4IFDF

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
213
Chain Sequence
QDRRRLLGPAAAKPMAFSNSEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 60
structure length 213
sequence length 245
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdF00
1E3HA 5K36D 5K36F 3M85D 2WNRA 2NN6E 2WP8A 3CDJA 5C0XE 2JEAB 4IFDA 2JE6A 3M85G 4AIMA 2BA0D 3M7ND 4OO1B 5JEAD 4NBQA 1R6MA 5JEAF 2PO2A 2JEBA 2BA1G 3GMEA 4OO1C 5JEAC 4IFDF 3L7ZB 2C38B 2JE6B 2WP8B 5JEAA 3GCMA 2PO1A 2JEAA 5K36E 3KRNA 2BR2A 1UDOA 3HKMA 2WNRB 2NN6D 2PNZA 1E3PA 2PO0B 2C39B 5C0XF 5C0XD 2NN6B 3M7NG 3H1CA 4IFDB 2C38A 4OO1E 2JEBB 4BA1B 2PO2B 2PNZB 1OYRA 2BA1D 5K36C 3DD6A 1OYSA 1UDQA 5C0XC 2PO1B 4OO1D 5JEAB 2C37A 2C37B 2NN6A 4AIDA 4IFDC 3CDIA 4OO1F 5JEAE 2NN6F 5C0XA 1R6LA 5C0XB 1OYPA 5K36A 2C39A 4BA2B 4IFDE 4IFDD 2BA0G 3L7ZA 4AM3A 3B4TA 2NN6C 2BR2B 4BA1A 2PO0A 3U1KA 4BA2A 5K36B 3GLLA 1UDSA 1UDNA 4OO1A
chains in the Genus database with same CATH superfamily
4DV7I 1HR0E 3D4JA 5K36D 5K36F 2V34A 5IWAE 2WNRA 2IESA 4XTJA 3CDJA 5LMNI 3K1JA 3QT6A 1NHIA 4HXZA 3QT8A 4WUDA 4LCGA 4DR2E 2HKJA 2UU9E 2AJ4A 2UUAE 4LCFA 3T1YE 4LF6I 4LFBI 2BA0D 4AQYI 4OO1B 4JI1E 4LF4E 4DV5I 5GMDA 4DUZI 4LF5E 1HNXE 5LL6R 4N3OA 2PO2A 2GS8A 2VQEE 2BA1G 4DPWA 3GMEA 2UXBI 4QNKA 4DR4E 2Z5CB 4IZJD 4IFDF 1S4EA 3L7ZB 1K47A 1MX0A 3J80C 1IBKI 4R1FA 3WU3A 3Q1QA 3U1YA 1HNZI 1HNWI 5LMUE 2V2QA 2R42A 2BM1A 3ZZTA 2JEAA 4X65I 2LJPA 1Z0WA 4DR1E 4DUYI 1HR0I 1IBLE 1Z0CA 4FWDA 2UXDE 5IT9C 4DPTA 1KVKA 2C39B 4HACB 5C0XD 4B3SE 4DR1I 2NN6B 2E1RA 5DNLA 4J3DA 2UUBE 4FW3A 5EL9A 2VQFI 4JI2E 3WU5A 4IZJA 4DR2I 1Z0BA 2UU9I 2UXCI 2PO2B 4JI8I 5JEAB 4DU8A 4Z7YA 4B3ME 3CDIA 4JI4I 4OO1F 5JEAE 1XNQI 5DROA 1HNXI 1FWKA 5C0XB 1KIJA 3PS3A 4LFBE 3L7ZA 2NN6C 4AQYE 4JI7I 1EA6A 4WUBA 2J65A 1Z5AA 2CVEA 1UDNA 3PYFA 4DR5I 1VI7A 4JI5I 4JI3I 4P7AA 2CG9A 2O1WA 4NXMI 3J80Q 3P3GA 2NPFA 4ED4A 5ELWA 4DR6E 4OKGA 1B62A 2X7IA 1XNRI 1N0VC 2IOPA 3ZZ0A 5C0XE 5FWKA 2HFUA 2VQFE 1XMOE 2HFSA 4IZJB 5A2QC 3P76A 2HHHE 1XXEA 2DEIA 2JE6A 1FKAE 1FNMA 3F0NA 4AIMA 1U2RA 1ZXMA 4OX9I 4DV1I 4JV5E 4B3SI 1QZRA 3M7ND 4DV3I 4DV6E 1IBLI 4OZEA 4ZVIA 4LF9I 4JYAI 4DR7E 4ISAA 2Z5BA 5FLXQ 5JEAC 3Q6MA 1N0UA 1PVGA 1RHYA 4URLA 2C38B 1VISA 1ZM4A 2JE6B 1ZM3A 2WP8B 4DU7A 4PRVA 4JYAE 5JEAA 3GCMA 4FWHA 2UXBE 4MU3A 4U3DA 3KRNA 5K36E 3Q6NA 2BR2A 4DV6I 4Z7CA 4K0KE 2XEXA 2NN6D 3ZZUA 4WUCA 3J7AM 1Z5CA 3P3EA 4DV0E 4X65E 3HJCA 2IERA 4NXNE 4DR5E 1XMOI 4DV2E 4PU9A 3OTOE 2JEBB 4MU4A 1N34E 2BA1D 5C0XC 2V8PA 2J7KA 2OI2A 2DEJA 1FI4A 4JI6E 5C0XA 4FW6A 2VQEI 1OYPA 1Y6ZA 5A2QQ 1H72C 3WU4A 4IFDE 4JG4A 4MU1A 4M1KA 4IS9A 4IFDD 4X66E 1J5EE 1XNQE 2UUAI 4P52A 2PO0A 4JI8E 3U1KA 5EKWA 4B3RE 4YY3I 3K17A 4PRXA 4LPFA 1Z0GA 4LF8E 4MU0A 2Z5BB 2R3VA 1E3HA 4LF7E 1S16A 4LF9E 1ELOA 4X62I 1FWLA 4MQYA 4EMDA 3ZKDA 1KKHA 4JI7E 1OJ4A 3WU6A 4MDTA 1UEKA 3T1HE 3QT5A 1B63A 4QNJA 5DRRA 2UUCE 2F4VI 1FJGI 3J7AG 3K85A 1ZM9A 2WW4A 4HACA 2IOQA 4X64I 4DUYE 2V2VA 4IZKB 4LFCE 1A6FA 1Z0VA 1IBKE 2E5LI 1HK7A 4LF7I 2AE8A 2JEBA 3GONA 5IWAI 4JI0E 4MYTA 4X64E 2GQ0A 4JI1I 1XHKA 2ZM6E 4DV5E 4JI6I 3LPSA 3M6AA 5GMEA 4UTGA 1EI1A 1NHHA 4FN5A 2PO1A 4KHPI 4KQVA 3V5RA 3JAMQ 2BM0A 4FWGA 3PS2A 1UDOA 4FW7A 4DV2I 4JI5E 2EFGA 2O3ZA 3HKMA 2WNRB 2E5LE 3OTOI 4U3BA 2HKEA 5DRQA 1E3PA 2PO0B 5C0XF 3H4LA 3M7NG 4KHPE 2PNMA 4YY3E 1USUA 3V2UC 1PIEA 2ZITA 4DV4I 3CWVA 4LOMA 2JT2A 3B82A 2CZ9A 4LCHA 3DD6A 1OYSA 4OO1D 2PO1B 3LTOA 2C37B 2GO4A 3PYGA 4AIDA 4IFDC 1IBME 4DV7E 4DUZE 2HK3A 4DPYA 3NZKA 4K0KI 3QT7A 3UHMA 4DR3E 1H73A 2UXDI 5K36A 4BA2B 4B3RI 1Y5YA 2BA0G 4B3MI 4AM3A 1ZXNA 3B4TA 1N32I 4IZKA 2Z5EA 2UUBI 1KTVA 3T1HI 1XMQE 1N36E 4HYMA 3JAMC 2UUCI 1FJGE 2F4VE 4DV0I 1Z59A 4OX9E 1H7UA 4BA2A 3ZKBA 1P42A 4DV3E 1UDSA 1N32E 2O1TA 4OO1A 4X66I 1J5EI 4FW4A 4DR4I 5DNXA 4GKKE 3B78A 3ZM7A 4USMA 3M85D 2NN6E 2VF3A 2WP8A 2O1UA 5LMUI 4DV1E 2O1VA 3B8HA 5BR8I 1WUUA 4LF8I 4JV5I 4GKJE 1NHJA 2JEAB 4GKKI 4MYUA 3PYEA 4NXME 2A2DA 4DV4E 4IFDA 4GQUA 4DPXA 1NZ0A 1N34I 3M85G 4DR6I 4DR7I 1BKNA 1XNRE 2CGEA 4GKJI 5JEAD 4NBQA 1I94I 1Y4SA 1R6MA 1Z0EA 3HULA 5JEAF 1USVA 4DR3I 3T1YI 4B3TI 1N33I 2PNLA 2Z5CA 3PS1A 1MG7A 4OO1C 1I94E 4LF4I 4DPUA 4UT4A 4YHHI 4LF5I 3LNUA 2GO3A 4LFAI 2BV3A 4RPFA 1YHCA 4LF6E 5LMNE 4NXNI 4JI4E 4LFCI 4JI3E 2X36A 2PNZA 2UXCE 1H74A 1MU5A 5BR8E 2A2CA 1YH8A 3J81Q 1DARA 1Z0TA 4USKA 5FLXC 3P06A 3H1CA 2ZBKB 4IFDB 2C38A 4FW5A 2HHHI 4OO1E 4BA1B 2PNZB 2F1DA 1OYRA 5K36C 1PKPA 1UDQA 4FW9A 4HY1A 2C37A 2VESA 1D6TA 1ZM2A 2NN6A 2ZM6I 2Q2EB 1Y4UA 2NN6F 1HNZE 1HNWE 1H7SA 4X62E 1R6LA 2HK2A 1XMQI 1N36I 3PRYA 4JI0I 1Y60A 5DRPA 3J81C 3P3CA 1RREA 2C39A 5L3JA 5IT9Q 1IBMI 4YHHE 4I3HA 2BR2B 4JI2I 4LFAE 2V2ZA 4BA1A 1RR9A 3PYDA 5K36B 3GLLA 4B3TE 1N33E 1Z5BA 4DXLA
chains in the Genus database with same CATH topology
1E3HA 5K36D 5K36F 3M85D 2WNRA 2NN6E 2WP8A 3CDJA 5C0XE 2JEAB 4IFDA 2JE6A 3M85G 4AIMA 2BA0D 3M7ND 4OO1B 5JEAD 4NBQA 1R6MA 5JEAF 2PO2A 2JEBA 2BA1G 3GMEA 4OO1C 5JEAC 4IFDF 3L7ZB 2C38B 2JE6B 2WP8B 5JEAA 3GCMA 2PO1A 2JEAA 5K36E 3KRNA 2BR2A 1UDOA 3HKMA 2WNRB 2NN6D 2PNZA 1E3PA 2PO0B 2C39B 5C0XF 5C0XD 2NN6B 3M7NG 3H1CA 4IFDB 2C38A 4OO1E 2JEBB 4BA1B 2PO2B 2PNZB 1OYRA 2BA1D 5K36C 3DD6A 1OYSA 1UDQA 5C0XC 2PO1B 4OO1D 5JEAB 2C37A 2C37B 2NN6A 4AIDA 4IFDC 3CDIA 4OO1F 5JEAE 2NN6F 5C0XA 1R6LA 5C0XB 1OYPA 5K36A 2C39A 4BA2B 4IFDE 4IFDD 2BA0G 3L7ZA 4AM3A 3B4TA 2NN6C 2BR2B 4BA1A 2PO0A 3U1KA 4BA2A 5K36B 3GLLA 1UDSA 1UDNA 4OO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3H A;  5K36 D;  5K36 F;  3M85 D;  2WNR A;  2NN6 E;  2WP8 A;  3CDJ A;  5C0X E;  2JEA B;  4IFD A;  2JE6 A;  3M85 G;  4AIM A;  2BA0 D;  3M7N D;  4OO1 B;  5JEA D;  4NBQ A;  1R6M A;  5JEA F;  2PO2 A;  2JEB A;  2BA1 G;  3GME A;  4OO1 C;  5JEA C;  4IFD F;  3L7Z B;  2C38 B;  2JE6 B;  2WP8 B;  5JEA A;  3GCM A;  2PO1 A;  2JEA A;  5K36 E;  3KRN A;  2BR2 A;  1UDO A;  3HKM A;  2WNR B;  2NN6 D;  2PNZ A;  1E3P A;  2PO0 B;  2C39 B;  5C0X F;  5C0X D;  2NN6 B;  3M7N G;  3H1C A;  4IFD B;  2C38 A;  4OO1 E;  2JEB B;  4BA1 B;  2PO2 B;  2PNZ B;  1OYR A;  2BA1 D;  5K36 C;  3DD6 A;  1OYS A;  1UDQ A;  5C0X C;  2PO1 B;  4OO1 D;  5JEA B;  2C37 A;  2C37 B;  2NN6 A;  4AID A;  4IFD C;  3CDI A;  4OO1 F;  5JEA E;  2NN6 F;  5C0X A;  1R6L A;  5C0X B;  1OYP A;  5K36 A;  2C39 A;  4BA2 B;  4IFD E;  4IFD D;  2BA0 G;  3L7Z A;  4AM3 A;  3B4T A;  2NN6 C;  2BR2 B;  4BA1 A;  2PO0 A;  3U1K A;  4BA2 A;  5K36 B;  3GLL A;  1UDS A;  1UDN A;  4OO1 A; 
#chains in the Genus database with same CATH topology
 4DV7 I;  1HR0 E;  3D4J A;  5K36 D;  5K36 F;  2V34 A;  5IWA E;  2WNR A;  2IES A;  4XTJ A;  3CDJ A;  5LMN I;  3K1J A;  3QT6 A;  1NHI A;  4HXZ A;  3QT8 A;  4WUD A;  4LCG A;  4DR2 E;  2HKJ A;  2UU9 E;  2AJ4 A;  2UUA E;  4LCF A;  3T1Y E;  4LF6 I;  4LFB I;  2BA0 D;  4AQY I;  4OO1 B;  4JI1 E;  4LF4 E;  4DV5 I;  5GMD A;  4DUZ I;  4LF5 E;  1HNX E;  5LL6 R;  4N3O A;  2PO2 A;  2GS8 A;  2VQE E;  2BA1 G;  4DPW A;  3GME A;  2UXB I;  4QNK A;  4DR4 E;  2Z5C B;  4IZJ D;  4IFD F;  1S4E A;  3L7Z B;  1K47 A;  1MX0 A;  3J80 C;  1IBK I;  4R1F A;  3WU3 A;  3Q1Q A;  3U1Y A;  1HNZ I;  1HNW I;  5LMU E;  2V2Q A;  2R42 A;  2BM1 A;  3ZZT A;  2JEA A;  4X65 I;  2LJP A;  1Z0W A;  4DR1 E;  4DUY I;  1HR0 I;  1IBL E;  1Z0C A;  4FWD A;  2UXD E;  5IT9 C;  4DPT A;  1KVK A;  2C39 B;  4HAC B;  5C0X D;  4B3S E;  4DR1 I;  2NN6 B;  2E1R A;  5DNL A;  4J3D A;  2UUB E;  4FW3 A;  5EL9 A;  2VQF I;  4JI2 E;  3WU5 A;  4IZJ A;  4DR2 I;  1Z0B A;  2UU9 I;  2UXC I;  2PO2 B;  4JI8 I;  5JEA B;  4DU8 A;  4Z7Y A;  4B3M E;  3CDI A;  4JI4 I;  4OO1 F;  5JEA E;  1XNQ I;  5DRO A;  1HNX I;  1FWK A;  5C0X B;  1KIJ A;  3PS3 A;  4LFB E;  3L7Z A;  2NN6 C;  4AQY E;  4JI7 I;  1EA6 A;  4WUB A;  2J65 A;  1Z5A A;  2CVE A;  1UDN A;  3PYF A;  4DR5 I;  1VI7 A;  4JI5 I;  4JI3 I;  4P7A A;  2CG9 A;  2O1W A;  4NXM I;  3J80 Q;  3P3G A;  2NPF A;  4ED4 A;  5ELW A;  4DR6 E;  4OKG A;  1B62 A;  2X7I A;  1XNR I;  1N0V C;  2IOP A;  3ZZ0 A;  5C0X E;  5FWK A;  2HFU A;  2VQF E;  1XMO E;  2HFS A;  4IZJ B;  5A2Q C;  3P76 A;  2HHH E;  1XXE A;  2DEI A;  2JE6 A;  1FKA E;  1FNM A;  3F0N A;  4AIM A;  1U2R A;  1ZXM A;  4OX9 I;  4DV1 I;  4JV5 E;  4B3S I;  1QZR A;  3M7N D;  4DV3 I;  4DV6 E;  1IBL I;  4OZE A;  4ZVI A;  4LF9 I;  4JYA I;  4DR7 E;  4ISA A;  2Z5B A;  5FLX Q;  5JEA C;  3Q6M A;  1N0U A;  1PVG A;  1RHY A;  4URL A;  2C38 B;  1VIS A;  1ZM4 A;  2JE6 B;  1ZM3 A;  2WP8 B;  4DU7 A;  4PRV A;  4JYA E;  5JEA A;  3GCM A;  4FWH A;  2UXB E;  4MU3 A;  4U3D A;  3KRN A;  5K36 E;  3Q6N A;  2BR2 A;  4DV6 I;  4Z7C A;  4K0K E;  2XEX A;  2NN6 D;  3ZZU A;  4WUC A;  3J7A M;  1Z5C A;  3P3E A;  4DV0 E;  4X65 E;  3HJC A;  2IER A;  4NXN E;  4DR5 E;  1XMO I;  4DV2 E;  4PU9 A;  3OTO E;  2JEB B;  4MU4 A;  1N34 E;  2BA1 D;  5C0X C;  2V8P A;  2J7K A;  2OI2 A;  2DEJ A;  1FI4 A;  4JI6 E;  5C0X A;  4FW6 A;  2VQE I;  1OYP A;  1Y6Z A;  5A2Q Q;  1H72 C;  3WU4 A;  4IFD E;  4JG4 A;  4MU1 A;  4M1K A;  4IS9 A;  4IFD D;  4X66 E;  1J5E E;  1XNQ E;  2UUA I;  4P52 A;  2PO0 A;  4JI8 E;  3U1K A;  5EKW A;  4B3R E;  4YY3 I;  3K17 A;  4PRX A;  4LPF A;  1Z0G A;  4LF8 E;  4MU0 A;  2Z5B B;  2R3V A;  1E3H A;  4LF7 E;  1S16 A;  4LF9 E;  1ELO A;  4X62 I;  1FWL A;  4MQY A;  4EMD A;  3ZKD A;  1KKH A;  4JI7 E;  1OJ4 A;  3WU6 A;  4MDT A;  1UEK A;  3T1H E;  3QT5 A;  1B63 A;  4QNJ A;  5DRR A;  2UUC E;  2F4V I;  1FJG I;  3J7A G;  3K85 A;  1ZM9 A;  2WW4 A;  4HAC A;  2IOQ A;  4X64 I;  4DUY E;  2V2V A;  4IZK B;  4LFC E;  1A6F A;  1Z0V A;  1IBK E;  2E5L I;  1HK7 A;  4LF7 I;  2AE8 A;  2JEB A;  3GON A;  5IWA I;  4JI0 E;  4MYT A;  4X64 E;  2GQ0 A;  4JI1 I;  1XHK A;  2ZM6 E;  4DV5 E;  4JI6 I;  3LPS A;  3M6A A;  5GME A;  4UTG A;  1EI1 A;  1NHH A;  4FN5 A;  2PO1 A;  4KHP I;  4KQV A;  3V5R A;  3JAM Q;  2BM0 A;  4FWG A;  3PS2 A;  1UDO A;  4FW7 A;  4DV2 I;  4JI5 E;  2EFG A;  2O3Z A;  3HKM A;  2WNR B;  2E5L E;  3OTO I;  4U3B A;  2HKE A;  5DRQ A;  1E3P A;  2PO0 B;  5C0X F;  3H4L A;  3M7N G;  4KHP E;  2PNM A;  4YY3 E;  1USU A;  3V2U C;  1PIE A;  2ZIT A;  4DV4 I;  3CWV A;  4LOM A;  2JT2 A;  3B82 A;  2CZ9 A;  4LCH A;  3DD6 A;  1OYS A;  4OO1 D;  2PO1 B;  3LTO A;  2C37 B;  2GO4 A;  3PYG A;  4AID A;  4IFD C;  1IBM E;  4DV7 E;  4DUZ E;  2HK3 A;  4DPY A;  3NZK A;  4K0K I;  3QT7 A;  3UHM A;  4DR3 E;  1H73 A;  2UXD I;  5K36 A;  4BA2 B;  4B3R I;  1Y5Y A;  2BA0 G;  4B3M I;  4AM3 A;  1ZXN A;  3B4T A;  1N32 I;  4IZK A;  2Z5E A;  2UUB I;  1KTV A;  3T1H I;  1XMQ E;  1N36 E;  4HYM A;  3JAM C;  2UUC I;  1FJG E;  2F4V E;  4DV0 I;  1Z59 A;  4OX9 E;  1H7U A;  4BA2 A;  3ZKB A;  1P42 A;  4DV3 E;  1UDS A;  1N32 E;  2O1T A;  4OO1 A;  4X66 I;  1J5E I;  4FW4 A;  4DR4 I;  5DNX A;  4GKK E;  3B78 A;  3ZM7 A;  4USM A;  3M85 D;  2NN6 E;  2VF3 A;  2WP8 A;  2O1U A;  5LMU I;  4DV1 E;  2O1V A;  3B8H A;  5BR8 I;  1WUU A;  4LF8 I;  4JV5 I;  4GKJ E;  1NHJ A;  2JEA B;  4GKK I;  4MYU A;  3PYE A;  4NXM E;  2A2D A;  4DV4 E;  4IFD A;  4GQU A;  4DPX A;  1NZ0 A;  1N34 I;  3M85 G;  4DR6 I;  4DR7 I;  1BKN A;  1XNR E;  2CGE A;  4GKJ I;  5JEA D;  4NBQ A;  1I94 I;  1Y4S A;  1R6M A;  1Z0E A;  3HUL A;  5JEA F;  1USV A;  4DR3 I;  3T1Y I;  4B3T I;  1N33 I;  2PNL A;  2Z5C A;  3PS1 A;  1MG7 A;  4OO1 C;  1I94 E;  4LF4 I;  4DPU A;  4UT4 A;  4YHH I;  4LF5 I;  3LNU A;  2GO3 A;  4LFA I;  2BV3 A;  4RPF A;  1YHC A;  4LF6 E;  5LMN E;  4NXN I;  4JI4 E;  4LFC I;  4JI3 E;  2X36 A;  2PNZ A;  2UXC E;  1H74 A;  1MU5 A;  5BR8 E;  2A2C A;  1YH8 A;  3J81 Q;  1DAR A;  1Z0T A;  4USK A;  5FLX C;  3P06 A;  3H1C A;  2ZBK B;  4IFD B;  2C38 A;  4FW5 A;  2HHH I;  4OO1 E;  4BA1 B;  2PNZ B;  2F1D A;  1OYR A;  5K36 C;  1PKP A;  1UDQ A;  4FW9 A;  4HY1 A;  2C37 A;  2VES A;  1D6T A;  1ZM2 A;  2NN6 A;  2ZM6 I;  2Q2E B;  1Y4U A;  2NN6 F;  1HNZ E;  1HNW E;  1H7S A;  4X62 E;  1R6L A;  2HK2 A;  1XMQ I;  1N36 I;  3PRY A;  4JI0 I;  1Y60 A;  5DRP A;  3J81 C;  3P3C A;  1RRE A;  2C39 A;  5L3J A;  5IT9 Q;  1IBM I;  4YHH E;  4I3H A;  2BR2 B;  4JI2 I;  4LFA E;  2V2Z A;  4BA1 A;  1RR9 A;  3PYD A;  5K36 B;  3GLL A;  4B3T E;  1N33 E;  1Z5B A;  4DXL A; 
#chains in the Genus database with same CATH homology
 1E3H A;  5K36 D;  5K36 F;  3M85 D;  2WNR A;  2NN6 E;  2WP8 A;  3CDJ A;  5C0X E;  2JEA B;  4IFD A;  2JE6 A;  3M85 G;  4AIM A;  2BA0 D;  3M7N D;  4OO1 B;  5JEA D;  4NBQ A;  1R6M A;  5JEA F;  2PO2 A;  2JEB A;  2BA1 G;  3GME A;  4OO1 C;  5JEA C;  4IFD F;  3L7Z B;  2C38 B;  2JE6 B;  2WP8 B;  5JEA A;  3GCM A;  2PO1 A;  2JEA A;  5K36 E;  3KRN A;  2BR2 A;  1UDO A;  3HKM A;  2WNR B;  2NN6 D;  2PNZ A;  1E3P A;  2PO0 B;  2C39 B;  5C0X F;  5C0X D;  2NN6 B;  3M7N G;  3H1C A;  4IFD B;  2C38 A;  4OO1 E;  2JEB B;  4BA1 B;  2PO2 B;  2PNZ B;  1OYR A;  2BA1 D;  5K36 C;  3DD6 A;  1OYS A;  1UDQ A;  5C0X C;  2PO1 B;  4OO1 D;  5JEA B;  2C37 A;  2C37 B;  2NN6 A;  4AID A;  4IFD C;  3CDI A;  4OO1 F;  5JEA E;  2NN6 F;  5C0X A;  1R6L A;  5C0X B;  1OYP A;  5K36 A;  2C39 A;  4BA2 B;  4IFD E;  4IFD D;  2BA0 G;  3L7Z A;  4AM3 A;  3B4T A;  2NN6 C;  2BR2 B;  4BA1 A;  2PO0 A;  3U1K A;  4BA2 A;  5K36 B;  3GLL A;  1UDS A;  1UDN A;  4OO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...