4IFDF

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
213
Chain Sequence
QDRRRLLGPAAAKPMAFSNSEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 60
structure length 213
sequence length 245
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4ifdF00
3M7ND 5K36A 2C38A 2NN6D 2NN6F 2BR2A 5C0XA 3GCMA 2BR2B 5C0XB 5JEAA 2BA1G 4OO1F 4OO1C 2PO2B 3U1KA 4BA1B 5K36E 5JEAF 2PO2A 2NN6E 3KRNA 5C0XE 5JEAD 3CDJA 5C0XF 2WNRB 2WNRA 2C37B 4IFDA 2C39A 2JEBB 1UDNA 5K36F 1UDOA 3GMEA 1R6MA 2WP8A 2PO1A 5C0XD 2JEAA 3B4TA 4AIMA 2JE6A 3CDIA 4OO1B 4BA2B 4BA1A 4IFDD 1OYSA 2NN6A 5JEAE 2JEAB 2PO0A 4NBQA 4OO1D 4IFDE 4AIDA 3M7NG 4BA2A 1E3HA 4IFDC 2BA0D 2NN6C 1E3PA 3HKMA 2WP8B 2PO1B 4OO1E 5K36D 5K36B 5C0XC 3M85G 2PNZB 2PNZA 3M85D 5JEAB 2JE6B 1OYRA 2JEBA 5JEAC 3GLLA 4IFDF 1UDSA 2BA0G 2PO0B 1R6LA 1UDQA 2C39B 2C37A 5K36C 1OYPA 3DD6A 2C38B 4OO1A 2BA1D 3L7ZB 2NN6B 3L7ZA 4IFDB 4AM3A 3H1CA
chains in the Genus database with same CATH superfamily
4DPWA 3M7ND 4B3TI 4MYTA 1ZM2A 2HK3A 1XMOI 4ISAA 4KHPE 1NHHA 4DR6I 2C38A 2NN6D 1NZ0A 3JAMQ 2HFSA 5LMUI 3J81C 1NHIA 4DV0I 1H7UA 1XXEA 4X65E 4DV3E 2XEXA 4X65I 2VQFI 1U2RA 3J81Q 4OO1C 4LF4I 1Y4SA 5JEAF 2PO2A 4RPFA 1XMQI 4B3ME 4NXME 4DV2E 2CGEA 4FW4A 2NPFA 1OJ4A 4OX9E 4DV1E 4LF5E 1ZM4A 2C37B 1N0VC 3GMEA 2HHHI 4JI2I 3WU5A 4JG4A 3J7AG 4LF7I 4LF6E 1MG7A 4AIMA 4HY1A 1FJGI 2UXCI 1RR9A 1FI4A 2JE6A 4YY3I 4U3BA 5BR8E 4OO1B 3T1HI 4BA2B 2AE8A 2DEJA 1FWKA 4LF6I 2O1VA 4JV5E 4DV0E 1Z0CA 4QNKA 1Y60A 3Q1QA 2O1UA 3U1YA 4X62E 4XTJA 4DR2I 4LFAI 4IFDE 4DPXA 3M7NG 4DR7E 1E3HA 4JI3E 2OI2A 4DV2I 4LFBI 4JI3I 4WUDA 2VF3A 5LL6R 4IZJD 3HULA 4LCGA 4JI7I 4PRXA 4DU7A 4MU4A 4DR5E 3P3GA 5K36B 2VESA 1Y6ZA 4P7AA 1KKHA 2JT2A 4DU8A 2UXBI 2V2VA 4HXZA 4YY3E 2JE6B 4KHPI 2JEBA 1HNXE 1MX0A 4DV6I 5LMNE 2A2CA 3PYGA 4JI8E 4DV7I 4HACB 1UDSA 4WUBA 2R3VA 2BV3A 1WUUA 2BA0G 2E1RA 2PO0B 2VQEI 4DV5E 1Z0GA 1UDQA 2HKEA 3P06A 2C37A 2X36A 2C38B 1Z0WA 5LMNI 1DARA 4LFCE 4DV1I 3L7ZB 4UT4A 4FWDA 1HR0E 2VQEE 2NN6B 3QT5A 4OKGA 3OTOE 2F4VE 2J65A 1EI1A 2F4VI 3T1HE 1HNXI 3PYFA 3Q6MA 4HACA 3PS3A 2NN6F 5GMDA 1RREA 1Y4UA 1J5EI 2BR2A 5C0XA 4K0KE 4LCFA 4B3TE 4LF8E 4JI6I 2V2ZA 3LNUA 2AJ4A 4BA1B 5FLXC 4IS9A 4JI6E 5K36E 3J80C 5C0XF 5EKWA 4GQUA 3GONA 4PRVA 4MQYA 4URLA 1ZXNA 3P3CA 4LF5I 2WNRA 4K0KI 1Z5CA 2C39A 3ZZTA 4P52A 2JEBB 1UDNA 4USKA 4MDTA 3V5RA 4YHHI 4LF4E 1R6MA 2Z5EA 2Z5BA 4DR3I 5C0XD 3WU4A 3V2UC 5DNXA 2UUCE 2UUBI 2E5LE 3T1YI 2E5LI 2HK2A 2IOQA 2V34A 1Y5YA 2J7KA 3PS2A 4YHHE 4DR1E 1EA6A 2ZM6E 4IFDD 1OYSA 4GKKE 4B3SE 1H72C 5IWAI 4NXNI 2UUAI 2BM0A 4AQYI 5ELWA 1PVGA 1P42A 4HYMA 4DUZI 3P76A 4DR2E 4DUZE 4OO1D 4FN5A 3B8HA 4LFAE 2NN6C 1E3PA 4AQYE 3B78A 4U3DA 3WU6A 5A2QC 1KIJA 3HKMA 1Z59A 3QT8A 1Z5AA 3QT7A 4J3DA 1ELOA 1NHJA 2UXBE 2HFUA 2IESA 4N3OA 5FWKA 5FLXQ 1N34E 4R1FA 3M85D 1H73A 2LJPA 5DNLA 2UXDE 2O1WA 3D4JA 4DR4I 3GLLA 4DPTA 1IBME 2BM1A 1MU5A 2HKJA 4USMA 3Q6NA 2V8PA 3ZKDA 1ZM9A 4DV6E 2O1TA 1YHCA 1K47A 4DPYA 4JI1E 4DR6E 4MU3A 4FW9A 2V2QA 3K17A 1Z0EA 4JI5E 3L7ZA 5IT9Q 1HR0I 4DV3I 2BA1G 3H1CA 4EMDA 4AM3A 5K36A 4DR5I 4DR3E 4IZKA 2UUCI 4I3HA 5IWAE 1FNMA 1IBMI 4FW6A 4JI0E 2BR2B 5C0XB 5JEAA 1ZM3A 3LPSA 3U1KA 4IZKB 2NN6E 3KRNA 5JEAD 3CDJA 2WNRB 2IERA 1Z0VA 4IFDA 3PS1A 3OTOI 5K36F 1UDOA 2Z5BB 5BR8I 3T1YE 4LFCI 3B4TA 1A6FA 4DUYE 3NZKA 1N36I 2UU9I 4GKJI 5GMEA 4UTGA 3CDIA 4JI2E 2Z5CA 4BA1A 4DR4E 4JI0I 4MYUA 3LTOA 3UHMA 4B3SI 2PO0A 5DRQA 1N36E 2ZBKB 2UU9E 4GKJE 4NBQA 4DV4E 2EFGA 3J7AM 1Z5BA 4JI1I 5EL9A 4DPUA 3JAMC 4B3RE 4MU1A 1FJGE 1HNZE 2WP8B 2ZITA 2PO1B 1VI7A 5DRRA 4M1KA 4ZVIA 5C0XC 3M85G 1IBKI 4ED4A 1S4EA 2PNZA 1B62A 2A2DA 4JI7E 2UXDI 4PU9A 4FWGA 3M6AA 5JEAC 1XMQE 4B3MI 4NXMI 1BKNA 4IFDF 4JI8I 2F1DA 3PYDA 1R6LA 1FWLA 1PKPA 2C39B 5K36C 1OYPA 4LF9I 3DD6A 4FWHA 1XMOE 3PRYA 2BA1D 1Z0TA 1H7SA 4IZJA 1QZRA 1N32I 3PYEA 2Q2EB 3HJCA 4IFDB 3CWVA 2IOPA 2UXCE 4LOMA 4KQVA 1XNQE 1HK7A 3H4LA 1J5EE 1D6TA 2DEIA 3ZZUA 2WW4A 3GCMA 1FKAE 4X62I 5DROA 4OO1F 5IT9C 2PO2B 1USUA 1KVKA 4X64E 5C0XE 4X64I 2X7IA 1IBLI 4JI4E 2CZ9A 2VQFE 2HHHE 3F0NA 2Z5CB 5L3JA 4LPFA 2PNLA 4JYAI 2WP8A 2PO1A 1B63A 4FW3A 1I94E 4GKKI 2JEAA 2UUAE 4WUCA 1N33E 4Z7CA 3P3EA 3K85A 4JYAE 2CG9A 4LF8I 3QT6A 4DR1I 4DXLA 2CVEA 2UUBE 2ZM6I 5LMUE 5JEAE 2JEAB 4FW7A 1IBLE 4FW5A 4AIDA 4X66E 4BA2A 4IFDC 1N0UA 1ZXMA 2BA0D 2GO3A 1HNWI 4LF7E 3ZKBA 4MU0A 1UEKA 5DRPA 1YH8A 3ZM7A 1N33I 3B82A 4OO1E 1XNQI 1S16A 5K36D 1HNZI 4DR7I 1IBKE 2PNZB 1N32E 4IZJB 1H74A 2PNMA 4JV5I 4NXNE 4OZEA 4DUYI 1N34I 4B3RI 4DV5I 1KTVA 2R42A 5JEAB 1XNRE 1XHKA 3K1JA 1OYRA 1Z0BA 4LF9E 1RHYA 4DV7E 1PIEA 2GQ0A 3ZZ0A 4X66I 5A2QQ 2GO4A 4JI4I 2O3ZA 4JI5I 4DV4I 4Z7YA 1VISA 1XNRI 4QNJA 1USVA 4OO1A 4LFBE 1I94I 1HNWE 3J80Q 4OX9I 4LCHA 3WU3A 2GS8A 2NN6A
chains in the Genus database with same CATH topology
3M7ND 5K36A 2C38A 2NN6D 2NN6F 2BR2A 5C0XA 3GCMA 2BR2B 5C0XB 5JEAA 2BA1G 4OO1F 4OO1C 2PO2B 3U1KA 4BA1B 5K36E 5JEAF 2PO2A 2NN6E 3KRNA 5C0XE 5JEAD 3CDJA 5C0XF 2WNRB 2WNRA 2C37B 4IFDA 2C39A 2JEBB 1UDNA 5K36F 1UDOA 3GMEA 1R6MA 2WP8A 2PO1A 5C0XD 2JEAA 3B4TA 4AIMA 2JE6A 3CDIA 4OO1B 4BA2B 4BA1A 4IFDD 1OYSA 2NN6A 5JEAE 2JEAB 2PO0A 4NBQA 4OO1D 4IFDE 4AIDA 3M7NG 4BA2A 1E3HA 4IFDC 2BA0D 2NN6C 1E3PA 3HKMA 2WP8B 2PO1B 4OO1E 5K36D 5K36B 5C0XC 3M85G 2PNZB 2PNZA 3M85D 5JEAB 2JE6B 1OYRA 2JEBA 5JEAC 3GLLA 4IFDF 1UDSA 2BA0G 2PO0B 1R6LA 1UDQA 2C39B 2C37A 5K36C 1OYPA 3DD6A 2C38B 4OO1A 2BA1D 3L7ZB 2NN6B 3L7ZA 4IFDB 4AM3A 3H1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7N D;  5K36 A;  2C38 A;  2NN6 D;  2NN6 F;  2BR2 A;  5C0X A;  3GCM A;  2BR2 B;  5C0X B;  5JEA A;  2BA1 G;  4OO1 F;  4OO1 C;  2PO2 B;  3U1K A;  4BA1 B;  5K36 E;  5JEA F;  2PO2 A;  2NN6 E;  3KRN A;  5C0X E;  5JEA D;  3CDJ A;  5C0X F;  2WNR B;  2WNR A;  2C37 B;  4IFD A;  2C39 A;  2JEB B;  1UDN A;  5K36 F;  1UDO A;  3GME A;  1R6M A;  2WP8 A;  2PO1 A;  5C0X D;  2JEA A;  3B4T A;  4AIM A;  2JE6 A;  3CDI A;  4OO1 B;  4BA2 B;  4BA1 A;  4IFD D;  1OYS A;  2NN6 A;  5JEA E;  2JEA B;  2PO0 A;  4NBQ A;  4OO1 D;  4IFD E;  4AID A;  3M7N G;  4BA2 A;  1E3H A;  4IFD C;  2BA0 D;  2NN6 C;  1E3P A;  3HKM A;  2WP8 B;  2PO1 B;  4OO1 E;  5K36 D;  5K36 B;  5C0X C;  3M85 G;  2PNZ B;  2PNZ A;  3M85 D;  5JEA B;  2JE6 B;  1OYR A;  2JEB A;  5JEA C;  3GLL A;  4IFD F;  1UDS A;  2BA0 G;  2PO0 B;  1R6L A;  1UDQ A;  2C39 B;  2C37 A;  5K36 C;  1OYP A;  3DD6 A;  2C38 B;  4OO1 A;  2BA1 D;  3L7Z B;  2NN6 B;  3L7Z A;  4IFD B;  4AM3 A;  3H1C A; 
#chains in the Genus database with same CATH topology
 4DPW A;  3M7N D;  4B3T I;  4MYT A;  1ZM2 A;  2HK3 A;  1XMO I;  4ISA A;  4KHP E;  1NHH A;  4DR6 I;  2C38 A;  2NN6 D;  1NZ0 A;  3JAM Q;  2HFS A;  5LMU I;  3J81 C;  1NHI A;  4DV0 I;  1H7U A;  1XXE A;  4X65 E;  4DV3 E;  2XEX A;  4X65 I;  2VQF I;  1U2R A;  3J81 Q;  4OO1 C;  4LF4 I;  1Y4S A;  5JEA F;  2PO2 A;  4RPF A;  1XMQ I;  4B3M E;  4NXM E;  4DV2 E;  2CGE A;  4FW4 A;  2NPF A;  1OJ4 A;  4OX9 E;  4DV1 E;  4LF5 E;  1ZM4 A;  2C37 B;  1N0V C;  3GME A;  2HHH I;  4JI2 I;  3WU5 A;  4JG4 A;  3J7A G;  4LF7 I;  4LF6 E;  1MG7 A;  4AIM A;  4HY1 A;  1FJG I;  2UXC I;  1RR9 A;  1FI4 A;  2JE6 A;  4YY3 I;  4U3B A;  5BR8 E;  4OO1 B;  3T1H I;  4BA2 B;  2AE8 A;  2DEJ A;  1FWK A;  4LF6 I;  2O1V A;  4JV5 E;  4DV0 E;  1Z0C A;  4QNK A;  1Y60 A;  3Q1Q A;  2O1U A;  3U1Y A;  4X62 E;  4XTJ A;  4DR2 I;  4LFA I;  4IFD E;  4DPX A;  3M7N G;  4DR7 E;  1E3H A;  4JI3 E;  2OI2 A;  4DV2 I;  4LFB I;  4JI3 I;  4WUD A;  2VF3 A;  5LL6 R;  4IZJ D;  3HUL A;  4LCG A;  4JI7 I;  4PRX A;  4DU7 A;  4MU4 A;  4DR5 E;  3P3G A;  5K36 B;  2VES A;  1Y6Z A;  4P7A A;  1KKH A;  2JT2 A;  4DU8 A;  2UXB I;  2V2V A;  4HXZ A;  4YY3 E;  2JE6 B;  4KHP I;  2JEB A;  1HNX E;  1MX0 A;  4DV6 I;  5LMN E;  2A2C A;  3PYG A;  4JI8 E;  4DV7 I;  4HAC B;  1UDS A;  4WUB A;  2R3V A;  2BV3 A;  1WUU A;  2BA0 G;  2E1R A;  2PO0 B;  2VQE I;  4DV5 E;  1Z0G A;  1UDQ A;  2HKE A;  3P06 A;  2C37 A;  2X36 A;  2C38 B;  1Z0W A;  5LMN I;  1DAR A;  4LFC E;  4DV1 I;  3L7Z B;  4UT4 A;  4FWD A;  1HR0 E;  2VQE E;  2NN6 B;  3QT5 A;  4OKG A;  3OTO E;  2F4V E;  2J65 A;  1EI1 A;  2F4V I;  3T1H E;  1HNX I;  3PYF A;  3Q6M A;  4HAC A;  3PS3 A;  2NN6 F;  5GMD A;  1RRE A;  1Y4U A;  1J5E I;  2BR2 A;  5C0X A;  4K0K E;  4LCF A;  4B3T E;  4LF8 E;  4JI6 I;  2V2Z A;  3LNU A;  2AJ4 A;  4BA1 B;  5FLX C;  4IS9 A;  4JI6 E;  5K36 E;  3J80 C;  5C0X F;  5EKW A;  4GQU A;  3GON A;  4PRV A;  4MQY A;  4URL A;  1ZXN A;  3P3C A;  4LF5 I;  2WNR A;  4K0K I;  1Z5C A;  2C39 A;  3ZZT A;  4P52 A;  2JEB B;  1UDN A;  4USK A;  4MDT A;  3V5R A;  4YHH I;  4LF4 E;  1R6M A;  2Z5E A;  2Z5B A;  4DR3 I;  5C0X D;  3WU4 A;  3V2U C;  5DNX A;  2UUC E;  2UUB I;  2E5L E;  3T1Y I;  2E5L I;  2HK2 A;  2IOQ A;  2V34 A;  1Y5Y A;  2J7K A;  3PS2 A;  4YHH E;  4DR1 E;  1EA6 A;  2ZM6 E;  4IFD D;  1OYS A;  4GKK E;  4B3S E;  1H72 C;  5IWA I;  4NXN I;  2UUA I;  2BM0 A;  4AQY I;  5ELW A;  1PVG A;  1P42 A;  4HYM A;  4DUZ I;  3P76 A;  4DR2 E;  4DUZ E;  4OO1 D;  4FN5 A;  3B8H A;  4LFA E;  2NN6 C;  1E3P A;  4AQY E;  3B78 A;  4U3D A;  3WU6 A;  5A2Q C;  1KIJ A;  3HKM A;  1Z59 A;  3QT8 A;  1Z5A A;  3QT7 A;  4J3D A;  1ELO A;  1NHJ A;  2UXB E;  2HFU A;  2IES A;  4N3O A;  5FWK A;  5FLX Q;  1N34 E;  4R1F A;  3M85 D;  1H73 A;  2LJP A;  5DNL A;  2UXD E;  2O1W A;  3D4J A;  4DR4 I;  3GLL A;  4DPT A;  1IBM E;  2BM1 A;  1MU5 A;  2HKJ A;  4USM A;  3Q6N A;  2V8P A;  3ZKD A;  1ZM9 A;  4DV6 E;  2O1T A;  1YHC A;  1K47 A;  4DPY A;  4JI1 E;  4DR6 E;  4MU3 A;  4FW9 A;  2V2Q A;  3K17 A;  1Z0E A;  4JI5 E;  3L7Z A;  5IT9 Q;  1HR0 I;  4DV3 I;  2BA1 G;  3H1C A;  4EMD A;  4AM3 A;  5K36 A;  4DR5 I;  4DR3 E;  4IZK A;  2UUC I;  4I3H A;  5IWA E;  1FNM A;  1IBM I;  4FW6 A;  4JI0 E;  2BR2 B;  5C0X B;  5JEA A;  1ZM3 A;  3LPS A;  3U1K A;  4IZK B;  2NN6 E;  3KRN A;  5JEA D;  3CDJ A;  2WNR B;  2IER A;  1Z0V A;  4IFD A;  3PS1 A;  3OTO I;  5K36 F;  1UDO A;  2Z5B B;  5BR8 I;  3T1Y E;  4LFC I;  3B4T A;  1A6F A;  4DUY E;  3NZK A;  1N36 I;  2UU9 I;  4GKJ I;  5GME A;  4UTG A;  3CDI A;  4JI2 E;  2Z5C A;  4BA1 A;  4DR4 E;  4JI0 I;  4MYU A;  3LTO A;  3UHM A;  4B3S I;  2PO0 A;  5DRQ A;  1N36 E;  2ZBK B;  2UU9 E;  4GKJ E;  4NBQ A;  4DV4 E;  2EFG A;  3J7A M;  1Z5B A;  4JI1 I;  5EL9 A;  4DPU A;  3JAM C;  4B3R E;  4MU1 A;  1FJG E;  1HNZ E;  2WP8 B;  2ZIT A;  2PO1 B;  1VI7 A;  5DRR A;  4M1K A;  4ZVI A;  5C0X C;  3M85 G;  1IBK I;  4ED4 A;  1S4E A;  2PNZ A;  1B62 A;  2A2D A;  4JI7 E;  2UXD I;  4PU9 A;  4FWG A;  3M6A A;  5JEA C;  1XMQ E;  4B3M I;  4NXM I;  1BKN A;  4IFD F;  4JI8 I;  2F1D A;  3PYD A;  1R6L A;  1FWL A;  1PKP A;  2C39 B;  5K36 C;  1OYP A;  4LF9 I;  3DD6 A;  4FWH A;  1XMO E;  3PRY A;  2BA1 D;  1Z0T A;  1H7S A;  4IZJ A;  1QZR A;  1N32 I;  3PYE A;  2Q2E B;  3HJC A;  4IFD B;  3CWV A;  2IOP A;  2UXC E;  4LOM A;  4KQV A;  1XNQ E;  1HK7 A;  3H4L A;  1J5E E;  1D6T A;  2DEI A;  3ZZU A;  2WW4 A;  3GCM A;  1FKA E;  4X62 I;  5DRO A;  4OO1 F;  5IT9 C;  2PO2 B;  1USU A;  1KVK A;  4X64 E;  5C0X E;  4X64 I;  2X7I A;  1IBL I;  4JI4 E;  2CZ9 A;  2VQF E;  2HHH E;  3F0N A;  2Z5C B;  5L3J A;  4LPF A;  2PNL A;  4JYA I;  2WP8 A;  2PO1 A;  1B63 A;  4FW3 A;  1I94 E;  4GKK I;  2JEA A;  2UUA E;  4WUC A;  1N33 E;  4Z7C A;  3P3E A;  3K85 A;  4JYA E;  2CG9 A;  4LF8 I;  3QT6 A;  4DR1 I;  4DXL A;  2CVE A;  2UUB E;  2ZM6 I;  5LMU E;  5JEA E;  2JEA B;  4FW7 A;  1IBL E;  4FW5 A;  4AID A;  4X66 E;  4BA2 A;  4IFD C;  1N0U A;  1ZXM A;  2BA0 D;  2GO3 A;  1HNW I;  4LF7 E;  3ZKB A;  4MU0 A;  1UEK A;  5DRP A;  1YH8 A;  3ZM7 A;  1N33 I;  3B82 A;  4OO1 E;  1XNQ I;  1S16 A;  5K36 D;  1HNZ I;  4DR7 I;  1IBK E;  2PNZ B;  1N32 E;  4IZJ B;  1H74 A;  2PNM A;  4JV5 I;  4NXN E;  4OZE A;  4DUY I;  1N34 I;  4B3R I;  4DV5 I;  1KTV A;  2R42 A;  5JEA B;  1XNR E;  1XHK A;  3K1J A;  1OYR A;  1Z0B A;  4LF9 E;  1RHY A;  4DV7 E;  1PIE A;  2GQ0 A;  3ZZ0 A;  4X66 I;  5A2Q Q;  2GO4 A;  4JI4 I;  2O3Z A;  4JI5 I;  4DV4 I;  4Z7Y A;  1VIS A;  1XNR I;  4QNJ A;  1USV A;  4OO1 A;  4LFB E;  1I94 I;  1HNW E;  3J80 Q;  4OX9 I;  4LCH A;  3WU3 A;  2GS8 A;  2NN6 A; 
#chains in the Genus database with same CATH homology
 3M7N D;  5K36 A;  2C38 A;  2NN6 D;  2NN6 F;  2BR2 A;  5C0X A;  3GCM A;  2BR2 B;  5C0X B;  5JEA A;  2BA1 G;  4OO1 F;  4OO1 C;  2PO2 B;  3U1K A;  4BA1 B;  5K36 E;  5JEA F;  2PO2 A;  2NN6 E;  3KRN A;  5C0X E;  5JEA D;  3CDJ A;  5C0X F;  2WNR B;  2WNR A;  2C37 B;  4IFD A;  2C39 A;  2JEB B;  1UDN A;  5K36 F;  1UDO A;  3GME A;  1R6M A;  2WP8 A;  2PO1 A;  5C0X D;  2JEA A;  3B4T A;  4AIM A;  2JE6 A;  3CDI A;  4OO1 B;  4BA2 B;  4BA1 A;  4IFD D;  1OYS A;  2NN6 A;  5JEA E;  2JEA B;  2PO0 A;  4NBQ A;  4OO1 D;  4IFD E;  4AID A;  3M7N G;  4BA2 A;  1E3H A;  4IFD C;  2BA0 D;  2NN6 C;  1E3P A;  3HKM A;  2WP8 B;  2PO1 B;  4OO1 E;  5K36 D;  5K36 B;  5C0X C;  3M85 G;  2PNZ B;  2PNZ A;  3M85 D;  5JEA B;  2JE6 B;  1OYR A;  2JEB A;  5JEA C;  3GLL A;  4IFD F;  1UDS A;  2BA0 G;  2PO0 B;  1R6L A;  1UDQ A;  2C39 B;  2C37 A;  5K36 C;  1OYP A;  3DD6 A;  2C38 B;  4OO1 A;  2BA1 D;  3L7Z B;  2NN6 B;  3L7Z A;  4IFD B;  4AM3 A;  3H1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...