4IFDF

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
213
Chain Sequence
QDRRRLLGPAAAKPMAFSNSEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 60
structure length 213
sequence length 245
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdF00
2JE6A 2JEAB 5JEAE 5C0XB 5K36A 2WP8A 5JEAA 1E3PA 1UDNA 4BA1A 1E3HA 1OYSA 1OYPA 1R6MA 2NN6F 2JE6B 5K36B 2PO2A 2WP8B 3DD6A 2C39B 3CDJA 5JEAB 5C0XE 2BA0D 5C0XC 4BA1B 2NN6E 3B4TA 2PO2B 4OO1A 4BA2B 5C0XD 2PNZA 5K36E 3M7ND 5K36C 2NN6D 3HKMA 1R6LA 4AIMA 5JEAC 2NN6B 4OO1B 1OYRA 5K36D 5JEAD 4OO1F 3H1CA 4IFDF 3KRNA 4AM3A 2BR2A 3GMEA 2WNRA 4OO1E 2NN6C 2PO1A 3M85G 2JEBA 3CDIA 4IFDA 2PO0A 2BR2B 4OO1D 2WNRB 2PO1B 3GLLA 2BA1G 2JEBB 2PNZB 4IFDB 2PO0B 2JEAA 2C37A 1UDOA 3L7ZA 3GCMA 2C38A 2C37B 4OO1C 4IFDE 2C39A 4IFDC 1UDQA 3L7ZB 1UDSA 4NBQA 5C0XF 2BA0G 3M85D 4IFDD 2C38B 4BA2A 5K36F 3M7NG 4AIDA 5C0XA 2BA1D 5JEAF 3U1KA 2NN6A
chains in the Genus database with same CATH superfamily
4X64I 1S16A 4DPTA 5JEAE 2WP8A 5LMNE 4DV7E 1XHKA 1EI1A 2V2ZA 4HACB 4X65I 1IBMI 2ZM6E 1OJ4A 1Z0CA 3OTOE 4U3DA 1HR0E 4LF5I 2CVEA 1OYPA 3NZKA 1H74A 2VQEI 2AJ4A 2WP8B 4LFCI 2UXCE 4NXMI 1USUA 2BA0D 2BM0A 4LFBE 2UU9E 4X66E 4DU8A 3PYEA 1H73A 2ZITA 4NXNE 4YY3E 4B3TI 2UXBI 4JI5I 4LF7I 4LF9I 4JYAI 1XXEA 1XMQI 5K36C 5LMUE 3HKMA 3P3CA 4DV5I 1Y4UA 2V2VA 1ZXNA 4DPXA 1Z0VA 4JI7I 5L3JA 2AE8A 1FWLA 4JV5E 4DPUA 2ZBKB 3B78A 2HHHI 2WNRA 1RHYA 1FI4A 3PRYA 4DR1E 1XNRI 2PO1A 4MQYA 2BV3A 3CDIA 4B3SI 2Z5EA 2VF3A 3M6AA 4GKJE 4U3BA 2E5LE 2WNRB 5DROA 4DV2I 4DR5E 5DNLA 2UUBE 3JAMC 3QT6A 2PO1B 2BA1G 2Z5BB 2F4VI 1USVA 4Z7YA 4WUDA 2HKEA 4GKKI 2UUAE 2JEAA 1D6TA 4DR3I 4MU3A 4MU1A 3ZM7A 2IERA 1NHJA 4DPYA 4WUCA 2R3VA 3QT7A 4OZEA 4OO1C 4JI0E 4DR6E 4JI1I 1Z5CA 4DV1I 4IFDC 1RR9A 4JI4E 1UDSA 4LCGA 5C0XF 2BM1A 2BA0G 2A2CA 2PNLA 3Q1QA 1XMOI 4P7AA 1PKPA 1Z59A 5A2QC 1WUUA 4DR2I 2IESA 3Q6MA 2HFUA 2GO3A 2VQFI 1H7SA 4B3RE 1Y60A 4XTJA 5C0XA 4M1KA 1N34E 1Z5AA 5JEAF 4DV0E 4LFAI 3U1KA 1N36I 1N0VC 4FN5A 4OX9E 3P76A 4JI3E 2V8PA 4FWGA 4DU7A 3D4JA 2O1VA 5C0XB 2CZ9A 4DR4I 3PYDA 1KIJA 2Z5CA 5JEAA 4R1FA 1FJGI 1EA6A 4AQYI 1OYSA 4Z7CA 1N33E 1I94I 2HK2A 1H72C 4DR7I 2PO2A 2C39B 4FWHA 5DRPA 2Z5CB 2JT2A 5JEAB 5C0XE 4P52A 1Z0GA 4KHPE 3UHMA 5DRQA 3J80C 4FW6A 4X66I 2PO2B 4OO1A 4LF8E 5C0XD 4GQUA 2UXDI 1HK7A 4DUZI 2E1RA 3K1JA 4ISAA 4YHHE 5ELWA 1K47A 4OO1B 4X62I 1XNQI 1B62A 4UT4A 2NPFA 5JEAD 4JI6I 1IBLI 5EL9A 4DXLA 2IOQA 4IZKA 1IBKI 2O1TA 3LNUA 4AM3A 5EKWA 4OO1E 4DUYE 2NN6C 4MYTA 1Z0BA 5IWAE 3ZKDA 1ZM4A 4IZKB 4B3MI 1PVGA 2PO0A 1HNWE 2Q2EB 4FW5A 4OO1D 3T1YI 1ZM3A 4KQVA 3PS1A 4DV6E 4N3OA 4PRXA 2IOPA 1N32I 5GMEA 2PO0B 1J5EI 3F0NA 5DNXA 1ZM2A 1UDOA 4DV3E 4PU9A 4JI2I 4X64E 1P42A 3LPSA 4DV4I 2V34A 3P3GA 4X65E 1IBME 4MU0A 2HFSA 3QT8A 4LF5E 1UDQA 4NBQA 1S4EA 1HNZI 3M85D 1KVKA 2VQEE 4LFCE 3J81C 4NXME 4BA2A 5K36F 4FW7A 2J65A 4AIDA 1NZ0A 3V5RA 4B3TE 2UXBE 2NN6A 4JI5E 4LF7E 4LF9E 4JYAE 1XMQE 3JAMQ 4IS9A 2JEAB 4DV5E 5K36A 2A2DA 2O3ZA 3T1HE 5BR8I 1E3PA 3ZZUA 5FLXC 4JI7E 2UUCI 4BA1A 1E3HA 4JI8I 1HNXI 5K36B 1MU5A 3DD6A 1N33I 4K0KI 1MG7A 3K85A 5LL6R 2HHHE 3J7AG 1KTVA 4LF6I 4JG4A 4BA1B 2NN6E 1XNRE 4B3SE 4LF4I 3PYGA 2PNZA 3ZZTA 5K36E 3M7ND 4LCHA 5A2QQ 4DV2E 2NN6D 1VI7A 4AIMA 2F4VE 2O1WA 5LMNI 2R42A 4DV7I 2DEJA 1OYRA 2J7KA 4GKKE 5K36D 2ZM6I 3WU4A 3OTOI 1HR0I 4DR3E 3U1YA 4OO1F 3QT5A 2GO4A 1B63A 4HXZA 4IFDF 1H7UA 2UXCI 1ZXMA 2VESA 3B8HA 2BR2A 3GMEA 1QZRA 4LFBI 4IZJA 2UU9I 2HKJA 4JI1E 2JEBA 3M85G 2CGEA 4DV1E 2XEXA 2OI2A 2HK3A 4QNKA 4NXNI 3PYFA 3HULA 4IFDA 4YY3I 1NHHA 2BR2B 1XMOE 1N0UA 4IZJB 1VISA 3V2UC 5LMUI 4DR2E 3GLLA 2JEBB 2CG9A 4LPFA 2VQFE 3PS2A 4OKGA 3J80Q 4IFDB 2PNMA 2C37A 4QNJA 4LFAE 4WUBA 1N36E 4JV5I 5GMDA 3L7ZA 4LCFA 4DPWA 3GCMA 2C38A 2C37B 4DR4E 4IFDE 4DR1I 1RREA 2X7IA 1FJGE 4IZJD 4ED4A 3L7ZB 4AQYE 4PRVA 4GKJI 1I94E 2E5LI 4DR7E 4IFDD 2C38B 1Y6ZA 4DR5I 2UUBI 4URLA 4EMDA 1Z0EA 2O1UA 4RPFA 3WU3A 3M7NG 2UUAI 2WW4A 2GQ0A 3Q6NA 2UXDE 1Y4SA 4DUZE 1FNMA 2JE6A 3K17A 1YHCA 4HYMA 4JI0I 4DR6I 2V2QA 4X62E 1UDNA 1XNQE 3T1HI 4JI4I 1UEKA 1R6MA 1IBLE 2NN6F 2JE6B 4MDTA 4JI6E 1NHIA 3WU5A 1IBKE 1U2RA 4LOMA 1ZM9A 3CDJA 3WU6A 2EFGA 1FKAE 1ELOA 5C0XC 2DEIA 3B4TA 4B3RI 1N34I 2Z5BA 4DV0I 4B3ME 4BA2B 3LTOA 4OX9I 1A6FA 3P06A 3J81Q 3HJCA 4JI3I 3T1YE 1DARA 1R6LA 1YH8A 5JEAC 1N32E 2NN6B 3P3EA 1J5EE 3H4LA 1MX0A 3H1CA 1KKHA 4JI2E 5FWKA 3KRNA 4DV4E 4KHPI 5FLXQ 3ZZ0A 3PS3A 1PIEA 1Z5BA 1HNZE 4LF8I 3B82A 2F1DA 1Y5YA 4USMA 4J3DA 4YHHI 2PNZB 3CWVA 4FW3A 1FWKA 2GS8A 2X36A 5IT9C 4FWDA 4USKA 1Z0TA 2LJPA 4FW4A 4DUYI 5BR8E 2C39A 2UUCE 4MYUA 3GONA 5IWAI 4HY1A 5DRRA 1HNWI 4MU4A 4I3HA 4JI8E 1HNXE 4K0KE 1Z0WA 4DV6I 1BKNA 5IT9Q 3J7AM 4LF6E 3ZKBA 4FW9A 4LF4E 2BA1D 4HACA 4DV3I 4UTGA 4ZVIA
chains in the Genus database with same CATH topology
2JE6A 2JEAB 5JEAE 5C0XB 5K36A 2WP8A 5JEAA 1E3PA 1UDNA 4BA1A 1E3HA 1OYSA 1OYPA 1R6MA 2NN6F 2JE6B 5K36B 2PO2A 2WP8B 3DD6A 2C39B 3CDJA 5JEAB 5C0XE 2BA0D 5C0XC 4BA1B 2NN6E 3B4TA 2PO2B 4OO1A 4BA2B 5C0XD 2PNZA 5K36E 3M7ND 5K36C 2NN6D 3HKMA 1R6LA 4AIMA 5JEAC 2NN6B 4OO1B 1OYRA 5K36D 5JEAD 4OO1F 3H1CA 4IFDF 3KRNA 4AM3A 2BR2A 3GMEA 2WNRA 4OO1E 2NN6C 2PO1A 3M85G 2JEBA 3CDIA 4IFDA 2PO0A 2BR2B 4OO1D 2WNRB 2PO1B 3GLLA 2BA1G 2JEBB 2PNZB 4IFDB 2PO0B 2JEAA 2C37A 1UDOA 3L7ZA 3GCMA 2C38A 2C37B 4OO1C 4IFDE 2C39A 4IFDC 1UDQA 3L7ZB 1UDSA 4NBQA 5C0XF 2BA0G 3M85D 4IFDD 2C38B 4BA2A 5K36F 3M7NG 4AIDA 5C0XA 2BA1D 5JEAF 3U1KA 2NN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 A;  2JEA B;  5JEA E;  5C0X B;  5K36 A;  2WP8 A;  5JEA A;  1E3P A;  1UDN A;  4BA1 A;  1E3H A;  1OYS A;  1OYP A;  1R6M A;  2NN6 F;  2JE6 B;  5K36 B;  2PO2 A;  2WP8 B;  3DD6 A;  2C39 B;  3CDJ A;  5JEA B;  5C0X E;  2BA0 D;  5C0X C;  4BA1 B;  2NN6 E;  3B4T A;  2PO2 B;  4OO1 A;  4BA2 B;  5C0X D;  2PNZ A;  5K36 E;  3M7N D;  5K36 C;  2NN6 D;  3HKM A;  1R6L A;  4AIM A;  5JEA C;  2NN6 B;  4OO1 B;  1OYR A;  5K36 D;  5JEA D;  4OO1 F;  3H1C A;  4IFD F;  3KRN A;  4AM3 A;  2BR2 A;  3GME A;  2WNR A;  4OO1 E;  2NN6 C;  2PO1 A;  3M85 G;  2JEB A;  3CDI A;  4IFD A;  2PO0 A;  2BR2 B;  4OO1 D;  2WNR B;  2PO1 B;  3GLL A;  2BA1 G;  2JEB B;  2PNZ B;  4IFD B;  2PO0 B;  2JEA A;  2C37 A;  1UDO A;  3L7Z A;  3GCM A;  2C38 A;  2C37 B;  4OO1 C;  4IFD E;  2C39 A;  4IFD C;  1UDQ A;  3L7Z B;  1UDS A;  4NBQ A;  5C0X F;  2BA0 G;  3M85 D;  4IFD D;  2C38 B;  4BA2 A;  5K36 F;  3M7N G;  4AID A;  5C0X A;  2BA1 D;  5JEA F;  3U1K A;  2NN6 A; 
#chains in the Genus database with same CATH topology
 4X64 I;  1S16 A;  4DPT A;  5JEA E;  2WP8 A;  5LMN E;  4DV7 E;  1XHK A;  1EI1 A;  2V2Z A;  4HAC B;  4X65 I;  1IBM I;  2ZM6 E;  1OJ4 A;  1Z0C A;  3OTO E;  4U3D A;  1HR0 E;  4LF5 I;  2CVE A;  1OYP A;  3NZK A;  1H74 A;  2VQE I;  2AJ4 A;  2WP8 B;  4LFC I;  2UXC E;  4NXM I;  1USU A;  2BA0 D;  2BM0 A;  4LFB E;  2UU9 E;  4X66 E;  4DU8 A;  3PYE A;  1H73 A;  2ZIT A;  4NXN E;  4YY3 E;  4B3T I;  2UXB I;  4JI5 I;  4LF7 I;  4LF9 I;  4JYA I;  1XXE A;  1XMQ I;  5K36 C;  5LMU E;  3HKM A;  3P3C A;  4DV5 I;  1Y4U A;  2V2V A;  1ZXN A;  4DPX A;  1Z0V A;  4JI7 I;  5L3J A;  2AE8 A;  1FWL A;  4JV5 E;  4DPU A;  2ZBK B;  3B78 A;  2HHH I;  2WNR A;  1RHY A;  1FI4 A;  3PRY A;  4DR1 E;  1XNR I;  2PO1 A;  4MQY A;  2BV3 A;  3CDI A;  4B3S I;  2Z5E A;  2VF3 A;  3M6A A;  4GKJ E;  4U3B A;  2E5L E;  2WNR B;  5DRO A;  4DV2 I;  4DR5 E;  5DNL A;  2UUB E;  3JAM C;  3QT6 A;  2PO1 B;  2BA1 G;  2Z5B B;  2F4V I;  1USV A;  4Z7Y A;  4WUD A;  2HKE A;  4GKK I;  2UUA E;  2JEA A;  1D6T A;  4DR3 I;  4MU3 A;  4MU1 A;  3ZM7 A;  2IER A;  1NHJ A;  4DPY A;  4WUC A;  2R3V A;  3QT7 A;  4OZE A;  4OO1 C;  4JI0 E;  4DR6 E;  4JI1 I;  1Z5C A;  4DV1 I;  4IFD C;  1RR9 A;  4JI4 E;  1UDS A;  4LCG A;  5C0X F;  2BM1 A;  2BA0 G;  2A2C A;  2PNL A;  3Q1Q A;  1XMO I;  4P7A A;  1PKP A;  1Z59 A;  5A2Q C;  1WUU A;  4DR2 I;  2IES A;  3Q6M A;  2HFU A;  2GO3 A;  2VQF I;  1H7S A;  4B3R E;  1Y60 A;  4XTJ A;  5C0X A;  4M1K A;  1N34 E;  1Z5A A;  5JEA F;  4DV0 E;  4LFA I;  3U1K A;  1N36 I;  1N0V C;  4FN5 A;  4OX9 E;  3P76 A;  4JI3 E;  2V8P A;  4FWG A;  4DU7 A;  3D4J A;  2O1V A;  5C0X B;  2CZ9 A;  4DR4 I;  3PYD A;  1KIJ A;  2Z5C A;  5JEA A;  4R1F A;  1FJG I;  1EA6 A;  4AQY I;  1OYS A;  4Z7C A;  1N33 E;  1I94 I;  2HK2 A;  1H72 C;  4DR7 I;  2PO2 A;  2C39 B;  4FWH A;  5DRP A;  2Z5C B;  2JT2 A;  5JEA B;  5C0X E;  4P52 A;  1Z0G A;  4KHP E;  3UHM A;  5DRQ A;  3J80 C;  4FW6 A;  4X66 I;  2PO2 B;  4OO1 A;  4LF8 E;  5C0X D;  4GQU A;  2UXD I;  1HK7 A;  4DUZ I;  2E1R A;  3K1J A;  4ISA A;  4YHH E;  5ELW A;  1K47 A;  4OO1 B;  4X62 I;  1XNQ I;  1B62 A;  4UT4 A;  2NPF A;  5JEA D;  4JI6 I;  1IBL I;  5EL9 A;  4DXL A;  2IOQ A;  4IZK A;  1IBK I;  2O1T A;  3LNU A;  4AM3 A;  5EKW A;  4OO1 E;  4DUY E;  2NN6 C;  4MYT A;  1Z0B A;  5IWA E;  3ZKD A;  1ZM4 A;  4IZK B;  4B3M I;  1PVG A;  2PO0 A;  1HNW E;  2Q2E B;  4FW5 A;  4OO1 D;  3T1Y I;  1ZM3 A;  4KQV A;  3PS1 A;  4DV6 E;  4N3O A;  4PRX A;  2IOP A;  1N32 I;  5GME A;  2PO0 B;  1J5E I;  3F0N A;  5DNX A;  1ZM2 A;  1UDO A;  4DV3 E;  4PU9 A;  4JI2 I;  4X64 E;  1P42 A;  3LPS A;  4DV4 I;  2V34 A;  3P3G A;  4X65 E;  1IBM E;  4MU0 A;  2HFS A;  3QT8 A;  4LF5 E;  1UDQ A;  4NBQ A;  1S4E A;  1HNZ I;  3M85 D;  1KVK A;  2VQE E;  4LFC E;  3J81 C;  4NXM E;  4BA2 A;  5K36 F;  4FW7 A;  2J65 A;  4AID A;  1NZ0 A;  3V5R A;  4B3T E;  2UXB E;  2NN6 A;  4JI5 E;  4LF7 E;  4LF9 E;  4JYA E;  1XMQ E;  3JAM Q;  4IS9 A;  2JEA B;  4DV5 E;  5K36 A;  2A2D A;  2O3Z A;  3T1H E;  5BR8 I;  1E3P A;  3ZZU A;  5FLX C;  4JI7 E;  2UUC I;  4BA1 A;  1E3H A;  4JI8 I;  1HNX I;  5K36 B;  1MU5 A;  3DD6 A;  1N33 I;  4K0K I;  1MG7 A;  3K85 A;  5LL6 R;  2HHH E;  3J7A G;  1KTV A;  4LF6 I;  4JG4 A;  4BA1 B;  2NN6 E;  1XNR E;  4B3S E;  4LF4 I;  3PYG A;  2PNZ A;  3ZZT A;  5K36 E;  3M7N D;  4LCH A;  5A2Q Q;  4DV2 E;  2NN6 D;  1VI7 A;  4AIM A;  2F4V E;  2O1W A;  5LMN I;  2R42 A;  4DV7 I;  2DEJ A;  1OYR A;  2J7K A;  4GKK E;  5K36 D;  2ZM6 I;  3WU4 A;  3OTO I;  1HR0 I;  4DR3 E;  3U1Y A;  4OO1 F;  3QT5 A;  2GO4 A;  1B63 A;  4HXZ A;  4IFD F;  1H7U A;  2UXC I;  1ZXM A;  2VES A;  3B8H A;  2BR2 A;  3GME A;  1QZR A;  4LFB I;  4IZJ A;  2UU9 I;  2HKJ A;  4JI1 E;  2JEB A;  3M85 G;  2CGE A;  4DV1 E;  2XEX A;  2OI2 A;  2HK3 A;  4QNK A;  4NXN I;  3PYF A;  3HUL A;  4IFD A;  4YY3 I;  1NHH A;  2BR2 B;  1XMO E;  1N0U A;  4IZJ B;  1VIS A;  3V2U C;  5LMU I;  4DR2 E;  3GLL A;  2JEB B;  2CG9 A;  4LPF A;  2VQF E;  3PS2 A;  4OKG A;  3J80 Q;  4IFD B;  2PNM A;  2C37 A;  4QNJ A;  4LFA E;  4WUB A;  1N36 E;  4JV5 I;  5GMD A;  3L7Z A;  4LCF A;  4DPW A;  3GCM A;  2C38 A;  2C37 B;  4DR4 E;  4IFD E;  4DR1 I;  1RRE A;  2X7I A;  1FJG E;  4IZJ D;  4ED4 A;  3L7Z B;  4AQY E;  4PRV A;  4GKJ I;  1I94 E;  2E5L I;  4DR7 E;  4IFD D;  2C38 B;  1Y6Z A;  4DR5 I;  2UUB I;  4URL A;  4EMD A;  1Z0E A;  2O1U A;  4RPF A;  3WU3 A;  3M7N G;  2UUA I;  2WW4 A;  2GQ0 A;  3Q6N A;  2UXD E;  1Y4S A;  4DUZ E;  1FNM A;  2JE6 A;  3K17 A;  1YHC A;  4HYM A;  4JI0 I;  4DR6 I;  2V2Q A;  4X62 E;  1UDN A;  1XNQ E;  3T1H I;  4JI4 I;  1UEK A;  1R6M A;  1IBL E;  2NN6 F;  2JE6 B;  4MDT A;  4JI6 E;  1NHI A;  3WU5 A;  1IBK E;  1U2R A;  4LOM A;  1ZM9 A;  3CDJ A;  3WU6 A;  2EFG A;  1FKA E;  1ELO A;  5C0X C;  2DEI A;  3B4T A;  4B3R I;  1N34 I;  2Z5B A;  4DV0 I;  4B3M E;  4BA2 B;  3LTO A;  4OX9 I;  1A6F A;  3P06 A;  3J81 Q;  3HJC A;  4JI3 I;  3T1Y E;  1DAR A;  1R6L A;  1YH8 A;  5JEA C;  1N32 E;  2NN6 B;  3P3E A;  1J5E E;  3H4L A;  1MX0 A;  3H1C A;  1KKH A;  4JI2 E;  5FWK A;  3KRN A;  4DV4 E;  4KHP I;  5FLX Q;  3ZZ0 A;  3PS3 A;  1PIE A;  1Z5B A;  1HNZ E;  4LF8 I;  3B82 A;  2F1D A;  1Y5Y A;  4USM A;  4J3D A;  4YHH I;  2PNZ B;  3CWV A;  4FW3 A;  1FWK A;  2GS8 A;  2X36 A;  5IT9 C;  4FWD A;  4USK A;  1Z0T A;  2LJP A;  4FW4 A;  4DUY I;  5BR8 E;  2C39 A;  2UUC E;  4MYU A;  3GON A;  5IWA I;  4HY1 A;  5DRR A;  1HNW I;  4MU4 A;  4I3H A;  4JI8 E;  1HNX E;  4K0K E;  1Z0W A;  4DV6 I;  1BKN A;  5IT9 Q;  3J7A M;  4LF6 E;  3ZKB A;  4FW9 A;  4LF4 E;  2BA1 D;  4HAC A;  4DV3 I;  4UTG A;  4ZVI A; 
#chains in the Genus database with same CATH homology
 2JE6 A;  2JEA B;  5JEA E;  5C0X B;  5K36 A;  2WP8 A;  5JEA A;  1E3P A;  1UDN A;  4BA1 A;  1E3H A;  1OYS A;  1OYP A;  1R6M A;  2NN6 F;  2JE6 B;  5K36 B;  2PO2 A;  2WP8 B;  3DD6 A;  2C39 B;  3CDJ A;  5JEA B;  5C0X E;  2BA0 D;  5C0X C;  4BA1 B;  2NN6 E;  3B4T A;  2PO2 B;  4OO1 A;  4BA2 B;  5C0X D;  2PNZ A;  5K36 E;  3M7N D;  5K36 C;  2NN6 D;  3HKM A;  1R6L A;  4AIM A;  5JEA C;  2NN6 B;  4OO1 B;  1OYR A;  5K36 D;  5JEA D;  4OO1 F;  3H1C A;  4IFD F;  3KRN A;  4AM3 A;  2BR2 A;  3GME A;  2WNR A;  4OO1 E;  2NN6 C;  2PO1 A;  3M85 G;  2JEB A;  3CDI A;  4IFD A;  2PO0 A;  2BR2 B;  4OO1 D;  2WNR B;  2PO1 B;  3GLL A;  2BA1 G;  2JEB B;  2PNZ B;  4IFD B;  2PO0 B;  2JEA A;  2C37 A;  1UDO A;  3L7Z A;  3GCM A;  2C38 A;  2C37 B;  4OO1 C;  4IFD E;  2C39 A;  4IFD C;  1UDQ A;  3L7Z B;  1UDS A;  4NBQ A;  5C0X F;  2BA0 G;  3M85 D;  4IFD D;  2C38 B;  4BA2 A;  5K36 F;  3M7N G;  4AID A;  5C0X A;  2BA1 D;  5JEA F;  3U1K A;  2NN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...