4K0KI

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4k0kI00
4JI6E 2BM1A 4DUYE 4LF6I 2X7IA 4DV3I 1KIJA 2V8PA 1FJGI 1Z0CA 5IWAE 1HNXE 1N0VC 4B3RE 3ZM7A 2HKEA 3PYFA 4AQYI 1MX0A 3PYGA 2UU9E 5L3JA 2BM0A 2UUCI 1BKNA 2UUAI 4DV0E 3WU4A 4JI5I 4X62I 2UUBI 3M6AA 5FLXQ 2UXBI 2R42A 1XMQE 3OTOI 4DV2E 2EFGA 4M1KA 4YHHI 4DU7A 2UXDE 3T1YE 3J81C 4MYUA 3ZKBA 4JI6I 4DUYI 2VQFE 5IT9C 1IBKE 1XMOE 5IWAI 1QZRA 1HNXI 1N34E 4B3RI 4URLA 1Z5BA 2V2QA 2HFSA 4B3SI 4ED4A 1MU5A 2UU9I 2HK2A 1DARA 1FI4A 4FWHA 1KTVA 3K17A 2VQEE 1Z0GA 1IBME 1Z0WA 4LFCE 1XMQI 1S4EA 4DV2I 3WU5A 4FN5A 1ELOA 4EMDA 4B3ME 1IBLE 2HK3A 3T1YI 2GS8A 2HKJA 4HXZA 1J5EI 1XHKA 1OJ4A 1H74A 5FLXC 4JYAE 2VQFI 1Z0EA 1IBKI 1XMOI 1RR9A 3ZKDA 4DR3I 3ZZ0A 2A2CA 2UUCE 1N34I 4DR2E 1H7SA 4ZVIA 5LL6R 2V2ZA 4KHPI 3CWVA 4B3TI 4JI0E 2VQEI 4DV4E 4WUDA 4LF7E 1IBMI 4LFCI 4HY1A 1KKHA 4NXNI 4X66E 1FKAE 4B3MI 1IBLI 2X36A 4I3HA 5LMUE 1B62A 4B3SE 4JYAI 3ZZTA 4DR2I 1KVKA 4WUCA 1ZM9A 1S16A 1PIEA 4JG4A 4JI4E 3LPSA 4DV7E 4DR7E 3HULA 2VF3A 4GKKE 4LFAE 1Z0BA 4JI0I 1Z0VA 4K0KE 4DV4I 4LF7I 1J5EE 4DXLA 4DPWA 1D6TA 1A6FA 4KQVA 3WU6A 1I94E 4X66I 1N32E 4NXMI 4DR3E 4JI3E 4RPFA 4DPXA 2E1RA 4GKJE 5LMUI 1Z5AA 4P7AA 5BR8E 1EI1A 4JV5I 4PU9A 1WUUA 4KHPE 4B3TE 4X65I 3K1JA 1ZXNA 1HNZI 4DR4E 4JI4I 4DV7I 4Z7YA 3F0NA 4HACB 1UEKA 1VISA 3H4LA 4DR7I 4NXNE 1MG7A 1H73A 4GKKI 1RREA 4LFAI 4FWDA 2NPFA 4K0KI 5GMDA 3B8HA 4R1FA 1PVGA 4JI2E 3JAMQ 1ZM3A 3PYDA 4DPUA 4JI8E 1I94I 1N32I 2V2VA 1B63A 4JI3I 1HNWE 1NHHA 3J7AG 3QT7A 4GKJI 3LNUA 2HFUA 4DUZE 2DEJA 1PKPA 5BR8I 4DPYA 4PRXA 1Z59A 3J80C 3D4JA 1K47A 5A2QC 4DR4I 4DR1E 4JI7E 1XNRE 1ZXMA 4OX9E 3T1HE 2J7KA 4NXME 2F4VE 4LF5E 4JI2I 3V5RA 3QT8A 4JI8I 4JV5E 4DV6E 4UTGA 1HNWI 2LJPA 4LF4E 4X65E 3Q1QA 3PYEA 2WW4A 4DUZI 3JAMC 1HNZE 1XNQI 4HYMA 4XTJA 4YY3E 4FW9A 1H72C 2XEXA 1N36E 4LF8E 4Z7CA 4DR1I 4JI7I 1XNRI 4LFBE 2E5LE 4PRVA 1NHJA 2ZM6E 4OX9I 3T1HI 1N0UA 3J80Q 2F4VI 3WU3A 2HHHE 2ZBKB 5A2QQ 4LF5I 4DR5E 3B82A 1EA6A 4DU8A 4DV1E 2AJ4A 4DV6I 4X64E 4DV5E 1NHIA 2CZ9A 1FWKA 4UT4A 2UXCE 4LF4I 5LMNE 4DR6E 1N33E 3ZZUA 2R3VA 4JI1E 4YY3I 1FNMA 4WUBA 1HR0E 4HACA 2BV3A 2OI2A 4LF9E 1N36I 4DPTA 4DV0I 4LF8I 4P52A 4LFBI 2DEIA 2E5LI 5GMEA 3GONA 2ZM6I 3QT5A 3J7AM 4MYTA 2HHHI 4LF6E 4DV3E 1FJGE 4DR5I 1Z0TA 1FWLA 1ZM2A 2UXDI 2V34A 1XNQE 2ZITA 4DV1I 4X64I 4DV5I 3V2UC 2UXCI 4AQYE 5LMNI 4DR6I 1N33I 1U2RA 2UUAE 2Q2EB 3LTOA 4JI5E 4JI1I 1Z5CA 3J81Q 1H7UA 4X62E 1ZM4A 2UUBE 1HR0I 2A2DA 2UXBE 4USKA 1NZ0A 3OTOE 5IT9Q 3B78A 4LF9I 3QT6A 4YHHE 4USMA 4FWGA
chains in the Genus database with same CATH superfamily
5FWKA 4JI6E 2BM1A 4DUYE 4AIDA 5JEAE 4LF6I 5C0XE 2X7IA 4DV3I 1KIJA 2V8PA 1FJGI 1Z0CA 2JEBA 4N3OA 5IWAE 1HNXE 1N0VC 4NBQA 4B3RE 2PO2B 3ZM7A 2HKEA 4IZKA 1Y4UA 4AQYI 1MX0A 3PYGA 2UU9E 5L3JA 2BM0A 2UUCI 1BKNA 2UUAI 4DV0E 2NN6F 3WU4A 3L7ZA 4JI5I 3P3EA 1HK7A 3GCMA 4X62I 2UUBI 3M6AA 5FLXQ 2UXBI 2R42A 1XMQE 3OTOI 4DV2E 4MU3A 4ISAA 2EFGA 4M1KA 4YHHI 4OO1D 3GMEA 4DU7A 3B4TA 3P76A 3PS2A 2UXDE 2PNLA 3T1YE 3J81C 4MYUA 3ZKBA 1USUA 4JI6I 4DUYI 2CVEA 2VQFE 5IT9C 1IBKE 1XMOE 3U1YA 1QZRA 2PO0B 5IWAI 1N34E 1HNXI 4IFDC 4B3RI 4URLA 1Z5BA 2BA1G 2V2QA 2HFSA 4B3SI 4ED4A 3P06A 1MU5A 2UU9I 4OO1B 2HK2A 1DARA 5JEAD 5C0XD 1FI4A 1YHCA 4FWHA 1KTVA 3K17A 2VQEE 1Z0GA 1IBME 1Z0WA 4LFCE 1XMQI 1S4EA 4DV2I 2Z5BB 3WU5A 4FN5A 1ELOA 4EMDA 4IFDF 4B3ME 3PS3A 1IBLE 2HK3A 3T1YI 2GS8A 2C38B 2IERA 2HKJA 4HXZA 2F1DA 1J5EI 1XHKA 1OJ4A 1H74A 5FLXC 3Q6MA 2PO1B 4JYAE 1OYSA 2VQFI 1Z0EA 1IBKI 1XMOI 5DROA 1RR9A 3ZKDA 4DR3I 3ZZ0A 3U1KA 2A2CA 2UUCE 1N34I 4OZEA 4DR2E 1H7SA 4AM3A 4ZVIA 4MU0A 2Z5EA 1P42A 4IFDA 3HJCA 5LL6R 2V2ZA 4IZJA 1UDOA 4KHPI 3CWVA 2IOQA 4B3TI 3NZKA 2WP8A 4FW7A 4JI0E 2VQEI 4DV4E 4WUDA 4LF7E 1IBMI 3P3GA 4HY1A 4LFCI 1KKHA 4FW6A 5K36D 2WNRB 2O1VA 4NXNI 4X66E 1FKAE 4B3MI 1IBLI 1VI7A 2X36A 3CDJA 4LCFA 4I3HA 5LMUE 1B62A 1UDSA 4B3SE 4JYAI 3H1CA 2O1UA 3ZZTA 4LCGA 2BA0D 4DR2I 1KVKA 4BA1A 4WUCA 1ZM9A 4LOMA 5K36B 1OYRA 1UDQA 1S16A 1PIEA 4IZKB 4JG4A 4JI4E 3LPSA 4DV7E 3M85G 4DR7E 3HULA 2VF3A 1XXEA 4GKKE 4LFAE 1Z0BA 1OYPA 2C39A 2GQ0A 1Z0VA 4JI0I 5DRRA 3GLLA 3L7ZB 1R6MA 2PNZB 4DV4I 4K0KE 4LF7I 1J5EE 4DXLA 5JEAC 1Y4SA 4OO1F 4DPWA 1D6TA 1A6FA 1Y6ZA 4KQVA 3WU6A 1I94E 4X66I 4BA2B 1N32E 4NXMI 4DR3E 4JI3E 4RPFA 4DPXA 2CGEA 2E1RA 4MU1A 2PO0A 5LMUI 4GKJE 1Z5AA 5K36E 4P7AA 5BR8E 3KRNA 2NN6B 1EI1A 4JV5I 4PU9A 1WUUA 4KHPE 4OO1A 4B3TE 3DD6A 4X65I 4MQYA 3K1JA 1ZXNA 1HNZI 4U3DA 5JEAF 1Y5YA 3PS1A 4DR4E 5C0XF 4JI4I 4DV7I 4Z7YA 3F0NA 4HACB 1UEKA 1VISA 3H4LA 4DR7I 4NXNE 1MG7A 1H73A 4GKKI 1RREA 4LFAI 2Z5BA 2AE8A 4FWDA 2NPFA 4K0KI 5GMDA 3B8HA 4R1FA 1PVGA 4JI2E 4LPFA 3JAMQ 1E3PA 2Z5CA 1ZM3A 2NN6E 3PYDA 4DPUA 4JI8E 1I94I 1N32I 5JEAA 2V2VA 1B63A 4JI3I 5C0XA 2IESA 4FWGA 1HNWE 1NHHA 3J7AG 2O3ZA 3QT7A 4GKJI 3LNUA 2HFUA 4DUZE 2DEJA 2C37B 1PKPA 5BR8I 1R6LA 4DPYA 5DRPA 4PRXA 1Z59A 3J80C 4IS9A 2JEAB 2BR2B 3D4JA 1K47A 5A2QC 2JE6A 4IFDB 4U3BA 5DNLA 4QNKA 4DR4I 4DR1E 3HKMA 4JI7E 1XNRE 2BA1D 1ZXMA 5DRQA 4OX9E 3T1HE 2J7KA 4NXME 2F4VE 2O1TA 4LF5E 5K36F 4JI2I 3V5RA 2PO2A 2CG9A 3QT8A 4JI8I 4OO1C 4DV6E 4JV5E 4UTGA 3M7NG 2IOPA 2JEBB 1HNWI 4MDTA 1YH8A 2LJPA 4LF4E 4X65E 3Q1QA 3PYEA 2WW4A 4DUZI 3JAMC 1UDNA 1HNZE 1XNQI 4HYMA 4IFDE 4XTJA 5K36A 4YY3E 4FW9A 2VESA 4LCHA 1H72C 2NN6D 4GQUA 2O1WA 4BA1B 2XEXA 1N36E 4LF8E 1E3HA 4Z7CA 2PNZA 5ELWA 4DR1I 4JI7I 1XNRI 4LFBE 5C0XC 2E5LE 4PRVA 1NHJA 2ZM6E 4OX9I 2GO4A 3T1HI 1N0UA 3J80Q 2F4VI 3WU3A 4BA2A 3K85A 2HHHE 2ZBKB 5A2QQ 4LF5I 2C39B 4DR5E 3B82A 1EA6A 4DU8A 4DV1E 2AJ4A 4DV6I 4X64E 4DV5E 1NHIA 2CZ9A 1FWKA 2NN6A 4UT4A 2UXCE 4FW3A 5DNXA 4FW4A 3CDIA 4LF4I 5LMNE 2GO3A 4DR6E 1N33E 3UHMA 3ZZUA 2R3VA 4JI1E 4YY3I 1FNMA 3Q6NA 4WUBA 1HR0E 2JT2A 4HACA 2BV3A 2OI2A 3M7ND 1USVA 1Y60A 4LF9E 2J65A 1N36I 4J3DA 4DPTA 4DV0I 4LF8I 5EL9A 4AIMA 4P52A 2C38A 4LFBI 2DEIA 2E5LI 4IFDD 5GMEA 3GONA 2ZM6I 2PO1A 3QT5A 2BA0G 3J7AM 4MYTA 2HHHI 4IZJD 3M85D 4LF6E 4FW5A 4DV3E 1FJGE 4DR5I 1Z0TA 1FWLA 5K36C 1ZM2A 2UXDI 2V34A 1XNQE 2ZITA 2Z5CB 4DV1I 4X64I 2C37A 4DV5I 3V2UC 2UXCI 5JEAB 4AQYE 5C0XB 4OO1E 5LMNI 4MU4A 4DR6I 1N33I 2JEAA 3P3CA 1U2RA 2BR2A 2UUAE 2Q2EB 3LTOA 4OKGA 4JI5E 4QNJA 4JI1I 1Z5CA 3J81Q 1H7UA 4X62E 4IZJB 1ZM4A 2UUBE 1HR0I 2WNRA 2A2DA 2UXBE 4USKA 1NZ0A 3OTOE 5IT9Q 3B78A 2WP8B 4LF9I 3PRYA 3QT6A 4YHHE 4USMA 2JE6B 1RHYA 2NN6C 2PNMA 5EKWA 3PYFA
chains in the Genus database with same CATH topology
5FWKA 4JI6E 2BM1A 4DUYE 4LF6I 2X7IA 4DV3I 1KIJA 2V8PA 1FJGI 1Z0CA 4N3OA 5IWAE 1HNXE 1N0VC 4B3RE 3ZM7A 2HKEA 4IZKA 1Y4UA 3PYFA 4AQYI 1MX0A 3PYGA 2UU9E 5L3JA 2BM0A 2UUCI 1BKNA 2UUAI 4DV0E 3WU4A 4JI5I 1HK7A 4X62I 2UUBI 3M6AA 5FLXQ 2UXBI 2R42A 1XMQE 3OTOI 4DV2E 2EFGA 4M1KA 4YHHI 4DU7A 2UXDE 2PNLA 3T1YE 3J81C 4MYUA 3ZKBA 1USUA 4JI6I 4DUYI 2VQFE 5IT9C 1IBKE 1XMOE 5IWAI 1QZRA 1HNXI 1N34E 4B3RI 4URLA 1Z5BA 2V2QA 2HFSA 4B3SI 4ED4A 3P06A 1MU5A 2UU9I 2HK2A 1DARA 1FI4A 4FWHA 1KTVA 3K17A 2VQEE 1Z0GA 1IBME 1Z0WA 4LFCE 1XMQI 1S4EA 4DV2I 2Z5BB 3WU5A 4FN5A 1ELOA 4EMDA 4B3ME 1IBLE 2HK3A 3T1YI 2GS8A 2HKJA 4HXZA 1J5EI 1XHKA 1OJ4A 1H74A 5FLXC 3Q6MA 4JYAE 2VQFI 1Z0EA 1IBKI 1XMOI 1RR9A 3ZKDA 4DR3I 3ZZ0A 2A2CA 2UUCE 1N34I 4DR2E 1H7SA 4ZVIA 2Z5EA 3HJCA 5LL6R 2V2ZA 4IZJA 4KHPI 3CWVA 2IOQA 4B3TI 4JI0E 2VQEI 4DV4E 4WUDA 4LF7E 1IBMI 4LFCI 4HY1A 1KKHA 2O1VA 4NXNI 4X66E 1FKAE 4B3MI 1IBLI 2X36A 4I3HA 5LMUE 1B62A 4B3SE 4JYAI 2O1UA 3ZZTA 4DR2I 1KVKA 4WUCA 1ZM9A 1S16A 1PIEA 4IZKB 4JG4A 4JI4E 3LPSA 4DV7E 4DR7E 3HULA 2VF3A 4GKKE 4LFAE 1Z0BA 2GQ0A 4JI0I 1Z0VA 4K0KE 4DV4I 4LF7I 1J5EE 4DXLA 1Y4SA 4DPWA 1D6TA 1A6FA 1Y6ZA 4KQVA 3WU6A 1I94E 4X66I 1N32E 4NXMI 4DR3E 4JI3E 4RPFA 4DPXA 2CGEA 2E1RA 4GKJE 5LMUI 1Z5AA 4P7AA 5BR8E 1EI1A 4JV5I 4PU9A 1WUUA 4KHPE 4B3TE 4X65I 3K1JA 1ZXNA 1HNZI 4DR4E 4JI4I 4DV7I 4Z7YA 3F0NA 4HACB 1UEKA 1VISA 3H4LA 4DR7I 4NXNE 1MG7A 1H73A 4GKKI 1RREA 4LFAI 2Z5BA 4FWDA 2NPFA 4K0KI 5GMDA 3B8HA 4R1FA 1PVGA 4JI2E 3JAMQ 2Z5CA 1ZM3A 3PYDA 4DPUA 4JI8E 1I94I 1N32I 2V2VA 1B63A 4JI3I 1HNWE 1NHHA 3J7AG 3QT7A 4GKJI 3LNUA 2HFUA 4DUZE 2DEJA 1PKPA 5BR8I 4DPYA 4PRXA 1Z59A 3J80C 3D4JA 1K47A 5A2QC 4DR4I 4DR1E 4JI7E 1XNRE 1ZXMA 4OX9E 3T1HE 2J7KA 4NXME 2F4VE 2O1TA 4LF5E 4JI2I 3V5RA 2CG9A 3QT8A 4JI8I 4JV5E 4DV6E 4UTGA 2IOPA 1HNWI 2LJPA 4LF4E 4X65E 3Q1QA 3PYEA 2WW4A 4DUZI 3JAMC 1HNZE 1XNQI 4HYMA 4XTJA 4YY3E 4FW9A 1H72C 2O1WA 2XEXA 1N36E 4LF8E 4Z7CA 4DR1I 4JI7I 1XNRI 4LFBE 2E5LE 4PRVA 1NHJA 2ZM6E 4OX9I 3T1HI 1N0UA 3J80Q 2F4VI 3WU3A 3K85A 2HHHE 2ZBKB 5A2QQ 4LF5I 4DR5E 3B82A 1EA6A 4DU8A 4DV1E 2AJ4A 4DV6I 4X64E 4DV5E 1NHIA 2CZ9A 1FWKA 4UT4A 2UXCE 4LF4I 5LMNE 4DR6E 1N33E 3ZZUA 2R3VA 4JI1E 4YY3I 1FNMA 3Q6NA 4WUBA 1HR0E 4HACA 2BV3A 2OI2A 1USVA 4LF9E 1N36I 4DPTA 4DV0I 4LF8I 4P52A 4LFBI 2DEIA 2E5LI 5GMEA 3GONA 2ZM6I 3QT5A 3J7AM 4MYTA 2HHHI 4IZJD 4LF6E 4DV3E 1FJGE 4DR5I 1Z0TA 1FWLA 1ZM2A 2UXDI 2V34A 1XNQE 2ZITA 2Z5CB 4DV1I 4X64I 4DV5I 3V2UC 2UXCI 4AQYE 5LMNI 4DR6I 1N33I 1U2RA 2UUAE 2Q2EB 3LTOA 4JI5E 4JI1I 1Z5CA 3J81Q 1H7UA 4X62E 4IZJB 1ZM4A 2UUBE 1HR0I 2A2DA 2UXBE 4USKA 1NZ0A 3OTOE 5IT9Q 3B78A 4LF9I 3PRYA 3QT6A 4YHHE 4USMA 2PNMA 4FWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 E;  2BM1 A;  4DUY E;  4LF6 I;  2X7I A;  4DV3 I;  1KIJ A;  2V8P A;  1FJG I;  1Z0C A;  5IWA E;  1HNX E;  1N0V C;  4B3R E;  3ZM7 A;  2HKE A;  3PYF A;  4AQY I;  1MX0 A;  3PYG A;  2UU9 E;  5L3J A;  2BM0 A;  2UUC I;  1BKN A;  2UUA I;  4DV0 E;  3WU4 A;  4JI5 I;  4X62 I;  2UUB I;  3M6A A;  5FLX Q;  2UXB I;  2R42 A;  1XMQ E;  3OTO I;  4DV2 E;  2EFG A;  4M1K A;  4YHH I;  4DU7 A;  2UXD E;  3T1Y E;  3J81 C;  4MYU A;  3ZKB A;  4JI6 I;  4DUY I;  2VQF E;  5IT9 C;  1IBK E;  1XMO E;  5IWA I;  1QZR A;  1HNX I;  1N34 E;  4B3R I;  4URL A;  1Z5B A;  2V2Q A;  2HFS A;  4B3S I;  4ED4 A;  1MU5 A;  2UU9 I;  2HK2 A;  1DAR A;  1FI4 A;  4FWH A;  1KTV A;  3K17 A;  2VQE E;  1Z0G A;  1IBM E;  1Z0W A;  4LFC E;  1XMQ I;  1S4E A;  4DV2 I;  3WU5 A;  4FN5 A;  1ELO A;  4EMD A;  4B3M E;  1IBL E;  2HK3 A;  3T1Y I;  2GS8 A;  2HKJ A;  4HXZ A;  1J5E I;  1XHK A;  1OJ4 A;  1H74 A;  5FLX C;  4JYA E;  2VQF I;  1Z0E A;  1IBK I;  1XMO I;  1RR9 A;  3ZKD A;  4DR3 I;  3ZZ0 A;  2A2C A;  2UUC E;  1N34 I;  4DR2 E;  1H7S A;  4ZVI A;  5LL6 R;  2V2Z A;  4KHP I;  3CWV A;  4B3T I;  4JI0 E;  2VQE I;  4DV4 E;  4WUD A;  4LF7 E;  1IBM I;  4LFC I;  4HY1 A;  1KKH A;  4NXN I;  4X66 E;  1FKA E;  4B3M I;  1IBL I;  2X36 A;  4I3H A;  5LMU E;  1B62 A;  4B3S E;  4JYA I;  3ZZT A;  4DR2 I;  1KVK A;  4WUC A;  1ZM9 A;  1S16 A;  1PIE A;  4JG4 A;  4JI4 E;  3LPS A;  4DV7 E;  4DR7 E;  3HUL A;  2VF3 A;  4GKK E;  4LFA E;  1Z0B A;  4JI0 I;  1Z0V A;  4K0K E;  4DV4 I;  4LF7 I;  1J5E E;  4DXL A;  4DPW A;  1D6T A;  1A6F A;  4KQV A;  3WU6 A;  1I94 E;  4X66 I;  1N32 E;  4NXM I;  4DR3 E;  4JI3 E;  4RPF A;  4DPX A;  2E1R A;  4GKJ E;  5LMU I;  1Z5A A;  4P7A A;  5BR8 E;  1EI1 A;  4JV5 I;  4PU9 A;  1WUU A;  4KHP E;  4B3T E;  4X65 I;  3K1J A;  1ZXN A;  1HNZ I;  4DR4 E;  4JI4 I;  4DV7 I;  4Z7Y A;  3F0N A;  4HAC B;  1UEK A;  1VIS A;  3H4L A;  4DR7 I;  4NXN E;  1MG7 A;  1H73 A;  4GKK I;  1RRE A;  4LFA I;  4FWD A;  2NPF A;  4K0K I;  5GMD A;  3B8H A;  4R1F A;  1PVG A;  4JI2 E;  3JAM Q;  1ZM3 A;  3PYD A;  4DPU A;  4JI8 E;  1I94 I;  1N32 I;  2V2V A;  1B63 A;  4JI3 I;  1HNW E;  1NHH A;  3J7A G;  3QT7 A;  4GKJ I;  3LNU A;  2HFU A;  4DUZ E;  2DEJ A;  1PKP A;  5BR8 I;  4DPY A;  4PRX A;  1Z59 A;  3J80 C;  3D4J A;  1K47 A;  5A2Q C;  4DR4 I;  4DR1 E;  4JI7 E;  1XNR E;  1ZXM A;  4OX9 E;  3T1H E;  2J7K A;  4NXM E;  2F4V E;  4LF5 E;  4JI2 I;  3V5R A;  3QT8 A;  4JI8 I;  4JV5 E;  4DV6 E;  4UTG A;  1HNW I;  2LJP A;  4LF4 E;  4X65 E;  3Q1Q A;  3PYE A;  2WW4 A;  4DUZ I;  3JAM C;  1HNZ E;  1XNQ I;  4HYM A;  4XTJ A;  4YY3 E;  4FW9 A;  1H72 C;  2XEX A;  1N36 E;  4LF8 E;  4Z7C A;  4DR1 I;  4JI7 I;  1XNR I;  4LFB E;  2E5L E;  4PRV A;  1NHJ A;  2ZM6 E;  4OX9 I;  3T1H I;  1N0U A;  3J80 Q;  2F4V I;  3WU3 A;  2HHH E;  2ZBK B;  5A2Q Q;  4LF5 I;  4DR5 E;  3B82 A;  1EA6 A;  4DU8 A;  4DV1 E;  2AJ4 A;  4DV6 I;  4X64 E;  4DV5 E;  1NHI A;  2CZ9 A;  1FWK A;  4UT4 A;  2UXC E;  4LF4 I;  5LMN E;  4DR6 E;  1N33 E;  3ZZU A;  2R3V A;  4JI1 E;  4YY3 I;  1FNM A;  4WUB A;  1HR0 E;  4HAC A;  2BV3 A;  2OI2 A;  4LF9 E;  1N36 I;  4DPT A;  4DV0 I;  4LF8 I;  4P52 A;  4LFB I;  2DEI A;  2E5L I;  5GME A;  3GON A;  2ZM6 I;  3QT5 A;  3J7A M;  4MYT A;  2HHH I;  4LF6 E;  4DV3 E;  1FJG E;  4DR5 I;  1Z0T A;  1FWL A;  1ZM2 A;  2UXD I;  2V34 A;  1XNQ E;  2ZIT A;  4DV1 I;  4X64 I;  4DV5 I;  3V2U C;  2UXC I;  4AQY E;  5LMN I;  4DR6 I;  1N33 I;  1U2R A;  2UUA E;  2Q2E B;  3LTO A;  4JI5 E;  4JI1 I;  1Z5C A;  3J81 Q;  1H7U A;  4X62 E;  1ZM4 A;  2UUB E;  1HR0 I;  2A2D A;  2UXB E;  4USK A;  1NZ0 A;  3OTO E;  5IT9 Q;  3B78 A;  4LF9 I;  3QT6 A;  4YHH E;  4USM A;  4FWG A; 
#chains in the Genus database with same CATH topology
 5FWK A;  4JI6 E;  2BM1 A;  4DUY E;  4AID A;  5JEA E;  4LF6 I;  5C0X E;  2X7I A;  4DV3 I;  1KIJ A;  2V8P A;  1FJG I;  1Z0C A;  2JEB A;  4N3O A;  5IWA E;  1HNX E;  1N0V C;  4NBQ A;  4B3R E;  2PO2 B;  3ZM7 A;  2HKE A;  4IZK A;  1Y4U A;  4AQY I;  1MX0 A;  3PYG A;  2UU9 E;  5L3J A;  2BM0 A;  2UUC I;  1BKN A;  2UUA I;  4DV0 E;  2NN6 F;  3WU4 A;  3L7Z A;  4JI5 I;  3P3E A;  1HK7 A;  3GCM A;  4X62 I;  2UUB I;  3M6A A;  5FLX Q;  2UXB I;  2R42 A;  1XMQ E;  3OTO I;  4DV2 E;  4MU3 A;  4ISA A;  2EFG A;  4M1K A;  4YHH I;  4OO1 D;  3GME A;  4DU7 A;  3B4T A;  3P76 A;  3PS2 A;  2UXD E;  2PNL A;  3T1Y E;  3J81 C;  4MYU A;  3ZKB A;  1USU A;  4JI6 I;  4DUY I;  2CVE A;  2VQF E;  5IT9 C;  1IBK E;  1XMO E;  3U1Y A;  1QZR A;  2PO0 B;  5IWA I;  1N34 E;  1HNX I;  4IFD C;  4B3R I;  4URL A;  1Z5B A;  2BA1 G;  2V2Q A;  2HFS A;  4B3S I;  4ED4 A;  3P06 A;  1MU5 A;  2UU9 I;  4OO1 B;  2HK2 A;  1DAR A;  5JEA D;  5C0X D;  1FI4 A;  1YHC A;  4FWH A;  1KTV A;  3K17 A;  2VQE E;  1Z0G A;  1IBM E;  1Z0W A;  4LFC E;  1XMQ I;  1S4E A;  4DV2 I;  2Z5B B;  3WU5 A;  4FN5 A;  1ELO A;  4EMD A;  4IFD F;  4B3M E;  3PS3 A;  1IBL E;  2HK3 A;  3T1Y I;  2GS8 A;  2C38 B;  2IER A;  2HKJ A;  4HXZ A;  2F1D A;  1J5E I;  1XHK A;  1OJ4 A;  1H74 A;  5FLX C;  3Q6M A;  2PO1 B;  4JYA E;  1OYS A;  2VQF I;  1Z0E A;  1IBK I;  1XMO I;  5DRO A;  1RR9 A;  3ZKD A;  4DR3 I;  3ZZ0 A;  3U1K A;  2A2C A;  2UUC E;  1N34 I;  4OZE A;  4DR2 E;  1H7S A;  4AM3 A;  4ZVI A;  4MU0 A;  2Z5E A;  1P42 A;  4IFD A;  3HJC A;  5LL6 R;  2V2Z A;  4IZJ A;  1UDO A;  4KHP I;  3CWV A;  2IOQ A;  4B3T I;  3NZK A;  2WP8 A;  4FW7 A;  4JI0 E;  2VQE I;  4DV4 E;  4WUD A;  4LF7 E;  1IBM I;  3P3G A;  4HY1 A;  4LFC I;  1KKH A;  4FW6 A;  5K36 D;  2WNR B;  2O1V A;  4NXN I;  4X66 E;  1FKA E;  4B3M I;  1IBL I;  1VI7 A;  2X36 A;  3CDJ A;  4LCF A;  4I3H A;  5LMU E;  1B62 A;  1UDS A;  4B3S E;  4JYA I;  3H1C A;  2O1U A;  3ZZT A;  4LCG A;  2BA0 D;  4DR2 I;  1KVK A;  4BA1 A;  4WUC A;  1ZM9 A;  4LOM A;  5K36 B;  1OYR A;  1UDQ A;  1S16 A;  1PIE A;  4IZK B;  4JG4 A;  4JI4 E;  3LPS A;  4DV7 E;  3M85 G;  4DR7 E;  3HUL A;  2VF3 A;  1XXE A;  4GKK E;  4LFA E;  1Z0B A;  1OYP A;  2C39 A;  2GQ0 A;  1Z0V A;  4JI0 I;  5DRR A;  3GLL A;  3L7Z B;  1R6M A;  2PNZ B;  4DV4 I;  4K0K E;  4LF7 I;  1J5E E;  4DXL A;  5JEA C;  1Y4S A;  4OO1 F;  4DPW A;  1D6T A;  1A6F A;  1Y6Z A;  4KQV A;  3WU6 A;  1I94 E;  4X66 I;  4BA2 B;  1N32 E;  4NXM I;  4DR3 E;  4JI3 E;  4RPF A;  4DPX A;  2CGE A;  2E1R A;  4MU1 A;  2PO0 A;  5LMU I;  4GKJ E;  1Z5A A;  5K36 E;  4P7A A;  5BR8 E;  3KRN A;  2NN6 B;  1EI1 A;  4JV5 I;  4PU9 A;  1WUU A;  4KHP E;  4OO1 A;  4B3T E;  3DD6 A;  4X65 I;  4MQY A;  3K1J A;  1ZXN A;  1HNZ I;  4U3D A;  5JEA F;  1Y5Y A;  3PS1 A;  4DR4 E;  5C0X F;  4JI4 I;  4DV7 I;  4Z7Y A;  3F0N A;  4HAC B;  1UEK A;  1VIS A;  3H4L A;  4DR7 I;  4NXN E;  1MG7 A;  1H73 A;  4GKK I;  1RRE A;  4LFA I;  2Z5B A;  2AE8 A;  4FWD A;  2NPF A;  4K0K I;  5GMD A;  3B8H A;  4R1F A;  1PVG A;  4JI2 E;  4LPF A;  3JAM Q;  1E3P A;  2Z5C A;  1ZM3 A;  2NN6 E;  3PYD A;  4DPU A;  4JI8 E;  1I94 I;  1N32 I;  5JEA A;  2V2V A;  1B63 A;  4JI3 I;  5C0X A;  2IES A;  4FWG A;  1HNW E;  1NHH A;  3J7A G;  2O3Z A;  3QT7 A;  4GKJ I;  3LNU A;  2HFU A;  4DUZ E;  2DEJ A;  2C37 B;  1PKP A;  5BR8 I;  1R6L A;  4DPY A;  5DRP A;  4PRX A;  1Z59 A;  3J80 C;  4IS9 A;  2JEA B;  2BR2 B;  3D4J A;  1K47 A;  5A2Q C;  2JE6 A;  4IFD B;  4U3B A;  5DNL A;  4QNK A;  4DR4 I;  4DR1 E;  3HKM A;  4JI7 E;  1XNR E;  2BA1 D;  1ZXM A;  5DRQ A;  4OX9 E;  3T1H E;  2J7K A;  4NXM E;  2F4V E;  2O1T A;  4LF5 E;  5K36 F;  4JI2 I;  3V5R A;  2PO2 A;  2CG9 A;  3QT8 A;  4JI8 I;  4OO1 C;  4DV6 E;  4JV5 E;  4UTG A;  3M7N G;  2IOP A;  2JEB B;  1HNW I;  4MDT A;  1YH8 A;  2LJP A;  4LF4 E;  4X65 E;  3Q1Q A;  3PYE A;  2WW4 A;  4DUZ I;  3JAM C;  1UDN A;  1HNZ E;  1XNQ I;  4HYM A;  4IFD E;  4XTJ A;  5K36 A;  4YY3 E;  4FW9 A;  2VES A;  4LCH A;  1H72 C;  2NN6 D;  4GQU A;  2O1W A;  4BA1 B;  2XEX A;  1N36 E;  4LF8 E;  1E3H A;  4Z7C A;  2PNZ A;  5ELW A;  4DR1 I;  4JI7 I;  1XNR I;  4LFB E;  5C0X C;  2E5L E;  4PRV A;  1NHJ A;  2ZM6 E;  4OX9 I;  2GO4 A;  3T1H I;  1N0U A;  3J80 Q;  2F4V I;  3WU3 A;  4BA2 A;  3K85 A;  2HHH E;  2ZBK B;  5A2Q Q;  4LF5 I;  2C39 B;  4DR5 E;  3B82 A;  1EA6 A;  4DU8 A;  4DV1 E;  2AJ4 A;  4DV6 I;  4X64 E;  4DV5 E;  1NHI A;  2CZ9 A;  1FWK A;  2NN6 A;  4UT4 A;  2UXC E;  4FW3 A;  5DNX A;  4FW4 A;  3CDI A;  4LF4 I;  5LMN E;  2GO3 A;  4DR6 E;  1N33 E;  3UHM A;  3ZZU A;  2R3V A;  4JI1 E;  4YY3 I;  1FNM A;  3Q6N A;  4WUB A;  1HR0 E;  2JT2 A;  4HAC A;  2BV3 A;  2OI2 A;  3M7N D;  1USV A;  1Y60 A;  4LF9 E;  2J65 A;  1N36 I;  4J3D A;  4DPT A;  4DV0 I;  4LF8 I;  5EL9 A;  4AIM A;  4P52 A;  2C38 A;  4LFB I;  2DEI A;  2E5L I;  4IFD D;  5GME A;  3GON A;  2ZM6 I;  2PO1 A;  3QT5 A;  2BA0 G;  3J7A M;  4MYT A;  2HHH I;  4IZJ D;  3M85 D;  4LF6 E;  4FW5 A;  4DV3 E;  1FJG E;  4DR5 I;  1Z0T A;  1FWL A;  5K36 C;  1ZM2 A;  2UXD I;  2V34 A;  1XNQ E;  2ZIT A;  2Z5C B;  4DV1 I;  4X64 I;  2C37 A;  4DV5 I;  3V2U C;  2UXC I;  5JEA B;  4AQY E;  5C0X B;  4OO1 E;  5LMN I;  4MU4 A;  4DR6 I;  1N33 I;  2JEA A;  3P3C A;  1U2R A;  2BR2 A;  2UUA E;  2Q2E B;  3LTO A;  4OKG A;  4JI5 E;  4QNJ A;  4JI1 I;  1Z5C A;  3J81 Q;  1H7U A;  4X62 E;  4IZJ B;  1ZM4 A;  2UUB E;  1HR0 I;  2WNR A;  2A2D A;  2UXB E;  4USK A;  1NZ0 A;  3OTO E;  5IT9 Q;  3B78 A;  2WP8 B;  4LF9 I;  3PRY A;  3QT6 A;  4YHH E;  4USM A;  2JE6 B;  1RHY A;  2NN6 C;  2PNM A;  5EKW A;  3PYF A; 
#chains in the Genus database with same CATH homology
 5FWK A;  4JI6 E;  2BM1 A;  4DUY E;  4LF6 I;  2X7I A;  4DV3 I;  1KIJ A;  2V8P A;  1FJG I;  1Z0C A;  4N3O A;  5IWA E;  1HNX E;  1N0V C;  4B3R E;  3ZM7 A;  2HKE A;  4IZK A;  1Y4U A;  3PYF A;  4AQY I;  1MX0 A;  3PYG A;  2UU9 E;  5L3J A;  2BM0 A;  2UUC I;  1BKN A;  2UUA I;  4DV0 E;  3WU4 A;  4JI5 I;  1HK7 A;  4X62 I;  2UUB I;  3M6A A;  5FLX Q;  2UXB I;  2R42 A;  1XMQ E;  3OTO I;  4DV2 E;  2EFG A;  4M1K A;  4YHH I;  4DU7 A;  2UXD E;  2PNL A;  3T1Y E;  3J81 C;  4MYU A;  3ZKB A;  1USU A;  4JI6 I;  4DUY I;  2VQF E;  5IT9 C;  1IBK E;  1XMO E;  5IWA I;  1QZR A;  1HNX I;  1N34 E;  4B3R I;  4URL A;  1Z5B A;  2V2Q A;  2HFS A;  4B3S I;  4ED4 A;  3P06 A;  1MU5 A;  2UU9 I;  2HK2 A;  1DAR A;  1FI4 A;  4FWH A;  1KTV A;  3K17 A;  2VQE E;  1Z0G A;  1IBM E;  1Z0W A;  4LFC E;  1XMQ I;  1S4E A;  4DV2 I;  2Z5B B;  3WU5 A;  4FN5 A;  1ELO A;  4EMD A;  4B3M E;  1IBL E;  2HK3 A;  3T1Y I;  2GS8 A;  2HKJ A;  4HXZ A;  1J5E I;  1XHK A;  1OJ4 A;  1H74 A;  5FLX C;  3Q6M A;  4JYA E;  2VQF I;  1Z0E A;  1IBK I;  1XMO I;  1RR9 A;  3ZKD A;  4DR3 I;  3ZZ0 A;  2A2C A;  2UUC E;  1N34 I;  4DR2 E;  1H7S A;  4ZVI A;  2Z5E A;  3HJC A;  5LL6 R;  2V2Z A;  4IZJ A;  4KHP I;  3CWV A;  2IOQ A;  4B3T I;  4JI0 E;  2VQE I;  4DV4 E;  4WUD A;  4LF7 E;  1IBM I;  4LFC I;  4HY1 A;  1KKH A;  2O1V A;  4NXN I;  4X66 E;  1FKA E;  4B3M I;  1IBL I;  2X36 A;  4I3H A;  5LMU E;  1B62 A;  4B3S E;  4JYA I;  2O1U A;  3ZZT A;  4DR2 I;  1KVK A;  4WUC A;  1ZM9 A;  1S16 A;  1PIE A;  4IZK B;  4JG4 A;  4JI4 E;  3LPS A;  4DV7 E;  4DR7 E;  3HUL A;  2VF3 A;  4GKK E;  4LFA E;  1Z0B A;  2GQ0 A;  4JI0 I;  1Z0V A;  4K0K E;  4DV4 I;  4LF7 I;  1J5E E;  4DXL A;  1Y4S A;  4DPW A;  1D6T A;  1A6F A;  1Y6Z A;  4KQV A;  3WU6 A;  1I94 E;  4X66 I;  1N32 E;  4NXM I;  4DR3 E;  4JI3 E;  4RPF A;  4DPX A;  2CGE A;  2E1R A;  4GKJ E;  5LMU I;  1Z5A A;  4P7A A;  5BR8 E;  1EI1 A;  4JV5 I;  4PU9 A;  1WUU A;  4KHP E;  4B3T E;  4X65 I;  3K1J A;  1ZXN A;  1HNZ I;  4DR4 E;  4JI4 I;  4DV7 I;  4Z7Y A;  3F0N A;  4HAC B;  1UEK A;  1VIS A;  3H4L A;  4DR7 I;  4NXN E;  1MG7 A;  1H73 A;  4GKK I;  1RRE A;  4LFA I;  2Z5B A;  4FWD A;  2NPF A;  4K0K I;  5GMD A;  3B8H A;  4R1F A;  1PVG A;  4JI2 E;  3JAM Q;  2Z5C A;  1ZM3 A;  3PYD A;  4DPU A;  4JI8 E;  1I94 I;  1N32 I;  2V2V A;  1B63 A;  4JI3 I;  1HNW E;  1NHH A;  3J7A G;  3QT7 A;  4GKJ I;  3LNU A;  2HFU A;  4DUZ E;  2DEJ A;  1PKP A;  5BR8 I;  4DPY A;  4PRX A;  1Z59 A;  3J80 C;  3D4J A;  1K47 A;  5A2Q C;  4DR4 I;  4DR1 E;  4JI7 E;  1XNR E;  1ZXM A;  4OX9 E;  3T1H E;  2J7K A;  4NXM E;  2F4V E;  2O1T A;  4LF5 E;  4JI2 I;  3V5R A;  2CG9 A;  3QT8 A;  4JI8 I;  4JV5 E;  4DV6 E;  4UTG A;  2IOP A;  1HNW I;  2LJP A;  4LF4 E;  4X65 E;  3Q1Q A;  3PYE A;  2WW4 A;  4DUZ I;  3JAM C;  1HNZ E;  1XNQ I;  4HYM A;  4XTJ A;  4YY3 E;  4FW9 A;  1H72 C;  2O1W A;  2XEX A;  1N36 E;  4LF8 E;  4Z7C A;  4DR1 I;  4JI7 I;  1XNR I;  4LFB E;  2E5L E;  4PRV A;  1NHJ A;  2ZM6 E;  4OX9 I;  3T1H I;  1N0U A;  3J80 Q;  2F4V I;  3WU3 A;  3K85 A;  2HHH E;  2ZBK B;  5A2Q Q;  4LF5 I;  4DR5 E;  3B82 A;  1EA6 A;  4DU8 A;  4DV1 E;  2AJ4 A;  4DV6 I;  4X64 E;  4DV5 E;  1NHI A;  2CZ9 A;  1FWK A;  4UT4 A;  2UXC E;  4LF4 I;  5LMN E;  4DR6 E;  1N33 E;  3ZZU A;  2R3V A;  4JI1 E;  4YY3 I;  1FNM A;  3Q6N A;  4WUB A;  1HR0 E;  4HAC A;  2BV3 A;  2OI2 A;  1USV A;  4LF9 E;  1N36 I;  4DPT A;  4DV0 I;  4LF8 I;  4P52 A;  4LFB I;  2DEI A;  2E5L I;  5GME A;  3GON A;  2ZM6 I;  3QT5 A;  3J7A M;  4MYT A;  2HHH I;  4IZJ D;  4LF6 E;  4DV3 E;  1FJG E;  4DR5 I;  1Z0T A;  1FWL A;  1ZM2 A;  2UXD I;  2V34 A;  1XNQ E;  2ZIT A;  2Z5C B;  4DV1 I;  4X64 I;  4DV5 I;  3V2U C;  2UXC I;  4AQY E;  5LMN I;  4DR6 I;  1N33 I;  1U2R A;  2UUA E;  2Q2E B;  3LTO A;  4JI5 E;  4JI1 I;  1Z5C A;  3J81 Q;  1H7U A;  4X62 E;  4IZJ B;  1ZM4 A;  2UUB E;  1HR0 I;  2A2D A;  2UXB E;  4USK A;  1NZ0 A;  3OTO E;  5IT9 Q;  3B78 A;  4LF9 I;  3PRY A;  3QT6 A;  4YHH E;  4USM A;  2PNM A;  4FWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...