4K0KI

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4k0kI00
3H4LA 4DR5I 1EA6A 4LFAE 4RPFA 3ZZUA 4X66E 3ZKDA 2UUAE 4R1FA 3OTOI 1N0VC 4JI7I 4DV7I 2HK2A 3F0NA 3WU4A 2ZITA 3GONA 4DV1I 3LPSA 1FKAE 2DEJA 3V5RA 4JYAI 1B63A 4OX9E 4LF9E 2HKEA 4DV5E 4JI4I 1HNXI 1Z0BA 3WU6A 2A2DA 4X65I 4JI6I 1S16A 1PIEA 4GKKE 1WUUA 2X36A 2HKJA 2ZM6I 4KQVA 4DR4I 1H72C 1HNZE 4DR2E 4DU8A 4JI7E 1Z0TA 3OTOE 4K0KI 1RREA 4P52A 4ZVIA 4GKKI 3ZM7A 4DUYI 4X66I 2A2CA 1K47A 4DR5E 1FWKA 2UU9E 4DUYE 4DV4I 1H7SA 4JYAE 1FJGI 3QT5A 4LF6I 1B62A 4JI1I 1Z5BA 1NHHA 4FWHA 4DR4E 2VQEE 4DV6E 4DXLA 3PYDA 4DR3I 1ZM9A 4DR1I 4DV3E 5LMNE 2J7KA 5L3JA 1OJ4A 1N33E 2X7IA 4UT4A 4GKJI 1FI4A 4AQYE 4DV1E 2UXCI 5GMDA 1Z0WA 3QT6A 3T1HE 4DV7E 2EFGA 1Z0VA 5IT9C 4LF6E 2GS8A 4FN5A 2VF3A 1XMOE 5A2QQ 5IT9Q 4PRXA 3B78A 2HK3A 4UTGA 1HR0I 3K1JA 3D4JA 2LJPA 5LMNI 1ZXNA 4YHHE 1XNRE 4URLA 4JV5E 4USKA 4DV2E 4LF4I 4B3RI 3J80Q 1H7UA 3PYGA 4EMDA 4LF7E 4LF7I 2R3VA 1HNZI 1HNWI 1EI1A 2UUCE 2UXCE 4DV4E 4JI2I 4DPWA 3J7AG 2VQFI 1HNXE 4DR7E 4DR7I 1XMOI 4X64I 4HY1A 1J5EE 4LF5E 4DU7A 4USMA 4B3SI 3PYEA 1KTVA 4K0KE 2V8PA 5GMEA 4JG4A 2HFUA 4DV0I 2F4VI 4DPTA 1N34I 3ZKBA 4M1KA 1IBME 4DUZE 1N32E 2WW4A 4DPYA 4YY3E 4AQYI 4PU9A 4GKJE 1IBLI 4DR6E 4LFCI 3K17A 1J5EI 2UXDE 4P7AA 4LF9I 1NHJA 4LFBI 2CZ9A 1PVGA 1D6TA 1N0UA 3J81Q 4DPUA 3PYFA 4LF8E 4NXMI 4B3ME 4Z7YA 4B3TI 2E5LI 1N36E 1PKPA 3B8HA 1RR9A 5IWAI 1XHKA 2HHHE 2UXBI 5FLXC 2XEXA 1Z59A 1Z0EA 4HXZA 4LFCE 3HULA 1IBLE 3Q1QA 4DV5I 4DR1E 1DARA 4YY3I 4B3MI 1ZM4A 2UUBE 3M6AA 1Z5CA 1IBKI 4FW9A 1UEKA 3J81C 4FWDA 2DEIA 2AJ4A 4WUDA 5LMUI 2UUAI 1XNRI 1QZRA 4JI3E 4YHHI 1BKNA 4LFAI 2HHHI 2UXBE 3V2UC 1ELOA 1N36I 1A6FA 2HFSA 3ZZ0A 4NXME 3JAMQ 4JI0I 4NXNI 2V2QA 3WU5A 1I94E 5FLXQ 1KKHA 4LFBE 4KHPE 1FWLA 5A2QC 1MX0A 2R42A 1N33I 4JI6E 1ZM3A 2UXDI 4KHPI 5LMUE 3WU3A 2E5LE 4JI5E 1ZXMA 4OX9I 1FNMA 1NHIA 1IBMI 3T1HI 3ZZTA 4HYMA 4X62I 1H74A 4WUBA 4DV0E 4PRVA 2F4VE 2ZM6E 1XMQI 4B3SE 3JAMC 1FJGE 1U2RA 5BR8E 4X65E 2UU9I 1MG7A 4DPXA 2VQFE 4JI2E 4WUCA 4HACA 4DV3I 4B3TE 1XNQI 4MYUA 2UUCI 4DV6I 3B82A 2VQEI 4X62E 1KIJA 2V2VA 4LF8I 1HNWE 4NXNE 4I3HA 4JI8I 3CWVA 1S4EA 1N34E 4JI5I 1VISA 4JV5I 4XTJA 2OI2A 1KVKA 4JI3I 3LNUA 3QT7A 3J80C 1Z0CA 4DR6I 5BR8I 1H73A 2E1RA 4JI4E 1I94I 1XMQE 3T1YI 4DUZI 1N32I 1XNQE 4JI0E 2BM1A 2NPFA 4DR2I 4B3RE 2ZBKB 2BV3A 2V2ZA 2Q2EB 1MU5A 5LL6R 4MYTA 3J7AM 4LF5I 1HR0E 4FWGA 5IWAE 1NZ0A 1IBKE 1Z0GA 4Z7CA 4ED4A 4DR3E 2UUBI 1Z5AA 2V34A 4JI8E 2BM0A 4LF4E 4HACB 4JI1E 3T1YE 4DV2I 3LTOA 4X64E 1ZM2A 3QT8A
chains in the Genus database with same CATH superfamily
3H4LA 4DR5I 1EA6A 4LFAE 4RPFA 4BA1B 3ZZUA 4X66E 2WNRA 3ZKDA 2UUAE 4FW7A 4R1FA 4IFDE 3OTOI 1N0VC 2Z5CA 4JI7I 4DV7I 2GO3A 3PS1A 2HK2A 4QNKA 3F0NA 3K85A 3WU4A 2ZITA 3GONA 4DV1I 3LPSA 1FKAE 5C0XF 2DEJA 3V5RA 4JYAI 1B63A 4OX9E 4LF9E 5DROA 2HKEA 4DV5E 4OO1B 4JI4I 5K36A 1HNXI 1Z0BA 2IESA 3WU6A 2NN6D 2A2DA 2IOQA 4MQYA 2BR2B 4X65I 4JI6I 1S16A 5K36E 1PIEA 4GKKE 1UDNA 1WUUA 2X36A 3UHMA 2HKJA 5C0XD 2ZM6I 1VI7A 2IERA 5ELWA 3L7ZA 4KQVA 4DR4I 1USUA 1H72C 2PO0A 5EKWA 1HNZE 4AIMA 4DR2E 3Q6MA 4DU8A 2JEBA 4JI7E 2WNRB 1UDOA 3M85D 1Z0TA 3OTOE 4K0KI 1RREA 3PRYA 4P52A 4ZVIA 4GKKI 3P76A 3ZM7A 2C37B 1UDQA 4DUYI 3HJCA 4X66I 1P42A 2J65A 2A2CA 5FWKA 1K47A 4DR5E 1FWKA 2C39B 1Y60A 2UU9E 4DUYE 4DV4I 3B4TA 1H7SA 4JYAE 1FJGI 3QT5A 4IS9A 4LF6I 1B62A 4JI1I 5JEAD 2NN6F 1Z5BA 4OZEA 5C0XB 1NHHA 3GLLA 2O1VA 4IZJD 4FWHA 4DR4E 2VQEE 4DV6E 4DXLA 3DD6A 3PYDA 5JEAC 4DR3I 1ZM9A 4DR1I 3Q6NA 2JT2A 3U1YA 5LMNE 4DV3E 4MU1A 2JE6B 2J7KA 5L3JA 1OJ4A 5DNLA 1N33E 3NZKA 2X7IA 4UT4A 4OO1E 4GKJI 1FI4A 4AQYE 5K36C 4DV1E 5DRRA 2UXCI 5GMDA 1Z0WA 3P3EA 3QT6A 3T1HE 4DV7E 1HK7A 2EFGA 1Z0VA 5IT9C 4LF6E 2GS8A 4FN5A 2VF3A 1XMOE 5A2QQ 5IT9Q 4PRXA 2PO2B 3B78A 2HK3A 4UTGA 1HR0I 3K1JA 1E3HA 3D4JA 2LJPA 5LMNI 1ZXNA 2CGEA 4YHHE 1XNRE 4URLA 4OO1F 4ISAA 3M85G 4OO1C 4JV5E 4USKA 4DV2E 4LF4I 4B3RI 3J80Q 1H7UA 3PYGA 4EMDA 4LF7E 4IFDB 4LF7I 2R3VA 1HNZI 1HNWI 1EI1A 2GQ0A 2O3ZA 4LOMA 2BA1G 2UUCE 2UXCE 2PO1B 4DV4E 5JEAF 4JI2I 5JEAE 3M7NG 1Y4SA 2NN6E 4DPWA 3J7AG 2VQFI 1HNXE 4DR7E 4DR7I 1XMOI 4X64I 4HY1A 1J5EE 4BA1A 4LF5E 4DU7A 4USMA 4B3SI 2BA0G 3PYEA 1R6MA 1KTVA 4K0KE 2V8PA 5GMEA 4JG4A 2HFUA 4DV0I 2F4VI 2BA0D 2C37A 4DPTA 1N34I 2O1WA 4IFDA 3ZKBA 2C38B 4M1KA 1IBME 4DUZE 1N32E 2NN6A 2WW4A 4DPYA 4YY3E 2O1UA 4AQYI 1UDSA 4OO1D 4PU9A 4GKJE 1IBLI 4OO1A 2Z5CB 4DR6E 4LFCI 3K17A 1J5EI 2UXDE 3U1KA 1Y5YA 2NN6C 2BR2A 4P7AA 4LF9I 1NHJA 2CVEA 5K36F 1RHYA 4LFBI 2CZ9A 1PVGA 2JEAA 1D6TA 1N0UA 3J81Q 4DPUA 2PO0B 5DRQA 4N3OA 3PYFA 4LF8E 4NXMI 5C0XE 4B3ME 2GO4A 4Z7YA 4LPFA 4B3TI 2E5LI 1N36E 1PKPA 3B8HA 3L7ZB 1RR9A 5IWAI 4AM3A 1XHKA 2HHHE 2UXBI 2JE6A 4QNJA 5FLXC 2XEXA 1Z59A 1Z0EA 4HXZA 4MU0A 4LFCE 3HULA 1IBLE 3Q1QA 4DV5I 4DR1E 1DARA 2IOPA 2PNZA 4YY3I 1YHCA 4B3MI 1ZM4A 2JEBB 2UUBE 3CDJA 3M6AA 1Z5CA 2WP8A 1IBKI 4FW9A 1UEKA 5EL9A 3J81C 4FWDA 2DEIA 2AJ4A 4WUDA 4LCGA 5LMUI 2UUAI 1XNRI 1QZRA 4JI3E 4YHHI 1BKNA 4LFAI 4MDTA 2HHHI 2UXBE 3GCMA 3V2UC 1ELOA 4MU4A 1N36I 1A6FA 1YH8A 2PO1A 2Z5BB 2HFSA 3ZZ0A 5C0XA 4NXME 3JAMQ 4JI0I 4NXNI 2V2QA 3WU5A 1I94E 2PNMA 5K36D 4FW3A 5C0XC 5FLXQ 1KKHA 2JEAB 2O1TA 4LFBE 4KHPE 1FWLA 1OYRA 5A2QC 3H1CA 4FW5A 1MX0A 2R42A 1N33I 4JI6E 1ZM3A 2UXDI 4IZKA 4KHPI 5JEAB 3HKMA 5LMUE 2NN6B 3WU3A 2E5LE 2CG9A 5DRPA 1USVA 4JI5E 4U3DA 1ZXMA 4OX9I 1FNMA 2VESA 1R6LA 1NHIA 1IBMI 2PO2A 3T1HI 3ZZTA 4HYMA 4IFDF 4X62I 4BA2A 1H74A 4WUBA 4DV0E 4PRVA 2F4VE 2ZM6E 3P06A 1XMQI 4B3SE 2AE8A 3JAMC 2F1DA 1FJGE 5K36B 1U2RA 2PNLA 5BR8E 4X65E 2UU9I 1MG7A 2C39A 4DPXA 2VQFE 4BA2B 1OYSA 4JI2E 5JEAA 4WUCA 4HACA 4DV3I 4GQUA 4B3TE 1XNQI 2Z5EA 4MYUA 4NBQA 2UUCI 4DV6I 3B82A 2VQEI 4X62E 1KIJA 2V2VA 4LF8I 1HNWE 3P3CA 2BA1D 4NXNE 4I3HA 4JI8I 4IZKB 3CWVA 1S4EA 1N34E 4JI5I 1VISA 4JV5I 4XTJA 2OI2A 3PS2A 1KVKA 4IZJA 4JI3I 3LNUA 4IFDC 3QT7A 3J80C 1Z0CA 4DR6I 5BR8I 1H73A 2E1RA 4JI4E 2WP8B 1I94I 3KRNA 1XMQE 3T1YI 4OKGA 4DUZI 1N32I 1XNQE 1OYPA 4JI0E 2C38A 1XXEA 2BM1A 2NPFA 4DR2I 4B3RE 2ZBKB 2BV3A 2V2ZA 2Q2EB 3GMEA 1MU5A 5LL6R 1E3PA 4MYTA 3J7AM 2Z5BA 3PS3A 4LF5I 4IFDD 4J3DA 1HR0E 4AIDA 4FWGA 1Y6ZA 3M7ND 3CDIA 5IWAE 1NZ0A 4FW6A 1IBKE 1Z0GA 4Z7CA 4ED4A 4LCFA 4DR3E 2PNZB 2UUBI 1Z5AA 4IZJB 4LCHA 2V34A 4FW4A 4JI8E 3P3GA 4MU3A 2BM0A 5DNXA 4LF4E 4HACB 4JI1E 3T1YE 1Y4UA 3LTOA 4DV2I 4U3BA 4X64E 1ZM2A 3QT8A
chains in the Genus database with same CATH topology
3H4LA 4DR5I 1EA6A 4LFAE 4RPFA 3ZZUA 4X66E 3ZKDA 2UUAE 4R1FA 3OTOI 1N0VC 2Z5CA 4JI7I 4DV7I 2HK2A 3F0NA 3K85A 3WU4A 2ZITA 3GONA 4DV1I 3LPSA 1FKAE 2DEJA 3V5RA 4JYAI 1B63A 4OX9E 4LF9E 2HKEA 4DV5E 4JI4I 1HNXI 1Z0BA 3WU6A 2A2DA 2IOQA 4X65I 4JI6I 1S16A 1PIEA 4GKKE 1WUUA 2X36A 2HKJA 2ZM6I 4KQVA 4DR4I 1USUA 1H72C 1HNZE 4DR2E 3Q6MA 4DU8A 4JI7E 1Z0TA 3OTOE 4K0KI 1RREA 3PRYA 4P52A 4ZVIA 4GKKI 3ZM7A 4DUYI 3HJCA 4X66I 2A2CA 5FWKA 1K47A 4DR5E 1FWKA 2UU9E 4DUYE 4DV4I 1H7SA 4JYAE 1FJGI 3QT5A 4LF6I 1B62A 4JI1I 1Z5BA 1NHHA 2O1VA 4IZJD 4FWHA 4DR4E 2VQEE 4DV6E 4DXLA 3PYDA 4DR3I 1ZM9A 4DR1I 3Q6NA 4DV3E 5LMNE 2J7KA 5L3JA 1OJ4A 1N33E 2X7IA 4UT4A 4GKJI 1FI4A 4AQYE 4DV1E 2UXCI 5GMDA 1Z0WA 3QT6A 3T1HE 4DV7E 1HK7A 2EFGA 1Z0VA 5IT9C 4LF6E 2GS8A 4FN5A 2VF3A 1XMOE 5A2QQ 5IT9Q 4PRXA 3B78A 2HK3A 4UTGA 1HR0I 3K1JA 3D4JA 2LJPA 5LMNI 1ZXNA 2CGEA 4YHHE 1XNRE 4URLA 4JV5E 4USKA 4DV2E 4LF4I 4B3RI 3J80Q 1H7UA 3PYGA 4EMDA 4LF7E 4LF7I 2R3VA 1HNZI 1HNWI 1EI1A 2GQ0A 2UUCE 2UXCE 4DV4E 4JI2I 1Y4SA 4DPWA 3J7AG 2VQFI 1HNXE 4DR7E 4DR7I 1XMOI 4X64I 4HY1A 1J5EE 4LF5E 4DU7A 4USMA 4B3SI 3PYEA 1KTVA 4K0KE 2V8PA 5GMEA 4JG4A 2HFUA 4DV0I 2F4VI 4DPTA 1N34I 2O1WA 3ZKBA 4M1KA 1IBME 4DUZE 1N32E 2WW4A 4DPYA 4YY3E 2O1UA 4AQYI 4PU9A 4GKJE 1IBLI 2Z5CB 4DR6E 4LFCI 3K17A 1J5EI 2UXDE 4P7AA 4LF9I 1NHJA 4LFBI 2CZ9A 1PVGA 1D6TA 1N0UA 3J81Q 4DPUA 4N3OA 3PYFA 4LF8E 4NXMI 4B3ME 4Z7YA 4B3TI 2E5LI 1N36E 1PKPA 3B8HA 1RR9A 5IWAI 1XHKA 2HHHE 2UXBI 5FLXC 2XEXA 1Z59A 1Z0EA 4HXZA 4LFCE 3HULA 1IBLE 3Q1QA 4DV5I 4DR1E 1DARA 2IOPA 4YY3I 4B3MI 1ZM4A 2UUBE 3M6AA 1Z5CA 1IBKI 4FW9A 1UEKA 3J81C 4FWDA 2DEIA 2AJ4A 4WUDA 5LMUI 2UUAI 1XNRI 1QZRA 4JI3E 4YHHI 1BKNA 4LFAI 2HHHI 2UXBE 3V2UC 1ELOA 1N36I 1A6FA 2Z5BB 2HFSA 3ZZ0A 4NXME 3JAMQ 4JI0I 4NXNI 2V2QA 3WU5A 1I94E 2PNMA 5FLXQ 1KKHA 2O1TA 4LFBE 4KHPE 1FWLA 5A2QC 1MX0A 2R42A 1N33I 4JI6E 1ZM3A 2UXDI 4IZKA 4KHPI 5LMUE 3WU3A 2E5LE 2CG9A 1USVA 4JI5E 1ZXMA 4OX9I 1FNMA 1NHIA 1IBMI 3T1HI 3ZZTA 4HYMA 4X62I 1H74A 4WUBA 4DV0E 4PRVA 2F4VE 2ZM6E 3P06A 1XMQI 4B3SE 3JAMC 1FJGE 1U2RA 2PNLA 5BR8E 4X65E 2UU9I 1MG7A 4DPXA 2VQFE 4JI2E 4WUCA 4HACA 4DV3I 4B3TE 1XNQI 2Z5EA 4MYUA 2UUCI 4DV6I 3B82A 2VQEI 4X62E 1KIJA 2V2VA 4LF8I 1HNWE 4NXNE 4I3HA 4JI8I 4IZKB 3CWVA 1S4EA 1N34E 4JI5I 1VISA 4JV5I 4XTJA 2OI2A 1KVKA 4IZJA 4JI3I 3LNUA 3QT7A 3J80C 1Z0CA 4DR6I 5BR8I 1H73A 2E1RA 4JI4E 1I94I 1XMQE 3T1YI 4DUZI 1N32I 1XNQE 4JI0E 2BM1A 2NPFA 4DR2I 4B3RE 2ZBKB 2BV3A 2V2ZA 2Q2EB 1MU5A 5LL6R 4MYTA 3J7AM 2Z5BA 4LF5I 1HR0E 4FWGA 1Y6ZA 5IWAE 1NZ0A 1IBKE 1Z0GA 4Z7CA 4ED4A 4DR3E 2UUBI 1Z5AA 4IZJB 2V34A 4JI8E 2BM0A 4LF4E 4HACB 4JI1E 3T1YE 1Y4UA 3LTOA 4DV2I 4X64E 1ZM2A 3QT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4L A;  4DR5 I;  1EA6 A;  4LFA E;  4RPF A;  3ZZU A;  4X66 E;  3ZKD A;  2UUA E;  4R1F A;  3OTO I;  1N0V C;  4JI7 I;  4DV7 I;  2HK2 A;  3F0N A;  3WU4 A;  2ZIT A;  3GON A;  4DV1 I;  3LPS A;  1FKA E;  2DEJ A;  3V5R A;  4JYA I;  1B63 A;  4OX9 E;  4LF9 E;  2HKE A;  4DV5 E;  4JI4 I;  1HNX I;  1Z0B A;  3WU6 A;  2A2D A;  4X65 I;  4JI6 I;  1S16 A;  1PIE A;  4GKK E;  1WUU A;  2X36 A;  2HKJ A;  2ZM6 I;  4KQV A;  4DR4 I;  1H72 C;  1HNZ E;  4DR2 E;  4DU8 A;  4JI7 E;  1Z0T A;  3OTO E;  4K0K I;  1RRE A;  4P52 A;  4ZVI A;  4GKK I;  3ZM7 A;  4DUY I;  4X66 I;  2A2C A;  1K47 A;  4DR5 E;  1FWK A;  2UU9 E;  4DUY E;  4DV4 I;  1H7S A;  4JYA E;  1FJG I;  3QT5 A;  4LF6 I;  1B62 A;  4JI1 I;  1Z5B A;  1NHH A;  4FWH A;  4DR4 E;  2VQE E;  4DV6 E;  4DXL A;  3PYD A;  4DR3 I;  1ZM9 A;  4DR1 I;  4DV3 E;  5LMN E;  2J7K A;  5L3J A;  1OJ4 A;  1N33 E;  2X7I A;  4UT4 A;  4GKJ I;  1FI4 A;  4AQY E;  4DV1 E;  2UXC I;  5GMD A;  1Z0W A;  3QT6 A;  3T1H E;  4DV7 E;  2EFG A;  1Z0V A;  5IT9 C;  4LF6 E;  2GS8 A;  4FN5 A;  2VF3 A;  1XMO E;  5A2Q Q;  5IT9 Q;  4PRX A;  3B78 A;  2HK3 A;  4UTG A;  1HR0 I;  3K1J A;  3D4J A;  2LJP A;  5LMN I;  1ZXN A;  4YHH E;  1XNR E;  4URL A;  4JV5 E;  4USK A;  4DV2 E;  4LF4 I;  4B3R I;  3J80 Q;  1H7U A;  3PYG A;  4EMD A;  4LF7 E;  4LF7 I;  2R3V A;  1HNZ I;  1HNW I;  1EI1 A;  2UUC E;  2UXC E;  4DV4 E;  4JI2 I;  4DPW A;  3J7A G;  2VQF I;  1HNX E;  4DR7 E;  4DR7 I;  1XMO I;  4X64 I;  4HY1 A;  1J5E E;  4LF5 E;  4DU7 A;  4USM A;  4B3S I;  3PYE A;  1KTV A;  4K0K E;  2V8P A;  5GME A;  4JG4 A;  2HFU A;  4DV0 I;  2F4V I;  4DPT A;  1N34 I;  3ZKB A;  4M1K A;  1IBM E;  4DUZ E;  1N32 E;  2WW4 A;  4DPY A;  4YY3 E;  4AQY I;  4PU9 A;  4GKJ E;  1IBL I;  4DR6 E;  4LFC I;  3K17 A;  1J5E I;  2UXD E;  4P7A A;  4LF9 I;  1NHJ A;  4LFB I;  2CZ9 A;  1PVG A;  1D6T A;  1N0U A;  3J81 Q;  4DPU A;  3PYF A;  4LF8 E;  4NXM I;  4B3M E;  4Z7Y A;  4B3T I;  2E5L I;  1N36 E;  1PKP A;  3B8H A;  1RR9 A;  5IWA I;  1XHK A;  2HHH E;  2UXB I;  5FLX C;  2XEX A;  1Z59 A;  1Z0E A;  4HXZ A;  4LFC E;  3HUL A;  1IBL E;  3Q1Q A;  4DV5 I;  4DR1 E;  1DAR A;  4YY3 I;  4B3M I;  1ZM4 A;  2UUB E;  3M6A A;  1Z5C A;  1IBK I;  4FW9 A;  1UEK A;  3J81 C;  4FWD A;  2DEI A;  2AJ4 A;  4WUD A;  5LMU I;  2UUA I;  1XNR I;  1QZR A;  4JI3 E;  4YHH I;  1BKN A;  4LFA I;  2HHH I;  2UXB E;  3V2U C;  1ELO A;  1N36 I;  1A6F A;  2HFS A;  3ZZ0 A;  4NXM E;  3JAM Q;  4JI0 I;  4NXN I;  2V2Q A;  3WU5 A;  1I94 E;  5FLX Q;  1KKH A;  4LFB E;  4KHP E;  1FWL A;  5A2Q C;  1MX0 A;  2R42 A;  1N33 I;  4JI6 E;  1ZM3 A;  2UXD I;  4KHP I;  5LMU E;  3WU3 A;  2E5L E;  4JI5 E;  1ZXM A;  4OX9 I;  1FNM A;  1NHI A;  1IBM I;  3T1H I;  3ZZT A;  4HYM A;  4X62 I;  1H74 A;  4WUB A;  4DV0 E;  4PRV A;  2F4V E;  2ZM6 E;  1XMQ I;  4B3S E;  3JAM C;  1FJG E;  1U2R A;  5BR8 E;  4X65 E;  2UU9 I;  1MG7 A;  4DPX A;  2VQF E;  4JI2 E;  4WUC A;  4HAC A;  4DV3 I;  4B3T E;  1XNQ I;  4MYU A;  2UUC I;  4DV6 I;  3B82 A;  2VQE I;  4X62 E;  1KIJ A;  2V2V A;  4LF8 I;  1HNW E;  4NXN E;  4I3H A;  4JI8 I;  3CWV A;  1S4E A;  1N34 E;  4JI5 I;  1VIS A;  4JV5 I;  4XTJ A;  2OI2 A;  1KVK A;  4JI3 I;  3LNU A;  3QT7 A;  3J80 C;  1Z0C A;  4DR6 I;  5BR8 I;  1H73 A;  2E1R A;  4JI4 E;  1I94 I;  1XMQ E;  3T1Y I;  4DUZ I;  1N32 I;  1XNQ E;  4JI0 E;  2BM1 A;  2NPF A;  4DR2 I;  4B3R E;  2ZBK B;  2BV3 A;  2V2Z A;  2Q2E B;  1MU5 A;  5LL6 R;  4MYT A;  3J7A M;  4LF5 I;  1HR0 E;  4FWG A;  5IWA E;  1NZ0 A;  1IBK E;  1Z0G A;  4Z7C A;  4ED4 A;  4DR3 E;  2UUB I;  1Z5A A;  2V34 A;  4JI8 E;  2BM0 A;  4LF4 E;  4HAC B;  4JI1 E;  3T1Y E;  4DV2 I;  3LTO A;  4X64 E;  1ZM2 A;  3QT8 A; 
#chains in the Genus database with same CATH topology
 3H4L A;  4DR5 I;  1EA6 A;  4LFA E;  4RPF A;  4BA1 B;  3ZZU A;  4X66 E;  2WNR A;  3ZKD A;  2UUA E;  4FW7 A;  4R1F A;  4IFD E;  3OTO I;  1N0V C;  2Z5C A;  4JI7 I;  4DV7 I;  2GO3 A;  3PS1 A;  2HK2 A;  4QNK A;  3F0N A;  3K85 A;  3WU4 A;  2ZIT A;  3GON A;  4DV1 I;  3LPS A;  1FKA E;  5C0X F;  2DEJ A;  3V5R A;  4JYA I;  1B63 A;  4OX9 E;  4LF9 E;  5DRO A;  2HKE A;  4DV5 E;  4OO1 B;  4JI4 I;  5K36 A;  1HNX I;  1Z0B A;  2IES A;  3WU6 A;  2NN6 D;  2A2D A;  2IOQ A;  4MQY A;  2BR2 B;  4X65 I;  4JI6 I;  1S16 A;  5K36 E;  1PIE A;  4GKK E;  1UDN A;  1WUU A;  2X36 A;  3UHM A;  2HKJ A;  5C0X D;  2ZM6 I;  1VI7 A;  2IER A;  5ELW A;  3L7Z A;  4KQV A;  4DR4 I;  1USU A;  1H72 C;  2PO0 A;  5EKW A;  1HNZ E;  4AIM A;  4DR2 E;  3Q6M A;  4DU8 A;  2JEB A;  4JI7 E;  2WNR B;  1UDO A;  3M85 D;  1Z0T A;  3OTO E;  4K0K I;  1RRE A;  3PRY A;  4P52 A;  4ZVI A;  4GKK I;  3P76 A;  3ZM7 A;  2C37 B;  1UDQ A;  4DUY I;  3HJC A;  4X66 I;  1P42 A;  2J65 A;  2A2C A;  5FWK A;  1K47 A;  4DR5 E;  1FWK A;  2C39 B;  1Y60 A;  2UU9 E;  4DUY E;  4DV4 I;  3B4T A;  1H7S A;  4JYA E;  1FJG I;  3QT5 A;  4IS9 A;  4LF6 I;  1B62 A;  4JI1 I;  5JEA D;  2NN6 F;  1Z5B A;  4OZE A;  5C0X B;  1NHH A;  3GLL A;  2O1V A;  4IZJ D;  4FWH A;  4DR4 E;  2VQE E;  4DV6 E;  4DXL A;  3DD6 A;  3PYD A;  5JEA C;  4DR3 I;  1ZM9 A;  4DR1 I;  3Q6N A;  2JT2 A;  3U1Y A;  5LMN E;  4DV3 E;  4MU1 A;  2JE6 B;  2J7K A;  5L3J A;  1OJ4 A;  5DNL A;  1N33 E;  3NZK A;  2X7I A;  4UT4 A;  4OO1 E;  4GKJ I;  1FI4 A;  4AQY E;  5K36 C;  4DV1 E;  5DRR A;  2UXC I;  5GMD A;  1Z0W A;  3P3E A;  3QT6 A;  3T1H E;  4DV7 E;  1HK7 A;  2EFG A;  1Z0V A;  5IT9 C;  4LF6 E;  2GS8 A;  4FN5 A;  2VF3 A;  1XMO E;  5A2Q Q;  5IT9 Q;  4PRX A;  2PO2 B;  3B78 A;  2HK3 A;  4UTG A;  1HR0 I;  3K1J A;  1E3H A;  3D4J A;  2LJP A;  5LMN I;  1ZXN A;  2CGE A;  4YHH E;  1XNR E;  4URL A;  4OO1 F;  4ISA A;  3M85 G;  4OO1 C;  4JV5 E;  4USK A;  4DV2 E;  4LF4 I;  4B3R I;  3J80 Q;  1H7U A;  3PYG A;  4EMD A;  4LF7 E;  4IFD B;  4LF7 I;  2R3V A;  1HNZ I;  1HNW I;  1EI1 A;  2GQ0 A;  2O3Z A;  4LOM A;  2BA1 G;  2UUC E;  2UXC E;  2PO1 B;  4DV4 E;  5JEA F;  4JI2 I;  5JEA E;  3M7N G;  1Y4S A;  2NN6 E;  4DPW A;  3J7A G;  2VQF I;  1HNX E;  4DR7 E;  4DR7 I;  1XMO I;  4X64 I;  4HY1 A;  1J5E E;  4BA1 A;  4LF5 E;  4DU7 A;  4USM A;  4B3S I;  2BA0 G;  3PYE A;  1R6M A;  1KTV A;  4K0K E;  2V8P A;  5GME A;  4JG4 A;  2HFU A;  4DV0 I;  2F4V I;  2BA0 D;  2C37 A;  4DPT A;  1N34 I;  2O1W A;  4IFD A;  3ZKB A;  2C38 B;  4M1K A;  1IBM E;  4DUZ E;  1N32 E;  2NN6 A;  2WW4 A;  4DPY A;  4YY3 E;  2O1U A;  4AQY I;  1UDS A;  4OO1 D;  4PU9 A;  4GKJ E;  1IBL I;  4OO1 A;  2Z5C B;  4DR6 E;  4LFC I;  3K17 A;  1J5E I;  2UXD E;  3U1K A;  1Y5Y A;  2NN6 C;  2BR2 A;  4P7A A;  4LF9 I;  1NHJ A;  2CVE A;  5K36 F;  1RHY A;  4LFB I;  2CZ9 A;  1PVG A;  2JEA A;  1D6T A;  1N0U A;  3J81 Q;  4DPU A;  2PO0 B;  5DRQ A;  4N3O A;  3PYF A;  4LF8 E;  4NXM I;  5C0X E;  4B3M E;  2GO4 A;  4Z7Y A;  4LPF A;  4B3T I;  2E5L I;  1N36 E;  1PKP A;  3B8H A;  3L7Z B;  1RR9 A;  5IWA I;  4AM3 A;  1XHK A;  2HHH E;  2UXB I;  2JE6 A;  4QNJ A;  5FLX C;  2XEX A;  1Z59 A;  1Z0E A;  4HXZ A;  4MU0 A;  4LFC E;  3HUL A;  1IBL E;  3Q1Q A;  4DV5 I;  4DR1 E;  1DAR A;  2IOP A;  2PNZ A;  4YY3 I;  1YHC A;  4B3M I;  1ZM4 A;  2JEB B;  2UUB E;  3CDJ A;  3M6A A;  1Z5C A;  2WP8 A;  1IBK I;  4FW9 A;  1UEK A;  5EL9 A;  3J81 C;  4FWD A;  2DEI A;  2AJ4 A;  4WUD A;  4LCG A;  5LMU I;  2UUA I;  1XNR I;  1QZR A;  4JI3 E;  4YHH I;  1BKN A;  4LFA I;  4MDT A;  2HHH I;  2UXB E;  3GCM A;  3V2U C;  1ELO A;  4MU4 A;  1N36 I;  1A6F A;  1YH8 A;  2PO1 A;  2Z5B B;  2HFS A;  3ZZ0 A;  5C0X A;  4NXM E;  3JAM Q;  4JI0 I;  4NXN I;  2V2Q A;  3WU5 A;  1I94 E;  2PNM A;  5K36 D;  4FW3 A;  5C0X C;  5FLX Q;  1KKH A;  2JEA B;  2O1T A;  4LFB E;  4KHP E;  1FWL A;  1OYR A;  5A2Q C;  3H1C A;  4FW5 A;  1MX0 A;  2R42 A;  1N33 I;  4JI6 E;  1ZM3 A;  2UXD I;  4IZK A;  4KHP I;  5JEA B;  3HKM A;  5LMU E;  2NN6 B;  3WU3 A;  2E5L E;  2CG9 A;  5DRP A;  1USV A;  4JI5 E;  4U3D A;  1ZXM A;  4OX9 I;  1FNM A;  2VES A;  1R6L A;  1NHI A;  1IBM I;  2PO2 A;  3T1H I;  3ZZT A;  4HYM A;  4IFD F;  4X62 I;  4BA2 A;  1H74 A;  4WUB A;  4DV0 E;  4PRV A;  2F4V E;  2ZM6 E;  3P06 A;  1XMQ I;  4B3S E;  2AE8 A;  3JAM C;  2F1D A;  1FJG E;  5K36 B;  1U2R A;  2PNL A;  5BR8 E;  4X65 E;  2UU9 I;  1MG7 A;  2C39 A;  4DPX A;  2VQF E;  4BA2 B;  1OYS A;  4JI2 E;  5JEA A;  4WUC A;  4HAC A;  4DV3 I;  4GQU A;  4B3T E;  1XNQ I;  2Z5E A;  4MYU A;  4NBQ A;  2UUC I;  4DV6 I;  3B82 A;  2VQE I;  4X62 E;  1KIJ A;  2V2V A;  4LF8 I;  1HNW E;  3P3C A;  2BA1 D;  4NXN E;  4I3H A;  4JI8 I;  4IZK B;  3CWV A;  1S4E A;  1N34 E;  4JI5 I;  1VIS A;  4JV5 I;  4XTJ A;  2OI2 A;  3PS2 A;  1KVK A;  4IZJ A;  4JI3 I;  3LNU A;  4IFD C;  3QT7 A;  3J80 C;  1Z0C A;  4DR6 I;  5BR8 I;  1H73 A;  2E1R A;  4JI4 E;  2WP8 B;  1I94 I;  3KRN A;  1XMQ E;  3T1Y I;  4OKG A;  4DUZ I;  1N32 I;  1XNQ E;  1OYP A;  4JI0 E;  2C38 A;  1XXE A;  2BM1 A;  2NPF A;  4DR2 I;  4B3R E;  2ZBK B;  2BV3 A;  2V2Z A;  2Q2E B;  3GME A;  1MU5 A;  5LL6 R;  1E3P A;  4MYT A;  3J7A M;  2Z5B A;  3PS3 A;  4LF5 I;  4IFD D;  4J3D A;  1HR0 E;  4AID A;  4FWG A;  1Y6Z A;  3M7N D;  3CDI A;  5IWA E;  1NZ0 A;  4FW6 A;  1IBK E;  1Z0G A;  4Z7C A;  4ED4 A;  4LCF A;  4DR3 E;  2PNZ B;  2UUB I;  1Z5A A;  4IZJ B;  4LCH A;  2V34 A;  4FW4 A;  4JI8 E;  3P3G A;  4MU3 A;  2BM0 A;  5DNX A;  4LF4 E;  4HAC B;  4JI1 E;  3T1Y E;  1Y4U A;  3LTO A;  4DV2 I;  4U3B A;  4X64 E;  1ZM2 A;  3QT8 A; 
#chains in the Genus database with same CATH homology
 3H4L A;  4DR5 I;  1EA6 A;  4LFA E;  4RPF A;  3ZZU A;  4X66 E;  3ZKD A;  2UUA E;  4R1F A;  3OTO I;  1N0V C;  2Z5C A;  4JI7 I;  4DV7 I;  2HK2 A;  3F0N A;  3K85 A;  3WU4 A;  2ZIT A;  3GON A;  4DV1 I;  3LPS A;  1FKA E;  2DEJ A;  3V5R A;  4JYA I;  1B63 A;  4OX9 E;  4LF9 E;  2HKE A;  4DV5 E;  4JI4 I;  1HNX I;  1Z0B A;  3WU6 A;  2A2D A;  2IOQ A;  4X65 I;  4JI6 I;  1S16 A;  1PIE A;  4GKK E;  1WUU A;  2X36 A;  2HKJ A;  2ZM6 I;  4KQV A;  4DR4 I;  1USU A;  1H72 C;  1HNZ E;  4DR2 E;  3Q6M A;  4DU8 A;  4JI7 E;  1Z0T A;  3OTO E;  4K0K I;  1RRE A;  3PRY A;  4P52 A;  4ZVI A;  4GKK I;  3ZM7 A;  4DUY I;  3HJC A;  4X66 I;  2A2C A;  5FWK A;  1K47 A;  4DR5 E;  1FWK A;  2UU9 E;  4DUY E;  4DV4 I;  1H7S A;  4JYA E;  1FJG I;  3QT5 A;  4LF6 I;  1B62 A;  4JI1 I;  1Z5B A;  1NHH A;  2O1V A;  4IZJ D;  4FWH A;  4DR4 E;  2VQE E;  4DV6 E;  4DXL A;  3PYD A;  4DR3 I;  1ZM9 A;  4DR1 I;  3Q6N A;  4DV3 E;  5LMN E;  2J7K A;  5L3J A;  1OJ4 A;  1N33 E;  2X7I A;  4UT4 A;  4GKJ I;  1FI4 A;  4AQY E;  4DV1 E;  2UXC I;  5GMD A;  1Z0W A;  3QT6 A;  3T1H E;  4DV7 E;  1HK7 A;  2EFG A;  1Z0V A;  5IT9 C;  4LF6 E;  2GS8 A;  4FN5 A;  2VF3 A;  1XMO E;  5A2Q Q;  5IT9 Q;  4PRX A;  3B78 A;  2HK3 A;  4UTG A;  1HR0 I;  3K1J A;  3D4J A;  2LJP A;  5LMN I;  1ZXN A;  2CGE A;  4YHH E;  1XNR E;  4URL A;  4JV5 E;  4USK A;  4DV2 E;  4LF4 I;  4B3R I;  3J80 Q;  1H7U A;  3PYG A;  4EMD A;  4LF7 E;  4LF7 I;  2R3V A;  1HNZ I;  1HNW I;  1EI1 A;  2GQ0 A;  2UUC E;  2UXC E;  4DV4 E;  4JI2 I;  1Y4S A;  4DPW A;  3J7A G;  2VQF I;  1HNX E;  4DR7 E;  4DR7 I;  1XMO I;  4X64 I;  4HY1 A;  1J5E E;  4LF5 E;  4DU7 A;  4USM A;  4B3S I;  3PYE A;  1KTV A;  4K0K E;  2V8P A;  5GME A;  4JG4 A;  2HFU A;  4DV0 I;  2F4V I;  4DPT A;  1N34 I;  2O1W A;  3ZKB A;  4M1K A;  1IBM E;  4DUZ E;  1N32 E;  2WW4 A;  4DPY A;  4YY3 E;  2O1U A;  4AQY I;  4PU9 A;  4GKJ E;  1IBL I;  2Z5C B;  4DR6 E;  4LFC I;  3K17 A;  1J5E I;  2UXD E;  4P7A A;  4LF9 I;  1NHJ A;  4LFB I;  2CZ9 A;  1PVG A;  1D6T A;  1N0U A;  3J81 Q;  4DPU A;  4N3O A;  3PYF A;  4LF8 E;  4NXM I;  4B3M E;  4Z7Y A;  4B3T I;  2E5L I;  1N36 E;  1PKP A;  3B8H A;  1RR9 A;  5IWA I;  1XHK A;  2HHH E;  2UXB I;  5FLX C;  2XEX A;  1Z59 A;  1Z0E A;  4HXZ A;  4LFC E;  3HUL A;  1IBL E;  3Q1Q A;  4DV5 I;  4DR1 E;  1DAR A;  2IOP A;  4YY3 I;  4B3M I;  1ZM4 A;  2UUB E;  3M6A A;  1Z5C A;  1IBK I;  4FW9 A;  1UEK A;  3J81 C;  4FWD A;  2DEI A;  2AJ4 A;  4WUD A;  5LMU I;  2UUA I;  1XNR I;  1QZR A;  4JI3 E;  4YHH I;  1BKN A;  4LFA I;  2HHH I;  2UXB E;  3V2U C;  1ELO A;  1N36 I;  1A6F A;  2Z5B B;  2HFS A;  3ZZ0 A;  4NXM E;  3JAM Q;  4JI0 I;  4NXN I;  2V2Q A;  3WU5 A;  1I94 E;  2PNM A;  5FLX Q;  1KKH A;  2O1T A;  4LFB E;  4KHP E;  1FWL A;  5A2Q C;  1MX0 A;  2R42 A;  1N33 I;  4JI6 E;  1ZM3 A;  2UXD I;  4IZK A;  4KHP I;  5LMU E;  3WU3 A;  2E5L E;  2CG9 A;  1USV A;  4JI5 E;  1ZXM A;  4OX9 I;  1FNM A;  1NHI A;  1IBM I;  3T1H I;  3ZZT A;  4HYM A;  4X62 I;  1H74 A;  4WUB A;  4DV0 E;  4PRV A;  2F4V E;  2ZM6 E;  3P06 A;  1XMQ I;  4B3S E;  3JAM C;  1FJG E;  1U2R A;  2PNL A;  5BR8 E;  4X65 E;  2UU9 I;  1MG7 A;  4DPX A;  2VQF E;  4JI2 E;  4WUC A;  4HAC A;  4DV3 I;  4B3T E;  1XNQ I;  2Z5E A;  4MYU A;  2UUC I;  4DV6 I;  3B82 A;  2VQE I;  4X62 E;  1KIJ A;  2V2V A;  4LF8 I;  1HNW E;  4NXN E;  4I3H A;  4JI8 I;  4IZK B;  3CWV A;  1S4E A;  1N34 E;  4JI5 I;  1VIS A;  4JV5 I;  4XTJ A;  2OI2 A;  1KVK A;  4IZJ A;  4JI3 I;  3LNU A;  3QT7 A;  3J80 C;  1Z0C A;  4DR6 I;  5BR8 I;  1H73 A;  2E1R A;  4JI4 E;  1I94 I;  1XMQ E;  3T1Y I;  4DUZ I;  1N32 I;  1XNQ E;  4JI0 E;  2BM1 A;  2NPF A;  4DR2 I;  4B3R E;  2ZBK B;  2BV3 A;  2V2Z A;  2Q2E B;  1MU5 A;  5LL6 R;  4MYT A;  3J7A M;  2Z5B A;  4LF5 I;  1HR0 E;  4FWG A;  1Y6Z A;  5IWA E;  1NZ0 A;  1IBK E;  1Z0G A;  4Z7C A;  4ED4 A;  4DR3 E;  2UUB I;  1Z5A A;  4IZJ B;  2V34 A;  4JI8 E;  2BM0 A;  4LF4 E;  4HAC B;  4JI1 E;  3T1Y E;  1Y4U A;  3LTO A;  4DV2 I;  4X64 E;  1ZM2 A;  3QT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...