4IFDF

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
213
Chain Sequence
QDRRRLLGPAAAKPMAFSNSEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 60
structure length 213
sequence length 245
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdF00
4IFDE 3GMEA 2C37A 4OO1B 2NN6A 5C0XA 2JEAB 2PO2B 2JEAA 2NN6E 3M7ND 5C0XE 1UDOA 2WNRA 2WP8A 2JE6A 2BR2A 5K36B 5C0XF 5K36D 3B4TA 4BA2B 2C39A 1R6MA 3M7NG 5K36E 2PNZA 2C38A 3HKMA 2JEBB 3U1KA 5C0XC 1OYSA 3M85D 2C37B 2WNRB 2NN6D 4AIMA 4BA1B 4BA1A 4OO1C 2PO1B 2BA0D 4IFDA 4IFDB 3CDIA 2PO1A 3L7ZA 1OYPA 2BA1G 2PNZB 5JEAF 2C38B 1E3PA 4OO1E 4AM3A 5C0XB 2JEBA 2NN6C 2BA0G 4IFDF 5K36F 4OO1A 3H1CA 2JE6B 5JEAB 5JEAA 2WP8B 5JEAE 1E3HA 2BR2B 5K36A 3DD6A 4OO1F 1R6LA 1UDQA 1OYRA 5JEAC 4AIDA 4BA2A 5JEAD 2PO0B 2PO2A 5C0XD 2NN6B 2PO0A 1UDSA 3KRNA 3M85G 4IFDD 5K36C 1UDNA 2NN6F 3L7ZB 4IFDC 3CDJA 3GCMA 4OO1D 2BA1D 3GLLA 4NBQA 2C39B
chains in the Genus database with same CATH superfamily
4LF4E 4JI0E 4U3DA 4JI8E 2C37A 4OO1B 2NN6A 3WU6A 1HNXE 2HKJA 5LMUI 5A2QQ 4YY3E 4DV6I 5EKWA 3P3CA 4Z7CA 5FLXC 3J7AM 1UDOA 4X65I 1D6TA 4LCFA 4DV2I 1VI7A 3QT8A 5K36D 2VESA 4DV7E 3M7NG 4NXMI 3V5RA 1IBKE 5K36E 1N32I 1IBMI 2A2CA 5IWAE 2E5LI 2UUCE 4LCHA 2O1WA 4DV1I 4YY3I 4DV3E 2IOQA 1BKNA 1YHCA 1OYSA 2V2ZA 1ZM9A 2GO4A 5GMEA 2VF3A 5LMUE 4AIMA 1H74A 1B62A 1Z0WA 1NHJA 2PO1B 3M6AA 2VQEI 3CDIA 2PO1A 3WU5A 2PNZB 4DR5I 4LF5I 1E3PA 1IBME 4AM3A 1Y5YA 2DEIA 3T1YI 4DR3I 1XMQI 3ZZTA 2NN6C 1U2RA 4LPFA 1FKAE 5JEAA 4JI0I 3V2UC 1S16A 4KQVA 4U3BA 5JEAE 2UUAE 4JI3E 3PS2A 5K36A 3DD6A 3GONA 5DNXA 1R6LA 4J3DA 4X66I 1HNWI 3J81C 5IT9Q 4AIDA 4BA2A 3T1HI 3ZZ0A 4LFCE 3PYEA 2J7KA 3B8HA 2AE8A 4DR6E 1ZM2A 5DRQA 2CVEA 2CZ9A 4JI1E 2UU9E 3OTOE 2HHHI 2V2VA 4LF6E 4DV7I 2BM1A 4IFDC 5K36C 3GCMA 1PVGA 2UUBE 3ZZUA 1PKPA 4LFAE 4JV5E 1H73A 1HNWE 3WU3A 1N36I 3J80C 2X36A 4ZVIA 4DR2I 4HY1A 2BV3A 1RHYA 5C0XA 2AJ4A 2O1UA 3K17A 4Z7YA 2GO3A 5FLXQ 3LPSA 4IZJD 2BR2A 1YH8A 4JYAE 1NHHA 5C0XF 3P3GA 1XXEA 3B4TA 4EMDA 1USVA 2HFSA 1R6MA 2HKEA 4JI7E 4IZKB 4LFBI 4FWDA 1QZRA 2IERA 3PYFA 4LF8E 4DV4E 1HK7A 3U1KA 4DR4I 1HNXI 2VQEE 5GMDA 5C0XC 1KKHA 4DR2E 2OI2A 4DV6E 4RPFA 2ZM6E 3M85D 2CG9A 3LNUA 2JT2A 4DR1E 4B3TE 4BA1A 1Z0CA 5BR8I 3PS1A 3T1YE 4JI2E 4DV2E 1XMQE 3T1HE 2BA0D 4IFDA 1RR9A 1WUUA 4DUYE 4YHHE 4DV5E 1K47A 4DR6I 1N34I 2ZBKB 2DEJA 4QNJA 1N32E 2Q2EB 4DV4I 3PS3A 2UU9I 5IWAI 3P06A 4KHPI 5K36F 2UXCE 3H1CA 4DU7A 1RREA 2JE6B 4N3OA 1ZXMA 5JEAB 3Q6MA 2ZM6I 3HULA 1FWLA 4DPUA 3LTOA 4FN5A 3P3EA 4GKJI 1ZM3A 2BR2B 4PRVA 4HYMA 4LOMA 1P42A 4DPWA 1Z59A 3OTOI 2HHHE 2Z5CB 2O1VA 5JEAD 3PRYA 2PO0B 1MG7A 2VQFE 4NXNE 4ISAA 2NN6B 4JYAI 4OZEA 4DXLA 3KRNA 4DV0E 4K0KE 4B3MI 3Q6NA 2XEXA 1N33E 4MQYA 1Y6ZA 3K85A 4IFDD 4DR4E 2NN6F 4MU4A 3CDJA 4FWGA 4OO1D 2HK3A 1XNRE 4IZKA 4DR1I 2Z5CA 4ED4A 4MU1A 1ZM4A 4X62I 1XMOE 1HNZE 2IOPA 3D4JA 2UXBE 2PNMA 4NXME 2NN6E 3J81Q 1FNMA 4YHHI 3QT5A 1N0UA 1N34E 2WP8A 3QT7A 1N33I 2JE6A 4PRXA 5K36B 3H4LA 4FW3A 1A6FA 5L3JA 2X7IA 4P52A 2UXCI 1VISA 2UUBI 4FWHA 1DARA 4BA2B 1FWKA 4DPTA 5FWKA 4JV5I 1Z0GA 1FI4A 2PNZA 3F0NA 4I3HA 4GKKI 3HKMA 3WU4A 1XHKA 2UXDI 1Z5BA 4FW4A 2UXBI 4DR5E 2V8PA 1KVKA 1ZXNA 3ZM7A 2NN6D 4DUYI 1FJGI 4FW5A 4BA1B 5EL9A 3UHMA 4NXNI 3JAMQ 5ELWA 3PYDA 3HJCA 4IFDB 1IBKI 1Y4SA 2BA1G 2E5LE 2UUCI 3U1YA 4OO1E 2UXDE 4LF8I 1H7SA 5C0XB 4AQYI 1I94I 2JEBA 2O3ZA 5IT9C 4OO1A 4B3RE 2GS8A 3B78A 4LFCI 4MYUA 1H72C 2V34A 2CGEA 2IESA 4WUDA 2Z5BA 4LF9E 1XMOI 4JI4I 4DU8A 1E3HA 4OO1F 4JI1I 4GQUA 1UDQA 1OJ4A 4K0KI 4JI8I 5DNLA 2PNLA 1KIJA 2Z5EA 4AQYE 4KHPE 4B3RI 2J65A 3K1JA 4JI6E 1Z0TA 1UDSA 2UUAI 4JI3I 3M85G 4X64E 2NPFA 4WUBA 1NZ0A 1KTVA 1N0VC 2ZITA 3L7ZB 4X62E 4USKA 4GKKE 1J5EI 4B3SE 4LF7I 4UTGA 4FW6A 1Z0EA 2F4VE 4NBQA 2C39B 1Z0BA 4IFDE 1Y60A 4IZJB 1Y4UA 3GMEA 4XTJA 2JEAB 2O1TA 2PO2B 2BM0A 4JI5I 2EFGA 2JEAA 3M7ND 5C0XE 4LF6I 4DV0I 2WNRA 4JI6I 4PU9A 4HACB 4M1KA 4LFAI 2R42A 4LF7E 4B3TI 1N36E 4JI2I 1I94E 2V2QA 2C39A 5BR8E 1FJGE 5DRRA 2C38A 1USUA 1ELOA 2JEBB 5LMNI 4JI4E 3ZKDA 3PYGA 3Q1QA 4LF4I 2C37B 3J7AG 2WNRB 4DUZI 1HR0I 2WW4A 1IBLE 4JI7I 4OO1C 5A2QC 1MU5A 4DPYA 3L7ZA 1OYPA 4LFBE 2A2DA 1EI1A 5JEAF 5LL6R 2C38B 4GKJE 1EA6A 4X65E 4MYTA 2R3VA 5LMNE 2HK2A 1Z5CA 4JG4A 4OX9E 1XNQE 1MX0A 1S4EA 4IFDF 2BA0G 4WUCA 2F4VI 1Z5AA 4B3SI 2HFUA 2E1RA 2WP8B 4MU0A 3P76A 4DV1E 4DV3I 4DUZE 1HR0E 4DR3E 4B3ME 1PIEA 4DR7E 5DRPA 4DV5I 1H7UA 2GQ0A 1NHIA 4IZJA 4FW7A 2F1DA 4FW9A 4URLA 4JI5E 1OYRA 4X64I 5JEAC 1XNRI 3JAMC 4HXZA 4USMA 4IS9A 2PO2A 1B63A 5C0XD 3CWVA 2LJPA 2PO0A 4QNKA 1J5EE 5DROA 1UEKA 4OX9I 4LF5E 1XNQI 3B82A 2Z5BB 4X66E 3QT6A 4MDTA 4DPXA 1HNZI 4OKGA 1UDNA 3ZKBA 4LCGA 4UT4A 4MU3A 4LF9I 1Z0VA 4DR7I 2BA1D 3NZKA 4HACA 3J80Q 4P7AA 3GLLA 4R1FA 1IBLI 2VQFI
chains in the Genus database with same CATH topology
4IFDE 3GMEA 2C37A 4OO1B 2NN6A 5C0XA 2JEAB 2PO2B 2JEAA 2NN6E 3M7ND 5C0XE 1UDOA 2WNRA 2WP8A 2JE6A 2BR2A 5K36B 5C0XF 5K36D 3B4TA 4BA2B 2C39A 1R6MA 3M7NG 5K36E 2PNZA 2C38A 3HKMA 2JEBB 3U1KA 5C0XC 1OYSA 3M85D 2C37B 2WNRB 2NN6D 4AIMA 4BA1B 4BA1A 4OO1C 2PO1B 2BA0D 4IFDA 4IFDB 3CDIA 2PO1A 3L7ZA 1OYPA 2BA1G 2PNZB 5JEAF 2C38B 1E3PA 4OO1E 4AM3A 5C0XB 2JEBA 2NN6C 2BA0G 4IFDF 5K36F 4OO1A 3H1CA 2JE6B 5JEAB 5JEAA 2WP8B 5JEAE 1E3HA 2BR2B 5K36A 3DD6A 4OO1F 1R6LA 1UDQA 1OYRA 5JEAC 4AIDA 4BA2A 5JEAD 2PO0B 2PO2A 5C0XD 2NN6B 2PO0A 1UDSA 3KRNA 3M85G 4IFDD 5K36C 1UDNA 2NN6F 3L7ZB 4IFDC 3CDJA 3GCMA 4OO1D 2BA1D 3GLLA 4NBQA 2C39B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD E;  3GME A;  2C37 A;  4OO1 B;  2NN6 A;  5C0X A;  2JEA B;  2PO2 B;  2JEA A;  2NN6 E;  3M7N D;  5C0X E;  1UDO A;  2WNR A;  2WP8 A;  2JE6 A;  2BR2 A;  5K36 B;  5C0X F;  5K36 D;  3B4T A;  4BA2 B;  2C39 A;  1R6M A;  3M7N G;  5K36 E;  2PNZ A;  2C38 A;  3HKM A;  2JEB B;  3U1K A;  5C0X C;  1OYS A;  3M85 D;  2C37 B;  2WNR B;  2NN6 D;  4AIM A;  4BA1 B;  4BA1 A;  4OO1 C;  2PO1 B;  2BA0 D;  4IFD A;  4IFD B;  3CDI A;  2PO1 A;  3L7Z A;  1OYP A;  2BA1 G;  2PNZ B;  5JEA F;  2C38 B;  1E3P A;  4OO1 E;  4AM3 A;  5C0X B;  2JEB A;  2NN6 C;  2BA0 G;  4IFD F;  5K36 F;  4OO1 A;  3H1C A;  2JE6 B;  5JEA B;  5JEA A;  2WP8 B;  5JEA E;  1E3H A;  2BR2 B;  5K36 A;  3DD6 A;  4OO1 F;  1R6L A;  1UDQ A;  1OYR A;  5JEA C;  4AID A;  4BA2 A;  5JEA D;  2PO0 B;  2PO2 A;  5C0X D;  2NN6 B;  2PO0 A;  1UDS A;  3KRN A;  3M85 G;  4IFD D;  5K36 C;  1UDN A;  2NN6 F;  3L7Z B;  4IFD C;  3CDJ A;  3GCM A;  4OO1 D;  2BA1 D;  3GLL A;  4NBQ A;  2C39 B; 
#chains in the Genus database with same CATH topology
 4LF4 E;  4JI0 E;  4U3D A;  4JI8 E;  2C37 A;  4OO1 B;  2NN6 A;  3WU6 A;  1HNX E;  2HKJ A;  5LMU I;  5A2Q Q;  4YY3 E;  4DV6 I;  5EKW A;  3P3C A;  4Z7C A;  5FLX C;  3J7A M;  1UDO A;  4X65 I;  1D6T A;  4LCF A;  4DV2 I;  1VI7 A;  3QT8 A;  5K36 D;  2VES A;  4DV7 E;  3M7N G;  4NXM I;  3V5R A;  1IBK E;  5K36 E;  1N32 I;  1IBM I;  2A2C A;  5IWA E;  2E5L I;  2UUC E;  4LCH A;  2O1W A;  4DV1 I;  4YY3 I;  4DV3 E;  2IOQ A;  1BKN A;  1YHC A;  1OYS A;  2V2Z A;  1ZM9 A;  2GO4 A;  5GME A;  2VF3 A;  5LMU E;  4AIM A;  1H74 A;  1B62 A;  1Z0W A;  1NHJ A;  2PO1 B;  3M6A A;  2VQE I;  3CDI A;  2PO1 A;  3WU5 A;  2PNZ B;  4DR5 I;  4LF5 I;  1E3P A;  1IBM E;  4AM3 A;  1Y5Y A;  2DEI A;  3T1Y I;  4DR3 I;  1XMQ I;  3ZZT A;  2NN6 C;  1U2R A;  4LPF A;  1FKA E;  5JEA A;  4JI0 I;  3V2U C;  1S16 A;  4KQV A;  4U3B A;  5JEA E;  2UUA E;  4JI3 E;  3PS2 A;  5K36 A;  3DD6 A;  3GON A;  5DNX A;  1R6L A;  4J3D A;  4X66 I;  1HNW I;  3J81 C;  5IT9 Q;  4AID A;  4BA2 A;  3T1H I;  3ZZ0 A;  4LFC E;  3PYE A;  2J7K A;  3B8H A;  2AE8 A;  4DR6 E;  1ZM2 A;  5DRQ A;  2CVE A;  2CZ9 A;  4JI1 E;  2UU9 E;  3OTO E;  2HHH I;  2V2V A;  4LF6 E;  4DV7 I;  2BM1 A;  4IFD C;  5K36 C;  3GCM A;  1PVG A;  2UUB E;  3ZZU A;  1PKP A;  4LFA E;  4JV5 E;  1H73 A;  1HNW E;  3WU3 A;  1N36 I;  3J80 C;  2X36 A;  4ZVI A;  4DR2 I;  4HY1 A;  2BV3 A;  1RHY A;  5C0X A;  2AJ4 A;  2O1U A;  3K17 A;  4Z7Y A;  2GO3 A;  5FLX Q;  3LPS A;  4IZJ D;  2BR2 A;  1YH8 A;  4JYA E;  1NHH A;  5C0X F;  3P3G A;  1XXE A;  3B4T A;  4EMD A;  1USV A;  2HFS A;  1R6M A;  2HKE A;  4JI7 E;  4IZK B;  4LFB I;  4FWD A;  1QZR A;  2IER A;  3PYF A;  4LF8 E;  4DV4 E;  1HK7 A;  3U1K A;  4DR4 I;  1HNX I;  2VQE E;  5GMD A;  5C0X C;  1KKH A;  4DR2 E;  2OI2 A;  4DV6 E;  4RPF A;  2ZM6 E;  3M85 D;  2CG9 A;  3LNU A;  2JT2 A;  4DR1 E;  4B3T E;  4BA1 A;  1Z0C A;  5BR8 I;  3PS1 A;  3T1Y E;  4JI2 E;  4DV2 E;  1XMQ E;  3T1H E;  2BA0 D;  4IFD A;  1RR9 A;  1WUU A;  4DUY E;  4YHH E;  4DV5 E;  1K47 A;  4DR6 I;  1N34 I;  2ZBK B;  2DEJ A;  4QNJ A;  1N32 E;  2Q2E B;  4DV4 I;  3PS3 A;  2UU9 I;  5IWA I;  3P06 A;  4KHP I;  5K36 F;  2UXC E;  3H1C A;  4DU7 A;  1RRE A;  2JE6 B;  4N3O A;  1ZXM A;  5JEA B;  3Q6M A;  2ZM6 I;  3HUL A;  1FWL A;  4DPU A;  3LTO A;  4FN5 A;  3P3E A;  4GKJ I;  1ZM3 A;  2BR2 B;  4PRV A;  4HYM A;  4LOM A;  1P42 A;  4DPW A;  1Z59 A;  3OTO I;  2HHH E;  2Z5C B;  2O1V A;  5JEA D;  3PRY A;  2PO0 B;  1MG7 A;  2VQF E;  4NXN E;  4ISA A;  2NN6 B;  4JYA I;  4OZE A;  4DXL A;  3KRN A;  4DV0 E;  4K0K E;  4B3M I;  3Q6N A;  2XEX A;  1N33 E;  4MQY A;  1Y6Z A;  3K85 A;  4IFD D;  4DR4 E;  2NN6 F;  4MU4 A;  3CDJ A;  4FWG A;  4OO1 D;  2HK3 A;  1XNR E;  4IZK A;  4DR1 I;  2Z5C A;  4ED4 A;  4MU1 A;  1ZM4 A;  4X62 I;  1XMO E;  1HNZ E;  2IOP A;  3D4J A;  2UXB E;  2PNM A;  4NXM E;  2NN6 E;  3J81 Q;  1FNM A;  4YHH I;  3QT5 A;  1N0U A;  1N34 E;  2WP8 A;  3QT7 A;  1N33 I;  2JE6 A;  4PRX A;  5K36 B;  3H4L A;  4FW3 A;  1A6F A;  5L3J A;  2X7I A;  4P52 A;  2UXC I;  1VIS A;  2UUB I;  4FWH A;  1DAR A;  4BA2 B;  1FWK A;  4DPT A;  5FWK A;  4JV5 I;  1Z0G A;  1FI4 A;  2PNZ A;  3F0N A;  4I3H A;  4GKK I;  3HKM A;  3WU4 A;  1XHK A;  2UXD I;  1Z5B A;  4FW4 A;  2UXB I;  4DR5 E;  2V8P A;  1KVK A;  1ZXN A;  3ZM7 A;  2NN6 D;  4DUY I;  1FJG I;  4FW5 A;  4BA1 B;  5EL9 A;  3UHM A;  4NXN I;  3JAM Q;  5ELW A;  3PYD A;  3HJC A;  4IFD B;  1IBK I;  1Y4S A;  2BA1 G;  2E5L E;  2UUC I;  3U1Y A;  4OO1 E;  2UXD E;  4LF8 I;  1H7S A;  5C0X B;  4AQY I;  1I94 I;  2JEB A;  2O3Z A;  5IT9 C;  4OO1 A;  4B3R E;  2GS8 A;  3B78 A;  4LFC I;  4MYU A;  1H72 C;  2V34 A;  2CGE A;  2IES A;  4WUD A;  2Z5B A;  4LF9 E;  1XMO I;  4JI4 I;  4DU8 A;  1E3H A;  4OO1 F;  4JI1 I;  4GQU A;  1UDQ A;  1OJ4 A;  4K0K I;  4JI8 I;  5DNL A;  2PNL A;  1KIJ A;  2Z5E A;  4AQY E;  4KHP E;  4B3R I;  2J65 A;  3K1J A;  4JI6 E;  1Z0T A;  1UDS A;  2UUA I;  4JI3 I;  3M85 G;  4X64 E;  2NPF A;  4WUB A;  1NZ0 A;  1KTV A;  1N0V C;  2ZIT A;  3L7Z B;  4X62 E;  4USK A;  4GKK E;  1J5E I;  4B3S E;  4LF7 I;  4UTG A;  4FW6 A;  1Z0E A;  2F4V E;  4NBQ A;  2C39 B;  1Z0B A;  4IFD E;  1Y60 A;  4IZJ B;  1Y4U A;  3GME A;  4XTJ A;  2JEA B;  2O1T A;  2PO2 B;  2BM0 A;  4JI5 I;  2EFG A;  2JEA A;  3M7N D;  5C0X E;  4LF6 I;  4DV0 I;  2WNR A;  4JI6 I;  4PU9 A;  4HAC B;  4M1K A;  4LFA I;  2R42 A;  4LF7 E;  4B3T I;  1N36 E;  4JI2 I;  1I94 E;  2V2Q A;  2C39 A;  5BR8 E;  1FJG E;  5DRR A;  2C38 A;  1USU A;  1ELO A;  2JEB B;  5LMN I;  4JI4 E;  3ZKD A;  3PYG A;  3Q1Q A;  4LF4 I;  2C37 B;  3J7A G;  2WNR B;  4DUZ I;  1HR0 I;  2WW4 A;  1IBL E;  4JI7 I;  4OO1 C;  5A2Q C;  1MU5 A;  4DPY A;  3L7Z A;  1OYP A;  4LFB E;  2A2D A;  1EI1 A;  5JEA F;  5LL6 R;  2C38 B;  4GKJ E;  1EA6 A;  4X65 E;  4MYT A;  2R3V A;  5LMN E;  2HK2 A;  1Z5C A;  4JG4 A;  4OX9 E;  1XNQ E;  1MX0 A;  1S4E A;  4IFD F;  2BA0 G;  4WUC A;  2F4V I;  1Z5A A;  4B3S I;  2HFU A;  2E1R A;  2WP8 B;  4MU0 A;  3P76 A;  4DV1 E;  4DV3 I;  4DUZ E;  1HR0 E;  4DR3 E;  4B3M E;  1PIE A;  4DR7 E;  5DRP A;  4DV5 I;  1H7U A;  2GQ0 A;  1NHI A;  4IZJ A;  4FW7 A;  2F1D A;  4FW9 A;  4URL A;  4JI5 E;  1OYR A;  4X64 I;  5JEA C;  1XNR I;  3JAM C;  4HXZ A;  4USM A;  4IS9 A;  2PO2 A;  1B63 A;  5C0X D;  3CWV A;  2LJP A;  2PO0 A;  4QNK A;  1J5E E;  5DRO A;  1UEK A;  4OX9 I;  4LF5 E;  1XNQ I;  3B82 A;  2Z5B B;  4X66 E;  3QT6 A;  4MDT A;  4DPX A;  1HNZ I;  4OKG A;  1UDN A;  3ZKB A;  4LCG A;  4UT4 A;  4MU3 A;  4LF9 I;  1Z0V A;  4DR7 I;  2BA1 D;  3NZK A;  4HAC A;  3J80 Q;  4P7A A;  3GLL A;  4R1F A;  1IBL I;  2VQF I; 
#chains in the Genus database with same CATH homology
 4IFD E;  3GME A;  2C37 A;  4OO1 B;  2NN6 A;  5C0X A;  2JEA B;  2PO2 B;  2JEA A;  2NN6 E;  3M7N D;  5C0X E;  1UDO A;  2WNR A;  2WP8 A;  2JE6 A;  2BR2 A;  5K36 B;  5C0X F;  5K36 D;  3B4T A;  4BA2 B;  2C39 A;  1R6M A;  3M7N G;  5K36 E;  2PNZ A;  2C38 A;  3HKM A;  2JEB B;  3U1K A;  5C0X C;  1OYS A;  3M85 D;  2C37 B;  2WNR B;  2NN6 D;  4AIM A;  4BA1 B;  4BA1 A;  4OO1 C;  2PO1 B;  2BA0 D;  4IFD A;  4IFD B;  3CDI A;  2PO1 A;  3L7Z A;  1OYP A;  2BA1 G;  2PNZ B;  5JEA F;  2C38 B;  1E3P A;  4OO1 E;  4AM3 A;  5C0X B;  2JEB A;  2NN6 C;  2BA0 G;  4IFD F;  5K36 F;  4OO1 A;  3H1C A;  2JE6 B;  5JEA B;  5JEA A;  2WP8 B;  5JEA E;  1E3H A;  2BR2 B;  5K36 A;  3DD6 A;  4OO1 F;  1R6L A;  1UDQ A;  1OYR A;  5JEA C;  4AID A;  4BA2 A;  5JEA D;  2PO0 B;  2PO2 A;  5C0X D;  2NN6 B;  2PO0 A;  1UDS A;  3KRN A;  3M85 G;  4IFD D;  5K36 C;  1UDN A;  2NN6 F;  3L7Z B;  4IFD C;  3CDJ A;  3GCM A;  4OO1 D;  2BA1 D;  3GLL A;  4NBQ A;  2C39 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...