4IFDF

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
213
Chain Sequence
QDRRRLLGPAAAKPMAFSNSEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 60
structure length 213
sequence length 245
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdF00
2JEBA 2C37B 4AIDA 4BA2A 5JEAD 4OO1E 1OYSA 2WP8A 2PO1B 3M7NG 5K36A 3L7ZB 2C38A 2NN6F 4NBQA 1E3HA 5JEAC 2NN6B 4BA1B 2JE6B 1UDNA 2WNRA 3H1CA 4OO1A 2PNZA 2NN6D 5JEAE 3DD6A 2JEAB 4IFDF 3CDIA 4IFDB 2BR2A 3M85D 4AIMA 2NN6C 1E3PA 2BA0D 4IFDD 5JEAA 2C39B 2PO2B 3GCMA 1UDSA 2C37A 2BA1D 3HKMA 2PO0B 1UDQA 1OYRA 4OO1F 5C0XF 4IFDC 4OO1B 2PO1A 5C0XB 3M85G 2JEBB 4BA2B 4IFDE 3M7ND 4OO1D 5K36F 2NN6A 4BA1A 5C0XD 2WP8B 2JE6A 5K36B 2C38B 2BA1G 2NN6E 3KRNA 4OO1C 5K36D 2JEAA 1R6MA 5C0XC 2WNRB 3B4TA 4IFDA 2PNZB 3GMEA 3L7ZA 1R6LA 5C0XE 3U1KA 5K36C 2BA0G 1OYPA 2BR2B 3CDJA 2C39A 2PO2A 5JEAF 5K36E 2PO0A 4AM3A 1UDOA 5JEAB 5C0XA 3GLLA
chains in the Genus database with same CATH superfamily
2JEBA 2UU9E 4LCFA 1Y6ZA 1XMOE 2R42A 1I94I 4BA2A 1MG7A 2F1DA 1Z5CA 1PKPA 4USKA 4NXNE 3T1HE 4YHHE 1IBLE 2UXCI 1BKNA 4WUCA 2C38A 4JI4E 2O1VA 2NN6F 4NBQA 2VF3A 2BM1A 4K0KI 4DU8A 4DR3E 4JI1I 1UDNA 4LFCI 2F4VI 4OO1A 4USMA 5JEAE 4DPWA 3ZZTA 4AQYI 4M1KA 2JEAB 4FW3A 4IFDF 4DUZI 1HNZI 3Q1QA 2BR2A 2HFSA 4HXZA 4DV6E 5EL9A 4X62I 4DV5E 1E3PA 1FJGI 3ZZUA 5DRPA 2E1RA 3K17A 2UUCE 4ZVIA 1XMQE 5DNLA 4JI8I 1D6TA 4LF4I 4B3SI 3CWVA 4FW7A 1N34I 2PO2B 3GCMA 3T1YE 1N32E 4FN5A 4FWGA 4ISAA 4MU4A 3HKMA 3QT8A 1UDQA 2PO0B 5LMUE 4LF9I 3WU4A 4OO1B 3WU5A 1DARA 5IT9C 1RR9A 4LPFA 3JAMC 2DEIA 3M85G 4I3HA 2HFUA 4X64I 4JG4A 1I94E 4XTJA 4RPFA 3PS3A 5DRQA 2NN6A 5C0XD 5FWKA 5K36B 1RHYA 4DR4I 4ED4A 3LNUA 4LCHA 1J5EI 1HNWI 4EMDA 4JI1E 2UU9I 1FNMA 1USVA 4B3TI 2WNRB 3B4TA 4IFDA 4LF8E 2F4VE 4NXNI 3T1HI 4AQYE 4FW5A 3U1KA 4JI4I 4DUZE 1B62A 1HNZE 1Z5BA 3CDJA 1N36E 2C39A 4X62E 3PS1A 1A6FA 2Q2EB 4B3RE 1FJGE 5K36E 4GKJE 2WW4A 4MU1A 4DV7I 4JI8E 4B3SE 2HK2A 3PYDA 2IOQA 2V2ZA 3J80C 1OJ4A 2CZ9A 2PO1B 1Y4UA 3M7NG 4JV5I 1VI7A 3V5RA 4DV5I 4PRXA 4X64E 4DR7I 2J7KA 4DR6I 1Z0WA 1FI4A 1KVKA 5JEAC 4BA1B 4MU0A 2JE6B 5GMEA 4FWDA 4LFAE 1Z0VA 2NPFA 2VESA 3HJCA 2NN6D 2PNZA 2BM0A 3DD6A 1HNWE 3B8HA 4OZEA 4LF5I 1H72C 4B3TE 3B82A 4DR5E 2ZM6E 4UT4A 4AIMA 4DPXA 5GMDA 5FLXQ 4JI7E 4IFDD 1H7SA 3QT5A 1H74A 1K47A 1S16A 3PS2A 4X66E 2C37A 2BA1D 2PNLA 3J81C 4DR1E 1OYRA 1YHCA 4LF8I 4DV7E 1S4EA 1Y4SA 1KTVA 5C0XB 2GO3A 3K85A 2UUAI 2JEBB 4UTGA 5IWAI 4BA2B 2UXDI 2LJPA 1N36I 2IERA 1HNXE 2HKJA 3M7ND 1Z0EA 4JV5E 4B3RI 2C38B 3F0NA 4GKJI 4DV3I 4DV4I 4DR7E 4DR6E 4MDTA 4IZJA 3KRNA 4OO1C 1FKAE 3NZKA 2UUBI 2GO4A 4GQUA 4MU3A 1Y5YA 4JI2E 4URLA 2UXBI 3L7ZA 5C0XE 4LF5E 5K36C 2CG9A 4DPTA 2BR2B 1NHJA 4DXLA 1PVGA 2CGEA 4WUDA 1KIJA 1ZXMA 4LFAI 5JEAF 1WUUA 4AM3A 4PU9A 1UDOA 1N33I 2A2DA 4IS9A 2X7IA 1Z0GA 4DR2E 3K1JA 5FLXC 4AIDA 4LF6E 4DR5I 3ZKDA 4HACA 2ZM6I 1EA6A 3ZZ0A 4OO1E 1OYSA 2WP8A 3ZM7A 3PYEA 3L7ZB 4DPUA 1ELOA 2UUAE 4JI7I 1HR0I 5IWAE 1RREA 2UXDE 4YY3I 2BV3A 1E3HA 1ZM3A 2HKEA 4IZKA 4Z7CA 2NN6B 4JI5E 1FWKA 4GKKI 4X66I 2GQ0A 2Z5BA 4DR1I 4DV3E 4DV4E 4OX9E 1HK7A 1H7UA 3H1CA 4P52A 2Z5EA 3WU3A 2Z5CA 1FWLA 2UUBE 4IFDB 1HNXI 4IZJD 2XEXA 3M85D 2HHHE 4JI3E 4LF7E 4QNJA 2UXBE 2OI2A 4DV1E 1MU5A 2AE8A 1ZM9A 3PRYA 2ZBKB 5JEAA 2C39B 4IZKB 5A2QQ 1YH8A 1KKHA 2Z5BB 4OO1F 3V2UC 1N33E 5BR8E 4JI2I 3QT7A 1B63A 1ZM2A 3HULA 5ELWA 2R3VA 4X65I 4LFBI 2V34A 3J7AM 3PYFA 3QT6A 4MYTA 1IBME 4KHPE 4HY1A 4IFDE 4WUBA 5K36F 3Q6NA 4FW6A 5IT9Q 3JAMQ 2E5LE 1HR0E 1Z59A 4JI0I 4YY3E 3ZKBA 2VQEI 1QZRA 2IESA 1ZM4A 4GKKE 2JEAA 5C0XC 4DR2I 4N3OA 4LF6I 1N0VC 5DRRA 4MYUA 2DEJA 2PNZB 3GMEA 2AJ4A 4FW4A 1U2RA 4JYAI 2V8PA 5LL6R 2BA0G 1XNQI 4JI5I 3P06A 1USUA 2PO2A 2PO0A 4J3DA 4P7AA 4OX9I 3H4LA 1NZ0A 4U3DA 4DPYA 1Z5AA 2J65A 3OTOI 3U1YA 1XHKA 1EI1A 2VQFI 1H73A 2V2VA 1N0UA 2C37B 5JEAD 2HHHI 4JI3I 4LF7I 4X65E 4DUYE 5LMNI 1ZXNA 4DV1I 3UHMA 3PYGA 5A2QC 4LFBE 5K36A 4OKGA 4NXMI 2CVEA 4JI6I 3J80Q 5EKWA 4R1FA 4PRVA 4JI0E 2WNRA 4DV0E 5BR8I 4LCGA 2VQEE 4B3MI 4IZJB 4QNKA 4U3BA 3D4JA 1IBKI 3CDIA 1XNRI 1VISA 3Q6MA 1IBMI 4KHPI 1Z0TA 1UEKA 3M6AA 3P3EA 2NN6C 2E5LI 2UXCE 3GONA 2BA0D 4JYAE 1Y60A 2O1WA 4DV2I 1XNQE 2ZITA 4DU7A 4K0KE 2V2QA 3P76A 3WU6A 1UDSA 2PNMA 1XMOI 4LOMA 4LFCE 5C0XF 4IFDC 3LTOA 3OTOE 2VQFE 2PO1A 4YHHI 1NHIA 2HK3A 1IBLI 1NHHA 2GS8A 2O3ZA 4MQYA 4KQVA 3J81Q 3LPSA 4HACB 4OO1D 4BA1A 2WP8B 2JE6A 5DNXA 5LMNE 4DR3I 2O1TA 3B78A 4NXME 1XXEA 4JI6E 2BA1G 4LF4E 2X36A 2NN6E 5K36D 1N34E 1R6MA 2EFGA 2O1UA 2IOPA 4Z7YA 2JT2A 5DROA 4B3ME 4LF9E 4DV6I 4DUYI 1Z0BA 4FW9A 3J7AG 2Z5CB 5L3JA 1IBKE 1R6LA 2A2CA 1XNRE 1PIEA 2UUCI 1OYPA 4HYMA 1XMQI 1Z0CA 3T1YI 1N32I 5LMUI 4FWHA 4DV0I 1P42A 4DV2E 4DR4E 5JEAB 1MX0A 3P3CA 3P3GA 5C0XA 1J5EE 3GLLA
chains in the Genus database with same CATH topology
2JEBA 2C37B 4AIDA 4BA2A 5JEAD 4OO1E 1OYSA 2WP8A 2PO1B 3M7NG 5K36A 3L7ZB 2C38A 2NN6F 4NBQA 1E3HA 5JEAC 2NN6B 4BA1B 2JE6B 1UDNA 2WNRA 3H1CA 4OO1A 2PNZA 2NN6D 5JEAE 3DD6A 2JEAB 4IFDF 3CDIA 4IFDB 2BR2A 3M85D 4AIMA 2NN6C 1E3PA 2BA0D 4IFDD 5JEAA 2C39B 2PO2B 3GCMA 1UDSA 2C37A 2BA1D 3HKMA 2PO0B 1UDQA 1OYRA 4OO1F 5C0XF 4IFDC 4OO1B 2PO1A 5C0XB 3M85G 2JEBB 4BA2B 4IFDE 3M7ND 4OO1D 5K36F 2NN6A 4BA1A 5C0XD 2WP8B 2JE6A 5K36B 2C38B 2BA1G 2NN6E 3KRNA 4OO1C 5K36D 2JEAA 1R6MA 5C0XC 2WNRB 3B4TA 4IFDA 2PNZB 3GMEA 3L7ZA 1R6LA 5C0XE 3U1KA 5K36C 2BA0G 1OYPA 2BR2B 3CDJA 2C39A 2PO2A 5JEAF 5K36E 2PO0A 4AM3A 1UDOA 5JEAB 5C0XA 3GLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEB A;  2C37 B;  4AID A;  4BA2 A;  5JEA D;  4OO1 E;  1OYS A;  2WP8 A;  2PO1 B;  3M7N G;  5K36 A;  3L7Z B;  2C38 A;  2NN6 F;  4NBQ A;  1E3H A;  5JEA C;  2NN6 B;  4BA1 B;  2JE6 B;  1UDN A;  2WNR A;  3H1C A;  4OO1 A;  2PNZ A;  2NN6 D;  5JEA E;  3DD6 A;  2JEA B;  4IFD F;  3CDI A;  4IFD B;  2BR2 A;  3M85 D;  4AIM A;  2NN6 C;  1E3P A;  2BA0 D;  4IFD D;  5JEA A;  2C39 B;  2PO2 B;  3GCM A;  1UDS A;  2C37 A;  2BA1 D;  3HKM A;  2PO0 B;  1UDQ A;  1OYR A;  4OO1 F;  5C0X F;  4IFD C;  4OO1 B;  2PO1 A;  5C0X B;  3M85 G;  2JEB B;  4BA2 B;  4IFD E;  3M7N D;  4OO1 D;  5K36 F;  2NN6 A;  4BA1 A;  5C0X D;  2WP8 B;  2JE6 A;  5K36 B;  2C38 B;  2BA1 G;  2NN6 E;  3KRN A;  4OO1 C;  5K36 D;  2JEA A;  1R6M A;  5C0X C;  2WNR B;  3B4T A;  4IFD A;  2PNZ B;  3GME A;  3L7Z A;  1R6L A;  5C0X E;  3U1K A;  5K36 C;  2BA0 G;  1OYP A;  2BR2 B;  3CDJ A;  2C39 A;  2PO2 A;  5JEA F;  5K36 E;  2PO0 A;  4AM3 A;  1UDO A;  5JEA B;  5C0X A;  3GLL A; 
#chains in the Genus database with same CATH topology
 2JEB A;  2UU9 E;  4LCF A;  1Y6Z A;  1XMO E;  2R42 A;  1I94 I;  4BA2 A;  1MG7 A;  2F1D A;  1Z5C A;  1PKP A;  4USK A;  4NXN E;  3T1H E;  4YHH E;  1IBL E;  2UXC I;  1BKN A;  4WUC A;  2C38 A;  4JI4 E;  2O1V A;  2NN6 F;  4NBQ A;  2VF3 A;  2BM1 A;  4K0K I;  4DU8 A;  4DR3 E;  4JI1 I;  1UDN A;  4LFC I;  2F4V I;  4OO1 A;  4USM A;  5JEA E;  4DPW A;  3ZZT A;  4AQY I;  4M1K A;  2JEA B;  4FW3 A;  4IFD F;  4DUZ I;  1HNZ I;  3Q1Q A;  2BR2 A;  2HFS A;  4HXZ A;  4DV6 E;  5EL9 A;  4X62 I;  4DV5 E;  1E3P A;  1FJG I;  3ZZU A;  5DRP A;  2E1R A;  3K17 A;  2UUC E;  4ZVI A;  1XMQ E;  5DNL A;  4JI8 I;  1D6T A;  4LF4 I;  4B3S I;  3CWV A;  4FW7 A;  1N34 I;  2PO2 B;  3GCM A;  3T1Y E;  1N32 E;  4FN5 A;  4FWG A;  4ISA A;  4MU4 A;  3HKM A;  3QT8 A;  1UDQ A;  2PO0 B;  5LMU E;  4LF9 I;  3WU4 A;  4OO1 B;  3WU5 A;  1DAR A;  5IT9 C;  1RR9 A;  4LPF A;  3JAM C;  2DEI A;  3M85 G;  4I3H A;  2HFU A;  4X64 I;  4JG4 A;  1I94 E;  4XTJ A;  4RPF A;  3PS3 A;  5DRQ A;  2NN6 A;  5C0X D;  5FWK A;  5K36 B;  1RHY A;  4DR4 I;  4ED4 A;  3LNU A;  4LCH A;  1J5E I;  1HNW I;  4EMD A;  4JI1 E;  2UU9 I;  1FNM A;  1USV A;  4B3T I;  2WNR B;  3B4T A;  4IFD A;  4LF8 E;  2F4V E;  4NXN I;  3T1H I;  4AQY E;  4FW5 A;  3U1K A;  4JI4 I;  4DUZ E;  1B62 A;  1HNZ E;  1Z5B A;  3CDJ A;  1N36 E;  2C39 A;  4X62 E;  3PS1 A;  1A6F A;  2Q2E B;  4B3R E;  1FJG E;  5K36 E;  4GKJ E;  2WW4 A;  4MU1 A;  4DV7 I;  4JI8 E;  4B3S E;  2HK2 A;  3PYD A;  2IOQ A;  2V2Z A;  3J80 C;  1OJ4 A;  2CZ9 A;  2PO1 B;  1Y4U A;  3M7N G;  4JV5 I;  1VI7 A;  3V5R A;  4DV5 I;  4PRX A;  4X64 E;  4DR7 I;  2J7K A;  4DR6 I;  1Z0W A;  1FI4 A;  1KVK A;  5JEA C;  4BA1 B;  4MU0 A;  2JE6 B;  5GME A;  4FWD A;  4LFA E;  1Z0V A;  2NPF A;  2VES A;  3HJC A;  2NN6 D;  2PNZ A;  2BM0 A;  3DD6 A;  1HNW E;  3B8H A;  4OZE A;  4LF5 I;  1H72 C;  4B3T E;  3B82 A;  4DR5 E;  2ZM6 E;  4UT4 A;  4AIM A;  4DPX A;  5GMD A;  5FLX Q;  4JI7 E;  4IFD D;  1H7S A;  3QT5 A;  1H74 A;  1K47 A;  1S16 A;  3PS2 A;  4X66 E;  2C37 A;  2BA1 D;  2PNL A;  3J81 C;  4DR1 E;  1OYR A;  1YHC A;  4LF8 I;  4DV7 E;  1S4E A;  1Y4S A;  1KTV A;  5C0X B;  2GO3 A;  3K85 A;  2UUA I;  2JEB B;  4UTG A;  5IWA I;  4BA2 B;  2UXD I;  2LJP A;  1N36 I;  2IER A;  1HNX E;  2HKJ A;  3M7N D;  1Z0E A;  4JV5 E;  4B3R I;  2C38 B;  3F0N A;  4GKJ I;  4DV3 I;  4DV4 I;  4DR7 E;  4DR6 E;  4MDT A;  4IZJ A;  3KRN A;  4OO1 C;  1FKA E;  3NZK A;  2UUB I;  2GO4 A;  4GQU A;  4MU3 A;  1Y5Y A;  4JI2 E;  4URL A;  2UXB I;  3L7Z A;  5C0X E;  4LF5 E;  5K36 C;  2CG9 A;  4DPT A;  2BR2 B;  1NHJ A;  4DXL A;  1PVG A;  2CGE A;  4WUD A;  1KIJ A;  1ZXM A;  4LFA I;  5JEA F;  1WUU A;  4AM3 A;  4PU9 A;  1UDO A;  1N33 I;  2A2D A;  4IS9 A;  2X7I A;  1Z0G A;  4DR2 E;  3K1J A;  5FLX C;  4AID A;  4LF6 E;  4DR5 I;  3ZKD A;  4HAC A;  2ZM6 I;  1EA6 A;  3ZZ0 A;  4OO1 E;  1OYS A;  2WP8 A;  3ZM7 A;  3PYE A;  3L7Z B;  4DPU A;  1ELO A;  2UUA E;  4JI7 I;  1HR0 I;  5IWA E;  1RRE A;  2UXD E;  4YY3 I;  2BV3 A;  1E3H A;  1ZM3 A;  2HKE A;  4IZK A;  4Z7C A;  2NN6 B;  4JI5 E;  1FWK A;  4GKK I;  4X66 I;  2GQ0 A;  2Z5B A;  4DR1 I;  4DV3 E;  4DV4 E;  4OX9 E;  1HK7 A;  1H7U A;  3H1C A;  4P52 A;  2Z5E A;  3WU3 A;  2Z5C A;  1FWL A;  2UUB E;  4IFD B;  1HNX I;  4IZJ D;  2XEX A;  3M85 D;  2HHH E;  4JI3 E;  4LF7 E;  4QNJ A;  2UXB E;  2OI2 A;  4DV1 E;  1MU5 A;  2AE8 A;  1ZM9 A;  3PRY A;  2ZBK B;  5JEA A;  2C39 B;  4IZK B;  5A2Q Q;  1YH8 A;  1KKH A;  2Z5B B;  4OO1 F;  3V2U C;  1N33 E;  5BR8 E;  4JI2 I;  3QT7 A;  1B63 A;  1ZM2 A;  3HUL A;  5ELW A;  2R3V A;  4X65 I;  4LFB I;  2V34 A;  3J7A M;  3PYF A;  3QT6 A;  4MYT A;  1IBM E;  4KHP E;  4HY1 A;  4IFD E;  4WUB A;  5K36 F;  3Q6N A;  4FW6 A;  5IT9 Q;  3JAM Q;  2E5L E;  1HR0 E;  1Z59 A;  4JI0 I;  4YY3 E;  3ZKB A;  2VQE I;  1QZR A;  2IES A;  1ZM4 A;  4GKK E;  2JEA A;  5C0X C;  4DR2 I;  4N3O A;  4LF6 I;  1N0V C;  5DRR A;  4MYU A;  2DEJ A;  2PNZ B;  3GME A;  2AJ4 A;  4FW4 A;  1U2R A;  4JYA I;  2V8P A;  5LL6 R;  2BA0 G;  1XNQ I;  4JI5 I;  3P06 A;  1USU A;  2PO2 A;  2PO0 A;  4J3D A;  4P7A A;  4OX9 I;  3H4L A;  1NZ0 A;  4U3D A;  4DPY A;  1Z5A A;  2J65 A;  3OTO I;  3U1Y A;  1XHK A;  1EI1 A;  2VQF I;  1H73 A;  2V2V A;  1N0U A;  2C37 B;  5JEA D;  2HHH I;  4JI3 I;  4LF7 I;  4X65 E;  4DUY E;  5LMN I;  1ZXN A;  4DV1 I;  3UHM A;  3PYG A;  5A2Q C;  4LFB E;  5K36 A;  4OKG A;  4NXM I;  2CVE A;  4JI6 I;  3J80 Q;  5EKW A;  4R1F A;  4PRV A;  4JI0 E;  2WNR A;  4DV0 E;  5BR8 I;  4LCG A;  2VQE E;  4B3M I;  4IZJ B;  4QNK A;  4U3B A;  3D4J A;  1IBK I;  3CDI A;  1XNR I;  1VIS A;  3Q6M A;  1IBM I;  4KHP I;  1Z0T A;  1UEK A;  3M6A A;  3P3E A;  2NN6 C;  2E5L I;  2UXC E;  3GON A;  2BA0 D;  4JYA E;  1Y60 A;  2O1W A;  4DV2 I;  1XNQ E;  2ZIT A;  4DU7 A;  4K0K E;  2V2Q A;  3P76 A;  3WU6 A;  1UDS A;  2PNM A;  1XMO I;  4LOM A;  4LFC E;  5C0X F;  4IFD C;  3LTO A;  3OTO E;  2VQF E;  2PO1 A;  4YHH I;  1NHI A;  2HK3 A;  1IBL I;  1NHH A;  2GS8 A;  2O3Z A;  4MQY A;  4KQV A;  3J81 Q;  3LPS A;  4HAC B;  4OO1 D;  4BA1 A;  2WP8 B;  2JE6 A;  5DNX A;  5LMN E;  4DR3 I;  2O1T A;  3B78 A;  4NXM E;  1XXE A;  4JI6 E;  2BA1 G;  4LF4 E;  2X36 A;  2NN6 E;  5K36 D;  1N34 E;  1R6M A;  2EFG A;  2O1U A;  2IOP A;  4Z7Y A;  2JT2 A;  5DRO A;  4B3M E;  4LF9 E;  4DV6 I;  4DUY I;  1Z0B A;  4FW9 A;  3J7A G;  2Z5C B;  5L3J A;  1IBK E;  1R6L A;  2A2C A;  1XNR E;  1PIE A;  2UUC I;  1OYP A;  4HYM A;  1XMQ I;  1Z0C A;  3T1Y I;  1N32 I;  5LMU I;  4FWH A;  4DV0 I;  1P42 A;  4DV2 E;  4DR4 E;  5JEA B;  1MX0 A;  3P3C A;  3P3G A;  5C0X A;  1J5E E;  3GLL A; 
#chains in the Genus database with same CATH homology
 2JEB A;  2C37 B;  4AID A;  4BA2 A;  5JEA D;  4OO1 E;  1OYS A;  2WP8 A;  2PO1 B;  3M7N G;  5K36 A;  3L7Z B;  2C38 A;  2NN6 F;  4NBQ A;  1E3H A;  5JEA C;  2NN6 B;  4BA1 B;  2JE6 B;  1UDN A;  2WNR A;  3H1C A;  4OO1 A;  2PNZ A;  2NN6 D;  5JEA E;  3DD6 A;  2JEA B;  4IFD F;  3CDI A;  4IFD B;  2BR2 A;  3M85 D;  4AIM A;  2NN6 C;  1E3P A;  2BA0 D;  4IFD D;  5JEA A;  2C39 B;  2PO2 B;  3GCM A;  1UDS A;  2C37 A;  2BA1 D;  3HKM A;  2PO0 B;  1UDQ A;  1OYR A;  4OO1 F;  5C0X F;  4IFD C;  4OO1 B;  2PO1 A;  5C0X B;  3M85 G;  2JEB B;  4BA2 B;  4IFD E;  3M7N D;  4OO1 D;  5K36 F;  2NN6 A;  4BA1 A;  5C0X D;  2WP8 B;  2JE6 A;  5K36 B;  2C38 B;  2BA1 G;  2NN6 E;  3KRN A;  4OO1 C;  5K36 D;  2JEA A;  1R6M A;  5C0X C;  2WNR B;  3B4T A;  4IFD A;  2PNZ B;  3GME A;  3L7Z A;  1R6L A;  5C0X E;  3U1K A;  5K36 C;  2BA0 G;  1OYP A;  2BR2 B;  3CDJ A;  2C39 A;  2PO2 A;  5JEA F;  5K36 E;  2PO0 A;  4AM3 A;  1UDO A;  5JEA B;  5C0X A;  3GLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...