I 4JI0E 3QT5A 3Q6MA 2XEXA 3V5RA 4DR4E 5LMNI 4DV2E 1IBKE 2GS8A 4DV0I 1MU5A 1BKNA 4YHHE 4JV5I 4USKA 3Q6NA 2UXDE 4DPXA 4JYAE 1N0UA 4B3TI 1FJGE 1MG7A 3H4LA 2O1TA 2A2CA 1IBME 1U2RA 4LF8I 4HY1A 3HJCA 4DV4I 4DR3I 4USMA 2A2DA 2F4VE 5IWAE 4B3SE 4DU8A 4JI4I 1NHJA 4JI8I 2UU9E 4X66I 4WUBA 1J5EI 4NXMI 3B8HA 3PYFA 2V2ZA 3B82A 1ZXMA 3T1HE 5IT9C 4DV1I 4I3HA 4DV5I 2PNMA 1FI4A 4DR6I 4DR7I 4DR2E 1HNXE 4DPYA 3J7AM 4PRXA 3WU4A 4OX9E 1KVKA 3K17A 4LF6I 1Y4SA 2ZBKB 1RR9A 1A6FA 2Z5BB 3QT8A 1EI1A 3J80C 2HKJA 4EMDA 3JAMC 3ZZ0A 4GKJI 2BM0A 4HXZA 4LFAE 1WUUA 2V8PA 2VQEE 4DPWA 2Z5CA 4Z7CA 3OTOI 1UEKA 4YY3E 1B62A 4FW9A 4DV7I 2E5LE 4DXLA 4X62E 4LFCI 4JI6I 1H7UA 4X64E 4B3MI 4HACB 4PRVA 2UUBI 1N33E 2UUCI 3PRYA 5L3JA 5FLXC 1B63A 2O1VA 4JI2E 1I94E 4JI1I 4DR4I 4DV2I 1NHIA 1KKHA 1XMOE 1K47A 2BV3A 4YHHI 1S4EA 4FWGA 4JYAI 2VQFE 4JG4A 4GKKE 5IT9Q 4LF9I 1Z5AA 2V34A 2R42A 4DV6E 1FKAE 2HFSA 1IBMI 2Z5BA 5LMUI 3M6AA 4P7AA 5A2QC 5IWAI 4DUYI 3CWVA 2HK3A 2CZ9A 3J80Q 2ZM6E 1HR0E 2UU9I 1XHKA 3JAMQ 3T1HI 5FWKA 2Z5CB 4FWDA 4HACA 1Z0BA 3D4JA 4LF5E 2IOPA 4DR5E 1DARA 4DV3E 3GONA 4OX9I 4JI7E 1H72C 1ZM3A 1XNRE 2V2VA 4DR1E 1Z0GA 1D6TA 5LL6R 1Z0TA 3T1YE 5FLXQ 2HHHE 4DUZE 2DEIA 4LFAI 4DPTA 2EFGA 2VQEI 1MX0A 2DEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVG A;  1Z59 A;  1VIS A;  4WUD A;  4YY3 I;  1Z0E A;  4X62 I;  4JI3 E;  1HNZ I;  4UT4 A;  1N32 I;  1ZXN A;  1N33 I;  1N0V C;  3HUL A;  4DR3 E;  5A2Q Q;  4JI2 I;  1H74 A;  1I94 I;  3V2U C;  1KTV A;  3PYE A;  3ZZT A;  4NXN E;  3F0N A;  2UXB E;  3PYD A;  2X7I A;  4RPF A;  1XMO I;  1RRE A;  3J81 C;  4Z7Y A;  4JI5 I;  1NZ0 A;  4LFB I;  4GKK I;  2E1R A;  4XTJ A;  1FNM A;  2HFU A;  1N36 E;  4DR6 E;  4LF4 I;  2AJ4 A;  4JI0 I;  4DPU A;  4UTG A;  4ED4 A;  4HYM A;  1XMQ E;  1IBK I;  1PIE A;  2UXC E;  5BR8 E;  3J7A G;  3ZZU A;  1OJ4 A;  2ZM6 I;  3LTO A;  1HR0 I;  2UXD I;  2BM1 A;  1FJG I;  2OI2 A;  4B3R E;  2HKE A;  1FWL A;  2LJP A;  4KHP E;  4DR5 I;  4DV3 I;  2V2Q A;  2F4V I;  4WUC A;  1XNQ E;  1HNW E;  4JI6 E;  4B3S I;  4JI7 I;  1XNR I;  4DR1 I;  3ZKB A;  1N34 E;  4P52 A;  4PU9 A;  3Q1Q A;  3T1Y I;  3LPS A;  4JI1 E;  4AQY E;  2HHH I;  2UUA E;  3K1J A;  4DUZ I;  4DR2 I;  4M1K A;  3J81 Q;  1Z0V A;  3QT7 A;  1IBL E;  1HNX I;  4X65 E;  4K0K E;  4KQV A;  4LF9 E;  2J7K A;  1S16 A;  4JI3 I;  4LF7 E;  5LMU E;  4DU7 A;  5LMN E;  4DV0 E;  4DUY E;  4JV5 E;  4NXN I;  1Z5B A;  2UXB I;  2ZIT A;  4B3T E;  4FN5 A;  2E5L I;  1Z0C A;  4X64 I;  4LF8 E;  1EA6 A;  4MYU A;  4MYT A;  1N36 I;  1Z0W A;  3LNU A;  4DV4 E;  1NHH A;  2NPF A;  1XMQ I;  1ZM9 A;  4JI4 E;  3QT6 A;  4R1F A;  4JI8 E;  2Q2E B;  4X66 E;  2UXC I;  1J5E E;  5BR8 I;  3WU5 A;  4NXM E;  3WU6 A;  2VQF I;  4DV1 E;  1ELO A;  4DV5 E;  1ZM4 A;  4DV6 I;  4DR7 E;  4ZVI A;  1H73 A;  3ZM7 A;  5GME A;  4B3R I;  3B78 A;  3WU3 A;  4KHP I;  5GMD A;  4LF6 E;  1XNQ I;  1HNW I;  1HNZ E;  1N32 E;  2R3V A;  1KIJ A;  1N34 I;  4URL A;  4FWH A;  1ZM2 A;  4GKJ E;  4AQY I;  2X36 A;  1PKP A;  2VF3 A;  2UUA I;  3PYG A;  3OTO E;  1H7S A;  4LF5 I;  1IBL I;  4X65 I;  4DV7 E;  1Z5C A;  4LFC E;  4JI5 E;  2WW4 A;  4K0K I;  3ZKD A;  4LFB E;  4B3M E;  2UUB E;  2UUC E;  1QZR A;  1FWK A;  2HK2 A;  4LF4 E;  4LF7 I;  4JI0 E;  3QT5 A;  2XEX A;  3V5R A;  4DR4 E;  5LMN I;  4DV2 E;  1IBK E;  2GS8 A;  4DV0 I;  1MU5 A;  1BKN A;  4YHH E;  4JV5 I;  4USK A;  2UXD E;  4DPX A;  4JYA E;  1N0U A;  4B3T I;  1FJG E;  1MG7 A;  3H4L A;  2A2C A;  1IBM E;  1U2R A;  4LF8 I;  4HY1 A;  4DV4 I;  4DR3 I;  4USM A;  2A2D A;  2F4V E;  5IWA E;  4B3S E;  4DU8 A;  4JI4 I;  1NHJ A;  4JI8 I;  2UU9 E;  4X66 I;  4WUB A;  1J5E I;  4NXM I;  3B8H A;  3PYF A;  2V2Z A;  3B82 A;  1ZXM A;  3T1H E;  5IT9 C;  4DV1 I;  4I3H A;  4DV5 I;  1FI4 A;  4DR6 I;  4DR7 I;  4DR2 E;  1HNX E;  4DPY A;  3J7A M;  4PRX A;  3WU4 A;  4OX9 E;  1KVK A;  3K17 A;  4LF6 I;  2ZBK B;  1RR9 A;  1A6F A;  3QT8 A;  1EI1 A;  3J80 C;  2HKJ A;  4EMD A;  3JAM C;  3ZZ0 A;  4GKJ I;  2BM0 A;  4HXZ A;  4LFA E;  1WUU A;  2V8P A;  2VQE E;  4DPW A;  4Z7C A;  3OTO I;  1UEK A;  4YY3 E;  1B62 A;  4FW9 A;  4DV7 I;  2E5L E;  4DXL A;  4X62 E;  4LFC I;  4JI6 I;  1H7U A;  4X64 E;  4B3M I;  4HAC B;  4PRV A;  2UUB I;  1N33 E;  2UUC I;  5L3J A;  5FLX C;  1B63 A;  4JI2 E;  1I94 E;  4JI1 I;  4DR4 I;  4DV2 I;  1NHI A;  1KKH A;  1XMO E;  1K47 A;  2BV3 A;  4YHH I;  1S4E A;  4FWG A;  4JYA I;  2VQF E;  4JG4 A;  4GKK E;  5IT9 Q;  4LF9 I;  1Z5A A;  2V34 A;  2R42 A;  4DV6 E;  1FKA E;  2HFS A;  1IBM I;  5LMU I;  3M6A A;  4P7A A;  5A2Q C;  5IWA I;  4DUY I;  3CWV A;  2HK3 A;  2CZ9 A;  3J80 Q;  2ZM6 E;  1HR0 E;  2UU9 I;  1XHK A;  3JAM Q;  3T1H I;  4FWD A;  4HAC A;  1Z0B A;  3D4J A;  4LF5 E;  4DR5 E;  1DAR A;  4DV3 E;  3GON A;  4OX9 I;  4JI7 E;  1H72 C;  1ZM3 A;  1XNR E;  2V2V A;  4DR1 E;  1Z0G A;  1D6T A;  5LL6 R;  1Z0T A;  3T1Y E;  5FLX Q;  2HHH E;  4DUZ E;  2DEI A;  4LFA I;  4DPT A;  2EFG A;  2VQE I;  1MX0 A;  2DEJ A; 
#chains in the Genus database with same CATH topology
 1PVG A;  1Z59 A;  1USV A;  4QNJ A;  4N3O A;  1VIS A;  4WUD A;  4YY3 I;  4OO1 D;  2IOQ A;  2GO4 A;  1Z0E A;  2C38 A;  4X62 I;  4JI3 E;  1HNZ I;  4UT4 A;  1N32 I;  1ZXN A;  1UDO A;  4FW3 A;  1N33 I;  1Y6Z A;  1N0V C;  3HUL A;  2NN6 B;  4DR3 E;  5A2Q Q;  4LOM A;  1VI7 A;  4JI2 I;  1H74 A;  1I94 I;  2PO1 A;  3V2U C;  1KTV A;  3PYE A;  3ZZT A;  4NXN E;  4IZJ A;  3DD6 A;  3F0N A;  3PYD A;  2UXB E;  2X7I A;  4RPF A;  5K36 D;  5JEA F;  1XMO I;  1RRE A;  3J81 C;  3PS2 A;  5DRP A;  4Z7Y A;  2PNZ A;  5DRO A;  4BA1 A;  1Y4U A;  4JI5 I;  1NZ0 A;  2PNL A;  2C39 B;  4LFB I;  4GKK I;  2E1R A;  4XTJ A;  2BA1 D;  1FNM A;  2HFU A;  1N36 E;  4DR6 E;  4LF4 I;  2AJ4 A;  4JI0 I;  4DPU A;  4UTG A;  2CVE A;  4ED4 A;  2NN6 C;  4HYM A;  1XMQ E;  2JEA A;  1IBK I;  1PIE A;  2AE8 A;  1R6M A;  2UXC E;  5JEA B;  2CGE A;  2IER A;  5BR8 E;  3J7A G;  1USU A;  3ZZU A;  4IFD E;  1OJ4 A;  2PO2 B;  3LTO A;  4AID A;  2ZM6 I;  1HR0 I;  2BM1 A;  2UXD I;  2F1D A;  1FJG I;  2OI2 A;  2WP8 B;  4B3R E;  2HKE A;  1FWL A;  2LJP A;  4OKG A;  4KHP E;  2Z5E A;  1HK7 A;  4DR5 I;  2NN6 A;  4DV3 I;  2V2Q A;  2F4V I;  4WUC A;  1XNQ E;  3U1K A;  1HNW E;  5JEA C;  4JI6 E;  4B3S I;  2BA0 D;  4JI7 I;  1XNR I;  4DR1 I;  3ZKB A;  1N34 E;  4P52 A;  4PU9 A;  3Q1Q A;  3GME A;  3T1Y I;  3LPS A;  2PO1 B;  4JI1 E;  5C0X D;  2GO3 A;  4AQY E;  2HHH I;  4IZJ B;  4U3D A;  2UUA E;  3K1J A;  4DUZ I;  2BA1 G;  4M1K A;  4DR2 I;  3J81 Q;  1Z0V A;  3QT7 A;  1IBL E;  1HNX I;  4X65 E;  4IFD A;  4K0K E;  4KQV A;  4LF9 E;  1UDQ A;  2J7K A;  1S16 A;  4JI3 I;  4LF7 E;  5JEA A;  1RHY A;  5LMU E;  3P3E A;  4DU7 A;  4IZK B;  2PO2 A;  5LMN E;  2NN6 D;  4DV0 E;  1UDS A;  4DUY E;  2WP8 A;  4J3D A;  4JV5 E;  4NXN I;  1Z5B A;  2UXB I;  2ZIT A;  1OYR A;  1P42 A;  4B3T E;  2CG9 A;  4LCH A;  4FN5 A;  2E5L I;  1Z0C A;  5DRQ A;  4X64 I;  4LF8 E;  1EA6 A;  4MYU A;  4MYT A;  2BA0 G;  1N36 I;  1Z0W A;  3LNU A;  4MU0 A;  4DV4 E;  4IFD F;  1NHH A;  2NPF A;  3B4T A;  1XMQ I;  1ZM9 A;  4JI4 E;  3QT6 A;  4R1F A;  4JI8 E;  2C37 A;  2Q2E B;  4LCG A;  4X66 E;  2UXC I;  2JT2 A;  1J5E E;  5BR8 I;  3WU5 A;  1YH8 A;  4NXM E;  3M85 D;  3WU6 A;  1Y5Y A;  2VQF I;  4DV1 E;  1ELO A;  4FW7 A;  1ZM4 A;  4DV5 E;  3H1C A;  4AIM A;  4DV6 I;  4DR7 E;  4ZVI A;  1H73 A;  3ZM7 A;  5GME A;  4B3R I;  5ELW A;  4IFD B;  3B78 A;  5DNX A;  3WU3 A;  4IZK A;  4KHP I;  2O1U A;  5GMD A;  4LF6 E;  1XNQ I;  1HNW I;  1HNZ E;  1N32 E;  2R3V A;  1KIJ A;  1N34 I;  4URL A;  4OO1 E;  3K85 A;  4FWH A;  1ZM2 A;  4GKJ E;  4QNK A;  4LCF A;  1OYP A;  2GQ0 A;  4AQY I;  3CDJ A;  2X36 A;  4IZJ D;  1PKP A;  2VF3 A;  2UUA I;  4IFD C;  3PYG A;  1H7S A;  3OTO E;  2O1W A;  4LF5 I;  1IBL I;  4GQU A;  4X65 I;  3GCM A;  1Z5C A;  4DV7 E;  5DNL A;  2WNR B;  4LFC E;  4JI5 E;  2WW4 A;  4FW6 A;  5EL9 A;  4K0K I;  3P76 A;  3P06 A;  3ZKD A;  4LFB E;  4B3M E;  3P3G A;  2UUB E;  5K36 E;  2UUC E;  1QZR A;  1FWK A;  2PO0 A;  2HK2 A;  4LF4 E;  4LF7 I;  4JI0 E;  1OYS A;  3QT5 A;  3Q6M A;  2XEX A;  3V5R A;  2JEB B;  3M85 G;  4DR4 E;  4OZE A;  5LMN I;  4DV2 E;  1IBK E;  2C37 B;  2GS8 A;  4DV0 I;  3P3C A;  1MU5 A;  1BKN A;  4YHH E;  4JV5 I;  4USK A;  3Q6N A;  2UXD E;  4DPX A;  4JYA E;  1N0U A;  4B3T I;  4OO1 A;  4MU3 A;  1FJG E;  1XXE A;  1MG7 A;  3H4L A;  5C0X F;  1YHC A;  2O1T A;  2A2C A;  1IBM E;  1U2R A;  4LF8 I;  4HY1 A;  3HJC A;  4DV4 I;  4DR3 I;  4USM A;  2A2D A;  2F4V E;  5IWA E;  4MDT A;  4B3S E;  3CDI A;  4DU8 A;  4JI4 I;  1NHJ A;  4JI8 I;  2UU9 E;  4X66 I;  1E3H A;  4WUB A;  1J5E I;  4MU1 A;  4NXM I;  3B8H A;  3PYF A;  2V2Z A;  3B82 A;  2WNR A;  1ZXM A;  3KRN A;  5C0X B;  3T1H E;  5IT9 C;  4DV1 I;  4I3H A;  4DV5 I;  2PNM A;  3M7N D;  1FI4 A;  4DR6 I;  4DR7 I;  2BR2 A;  4DR2 E;  3PS3 A;  1HNX E;  4OO1 F;  4IFD D;  4DPY A;  3J7A M;  4PRX A;  5C0X E;  3GLL A;  3WU4 A;  4OX9 E;  1KVK A;  2JEB A;  3K17 A;  4BA2 A;  1R6L A;  2PO0 B;  4LF6 I;  1Y4S A;  2O3Z A;  2ZBK B;  1RR9 A;  1A6F A;  2Z5B B;  3QT8 A;  5JEA D;  1EI1 A;  3J80 C;  5C0X C;  2HKJ A;  4EMD A;  3JAM C;  3ZZ0 A;  4GKJ I;  2BM0 A;  4HXZ A;  4FW5 A;  3PS1 A;  4MQY A;  4LFA E;  1WUU A;  2IES A;  2V8P A;  4DPW A;  2VQE E;  5K36 F;  2Z5C A;  2JE6 A;  4Z7C A;  4OO1 B;  3OTO I;  1UEK A;  4IS9 A;  4YY3 E;  1B62 A;  1UDN A;  2NN6 E;  4FW9 A;  4DV7 I;  3L7Z A;  2E5L E;  4DXL A;  4X62 E;  4LFC I;  1E3P A;  4JI6 I;  1H7U A;  4X64 E;  4B3M I;  4HAC B;  4PRV A;  2UUB I;  1N33 E;  2UUC I;  3PRY A;  4LPF A;  5L3J A;  5FLX C;  1B63 A;  2O1V A;  4JI2 E;  3U1Y A;  1Y60 A;  1I94 E;  4NBQ A;  4JI1 I;  4DR4 I;  5C0X A;  2J65 A;  4DV2 I;  4ISA A;  4U3B A;  1NHI A;  5K36 B;  4OO1 C;  1KKH A;  1XMO E;  3M7N G;  1K47 A;  2BV3 A;  4YHH I;  1S4E A;  4FWG A;  4JYA I;  2VQF E;  4JG4 A;  4GKK E;  5IT9 Q;  4LF9 I;  1Z5A A;  5DRR A;  2BR2 B;  2R42 A;  2V34 A;  4DV6 E;  1FKA E;  2HFS A;  5JEA E;  1IBM I;  2Z5B A;  5LMU I;  3M6A A;  4P7A A;  4BA2 B;  2C38 B;  5A2Q C;  5K36 C;  5IWA I;  4DUY I;  3CWV A;  2HK3 A;  2CZ9 A;  3J80 Q;  2ZM6 E;  1HR0 E;  2UU9 I;  1XHK A;  3JAM Q;  4MU4 A;  3T1H I;  2C39 A;  5FWK A;  2Z5C B;  4FWD A;  4HAC A;  2JE6 B;  1Z0B A;  3D4J A;  4LF5 E;  2IOP A;  3L7Z B;  1DAR A;  4DR5 E;  2PNZ B;  3HKM A;  4DV3 E;  4BA1 B;  3GON A;  4OX9 I;  4FW4 A;  1H72 C;  4JI7 E;  1ZM3 A;  1XNR E;  2V2V A;  4DR1 E;  1Z0G A;  5K36 A;  4AM3 A;  3UHM A;  1D6T A;  5LL6 R;  1Z0T A;  3NZK A;  3T1Y E;  5FLX Q;  2JEA B;  2VES A;  2NN6 F;  2HHH E;  4DUZ E;  5EKW A;  2DEI A;  4LFA I;  4DPT A;  2EFG A;  2VQE I;  1MX0 A;  2DEJ A; 
#chains in the Genus database with same CATH homology
 1PVG A;  1Z59 A;  1USV A;  4N3O A;  1VIS A;  4WUD A;  4YY3 I;  2IOQ A;  1Z0E A;  4X62 I;  4JI3 E;  1HNZ I;  4UT4 A;  1N32 I;  1ZXN A;  1N33 I;  1Y6Z A;  1N0V C;  3HUL A;  4DR3 E;  5A2Q Q;  4JI2 I;  1H74 A;  1I94 I;  3V2U C;  1KTV A;  3PYE A;  3ZZT A;  4NXN E;  4IZJ A;  3F0N A;  2UXB E;  3PYD A;  2X7I A;  4RPF A;  1XMO I;  1RRE A;  3J81 C;  4Z7Y A;  1Y4U A;  4JI5 I;  1NZ0 A;  2PNL A;  4LFB I;  4GKK I;  2E1R A;  4XTJ A;  1FNM A;  2HFU A;  1N36 E;  4DR6 E;  4LF4 I;  2AJ4 A;  4JI0 I;  4DPU A;  4UTG A;  4ED4 A;  4HYM A;  1XMQ E;  1IBK I;  1PIE A;  2UXC E;  2CGE A;  5BR8 E;  3J7A G;  1USU A;  3ZZU A;  1OJ4 A;  2ZM6 I;  3LTO A;  1HR0 I;  2UXD I;  2BM1 A;  1FJG I;  2OI2 A;  4B3R E;  2HKE A;  1FWL A;  2LJP A;  4KHP E;  2Z5E A;  1HK7 A;  4DR5 I;  4DV3 I;  2V2Q A;  2F4V I;  4WUC A;  1XNQ E;  1HNW E;  4JI6 E;  4B3S I;  4JI7 I;  1XNR I;  4DR1 I;  3ZKB A;  1N34 E;  4P52 A;  4PU9 A;  3Q1Q A;  3T1Y I;  3LPS A;  4JI1 E;  4AQY E;  2HHH I;  4IZJ B;  2UUA E;  3K1J A;  4DUZ I;  4DR2 I;  4M1K A;  3J81 Q;  1Z0V A;  3QT7 A;  1IBL E;  1HNX I;  4X65 E;  4K0K E;  4KQV A;  4LF9 E;  2J7K A;  1S16 A;  4JI3 I;  4LF7 E;  5LMU E;  4DU7 A;  4IZK B;  5LMN E;  4DV0 E;  4DUY E;  4JV5 E;  4NXN I;  1Z5B A;  2UXB I;  2ZIT A;  4B3T E;  2CG9 A;  4FN5 A;  2E5L I;  1Z0C A;  4X64 I;  4LF8 E;  1EA6 A;  4MYU A;  4MYT A;  1N36 I;  1Z0W A;  3LNU A;  4DV4 E;  1NHH A;  2NPF A;  1XMQ I;  1ZM9 A;  4JI4 E;  3QT6 A;  4R1F A;  4JI8 E;  2Q2E B;  4X66 E;  2UXC I;  1J5E E;  5BR8 I;  3WU5 A;  4NXM E;  3WU6 A;  2VQF I;  4DV1 E;  1ELO A;  4DV5 E;  1ZM4 A;  4DV6 I;  4DR7 E;  4ZVI A;  1H73 A;  3ZM7 A;  5GME A;  4B3R I;  3B78 A;  3WU3 A;  4IZK A;  4KHP I;  2O1U A;  5GMD A;  4LF6 E;  1XNQ I;  1HNW I;  1HNZ E;  1N32 E;  2R3V A;  1KIJ A;  1N34 I;  4URL A;  3K85 A;  4FWH A;  1ZM2 A;  4GKJ E;  2GQ0 A;  4AQY I;  2X36 A;  4IZJ D;  1PKP A;  2VF3 A;  2UUA I;  3PYG A;  3OTO E;  1H7S A;  2O1W A;  4LF5 I;  1IBL I;  4X65 I;  4DV7 E;  1Z5C A;  4LFC E;  4JI5 E;  2WW4 A;  4K0K I;  3P06 A;  3ZKD A;  4LFB E;  4B3M E;  2UUB E;  2UUC E;  1QZR A;  1FWK A;  2HK2 A;  4LF4 E;  4LF7 I;  4JI0 E;  3QT5 A;  3Q6M A;  2XEX A;  3V5R A;  4DR4 E;  5LMN I;  4DV2 E;  1IBK E;  2GS8 A;  4DV0 I;  1MU5 A;  1BKN A;  4YHH E;  4JV5 I;  4USK A;  3Q6N A;  2UXD E;  4DPX A;  4JYA E;  1N0U A;  4B3T I;  1FJG E;  1MG7 A;  3H4L A;  2O1T A;  2A2C A;  1IBM E;  1U2R A;  4LF8 I;  4HY1 A;  3HJC A;  4DV4 I;  4DR3 I;  4USM A;  2A2D A;  2F4V E;  5IWA E;  4B3S E;  4DU8 A;  4JI4 I;  1NHJ A;  4JI8 I;  2UU9 E;  4X66 I;  4WUB A;  1J5E I;  4NXM I;  3B8H A;  3PYF A;  2V2Z A;  3B82 A;  1ZXM A;  3T1H E;  5IT9 C;  4DV1 I;  4I3H A;  4DV5 I;  2PNM A;  1FI4 A;  4DR6 I;  4DR7 I;  4DR2 E;  1HNX E;  4DPY A;  3J7A M;  4PRX A;  3WU4 A;  4OX9 E;  1KVK A;  3K17 A;  4LF6 I;  1Y4S A;  2ZBK B;  1RR9 A;  1A6F A;  2Z5B B;  3QT8 A;  1EI1 A;  3J80 C;  2HKJ A;  4EMD A;  3JAM C;  3ZZ0 A;  4GKJ I;  2BM0 A;  4HXZ A;  4LFA E;  1WUU A;  2V8P A;  2VQE E;  4DPW A;  2Z5C A;  4Z7C A;  3OTO I;  1UEK A;  4YY3 E;  1B62 A;  4FW9 A;  4DV7 I;  2E5L E;  4DXL A;  4X62 E;  4LFC I;  4JI6 I;  1H7U A;  4X64 E;  4B3M I;  4HAC B;  4PRV A;  2UUB I;  1N33 E;  2UUC I;  3PRY A;  5L3J A;  5FLX C;  1B63 A;  2O1V A;  4JI2 E;  1I94 E;  4JI1 I;  4DR4 I;  4DV2 I;  1NHI A;  1KKH A;  1XMO E;  1K47 A;  2BV3 A;  4YHH I;  1S4E A;  4FWG A;  4JYA I;  2VQF E;  4JG4 A;  4GKK E;  5IT9 Q;  4LF9 I;  1Z5A A;  2V34 A;  2R42 A;  4DV6 E;  1FKA E;  2HFS A;  1IBM I;  2Z5B A;  5LMU I;  3M6A A;  4P7A A;  5A2Q C;  5IWA I;  4DUY I;  3CWV A;  2HK3 A;  2CZ9 A;  3J80 Q;  2ZM6 E;  1HR0 E;  2UU9 I;  1XHK A;  3JAM Q;  3T1H I;  5FWK A;  2Z5C B;  4FWD A;  4HAC A;  1Z0B A;  3D4J A;  4LF5 E;  2IOP A;  4DR5 E;  1DAR A;  4DV3 E;  3GON A;  4OX9 I;  4JI7 E;  1H72 C;  1ZM3 A;  1XNR E;  2V2V A;  4DR1 E;  1Z0G A;  1D6T A;  5LL6 R;  1Z0T A;  3T1Y E;  5FLX Q;  2HHH E;  4DUZ E;  2DEI A;  4LFA I;  4DPT A;  2EFG A;  2VQE I;  1MX0 A;  2DEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...