4K0KI

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4k0kI00
4FWDA 1IBME 1IBLI 1KTVA 2BV3A 2DEJA 1D6TA 1Z5BA 1FJGE 4JI3I 2AJ4A 4DV2E 4JI4I 1Z0TA 3OTOE 2ZM6E 4B3ME 3B78A 2UXCI 3QT6A 2UU9E 2LJPA 1Z5AA 1H7UA 2ZITA 1N32E 1NZ0A 5IWAI 4K0KE 4FW9A 4B3SE 2VQFI 4LFAE 5LMNE 4MYUA 1J5EE 2HK2A 3H4LA 4X64E 4Z7CA 4X66E 5GMDA 4LF7E 2E1RA 4DV5I 4X62E 4EMDA 1U2RA 4DR1I 3ZM7A 4B3RE 2HKEA 4DV7E 3PYEA 1NHJA 3ZZTA 4DUZE 1XMOE 4NXMI 1ZXNA 5BR8I 1HNXI 1H74A 4NXNE 1N33E 4JI8I 4LF4E 1IBLE 1NHIA 5LL6R 2UUBI 4OX9I 4DU7A 4DR3I 3JAMQ 2J7KA 1B62A 4DPYA 4JI3E 1KKHA 1PVGA 2V8PA 4USMA 4DV6E 4JI4E 4B3TI 2HFSA 3M6AA 4ED4A 3QT8A 1RR9A 3ZZUA 1S4EA 4P52A 4M1KA 5LMUI 1N36I 3LTOA 4DUYI 2VQEI 1FI4A 2VQFE 4PRVA 2UUCI 1XMQI 1H72C 2DEIA 1XNQI 1HNZI 2EFGA 2UUAI 4DV5E 4LF6E 4LF9I 3LNUA 3QT5A 4HACA 4JI7I 4LFCE 1MX0A 5L3JA 4DR5I 4LF5I 4NXME 2UXDI 2A2DA 2VF3A 4GKJI 5BR8E 4DV3E 4JI0I 1HR0I 4JI8E 2GS8A 2HKJA 1A6FA 2X7IA 4DPTA 4URLA 3CWVA 4JG4A 4OX9E 1K47A 4DR3E 2E5LE 3D4JA 2ZBKB 4RPFA 4B3TE 1IBKE 1ZM4A 4DV0I 4LFBE 2V2ZA 3JAMC 2BM0A 4P7AA 4JYAI 1N36E 3J80Q 5GMEA 4DPWA 4DUYE 4X65I 2VQEE 2V2QA 2UUCE 1XMQE 3T1YI 3V2UC 1XNQE 2X36A 4DR2I 4PU9A 2XEXA 3LPSA 2UUAE 1EA6A 4UT4A 4DR4I 2CZ9A 1S16A 4LF9E 5FLXC 4JI5E 4JI7E 2NPFA 3V5RA 3HULA 1ZXMA 4DR5E 2UXDE 1ZM3A 4HXZA 4JI2I 1RREA 1Z0CA 4HACB 4YHHI 1KIJA 1N0UA 1OJ4A 3F0NA 1Z0VA 4I3HA 4DV4I 5IT9Q 2UXCE 1Z0WA 4WUBA 4AQYI 4DR6I 3WU4A 1EI1A 4B3MI 4DXLA 4GKKI 4YY3I 3K17A 3ZKBA 3GONA 2UU9I 4WUCA 5IWAE 4DV0E 4XTJA 5FLXQ 3B82A 4JYAE 1N32I 2HK3A 1UEKA 3PYGA 1KVKA 1QZRA 4B3SI 4FWHA 2HHHI 4X65E 1ZM2A 1H73A 4DR7E 1J5EI 4DR1E 1I94I 3J80C 4DR2E 4LF7I 4X62I 1BKNA 3J81C 1VISA 4DPXA 2OI2A 1N34I 4DV7I 4JI1I 2A2CA 1HNXE 4DUZI 1XMOI 4Z7YA 1XHKA 1XNRI 3QT7A 4JI2E 4WUDA 2HFUA 5A2QC 4YHHE 2UUBE 4NXNI 1DARA 3PYDA 2R42A 3ZKDA 1FKAE 4DV4E 1ZM9A 4AQYE 4DR6E 4MYTA 1FWLA 4ZVIA 4DV6I 3J7AM 4JI6I 4GKKE 1MG7A 4YY3E 5LMUE 3B8HA 4KHPI 5IT9C 2Q2EB 4DU8A 3J81Q 1NHHA 1HNZE 4FN5A 4USKA 1HNWI 4JV5I 2HHHE 2F4VI 1ELOA 5A2QQ 1I94E 2UXBI 4LF6I 4KQVA 2V34A 4DPUA 4LF5E 3T1HI 1PKPA 4LFCI 4DV1I 4LF8I 1N34E 2V2VA 2BM1A 3WU6A 4GKJE 4JI1E 4DR7I 1XNRE 4JI0E 1HR0E 1IBMI 3PYFA 4FWGA 1WUUA 4DV3I 3WU3A 1FJGI 1PIEA 4DV2I 3OTOI 2ZM6I 2E5LI 1H7SA 1Z0GA 1FNMA 4JI6E 1IBKI 4HYMA 4KHPE 4K0KI 1Z59A 4LFBI 1FWKA 4LFAI 5LMNI 2R3VA 4HY1A 3T1YE 2WW4A 4X64I 1Z0BA 4X66I 1HNWE 4JV5E 1MU5A 4PRXA 4R1FA 2F4VE 4DR4E 4B3RI 3K1JA 3WU5A 3J7AG 1Z0EA 3ZZ0A 2UXBE 3T1HE 4JI5I 1B63A 4DV1E 4LF8E 1N0VC 3Q1QA 1Z5CA 1N33I 4LF4I 4UTGA
chains in the Genus database with same CATH superfamily
4FWDA 1IBME 1IBLI 1KTVA 2BV3A 2DEJA 2NN6A 1D6TA 3U1YA 1Z5BA 1FJGE 4JI3I 2AJ4A 4DV2E 4JI4I 1UDNA 1Z0TA 3OTOE 2ZM6E 4B3ME 3B78A 2UXCI 1UDOA 3QT6A 2UU9E 2IOQA 2LJPA 1Z5AA 1H7UA 2ZITA 1N32E 1NZ0A 3KRNA 5IWAI 4K0KE 5FWKA 4FW9A 2C37B 5DNXA 4B3SE 2VQFI 4LFAE 5LMNE 2Z5BA 5DRPA 4MYUA 1J5EE 2HK2A 3H4LA 4X64E 4Z7CA 4X66E 5GMDA 4IZKB 5ELWA 4LF7E 2E1RA 3P3EA 1E3PA 4AIDA 4X62E 1R6MA 4DV5I 5JEAA 5C0XD 4EMDA 1U2RA 4DR1I 3ZM7A 4B3RE 2HKEA 4DV7E 3PYEA 1NHJA 3ZZTA 4DUZE 1XMOE 2PNMA 4NXMI 1UDSA 4LOMA 1ZXNA 2PO0A 2JE6B 5BR8I 4NBQA 5C0XF 1HNXI 1Y6ZA 3P06A 1H74A 4NXNE 1N33E 4JI8I 4LF4E 5JEAF 4IFDB 1IBLE 1NHIA 5LL6R 2UUBI 4OX9I 4DU7A 4DR3I 4N3OA 3JAMQ 2J7KA 1B62A 4DPYA 3CDJA 4JI3E 1KKHA 1PVGA 2V8PA 4USMA 4DV6E 4JI4E 4IZJA 2WP8A 5EKWA 2IESA 4B3TI 2HFSA 4OKGA 3PRYA 3M6AA 4ED4A 3QT8A 2NN6B 1RR9A 2BA0D 3ZZUA 2JEBA 1S4EA 4P52A 4M1KA 5LMUI 1N36I 5K36D 3LTOA 4DUYI 2J65A 2VQEI 1OYSA 1FI4A 2VQFE 4PRVA 4MU1A 2UUCI 1XMQI 1H72C 2DEIA 4FW3A 1XNQI 2JEAA 1HNZI 2EFGA 2CGEA 2UUAI 4DV5E 4LCGA 4LF6E 4LF9I 1YH8A 3LNUA 3QT5A 4HACA 4JI7I 5DROA 4LFCE 1MX0A 3DD6A 2Z5BB 5DNLA 1Y60A 5L3JA 4DR5I 4LF5I 4NXME 2UXDI 4QNJA 2A2DA 2VF3A 5JEAB 4GKJI 5BR8E 4DV3E 1UDQA 3CDIA 3Q6MA 4JI0I 1HR0I 4JI8E 2GS8A 2HKJA 1A6FA 1VI7A 2X7IA 4DPTA 4URLA 3CWVA 4JG4A 4OX9E 1K47A 2PO0B 4DR3E 5C0XC 2E5LE 2PO1A 4AIMA 3D4JA 3GCMA 2PO2A 2ZBKB 4RPFA 5JEAC 4B3TE 1IBKE 1ZM4A 4U3BA 2F1DA 4DV0I 4LFBE 2GO4A 4IFDE 2V2ZA 3JAMC 2WNRB 3HJCA 2BM0A 4P7AA 4LPFA 4JYAI 1N36E 3J80Q 5GMEA 4DPWA 5C0XA 4DUYE 4IZJB 2WP8B 4X65I 2VQEE 2V2QA 2PNZA 2UUCE 1XMQE 3T1YI 2JEBB 3V2UC 1XNQE 2NN6E 2X36A 4DR2I 4PU9A 2XEXA 2IERA 3LPSA 2UUAE 1EA6A 4UT4A 4DR4I 2CZ9A 1S16A 4LF9E 5FLXC 2O1WA 4JI5E 2BR2A 4JI7E 4OO1E 2NPFA 3V5RA 2JEAB 2C39A 3HULA 1ZXMA 4DR5E 2UXDE 1ZM3A 5K36C 4HXZA 4JI2I 3H1CA 1RREA 1Z0CA 4HACB 4YHHI 1KIJA 1N0UA 1OJ4A 4MU0A 2BA0G 3F0NA 3B4TA 2Z5EA 1Z0VA 4U3DA 4I3HA 2O1TA 4DV4I 1Y4UA 5IT9Q 2UXCE 4OZEA 1Z0WA 2C38A 4WUBA 4AQYI 5K36A 4DR6I 3WU4A 1EI1A 2GO3A 4B3MI 5DRQA 4DXLA 2AE8A 4GKKI 4YY3I 3K17A 3ZKBA 3GONA 2UU9I 4WUCA 5IWAE 4DV0E 3M85D 2O3ZA 4XTJA 5FLXQ 3B82A 2PO1B 3P76A 4JYAE 1N32I 2HK3A 4MU4A 2PO2B 1UEKA 4BA1A 3PYGA 1KVKA 4BA2A 1QZRA 4B3SI 4FWHA 5K36F 2HHHI 4X65E 1ZM2A 2GQ0A 1H73A 4DR7E 1J5EI 4DR1E 1I94I 3J80C 4DR2E 4LF7I 4X62I 1BKNA 3J81C 1YHCA 5C0XB 1VISA 4FW7A 4DPXA 2OI2A 2PNZB 1Y4SA 1N34I 3PS1A 4MQYA 4DV7I 4JI1I 2A2CA 1HNXE 2O1VA 4DUZI 1XMOI 4Z7YA 1XHKA 1XNRI 4IFDA 3QT7A 4JI2E 4LCHA 4WUDA 2HFUA 5A2QC 4IFDD 1OYRA 2BR2B 4YHHE 2UUBE 4NXNI 1DARA 2C39B 4QNKA 3PYDA 2BA1G 2R42A 3NZKA 2VESA 3ZKDA 1FKAE 4DV4E 4IFDF 1ZM9A 2NN6D 4AQYE 4DR6E 4J3DA 4MYTA 4ZVIA 1FWLA 4IS9A 4DV6I 2BA1D 3J7AM 4JI6I 4GKKE 1MG7A 4YY3E 4OO1A 3B8HA 5LMUE 4KHPI 5EL9A 2Z5CA 5IT9C 2Q2EB 4DU8A 3J81Q 1NHHA 1RHYA 4OO1D 1E3HA 2C38B 5K36B 1OYPA 2NN6F 3L7ZA 4MDTA 1HNZE 4FN5A 4USKA 1HNWI 4JV5I 3HKMA 2HHHE 2F4VI 2IOPA 3Q6NA 4OO1F 1ELOA 5A2QQ 4GQUA 2CG9A 1I94E 2UXBI 4LF6I 4KQVA 4BA1B 2V34A 4DPUA 4LF5E 3T1HI 4BA2B 1PKPA 4LFCI 4DV1I 4LF8I 1N34E 2V2VA 2BM1A 1USVA 3WU6A 4GKJE 5JEAD 4JI1E 4DR7I 1XNRE 4JI0E 1HR0E 1IBMI 3PYFA 4FWGA 2O1UA 1WUUA 4DV3I 3WU3A 3UHMA 3GLLA 5C0XE 4MU3A 3M7NG 4FW4A 1FJGI 2JT2A 3M85G 1PIEA 1P42A 5JEAE 4DV2I 3OTOI 2ZM6I 1USUA 3P3GA 2C37A 3M7ND 2WNRA 3K85A 2E5LI 1H7SA 1Y5YA 1Z0GA 1R6LA 3P3CA 3PS3A 1FNMA 4JI6E 4IZKA 1IBKI 4HYMA 4LCFA 4KHPE 4K0KI 1Z59A 4LFBI 4IZJD 1FWKA 4LFAI 5LMNI 2R3VA 4IFDC 4HY1A 3T1YE 1XXEA 2WW4A 4X64I 2PNLA 1Z0BA 4X66I 2CVEA 4OO1B 1HNWE 4JV5E 1MU5A 2Z5CB 4PRXA 4R1FA 4FW5A 4AM3A 2F4VE 4DR4E 1HK7A 2JE6A 3U1KA 4FW6A 4B3RI 2NN6C 3K1JA 5DRRA 3WU5A 3L7ZB 3J7AG 1Z0EA 3ZZ0A 2UXBE 5K36E 3GMEA 4ISAA 3T1HE 4JI5I 1B63A 4DV1E 4LF8E 1N0VC 3Q1QA 4OO1C 1Z5CA 1N33I 3PS2A 4LF4I 4UTGA
chains in the Genus database with same CATH topology
4FWDA 1IBME 1IBLI 1KTVA 2BV3A 2DEJA 1D6TA 1Z5BA 1FJGE 4JI3I 2AJ4A 4DV2E 4JI4I 1Z0TA 3OTOE 2ZM6E 4B3ME 3B78A 2UXCI 3QT6A 2UU9E 2IOQA 2LJPA 1Z5AA 1H7UA 2ZITA 1N32E 1NZ0A 5IWAI 4K0KE 5FWKA 4FW9A 4B3SE 2VQFI 4LFAE 5LMNE 2Z5BA 4MYUA 1J5EE 2HK2A 3H4LA 4X64E 4Z7CA 4X66E 5GMDA 4IZKB 4LF7E 2E1RA 4DV5I 4X62E 4EMDA 1U2RA 4DR1I 3ZM7A 4B3RE 2HKEA 4DV7E 3PYEA 1NHJA 3ZZTA 4DUZE 1XMOE 2PNMA 4NXMI 1ZXNA 5BR8I 1HNXI 1Y6ZA 3P06A 1H74A 4NXNE 1N33E 4JI8I 4LF4E 1IBLE 1NHIA 5LL6R 2UUBI 4OX9I 4DU7A 4DR3I 4N3OA 3JAMQ 2J7KA 1B62A 4DPYA 4JI3E 1KKHA 1PVGA 2V8PA 4USMA 4DV6E 4JI4E 4IZJA 4B3TI 2HFSA 3PRYA 3M6AA 4ED4A 3QT8A 1RR9A 3ZZUA 1S4EA 4P52A 4M1KA 5LMUI 1N36I 3LTOA 4DUYI 2VQEI 1FI4A 2VQFE 4PRVA 2UUCI 1XMQI 1H72C 2DEIA 1XNQI 1HNZI 2EFGA 2CGEA 2UUAI 4DV5E 4LF6E 4LF9I 3LNUA 3QT5A 4HACA 4JI7I 4LFCE 1MX0A 2Z5BB 5L3JA 4DR5I 4LF5I 4NXME 2UXDI 2A2DA 2VF3A 4GKJI 5BR8E 4DV3E 3Q6MA 4JI0I 1HR0I 4JI8E 2GS8A 2HKJA 1A6FA 2X7IA 4DPTA 4URLA 3CWVA 4JG4A 4OX9E 1K47A 4DR3E 2E5LE 3D4JA 2ZBKB 4RPFA 4B3TE 1IBKE 1ZM4A 4DV0I 4LFBE 2V2ZA 3JAMC 3HJCA 2BM0A 4P7AA 4JYAI 1N36E 3J80Q 5GMEA 4DPWA 4DUYE 4IZJB 4X65I 2VQEE 2V2QA 2UUCE 1XMQE 3T1YI 3V2UC 1XNQE 2X36A 4DR2I 4PU9A 2XEXA 3LPSA 2UUAE 1EA6A 4UT4A 4DR4I 2CZ9A 1S16A 4LF9E 5FLXC 2O1WA 4JI5E 4JI7E 2NPFA 3V5RA 3HULA 1ZXMA 4DR5E 2UXDE 1ZM3A 4HXZA 4JI2I 1RREA 1Z0CA 4HACB 4YHHI 1KIJA 1N0UA 1OJ4A 3F0NA 2Z5EA 1Z0VA 4I3HA 2O1TA 4DV4I 1Y4UA 5IT9Q 2UXCE 1Z0WA 4WUBA 4AQYI 4DR6I 3WU4A 1EI1A 4B3MI 4DXLA 4GKKI 4YY3I 3K17A 3ZKBA 3GONA 2UU9I 4WUCA 5IWAE 4DV0E 4XTJA 5FLXQ 3B82A 4JYAE 1N32I 2HK3A 1UEKA 3PYGA 1KVKA 1QZRA 4B3SI 4FWHA 2HHHI 4X65E 1ZM2A 2GQ0A 1H73A 4DR7E 1J5EI 4DR1E 1I94I 3J80C 4DR2E 4LF7I 4X62I 1BKNA 3J81C 1VISA 4DPXA 2OI2A 1Y4SA 1N34I 4DV7I 4JI1I 2A2CA 1HNXE 2O1VA 4DUZI 1XMOI 4Z7YA 1XHKA 1XNRI 3QT7A 4JI2E 4WUDA 2HFUA 5A2QC 4YHHE 2UUBE 4NXNI 1DARA 3PYDA 2R42A 3ZKDA 1FKAE 4DV4E 1ZM9A 4AQYE 4DR6E 4MYTA 1FWLA 4ZVIA 4DV6I 3J7AM 4JI6I 4GKKE 1MG7A 4YY3E 5LMUE 3B8HA 4KHPI 2Z5CA 5IT9C 2Q2EB 4DU8A 3J81Q 1NHHA 1HNZE 4FN5A 4USKA 1HNWI 4JV5I 2HHHE 2F4VI 2IOPA 3Q6NA 1ELOA 5A2QQ 2CG9A 1I94E 2UXBI 4LF6I 4KQVA 2V34A 4DPUA 4LF5E 3T1HI 1PKPA 4LFCI 4DV1I 4LF8I 1N34E 2V2VA 2BM1A 1USVA 3WU6A 4GKJE 4JI1E 4DR7I 1XNRE 4JI0E 1HR0E 1IBMI 3PYFA 4FWGA 2O1UA 1WUUA 4DV3I 3WU3A 1FJGI 1PIEA 4DV2I 3OTOI 2ZM6I 1USUA 3K85A 2E5LI 1H7SA 1Z0GA 1FNMA 4JI6E 4IZKA 1IBKI 4HYMA 4KHPE 4K0KI 1Z59A 4LFBI 4IZJD 1FWKA 4LFAI 5LMNI 2R3VA 4HY1A 3T1YE 2WW4A 4X64I 2PNLA 1Z0BA 4X66I 1HNWE 4JV5E 1MU5A 2Z5CB 4PRXA 4R1FA 2F4VE 4DR4E 1HK7A 4B3RI 3K1JA 3WU5A 3J7AG 1Z0EA 3ZZ0A 2UXBE 3T1HE 4JI5I 1B63A 4DV1E 4LF8E 1N0VC 3Q1QA 1Z5CA 1N33I 4LF4I 4UTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWD A;  1IBM E;  1IBL I;  1KTV A;  2BV3 A;  2DEJ A;  1D6T A;  1Z5B A;  1FJG E;  4JI3 I;  2AJ4 A;  4DV2 E;  4JI4 I;  1Z0T A;  3OTO E;  2ZM6 E;  4B3M E;  3B78 A;  2UXC I;  3QT6 A;  2UU9 E;  2LJP A;  1Z5A A;  1H7U A;  2ZIT A;  1N32 E;  1NZ0 A;  5IWA I;  4K0K E;  4FW9 A;  4B3S E;  2VQF I;  4LFA E;  5LMN E;  4MYU A;  1J5E E;  2HK2 A;  3H4L A;  4X64 E;  4Z7C A;  4X66 E;  5GMD A;  4LF7 E;  2E1R A;  4DV5 I;  4X62 E;  4EMD A;  1U2R A;  4DR1 I;  3ZM7 A;  4B3R E;  2HKE A;  4DV7 E;  3PYE A;  1NHJ A;  3ZZT A;  4DUZ E;  1XMO E;  4NXM I;  1ZXN A;  5BR8 I;  1HNX I;  1H74 A;  4NXN E;  1N33 E;  4JI8 I;  4LF4 E;  1IBL E;  1NHI A;  5LL6 R;  2UUB I;  4OX9 I;  4DU7 A;  4DR3 I;  3JAM Q;  2J7K A;  1B62 A;  4DPY A;  4JI3 E;  1KKH A;  1PVG A;  2V8P A;  4USM A;  4DV6 E;  4JI4 E;  4B3T I;  2HFS A;  3M6A A;  4ED4 A;  3QT8 A;  1RR9 A;  3ZZU A;  1S4E A;  4P52 A;  4M1K A;  5LMU I;  1N36 I;  3LTO A;  4DUY I;  2VQE I;  1FI4 A;  2VQF E;  4PRV A;  2UUC I;  1XMQ I;  1H72 C;  2DEI A;  1XNQ I;  1HNZ I;  2EFG A;  2UUA I;  4DV5 E;  4LF6 E;  4LF9 I;  3LNU A;  3QT5 A;  4HAC A;  4JI7 I;  4LFC E;  1MX0 A;  5L3J A;  4DR5 I;  4LF5 I;  4NXM E;  2UXD I;  2A2D A;  2VF3 A;  4GKJ I;  5BR8 E;  4DV3 E;  4JI0 I;  1HR0 I;  4JI8 E;  2GS8 A;  2HKJ A;  1A6F A;  2X7I A;  4DPT A;  4URL A;  3CWV A;  4JG4 A;  4OX9 E;  1K47 A;  4DR3 E;  2E5L E;  3D4J A;  2ZBK B;  4RPF A;  4B3T E;  1IBK E;  1ZM4 A;  4DV0 I;  4LFB E;  2V2Z A;  3JAM C;  2BM0 A;  4P7A A;  4JYA I;  1N36 E;  3J80 Q;  5GME A;  4DPW A;  4DUY E;  4X65 I;  2VQE E;  2V2Q A;  2UUC E;  1XMQ E;  3T1Y I;  3V2U C;  1XNQ E;  2X36 A;  4DR2 I;  4PU9 A;  2XEX A;  3LPS A;  2UUA E;  1EA6 A;  4UT4 A;  4DR4 I;  2CZ9 A;  1S16 A;  4LF9 E;  5FLX C;  4JI5 E;  4JI7 E;  2NPF A;  3V5R A;  3HUL A;  1ZXM A;  4DR5 E;  2UXD E;  1ZM3 A;  4HXZ A;  4JI2 I;  1RRE A;  1Z0C A;  4HAC B;  4YHH I;  1KIJ A;  1N0U A;  1OJ4 A;  3F0N A;  1Z0V A;  4I3H A;  4DV4 I;  5IT9 Q;  2UXC E;  1Z0W A;  4WUB A;  4AQY I;  4DR6 I;  3WU4 A;  1EI1 A;  4B3M I;  4DXL A;  4GKK I;  4YY3 I;  3K17 A;  3ZKB A;  3GON A;  2UU9 I;  4WUC A;  5IWA E;  4DV0 E;  4XTJ A;  5FLX Q;  3B82 A;  4JYA E;  1N32 I;  2HK3 A;  1UEK A;  3PYG A;  1KVK A;  1QZR A;  4B3S I;  4FWH A;  2HHH I;  4X65 E;  1ZM2 A;  1H73 A;  4DR7 E;  1J5E I;  4DR1 E;  1I94 I;  3J80 C;  4DR2 E;  4LF7 I;  4X62 I;  1BKN A;  3J81 C;  1VIS A;  4DPX A;  2OI2 A;  1N34 I;  4DV7 I;  4JI1 I;  2A2C A;  1HNX E;  4DUZ I;  1XMO I;  4Z7Y A;  1XHK A;  1XNR I;  3QT7 A;  4JI2 E;  4WUD A;  2HFU A;  5A2Q C;  4YHH E;  2UUB E;  4NXN I;  1DAR A;  3PYD A;  2R42 A;  3ZKD A;  1FKA E;  4DV4 E;  1ZM9 A;  4AQY E;  4DR6 E;  4MYT A;  1FWL A;  4ZVI A;  4DV6 I;  3J7A M;  4JI6 I;  4GKK E;  1MG7 A;  4YY3 E;  5LMU E;  3B8H A;  4KHP I;  5IT9 C;  2Q2E B;  4DU8 A;  3J81 Q;  1NHH A;  1HNZ E;  4FN5 A;  4USK A;  1HNW I;  4JV5 I;  2HHH E;  2F4V I;  1ELO A;  5A2Q Q;  1I94 E;  2UXB I;  4LF6 I;  4KQV A;  2V34 A;  4DPU A;  4LF5 E;  3T1H I;  1PKP A;  4LFC I;  4DV1 I;  4LF8 I;  1N34 E;  2V2V A;  2BM1 A;  3WU6 A;  4GKJ E;  4JI1 E;  4DR7 I;  1XNR E;  4JI0 E;  1HR0 E;  1IBM I;  3PYF A;  4FWG A;  1WUU A;  4DV3 I;  3WU3 A;  1FJG I;  1PIE A;  4DV2 I;  3OTO I;  2ZM6 I;  2E5L I;  1H7S A;  1Z0G A;  1FNM A;  4JI6 E;  1IBK I;  4HYM A;  4KHP E;  4K0K I;  1Z59 A;  4LFB I;  1FWK A;  4LFA I;  5LMN I;  2R3V A;  4HY1 A;  3T1Y E;  2WW4 A;  4X64 I;  1Z0B A;  4X66 I;  1HNW E;  4JV5 E;  1MU5 A;  4PRX A;  4R1F A;  2F4V E;  4DR4 E;  4B3R I;  3K1J A;  3WU5 A;  3J7A G;  1Z0E A;  3ZZ0 A;  2UXB E;  3T1H E;  4JI5 I;  1B63 A;  4DV1 E;  4LF8 E;  1N0V C;  3Q1Q A;  1Z5C A;  1N33 I;  4LF4 I;  4UTG A; 
#chains in the Genus database with same CATH topology
 4FWD A;  1IBM E;  1IBL I;  1KTV A;  2BV3 A;  2DEJ A;  2NN6 A;  1D6T A;  3U1Y A;  1Z5B A;  1FJG E;  4JI3 I;  2AJ4 A;  4DV2 E;  4JI4 I;  1UDN A;  1Z0T A;  3OTO E;  2ZM6 E;  4B3M E;  3B78 A;  2UXC I;  1UDO A;  3QT6 A;  2UU9 E;  2IOQ A;  2LJP A;  1Z5A A;  1H7U A;  2ZIT A;  1N32 E;  1NZ0 A;  3KRN A;  5IWA I;  4K0K E;  5FWK A;  4FW9 A;  2C37 B;  5DNX A;  4B3S E;  2VQF I;  4LFA E;  5LMN E;  2Z5B A;  5DRP A;  4MYU A;  1J5E E;  2HK2 A;  3H4L A;  4X64 E;  4Z7C A;  4X66 E;  5GMD A;  4IZK B;  5ELW A;  4LF7 E;  2E1R A;  3P3E A;  1E3P A;  4AID A;  4X62 E;  1R6M A;  4DV5 I;  5JEA A;  5C0X D;  4EMD A;  1U2R A;  4DR1 I;  3ZM7 A;  4B3R E;  2HKE A;  4DV7 E;  3PYE A;  1NHJ A;  3ZZT A;  4DUZ E;  1XMO E;  2PNM A;  4NXM I;  1UDS A;  4LOM A;  1ZXN A;  2PO0 A;  2JE6 B;  5BR8 I;  4NBQ A;  5C0X F;  1HNX I;  1Y6Z A;  3P06 A;  1H74 A;  4NXN E;  1N33 E;  4JI8 I;  4LF4 E;  5JEA F;  4IFD B;  1IBL E;  1NHI A;  5LL6 R;  2UUB I;  4OX9 I;  4DU7 A;  4DR3 I;  4N3O A;  3JAM Q;  2J7K A;  1B62 A;  4DPY A;  3CDJ A;  4JI3 E;  1KKH A;  1PVG A;  2V8P A;  4USM A;  4DV6 E;  4JI4 E;  4IZJ A;  2WP8 A;  5EKW A;  2IES A;  4B3T I;  2HFS A;  4OKG A;  3PRY A;  3M6A A;  4ED4 A;  3QT8 A;  2NN6 B;  1RR9 A;  2BA0 D;  3ZZU A;  2JEB A;  1S4E A;  4P52 A;  4M1K A;  5LMU I;  1N36 I;  5K36 D;  3LTO A;  4DUY I;  2J65 A;  2VQE I;  1OYS A;  1FI4 A;  2VQF E;  4PRV A;  4MU1 A;  2UUC I;  1XMQ I;  1H72 C;  2DEI A;  4FW3 A;  1XNQ I;  2JEA A;  1HNZ I;  2EFG A;  2CGE A;  2UUA I;  4DV5 E;  4LCG A;  4LF6 E;  4LF9 I;  1YH8 A;  3LNU A;  3QT5 A;  4HAC A;  4JI7 I;  5DRO A;  4LFC E;  1MX0 A;  3DD6 A;  2Z5B B;  5DNL A;  1Y60 A;  5L3J A;  4DR5 I;  4LF5 I;  4NXM E;  2UXD I;  4QNJ A;  2A2D A;  2VF3 A;  5JEA B;  4GKJ I;  5BR8 E;  4DV3 E;  1UDQ A;  3CDI A;  3Q6M A;  4JI0 I;  1HR0 I;  4JI8 E;  2GS8 A;  2HKJ A;  1A6F A;  1VI7 A;  2X7I A;  4DPT A;  4URL A;  3CWV A;  4JG4 A;  4OX9 E;  1K47 A;  2PO0 B;  4DR3 E;  5C0X C;  2E5L E;  2PO1 A;  4AIM A;  3D4J A;  3GCM A;  2PO2 A;  2ZBK B;  4RPF A;  5JEA C;  4B3T E;  1IBK E;  1ZM4 A;  4U3B A;  2F1D A;  4DV0 I;  4LFB E;  2GO4 A;  4IFD E;  2V2Z A;  3JAM C;  2WNR B;  3HJC A;  2BM0 A;  4P7A A;  4LPF A;  4JYA I;  1N36 E;  3J80 Q;  5GME A;  4DPW A;  5C0X A;  4DUY E;  4IZJ B;  2WP8 B;  4X65 I;  2VQE E;  2V2Q A;  2PNZ A;  2UUC E;  1XMQ E;  3T1Y I;  2JEB B;  3V2U C;  1XNQ E;  2NN6 E;  2X36 A;  4DR2 I;  4PU9 A;  2XEX A;  2IER A;  3LPS A;  2UUA E;  1EA6 A;  4UT4 A;  4DR4 I;  2CZ9 A;  1S16 A;  4LF9 E;  5FLX C;  2O1W A;  4JI5 E;  2BR2 A;  4JI7 E;  4OO1 E;  2NPF A;  3V5R A;  2JEA B;  2C39 A;  3HUL A;  1ZXM A;  4DR5 E;  2UXD E;  1ZM3 A;  5K36 C;  4HXZ A;  4JI2 I;  3H1C A;  1RRE A;  1Z0C A;  4HAC B;  4YHH I;  1KIJ A;  1N0U A;  1OJ4 A;  4MU0 A;  2BA0 G;  3F0N A;  3B4T A;  2Z5E A;  1Z0V A;  4U3D A;  4I3H A;  2O1T A;  4DV4 I;  1Y4U A;  5IT9 Q;  2UXC E;  4OZE A;  1Z0W A;  2C38 A;  4WUB A;  4AQY I;  5K36 A;  4DR6 I;  3WU4 A;  1EI1 A;  2GO3 A;  4B3M I;  5DRQ A;  4DXL A;  2AE8 A;  4GKK I;  4YY3 I;  3K17 A;  3ZKB A;  3GON A;  2UU9 I;  4WUC A;  5IWA E;  4DV0 E;  3M85 D;  2O3Z A;  4XTJ A;  5FLX Q;  3B82 A;  2PO1 B;  3P76 A;  4JYA E;  1N32 I;  2HK3 A;  4MU4 A;  2PO2 B;  1UEK A;  4BA1 A;  3PYG A;  1KVK A;  4BA2 A;  1QZR A;  4B3S I;  4FWH A;  5K36 F;  2HHH I;  4X65 E;  1ZM2 A;  2GQ0 A;  1H73 A;  4DR7 E;  1J5E I;  4DR1 E;  1I94 I;  3J80 C;  4DR2 E;  4LF7 I;  4X62 I;  1BKN A;  3J81 C;  1YHC A;  5C0X B;  1VIS A;  4FW7 A;  4DPX A;  2OI2 A;  2PNZ B;  1Y4S A;  1N34 I;  3PS1 A;  4MQY A;  4DV7 I;  4JI1 I;  2A2C A;  1HNX E;  2O1V A;  4DUZ I;  1XMO I;  4Z7Y A;  1XHK A;  1XNR I;  4IFD A;  3QT7 A;  4JI2 E;  4LCH A;  4WUD A;  2HFU A;  5A2Q C;  4IFD D;  1OYR A;  2BR2 B;  4YHH E;  2UUB E;  4NXN I;  1DAR A;  2C39 B;  4QNK A;  3PYD A;  2BA1 G;  2R42 A;  3NZK A;  2VES A;  3ZKD A;  1FKA E;  4DV4 E;  4IFD F;  1ZM9 A;  2NN6 D;  4AQY E;  4DR6 E;  4J3D A;  4MYT A;  4ZVI A;  1FWL A;  4IS9 A;  4DV6 I;  2BA1 D;  3J7A M;  4JI6 I;  4GKK E;  1MG7 A;  4YY3 E;  4OO1 A;  3B8H A;  5LMU E;  4KHP I;  5EL9 A;  2Z5C A;  5IT9 C;  2Q2E B;  4DU8 A;  3J81 Q;  1NHH A;  1RHY A;  4OO1 D;  1E3H A;  2C38 B;  5K36 B;  1OYP A;  2NN6 F;  3L7Z A;  4MDT A;  1HNZ E;  4FN5 A;  4USK A;  1HNW I;  4JV5 I;  3HKM A;  2HHH E;  2F4V I;  2IOP A;  3Q6N A;  4OO1 F;  1ELO A;  5A2Q Q;  4GQU A;  2CG9 A;  1I94 E;  2UXB I;  4LF6 I;  4KQV A;  4BA1 B;  2V34 A;  4DPU A;  4LF5 E;  3T1H I;  4BA2 B;  1PKP A;  4LFC I;  4DV1 I;  4LF8 I;  1N34 E;  2V2V A;  2BM1 A;  1USV A;  3WU6 A;  4GKJ E;  5JEA D;  4JI1 E;  4DR7 I;  1XNR E;  4JI0 E;  1HR0 E;  1IBM I;  3PYF A;  4FWG A;  2O1U A;  1WUU A;  4DV3 I;  3WU3 A;  3UHM A;  3GLL A;  5C0X E;  4MU3 A;  3M7N G;  4FW4 A;  1FJG I;  2JT2 A;  3M85 G;  1PIE A;  1P42 A;  5JEA E;  4DV2 I;  3OTO I;  2ZM6 I;  1USU A;  3P3G A;  2C37 A;  3M7N D;  2WNR A;  3K85 A;  2E5L I;  1H7S A;  1Y5Y A;  1Z0G A;  1R6L A;  3P3C A;  3PS3 A;  1FNM A;  4JI6 E;  4IZK A;  1IBK I;  4HYM A;  4LCF A;  4KHP E;  4K0K I;  1Z59 A;  4LFB I;  4IZJ D;  1FWK A;  4LFA I;  5LMN I;  2R3V A;  4IFD C;  4HY1 A;  3T1Y E;  1XXE A;  2WW4 A;  4X64 I;  2PNL A;  1Z0B A;  4X66 I;  2CVE A;  4OO1 B;  1HNW E;  4JV5 E;  1MU5 A;  2Z5C B;  4PRX A;  4R1F A;  4FW5 A;  4AM3 A;  2F4V E;  4DR4 E;  1HK7 A;  2JE6 A;  3U1K A;  4FW6 A;  4B3R I;  2NN6 C;  3K1J A;  5DRR A;  3WU5 A;  3L7Z B;  3J7A G;  1Z0E A;  3ZZ0 A;  2UXB E;  5K36 E;  3GME A;  4ISA A;  3T1H E;  4JI5 I;  1B63 A;  4DV1 E;  4LF8 E;  1N0V C;  3Q1Q A;  4OO1 C;  1Z5C A;  1N33 I;  3PS2 A;  4LF4 I;  4UTG A; 
#chains in the Genus database with same CATH homology
 4FWD A;  1IBM E;  1IBL I;  1KTV A;  2BV3 A;  2DEJ A;  1D6T A;  1Z5B A;  1FJG E;  4JI3 I;  2AJ4 A;  4DV2 E;  4JI4 I;  1Z0T A;  3OTO E;  2ZM6 E;  4B3M E;  3B78 A;  2UXC I;  3QT6 A;  2UU9 E;  2IOQ A;  2LJP A;  1Z5A A;  1H7U A;  2ZIT A;  1N32 E;  1NZ0 A;  5IWA I;  4K0K E;  5FWK A;  4FW9 A;  4B3S E;  2VQF I;  4LFA E;  5LMN E;  2Z5B A;  4MYU A;  1J5E E;  2HK2 A;  3H4L A;  4X64 E;  4Z7C A;  4X66 E;  5GMD A;  4IZK B;  4LF7 E;  2E1R A;  4DV5 I;  4X62 E;  4EMD A;  1U2R A;  4DR1 I;  3ZM7 A;  4B3R E;  2HKE A;  4DV7 E;  3PYE A;  1NHJ A;  3ZZT A;  4DUZ E;  1XMO E;  2PNM A;  4NXM I;  1ZXN A;  5BR8 I;  1HNX I;  1Y6Z A;  3P06 A;  1H74 A;  4NXN E;  1N33 E;  4JI8 I;  4LF4 E;  1IBL E;  1NHI A;  5LL6 R;  2UUB I;  4OX9 I;  4DU7 A;  4DR3 I;  4N3O A;  3JAM Q;  2J7K A;  1B62 A;  4DPY A;  4JI3 E;  1KKH A;  1PVG A;  2V8P A;  4USM A;  4DV6 E;  4JI4 E;  4IZJ A;  4B3T I;  2HFS A;  3PRY A;  3M6A A;  4ED4 A;  3QT8 A;  1RR9 A;  3ZZU A;  1S4E A;  4P52 A;  4M1K A;  5LMU I;  1N36 I;  3LTO A;  4DUY I;  2VQE I;  1FI4 A;  2VQF E;  4PRV A;  2UUC I;  1XMQ I;  1H72 C;  2DEI A;  1XNQ I;  1HNZ I;  2EFG A;  2CGE A;  2UUA I;  4DV5 E;  4LF6 E;  4LF9 I;  3LNU A;  3QT5 A;  4HAC A;  4JI7 I;  4LFC E;  1MX0 A;  2Z5B B;  5L3J A;  4DR5 I;  4LF5 I;  4NXM E;  2UXD I;  2A2D A;  2VF3 A;  4GKJ I;  5BR8 E;  4DV3 E;  3Q6M A;  4JI0 I;  1HR0 I;  4JI8 E;  2GS8 A;  2HKJ A;  1A6F A;  2X7I A;  4DPT A;  4URL A;  3CWV A;  4JG4 A;  4OX9 E;  1K47 A;  4DR3 E;  2E5L E;  3D4J A;  2ZBK B;  4RPF A;  4B3T E;  1IBK E;  1ZM4 A;  4DV0 I;  4LFB E;  2V2Z A;  3JAM C;  3HJC A;  2BM0 A;  4P7A A;  4JYA I;  1N36 E;  3J80 Q;  5GME A;  4DPW A;  4DUY E;  4IZJ B;  4X65 I;  2VQE E;  2V2Q A;  2UUC E;  1XMQ E;  3T1Y I;  3V2U C;  1XNQ E;  2X36 A;  4DR2 I;  4PU9 A;  2XEX A;  3LPS A;  2UUA E;  1EA6 A;  4UT4 A;  4DR4 I;  2CZ9 A;  1S16 A;  4LF9 E;  5FLX C;  2O1W A;  4JI5 E;  4JI7 E;  2NPF A;  3V5R A;  3HUL A;  1ZXM A;  4DR5 E;  2UXD E;  1ZM3 A;  4HXZ A;  4JI2 I;  1RRE A;  1Z0C A;  4HAC B;  4YHH I;  1KIJ A;  1N0U A;  1OJ4 A;  3F0N A;  2Z5E A;  1Z0V A;  4I3H A;  2O1T A;  4DV4 I;  1Y4U A;  5IT9 Q;  2UXC E;  1Z0W A;  4WUB A;  4AQY I;  4DR6 I;  3WU4 A;  1EI1 A;  4B3M I;  4DXL A;  4GKK I;  4YY3 I;  3K17 A;  3ZKB A;  3GON A;  2UU9 I;  4WUC A;  5IWA E;  4DV0 E;  4XTJ A;  5FLX Q;  3B82 A;  4JYA E;  1N32 I;  2HK3 A;  1UEK A;  3PYG A;  1KVK A;  1QZR A;  4B3S I;  4FWH A;  2HHH I;  4X65 E;  1ZM2 A;  2GQ0 A;  1H73 A;  4DR7 E;  1J5E I;  4DR1 E;  1I94 I;  3J80 C;  4DR2 E;  4LF7 I;  4X62 I;  1BKN A;  3J81 C;  1VIS A;  4DPX A;  2OI2 A;  1Y4S A;  1N34 I;  4DV7 I;  4JI1 I;  2A2C A;  1HNX E;  2O1V A;  4DUZ I;  1XMO I;  4Z7Y A;  1XHK A;  1XNR I;  3QT7 A;  4JI2 E;  4WUD A;  2HFU A;  5A2Q C;  4YHH E;  2UUB E;  4NXN I;  1DAR A;  3PYD A;  2R42 A;  3ZKD A;  1FKA E;  4DV4 E;  1ZM9 A;  4AQY E;  4DR6 E;  4MYT A;  1FWL A;  4ZVI A;  4DV6 I;  3J7A M;  4JI6 I;  4GKK E;  1MG7 A;  4YY3 E;  5LMU E;  3B8H A;  4KHP I;  2Z5C A;  5IT9 C;  2Q2E B;  4DU8 A;  3J81 Q;  1NHH A;  1HNZ E;  4FN5 A;  4USK A;  1HNW I;  4JV5 I;  2HHH E;  2F4V I;  2IOP A;  3Q6N A;  1ELO A;  5A2Q Q;  2CG9 A;  1I94 E;  2UXB I;  4LF6 I;  4KQV A;  2V34 A;  4DPU A;  4LF5 E;  3T1H I;  1PKP A;  4LFC I;  4DV1 I;  4LF8 I;  1N34 E;  2V2V A;  2BM1 A;  1USV A;  3WU6 A;  4GKJ E;  4JI1 E;  4DR7 I;  1XNR E;  4JI0 E;  1HR0 E;  1IBM I;  3PYF A;  4FWG A;  2O1U A;  1WUU A;  4DV3 I;  3WU3 A;  1FJG I;  1PIE A;  4DV2 I;  3OTO I;  2ZM6 I;  1USU A;  3K85 A;  2E5L I;  1H7S A;  1Z0G A;  1FNM A;  4JI6 E;  4IZK A;  1IBK I;  4HYM A;  4KHP E;  4K0K I;  1Z59 A;  4LFB I;  4IZJ D;  1FWK A;  4LFA I;  5LMN I;  2R3V A;  4HY1 A;  3T1Y E;  2WW4 A;  4X64 I;  2PNL A;  1Z0B A;  4X66 I;  1HNW E;  4JV5 E;  1MU5 A;  2Z5C B;  4PRX A;  4R1F A;  2F4V E;  4DR4 E;  1HK7 A;  4B3R I;  3K1J A;  3WU5 A;  3J7A G;  1Z0E A;  3ZZ0 A;  2UXB E;  3T1H E;  4JI5 I;  1B63 A;  4DV1 E;  4LF8 E;  1N0V C;  3Q1Q A;  1Z5C A;  1N33 I;  4LF4 I;  4UTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...