4K0KI

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4k0kI00
5LMUE 2HFUA 4LF8I 3F0NA 3T1HI 3J7AG 4JI7I 1HR0E 1QZRA 3ZKBA 4LF9E 1IBMI 3QT6A 3T1HE 2UUBE 4LFAI 3V2UC 4DR5E 3GONA 4WUDA 4Z7CA 3WU6A 2V34A 5GMEA 4DV5I 4MYUA 4LF7E 4JG4A 1KKHA 4YHHE 4LFAE 4DV3E 4DUYE 1XNRI 2HK3A 1S4EA 1ZXMA 1NHIA 1H74A 2UUCE 4GKJI 4ZVIA 1XMQE 4OX9E 1IBKI 2UXBI 4X65I 4LFCE 1Z5BA 3J80Q 4LF6I 2X36A 3K1JA 2NPFA 4LF5I 1HNZI 4JI0E 4JI4E 5IWAI 2HFSA 4DV2E 3WU5A 4DV6E 2E5LE 1PKPA 4LF5E 3PYGA 2BV3A 1IBKE 2UXBE 3D4JA 4DUZE 1H72C 2F4VE 2DEIA 2V8PA 2GS8A 1HR0I 5LMNE 3HULA 4GKJE 5LMNI 5FLXQ 4DV7E 2F4VI 4EMDA 3QT8A 1B62A 2XEXA 4JI0I 4JI2E 4DR6E 4GKKI 1EA6A 4JI6E 4LF7I 1Z0CA 4X65E 3M6AA 4K0KI 2A2CA 1N32E 2HKEA 2HK2A 1NHJA 4LF9I 4JV5E 2Q2EB 4DV3I 4Z7YA 2WW4A 1XMOE 3WU3A 2UXCI 1HNWE 4KQVA 5LL6R 4X62E 3OTOE 4AQYI 4FWGA 1WUUA 4X62I 2AJ4A 5L3JA 4DR4E 1Z0WA 4NXNI 4DPTA 1HNWI 4DV5E 1H73A 1PVGA 4RPFA 3J81Q 4B3SE 2UXDI 4JI1E 1FJGE 4JV5I 1HNXE 4B3MI 3ZZTA 2HHHE 1I94I 2A2DA 4DXLA 1Z5CA 4WUBA 4PRXA 1K47A 4KHPI 2UUAE 4DPYA 4LFBE 4HACA 5LMUI 4DPWA 4DV0E 4JI5I 1N33E 4GKKE 2HKJA 4YY3I 1Z5AA 2ZM6E 4WUCA 1ZM9A 1Z0TA 3PYFA 4XTJA 4NXMI 2ZM6I 1XNRE 1S16A 2E1RA 4LF4I 1EI1A 1FI4A 5A2QQ 1XNQI 4X64E 1N36E 4P52A 2E5LI 1N34I 1FNMA 3B8HA 4LF6E 4PU9A 1FJGI 2VQEE 1NHHA 4USKA 3WU4A 4B3RI 4DU7A 1N0UA 4HYMA 1Z0VA 1IBLE 2UU9I 4NXME 4DR2E 1H7UA 1MX0A 1NZ0A 5FLXC 3T1YI 2J7KA 1J5EE 5GMDA 1B63A 4JI3I 4PRVA 2VQEI 1KTVA 4HXZA 1Z0GA 1ELOA 4P7AA 4K0KE 1U2RA 4DR7E 4JYAE 1MU5A 4ED4A 4B3TI 1IBLI 2UU9E 4KHPE 1N34E 4OX9I 4DV1E 5IT9C 3K17A 4DR7I 4DV4E 1N0VC 3JAMQ 4LF4E 2OI2A 5A2QC 4DR3E 1ZM2A 3Q1QA 4NXNE 4UT4A 1UEKA 2ZITA 1KVKA 4MYTA 2UUAI 3ZZUA 4DV2I 3B82A 1HNZE 4JI4I 1Z59A 1MG7A 1I94E 4X66I 4X66E 2CZ9A 4DV0I 3PYEA 4JI1I 4JYAI 1XMOI 4DPXA 2DEJA 1FWKA 2HHHI 4I3HA 4JI7E 2VF3A 1DARA 2EFGA 4FWDA 3J7AM 4DR2I 4DR3I 4JI6I 1HNXI 5BR8I 3LNUA 4DV4I 1KIJA 4DUYI 1RREA 1OJ4A 1FKAE 1N32I 4DV1I 4FWHA 2BM1A 3T1YE 2UXCE 4AQYE 1FWLA 2R42A 3V5RA 4B3TE 1ZM3A 3ZM7A 1RR9A 2BM0A 3CWVA 2UXDE 4UTGA 4URLA 4FW9A 4JI3E 4JI8E 2X7IA 3J80C 4JI8I 1VISA 3LTOA 3B78A 1XNQE 1J5EI 3OTOI 1PIEA 4DV6I 1XHKA 3H4LA 3QT5A 4X64I 1N36I 2LJPA 4DU8A 4DV7I 1ZM4A 2VQFI 4B3RE 4DR1I 4HACB 2R3VA 4DUZI 4DR1E 3LPSA 2V2QA 2V2VA 4YHHI 4JI5E 4YY3E 1H7SA 4FN5A 4DR6I 3ZZ0A 4HY1A 3J81C 1BKNA 1N33I 4B3ME 1IBME 4LFBI 3PYDA 1XMQI 4DR5I 2UUBI 1Z0BA 4DPUA 4LFCI 2ZBKB 2UUCI 4R1FA 3JAMC 1D6TA 1ZXNA 4B3SI 2VQFE 4M1KA 4DR4I 1Z0EA 5IT9Q 4LF8E 4USMA 3ZKDA 4JI2I 1A6FA 5IWAE 3QT7A 2V2ZA 5BR8E
chains in the Genus database with same CATH superfamily
2JEBA 1OYSA 5LMUE 2Z5BB 2HFUA 4LF8I 3F0NA 3T1HI 3J7AG 4JI7I 3HJCA 1QZRA 3ZKBA 4IZKB 1HR0E 4LF9E 5EKWA 2O1UA 1IBMI 3QT6A 3T1HE 4FW3A 4OO1B 3L7ZA 2UUBE 4LFAI 3V2UC 4DR5E 3GONA 4WUDA 4Z7CA 3WU6A 2V34A 5GMEA 4DV5I 1E3PA 4MYUA 4LF7E 4JG4A 1KKHA 4YHHE 2JEAA 2GQ0A 4IS9A 5C0XF 4LFAE 4DV3E 4DUYE 1XNRI 4N3OA 2F1DA 1UDOA 2Z5CB 2HK3A 2C39A 1S4EA 1ZXMA 1NHIA 1H74A 2UUCE 1E3HA 4GKJI 4ZVIA 1XMQE 4OX9E 1UDNA 1IBKI 2UXBI 4X65I 2BA0D 4LFCE 1R6LA 1Z5BA 3J80Q 4LF6I 3GLLA 2X36A 3K1JA 2CVEA 2NPFA 4LF5I 2C37B 1HNZI 4JI0E 2C39B 4JI4E 5IWAI 2HFSA 4IZJA 4DV2E 3M7ND 3WU5A 4DV6E 3PS2A 2E5LE 1PKPA 4LF5E 5JEAA 3PYGA 4IFDD 2BV3A 4FW6A 1IBKE 2UXBE 3D4JA 4DUZE 2JEBB 1H72C 2F4VE 4ISAA 2DEIA 3Q6NA 2V8PA 4AM3A 2GS8A 1HR0I 5LMNE 3HULA 4GKJE 4OO1D 5LMNI 5JEAC 2NN6A 5FLXQ 4IFDC 3P3EA 5DNLA 4DV7E 2F4VI 4EMDA 3QT8A 1B62A 2XEXA 4JI0I 2WP8B 1Y4UA 4JI2E 4DR6E 4GKKI 1EA6A 4JI6E 2Z5CA 4LF7I 1Z0CA 4MQYA 4X65E 3M6AA 4IFDA 4K0KI 2A2CA 1N32E 2NN6B 3P3CA 2HKEA 2HK2A 2C38B 1NHJA 4MU3A 4LF9I 3M85G 4JV5E 2Q2EB 4DV3I 4Z7YA 2WW4A 1XMOE 5C0XB 2BA1D 3WU3A 3UHMA 2UXCI 1HNWE 5DROA 3U1KA 4KQVA 5LL6R 4X62E 3OTOE 4AQYI 4FWGA 1WUUA 2PO1A 4X62I 2AJ4A 3NZKA 5L3JA 2NN6C 4DR4E 2O1TA 5C0XE 1Z0WA 4NXNI 4DPTA 1HNWI 4DV5E 1H73A 5C0XD 1PVGA 4RPFA 2BR2A 2GO4A 3U1YA 3J81Q 4OO1F 4B3SE 2UXDI 4JI1E 1FJGE 4JV5I 1HNXE 4B3MI 4QNKA 3ZZTA 2HHHE 1I94I 2GO3A 2A2DA 4DXLA 4GQUA 1Z5CA 4WUBA 4PRXA 1K47A 4KHPI 2UUAE 4DPYA 3PS1A 4HACA 3H1CA 5LMUI 4LFBE 3GMEA 4DPWA 4DV0E 4JI5I 1N33E 4GKKE 4U3DA 2HKJA 4J3DA 3B4TA 4YY3I 1Z5AA 3DD6A 2ZM6E 3Q6MA 4WUCA 1P42A 1HK7A 1ZM9A 2C38A 1Z0TA 3PYFA 4XTJA 4NXMI 5JEAB 2ZM6I 4OZEA 1S16A 1XNRE 2E1RA 4LF4I 1EI1A 1FI4A 5A2QQ 4IZKA 3HKMA 1XNQI 4X64E 1N36E 4P52A 2PNZB 2E5LI 1N34I 1FNMA 2PNLA 3B8HA 3CDIA 5K36D 4AIMA 4LF6E 4PU9A 4FW4A 1FJGI 2VQEE 2O1WA 1NHHA 3CDJA 4USKA 3WU4A 4B3RI 4OO1E 4DU7A 1YHCA 1N0UA 4HYMA 1Z0VA 1IBLE 2UU9I 2NN6E 5FWKA 4NXME 4DR2E 1H7UA 1MX0A 4LPFA 1NZ0A 5FLXC 3T1YI 4NBQA 2J7KA 3L7ZB 5GMDA 1J5EE 1B63A 4JI3I 4PRVA 2VQEI 1KTVA 4HXZA 4MU1A 1Z0GA 4FW7A 1ELOA 1R6MA 2WNRB 4AIDA 4P7AA 2AE8A 4K0KE 1U2RA 4DR7E 4JYAE 1MU5A 1UDSA 2PO0A 4ED4A 4B3TI 2IERA 1IBLI 3P76A 2UU9E 4KHPE 5DRRA 1N34E 2JT2A 4OX9I 4DV1E 2PNMA 5IT9C 3K17A 4DR7I 4DV4E 1N0VC 4FW5A 3JAMQ 2WP8A 4LF4E 4BA1A 3P06A 2OI2A 5A2QC 2C37A 1USUA 2NN6F 5C0XC 4DR3E 1ZM2A 3Q1QA 5EL9A 4NXNE 3M85D 4UT4A 5DNXA 5K36B 1UEKA 2ZITA 1KVKA 4MYTA 2UUAI 3ZZUA 5JEAE 4DV2I 5DRPA 2BA1G 3B82A 1HNZE 4JI4I 4BA1B 1Z59A 1MG7A 1I94E 4X66I 4X66E 2CZ9A 4LCGA 4DV0I 3PYEA 4JI1I 2Z5EA 4JYAI 1XMOI 4DPXA 1VI7A 2DEJA 1FWKA 2HHHI 4I3HA 4JI7E 1Y60A 2VF3A 2O3ZA 1DARA 2EFGA 2IESA 4FWDA 1RHYA 3J7AM 4DR2I 4BA2A 4DR3I 2JE6B 4JI6I 3KRNA 1HNXI 5BR8I 3LNUA 4DV4I 1KIJA 4DUYI 1RREA 1OJ4A 2NN6D 1FKAE 4DV1I 3PRYA 4FWHA 1N32I 2BM1A 2WNRA 3T1YE 2UXCE 1Y4SA 4AQYE 1FWLA 2R42A 3V5RA 4B3TE 5DRQA 1Y6ZA 2O1VA 4MU4A 4QNJA 1ZM3A 5C0XA 3ZM7A 1Y5YA 5JEAD 1RR9A 2BM0A 2IOQA 4LCHA 3CWVA 3K85A 1YH8A 2UXDE 4IZJD 4UTGA 4FW9A 4URLA 4JI3E 2PO1B 4JI8E 5K36E 2PO0B 2X7IA 1XXEA 4OKGA 3J80C 2J65A 4JI8I 1USVA 2PO2B 1VISA 2JEAB 3LTOA 3B78A 1XNQE 4IFDB 3P3GA 1J5EI 3OTOI 1PIEA 4DV6I 1XHKA 4LCFA 4MU0A 3H4LA 3QT5A 4X64I 1N36I 2LJPA 4DU8A 4DV7I 1ZM4A 2VQFI 2PO2A 4B3RE 4DR1I 1OYRA 4IFDF 4HACB 4OO1C 2JE6A 3PS3A 2R3VA 4DUZI 4DR1E 3LPSA 2PNZA 2V2QA 2V2VA 4YHHI 4LOMA 4JI5E 4MDTA 2Z5BA 5K36C 4YY3E 4BA2B 1H7SA 4FN5A 4OO1A 2CGEA 2BR2B 4DR6I 3ZZ0A 4HY1A 3J81C 2VESA 1BKNA 1N33I 4B3ME 4IFDE 5K36F 1IBME 4LFBI 3PYDA 1XMQI 4DR5I 5K36A 2UUBI 1Z0BA 4IZJB 5JEAF 4DPUA 4LFCI 2ZBKB 2UUCI 4U3BA 4R1FA 3JAMC 1D6TA 1ZXNA 4B3SI 2IOPA 2VQFE 4M1KA 4DR4I 1Z0EA 5IT9Q 4LF8E 4USMA 2CG9A 2BA0G 3ZKDA 1OYPA 4JI2I 1UDQA 1A6FA 5IWAE 5ELWA 3GCMA 3QT7A 3M7NG 2V2ZA 5BR8E
chains in the Genus database with same CATH topology
5LMUE 2Z5BB 2HFUA 4LF8I 3F0NA 3T1HI 3J7AG 4JI7I 3HJCA 1QZRA 3ZKBA 4IZKB 1HR0E 4LF9E 2O1UA 1IBMI 3QT6A 3T1HE 2UUBE 4LFAI 3V2UC 4DR5E 3GONA 4WUDA 4Z7CA 3WU6A 2V34A 5GMEA 4DV5I 4MYUA 4LF7E 4JG4A 1KKHA 4YHHE 2GQ0A 4LFAE 4DV3E 4DUYE 1XNRI 4N3OA 2Z5CB 2HK3A 1S4EA 1ZXMA 1NHIA 1H74A 2UUCE 4GKJI 4ZVIA 1XMQE 4OX9E 1IBKI 2UXBI 4X65I 4LFCE 1Z5BA 3J80Q 4LF6I 2X36A 3K1JA 2NPFA 4LF5I 1HNZI 4JI0E 4JI4E 5IWAI 2HFSA 4IZJA 4DV2E 3WU5A 4DV6E 2E5LE 1PKPA 4LF5E 3PYGA 2BV3A 1IBKE 2UXBE 3D4JA 4DUZE 1H72C 2F4VE 2DEIA 3Q6NA 2V8PA 2GS8A 1HR0I 5LMNE 3HULA 4GKJE 5LMNI 5FLXQ 4DV7E 2F4VI 4EMDA 3QT8A 1B62A 2XEXA 4JI0I 1Y4UA 4JI2E 4DR6E 4GKKI 1EA6A 4JI6E 2Z5CA 4LF7I 1Z0CA 4X65E 3M6AA 4K0KI 2A2CA 1N32E 2HKEA 2HK2A 1NHJA 4LF9I 4JV5E 2Q2EB 4DV3I 4Z7YA 2WW4A 1XMOE 3WU3A 2UXCI 1HNWE 4KQVA 5LL6R 4X62E 3OTOE 4AQYI 4FWGA 1WUUA 4X62I 2AJ4A 5L3JA 4DR4E 2O1TA 1Z0WA 4NXNI 4DPTA 1HNWI 4DV5E 1H73A 1PVGA 4RPFA 3J81Q 4B3SE 2UXDI 4JI1E 1FJGE 4JV5I 1HNXE 4B3MI 3ZZTA 2HHHE 1I94I 2A2DA 4DXLA 1Z5CA 4WUBA 4PRXA 1K47A 4KHPI 2UUAE 4DPYA 4LFBE 4HACA 5LMUI 4DPWA 4DV0E 4JI5I 1N33E 4GKKE 2HKJA 4YY3I 1Z5AA 2ZM6E 3Q6MA 4WUCA 1HK7A 1ZM9A 1Z0TA 3PYFA 4XTJA 4NXMI 2ZM6I 1XNRE 1S16A 2E1RA 4LF4I 1EI1A 1FI4A 5A2QQ 4IZKA 1XNQI 4X64E 1N36E 4P52A 2E5LI 1N34I 1FNMA 2PNLA 3B8HA 4LF6E 4PU9A 1FJGI 2VQEE 2O1WA 1NHHA 4USKA 3WU4A 4B3RI 4DU7A 1N0UA 4HYMA 1Z0VA 1IBLE 2UU9I 5FWKA 4NXME 4DR2E 1H7UA 1MX0A 1NZ0A 5FLXC 3T1YI 2J7KA 1J5EE 5GMDA 1B63A 4JI3I 4PRVA 2VQEI 1KTVA 4HXZA 1Z0GA 1ELOA 4P7AA 4K0KE 1U2RA 4DR7E 4JYAE 1MU5A 4ED4A 4B3TI 1IBLI 2UU9E 4KHPE 1N34E 4OX9I 4DV1E 2PNMA 5IT9C 3K17A 4DR7I 4DV4E 1N0VC 3JAMQ 4LF4E 3P06A 2OI2A 5A2QC 1USUA 4DR3E 1ZM2A 3Q1QA 4NXNE 4UT4A 1UEKA 2ZITA 1KVKA 4MYTA 2UUAI 3ZZUA 4DV2I 3B82A 1HNZE 4JI4I 1Z59A 1MG7A 1I94E 4X66I 4X66E 2CZ9A 4DV0I 3PYEA 4JI1I 2Z5EA 4JYAI 1XMOI 4DPXA 2DEJA 1FWKA 2HHHI 4I3HA 4JI7E 2VF3A 1DARA 2EFGA 4FWDA 3J7AM 4DR2I 4DR3I 4JI6I 1HNXI 5BR8I 3LNUA 4DV4I 1KIJA 4DUYI 1RREA 1OJ4A 1FKAE 1N32I 4DV1I 3PRYA 4FWHA 2BM1A 3T1YE 2UXCE 1Y4SA 4AQYE 1FWLA 2R42A 3V5RA 4B3TE 1Y6ZA 2O1VA 1ZM3A 3ZM7A 1RR9A 2BM0A 2IOQA 3CWVA 3K85A 2UXDE 4IZJD 4UTGA 4FW9A 4URLA 4JI3E 4JI8E 2X7IA 3J80C 4JI8I 1USVA 1VISA 3LTOA 3B78A 1XNQE 1J5EI 3OTOI 1PIEA 4DV6I 1XHKA 3H4LA 3QT5A 4X64I 1N36I 2LJPA 4DU8A 4DV7I 1ZM4A 2VQFI 4B3RE 4DR1I 4HACB 2R3VA 4DUZI 4DR1E 3LPSA 2V2QA 2V2VA 4YHHI 4JI5E 2Z5BA 4YY3E 1H7SA 4FN5A 2CGEA 4DR6I 3ZZ0A 4HY1A 3J81C 1BKNA 1N33I 4B3ME 1IBME 4LFBI 3PYDA 1XMQI 4DR5I 2UUBI 1Z0BA 4IZJB 4DPUA 4LFCI 2ZBKB 2UUCI 4R1FA 3JAMC 1D6TA 1ZXNA 4B3SI 2IOPA 2VQFE 4M1KA 4DR4I 1Z0EA 5IT9Q 4LF8E 4USMA 2CG9A 3ZKDA 4JI2I 1A6FA 5IWAE 3QT7A 2V2ZA 5BR8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU E;  2HFU A;  4LF8 I;  3F0N A;  3T1H I;  3J7A G;  4JI7 I;  1HR0 E;  1QZR A;  3ZKB A;  4LF9 E;  1IBM I;  3QT6 A;  3T1H E;  2UUB E;  4LFA I;  3V2U C;  4DR5 E;  3GON A;  4WUD A;  4Z7C A;  3WU6 A;  2V34 A;  5GME A;  4DV5 I;  4MYU A;  4LF7 E;  4JG4 A;  1KKH A;  4YHH E;  4LFA E;  4DV3 E;  4DUY E;  1XNR I;  2HK3 A;  1S4E A;  1ZXM A;  1NHI A;  1H74 A;  2UUC E;  4GKJ I;  4ZVI A;  1XMQ E;  4OX9 E;  1IBK I;  2UXB I;  4X65 I;  4LFC E;  1Z5B A;  3J80 Q;  4LF6 I;  2X36 A;  3K1J A;  2NPF A;  4LF5 I;  1HNZ I;  4JI0 E;  4JI4 E;  5IWA I;  2HFS A;  4DV2 E;  3WU5 A;  4DV6 E;  2E5L E;  1PKP A;  4LF5 E;  3PYG A;  2BV3 A;  1IBK E;  2UXB E;  3D4J A;  4DUZ E;  1H72 C;  2F4V E;  2DEI A;  2V8P A;  2GS8 A;  1HR0 I;  5LMN E;  3HUL A;  4GKJ E;  5LMN I;  5FLX Q;  4DV7 E;  2F4V I;  4EMD A;  3QT8 A;  1B62 A;  2XEX A;  4JI0 I;  4JI2 E;  4DR6 E;  4GKK I;  1EA6 A;  4JI6 E;  4LF7 I;  1Z0C A;  4X65 E;  3M6A A;  4K0K I;  2A2C A;  1N32 E;  2HKE A;  2HK2 A;  1NHJ A;  4LF9 I;  4JV5 E;  2Q2E B;  4DV3 I;  4Z7Y A;  2WW4 A;  1XMO E;  3WU3 A;  2UXC I;  1HNW E;  4KQV A;  5LL6 R;  4X62 E;  3OTO E;  4AQY I;  4FWG A;  1WUU A;  4X62 I;  2AJ4 A;  5L3J A;  4DR4 E;  1Z0W A;  4NXN I;  4DPT A;  1HNW I;  4DV5 E;  1H73 A;  1PVG A;  4RPF A;  3J81 Q;  4B3S E;  2UXD I;  4JI1 E;  1FJG E;  4JV5 I;  1HNX E;  4B3M I;  3ZZT A;  2HHH E;  1I94 I;  2A2D A;  4DXL A;  1Z5C A;  4WUB A;  4PRX A;  1K47 A;  4KHP I;  2UUA E;  4DPY A;  4LFB E;  4HAC A;  5LMU I;  4DPW A;  4DV0 E;  4JI5 I;  1N33 E;  4GKK E;  2HKJ A;  4YY3 I;  1Z5A A;  2ZM6 E;  4WUC A;  1ZM9 A;  1Z0T A;  3PYF A;  4XTJ A;  4NXM I;  2ZM6 I;  1XNR E;  1S16 A;  2E1R A;  4LF4 I;  1EI1 A;  1FI4 A;  5A2Q Q;  1XNQ I;  4X64 E;  1N36 E;  4P52 A;  2E5L I;  1N34 I;  1FNM A;  3B8H A;  4LF6 E;  4PU9 A;  1FJG I;  2VQE E;  1NHH A;  4USK A;  3WU4 A;  4B3R I;  4DU7 A;  1N0U A;  4HYM A;  1Z0V A;  1IBL E;  2UU9 I;  4NXM E;  4DR2 E;  1H7U A;  1MX0 A;  1NZ0 A;  5FLX C;  3T1Y I;  2J7K A;  1J5E E;  5GMD A;  1B63 A;  4JI3 I;  4PRV A;  2VQE I;  1KTV A;  4HXZ A;  1Z0G A;  1ELO A;  4P7A A;  4K0K E;  1U2R A;  4DR7 E;  4JYA E;  1MU5 A;  4ED4 A;  4B3T I;  1IBL I;  2UU9 E;  4KHP E;  1N34 E;  4OX9 I;  4DV1 E;  5IT9 C;  3K17 A;  4DR7 I;  4DV4 E;  1N0V C;  3JAM Q;  4LF4 E;  2OI2 A;  5A2Q C;  4DR3 E;  1ZM2 A;  3Q1Q A;  4NXN E;  4UT4 A;  1UEK A;  2ZIT A;  1KVK A;  4MYT A;  2UUA I;  3ZZU A;  4DV2 I;  3B82 A;  1HNZ E;  4JI4 I;  1Z59 A;  1MG7 A;  1I94 E;  4X66 I;  4X66 E;  2CZ9 A;  4DV0 I;  3PYE A;  4JI1 I;  4JYA I;  1XMO I;  4DPX A;  2DEJ A;  1FWK A;  2HHH I;  4I3H A;  4JI7 E;  2VF3 A;  1DAR A;  2EFG A;  4FWD A;  3J7A M;  4DR2 I;  4DR3 I;  4JI6 I;  1HNX I;  5BR8 I;  3LNU A;  4DV4 I;  1KIJ A;  4DUY I;  1RRE A;  1OJ4 A;  1FKA E;  1N32 I;  4DV1 I;  4FWH A;  2BM1 A;  3T1Y E;  2UXC E;  4AQY E;  1FWL A;  2R42 A;  3V5R A;  4B3T E;  1ZM3 A;  3ZM7 A;  1RR9 A;  2BM0 A;  3CWV A;  2UXD E;  4UTG A;  4URL A;  4FW9 A;  4JI3 E;  4JI8 E;  2X7I A;  3J80 C;  4JI8 I;  1VIS A;  3LTO A;  3B78 A;  1XNQ E;  1J5E I;  3OTO I;  1PIE A;  4DV6 I;  1XHK A;  3H4L A;  3QT5 A;  4X64 I;  1N36 I;  2LJP A;  4DU8 A;  4DV7 I;  1ZM4 A;  2VQF I;  4B3R E;  4DR1 I;  4HAC B;  2R3V A;  4DUZ I;  4DR1 E;  3LPS A;  2V2Q A;  2V2V A;  4YHH I;  4JI5 E;  4YY3 E;  1H7S A;  4FN5 A;  4DR6 I;  3ZZ0 A;  4HY1 A;  3J81 C;  1BKN A;  1N33 I;  4B3M E;  1IBM E;  4LFB I;  3PYD A;  1XMQ I;  4DR5 I;  2UUB I;  1Z0B A;  4DPU A;  4LFC I;  2ZBK B;  2UUC I;  4R1F A;  3JAM C;  1D6T A;  1ZXN A;  4B3S I;  2VQF E;  4M1K A;  4DR4 I;  1Z0E A;  5IT9 Q;  4LF8 E;  4USM A;  3ZKD A;  4JI2 I;  1A6F A;  5IWA E;  3QT7 A;  2V2Z A;  5BR8 E; 
#chains in the Genus database with same CATH topology
 2JEB A;  1OYS A;  5LMU E;  2Z5B B;  2HFU A;  4LF8 I;  3F0N A;  3T1H I;  3J7A G;  4JI7 I;  3HJC A;  1QZR A;  3ZKB A;  4IZK B;  1HR0 E;  4LF9 E;  5EKW A;  2O1U A;  1IBM I;  3QT6 A;  3T1H E;  4FW3 A;  4OO1 B;  3L7Z A;  2UUB E;  4LFA I;  3V2U C;  4DR5 E;  3GON A;  4WUD A;  4Z7C A;  3WU6 A;  2V34 A;  5GME A;  4DV5 I;  1E3P A;  4MYU A;  4LF7 E;  4JG4 A;  1KKH A;  4YHH E;  2JEA A;  2GQ0 A;  4IS9 A;  5C0X F;  4LFA E;  4DV3 E;  4DUY E;  1XNR I;  4N3O A;  2F1D A;  1UDO A;  2Z5C B;  2HK3 A;  2C39 A;  1S4E A;  1ZXM A;  1NHI A;  1H74 A;  2UUC E;  1E3H A;  4GKJ I;  4ZVI A;  1XMQ E;  4OX9 E;  1UDN A;  1IBK I;  2UXB I;  4X65 I;  2BA0 D;  4LFC E;  1R6L A;  1Z5B A;  3J80 Q;  4LF6 I;  3GLL A;  2X36 A;  3K1J A;  2CVE A;  2NPF A;  4LF5 I;  2C37 B;  1HNZ I;  4JI0 E;  2C39 B;  4JI4 E;  5IWA I;  2HFS A;  4IZJ A;  4DV2 E;  3M7N D;  3WU5 A;  4DV6 E;  3PS2 A;  2E5L E;  1PKP A;  4LF5 E;  5JEA A;  3PYG A;  4IFD D;  2BV3 A;  4FW6 A;  1IBK E;  2UXB E;  3D4J A;  4DUZ E;  2JEB B;  1H72 C;  2F4V E;  4ISA A;  2DEI A;  3Q6N A;  2V8P A;  4AM3 A;  2GS8 A;  1HR0 I;  5LMN E;  3HUL A;  4GKJ E;  4OO1 D;  5LMN I;  5JEA C;  2NN6 A;  5FLX Q;  4IFD C;  3P3E A;  5DNL A;  4DV7 E;  2F4V I;  4EMD A;  3QT8 A;  1B62 A;  2XEX A;  4JI0 I;  2WP8 B;  1Y4U A;  4JI2 E;  4DR6 E;  4GKK I;  1EA6 A;  4JI6 E;  2Z5C A;  4LF7 I;  1Z0C A;  4MQY A;  4X65 E;  3M6A A;  4IFD A;  4K0K I;  2A2C A;  1N32 E;  2NN6 B;  3P3C A;  2HKE A;  2HK2 A;  2C38 B;  1NHJ A;  4MU3 A;  4LF9 I;  3M85 G;  4JV5 E;  2Q2E B;  4DV3 I;  4Z7Y A;  2WW4 A;  1XMO E;  5C0X B;  2BA1 D;  3WU3 A;  3UHM A;  2UXC I;  1HNW E;  5DRO A;  3U1K A;  4KQV A;  5LL6 R;  4X62 E;  3OTO E;  4AQY I;  4FWG A;  1WUU A;  2PO1 A;  4X62 I;  2AJ4 A;  3NZK A;  5L3J A;  2NN6 C;  4DR4 E;  2O1T A;  5C0X E;  1Z0W A;  4NXN I;  4DPT A;  1HNW I;  4DV5 E;  1H73 A;  5C0X D;  1PVG A;  4RPF A;  2BR2 A;  2GO4 A;  3U1Y A;  3J81 Q;  4OO1 F;  4B3S E;  2UXD I;  4JI1 E;  1FJG E;  4JV5 I;  1HNX E;  4B3M I;  4QNK A;  3ZZT A;  2HHH E;  1I94 I;  2GO3 A;  2A2D A;  4DXL A;  4GQU A;  1Z5C A;  4WUB A;  4PRX A;  1K47 A;  4KHP I;  2UUA E;  4DPY A;  3PS1 A;  4HAC A;  3H1C A;  5LMU I;  4LFB E;  3GME A;  4DPW A;  4DV0 E;  4JI5 I;  1N33 E;  4GKK E;  4U3D A;  2HKJ A;  4J3D A;  3B4T A;  4YY3 I;  1Z5A A;  3DD6 A;  2ZM6 E;  3Q6M A;  4WUC A;  1P42 A;  1HK7 A;  1ZM9 A;  2C38 A;  1Z0T A;  3PYF A;  4XTJ A;  4NXM I;  5JEA B;  2ZM6 I;  4OZE A;  1S16 A;  1XNR E;  2E1R A;  4LF4 I;  1EI1 A;  1FI4 A;  5A2Q Q;  4IZK A;  3HKM A;  1XNQ I;  4X64 E;  1N36 E;  4P52 A;  2PNZ B;  2E5L I;  1N34 I;  1FNM A;  2PNL A;  3B8H A;  3CDI A;  5K36 D;  4AIM A;  4LF6 E;  4PU9 A;  4FW4 A;  1FJG I;  2VQE E;  2O1W A;  1NHH A;  3CDJ A;  4USK A;  3WU4 A;  4B3R I;  4OO1 E;  4DU7 A;  1YHC A;  1N0U A;  4HYM A;  1Z0V A;  1IBL E;  2UU9 I;  2NN6 E;  5FWK A;  4NXM E;  4DR2 E;  1H7U A;  1MX0 A;  4LPF A;  1NZ0 A;  5FLX C;  3T1Y I;  4NBQ A;  2J7K A;  3L7Z B;  5GMD A;  1J5E E;  1B63 A;  4JI3 I;  4PRV A;  2VQE I;  1KTV A;  4HXZ A;  4MU1 A;  1Z0G A;  4FW7 A;  1ELO A;  1R6M A;  2WNR B;  4AID A;  4P7A A;  2AE8 A;  4K0K E;  1U2R A;  4DR7 E;  4JYA E;  1MU5 A;  1UDS A;  2PO0 A;  4ED4 A;  4B3T I;  2IER A;  1IBL I;  3P76 A;  2UU9 E;  4KHP E;  5DRR A;  1N34 E;  2JT2 A;  4OX9 I;  4DV1 E;  2PNM A;  5IT9 C;  3K17 A;  4DR7 I;  4DV4 E;  1N0V C;  4FW5 A;  3JAM Q;  2WP8 A;  4LF4 E;  4BA1 A;  3P06 A;  2OI2 A;  5A2Q C;  2C37 A;  1USU A;  2NN6 F;  5C0X C;  4DR3 E;  1ZM2 A;  3Q1Q A;  5EL9 A;  4NXN E;  3M85 D;  4UT4 A;  5DNX A;  5K36 B;  1UEK A;  2ZIT A;  1KVK A;  4MYT A;  2UUA I;  3ZZU A;  5JEA E;  4DV2 I;  5DRP A;  2BA1 G;  3B82 A;  1HNZ E;  4JI4 I;  4BA1 B;  1Z59 A;  1MG7 A;  1I94 E;  4X66 I;  4X66 E;  2CZ9 A;  4LCG A;  4DV0 I;  3PYE A;  4JI1 I;  2Z5E A;  4JYA I;  1XMO I;  4DPX A;  1VI7 A;  2DEJ A;  1FWK A;  2HHH I;  4I3H A;  4JI7 E;  1Y60 A;  2VF3 A;  2O3Z A;  1DAR A;  2EFG A;  2IES A;  4FWD A;  1RHY A;  3J7A M;  4DR2 I;  4BA2 A;  4DR3 I;  2JE6 B;  4JI6 I;  3KRN A;  1HNX I;  5BR8 I;  3LNU A;  4DV4 I;  1KIJ A;  4DUY I;  1RRE A;  1OJ4 A;  2NN6 D;  1FKA E;  4DV1 I;  3PRY A;  4FWH A;  1N32 I;  2BM1 A;  2WNR A;  3T1Y E;  2UXC E;  1Y4S A;  4AQY E;  1FWL A;  2R42 A;  3V5R A;  4B3T E;  5DRQ A;  1Y6Z A;  2O1V A;  4MU4 A;  4QNJ A;  1ZM3 A;  5C0X A;  3ZM7 A;  1Y5Y A;  5JEA D;  1RR9 A;  2BM0 A;  2IOQ A;  4LCH A;  3CWV A;  3K85 A;  1YH8 A;  2UXD E;  4IZJ D;  4UTG A;  4FW9 A;  4URL A;  4JI3 E;  2PO1 B;  4JI8 E;  5K36 E;  2PO0 B;  2X7I A;  1XXE A;  4OKG A;  3J80 C;  2J65 A;  4JI8 I;  1USV A;  2PO2 B;  1VIS A;  2JEA B;  3LTO A;  3B78 A;  1XNQ E;  4IFD B;  3P3G A;  1J5E I;  3OTO I;  1PIE A;  4DV6 I;  1XHK A;  4LCF A;  4MU0 A;  3H4L A;  3QT5 A;  4X64 I;  1N36 I;  2LJP A;  4DU8 A;  4DV7 I;  1ZM4 A;  2VQF I;  2PO2 A;  4B3R E;  4DR1 I;  1OYR A;  4IFD F;  4HAC B;  4OO1 C;  2JE6 A;  3PS3 A;  2R3V A;  4DUZ I;  4DR1 E;  3LPS A;  2PNZ A;  2V2Q A;  2V2V A;  4YHH I;  4LOM A;  4JI5 E;  4MDT A;  2Z5B A;  5K36 C;  4YY3 E;  4BA2 B;  1H7S A;  4FN5 A;  4OO1 A;  2CGE A;  2BR2 B;  4DR6 I;  3ZZ0 A;  4HY1 A;  3J81 C;  2VES A;  1BKN A;  1N33 I;  4B3M E;  4IFD E;  5K36 F;  1IBM E;  4LFB I;  3PYD A;  1XMQ I;  4DR5 I;  5K36 A;  2UUB I;  1Z0B A;  4IZJ B;  5JEA F;  4DPU A;  4LFC I;  2ZBK B;  2UUC I;  4U3B A;  4R1F A;  3JAM C;  1D6T A;  1ZXN A;  4B3S I;  2IOP A;  2VQF E;  4M1K A;  4DR4 I;  1Z0E A;  5IT9 Q;  4LF8 E;  4USM A;  2CG9 A;  2BA0 G;  3ZKD A;  1OYP A;  4JI2 I;  1UDQ A;  1A6F A;  5IWA E;  5ELW A;  3GCM A;  3QT7 A;  3M7N G;  2V2Z A;  5BR8 E; 
#chains in the Genus database with same CATH homology
 5LMU E;  2Z5B B;  2HFU A;  4LF8 I;  3F0N A;  3T1H I;  3J7A G;  4JI7 I;  3HJC A;  1QZR A;  3ZKB A;  4IZK B;  1HR0 E;  4LF9 E;  2O1U A;  1IBM I;  3QT6 A;  3T1H E;  2UUB E;  4LFA I;  3V2U C;  4DR5 E;  3GON A;  4WUD A;  4Z7C A;  3WU6 A;  2V34 A;  5GME A;  4DV5 I;  4MYU A;  4LF7 E;  4JG4 A;  1KKH A;  4YHH E;  2GQ0 A;  4LFA E;  4DV3 E;  4DUY E;  1XNR I;  4N3O A;  2Z5C B;  2HK3 A;  1S4E A;  1ZXM A;  1NHI A;  1H74 A;  2UUC E;  4GKJ I;  4ZVI A;  1XMQ E;  4OX9 E;  1IBK I;  2UXB I;  4X65 I;  4LFC E;  1Z5B A;  3J80 Q;  4LF6 I;  2X36 A;  3K1J A;  2NPF A;  4LF5 I;  1HNZ I;  4JI0 E;  4JI4 E;  5IWA I;  2HFS A;  4IZJ A;  4DV2 E;  3WU5 A;  4DV6 E;  2E5L E;  1PKP A;  4LF5 E;  3PYG A;  2BV3 A;  1IBK E;  2UXB E;  3D4J A;  4DUZ E;  1H72 C;  2F4V E;  2DEI A;  3Q6N A;  2V8P A;  2GS8 A;  1HR0 I;  5LMN E;  3HUL A;  4GKJ E;  5LMN I;  5FLX Q;  4DV7 E;  2F4V I;  4EMD A;  3QT8 A;  1B62 A;  2XEX A;  4JI0 I;  1Y4U A;  4JI2 E;  4DR6 E;  4GKK I;  1EA6 A;  4JI6 E;  2Z5C A;  4LF7 I;  1Z0C A;  4X65 E;  3M6A A;  4K0K I;  2A2C A;  1N32 E;  2HKE A;  2HK2 A;  1NHJ A;  4LF9 I;  4JV5 E;  2Q2E B;  4DV3 I;  4Z7Y A;  2WW4 A;  1XMO E;  3WU3 A;  2UXC I;  1HNW E;  4KQV A;  5LL6 R;  4X62 E;  3OTO E;  4AQY I;  4FWG A;  1WUU A;  4X62 I;  2AJ4 A;  5L3J A;  4DR4 E;  2O1T A;  1Z0W A;  4NXN I;  4DPT A;  1HNW I;  4DV5 E;  1H73 A;  1PVG A;  4RPF A;  3J81 Q;  4B3S E;  2UXD I;  4JI1 E;  1FJG E;  4JV5 I;  1HNX E;  4B3M I;  3ZZT A;  2HHH E;  1I94 I;  2A2D A;  4DXL A;  1Z5C A;  4WUB A;  4PRX A;  1K47 A;  4KHP I;  2UUA E;  4DPY A;  4LFB E;  4HAC A;  5LMU I;  4DPW A;  4DV0 E;  4JI5 I;  1N33 E;  4GKK E;  2HKJ A;  4YY3 I;  1Z5A A;  2ZM6 E;  3Q6M A;  4WUC A;  1HK7 A;  1ZM9 A;  1Z0T A;  3PYF A;  4XTJ A;  4NXM I;  2ZM6 I;  1XNR E;  1S16 A;  2E1R A;  4LF4 I;  1EI1 A;  1FI4 A;  5A2Q Q;  4IZK A;  1XNQ I;  4X64 E;  1N36 E;  4P52 A;  2E5L I;  1N34 I;  1FNM A;  2PNL A;  3B8H A;  4LF6 E;  4PU9 A;  1FJG I;  2VQE E;  2O1W A;  1NHH A;  4USK A;  3WU4 A;  4B3R I;  4DU7 A;  1N0U A;  4HYM A;  1Z0V A;  1IBL E;  2UU9 I;  5FWK A;  4NXM E;  4DR2 E;  1H7U A;  1MX0 A;  1NZ0 A;  5FLX C;  3T1Y I;  2J7K A;  1J5E E;  5GMD A;  1B63 A;  4JI3 I;  4PRV A;  2VQE I;  1KTV A;  4HXZ A;  1Z0G A;  1ELO A;  4P7A A;  4K0K E;  1U2R A;  4DR7 E;  4JYA E;  1MU5 A;  4ED4 A;  4B3T I;  1IBL I;  2UU9 E;  4KHP E;  1N34 E;  4OX9 I;  4DV1 E;  2PNM A;  5IT9 C;  3K17 A;  4DR7 I;  4DV4 E;  1N0V C;  3JAM Q;  4LF4 E;  3P06 A;  2OI2 A;  5A2Q C;  1USU A;  4DR3 E;  1ZM2 A;  3Q1Q A;  4NXN E;  4UT4 A;  1UEK A;  2ZIT A;  1KVK A;  4MYT A;  2UUA I;  3ZZU A;  4DV2 I;  3B82 A;  1HNZ E;  4JI4 I;  1Z59 A;  1MG7 A;  1I94 E;  4X66 I;  4X66 E;  2CZ9 A;  4DV0 I;  3PYE A;  4JI1 I;  2Z5E A;  4JYA I;  1XMO I;  4DPX A;  2DEJ A;  1FWK A;  2HHH I;  4I3H A;  4JI7 E;  2VF3 A;  1DAR A;  2EFG A;  4FWD A;  3J7A M;  4DR2 I;  4DR3 I;  4JI6 I;  1HNX I;  5BR8 I;  3LNU A;  4DV4 I;  1KIJ A;  4DUY I;  1RRE A;  1OJ4 A;  1FKA E;  1N32 I;  4DV1 I;  3PRY A;  4FWH A;  2BM1 A;  3T1Y E;  2UXC E;  1Y4S A;  4AQY E;  1FWL A;  2R42 A;  3V5R A;  4B3T E;  1Y6Z A;  2O1V A;  1ZM3 A;  3ZM7 A;  1RR9 A;  2BM0 A;  2IOQ A;  3CWV A;  3K85 A;  2UXD E;  4IZJ D;  4UTG A;  4FW9 A;  4URL A;  4JI3 E;  4JI8 E;  2X7I A;  3J80 C;  4JI8 I;  1USV A;  1VIS A;  3LTO A;  3B78 A;  1XNQ E;  1J5E I;  3OTO I;  1PIE A;  4DV6 I;  1XHK A;  3H4L A;  3QT5 A;  4X64 I;  1N36 I;  2LJP A;  4DU8 A;  4DV7 I;  1ZM4 A;  2VQF I;  4B3R E;  4DR1 I;  4HAC B;  2R3V A;  4DUZ I;  4DR1 E;  3LPS A;  2V2Q A;  2V2V A;  4YHH I;  4JI5 E;  2Z5B A;  4YY3 E;  1H7S A;  4FN5 A;  2CGE A;  4DR6 I;  3ZZ0 A;  4HY1 A;  3J81 C;  1BKN A;  1N33 I;  4B3M E;  1IBM E;  4LFB I;  3PYD A;  1XMQ I;  4DR5 I;  2UUB I;  1Z0B A;  4IZJ B;  4DPU A;  4LFC I;  2ZBK B;  2UUC I;  4R1F A;  3JAM C;  1D6T A;  1ZXN A;  4B3S I;  2IOP A;  2VQF E;  4M1K A;  4DR4 I;  1Z0E A;  5IT9 Q;  4LF8 E;  4USM A;  2CG9 A;  3ZKD A;  4JI2 I;  1A6F A;  5IWA E;  3QT7 A;  2V2Z A;  5BR8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...