4IFDF

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
213
Chain Sequence
QDRRRLLGPAAAKPMAFSNSEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 60
structure length 213
sequence length 245
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdF00
3M85D 1UDSA 3M7ND 5JEAD 5C0XD 2NN6F 4IFDD 2JE6A 2PO1A 3U1KA 2C38A 4BA2A 4OO1E 2BA0D 2BA1G 1UDOA 2PO0A 1UDNA 5K36E 2C39A 2NN6C 2WP8A 2PO0B 2C37A 3L7ZB 4IFDA 4OO1F 1UDQA 5JEAB 5JEAE 3DD6A 5C0XB 5C0XE 2JEBA 4IFDB 2NN6A 5K36F 3M7NG 2PNZA 4BA1A 2NN6D 2JE6B 4OO1C 2PO1B 2BR2A 2C38B 4BA2B 5C0XF 3CDJA 3GCMA 2JEAA 5K36C 2BR2B 2C39B 3CDIA 2BA1D 2WP8B 2C37B 3HKMA 4IFDE 4OO1D 3M85G 5C0XC 3KRNA 1OYRA 2WNRA 2JEBB 3H1CA 2NN6B 2NN6E 5K36D 1R6LA 2PNZB 5JEAF 4BA1B 2BA0G 4IFDF 2PO2A 1E3HA 1R6MA 4OO1A 2JEAB 4AM3A 1OYPA 2PO2B 3B4TA 1OYSA 4AIMA 4AIDA 4OO1B 1E3PA 5JEAC 5K36A 4IFDC 4NBQA 3L7ZA 5K36B 3GMEA 5JEAA 3GLLA 2WNRB 5C0XA
chains in the Genus database with same CATH superfamily
1Z0WA 2UUCI 5BR8I 3WU3A 4IZJA 1N36E 5IT9C 4X65E 4DR4E 5C0XD 2NN6F 4R1FA 3K85A 4IZJD 4YHHE 3JAMQ 2IESA 2GS8A 4DUZE 2BA0D 4ED4A 5FLXQ 4JG4A 4B3TE 5LMUE 4JI2E 4IZKB 3WU4A 3UHMA 1UDNA 5IT9Q 1XMOI 4DR5E 4JYAE 4U3BA 4LF4E 4OO1F 3PYGA 1HNWI 1HNZE 4U3DA 5JEAE 4FW4A 1IBLI 4JI4E 2JEBA 3K1JA 4IFDB 5K36F 4WUCA 4P52A 2O1TA 3PYDA 4GKJI 4DR1E 4B3RI 4RPFA 5L3JA 4JI0E 4LFCE 3PYEA 1FI4A 3PS3A 3WU5A 2JE6B 4OZEA 2PO1B 2CVEA 2BR2A 4DR3I 2UXBI 4BA2B 4LFAE 1H7SA 4MU4A 4LF8I 1KVKA 4X62I 1IBME 4QNKA 4JI3I 4DR2I 3CDIA 2VESA 3K17A 4N3OA 3QT7A 1ZM4A 4LF7I 1H7UA 2C37B 4LCFA 4DV5I 2F1DA 2GO3A 4B3SE 1QZRA 4X65I 1RHYA 2JT2A 2Z5BB 3M85G 5C0XC 3KRNA 4FWGA 1N32I 4YHHI 2Q2EB 3H1CA 2NN6E 2A2DA 1UEKA 1ZM2A 5LMUI 2PNZB 1S16A 2HFUA 4BA1B 2V2VA 2UXCE 4IFDF 1I94I 1NHIA 2PO2A 3J81C 4K0KE 5EL9A 2OI2A 3OTOE 4X66I 2JEAB 1B63A 3F0NA 3P3GA 4HACB 4LF9I 2UUBI 4DR7I 1D6TA 3PYFA 4DR1I 1XNQE 5DROA 3J81Q 1NHHA 4DV6E 4JI0I 4NBQA 2DEIA 4DV7E 3L7ZA 4KHPE 4B3MI 5LMNI 5JEAA 3GLLA 2WNRB 2UU9I 3D4JA 2HHHI 1MG7A 2ZBKB 3M85D 3J80C 3M7ND 1H73A 5JEAD 4JI1I 2WW4A 3PS1A 3PRYA 1KTVA 4GKKE 2C38A 3LPSA 4JV5E 1Z59A 4WUDA 3QT5A 4OKGA 2BA1G 1UDOA 1USVA 3J80Q 1FNMA 4XTJA 3J7AM 2C39A 1S4EA 4DV1E 4AQYI 3B78A 3ZKDA 1IBKE 3LNUA 2VQEE 1BKNA 4X64I 4DV4E 2ZM6I 4JI6E 4HYMA 4JI7E 2NN6A 4FW5A 5DRQA 3GONA 1XMQE 2J7KA 4DV2I 2UUAE 5IWAI 2NN6D 4FWDA 4HY1A 3Q6MA 4NXMI 4DV6I 4OX9E 4DV7I 5C0XF 3B82A 4LF6I 2VQFE 4JI8I 4DPXA 2BR2B 2VF3A 2BA1D 2WP8B 4DV0I 1MX0A 2A2CA 2Z5CA 4OO1D 1KKHA 4MU3A 2IOPA 4NXNE 4Z7YA 3WU6A 1OYRA 5K36D 4QNJA 4LOMA 4DPUA 4M1KA 2E5LI 1H74A 2HKEA 3M6AA 2AJ4A 1E3HA 4LCGA 4USKA 1N33E 2IERA 3CWVA 1R6MA 4FW9A 4UTGA 4LFBI 1Z0EA 4UT4A 4AM3A 2PO2B 3B4TA 2R42A 1XXEA 2DEJA 4IZKA 4JI5E 1N36I 4JI7I 4DR4I 1J5EE 4P7AA 3T1YE 2GO4A 5DNLA 1A6FA 4MU0A 1HR0E 1FJGE 1ZXNA 4I3HA 4GQUA 4DUZI 4DV3E 4PRXA 4B3TI 4DUYI 1H72C 1EA6A 1YH8A 4JI2I 3Q1QA 3ZM7A 4OX9I 4DR5I 4JYAI 1ZM9A 2HK3A 3T1HE 1VI7A 4LF4I 4LPFA 4IFDD 1HNZI 2JE6A 2PO1A 3U1KA 1N34E 1N0UA 4BA2A 1MU5A 4OO1E 4JI4I 2CG9A 2UXDE 2LJPA 1XNRE 1U2RA 1ZM3A 3ZKBA 2PO0A 4DUYE 4LFCI 4LF5E 5K36E 2UUCE 5BR8E 1NHJA 4J3DA 2C37A 4FN5A 4LFAI 4EMDA 2E1RA 2Z5BA 1UDQA 2CZ9A 4IS9A 1IBMI 5C0XB 1PKPA 4DPTA 1Z0TA 4IZJB 2PNZA 3U1YA 4FWHA 1N0VC 4YY3E 1WUUA 4BA1A 1XMOE 4B3SI 2F4VE 4DXLA 1FJGI 2X7IA 2BV3A 1HNWE 3CDJA 3GCMA 2JEAA 4URLA 4HACA 5DRPA 3P3CA 4DPWA 3P3EA 4B3RE 2UXCI 4GKJE 4DU8A 1XHKA 1HK7A 4MQYA 4K0KI 1FKAE 4IFDE 3OTOI 1NZ0A 2UXBE 1RREA 3QT6A 2WNRA 2JEBB 3ZZUA 4LF8E 4X62E 3ZZ0A 1XNQI 1FWLA 1PVGA 1Z0CA 1Y60A 4FW7A 4DU7A 4KHPI 4LF7E 1EI1A 4DV5E 3P76A 4OO1A 2GQ0A 1OYPA 5ELWA 1N32E 4AIMA 4AIDA 1Z5AA 1E3PA 5JEAC 5K36A 1YHCA 4MU1A 4GKKI 4JV5I 4YY3I 1I94E 5GMDA 5GMEA 1FWKA 2EFGA 2F4VI 4X66E 2CGEA 4FW6A 4DV1I 2HKJA 4LF9E 2UUBE 1IBKI 4DR7E 1UDSA 2VQEI 1HNXE 4KQVA 1DARA 4DV4I 4JI6I 1Z0BA 4DPYA 1Z5BA 2AE8A 4MYUA 2X36A 2V2ZA 1Y4UA 4B3ME 5DNXA 4WUBA 5LMNE 2BM1A 4ISAA 5LL6R 2HFSA 2O3ZA 1XMQI 2UU9E 2HHHE 3B8HA 2UUAI 1Y4SA 3H4LA 3NZKA 4Z7CA 2NN6C 2WP8A 2PO0B 4JI1E 3L7ZB 4IFDA 4DR6E 2HK2A 5JEAB 2VQFI 3DD6A 1K47A 3QT8A 5C0XE 1VISA 2BM0A 4MDTA 3HJCA 3M7NG 1USUA 1ELOA 5FWKA 2V34A 4AQYE 2O1UA 1P42A 1Y6ZA 4OO1C 1ZXMA 4NXNI 2C38B 2J65A 2PNMA 2V8PA 4X64E 2ZM6E 5K36C 1Z0VA 5A2QC 2C39B 3PS2A 4FW3A 1Y5YA 4PRVA 4DV2E 2IOQA 1N33I 2Z5EA 1B62A 3ZZTA 1HNXI 3HKMA 5IWAE 4LFBE 2XEXA 1RR9A 1Z5CA 3V5RA 4NXME 3J7AG 4JI5I 2PNLA 5A2QQ 2NN6B 4USMA 2O1VA 4LF6E 4PU9A 4MYTA 1J5EI 4JI8E 1R6LA 3T1YI 1KIJA 1OJ4A 3HULA 5JEAF 1Z0GA 1HR0I 2BA0G 2R3VA 4DV0E 4DV3I 3LTOA 1IBLE 2V2QA 4ZVIA 1PIEA 4DR6I 1OYSA 4HXZA 3T1HI 4OO1B 4DR3E 3V2UC 4IFDC 2E5LE 1N34I 2O1WA 3P06A 5K36B 2Z5CB 5EKWA 2UXDI 2ZITA 1XNRI 5DRRA 3GMEA 4LCHA 3JAMC 4JI3E 2NPFA 3Q6NA 5FLXC 4DR2E 5C0XA 4LF5I
chains in the Genus database with same CATH topology
3M85D 1UDSA 3M7ND 5JEAD 5C0XD 2NN6F 4IFDD 2JE6A 2PO1A 3U1KA 2C38A 4BA2A 4OO1E 2BA0D 2BA1G 1UDOA 2PO0A 1UDNA 5K36E 2C39A 2NN6C 2WP8A 2PO0B 2C37A 3L7ZB 4IFDA 4OO1F 1UDQA 5JEAB 5JEAE 3DD6A 5C0XB 5C0XE 2JEBA 4IFDB 2NN6A 5K36F 3M7NG 2PNZA 4BA1A 2NN6D 2JE6B 4OO1C 2PO1B 2BR2A 2C38B 4BA2B 5C0XF 3CDJA 3GCMA 2JEAA 5K36C 2BR2B 2C39B 3CDIA 2BA1D 2WP8B 2C37B 3HKMA 4IFDE 4OO1D 3M85G 5C0XC 3KRNA 1OYRA 2WNRA 2JEBB 3H1CA 2NN6B 2NN6E 5K36D 1R6LA 2PNZB 5JEAF 4BA1B 2BA0G 4IFDF 2PO2A 1E3HA 1R6MA 4OO1A 2JEAB 4AM3A 1OYPA 2PO2B 3B4TA 1OYSA 4AIMA 4AIDA 4OO1B 1E3PA 5JEAC 5K36A 4IFDC 4NBQA 3L7ZA 5K36B 3GMEA 5JEAA 3GLLA 2WNRB 5C0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M85 D;  1UDS A;  3M7N D;  5JEA D;  5C0X D;  2NN6 F;  4IFD D;  2JE6 A;  2PO1 A;  3U1K A;  2C38 A;  4BA2 A;  4OO1 E;  2BA0 D;  2BA1 G;  1UDO A;  2PO0 A;  1UDN A;  5K36 E;  2C39 A;  2NN6 C;  2WP8 A;  2PO0 B;  2C37 A;  3L7Z B;  4IFD A;  4OO1 F;  1UDQ A;  5JEA B;  5JEA E;  3DD6 A;  5C0X B;  5C0X E;  2JEB A;  4IFD B;  2NN6 A;  5K36 F;  3M7N G;  2PNZ A;  4BA1 A;  2NN6 D;  2JE6 B;  4OO1 C;  2PO1 B;  2BR2 A;  2C38 B;  4BA2 B;  5C0X F;  3CDJ A;  3GCM A;  2JEA A;  5K36 C;  2BR2 B;  2C39 B;  3CDI A;  2BA1 D;  2WP8 B;  2C37 B;  3HKM A;  4IFD E;  4OO1 D;  3M85 G;  5C0X C;  3KRN A;  1OYR A;  2WNR A;  2JEB B;  3H1C A;  2NN6 B;  2NN6 E;  5K36 D;  1R6L A;  2PNZ B;  5JEA F;  4BA1 B;  2BA0 G;  4IFD F;  2PO2 A;  1E3H A;  1R6M A;  4OO1 A;  2JEA B;  4AM3 A;  1OYP A;  2PO2 B;  3B4T A;  1OYS A;  4AIM A;  4AID A;  4OO1 B;  1E3P A;  5JEA C;  5K36 A;  4IFD C;  4NBQ A;  3L7Z A;  5K36 B;  3GME A;  5JEA A;  3GLL A;  2WNR B;  5C0X A; 
#chains in the Genus database with same CATH topology
 1Z0W A;  2UUC I;  5BR8 I;  3WU3 A;  4IZJ A;  1N36 E;  5IT9 C;  4X65 E;  4DR4 E;  5C0X D;  2NN6 F;  4R1F A;  3K85 A;  4IZJ D;  4YHH E;  3JAM Q;  2IES A;  2GS8 A;  4DUZ E;  2BA0 D;  4ED4 A;  5FLX Q;  4JG4 A;  4B3T E;  5LMU E;  4JI2 E;  4IZK B;  3WU4 A;  3UHM A;  1UDN A;  5IT9 Q;  1XMO I;  4DR5 E;  4JYA E;  4U3B A;  4LF4 E;  4OO1 F;  3PYG A;  1HNW I;  1HNZ E;  4U3D A;  5JEA E;  4FW4 A;  1IBL I;  4JI4 E;  2JEB A;  3K1J A;  4IFD B;  5K36 F;  4WUC A;  4P52 A;  2O1T A;  3PYD A;  4GKJ I;  4DR1 E;  4B3R I;  4RPF A;  5L3J A;  4JI0 E;  4LFC E;  3PYE A;  1FI4 A;  3PS3 A;  3WU5 A;  2JE6 B;  4OZE A;  2PO1 B;  2CVE A;  2BR2 A;  4DR3 I;  2UXB I;  4BA2 B;  4LFA E;  1H7S A;  4MU4 A;  4LF8 I;  1KVK A;  4X62 I;  1IBM E;  4QNK A;  4JI3 I;  4DR2 I;  3CDI A;  2VES A;  3K17 A;  4N3O A;  3QT7 A;  1ZM4 A;  4LF7 I;  1H7U A;  2C37 B;  4LCF A;  4DV5 I;  2F1D A;  2GO3 A;  4B3S E;  1QZR A;  4X65 I;  1RHY A;  2JT2 A;  2Z5B B;  3M85 G;  5C0X C;  3KRN A;  4FWG A;  1N32 I;  4YHH I;  2Q2E B;  3H1C A;  2NN6 E;  2A2D A;  1UEK A;  1ZM2 A;  5LMU I;  2PNZ B;  1S16 A;  2HFU A;  4BA1 B;  2V2V A;  2UXC E;  4IFD F;  1I94 I;  1NHI A;  2PO2 A;  3J81 C;  4K0K E;  5EL9 A;  2OI2 A;  3OTO E;  4X66 I;  2JEA B;  1B63 A;  3F0N A;  3P3G A;  4HAC B;  4LF9 I;  2UUB I;  4DR7 I;  1D6T A;  3PYF A;  4DR1 I;  1XNQ E;  5DRO A;  3J81 Q;  1NHH A;  4DV6 E;  4JI0 I;  4NBQ A;  2DEI A;  4DV7 E;  3L7Z A;  4KHP E;  4B3M I;  5LMN I;  5JEA A;  3GLL A;  2WNR B;  2UU9 I;  3D4J A;  2HHH I;  1MG7 A;  2ZBK B;  3M85 D;  3J80 C;  3M7N D;  1H73 A;  5JEA D;  4JI1 I;  2WW4 A;  3PS1 A;  3PRY A;  1KTV A;  4GKK E;  2C38 A;  3LPS A;  4JV5 E;  1Z59 A;  4WUD A;  3QT5 A;  4OKG A;  2BA1 G;  1UDO A;  1USV A;  3J80 Q;  1FNM A;  4XTJ A;  3J7A M;  2C39 A;  1S4E A;  4DV1 E;  4AQY I;  3B78 A;  3ZKD A;  1IBK E;  3LNU A;  2VQE E;  1BKN A;  4X64 I;  4DV4 E;  2ZM6 I;  4JI6 E;  4HYM A;  4JI7 E;  2NN6 A;  4FW5 A;  5DRQ A;  3GON A;  1XMQ E;  2J7K A;  4DV2 I;  2UUA E;  5IWA I;  2NN6 D;  4FWD A;  4HY1 A;  3Q6M A;  4NXM I;  4DV6 I;  4OX9 E;  4DV7 I;  5C0X F;  3B82 A;  4LF6 I;  2VQF E;  4JI8 I;  4DPX A;  2BR2 B;  2VF3 A;  2BA1 D;  2WP8 B;  4DV0 I;  1MX0 A;  2A2C A;  2Z5C A;  4OO1 D;  1KKH A;  4MU3 A;  2IOP A;  4NXN E;  4Z7Y A;  3WU6 A;  1OYR A;  5K36 D;  4QNJ A;  4LOM A;  4DPU A;  4M1K A;  2E5L I;  1H74 A;  2HKE A;  3M6A A;  2AJ4 A;  1E3H A;  4LCG A;  4USK A;  1N33 E;  2IER A;  3CWV A;  1R6M A;  4FW9 A;  4UTG A;  4LFB I;  1Z0E A;  4UT4 A;  4AM3 A;  2PO2 B;  3B4T A;  2R42 A;  1XXE A;  2DEJ A;  4IZK A;  4JI5 E;  1N36 I;  4JI7 I;  4DR4 I;  1J5E E;  4P7A A;  3T1Y E;  2GO4 A;  5DNL A;  1A6F A;  4MU0 A;  1HR0 E;  1FJG E;  1ZXN A;  4I3H A;  4GQU A;  4DUZ I;  4DV3 E;  4PRX A;  4B3T I;  4DUY I;  1H72 C;  1EA6 A;  1YH8 A;  4JI2 I;  3Q1Q A;  3ZM7 A;  4OX9 I;  4DR5 I;  4JYA I;  1ZM9 A;  2HK3 A;  3T1H E;  1VI7 A;  4LF4 I;  4LPF A;  4IFD D;  1HNZ I;  2JE6 A;  2PO1 A;  3U1K A;  1N34 E;  1N0U A;  4BA2 A;  1MU5 A;  4OO1 E;  4JI4 I;  2CG9 A;  2UXD E;  2LJP A;  1XNR E;  1U2R A;  1ZM3 A;  3ZKB A;  2PO0 A;  4DUY E;  4LFC I;  4LF5 E;  5K36 E;  2UUC E;  5BR8 E;  1NHJ A;  4J3D A;  2C37 A;  4FN5 A;  4LFA I;  4EMD A;  2E1R A;  2Z5B A;  1UDQ A;  2CZ9 A;  4IS9 A;  1IBM I;  5C0X B;  1PKP A;  4DPT A;  1Z0T A;  4IZJ B;  2PNZ A;  3U1Y A;  4FWH A;  1N0V C;  4YY3 E;  1WUU A;  4BA1 A;  1XMO E;  4B3S I;  2F4V E;  4DXL A;  1FJG I;  2X7I A;  2BV3 A;  1HNW E;  3CDJ A;  3GCM A;  2JEA A;  4URL A;  4HAC A;  5DRP A;  3P3C A;  4DPW A;  3P3E A;  4B3R E;  2UXC I;  4GKJ E;  4DU8 A;  1XHK A;  1HK7 A;  4MQY A;  4K0K I;  1FKA E;  4IFD E;  3OTO I;  1NZ0 A;  2UXB E;  1RRE A;  3QT6 A;  2WNR A;  2JEB B;  3ZZU A;  4LF8 E;  4X62 E;  3ZZ0 A;  1XNQ I;  1FWL A;  1PVG A;  1Z0C A;  1Y60 A;  4FW7 A;  4DU7 A;  4KHP I;  4LF7 E;  1EI1 A;  4DV5 E;  3P76 A;  4OO1 A;  2GQ0 A;  1OYP A;  5ELW A;  1N32 E;  4AIM A;  4AID A;  1Z5A A;  1E3P A;  5JEA C;  5K36 A;  1YHC A;  4MU1 A;  4GKK I;  4JV5 I;  4YY3 I;  1I94 E;  5GMD A;  5GME A;  1FWK A;  2EFG A;  2F4V I;  4X66 E;  2CGE A;  4FW6 A;  4DV1 I;  2HKJ A;  4LF9 E;  2UUB E;  1IBK I;  4DR7 E;  1UDS A;  2VQE I;  1HNX E;  4KQV A;  1DAR A;  4DV4 I;  4JI6 I;  1Z0B A;  4DPY A;  1Z5B A;  2AE8 A;  4MYU A;  2X36 A;  2V2Z A;  1Y4U A;  4B3M E;  5DNX A;  4WUB A;  5LMN E;  2BM1 A;  4ISA A;  5LL6 R;  2HFS A;  2O3Z A;  1XMQ I;  2UU9 E;  2HHH E;  3B8H A;  2UUA I;  1Y4S A;  3H4L A;  3NZK A;  4Z7C A;  2NN6 C;  2WP8 A;  2PO0 B;  4JI1 E;  3L7Z B;  4IFD A;  4DR6 E;  2HK2 A;  5JEA B;  2VQF I;  3DD6 A;  1K47 A;  3QT8 A;  5C0X E;  1VIS A;  2BM0 A;  4MDT A;  3HJC A;  3M7N G;  1USU A;  1ELO A;  5FWK A;  2V34 A;  4AQY E;  2O1U A;  1P42 A;  1Y6Z A;  4OO1 C;  1ZXM A;  4NXN I;  2C38 B;  2J65 A;  2PNM A;  2V8P A;  4X64 E;  2ZM6 E;  5K36 C;  1Z0V A;  5A2Q C;  2C39 B;  3PS2 A;  4FW3 A;  1Y5Y A;  4PRV A;  4DV2 E;  2IOQ A;  1N33 I;  2Z5E A;  1B62 A;  3ZZT A;  1HNX I;  3HKM A;  5IWA E;  4LFB E;  2XEX A;  1RR9 A;  1Z5C A;  3V5R A;  4NXM E;  3J7A G;  4JI5 I;  2PNL A;  5A2Q Q;  2NN6 B;  4USM A;  2O1V A;  4LF6 E;  4PU9 A;  4MYT A;  1J5E I;  4JI8 E;  1R6L A;  3T1Y I;  1KIJ A;  1OJ4 A;  3HUL A;  5JEA F;  1Z0G A;  1HR0 I;  2BA0 G;  2R3V A;  4DV0 E;  4DV3 I;  3LTO A;  1IBL E;  2V2Q A;  4ZVI A;  1PIE A;  4DR6 I;  1OYS A;  4HXZ A;  3T1H I;  4OO1 B;  4DR3 E;  3V2U C;  4IFD C;  2E5L E;  1N34 I;  2O1W A;  3P06 A;  5K36 B;  2Z5C B;  5EKW A;  2UXD I;  2ZIT A;  1XNR I;  5DRR A;  3GME A;  4LCH A;  3JAM C;  4JI3 E;  2NPF A;  3Q6N A;  5FLX C;  4DR2 E;  5C0X A;  4LF5 I; 
#chains in the Genus database with same CATH homology
 3M85 D;  1UDS A;  3M7N D;  5JEA D;  5C0X D;  2NN6 F;  4IFD D;  2JE6 A;  2PO1 A;  3U1K A;  2C38 A;  4BA2 A;  4OO1 E;  2BA0 D;  2BA1 G;  1UDO A;  2PO0 A;  1UDN A;  5K36 E;  2C39 A;  2NN6 C;  2WP8 A;  2PO0 B;  2C37 A;  3L7Z B;  4IFD A;  4OO1 F;  1UDQ A;  5JEA B;  5JEA E;  3DD6 A;  5C0X B;  5C0X E;  2JEB A;  4IFD B;  2NN6 A;  5K36 F;  3M7N G;  2PNZ A;  4BA1 A;  2NN6 D;  2JE6 B;  4OO1 C;  2PO1 B;  2BR2 A;  2C38 B;  4BA2 B;  5C0X F;  3CDJ A;  3GCM A;  2JEA A;  5K36 C;  2BR2 B;  2C39 B;  3CDI A;  2BA1 D;  2WP8 B;  2C37 B;  3HKM A;  4IFD E;  4OO1 D;  3M85 G;  5C0X C;  3KRN A;  1OYR A;  2WNR A;  2JEB B;  3H1C A;  2NN6 B;  2NN6 E;  5K36 D;  1R6L A;  2PNZ B;  5JEA F;  4BA1 B;  2BA0 G;  4IFD F;  2PO2 A;  1E3H A;  1R6M A;  4OO1 A;  2JEA B;  4AM3 A;  1OYP A;  2PO2 B;  3B4T A;  1OYS A;  4AIM A;  4AID A;  4OO1 B;  1E3P A;  5JEA C;  5K36 A;  4IFD C;  4NBQ A;  3L7Z A;  5K36 B;  3GME A;  5JEA A;  3GLL A;  2WNR B;  5C0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...