4IFDF

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
213
Chain Sequence
b'QDRRRLLGPAAAKPMAFSNSEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 60
structure length 213
sequence length 245
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdF00
1OYSA 2BR2B 5K36D 2BA1D 4IFDA 1UDSA 4IFDB 5C0XC 3H1CA 4BA1A 2C37B 4BA2B 4BA1B 4IFDF 5K36C 2BA0D 5C0XA 2JEAB 2NN6C 3M85D 5C0XD 2JE6B 2WNRB 3U1KA 5C0XE 3L7ZA 5K36A 3L7ZB 3CDIA 1OYPA 4OO1C 1E3HA 3M7NG 5K36E 4AIMA 2PO1A 5JEAC 2NN6D 2WP8A 2NN6E 5K36F 2WP8B 3M7ND 4OO1D 4OO1E 3GLLA 5JEAD 3B4TA 2C39A 5JEAE 2JEBA 1UDNA 5C0XB 2C39B 2C38A 5C0XF 2PO0A 2NN6A 5K36B 3GCMA 2NN6B 1UDQA 3DD6A 2PO1B 1R6LA 2NN6F 4OO1A 3GMEA 4IFDC 5JEAA 4OO1B 1E3PA 2BR2A 5JEAB 2PNZA 4OO1F 4AM3A 2JEBB 2BA0G 5JEAF 3HKMA 2PNZB 3CDJA 4AIDA 4IFDD 2C37A 2C38B 4BA2A 4IFDE 1UDOA 1R6MA 3M85G 2PO0B 2JEAA 1OYRA 2WNRA 2BA1G 2JE6A 3KRNA 2PO2A 2PO2B 4NBQA
chains in the Genus database with same CATH superfamily
3J7AG 5A2QC 2DEIA 4B3ME 1DARA 2DEJA 1PKPA 3T1HI 4USMA 2BA1D 1HNZI 1IBME 4NXME 4IFDB 4LF7I 1PIEA 3H1CA 4AQYI 3B78A 1IBKE 2HFUA 2PNLA 2UXCE 5GMDA 3V2UC 4DV5E 2UUCE 4DV1I 5C0XA 2JEAB 4UTGA 1B62A 3T1YE 2NN6C 4DU8A 3OTOE 1IBLI 4DR4E 4IZJD 4DR2E 3ZM7A 5C0XE 4DR6I 3L7ZA 2VQEI 4DR1E 4DR5I 1Z0WA 4OZEA 2IERA 3PYEA 2F1DA 2CVEA 4LFCI 3ZZUA 4AIMA 2O1TA 1HNWE 3Q6NA 5JEAC 1HR0E 4LFAI 4LFBI 4DV0I 4NXNE 4JYAE 1N33I 2IOPA 2WP8B 2NPFA 4X66I 1FWLA 5DNXA 3T1HE 1VI7A 4OO1E 1KKHA 3B4TA 2C39A 5A2QQ 4M1KA 4DPWA 3K17A 1UDNA 4LF9I 4AQYE 2C38A 4JI1I 2PO0A 4B3TI 2PNMA 2V34A 3GCMA 3WU5A 1N0VC 1UDQA 3JAMC 1IBLE 4JI7E 3CWVA 1NHHA 4DR6E 4JI2I 2VQEE 2NN6F 4DR5E 1Z5AA 4IFDC 5L3JA 2V8PA 4U3BA 4Z7CA 3V5RA 1NHIA 1E3PA 1H73A 4LFCE 1Y4UA 1H7SA 5DNLA 4DV3I 3F0NA 2HKEA 4LFAE 2PNZA 2V2ZA 4GKKI 4LFBE 2Z5EA 1XHKA 5EKWA 4GKJI 4N3OA 5JEAF 3CDJA 4DR7E 2C37A 4X65I 4MQYA 1UDOA 1FJGI 4B3MI 1N32I 2UXBI 4PRVA 2GO4A 3M6AA 4HACA 2ZBKB 3Q6MA 4U3DA 4JI1E 2AE8A 5LMUI 4B3TE 1J5EI 3J7AM 4NBQA 1IBKI 2X7IA 1OYSA 4JI0E 2UUAI 1XNRI 2BR2B 4RPFA 1B63A 4OKGA 2UXDE 3T1YI 3OTOI 1Y60A 4DR2I 4WUCA 3WU3A 3JAMQ 4FW5A 3D4JA 4BA1A 4DR1I 1KTVA 4LF5I 4MU1A 4JI5I 4IFDF 4P52A 4DV3E 1I94I 4GKKE 5BR8I 2BA0D 1S16A 4LCFA 1Z0TA 4GKJE 1ZXNA 1Z59A 4DUYI 1YHCA 2VESA 2UU9E 3M85D 5C0XD 4DPXA 4X65E 2E1RA 4ZVIA 1N32E 2UXBE 3L7ZB 1OJ4A 1Z0CA 1Z0GA 4MU0A 2NN6E 1RHYA 5LMNI 5K36F 5LMUE 1J5EE 2Z5CB 4JI6I 4MDTA 3K85A 5FWKA 2GO3A 4WUDA 2UUAE 3WU6A 4UT4A 1XNRE 4OO1D 3P06A 3P3CA 3QT8A 3HJCA 3B82A 1KVKA 4LPFA 4JI7I 2JEBA 5JEAE 4IZJB 5EL9A 2Z5BB 1NHJA 2C39B 1H7UA 4LF5E 1VISA 4JI5E 1BKNA 1I94E 3PS2A 5BR8E 5K36B 4HXZA 3ZKDA 4DUYE 1MU5A 2PO1B 4IZKB 3PYGA 1XMQI 4DR7I 1R6LA 4OO1A 4JI3E 3PYDA 1FWKA 1Z5CA 1MG7A 1FKAE 4JI4I 2VQFE 4QNKA 4DV4I 4AM3A 5LMNE 4MYTA 4JI6E 3P76A 2PNZB 4KHPE 1HNXE 1U2RA 4IFDE 2A2CA 4JI0I 2IESA 4DR3I 4FW6A 3J81Q 4YHHI 2JEAA 3PS3A 2UXDI 1OYRA 4X64I 3KRNA 1A6FA 1Z5BA 1NZ0A 2V2QA 2X36A 4DUZI 3ZKBA 3NZKA 4DV6E 1N34I 2CZ9A 4KQVA 1UDSA 1XMQE 2UU9I 1XXEA 1PVGA 1USUA 4JI4E 1ZM2A 4FN5A 4BA2B 2CGEA 4BA1B 4DV4E 2HHHE 5K36C 1XMOI 2BM1A 4FW7A 3HULA 2E5LI 3PRYA 2WNRB 2JE6B 3U1KA 4DPTA 3U1YA 1HK7A 2J65A 4DR3E 2ZM6I 4YHHE 3CDIA 1ELOA 4X62E 4X64E 4LF8I 3M7NG 2ZITA 3QT6A 2NN6D 3WU4A 5IT9Q 4DUZE 4ISAA 1KIJA 2F4VI 1N36I 4MU4A 1XNQE 2GQ0A 2VF3A 1FI4A 1N34E 5JEAD 5DROA 2LJPA 3K1JA 4K0KI 5C0XB 1WUUA 4MYUA 3ZZ0A 4MU3A 2WW4A 4JI3I 4FWGA 4DV2I 2GS8A 4FW4A 2NN6A 4EMDA 1XMOE 2VQFI 5ELWA 2E5LE 4LCHA 4QNJA 3UHMA 3J81C 4KHPI 1YH8A 1HNXI 2ZM6E 5JEAA 4OO1B 4JV5I 4B3SI 4LF4I 3H4LA 2BR2A 4LF8E 2HKJA 2BA0G 4YY3I 4AIDA 2F4VE 4LOMA 4IFDD 1P42A 2C38B 1N36E 2A2DA 2O1WA 1R6MA 1Z0BA 3M85G 2PO0B 2O1UA 1H72C 1S4EA 4DV6I 1USVA 4K0KE 2AJ4A 4DV7I 2HK3A 5IWAI 2BA1G 3QT7A 4DU7A 2PO2A 1FNMA 4DV2E 2O3ZA 2J7KA 4JI8I 3P3EA 1N0UA 4DPYA 1H74A 2BM0A 1K47A 4LF6E 1ZM3A 2HHHI 3B8HA 5K36D 4IFDA 4B3RE 4USKA 4XTJA 4FWHA 2Z5CA 3LNUA 4R1FA 2UUBE 5C0XC 4I3HA 4FWDA 2BV3A 2O1VA 4B3SE 2C37B 5IT9C 4LF4E 4JV5E 4ED4A 5DRRA 4X62I 2JT2A 2R42A 1QZRA 4IZJA 1HNZE 2Z5BA 5FLXC 4YY3E 1Y6ZA 1EA6A 4HACB 2EFGA 4LF7E 5K36A 4P7AA 1XNQI 1OYPA 2HFSA 1RR9A 4OO1C 3PS1A 4DV7E 1E3HA 1RREA 3PYFA 1ZXMA 4Z7YA 2PO1A 5IWAE 5K36E 4IZKA 4DV1E 1ZM4A 2WP8A 4JI8E 1ZM9A 3J80C 4DXLA 3P3GA 4IS9A 2R3VA 5LL6R 2CG9A 3M7ND 2XEXA 5DRQA 3QT5A 4DV0E 1Z0VA 3GONA 1D6TA 1N33E 4OX9I 4X66E 5C0XF 4GQUA 4WUBA 4HYMA 1Z0EA 4URLA 5GMEA 2NN6B 3ZZTA 3DD6A 1Y5YA 4HY1A 4PU9A 4LF9E 1IBMI 5DRPA 4NXMI 3GMEA 1MX0A 5FLXQ 2OI2A 5JEAB 2UXCI 4OO1F 4DV5I 2UUCI 2JEBB 3Q1QA 4JI2E 3HKMA 2HK2A 4DR4I 4DPUA 1UEKA 2V2VA 4PRXA 4BA2A 4LF6I 3LTOA 3J80Q 4J3DA 4JG4A 4B3RI 1EI1A 2JE6A 2WNRA 1HNWI 1Y4SA 1HR0I 2Q2EB 2UUBI 2IOQA 4FW9A 4OX9E 4FW3A 4NXNI 4JYAI 2PO2B 3LPSA 3GLLA 4LCGA 1FJGE
chains in the Genus database with same CATH topology
1OYSA 2BR2B 5K36D 2BA1D 4IFDA 1UDSA 4IFDB 5C0XC 3H1CA 4BA1A 2C37B 4BA2B 4BA1B 4IFDF 5K36C 2BA0D 5C0XA 2JEAB 2NN6C 3M85D 5C0XD 2JE6B 2WNRB 3U1KA 5C0XE 3L7ZA 5K36A 3L7ZB 3CDIA 1OYPA 4OO1C 1E3HA 3M7NG 5K36E 4AIMA 2PO1A 5JEAC 2NN6D 2WP8A 2NN6E 5K36F 2WP8B 3M7ND 4OO1D 4OO1E 3GLLA 5JEAD 3B4TA 2C39A 5JEAE 2JEBA 1UDNA 5C0XB 2C39B 2C38A 5C0XF 2PO0A 2NN6A 5K36B 3GCMA 2NN6B 1UDQA 3DD6A 2PO1B 1R6LA 2NN6F 4OO1A 3GMEA 4IFDC 5JEAA 4OO1B 1E3PA 2BR2A 5JEAB 2PNZA 4OO1F 4AM3A 2JEBB 2BA0G 5JEAF 3HKMA 2PNZB 3CDJA 4AIDA 4IFDD 2C37A 2C38B 4BA2A 4IFDE 1UDOA 1R6MA 3M85G 2PO0B 2JEAA 1OYRA 2WNRA 2BA1G 2JE6A 3KRNA 2PO2A 2PO2B 4NBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYS A;  2BR2 B;  5K36 D;  2BA1 D;  4IFD A;  1UDS A;  4IFD B;  5C0X C;  3H1C A;  4BA1 A;  2C37 B;  4BA2 B;  4BA1 B;  4IFD F;  5K36 C;  2BA0 D;  5C0X A;  2JEA B;  2NN6 C;  3M85 D;  5C0X D;  2JE6 B;  2WNR B;  3U1K A;  5C0X E;  3L7Z A;  5K36 A;  3L7Z B;  3CDI A;  1OYP A;  4OO1 C;  1E3H A;  3M7N G;  5K36 E;  4AIM A;  2PO1 A;  5JEA C;  2NN6 D;  2WP8 A;  2NN6 E;  5K36 F;  2WP8 B;  3M7N D;  4OO1 D;  4OO1 E;  3GLL A;  5JEA D;  3B4T A;  2C39 A;  5JEA E;  2JEB A;  1UDN A;  5C0X B;  2C39 B;  2C38 A;  5C0X F;  2PO0 A;  2NN6 A;  5K36 B;  3GCM A;  2NN6 B;  1UDQ A;  3DD6 A;  2PO1 B;  1R6L A;  2NN6 F;  4OO1 A;  3GME A;  4IFD C;  5JEA A;  4OO1 B;  1E3P A;  2BR2 A;  5JEA B;  2PNZ A;  4OO1 F;  4AM3 A;  2JEB B;  2BA0 G;  5JEA F;  3HKM A;  2PNZ B;  3CDJ A;  4AID A;  4IFD D;  2C37 A;  2C38 B;  4BA2 A;  4IFD E;  1UDO A;  1R6M A;  3M85 G;  2PO0 B;  2JEA A;  1OYR A;  2WNR A;  2BA1 G;  2JE6 A;  3KRN A;  2PO2 A;  2PO2 B;  4NBQ A; 
#chains in the Genus database with same CATH topology
 3J7A G;  5A2Q C;  2DEI A;  4B3M E;  1DAR A;  2DEJ A;  1PKP A;  3T1H I;  4USM A;  2BA1 D;  1HNZ I;  1IBM E;  4NXM E;  4IFD B;  4LF7 I;  1PIE A;  3H1C A;  4AQY I;  3B78 A;  1IBK E;  2HFU A;  2PNL A;  2UXC E;  5GMD A;  3V2U C;  4DV5 E;  2UUC E;  4DV1 I;  5C0X A;  2JEA B;  4UTG A;  1B62 A;  3T1Y E;  2NN6 C;  4DU8 A;  3OTO E;  1IBL I;  4DR4 E;  4IZJ D;  4DR2 E;  3ZM7 A;  5C0X E;  4DR6 I;  3L7Z A;  2VQE I;  4DR1 E;  4DR5 I;  1Z0W A;  4OZE A;  2IER A;  3PYE A;  2F1D A;  2CVE A;  4LFC I;  3ZZU A;  4AIM A;  2O1T A;  1HNW E;  3Q6N A;  5JEA C;  1HR0 E;  4LFA I;  4LFB I;  4DV0 I;  4NXN E;  4JYA E;  1N33 I;  2IOP A;  2WP8 B;  2NPF A;  4X66 I;  1FWL A;  5DNX A;  3T1H E;  1VI7 A;  4OO1 E;  1KKH A;  3B4T A;  2C39 A;  5A2Q Q;  4M1K A;  4DPW A;  3K17 A;  1UDN A;  4LF9 I;  4AQY E;  2C38 A;  4JI1 I;  2PO0 A;  4B3T I;  2PNM A;  2V34 A;  3GCM A;  3WU5 A;  1N0V C;  1UDQ A;  3JAM C;  1IBL E;  4JI7 E;  3CWV A;  1NHH A;  4DR6 E;  4JI2 I;  2VQE E;  2NN6 F;  4DR5 E;  1Z5A A;  4IFD C;  5L3J A;  2V8P A;  4U3B A;  4Z7C A;  3V5R A;  1NHI A;  1E3P A;  1H73 A;  4LFC E;  1Y4U A;  1H7S A;  5DNL A;  4DV3 I;  3F0N A;  2HKE A;  4LFA E;  2PNZ A;  2V2Z A;  4GKK I;  4LFB E;  2Z5E A;  1XHK A;  5EKW A;  4GKJ I;  4N3O A;  5JEA F;  3CDJ A;  4DR7 E;  2C37 A;  4X65 I;  4MQY A;  1UDO A;  1FJG I;  4B3M I;  1N32 I;  2UXB I;  4PRV A;  2GO4 A;  3M6A A;  4HAC A;  2ZBK B;  3Q6M A;  4U3D A;  4JI1 E;  2AE8 A;  5LMU I;  4B3T E;  1J5E I;  3J7A M;  4NBQ A;  1IBK I;  2X7I A;  1OYS A;  4JI0 E;  2UUA I;  1XNR I;  2BR2 B;  4RPF A;  1B63 A;  4OKG A;  2UXD E;  3T1Y I;  3OTO I;  1Y60 A;  4DR2 I;  4WUC A;  3WU3 A;  3JAM Q;  4FW5 A;  3D4J A;  4BA1 A;  4DR1 I;  1KTV A;  4LF5 I;  4MU1 A;  4JI5 I;  4IFD F;  4P52 A;  4DV3 E;  1I94 I;  4GKK E;  5BR8 I;  2BA0 D;  1S16 A;  4LCF A;  1Z0T A;  4GKJ E;  1ZXN A;  1Z59 A;  4DUY I;  1YHC A;  2VES A;  2UU9 E;  3M85 D;  5C0X D;  4DPX A;  4X65 E;  2E1R A;  4ZVI A;  1N32 E;  2UXB E;  3L7Z B;  1OJ4 A;  1Z0C A;  1Z0G A;  4MU0 A;  2NN6 E;  1RHY A;  5LMN I;  5K36 F;  5LMU E;  1J5E E;  2Z5C B;  4JI6 I;  4MDT A;  3K85 A;  5FWK A;  2GO3 A;  4WUD A;  2UUA E;  3WU6 A;  4UT4 A;  1XNR E;  4OO1 D;  3P06 A;  3P3C A;  3QT8 A;  3HJC A;  3B82 A;  1KVK A;  4LPF A;  4JI7 I;  2JEB A;  5JEA E;  4IZJ B;  5EL9 A;  2Z5B B;  1NHJ A;  2C39 B;  1H7U A;  4LF5 E;  1VIS A;  4JI5 E;  1BKN A;  1I94 E;  3PS2 A;  5BR8 E;  5K36 B;  4HXZ A;  3ZKD A;  4DUY E;  1MU5 A;  2PO1 B;  4IZK B;  3PYG A;  1XMQ I;  4DR7 I;  1R6L A;  4OO1 A;  4JI3 E;  3PYD A;  1FWK A;  1Z5C A;  1MG7 A;  1FKA E;  4JI4 I;  2VQF E;  4QNK A;  4DV4 I;  4AM3 A;  5LMN E;  4MYT A;  4JI6 E;  3P76 A;  2PNZ B;  4KHP E;  1HNX E;  1U2R A;  4IFD E;  2A2C A;  4JI0 I;  2IES A;  4DR3 I;  4FW6 A;  3J81 Q;  4YHH I;  2JEA A;  3PS3 A;  2UXD I;  1OYR A;  4X64 I;  3KRN A;  1A6F A;  1Z5B A;  1NZ0 A;  2V2Q A;  2X36 A;  4DUZ I;  3ZKB A;  3NZK A;  4DV6 E;  1N34 I;  2CZ9 A;  4KQV A;  1UDS A;  1XMQ E;  2UU9 I;  1XXE A;  1PVG A;  1USU A;  4JI4 E;  1ZM2 A;  4FN5 A;  4BA2 B;  2CGE A;  4BA1 B;  4DV4 E;  2HHH E;  5K36 C;  1XMO I;  2BM1 A;  4FW7 A;  3HUL A;  2E5L I;  3PRY A;  2WNR B;  2JE6 B;  3U1K A;  4DPT A;  3U1Y A;  1HK7 A;  2J65 A;  4DR3 E;  2ZM6 I;  4YHH E;  3CDI A;  1ELO A;  4X62 E;  4X64 E;  4LF8 I;  3M7N G;  2ZIT A;  3QT6 A;  2NN6 D;  3WU4 A;  5IT9 Q;  4DUZ E;  4ISA A;  1KIJ A;  2F4V I;  1N36 I;  4MU4 A;  1XNQ E;  2GQ0 A;  2VF3 A;  1FI4 A;  1N34 E;  5JEA D;  5DRO A;  2LJP A;  3K1J A;  4K0K I;  5C0X B;  1WUU A;  4MYU A;  3ZZ0 A;  4MU3 A;  2WW4 A;  4JI3 I;  4FWG A;  4DV2 I;  2GS8 A;  4FW4 A;  2NN6 A;  4EMD A;  1XMO E;  2VQF I;  5ELW A;  2E5L E;  4LCH A;  4QNJ A;  3UHM A;  3J81 C;  4KHP I;  1YH8 A;  1HNX I;  2ZM6 E;  5JEA A;  4OO1 B;  4JV5 I;  4B3S I;  4LF4 I;  3H4L A;  2BR2 A;  4LF8 E;  2HKJ A;  2BA0 G;  4YY3 I;  4AID A;  2F4V E;  4LOM A;  4IFD D;  1P42 A;  2C38 B;  1N36 E;  2A2D A;  2O1W A;  1R6M A;  1Z0B A;  3M85 G;  2PO0 B;  2O1U A;  1H72 C;  1S4E A;  4DV6 I;  1USV A;  4K0K E;  2AJ4 A;  4DV7 I;  2HK3 A;  5IWA I;  2BA1 G;  3QT7 A;  4DU7 A;  2PO2 A;  1FNM A;  4DV2 E;  2O3Z A;  2J7K A;  4JI8 I;  3P3E A;  1N0U A;  4DPY A;  1H74 A;  2BM0 A;  1K47 A;  4LF6 E;  1ZM3 A;  2HHH I;  3B8H A;  5K36 D;  4IFD A;  4B3R E;  4USK A;  4XTJ A;  4FWH A;  2Z5C A;  3LNU A;  4R1F A;  2UUB E;  5C0X C;  4I3H A;  4FWD A;  2BV3 A;  2O1V A;  4B3S E;  2C37 B;  5IT9 C;  4LF4 E;  4JV5 E;  4ED4 A;  5DRR A;  4X62 I;  2JT2 A;  2R42 A;  1QZR A;  4IZJ A;  1HNZ E;  2Z5B A;  5FLX C;  4YY3 E;  1Y6Z A;  1EA6 A;  4HAC B;  2EFG A;  4LF7 E;  5K36 A;  4P7A A;  1XNQ I;  1OYP A;  2HFS A;  1RR9 A;  4OO1 C;  3PS1 A;  4DV7 E;  1E3H A;  1RRE A;  3PYF A;  1ZXM A;  4Z7Y A;  2PO1 A;  5IWA E;  5K36 E;  4IZK A;  4DV1 E;  1ZM4 A;  2WP8 A;  4JI8 E;  1ZM9 A;  3J80 C;  4DXL A;  3P3G A;  4IS9 A;  2R3V A;  5LL6 R;  2CG9 A;  3M7N D;  2XEX A;  5DRQ A;  3QT5 A;  4DV0 E;  1Z0V A;  3GON A;  1D6T A;  1N33 E;  4OX9 I;  4X66 E;  5C0X F;  4GQU A;  4WUB A;  4HYM A;  1Z0E A;  4URL A;  5GME A;  2NN6 B;  3ZZT A;  3DD6 A;  1Y5Y A;  4HY1 A;  4PU9 A;  4LF9 E;  1IBM I;  5DRP A;  4NXM I;  3GME A;  1MX0 A;  5FLX Q;  2OI2 A;  5JEA B;  2UXC I;  4OO1 F;  4DV5 I;  2UUC I;  2JEB B;  3Q1Q A;  4JI2 E;  3HKM A;  2HK2 A;  4DR4 I;  4DPU A;  1UEK A;  2V2V A;  4PRX A;  4BA2 A;  4LF6 I;  3LTO A;  3J80 Q;  4J3D A;  4JG4 A;  4B3R I;  1EI1 A;  2JE6 A;  2WNR A;  1HNW I;  1Y4S A;  1HR0 I;  2Q2E B;  2UUB I;  2IOQ A;  4FW9 A;  4OX9 E;  4FW3 A;  4NXN I;  4JYA I;  2PO2 B;  3LPS A;  3GLL A;  4LCG A;  1FJG E; 
#chains in the Genus database with same CATH homology
 1OYS A;  2BR2 B;  5K36 D;  2BA1 D;  4IFD A;  1UDS A;  4IFD B;  5C0X C;  3H1C A;  4BA1 A;  2C37 B;  4BA2 B;  4BA1 B;  4IFD F;  5K36 C;  2BA0 D;  5C0X A;  2JEA B;  2NN6 C;  3M85 D;  5C0X D;  2JE6 B;  2WNR B;  3U1K A;  5C0X E;  3L7Z A;  5K36 A;  3L7Z B;  3CDI A;  1OYP A;  4OO1 C;  1E3H A;  3M7N G;  5K36 E;  4AIM A;  2PO1 A;  5JEA C;  2NN6 D;  2WP8 A;  2NN6 E;  5K36 F;  2WP8 B;  3M7N D;  4OO1 D;  4OO1 E;  3GLL A;  5JEA D;  3B4T A;  2C39 A;  5JEA E;  2JEB A;  1UDN A;  5C0X B;  2C39 B;  2C38 A;  5C0X F;  2PO0 A;  2NN6 A;  5K36 B;  3GCM A;  2NN6 B;  1UDQ A;  3DD6 A;  2PO1 B;  1R6L A;  2NN6 F;  4OO1 A;  3GME A;  4IFD C;  5JEA A;  4OO1 B;  1E3P A;  2BR2 A;  5JEA B;  2PNZ A;  4OO1 F;  4AM3 A;  2JEB B;  2BA0 G;  5JEA F;  3HKM A;  2PNZ B;  3CDJ A;  4AID A;  4IFD D;  2C37 A;  2C38 B;  4BA2 A;  4IFD E;  1UDO A;  1R6M A;  3M85 G;  2PO0 B;  2JEA A;  1OYR A;  2WNR A;  2BA1 G;  2JE6 A;  3KRN A;  2PO2 A;  2PO2 B;  4NBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...