4K0KI

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4k0kI00
3ZZTA 1N32I 4HYMA 4X62I 1HNXE 4JI7E 1N0VC 2E1RA 3LTOA 1IBKI 3J7AM 4JV5E 4X65I 1Z0TA 2A2CA 1ZM9A 4DR4I 1WUUA 4LF5I 3CWVA 4KHPE 4GKJE 4JI6I 2AJ4A 2F4VI 4FWGA 1KKHA 4JI3E 1B62A 4JYAI 3HULA 2BM0A 4DR2I 3J7AG 4HY1A 2VQFI 5LMNE 2F4VE 4DUZI 4FWHA 4KHPI 3JAMC 3K1JA 4LF6I 1NHIA 4YHHE 5A2QC 1IBKE 1U2RA 2R3VA 1ZM3A 1NHJA 4UT4A 1N33I 4DV1I 1BKNA 1QZRA 4LFBI 1N32E 1N0UA 1XNQI 4DPXA 1A6FA 4JI5E 1Z59A 5IWAE 2UUBE 4DR6E 3V5RA 4DR6I 2V8PA 4X65E 1J5EI 4B3TE 4PRVA 3K17A 3WU4A 1UEKA 2BV3A 4JI7I 4JI1I 5LMUI 2LJPA 1Z0CA 1NHHA 2HFUA 3ZZUA 4JI1E 2GS8A 1Z0BA 2X7IA 4B3RI 1H7UA 1EA6A 4AQYE 3QT5A 4UTGA 3OTOI 5GMEA 1B63A 3B78A 1Z0VA 4XTJA 4JI4I 1XNQE 1FKAE 3ZZ0A 2DEJA 4LFBE 1HR0I 2ZM6E 2UUCE 1N33E 4DR3E 1ZXMA 4LFAE 4JI3I 1S16A 1IBLE 3F0NA 1XHKA 3T1YE 1I94I 1IBMI 3WU3A 1MG7A 4B3MI 4DUZE 3ZKDA 4USKA 1OJ4A 4DR3I 2ZM6I 4JYAE 1ZM2A 3J81Q 4FN5A 1H72C 5A2QQ 1N34I 4DV6I 1N36I 4X64I 4AQYI 2Q2EB 3PYFA 2HHHE 4K0KE 1K47A 2UXBI 3J80C 4DUYI 2HHHI 1FWKA 4NXMI 3ZKBA 1H7SA 2V2ZA 4DV7E 4DV5I 3LPSA 1N36E 2HFSA 2UUAI 1ZM4A 5IWAI 5FLXQ 2UXCI 3JAMQ 2E5LE 2DEIA 5BR8E 1FWLA 4DV0E 1KVKA 4DXLA 2HK3A 1Z0EA 4ED4A 4USMA 5FLXC 4YHHI 4MYUA 4JG4A 3J81C 4EMDA 3Q1QA 4DV4I 1RR9A 4ZVIA 4LFAI 4DR2E 5BR8I 3QT6A 1XMQE 2E5LI 2UU9I 1HNWE 3J80Q 4JI6E 4JI2I 2UUAE 1XMOE 3GONA 1DARA 4DV2E 2ZITA 1HNZE 1Z0GA 2V2VA 4DV0I 4B3SI 2CZ9A 4HXZA 2UXDE 4X62E 2UXBE 1KIJA 3B82A 4Z7CA 3D4JA 3V2UC 3PYGA 1J5EE 4B3TI 4DPWA 4URLA 3WU6A 4DV2I 4DV7I 1Z5CA 4X64E 4R1FA 1XMOI 4DU7A 4JI8E 1KTVA 4JI2E 1FNMA 4DPUA 3WU5A 1XMQI 3QT7A 3B8HA 4HACB 4PRXA 5LL6R 4DV1E 2UXDI 4K0KI 4B3SE 4LF4E 4GKKI 1H73A 3LNUA 2VQEE 1HNZI 4DR7E 3M6AA 4DV3I 4LF6E 2VQEI 4LF8I 4GKKE 1H74A 4FW9A 1RREA 1HR0E 4DPYA 2EFGA 4FWDA 4WUDA 2UXCE 1MX0A 2J7KA 4DV4E 4JI8I 4LF8E 4HACA 3T1HI 4DV3E 4LF5E 4DR7I 4DR4E 1I94E 1IBME 5L3JA 4NXME 4DR1E 4PU9A 1FJGE 4KQVA 4YY3I 1HNXI 2HK2A 4WUCA 2R42A 4Z7YA 4LF9I 4NXNE 4MYTA 2V34A 4X66E 3OTOE 3PYDA 3QT8A 4DV5E 2A2DA 1XNRE 1N34E 1Z5BA 2UU9E 1HNWI 4DUYE 1NZ0A 2HKJA 4OX9E 4YY3E 1Z5AA 3PYEA 1Z0WA 1FJGI 4JI0E 4LF7I 4DR1I 4DR5I 2WW4A 4WUBA 3T1HE 1S4EA 4DV6E 4LFCE 4JI5I 1IBLI 2VQFE 4P52A 5LMNI 2HKEA 1PVGA 1FI4A 3H4LA 1ZXNA 1PKPA 4LFCI 4DU8A 4B3ME 1EI1A 2VF3A 4DR5E 5GMDA 3T1YI 1VISA 2XEXA 2OI2A 2NPFA 4I3HA 4RPFA 4P7AA 4LF4I 4JI0I 4LF7E 4B3RE 2X36A 1PIEA 5IT9Q 1MU5A 2UUCI 4OX9I 5LMUE 4JI4E 2V2QA 2ZBKB 4GKJI 1XNRI 1D6TA 5IT9C 4DPTA 3ZM7A 4JV5I 4X66I 2UUBI 2BM1A 1ELOA 4NXNI 4LF9E 4M1KA
chains in the Genus database with same CATH superfamily
3ZZTA 1N32I 4HYMA 4X62I 1HNXE 4JI7E 2JEAA 2GQ0A 2Z5CB 1UDSA 1N0VC 2E1RA 3LTOA 1IBKI 3J7AM 2BR2B 4X65I 4JV5E 1Z0TA 2A2CA 1ZM9A 4DR4I 2PO0B 1WUUA 4LF5I 3KRNA 3CWVA 4KHPE 2PO0A 2JT2A 4GKJE 4JI6I 2AJ4A 5DNLA 2F4VI 4FW7A 4FWGA 1KKHA 4JI3E 4OO1C 1B62A 4JYAI 3HULA 4IFDD 2BM0A 4DR2I 4J3DA 3J7AG 4HY1A 2VQFI 5LMNE 2F4VE 4DUZI 4OO1F 2O1VA 2C38B 4FWHA 4KHPI 3JAMC 3K1JA 4LF6I 1NHIA 4YHHE 2JEAB 5A2QC 5JEAB 5C0XD 5K36B 1IBKE 1U2RA 2R3VA 1ZM3A 3GLLA 1NHJA 2O1WA 4UT4A 4IZKB 1N33I 4DV1I 2C39B 1BKNA 3Q6NA 1QZRA 4LFBI 5K36E 1Y60A 1N32E 1N0UA 4U3BA 3HJCA 1XNQI 4DPXA 4IFDA 4AIDA 1A6FA 4JI5E 1Z59A 3H1CA 5IWAE 2UUBE 4DR6E 5JEAE 3V5RA 1UDOA 4DR6I 3M7ND 2V8PA 4X65E 1J5EI 4B3TE 4BA1A 3PRYA 4PRVA 3K17A 3DD6A 3WU4A 1UEKA 2BV3A 4JI7I 4JI1I 5LMUI 2LJPA 1E3PA 1XXEA 2BA1D 2C37B 1Z0CA 1NHHA 2HFUA 3ZZUA 2PO2A 4JI1E 2GS8A 1Z0BA 2X7IA 4B3RI 1E3HA 1H7UA 1EA6A 2BR2A 2NN6E 4AQYE 3QT5A 4UTGA 3OTOI 5GMEA 1B63A 3CDJA 3B78A 1Z0VA 2IERA 4XTJA 4JI4I 1USUA 1XNQE 1FKAE 3ZZ0A 4IZKA 3P3GA 3L7ZA 2DEJA 4LFBE 1HR0I 2ZM6E 3P3EA 2UUCE 1N33E 4DR3E 1ZXMA 4LFAE 4JI3I 4AM3A 1S16A 1IBLE 3F0NA 2CG9A 4OO1B 1Y5YA 1XHKA 2AE8A 2O3ZA 3T1YE 1I94I 1IBMI 4OKGA 4GQUA 3WU3A 1MG7A 4B3MI 5K36F 4DUZE 3ZKDA 4USKA 2PNMA 1OJ4A 4DR3I 4BA1B 2ZM6I 4QNKA 4JYAE 1ZM2A 3J81Q 3UHMA 4FN5A 1H72C 4LPFA 5A2QQ 1N34I 4DV6I 1RHYA 4MDTA 1N36I 4X64I 4OZEA 4AQYI 4FW3A 4LCHA 4IFDB 1R6LA 2Q2EB 3PYFA 2HHHE 4K0KE 1K47A 2UXBI 4U3DA 3J80C 2GO4A 4DUYI 2PO1A 2NN6F 4OO1D 2HHHI 2PNLA 1FWKA 1OYRA 4NXMI 5DNXA 3ZKBA 1H7SA 2V2ZA 4DV7E 4DV5I 1UDNA 3LPSA 1N36E 2HFSA 3U1YA 2UUAI 1ZM4A 5IWAI 5FLXQ 2UXCI 3JAMQ 2E5LE 4N3OA 2DEIA 5BR8E 1FWLA 3NZKA 5FWKA 4DV0E 1KVKA 2O1TA 4DXLA 2HK3A 5C0XC 1Z0EA 4ED4A 4USMA 5FLXC 4YHHI 4MYUA 4JG4A 3L7ZB 3J81C 4EMDA 3Q1QA 4DV4I 2Z5BA 4BA2A 2C39A 1VI7A 1RR9A 1USVA 4ZVIA 4LFAI 4DR2E 5BR8I 3QT6A 1XMQE 2IESA 3U1KA 2E5LI 2UU9I 1HNWE 1Y4UA 3J80Q 4JI6E 4JI2I 2IOQA 2PO2B 3M7NG 2UUAE 2BA0G 3GMEA 1XMOE 4FW5A 3GONA 4FW6A 1DARA 4DV2E 2ZITA 4MU4A 1HNZE 3Q6MA 5JEAC 1Z0GA 4IFDF 3HKMA 2V2VA 4DV0I 4B3SI 2C37A 2CZ9A 4HXZA 2UXDE 5JEAD 4X62E 2UXBE 1KIJA 5C0XA 2VESA 3B82A 3D4JA 4Z7CA 3V2UC 3PYGA 1J5EE 4B3TI 4DPWA 4URLA 3WU6A 4DV2I 4DV7I 1Z5CA 4X64E 4R1FA 1XMOI 4DU7A 4JI8E 2JE6A 2PO1B 1KTVA 5C0XE 4JI2E 1FNMA 4DPUA 1YH8A 3WU5A 5C0XF 2JEBB 5C0XB 1XMQI 1Y4SA 4AIMA 3QT7A 3B8HA 4HACB 4PRXA 5LL6R 4DV1E 2UXDI 4K0KI 4B3SE 4LF4E 4GKKI 1H73A 3LNUA 2VQEE 1Y6ZA 1HNZI 4DR7E 3M6AA 4DV3I 4LF6E 2VQEI 5DRRA 4LF8I 2IOPA 4GKKE 1H74A 1YHCA 4FW9A 1RREA 1HR0E 2Z5EA 4DPYA 4WUDA 2EFGA 4FWDA 2UXCE 1MX0A 2J7KA 4DV4E 4JI8I 4LF8E 4HACA 3T1HI 4DV3E 4LF5E 4OO1E 4OO1A 4DR7I 4DR4E 1I94E 1IBME 5L3JA 4NXME 4LOMA 2J65A 4DR1E 4PU9A 1FJGE 2WP8B 2WNRA 4KQVA 2WNRB 4YY3I 1HNXI 5K36A 2HK2A 4WUCA 4QNJA 3PS3A 2R42A 2GO3A 4Z7YA 4LF9I 4NXNE 4MYTA 2V34A 3P76A 4X66E 3OTOE 3GCMA 3PYDA 4MQYA 3QT8A 4ISAA 4DV5E 5K36C 2NN6C 2BA0D 2PNZA 2A2DA 5JEAF 3M85D 1XNRE 2PNZB 1N34E 1Z5BA 2UU9E 1HNWI 4DUYE 1NZ0A 2HKJA 3B4TA 4IZJB 3M85G 4OX9E 3PS2A 4YY3E 1Z5AA 5EKWA 1P42A 3PYEA 1Z0WA 1FJGI 4JI0E 4LF7I 3PS1A 5DROA 4NBQA 4DR1I 3K85A 2Z5BB 4BA2B 4DR5I 2WW4A 4LCGA 2NN6D 2F1DA 4WUBA 3T1HE 1S4EA 3CDIA 4DV6E 4IS9A 2JEBA 4LFCE 4JI5I 4MU3A 1IBLI 2C38A 2VQFE 4P52A 5LMNI 2O1UA 2HKEA 1PVGA 1FI4A 3H4LA 4IFDC 1ZXNA 1PKPA 2NN6B 4LFCI 4MU0A 4IZJA 4DU8A 4B3ME 5DRQA 4MU1A 3P3CA 1EI1A 2VF3A 4DR5E 5GMDA 3T1YI 1VISA 4IZJD 2XEXA 2OI2A 2NPFA 5DRPA 4I3HA 1HK7A 4RPFA 4P7AA 4LF4I 4JI0I 4LF7E 4B3RE 2X36A 5K36D 1PIEA 5IT9Q 2CVEA 1MU5A 2UUCI 3P06A 4OX9I 5LMUE 1OYSA 1R6MA 5ELWA 2V2QA 4JI4E 2ZBKB 2BA1G 5EL9A 4GKJI 1XNRI 1D6TA 1OYPA 2WP8A 4DPTA 5IT9C 4FW4A 2Z5CA 2CGEA 2JE6B 3ZM7A 5JEAA 2NN6A 4JV5I 4X66I 4LCFA 2UUBI 2BM1A 1ELOA 1UDQA 4NXNI 4LF9E 4M1KA 4IFDE
chains in the Genus database with same CATH topology
3ZZTA 1N32I 4HYMA 4X62I 1HNXE 4JI7E 2GQ0A 2Z5CB 1N0VC 2E1RA 3LTOA 1IBKI 3J7AM 4JV5E 4X65I 1Z0TA 2A2CA 1ZM9A 4DR4I 1WUUA 4LF5I 3CWVA 4KHPE 4GKJE 4JI6I 2AJ4A 2F4VI 4FWGA 1KKHA 4JI3E 1B62A 4JYAI 3HULA 2BM0A 4DR2I 3J7AG 4HY1A 2VQFI 5LMNE 2F4VE 4DUZI 2O1VA 4FWHA 4KHPI 3JAMC 3K1JA 4LF6I 1NHIA 4YHHE 5A2QC 1IBKE 1U2RA 2R3VA 1ZM3A 1NHJA 2O1WA 4UT4A 4IZKB 1N33I 4DV1I 1BKNA 3Q6NA 1QZRA 4LFBI 1N32E 1N0UA 3HJCA 1XNQI 4DPXA 1A6FA 4JI5E 1Z59A 5IWAE 2UUBE 4DR6E 3V5RA 4DR6I 2V8PA 4X65E 1J5EI 4B3TE 3PRYA 4PRVA 3K17A 3WU4A 1UEKA 2BV3A 4JI7I 4JI1I 5LMUI 2LJPA 1Z0CA 1NHHA 2HFUA 3ZZUA 4JI1E 2GS8A 1Z0BA 2X7IA 4B3RI 1H7UA 1EA6A 4AQYE 3QT5A 4UTGA 3OTOI 5GMEA 1B63A 3B78A 1Z0VA 4XTJA 4JI4I 1USUA 1XNQE 1FKAE 3ZZ0A 4IZKA 2DEJA 4LFBE 1HR0I 2ZM6E 2UUCE 1N33E 4DR3E 1ZXMA 4LFAE 4JI3I 1S16A 1IBLE 3F0NA 2CG9A 1XHKA 3T1YE 1I94I 1IBMI 3WU3A 1MG7A 4B3MI 4DUZE 3ZKDA 4USKA 2PNMA 1OJ4A 4DR3I 2ZM6I 4JYAE 1ZM2A 3J81Q 4FN5A 1H72C 5A2QQ 1N34I 4DV6I 1N36I 4X64I 4AQYI 2Q2EB 3PYFA 2HHHE 4K0KE 1K47A 2UXBI 3J80C 4DUYI 2HHHI 2PNLA 1FWKA 4NXMI 3ZKBA 1H7SA 2V2ZA 4DV7E 4DV5I 3LPSA 1N36E 2HFSA 2UUAI 1ZM4A 5IWAI 5FLXQ 2UXCI 3JAMQ 2E5LE 2DEIA 4N3OA 5BR8E 1FWLA 4DV0E 5FWKA 1KVKA 2O1TA 4DXLA 2HK3A 1Z0EA 4ED4A 4USMA 5FLXC 4YHHI 4MYUA 4JG4A 3J81C 4EMDA 3Q1QA 4DV4I 2Z5BA 1RR9A 1USVA 4ZVIA 4LFAI 4DR2E 5BR8I 3QT6A 1XMQE 2E5LI 2UU9I 1HNWE 1Y4UA 3J80Q 4JI6E 4JI2I 2IOQA 2UUAE 1XMOE 3GONA 1DARA 4DV2E 2ZITA 1HNZE 3Q6MA 1Z0GA 2V2VA 4DV0I 4B3SI 2CZ9A 4HXZA 2UXDE 4X62E 2UXBE 1KIJA 3B82A 4Z7CA 3D4JA 3V2UC 3PYGA 1J5EE 4B3TI 4DPWA 4URLA 3WU6A 4DV2I 4DV7I 1Z5CA 4X64E 4R1FA 1XMOI 4DU7A 4JI8E 1KTVA 4JI2E 1FNMA 4DPUA 3WU5A 1XMQI 1Y4SA 3QT7A 3B8HA 4HACB 4PRXA 5LL6R 4DV1E 2UXDI 4K0KI 4B3SE 4LF4E 4GKKI 1H73A 3LNUA 2VQEE 1Y6ZA 1HNZI 4DR7E 3M6AA 4DV3I 4LF6E 2VQEI 4LF8I 2IOPA 4GKKE 1H74A 4FW9A 1RREA 1HR0E 2Z5EA 4DPYA 2EFGA 4FWDA 4WUDA 2UXCE 1MX0A 2J7KA 4DV4E 4JI8I 4LF8E 4HACA 3T1HI 4DV3E 4LF5E 4DR7I 4DR4E 1I94E 1IBME 5L3JA 4NXME 4DR1E 4PU9A 1FJGE 4KQVA 4YY3I 1HNXI 2HK2A 4WUCA 2R42A 4Z7YA 4LF9I 4NXNE 4MYTA 2V34A 4X66E 3OTOE 3PYDA 3QT8A 4DV5E 2A2DA 1XNRE 1N34E 1Z5BA 2UU9E 1HNWI 4DUYE 1NZ0A 2HKJA 4IZJB 4OX9E 4YY3E 1Z5AA 3PYEA 1Z0WA 1FJGI 4JI0E 4LF7I 4DR1I 3K85A 2Z5BB 4DR5I 2WW4A 4WUBA 3T1HE 1S4EA 4DV6E 4LFCE 4JI5I 1IBLI 2VQFE 4P52A 5LMNI 2O1UA 2HKEA 1PVGA 1FI4A 3H4LA 1ZXNA 1PKPA 4LFCI 4IZJA 4DU8A 4B3ME 1EI1A 2VF3A 4DR5E 5GMDA 3T1YI 1VISA 4IZJD 2XEXA 2OI2A 2NPFA 4I3HA 1HK7A 4RPFA 4P7AA 4LF4I 4JI0I 4LF7E 4B3RE 2X36A 1PIEA 5IT9Q 1MU5A 2UUCI 3P06A 4OX9I 5LMUE 2V2QA 4JI4E 2ZBKB 4GKJI 1XNRI 1D6TA 5IT9C 4DPTA 2Z5CA 2CGEA 3ZM7A 4JV5I 4X66I 2UUBI 2BM1A 1ELOA 4NXNI 4LF9E 4M1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZT A;  1N32 I;  4HYM A;  4X62 I;  1HNX E;  4JI7 E;  1N0V C;  2E1R A;  3LTO A;  1IBK I;  3J7A M;  4JV5 E;  4X65 I;  1Z0T A;  2A2C A;  1ZM9 A;  4DR4 I;  1WUU A;  4LF5 I;  3CWV A;  4KHP E;  4GKJ E;  4JI6 I;  2AJ4 A;  2F4V I;  4FWG A;  1KKH A;  4JI3 E;  1B62 A;  4JYA I;  3HUL A;  2BM0 A;  4DR2 I;  3J7A G;  4HY1 A;  2VQF I;  5LMN E;  2F4V E;  4DUZ I;  4FWH A;  4KHP I;  3JAM C;  3K1J A;  4LF6 I;  1NHI A;  4YHH E;  5A2Q C;  1IBK E;  1U2R A;  2R3V A;  1ZM3 A;  1NHJ A;  4UT4 A;  1N33 I;  4DV1 I;  1BKN A;  1QZR A;  4LFB I;  1N32 E;  1N0U A;  1XNQ I;  4DPX A;  1A6F A;  4JI5 E;  1Z59 A;  5IWA E;  2UUB E;  4DR6 E;  3V5R A;  4DR6 I;  2V8P A;  4X65 E;  1J5E I;  4B3T E;  4PRV A;  3K17 A;  3WU4 A;  1UEK A;  2BV3 A;  4JI7 I;  4JI1 I;  5LMU I;  2LJP A;  1Z0C A;  1NHH A;  2HFU A;  3ZZU A;  4JI1 E;  2GS8 A;  1Z0B A;  2X7I A;  4B3R I;  1H7U A;  1EA6 A;  4AQY E;  3QT5 A;  4UTG A;  3OTO I;  5GME A;  1B63 A;  3B78 A;  1Z0V A;  4XTJ A;  4JI4 I;  1XNQ E;  1FKA E;  3ZZ0 A;  2DEJ A;  4LFB E;  1HR0 I;  2ZM6 E;  2UUC E;  1N33 E;  4DR3 E;  1ZXM A;  4LFA E;  4JI3 I;  1S16 A;  1IBL E;  3F0N A;  1XHK A;  3T1Y E;  1I94 I;  1IBM I;  3WU3 A;  1MG7 A;  4B3M I;  4DUZ E;  3ZKD A;  4USK A;  1OJ4 A;  4DR3 I;  2ZM6 I;  4JYA E;  1ZM2 A;  3J81 Q;  4FN5 A;  1H72 C;  5A2Q Q;  1N34 I;  4DV6 I;  1N36 I;  4X64 I;  4AQY I;  2Q2E B;  3PYF A;  2HHH E;  4K0K E;  1K47 A;  2UXB I;  3J80 C;  4DUY I;  2HHH I;  1FWK A;  4NXM I;  3ZKB A;  1H7S A;  2V2Z A;  4DV7 E;  4DV5 I;  3LPS A;  1N36 E;  2HFS A;  2UUA I;  1ZM4 A;  5IWA I;  5FLX Q;  2UXC I;  3JAM Q;  2E5L E;  2DEI A;  5BR8 E;  1FWL A;  4DV0 E;  1KVK A;  4DXL A;  2HK3 A;  1Z0E A;  4ED4 A;  4USM A;  5FLX C;  4YHH I;  4MYU A;  4JG4 A;  3J81 C;  4EMD A;  3Q1Q A;  4DV4 I;  1RR9 A;  4ZVI A;  4LFA I;  4DR2 E;  5BR8 I;  3QT6 A;  1XMQ E;  2E5L I;  2UU9 I;  1HNW E;  3J80 Q;  4JI6 E;  4JI2 I;  2UUA E;  1XMO E;  3GON A;  1DAR A;  4DV2 E;  2ZIT A;  1HNZ E;  1Z0G A;  2V2V A;  4DV0 I;  4B3S I;  2CZ9 A;  4HXZ A;  2UXD E;  4X62 E;  2UXB E;  1KIJ A;  3B82 A;  4Z7C A;  3D4J A;  3V2U C;  3PYG A;  1J5E E;  4B3T I;  4DPW A;  4URL A;  3WU6 A;  4DV2 I;  4DV7 I;  1Z5C A;  4X64 E;  4R1F A;  1XMO I;  4DU7 A;  4JI8 E;  1KTV A;  4JI2 E;  1FNM A;  4DPU A;  3WU5 A;  1XMQ I;  3QT7 A;  3B8H A;  4HAC B;  4PRX A;  5LL6 R;  4DV1 E;  2UXD I;  4K0K I;  4B3S E;  4LF4 E;  4GKK I;  1H73 A;  3LNU A;  2VQE E;  1HNZ I;  4DR7 E;  3M6A A;  4DV3 I;  4LF6 E;  2VQE I;  4LF8 I;  4GKK E;  1H74 A;  4FW9 A;  1RRE A;  1HR0 E;  4DPY A;  2EFG A;  4FWD A;  4WUD A;  2UXC E;  1MX0 A;  2J7K A;  4DV4 E;  4JI8 I;  4LF8 E;  4HAC A;  3T1H I;  4DV3 E;  4LF5 E;  4DR7 I;  4DR4 E;  1I94 E;  1IBM E;  5L3J A;  4NXM E;  4DR1 E;  4PU9 A;  1FJG E;  4KQV A;  4YY3 I;  1HNX I;  2HK2 A;  4WUC A;  2R42 A;  4Z7Y A;  4LF9 I;  4NXN E;  4MYT A;  2V34 A;  4X66 E;  3OTO E;  3PYD A;  3QT8 A;  4DV5 E;  2A2D A;  1XNR E;  1N34 E;  1Z5B A;  2UU9 E;  1HNW I;  4DUY E;  1NZ0 A;  2HKJ A;  4OX9 E;  4YY3 E;  1Z5A A;  3PYE A;  1Z0W A;  1FJG I;  4JI0 E;  4LF7 I;  4DR1 I;  4DR5 I;  2WW4 A;  4WUB A;  3T1H E;  1S4E A;  4DV6 E;  4LFC E;  4JI5 I;  1IBL I;  2VQF E;  4P52 A;  5LMN I;  2HKE A;  1PVG A;  1FI4 A;  3H4L A;  1ZXN A;  1PKP A;  4LFC I;  4DU8 A;  4B3M E;  1EI1 A;  2VF3 A;  4DR5 E;  5GMD A;  3T1Y I;  1VIS A;  2XEX A;  2OI2 A;  2NPF A;  4I3H A;  4RPF A;  4P7A A;  4LF4 I;  4JI0 I;  4LF7 E;  4B3R E;  2X36 A;  1PIE A;  5IT9 Q;  1MU5 A;  2UUC I;  4OX9 I;  5LMU E;  4JI4 E;  2V2Q A;  2ZBK B;  4GKJ I;  1XNR I;  1D6T A;  5IT9 C;  4DPT A;  3ZM7 A;  4JV5 I;  4X66 I;  2UUB I;  2BM1 A;  1ELO A;  4NXN I;  4LF9 E;  4M1K A; 
#chains in the Genus database with same CATH topology
 3ZZT A;  1N32 I;  4HYM A;  4X62 I;  1HNX E;  4JI7 E;  2JEA A;  2GQ0 A;  2Z5C B;  1UDS A;  1N0V C;  2E1R A;  3LTO A;  1IBK I;  3J7A M;  2BR2 B;  4X65 I;  4JV5 E;  1Z0T A;  2A2C A;  1ZM9 A;  4DR4 I;  2PO0 B;  1WUU A;  4LF5 I;  3KRN A;  3CWV A;  4KHP E;  2PO0 A;  2JT2 A;  4GKJ E;  4JI6 I;  2AJ4 A;  5DNL A;  2F4V I;  4FW7 A;  4FWG A;  1KKH A;  4JI3 E;  4OO1 C;  1B62 A;  4JYA I;  3HUL A;  4IFD D;  2BM0 A;  4DR2 I;  4J3D A;  3J7A G;  4HY1 A;  2VQF I;  5LMN E;  2F4V E;  4DUZ I;  4OO1 F;  2O1V A;  2C38 B;  4FWH A;  4KHP I;  3JAM C;  3K1J A;  4LF6 I;  1NHI A;  4YHH E;  2JEA B;  5A2Q C;  5JEA B;  5C0X D;  5K36 B;  1IBK E;  1U2R A;  2R3V A;  1ZM3 A;  3GLL A;  1NHJ A;  2O1W A;  4UT4 A;  4IZK B;  1N33 I;  4DV1 I;  2C39 B;  1BKN A;  3Q6N A;  1QZR A;  4LFB I;  5K36 E;  1Y60 A;  1N32 E;  1N0U A;  4U3B A;  3HJC A;  1XNQ I;  4DPX A;  4IFD A;  4AID A;  1A6F A;  4JI5 E;  1Z59 A;  3H1C A;  5IWA E;  2UUB E;  4DR6 E;  5JEA E;  3V5R A;  1UDO A;  4DR6 I;  3M7N D;  2V8P A;  4X65 E;  1J5E I;  4B3T E;  4BA1 A;  3PRY A;  4PRV A;  3K17 A;  3DD6 A;  3WU4 A;  1UEK A;  2BV3 A;  4JI7 I;  4JI1 I;  5LMU I;  2LJP A;  1E3P A;  1XXE A;  2BA1 D;  2C37 B;  1Z0C A;  1NHH A;  2HFU A;  3ZZU A;  2PO2 A;  4JI1 E;  2GS8 A;  1Z0B A;  2X7I A;  4B3R I;  1E3H A;  1H7U A;  1EA6 A;  2BR2 A;  2NN6 E;  4AQY E;  3QT5 A;  4UTG A;  3OTO I;  5GME A;  1B63 A;  3CDJ A;  3B78 A;  1Z0V A;  2IER A;  4XTJ A;  4JI4 I;  1USU A;  1XNQ E;  1FKA E;  3ZZ0 A;  4IZK A;  3P3G A;  3L7Z A;  2DEJ A;  4LFB E;  1HR0 I;  2ZM6 E;  3P3E A;  2UUC E;  1N33 E;  4DR3 E;  1ZXM A;  4LFA E;  4JI3 I;  4AM3 A;  1S16 A;  1IBL E;  3F0N A;  2CG9 A;  4OO1 B;  1Y5Y A;  1XHK A;  2AE8 A;  2O3Z A;  3T1Y E;  1I94 I;  1IBM I;  4OKG A;  4GQU A;  3WU3 A;  1MG7 A;  4B3M I;  5K36 F;  4DUZ E;  3ZKD A;  4USK A;  2PNM A;  1OJ4 A;  4DR3 I;  4BA1 B;  2ZM6 I;  4QNK A;  4JYA E;  1ZM2 A;  3J81 Q;  3UHM A;  4FN5 A;  1H72 C;  4LPF A;  5A2Q Q;  1N34 I;  4DV6 I;  1RHY A;  4MDT A;  1N36 I;  4X64 I;  4OZE A;  4AQY I;  4FW3 A;  4LCH A;  4IFD B;  1R6L A;  2Q2E B;  3PYF A;  2HHH E;  4K0K E;  1K47 A;  2UXB I;  4U3D A;  3J80 C;  2GO4 A;  4DUY I;  2PO1 A;  2NN6 F;  4OO1 D;  2HHH I;  2PNL A;  1FWK A;  1OYR A;  4NXM I;  5DNX A;  3ZKB A;  1H7S A;  2V2Z A;  4DV7 E;  4DV5 I;  1UDN A;  3LPS A;  1N36 E;  2HFS A;  3U1Y A;  2UUA I;  1ZM4 A;  5IWA I;  5FLX Q;  2UXC I;  3JAM Q;  2E5L E;  4N3O A;  2DEI A;  5BR8 E;  1FWL A;  3NZK A;  5FWK A;  4DV0 E;  1KVK A;  2O1T A;  4DXL A;  2HK3 A;  5C0X C;  1Z0E A;  4ED4 A;  4USM A;  5FLX C;  4YHH I;  4MYU A;  4JG4 A;  3L7Z B;  3J81 C;  4EMD A;  3Q1Q A;  4DV4 I;  2Z5B A;  4BA2 A;  2C39 A;  1VI7 A;  1RR9 A;  1USV A;  4ZVI A;  4LFA I;  4DR2 E;  5BR8 I;  3QT6 A;  1XMQ E;  2IES A;  3U1K A;  2E5L I;  2UU9 I;  1HNW E;  1Y4U A;  3J80 Q;  4JI6 E;  4JI2 I;  2IOQ A;  2PO2 B;  3M7N G;  2UUA E;  2BA0 G;  3GME A;  1XMO E;  4FW5 A;  3GON A;  4FW6 A;  1DAR A;  4DV2 E;  2ZIT A;  4MU4 A;  1HNZ E;  3Q6M A;  5JEA C;  1Z0G A;  4IFD F;  3HKM A;  2V2V A;  4DV0 I;  4B3S I;  2C37 A;  2CZ9 A;  4HXZ A;  2UXD E;  5JEA D;  4X62 E;  2UXB E;  1KIJ A;  5C0X A;  2VES A;  3B82 A;  3D4J A;  4Z7C A;  3V2U C;  3PYG A;  1J5E E;  4B3T I;  4DPW A;  4URL A;  3WU6 A;  4DV2 I;  4DV7 I;  1Z5C A;  4X64 E;  4R1F A;  1XMO I;  4DU7 A;  4JI8 E;  2JE6 A;  2PO1 B;  1KTV A;  5C0X E;  4JI2 E;  1FNM A;  4DPU A;  1YH8 A;  3WU5 A;  5C0X F;  2JEB B;  5C0X B;  1XMQ I;  1Y4S A;  4AIM A;  3QT7 A;  3B8H A;  4HAC B;  4PRX A;  5LL6 R;  4DV1 E;  2UXD I;  4K0K I;  4B3S E;  4LF4 E;  4GKK I;  1H73 A;  3LNU A;  2VQE E;  1Y6Z A;  1HNZ I;  4DR7 E;  3M6A A;  4DV3 I;  4LF6 E;  2VQE I;  5DRR A;  4LF8 I;  2IOP A;  4GKK E;  1H74 A;  1YHC A;  4FW9 A;  1RRE A;  1HR0 E;  2Z5E A;  4DPY A;  4WUD A;  2EFG A;  4FWD A;  2UXC E;  1MX0 A;  2J7K A;  4DV4 E;  4JI8 I;  4LF8 E;  4HAC A;  3T1H I;  4DV3 E;  4LF5 E;  4OO1 E;  4OO1 A;  4DR7 I;  4DR4 E;  1I94 E;  1IBM E;  5L3J A;  4NXM E;  4LOM A;  2J65 A;  4DR1 E;  4PU9 A;  1FJG E;  2WP8 B;  2WNR A;  4KQV A;  2WNR B;  4YY3 I;  1HNX I;  5K36 A;  2HK2 A;  4WUC A;  4QNJ A;  3PS3 A;  2R42 A;  2GO3 A;  4Z7Y A;  4LF9 I;  4NXN E;  4MYT A;  2V34 A;  3P76 A;  4X66 E;  3OTO E;  3GCM A;  3PYD A;  4MQY A;  3QT8 A;  4ISA A;  4DV5 E;  5K36 C;  2NN6 C;  2BA0 D;  2PNZ A;  2A2D A;  5JEA F;  3M85 D;  1XNR E;  2PNZ B;  1N34 E;  1Z5B A;  2UU9 E;  1HNW I;  4DUY E;  1NZ0 A;  2HKJ A;  3B4T A;  4IZJ B;  3M85 G;  4OX9 E;  3PS2 A;  4YY3 E;  1Z5A A;  5EKW A;  1P42 A;  3PYE A;  1Z0W A;  1FJG I;  4JI0 E;  4LF7 I;  3PS1 A;  5DRO A;  4NBQ A;  4DR1 I;  3K85 A;  2Z5B B;  4BA2 B;  4DR5 I;  2WW4 A;  4LCG A;  2NN6 D;  2F1D A;  4WUB A;  3T1H E;  1S4E A;  3CDI A;  4DV6 E;  4IS9 A;  2JEB A;  4LFC E;  4JI5 I;  4MU3 A;  1IBL I;  2C38 A;  2VQF E;  4P52 A;  5LMN I;  2O1U A;  2HKE A;  1PVG A;  1FI4 A;  3H4L A;  4IFD C;  1ZXN A;  1PKP A;  2NN6 B;  4LFC I;  4MU0 A;  4IZJ A;  4DU8 A;  4B3M E;  5DRQ A;  4MU1 A;  3P3C A;  1EI1 A;  2VF3 A;  4DR5 E;  5GMD A;  3T1Y I;  1VIS A;  4IZJ D;  2XEX A;  2OI2 A;  2NPF A;  5DRP A;  4I3H A;  1HK7 A;  4RPF A;  4P7A A;  4LF4 I;  4JI0 I;  4LF7 E;  4B3R E;  2X36 A;  5K36 D;  1PIE A;  5IT9 Q;  2CVE A;  1MU5 A;  2UUC I;  3P06 A;  4OX9 I;  5LMU E;  1OYS A;  1R6M A;  5ELW A;  2V2Q A;  4JI4 E;  2ZBK B;  2BA1 G;  5EL9 A;  4GKJ I;  1XNR I;  1D6T A;  1OYP A;  2WP8 A;  4DPT A;  5IT9 C;  4FW4 A;  2Z5C A;  2CGE A;  2JE6 B;  3ZM7 A;  5JEA A;  2NN6 A;  4JV5 I;  4X66 I;  4LCF A;  2UUB I;  2BM1 A;  1ELO A;  1UDQ A;  4NXN I;  4LF9 E;  4M1K A;  4IFD E; 
#chains in the Genus database with same CATH homology
 3ZZT A;  1N32 I;  4HYM A;  4X62 I;  1HNX E;  4JI7 E;  2GQ0 A;  2Z5C B;  1N0V C;  2E1R A;  3LTO A;  1IBK I;  3J7A M;  4JV5 E;  4X65 I;  1Z0T A;  2A2C A;  1ZM9 A;  4DR4 I;  1WUU A;  4LF5 I;  3CWV A;  4KHP E;  4GKJ E;  4JI6 I;  2AJ4 A;  2F4V I;  4FWG A;  1KKH A;  4JI3 E;  1B62 A;  4JYA I;  3HUL A;  2BM0 A;  4DR2 I;  3J7A G;  4HY1 A;  2VQF I;  5LMN E;  2F4V E;  4DUZ I;  2O1V A;  4FWH A;  4KHP I;  3JAM C;  3K1J A;  4LF6 I;  1NHI A;  4YHH E;  5A2Q C;  1IBK E;  1U2R A;  2R3V A;  1ZM3 A;  1NHJ A;  2O1W A;  4UT4 A;  4IZK B;  1N33 I;  4DV1 I;  1BKN A;  3Q6N A;  1QZR A;  4LFB I;  1N32 E;  1N0U A;  3HJC A;  1XNQ I;  4DPX A;  1A6F A;  4JI5 E;  1Z59 A;  5IWA E;  2UUB E;  4DR6 E;  3V5R A;  4DR6 I;  2V8P A;  4X65 E;  1J5E I;  4B3T E;  3PRY A;  4PRV A;  3K17 A;  3WU4 A;  1UEK A;  2BV3 A;  4JI7 I;  4JI1 I;  5LMU I;  2LJP A;  1Z0C A;  1NHH A;  2HFU A;  3ZZU A;  4JI1 E;  2GS8 A;  1Z0B A;  2X7I A;  4B3R I;  1H7U A;  1EA6 A;  4AQY E;  3QT5 A;  4UTG A;  3OTO I;  5GME A;  1B63 A;  3B78 A;  1Z0V A;  4XTJ A;  4JI4 I;  1USU A;  1XNQ E;  1FKA E;  3ZZ0 A;  4IZK A;  2DEJ A;  4LFB E;  1HR0 I;  2ZM6 E;  2UUC E;  1N33 E;  4DR3 E;  1ZXM A;  4LFA E;  4JI3 I;  1S16 A;  1IBL E;  3F0N A;  2CG9 A;  1XHK A;  3T1Y E;  1I94 I;  1IBM I;  3WU3 A;  1MG7 A;  4B3M I;  4DUZ E;  3ZKD A;  4USK A;  2PNM A;  1OJ4 A;  4DR3 I;  2ZM6 I;  4JYA E;  1ZM2 A;  3J81 Q;  4FN5 A;  1H72 C;  5A2Q Q;  1N34 I;  4DV6 I;  1N36 I;  4X64 I;  4AQY I;  2Q2E B;  3PYF A;  2HHH E;  4K0K E;  1K47 A;  2UXB I;  3J80 C;  4DUY I;  2HHH I;  2PNL A;  1FWK A;  4NXM I;  3ZKB A;  1H7S A;  2V2Z A;  4DV7 E;  4DV5 I;  3LPS A;  1N36 E;  2HFS A;  2UUA I;  1ZM4 A;  5IWA I;  5FLX Q;  2UXC I;  3JAM Q;  2E5L E;  2DEI A;  4N3O A;  5BR8 E;  1FWL A;  4DV0 E;  5FWK A;  1KVK A;  2O1T A;  4DXL A;  2HK3 A;  1Z0E A;  4ED4 A;  4USM A;  5FLX C;  4YHH I;  4MYU A;  4JG4 A;  3J81 C;  4EMD A;  3Q1Q A;  4DV4 I;  2Z5B A;  1RR9 A;  1USV A;  4ZVI A;  4LFA I;  4DR2 E;  5BR8 I;  3QT6 A;  1XMQ E;  2E5L I;  2UU9 I;  1HNW E;  1Y4U A;  3J80 Q;  4JI6 E;  4JI2 I;  2IOQ A;  2UUA E;  1XMO E;  3GON A;  1DAR A;  4DV2 E;  2ZIT A;  1HNZ E;  3Q6M A;  1Z0G A;  2V2V A;  4DV0 I;  4B3S I;  2CZ9 A;  4HXZ A;  2UXD E;  4X62 E;  2UXB E;  1KIJ A;  3B82 A;  4Z7C A;  3D4J A;  3V2U C;  3PYG A;  1J5E E;  4B3T I;  4DPW A;  4URL A;  3WU6 A;  4DV2 I;  4DV7 I;  1Z5C A;  4X64 E;  4R1F A;  1XMO I;  4DU7 A;  4JI8 E;  1KTV A;  4JI2 E;  1FNM A;  4DPU A;  3WU5 A;  1XMQ I;  1Y4S A;  3QT7 A;  3B8H A;  4HAC B;  4PRX A;  5LL6 R;  4DV1 E;  2UXD I;  4K0K I;  4B3S E;  4LF4 E;  4GKK I;  1H73 A;  3LNU A;  2VQE E;  1Y6Z A;  1HNZ I;  4DR7 E;  3M6A A;  4DV3 I;  4LF6 E;  2VQE I;  4LF8 I;  2IOP A;  4GKK E;  1H74 A;  4FW9 A;  1RRE A;  1HR0 E;  2Z5E A;  4DPY A;  2EFG A;  4FWD A;  4WUD A;  2UXC E;  1MX0 A;  2J7K A;  4DV4 E;  4JI8 I;  4LF8 E;  4HAC A;  3T1H I;  4DV3 E;  4LF5 E;  4DR7 I;  4DR4 E;  1I94 E;  1IBM E;  5L3J A;  4NXM E;  4DR1 E;  4PU9 A;  1FJG E;  4KQV A;  4YY3 I;  1HNX I;  2HK2 A;  4WUC A;  2R42 A;  4Z7Y A;  4LF9 I;  4NXN E;  4MYT A;  2V34 A;  4X66 E;  3OTO E;  3PYD A;  3QT8 A;  4DV5 E;  2A2D A;  1XNR E;  1N34 E;  1Z5B A;  2UU9 E;  1HNW I;  4DUY E;  1NZ0 A;  2HKJ A;  4IZJ B;  4OX9 E;  4YY3 E;  1Z5A A;  3PYE A;  1Z0W A;  1FJG I;  4JI0 E;  4LF7 I;  4DR1 I;  3K85 A;  2Z5B B;  4DR5 I;  2WW4 A;  4WUB A;  3T1H E;  1S4E A;  4DV6 E;  4LFC E;  4JI5 I;  1IBL I;  2VQF E;  4P52 A;  5LMN I;  2O1U A;  2HKE A;  1PVG A;  1FI4 A;  3H4L A;  1ZXN A;  1PKP A;  4LFC I;  4IZJ A;  4DU8 A;  4B3M E;  1EI1 A;  2VF3 A;  4DR5 E;  5GMD A;  3T1Y I;  1VIS A;  4IZJ D;  2XEX A;  2OI2 A;  2NPF A;  4I3H A;  1HK7 A;  4RPF A;  4P7A A;  4LF4 I;  4JI0 I;  4LF7 E;  4B3R E;  2X36 A;  1PIE A;  5IT9 Q;  1MU5 A;  2UUC I;  3P06 A;  4OX9 I;  5LMU E;  2V2Q A;  4JI4 E;  2ZBK B;  4GKJ I;  1XNR I;  1D6T A;  5IT9 C;  4DPT A;  2Z5C A;  2CGE A;  3ZM7 A;  4JV5 I;  4X66 I;  2UUB I;  2BM1 A;  1ELO A;  4NXN I;  4LF9 E;  4M1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...