4AQYE

Structure of ribosome-apramycin complexes
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4aqyE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4aqyE02
4LFAE 3ZM7A 1H74A 4B3ME 2NUGA 4JI6E 4JI5I 4DV1I 2DIXA 4KHPI 4X64E 4X66E 1UILA 2EFGA 1N33I 4X62E 3V2UC 1X49A 1VISA 2R42A 3ZKDA 5FLXC 1S4EA 2V2QA 1Z0BA 4FN5A 4JI8E 5LL6R 3J7AM 2A2DA 4DV7I 2DEIA 4I3HA 2LTRA 3QT7A 1HNWI 1Z5CA 4GKJI 3T1HE 4LF4I 2F4VI 1Z0TA 2UU9I 2NUFA 1X47A 1IBME 5FLXQ 5GMDA 2OI2A 4LFBE 1H73A 1J26A 1FI4A 4B3TI 1H72C 4DV5E 1YYKA 5BR8I 1I94I 4B3RI 4AQYI 1NZ0A 2WW4A 3PYGA 5CFFE 2L3CA 4DR5E 1FJGE 4LF9E 4B3SE 4DUYE 4FWHA 5GMEA 4Z7YA 2BM0A 3C4BA 1RREA 1H7UA 4K0KE 1Z0CA 2RTXA 1K47A 1IBLI 4LF9I 3ADGA 2HK2A 2E5LI 4DKKA 1N0UA 1N36I 1Z5AA 2UUCI 3J80Q 4DV4E 5BR8E 1I94E 4JI7I 4DR4E 1RC7A 4LFCE 4DV2E 1Z0VA 2B7VA 4JI1E 3QT5A 2L2MA 2IHR1 1YZ9A 1WUUA 1MU5A 1ELOA 2UXBE 2CPNA 1A6FA 3WU4A 3ADJA 1ZXMA 5A2QQ 1O0WA 5IT9Q 2EZ6A 4DR3I 1ZM3A 5LMNE 4JI7E 2VQFE 2UUAI 3LLHA 3M6AA 1N33E 3ZKBA 4DUZI 4DPUA 2HK3A 1KVKA 4JI5E 4JI6I 4M1KA 4EMDA 1NHJA 1N36E 4NXME 4P7AA 4YHHE 4DR5I 1ZM4A 4LF5I 4LF8E 1KKHA 2UXCI 4NXMI 1J5EE 2LJPA 4YY3E 2V8PA 3F0NA 5IT9C 2GS8A 3ZZUA 1J5EI 2UXCE 4DUYI 1HNXE 4YHHI 4JI3E 4JYAI 3LTOA 3LPSA 2LBSB 2BM1A 2NPFA 2F4VE 3T1HI 4JI2E 1ZM2A 4WUBA 3OTOI 4XTJA 5LMNI 3ADIA 4LF7E 2N3HA 4DR3E 2ZM6E 1HNWE 4LFBI 2L33A 2LUPB 1HR0I 4FWGA 3T1YI 2RSMA 3D4JA 5L3JA 4DR6E 1D6TA 4LF4E 2KHXA 3QT8A 1Z0GA 1B62A 4DPTA 2HHHI 1UHZA 3PYDA 4DR2E 2LTSA 1FNMA 3T1YE 4DV7E 1HR0E 4JI1I 4JI8I 4P52A 4LFCI 1FWLA 3ADLA 2HHHE 3OTOE 3GONA 1U2RA 4DR1I 4FWDA 3J7Yp 4HACA 1B63A 2B7TA 1X48A 4JYAE 2MDRA 3PYEA 4JI3I 3B78A 4DV3I 1S16A 2ZM6I 1PVGA 4DV2I 3JAMC 4LF7I 4MYUA 4K0KI 4B3MI 3WU5A 3J80C 2LUQA 1DARA 4USMA 1FJGI 2X36A 4OX9E 4DR7E 4JG4A 4X65E 1RR9A 3WU6A 4B3RE 1ZXNA 4HACB 4JI0I 1HNZE 1FKAE 2L3JA 4DPYA 4B3SI 4DV3E 1RQ0A 1QU6A 3QT6A 1MG7A 1YYWA 4DR1E 4ZVIA 2N3GA 2VQFI 2LRSA 3PYFA 2NUEA 2BV3A 4OOGC 3ZZTA 4DUZE 1EA6A 2DB2A 4PU9A 4JV5I 2E1RA 2ZITA 2B3TB 3CWVA 4GKJE 2UUAE 2L2KB 1XNRI 4DR6I 4HY1A 4DV0I 4X8WA 2HFSA 4HXZA 1NHIA 1STUA 4DV6E 2CZ9A 2V2VA 4RPFA 1T4NA 3J7AG 2UXBI 4DV1E 1BKNA 3K1JA 1MX0A 1NHHA 4JI2I 4DV4I 4LFAI 2X7IA 2JY9A 1N0VC 3B82A 1DI2A 1N34I 2R3VA 4DPWA 4DV6I 2UUCE 1IBKI 4DV0E 1KTVA 4LF8I 4LF5E 1EI1A 4R1FA 1GQEA 4WUDA 5LMUE 2LJHA 3VYXA 1KIJA 2ZBKB 4NXNI 1UEKA 4B3TE 1WHNA 4WUCA 3H4LA 5IWAE 4AQYE 4NXNE 3C4TA 3Q1QA 4M30A 1PIEA 3JAMQ 4DV5I 5LMUI 1T4OA 2UXDE 1YYOA 4MYTA 3VYYA 1HNZI 1OJ4A 1QZRA 1IBMI 1XMOE 2L2NA 2UUBE 4GKKE 1XMQI 2VQEI 2Q2EB 4LF6E 2YT4A 1N32I 4DU7A 2V2ZA 1XNQI 1Z0EA 1IBKE 1EKZA 3LNUA 4FW9A 3K17A 4UT4A 3WU3A 3ZZ0A 1T4LB 4KHPE 4DR4I 2HKJA 4USKA 3J81Q 4JI4I 4Z7CA 4M2ZA 4X62I 4URLA 1XNQE 4JI4E 2A2CA 1Z0WA 4HYMA 2E5LE 3HULA 3V5RA 1IBLE 4X64I 4X66I 2HFUA 2RS7A 4UTGA 4JV5E 2RS6A 2VF3A 1XNRE 4WYQB 4DR2I 1N32E 1ZBTA 2V34A 1PKPA 1H7SA 4LF6I 2HKEA 4DXLA 2UXDI 4PRXA 4ED4A 2VQEE 2AJ4A 3J81C 1XMQE 2UUBI 2DEJA 4GKKI 5IWAI 1XMOI 2J7KA 2DMYA 1Z5BA 2JVAA 1ZM9A 4JI0E 4DU8A 1FWKA 2UU9E 4PRVA 3B8HA 4WFTA 5A2QC 2XEXA 1HNXI 1WHQA 3P1XA 1Z59A 4YY3I 4X65I 4KQVA 4OX9I 4DR7I 1XHKA 1N34E 4DPXA 2NA2A 3HTXA
chains in the Genus database with same CATH superfamily
4LFAE 3ZM7A 1H74A 3EQ1A 4B3ME 5C0XE 5AC5A 2EOOA 2NN6B 4IZJD 5IV8B 2NUGA 4IZJB 4JI6E 5C0XA 4JI5I 1G2DC 3PS2A 4DV1I 2DIXA 4KHPI 2JOXA 4X64E 2ELYA 4X66E 1Y4SA 1UILA 2EFGA 2JE6B 1N33I 3P76A 4LCGA 1VI7A 3BBGA 4X62E 3V2UC 1X49A 1VISA 2R42A 4L8NA 1A1GA 1Y4UA 4OO1E 3HJCA 3ZKDA 5FLXC 2EM0A 2EWLA 1S4EA 2LJUA 2V2QA 4FW7A 1Z0BA 2EMYA 2YTDA 5LL6R 4JI8E 3C6KA 2NN6F 4FN5A 3J7AM 2K4VA 2YTGA 2A2DA 3DF6A 2DEIA 4I3HA 4DV7I 5DRQA 4BC9A 2LTRA 2EM7A 2EL6A 2EMIA 1JK2A 1TF6A 3QT7A 2EMXA 1HNWI 2EPAA 1A1HA 1Z5CA 1GTKA 3EPLA 1ZR9A 4FW5A 3AV0A 4P7DA 4F9AB 2JEBB 2JE6A 4GKJI 3T1HE 4N4RB 4LF4I 2F4VI 2YSPA 1Z0TA 2UU9I 2NUFA 2EM4A 1X47A 1IBME 2ELZA 4TUGA 5GMDA 5FLXQ 2OI2A 2WBTA 2L6MA 3DJWA 4F54A 1JK1A 4LFBE 3GMEA 1H73A 1ZAAC 1X6HA 1J26A 1FI4A 2EMGA 4B3TI 1H72C 2Z5CB 2YTFA 4DV5E 1YYKA 4NHRA 2EN6A 3THOB 3M85D 5BR8I 3CDJA 4RH8A 1I94I 4IFDD 4B3RI 2IESA 4M9VC 3F6GA 4AQYI 3L7ZA 1NZ0A 3F6HA 2WW4A 3L7ZB 2WP8B 1PJSA 3PYGA 2O3ZA 2JXPA 2V86A 5CFFE 2VE7C 2L3CA 4DR5E 2JP9A 1FJGE 1OYSA 4LF9E 5K36A 3LMLA 4B3SE 4DUYE 5K36C 4FWHA 2YTEA 4MDTA 2E1MA 2C38A 5GMEA 3HPZA 3THNA 4OZEA 2BM0A 3C4BA 1RREA 4F9CB 4Z7YA 4R2PA 2EN1A 1H7UA 2JPAA 4R2EA 4K0KE 2O1TA 1Z0CA 2RTXA 1UBDC 1K47A 1IBLI 3P3EA 2AE8A 4LF9I 3ADGA 2HK2A 3GLLA 2E5LI 3IWBA 2V88A 3M85G 2EN3A 4DKKA 1N0UA 3FIGA 1N36I 1Z5AA 2RPCA 2UUCI 3J80Q 4DV4E 4FK5C 5BR8E 1I94E 4IS9A 2IOPA 4JI7I 4DR4E 5AASA 1RC7A 2EPNA 4NBQA 5AE3A 2MDGA 2C39A 4LFCE 4DV2E 4BHBA 2CGEA 1Z0VA 1T38A 2B7VA 1A1IA 4WX9A 4JI1E 2CSHA 3QT5A 2IERA 5DNYA 2L2MA 2IHR1 2EPUA 4Q28A 3KRNA 2WZOA 1YZ9A 4BC7A 1UDSA 1WUUA 3H1CA 1MU5A 1ELOA 1YUJA 2UXBE 2PNLA 4BA2B 5A6KA 1EH7A 2CPNA 2EPZA 5C0XC 1A6FA 3WU4A 1NEIA 3ADJA 1L4SA 2EMWA 2EL4A 1ZXMA 1RMDA 1DQ3A 5A2QQ 3DD6A 2L8TA 5A6JA 4BBYA 1O0WA 2EQ1A 1YH8A 2NN6A 5IT9Q 2EZ6A 4P78A 2WP8A 2LO3A 4DR3I 2C39B 3HQ1A 1ZM3A 5LMNE 2VESA 2EM2A 3MHSC 4JI7E 2VQFE 5LLQA 2UUAI 2EOSA 3LLHA 4MU4A 2PO0A 5EL9A 3B4TA 4QNKA 2M9AA 2M7QA 3M6AA 3OMLA 1N33E 2EPMX 2O1WA 3ZKBA 4DUZI 4DPUA 2JT2A 4IZKA 2HK3A 1KVKA 2Z5BB 4R2SA 4JI5E 4JI6I 4BA1A 5FWKA 4M1KA 2GPIA 2YRHA 4EMDA 2JWOA 1N36E 1NHJA 2EPCA 2EQ3A 4NXME 5JEAC 4R03A 2MKDA 4MLQA 4P7AA 4LTYA 4YHHE 1GZ6A 4IZJA 5KL4A 4DR5I 1ZM4A 4LF5I 4LF8E 5DNLA 1KKHA 2UXCI 1BBGA 1XXEA 1J5EE 4NXMI 2LJPA 2YSOA 4YY3E 4KZSA 5IT9C 2V8PA 3F0NA 2PO0B 4MU1A 4TUIA 2GS8A 3ZZUA 1ZBQA 5T6JA 1J5EI 2IOQA 2WBSA 2LE2A 2UXCE 4DUYI 2K7IA 1HNXE 2YTPA 4YHHI 4JI3E 2C37A 2NN6E 2MC5A 4O24A 3LTOA 4BCAA 1PDAA 4LU9A 4ZYHA 5KL3A 1R6MA 1WJPA 2LBSB 3LPSA 3AUZA 4IS1C 2BM1A 5DNXA 2NPFA 1OYRA 4IFDF 2EM5A 4BMJA 4JI2E 2F4VE 1ZM2A 4MU3A 2EOEA 4WUBA 3OTOI 2R76A 4R2AA 3UHMA 4XTJA 5LMNI 3ADIA 2GQ0A 4LF7E 2N3HA 5JEAA 4DR3E 1SR9A 2O1VA 4J8ZA 5IXMB 2ZM6E 1HNWE 5JEAB 4LFBI 2L33A 2LUPB 5A6BD 4FWGA 1HR0I 3T1YI 1R6LA 2YWQA 2RSMA 3D4JA 5L3JA 5K36F 2EJ4A 2CTDA 4DR6E 4LPFA 1D6TA 4LF4E 2KHXA 3QT8A 3M7ND 4N3OA 4GQUA 1Z0GA 2L92A 4IZKB 1B62A 4DPTA 2HHHI 5AC4A 2FTXB 1NCSA 2EOFA 1UHZA 2JR1A 3BF2A 4AIDA 1USUA 3PYDA 4DR2E 2WCC3 3H09A 2LTSA 2BA0G 1E3HA 1FNMA 3KZZA 1HK7A 3T1YE 4DV7E 1HR0E 4JI1I 2EN4A 2EQ0A 3C6MA 2PRTA 1TF3A 4JI8I 3Q6MA 4P52A 4LFCI 1FWLA 2KOUA 3U1YA 3ADLA 2EOZA 4WPYA 2EPOA 2JOBA 2HHHE 2F8BA 2M1SA 3IWDA 4F9BB 3OTOE 2BA1D 3M99B 1U2RA 3GONA 5AE2A 4DR1I 4FWDA 2C38B 3J7Yp 1LLMC 2RSIA 1B63A 4HACA 2B7TA 1X48A 4JYAE 2BBGA 2MDRA 4R2DA 3PYEA 4JI3I 1YUIA 3B78A 2LMZA 1S16A 2PO2A 2ZM6I 2LV2A 1PVGA 4DV3I 4DV2I 3JAMC 2EPKX 4LF7I 4MYUA 2NN6C 4K0KI 2EN8A 3IWCA 3KWRA 1BB8A 1IBKI 4B3MI 3MHHC 1Y5YA 3WU5A 3GCMA 3J80C 4F6NA 2H36X 2YTJA 4KWYA 2LUQA 4FW6A 1DARA 4USMA 3VK6A 4O43A 4FW3A 4ZYGA 1FJGI 2PO1A 1MGTA 4OX9E 4DR7E 2X36A 4JG4A 4X65E 4JYAI 2LT7A 1YHCA 1RR9A 3WU6A 5JEAE 4B3RE 1Y60A 1ZXNA 4HACB 5KL2A 2ODRD 3ZOQB 1A1JA 4OKGA 5DRPA 4JI0I 1HNZE 1FKAE 2L3JA 4DPYA 4B3SI 5A69A 2CT1A 4DV3E 3MSWA 4BA2A 2VF1A 4M0VA 2Z5BA 1RQ0A 1QU6A 1QNTA 3QT6A 1MG7A 2EP3A 4DR1E 1YYWA 4ZVIA 4OO1C 2EOHA 5A6AA 2DMIA 2N3GA 2VQFI 2LRSA 3PYFA 2NUEA 4AIMA 2BV3A 5DROA 4O4KA 3PRYA 4OOGC 3ZZTA 5K36B 2HC5A 2CG9A 4DUZE 2DGCA 2EMFA 2DB2A 1EA6A 4PU9A 4DMIA 2I9IA 4JV5I 1IQOA 2E1RA 2EOXA 3T1HI 1UDNA 1PJTA 4WXCA 2ZITA 1ZU1A 2EOJA 2B3TB 3K85A 4AM3A 3CWVA 3HKMA 4GKJE 2EOMA 2UUAE 4O5GA 2ADRA 5ADZA 1IMUA 2EM9A 2L2KB 4LCFA 2BA0D 4LOMA 4OO1D 1XNRI 4DR6I 4HY1A 4DV0I 4X8WA 2EM8A 2HFSA 4HXZA 1NHIA 1STUA 2Q8UA 4I8OA 4IJDA 4DV6E 2HGHA 2ENAA 2CZ9A 2EL5A 2V2VA 4RPFA 1T4NA 2E72A 1F2IG 3J7AG 5C0XB 2UXBI 4DV1E 1BKNA 3K1JA 1RHYA 1MX0A 1NHHA 4JI2I 4DV4I 2DRPA 4LFAI 2X7IA 2JY9A 1N0VC 3B82A 1DI2A 1N34I 2YTIA 2EMBA 1MEYC 4IFDC 2PNZB 5DRRA 2EORA 2R3VA 2YU8A 4DPWA 2Z5CA 3P06A 1EH8A 1Z1BA 2G7HA 2V8QB 4QNJA 4DV6I 2EPXA 2UUCE 4HTGA 2DLKA 2EOIA 2EMCA 2DSYA 1TN9A 2PNMA 5C0XF 4DV0E 1A1FA 1KTVA 3NZKA 5JEAD 4WSGA 4IFDE 3QG5C 4ZYEA 2JEAA 4LF8I 4LF5E 2LCEA 1AH5A 1EI1A 4X9JA 4R1FA 1GQEA 4WUDA 2J65A 5LMUE 2LJHA 4BS9A 3VYXA 2V87A 1X5WA 2BB8A 2EM3A 2VRDA 4R2RA 1KIJA 5K36E 1A1KA 2ZBKB 4OO1A 4NXNI 3M7NG 1YPNA 5KL5A 1UEKA 4MQYA 4B3TE 1WHNA 4OO1F 2EPRA 4WSPA 4WUCA 5KL7A 1WXRA 1P47A 1E3PA 3H4LA 5IWAE 2BA1G 4AQYE 4NXNE 3C4TA 3EPKA 4M30A 2NN6D 3Q1QA 2YTNA 4ISAA 1PIEA 4R2CA 1Y6ZA 3JAMQ 4DV5I 5LMUI 1T4OA 1SFEA 2ENCA 2UXDE 3PS1A 1YYOA 2RQLA 4MYTA 2YPNA 2JEBA 2V85A 3VYYA 1HNZI 1OJ4A 1QZRA 2EN7A 1KJKA 1XMOE 1IBMI 2EN2A 2GO4A 2L2NA 3KZYA 2D9HA 2UUBE 4GKKE 1XMQI 2ENHA 2VQEI 3K6QA 2Q2EB 3P3GA 3PS3A 4NZVA 2ODRC 4LF6E 2WNRA 2YT4A 2O1UA 5ELWA 2C37B 1N32I 4DU7A 2YU5A 2EE8A 2V2ZA 1XNQI 2EMZA 1Z0EA 4LCHA 1IBKE 1EKZA 1P42A 3LNUA 4RHBB 4FW9A 3K17A 3CDIA 4UT4A 4MU0A 3WU3A 3ZZ0A 1USVA 2EPLX 3BIDA 2I13A 4FW4A 2EPPA 2YTOA 3ECRA 1T4LB 4KHPE 3U1KA 4IFDB 4DR4I 2HKJA 1IQSA 4R8OA 5A6BA 4USKA 3VHTB 3J81Q 4JI4I 4Z7CA 4M2ZA 4X62I 2V83A 5JEAF 4URLA 1XNQE 4JI4E 2A2CA 1Z0WA 4U3DA 4MLVA 4HYMA 1WRJA 2E5LE 3HULA 3V5RA 2YTQA 1IBLE 2B9DA 2EMLA 1UDQA 4X64I 4X66I 2BR2B 2F1DA 2HFUA 4BA1B 2NABA 2RS7A 2EMHA 2GHFA 2R1FA 2EM6A 1UN6B 4UTGA 2JYAA 4JV5E 1YSAC 2RS6A 2FGGA 4HEIA 2VF3A 4R2QA 1XNRE 4WYQB 4DR2I 1N32E 4IFDA 1ZBTA 5AE1A 2V34A 1PKPA 1H7SA 4GEQB 4LF6I 2HKEA 1EH6A 4DXLA 4GZNC 4PRXA 2UXDI 4ED4A 2VQEE 2YRKA 2N8XA 2AJ4A 5EKWA 3J81C 1XMQE 1X6FA 2DEJA 2UUBI 1B69A 3EPHA 4GKKI 3HXLA 2CVEA 4OO1B 5IWAI 1XMOI 4BHCA 2GO3A 3L00A 2PO2B 2J7KA 3UK3C 4ZYDA 2DMYA 1A1LA 1Z5BA 1AAYA 2M4IA 2JVAA 2GLIA 4L5NC 1ZM9A 3HPSA 4JI0E 5TSEA 4DU8A 1FWKA 2UU9E 2HJJA 2EOYA 3JTZA 2EMKA 2EOQA 2Z5EA 4WFTA 3B8HA 4PRVA 2FV4B 3Q6NA 5K36D 5A2QC 1N3GA 3JU0A 1OYPA 2XEXA 2JEAB 2KONA 2PO1B 1YFHA 1BBOA 2V89A 1UDOA 2LVHA 1HNXI 2MKNA 2J7JA 5F3WA 4J3DA 3TQMA 1WHQA 3P1XA 4Q35B 1Z59A 4YY3I 1DGCA 4X65I 1T39A 2WBUA 1X6EA 2EMAA 5KL6A 4KQVA 4OX9I 2PNZA 4DR7I 2WNRB 1KYQA 3RMPA 1X3CA 2DLQA 1XHKA 2YRMA 3BGHA 4WXDA 2BR2A 4U3BA 3EPJA 1PJQA 1N34E 4F2JC 4DPXA 2NA2A 2YZTA 2MC6A 2A25A 3HTXA 4F6MA 5C0XD 3P3CA 1G2FC
chains in the Genus database with same CATH topology
4LFAE 3ZM7A 1H74A 4B3ME 4IZJD 2NUGA 4IZJB 4JI6E 4JI5I 4DV1I 2DIXA 4KHPI 2JOXA 4X64E 4X66E 1Y4SA 1UILA 2EFGA 1N33I 4X62E 3V2UC 1X49A 1VISA 2R42A 4L8NA 1Y4UA 3HJCA 3ZKDA 5FLXC 1S4EA 2EWLA 2V2QA 1Z0BA 5LL6R 4JI8E 4FN5A 3J7AM 2K4VA 2A2DA 4DV7I 3DF6A 2DEIA 4I3HA 4BC9A 2LTRA 3QT7A 1HNWI 1Z5CA 3AV0A 4P7DA 4F9AB 4GKJI 3T1HE 4LF4I 2F4VI 1Z0TA 2UU9I 2NUFA 1X47A 1IBME 4TUGA 5GMDA 5FLXQ 2OI2A 4LFBE 2L6MA 3DJWA 2MC6A 1H73A 1J26A 1FI4A 4B3TI 1H72C 2Z5CB 4DV5E 1YYKA 5BR8I 1I94I 4B3RI 3F6GA 4AQYI 1NZ0A 3F6HA 2WW4A 3PYGA 2V86A 5CFFE 4DR5E 2VE7C 2L3CA 1FJGE 4LF9E 3LMLA 4B3SE 4DUYE 4FWHA 2E1MA 5GMEA 3HPZA 4Z7YA 2BM0A 3C4BA 1RREA 4F9CB 1H7UA 2O1TA 4K0KE 1Z0CA 2RTXA 1K47A 1IBLI 4LF9I 3ADGA 2HK2A 2E5LI 3IWBA 2V88A 4DKKA 1N0UA 3FIGA 1N36I 1Z5AA 2UUCI 3J80Q 4DV4E 5BR8E 1I94E 2IOPA 4JI7I 4DR4E 5AASA 1RC7A 5AE3A 4LFCE 4DV2E 2CGEA 1Z0VA 2B7VA 4JI1E 3QT5A 5DNYA 2L2MA 2IHR1 4Q28A 2WZOA 1YZ9A 4BC7A 1WUUA 1MU5A 1ELOA 2UXBE 2PNLA 2CPNA 1A6FA 3WU4A 3ADJA 1ZXMA 1DQ3A 5A2QQ 2L8TA 4BBYA 1O0WA 5IT9Q 2EZ6A 4P78A 4DR3I 3HQ1A 1ZM3A 5LMNE 4JI7E 2VQFE 2UUAI 3LLHA 2M7QA 3M6AA 3OMLA 1N33E 2O1WA 3ZKBA 4DUZI 4DPUA 4IZKA 2HK3A 1KVKA 2Z5BB 4JI5E 4JI6I 5FWKA 4M1KA 4EMDA 2JWOA 1N36E 1NHJA 4NXME 4R03A 4P7AA 4LTYA 4YHHE 1GZ6A 4IZJA 4DR5I 1ZM4A 4LF5I 4LF8E 1KKHA 2UXCI 4NXMI 1J5EE 2LJPA 4YY3E 4KZSA 5IT9C 2V8PA 3F0NA 4TUIA 2GS8A 3ZZUA 1ZBQA 5T6JA 1J5EI 2IOQA 2LE2A 2UXCE 4DUYI 1HNXE 4YHHI 4JI3E 4JYAI 3LTOA 2MC5A 4BCAA 4LU9A 3LPSA 2LBSB 3AUZA 2BM1A 2NPFA 2F4VE 4BMJA 4JI2E 1ZM2A 4WUBA 3T1HI 3OTOI 4XTJA 5LMNI 3ADIA 2GQ0A 4LF7E 2N3HA 4DR3E 1SR9A 2O1VA 4J8ZA 2ZM6E 1HNWE 4LFBI 2L33A 2LUPB 1HR0I 4FWGA 3T1YI 2RSMA 3D4JA 5L3JA 4DR6E 1D6TA 4LF4E 2KHXA 3QT8A 4N3OA 1Z0GA 2L92A 4IZKB 1B62A 4DPTA 2HHHI 2FTXB 1UHZA 2JR1A 1USUA 3PYDA 4DR2E 3H09A 2LTSA 1FNMA 1HK7A 3T1YE 4DV7E 1HR0E 4JI1I 4JI8I 3Q6MA 4P52A 4LFCI 1FWLA 2KOUA 3ADLA 4WPYA 2JOBA 2HHHE 2F8BA 2M1SA 3IWDA 4F9BB 3OTOE 3GONA 1U2RA 5AE2A 4DR1I 4FWDA 3J7Yp 4HACA 1B63A 2B7TA 1X48A 4JYAE 2MDRA 3PYEA 4JI3I 3B78A 4DV3I 2LMZA 1S16A 2ZM6I 1PVGA 4DV2I 3JAMC 4LF7I 4MYUA 4K0KI 3IWCA 3KWRA 4B3MI 3WU5A 3J80C 2H36X 2LUQA 1DARA 4USMA 3VK6A 1FJGI 2X36A 4OX9E 4DR7E 4JG4A 4X65E 1RR9A 3WU6A 4B3RE 1ZXNA 4HACB 2ODRD 3ZOQB 4JI0I 1HNZE 1FKAE 2L3JA 4DPYA 4B3SI 4DV3E 3MSWA 2VF1A 4M0VA 2Z5BA 1RQ0A 1QU6A 3QT6A 1MG7A 1YYWA 4DR1E 4ZVIA 2N3GA 2VQFI 2LRSA 3PYFA 2NUEA 2BV3A 3PRYA 4OOGC 3ZZTA 2CG9A 4DUZE 1EA6A 2DB2A 4PU9A 4DMIA 4JV5I 2E1RA 2ZITA 2B3TB 3K85A 3CWVA 4GKJE 2UUAE 5ADZA 2L2KB 1XNRI 4DR6I 4HY1A 4DV0I 4X8WA 2HFSA 4HXZA 1NHIA 1STUA 4I8OA 4DV6E 2CZ9A 2V2VA 4RPFA 1T4NA 3J7AG 2UXBI 4DV1E 1BKNA 3K1JA 1MX0A 1NHHA 4JI2I 4DV4I 4LFAI 2X7IA 2JY9A 1N0VC 3B82A 1DI2A 1N34I 2R3VA 4DPWA 2Z5CA 3P06A 2G7HA 2V8QB 4DV6I 2UUCE 2PNMA 1IBKI 2DSYA 4DV0E 1KTVA 4LF8I 4LF5E 1EI1A 4R1FA 1GQEA 4WUDA 5LMUE 2LJHA 4BS9A 3VYXA 2V87A 1KIJA 2ZBKB 4NXNI 1UEKA 4B3TE 1WHNA 4WSPA 4WUCA 1WXRA 3H4LA 5IWAE 4AQYE 4NXNE 3C4TA 3Q1QA 4M30A 1PIEA 1Y6ZA 3JAMQ 4DV5I 5LMUI 1T4OA 2UXDE 1YYOA 4MYTA 2V85A 3VYYA 1HNZI 1OJ4A 1QZRA 1IBMI 1XMOE 2L2NA 2UUBE 4GKKE 1XMQI 2VQEI 3K6QA 2Q2EB 2ODRC 4LF6E 2YT4A 2O1UA 1N32I 4DU7A 2V2ZA 1XNQI 1Z0EA 1IBKE 1EKZA 3LNUA 4FW9A 3K17A 4UT4A 3WU3A 3ZZ0A 1USVA 1T4LB 4KHPE 4DR4I 2HKJA 4R8OA 4USKA 3J81Q 4JI4I 4Z7CA 4M2ZA 4X62I 2V83A 4URLA 1XNQE 4JI4E 2A2CA 1Z0WA 4HYMA 2E5LE 3HULA 3V5RA 1IBLE 2B9DA 4X64I 4X66I 2HFUA 2RS7A 4UTGA 4JV5E 2RS6A 2FGGA 2VF3A 1XNRE 4WYQB 4DR2I 1N32E 1ZBTA 5AE1A 2V34A 1H7SA 1PKPA 4GEQB 4LF6I 2HKEA 4DXLA 2UXDI 4PRXA 4ED4A 2VQEE 2AJ4A 3J81C 1XMQE 2UUBI 2DEJA 4GKKI 3HXLA 5IWAI 1XMOI 2J7KA 2DMYA 1Z5BA 2M4IA 2JVAA 4L5NC 1ZM9A 3HPSA 4JI0E 4DU8A 1FWKA 2UU9E 4PRVA 3JTZA 2Z5EA 3B8HA 4WFTA 2FV4B 3Q6NA 5A2QC 3JU0A 2XEXA 2KONA 2V89A 1HNXI 5F3WA 1WHQA 3P1XA 1Z59A 4YY3I 4X65I 4KQVA 4OX9I 4DR7I 3RMPA 1XHKA 1N34E 4DPXA 2NA2A 2YZTA 4F54A 3HTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA E;  3ZM7 A;  1H74 A;  4B3M E;  2NUG A;  4JI6 E;  4JI5 I;  4DV1 I;  2DIX A;  4KHP I;  4X64 E;  4X66 E;  1UIL A;  2EFG A;  1N33 I;  4X62 E;  3V2U C;  1X49 A;  1VIS A;  2R42 A;  3ZKD A;  5FLX C;  1S4E A;  2V2Q A;  1Z0B A;  4FN5 A;  4JI8 E;  5LL6 R;  3J7A M;  2A2D A;  4DV7 I;  2DEI A;  4I3H A;  2LTR A;  3QT7 A;  1HNW I;  1Z5C A;  4GKJ I;  3T1H E;  4LF4 I;  2F4V I;  1Z0T A;  2UU9 I;  2NUF A;  1X47 A;  1IBM E;  5FLX Q;  5GMD A;  2OI2 A;  4LFB E;  1H73 A;  1J26 A;  1FI4 A;  4B3T I;  1H72 C;  4DV5 E;  1YYK A;  5BR8 I;  1I94 I;  4B3R I;  4AQY I;  1NZ0 A;  2WW4 A;  3PYG A;  5CFF E;  2L3C A;  4DR5 E;  1FJG E;  4LF9 E;  4B3S E;  4DUY E;  4FWH A;  5GME A;  4Z7Y A;  2BM0 A;  3C4B A;  1RRE A;  1H7U A;  4K0K E;  1Z0C A;  2RTX A;  1K47 A;  1IBL I;  4LF9 I;  3ADG A;  2HK2 A;  2E5L I;  4DKK A;  1N0U A;  1N36 I;  1Z5A A;  2UUC I;  3J80 Q;  4DV4 E;  5BR8 E;  1I94 E;  4JI7 I;  4DR4 E;  1RC7 A;  4LFC E;  4DV2 E;  1Z0V A;  2B7V A;  4JI1 E;  3QT5 A;  2L2M A;  2IHR 1;  1YZ9 A;  1WUU A;  1MU5 A;  1ELO A;  2UXB E;  2CPN A;  1A6F A;  3WU4 A;  3ADJ A;  1ZXM A;  5A2Q Q;  1O0W A;  5IT9 Q;  2EZ6 A;  4DR3 I;  1ZM3 A;  5LMN E;  4JI7 E;  2VQF E;  2UUA I;  3LLH A;  3M6A A;  1N33 E;  3ZKB A;  4DUZ I;  4DPU A;  2HK3 A;  1KVK A;  4JI5 E;  4JI6 I;  4M1K A;  4EMD A;  1NHJ A;  1N36 E;  4NXM E;  4P7A A;  4YHH E;  4DR5 I;  1ZM4 A;  4LF5 I;  4LF8 E;  1KKH A;  2UXC I;  4NXM I;  1J5E E;  2LJP A;  4YY3 E;  2V8P A;  3F0N A;  5IT9 C;  2GS8 A;  3ZZU A;  1J5E I;  2UXC E;  4DUY I;  1HNX E;  4YHH I;  4JI3 E;  4JYA I;  3LTO A;  3LPS A;  2LBS B;  2BM1 A;  2NPF A;  2F4V E;  3T1H I;  4JI2 E;  1ZM2 A;  4WUB A;  3OTO I;  4XTJ A;  5LMN I;  3ADI A;  4LF7 E;  2N3H A;  4DR3 E;  2ZM6 E;  1HNW E;  4LFB I;  2L33 A;  2LUP B;  1HR0 I;  4FWG A;  3T1Y I;  2RSM A;  3D4J A;  5L3J A;  4DR6 E;  1D6T A;  4LF4 E;  2KHX A;  3QT8 A;  1Z0G A;  1B62 A;  4DPT A;  2HHH I;  1UHZ A;  3PYD A;  4DR2 E;  2LTS A;  1FNM A;  3T1Y E;  4DV7 E;  1HR0 E;  4JI1 I;  4JI8 I;  4P52 A;  4LFC I;  1FWL A;  3ADL A;  2HHH E;  3OTO E;  3GON A;  1U2R A;  4DR1 I;  4FWD A;  3J7Y p;  4HAC A;  1B63 A;  2B7T A;  1X48 A;  4JYA E;  2MDR A;  3PYE A;  4JI3 I;  3B78 A;  4DV3 I;  1S16 A;  2ZM6 I;  1PVG A;  4DV2 I;  3JAM C;  4LF7 I;  4MYU A;  4K0K I;  4B3M I;  3WU5 A;  3J80 C;  2LUQ A;  1DAR A;  4USM A;  1FJG I;  2X36 A;  4OX9 E;  4DR7 E;  4JG4 A;  4X65 E;  1RR9 A;  3WU6 A;  4B3R E;  1ZXN A;  4HAC B;  4JI0 I;  1HNZ E;  1FKA E;  2L3J A;  4DPY A;  4B3S I;  4DV3 E;  1RQ0 A;  1QU6 A;  3QT6 A;  1MG7 A;  1YYW A;  4DR1 E;  4ZVI A;  2N3G A;  2VQF I;  2LRS A;  3PYF A;  2NUE A;  2BV3 A;  4OOG C;  3ZZT A;  4DUZ E;  1EA6 A;  2DB2 A;  4PU9 A;  4JV5 I;  2E1R A;  2ZIT A;  2B3T B;  3CWV A;  4GKJ E;  2UUA E;  2L2K B;  1XNR I;  4DR6 I;  4HY1 A;  4DV0 I;  4X8W A;  2HFS A;  4HXZ A;  1NHI A;  1STU A;  4DV6 E;  2CZ9 A;  2V2V A;  4RPF A;  1T4N A;  3J7A G;  2UXB I;  4DV1 E;  1BKN A;  3K1J A;  1MX0 A;  1NHH A;  4JI2 I;  4DV4 I;  4LFA I;  2X7I A;  2JY9 A;  1N0V C;  3B82 A;  1DI2 A;  1N34 I;  2R3V A;  4DPW A;  4DV6 I;  2UUC E;  1IBK I;  4DV0 E;  1KTV A;  4LF8 I;  4LF5 E;  1EI1 A;  4R1F A;  1GQE A;  4WUD A;  5LMU E;  2LJH A;  3VYX A;  1KIJ A;  2ZBK B;  4NXN I;  1UEK A;  4B3T E;  1WHN A;  4WUC A;  3H4L A;  5IWA E;  4AQY E;  4NXN E;  3C4T A;  3Q1Q A;  4M30 A;  1PIE A;  3JAM Q;  4DV5 I;  5LMU I;  1T4O A;  2UXD E;  1YYO A;  4MYT A;  3VYY A;  1HNZ I;  1OJ4 A;  1QZR A;  1IBM I;  1XMO E;  2L2N A;  2UUB E;  4GKK E;  1XMQ I;  2VQE I;  2Q2E B;  4LF6 E;  2YT4 A;  1N32 I;  4DU7 A;  2V2Z A;  1XNQ I;  1Z0E A;  1IBK E;  1EKZ A;  3LNU A;  4FW9 A;  3K17 A;  4UT4 A;  3WU3 A;  3ZZ0 A;  1T4L B;  4KHP E;  4DR4 I;  2HKJ A;  4USK A;  3J81 Q;  4JI4 I;  4Z7C A;  4M2Z A;  4X62 I;  4URL A;  1XNQ E;  4JI4 E;  2A2C A;  1Z0W A;  4HYM A;  2E5L E;  3HUL A;  3V5R A;  1IBL E;  4X64 I;  4X66 I;  2HFU A;  2RS7 A;  4UTG A;  4JV5 E;  2RS6 A;  2VF3 A;  1XNR E;  4WYQ B;  4DR2 I;  1N32 E;  1ZBT A;  2V34 A;  1PKP A;  1H7S A;  4LF6 I;  2HKE A;  4DXL A;  2UXD I;  4PRX A;  4ED4 A;  2VQE E;  2AJ4 A;  3J81 C;  1XMQ E;  2UUB I;  2DEJ A;  4GKK I;  5IWA I;  1XMO I;  2J7K A;  2DMY A;  1Z5B A;  2JVA A;  1ZM9 A;  4JI0 E;  4DU8 A;  1FWK A;  2UU9 E;  4PRV A;  3B8H A;  4WFT A;  5A2Q C;  2XEX A;  1HNX I;  1WHQ A;  3P1X A;  1Z59 A;  4YY3 I;  4X65 I;  4KQV A;  4OX9 I;  4DR7 I;  1XHK A;  1N34 E;  4DPX A;  2NA2 A;  3HTX A; 
#chains in the Genus database with same CATH topology
 4LFA E;  3ZM7 A;  1H74 A;  3EQ1 A;  4B3M E;  5C0X E;  5AC5 A;  2EOO A;  2NN6 B;  4IZJ D;  5IV8 B;  2NUG A;  4IZJ B;  4JI6 E;  5C0X A;  4JI5 I;  1G2D C;  3PS2 A;  4DV1 I;  2DIX A;  4KHP I;  2JOX A;  4X64 E;  2ELY A;  4X66 E;  1Y4S A;  1UIL A;  2EFG A;  2JE6 B;  1N33 I;  3P76 A;  4LCG A;  1VI7 A;  3BBG A;  4X62 E;  3V2U C;  1X49 A;  1VIS A;  2R42 A;  4L8N A;  1A1G A;  1Y4U A;  4OO1 E;  3HJC A;  3ZKD A;  5FLX C;  2EM0 A;  2EWL A;  1S4E A;  2LJU A;  2V2Q A;  4FW7 A;  1Z0B A;  2EMY A;  2YTD A;  5LL6 R;  4JI8 E;  3C6K A;  2NN6 F;  4FN5 A;  3J7A M;  2K4V A;  2YTG A;  2A2D A;  3DF6 A;  2DEI A;  4I3H A;  4DV7 I;  5DRQ A;  4BC9 A;  2LTR A;  2EM7 A;  2EL6 A;  2EMI A;  1JK2 A;  1TF6 A;  3QT7 A;  2EMX A;  1HNW I;  2EPA A;  1A1H A;  1Z5C A;  1GTK A;  3EPL A;  1ZR9 A;  4FW5 A;  3AV0 A;  4P7D A;  4F9A B;  2JEB B;  2JE6 A;  4GKJ I;  3T1H E;  4N4R B;  4LF4 I;  2F4V I;  2YSP A;  1Z0T A;  2UU9 I;  2NUF A;  2EM4 A;  1X47 A;  1IBM E;  2ELZ A;  4TUG A;  5GMD A;  5FLX Q;  2OI2 A;  2WBT A;  2L6M A;  3DJW A;  4F54 A;  1JK1 A;  4LFB E;  3GME A;  1H73 A;  1ZAA C;  1X6H A;  1J26 A;  1FI4 A;  2EMG A;  4B3T I;  1H72 C;  2Z5C B;  2YTF A;  4DV5 E;  1YYK A;  4NHR A;  2EN6 A;  3THO B;  3M85 D;  5BR8 I;  3CDJ A;  4RH8 A;  1I94 I;  4IFD D;  4B3R I;  2IES A;  4M9V C;  3F6G A;  4AQY I;  3L7Z A;  1NZ0 A;  3F6H A;  2WW4 A;  3L7Z B;  2WP8 B;  1PJS A;  3PYG A;  2O3Z A;  2JXP A;  2V86 A;  5CFF E;  2VE7 C;  2L3C A;  4DR5 E;  2JP9 A;  1FJG E;  1OYS A;  4LF9 E;  5K36 A;  3LML A;  4B3S E;  4DUY E;  5K36 C;  4FWH A;  2YTE A;  4MDT A;  2E1M A;  2C38 A;  5GME A;  3HPZ A;  3THN A;  4OZE A;  2BM0 A;  3C4B A;  1RRE A;  4F9C B;  4Z7Y A;  4R2P A;  2EN1 A;  1H7U A;  2JPA A;  4R2E A;  4K0K E;  2O1T A;  1Z0C A;  2RTX A;  1UBD C;  1K47 A;  1IBL I;  3P3E A;  2AE8 A;  4LF9 I;  3ADG A;  2HK2 A;  3GLL A;  2E5L I;  3IWB A;  2V88 A;  3M85 G;  2EN3 A;  4DKK A;  1N0U A;  3FIG A;  1N36 I;  1Z5A A;  2RPC A;  2UUC I;  3J80 Q;  4DV4 E;  4FK5 C;  5BR8 E;  1I94 E;  4IS9 A;  2IOP A;  4JI7 I;  4DR4 E;  5AAS A;  1RC7 A;  2EPN A;  4NBQ A;  5AE3 A;  2MDG A;  2C39 A;  4LFC E;  4DV2 E;  4BHB A;  2CGE A;  1Z0V A;  1T38 A;  2B7V A;  1A1I A;  4WX9 A;  4JI1 E;  2CSH A;  3QT5 A;  2IER A;  5DNY A;  2L2M A;  2IHR 1;  2EPU A;  4Q28 A;  3KRN A;  2WZO A;  1YZ9 A;  4BC7 A;  1UDS A;  1WUU A;  3H1C A;  1MU5 A;  1ELO A;  1YUJ A;  2UXB E;  2PNL A;  4BA2 B;  5A6K A;  1EH7 A;  2CPN A;  2EPZ A;  5C0X C;  1A6F A;  3WU4 A;  1NEI A;  3ADJ A;  1L4S A;  2EMW A;  2EL4 A;  1ZXM A;  1RMD A;  1DQ3 A;  5A2Q Q;  3DD6 A;  2L8T A;  5A6J A;  4BBY A;  1O0W A;  2EQ1 A;  1YH8 A;  2NN6 A;  5IT9 Q;  2EZ6 A;  4P78 A;  2WP8 A;  2LO3 A;  4DR3 I;  2C39 B;  3HQ1 A;  1ZM3 A;  5LMN E;  2VES A;  2EM2 A;  3MHS C;  4JI7 E;  2VQF E;  5LLQ A;  2UUA I;  2EOS A;  3LLH A;  4MU4 A;  2PO0 A;  5EL9 A;  3B4T A;  4QNK A;  2M9A A;  2M7Q A;  3M6A A;  3OML A;  1N33 E;  2EPM X;  2O1W A;  3ZKB A;  4DUZ I;  4DPU A;  2JT2 A;  4IZK A;  2HK3 A;  1KVK A;  2Z5B B;  4R2S A;  4JI5 E;  4JI6 I;  4BA1 A;  5FWK A;  4M1K A;  2GPI A;  2YRH A;  4EMD A;  2JWO A;  1N36 E;  1NHJ A;  2EPC A;  2EQ3 A;  4NXM E;  5JEA C;  4R03 A;  2MKD A;  4MLQ A;  4P7A A;  4LTY A;  4YHH E;  1GZ6 A;  4IZJ A;  5KL4 A;  4DR5 I;  1ZM4 A;  4LF5 I;  4LF8 E;  5DNL A;  1KKH A;  2UXC I;  1BBG A;  1XXE A;  1J5E E;  4NXM I;  2LJP A;  2YSO A;  4YY3 E;  4KZS A;  5IT9 C;  2V8P A;  3F0N A;  2PO0 B;  4MU1 A;  4TUI A;  2GS8 A;  3ZZU A;  1ZBQ A;  5T6J A;  1J5E I;  2IOQ A;  2WBS A;  2LE2 A;  2UXC E;  4DUY I;  2K7I A;  1HNX E;  2YTP A;  4YHH I;  4JI3 E;  2C37 A;  2NN6 E;  2MC5 A;  4O24 A;  3LTO A;  4BCA A;  1PDA A;  4LU9 A;  4ZYH A;  5KL3 A;  1R6M A;  1WJP A;  2LBS B;  3LPS A;  3AUZ A;  4IS1 C;  2BM1 A;  5DNX A;  2NPF A;  1OYR A;  4IFD F;  2EM5 A;  4BMJ A;  4JI2 E;  2F4V E;  1ZM2 A;  4MU3 A;  2EOE A;  4WUB A;  3OTO I;  2R76 A;  4R2A A;  3UHM A;  4XTJ A;  5LMN I;  3ADI A;  2GQ0 A;  4LF7 E;  2N3H A;  5JEA A;  4DR3 E;  1SR9 A;  2O1V A;  4J8Z A;  5IXM B;  2ZM6 E;  1HNW E;  5JEA B;  4LFB I;  2L33 A;  2LUP B;  5A6B D;  4FWG A;  1HR0 I;  3T1Y I;  1R6L A;  2YWQ A;  2RSM A;  3D4J A;  5L3J A;  5K36 F;  2EJ4 A;  2CTD A;  4DR6 E;  4LPF A;  1D6T A;  4LF4 E;  2KHX A;  3QT8 A;  3M7N D;  4N3O A;  4GQU A;  1Z0G A;  2L92 A;  4IZK B;  1B62 A;  4DPT A;  2HHH I;  5AC4 A;  2FTX B;  1NCS A;  2EOF A;  1UHZ A;  2JR1 A;  3BF2 A;  4AID A;  1USU A;  3PYD A;  4DR2 E;  2WCC 3;  3H09 A;  2LTS A;  2BA0 G;  1E3H A;  1FNM A;  3KZZ A;  1HK7 A;  3T1Y E;  4DV7 E;  1HR0 E;  4JI1 I;  2EN4 A;  2EQ0 A;  3C6M A;  2PRT A;  1TF3 A;  4JI8 I;  3Q6M A;  4P52 A;  4LFC I;  1FWL A;  2KOU A;  3U1Y A;  3ADL A;  2EOZ A;  4WPY A;  2EPO A;  2JOB A;  2HHH E;  2F8B A;  2M1S A;  3IWD A;  4F9B B;  3OTO E;  2BA1 D;  3M99 B;  1U2R A;  3GON A;  5AE2 A;  4DR1 I;  4FWD A;  2C38 B;  3J7Y p;  1LLM C;  2RSI A;  1B63 A;  4HAC A;  2B7T A;  1X48 A;  4JYA E;  2BBG A;  2MDR A;  4R2D A;  3PYE A;  4JI3 I;  1YUI A;  3B78 A;  2LMZ A;  1S16 A;  2PO2 A;  2ZM6 I;  2LV2 A;  1PVG A;  4DV3 I;  4DV2 I;  3JAM C;  2EPK X;  4LF7 I;  4MYU A;  2NN6 C;  4K0K I;  2EN8 A;  3IWC A;  3KWR A;  1BB8 A;  1IBK I;  4B3M I;  3MHH C;  1Y5Y A;  3WU5 A;  3GCM A;  3J80 C;  4F6N A;  2H36 X;  2YTJ A;  4KWY A;  2LUQ A;  4FW6 A;  1DAR A;  4USM A;  3VK6 A;  4O43 A;  4FW3 A;  4ZYG A;  1FJG I;  2PO1 A;  1MGT A;  4OX9 E;  4DR7 E;  2X36 A;  4JG4 A;  4X65 E;  4JYA I;  2LT7 A;  1YHC A;  1RR9 A;  3WU6 A;  5JEA E;  4B3R E;  1Y60 A;  1ZXN A;  4HAC B;  5KL2 A;  2ODR D;  3ZOQ B;  1A1J A;  4OKG A;  5DRP A;  4JI0 I;  1HNZ E;  1FKA E;  2L3J A;  4DPY A;  4B3S I;  5A69 A;  2CT1 A;  4DV3 E;  3MSW A;  4BA2 A;  2VF1 A;  4M0V A;  2Z5B A;  1RQ0 A;  1QU6 A;  1QNT A;  3QT6 A;  1MG7 A;  2EP3 A;  4DR1 E;  1YYW A;  4ZVI A;  4OO1 C;  2EOH A;  5A6A A;  2DMI A;  2N3G A;  2VQF I;  2LRS A;  3PYF A;  2NUE A;  4AIM A;  2BV3 A;  5DRO A;  4O4K A;  3PRY A;  4OOG C;  3ZZT A;  5K36 B;  2HC5 A;  2CG9 A;  4DUZ E;  2DGC A;  2EMF A;  2DB2 A;  1EA6 A;  4PU9 A;  4DMI A;  2I9I A;  4JV5 I;  1IQO A;  2E1R A;  2EOX A;  3T1H I;  1UDN A;  1PJT A;  4WXC A;  2ZIT A;  1ZU1 A;  2EOJ A;  2B3T B;  3K85 A;  4AM3 A;  3CWV A;  3HKM A;  4GKJ E;  2EOM A;  2UUA E;  4O5G A;  2ADR A;  5ADZ A;  1IMU A;  2EM9 A;  2L2K B;  4LCF A;  2BA0 D;  4LOM A;  4OO1 D;  1XNR I;  4DR6 I;  4HY1 A;  4DV0 I;  4X8W A;  2EM8 A;  2HFS A;  4HXZ A;  1NHI A;  1STU A;  2Q8U A;  4I8O A;  4IJD A;  4DV6 E;  2HGH A;  2ENA A;  2CZ9 A;  2EL5 A;  2V2V A;  4RPF A;  1T4N A;  2E72 A;  1F2I G;  3J7A G;  5C0X B;  2UXB I;  4DV1 E;  1BKN A;  3K1J A;  1RHY A;  1MX0 A;  1NHH A;  4JI2 I;  4DV4 I;  2DRP A;  4LFA I;  2X7I A;  2JY9 A;  1N0V C;  3B82 A;  1DI2 A;  1N34 I;  2YTI A;  2EMB A;  1MEY C;  4IFD C;  2PNZ B;  5DRR A;  2EOR A;  2R3V A;  2YU8 A;  4DPW A;  2Z5C A;  3P06 A;  1EH8 A;  1Z1B A;  2G7H A;  2V8Q B;  4QNJ A;  4DV6 I;  2EPX A;  2UUC E;  4HTG A;  2DLK A;  2EOI A;  2EMC A;  2DSY A;  1TN9 A;  2PNM A;  5C0X F;  4DV0 E;  1A1F A;  1KTV A;  3NZK A;  5JEA D;  4WSG A;  4IFD E;  3QG5 C;  4ZYE A;  2JEA A;  4LF8 I;  4LF5 E;  2LCE A;  1AH5 A;  1EI1 A;  4X9J A;  4R1F A;  1GQE A;  4WUD A;  2J65 A;  5LMU E;  2LJH A;  4BS9 A;  3VYX A;  2V87 A;  1X5W A;  2BB8 A;  2EM3 A;  2VRD A;  4R2R A;  1KIJ A;  5K36 E;  1A1K A;  2ZBK B;  4OO1 A;  4NXN I;  3M7N G;  1YPN A;  5KL5 A;  1UEK A;  4MQY A;  4B3T E;  1WHN A;  4OO1 F;  2EPR A;  4WSP A;  4WUC A;  5KL7 A;  1WXR A;  1P47 A;  1E3P A;  3H4L A;  5IWA E;  2BA1 G;  4AQY E;  4NXN E;  3C4T A;  3EPK A;  4M30 A;  2NN6 D;  3Q1Q A;  2YTN A;  4ISA A;  1PIE A;  4R2C A;  1Y6Z A;  3JAM Q;  4DV5 I;  5LMU I;  1T4O A;  1SFE A;  2ENC A;  2UXD E;  3PS1 A;  1YYO A;  2RQL A;  4MYT A;  2YPN A;  2JEB A;  2V85 A;  3VYY A;  1HNZ I;  1OJ4 A;  1QZR A;  2EN7 A;  1KJK A;  1XMO E;  1IBM I;  2EN2 A;  2GO4 A;  2L2N A;  3KZY A;  2D9H A;  2UUB E;  4GKK E;  1XMQ I;  2ENH A;  2VQE I;  3K6Q A;  2Q2E B;  3P3G A;  3PS3 A;  4NZV A;  2ODR C;  4LF6 E;  2WNR A;  2YT4 A;  2O1U A;  5ELW A;  2C37 B;  1N32 I;  4DU7 A;  2YU5 A;  2EE8 A;  2V2Z A;  1XNQ I;  2EMZ A;  1Z0E A;  4LCH A;  1IBK E;  1EKZ A;  1P42 A;  3LNU A;  4RHB B;  4FW9 A;  3K17 A;  3CDI A;  4UT4 A;  4MU0 A;  3WU3 A;  3ZZ0 A;  1USV A;  2EPL X;  3BID A;  2I13 A;  4FW4 A;  2EPP A;  2YTO A;  3ECR A;  1T4L B;  4KHP E;  3U1K A;  4IFD B;  4DR4 I;  2HKJ A;  1IQS A;  4R8O A;  5A6B A;  4USK A;  3VHT B;  3J81 Q;  4JI4 I;  4Z7C A;  4M2Z A;  4X62 I;  2V83 A;  5JEA F;  4URL A;  1XNQ E;  4JI4 E;  2A2C A;  1Z0W A;  4U3D A;  4MLV A;  4HYM A;  1WRJ A;  2E5L E;  3HUL A;  3V5R A;  2YTQ A;  1IBL E;  2B9D A;  2EML A;  1UDQ A;  4X64 I;  4X66 I;  2BR2 B;  2F1D A;  2HFU A;  4BA1 B;  2NAB A;  2RS7 A;  2EMH A;  2GHF A;  2R1F A;  2EM6 A;  1UN6 B;  4UTG A;  2JYA A;  4JV5 E;  1YSA C;  2RS6 A;  2FGG A;  4HEI A;  2VF3 A;  4R2Q A;  1XNR E;  4WYQ B;  4DR2 I;  1N32 E;  4IFD A;  1ZBT A;  5AE1 A;  2V34 A;  1PKP A;  1H7S A;  4GEQ B;  4LF6 I;  2HKE A;  1EH6 A;  4DXL A;  4GZN C;  4PRX A;  2UXD I;  4ED4 A;  2VQE E;  2YRK A;  2N8X A;  2AJ4 A;  5EKW A;  3J81 C;  1XMQ E;  1X6F A;  2DEJ A;  2UUB I;  1B69 A;  3EPH A;  4GKK I;  3HXL A;  2CVE A;  4OO1 B;  5IWA I;  1XMO I;  4BHC A;  2GO3 A;  3L00 A;  2PO2 B;  2J7K A;  3UK3 C;  4ZYD A;  2DMY A;  1A1L A;  1Z5B A;  1AAY A;  2M4I A;  2JVA A;  2GLI A;  4L5N C;  1ZM9 A;  3HPS A;  4JI0 E;  5TSE A;  4DU8 A;  1FWK A;  2UU9 E;  2HJJ A;  2EOY A;  3JTZ A;  2EMK A;  2EOQ A;  2Z5E A;  4WFT A;  3B8H A;  4PRV A;  2FV4 B;  3Q6N A;  5K36 D;  5A2Q C;  1N3G A;  3JU0 A;  1OYP A;  2XEX A;  2JEA B;  2KON A;  2PO1 B;  1YFH A;  1BBO A;  2V89 A;  1UDO A;  2LVH A;  1HNX I;  2MKN A;  2J7J A;  5F3W A;  4J3D A;  3TQM A;  1WHQ A;  3P1X A;  4Q35 B;  1Z59 A;  4YY3 I;  1DGC A;  4X65 I;  1T39 A;  2WBU A;  1X6E A;  2EMA A;  5KL6 A;  4KQV A;  4OX9 I;  2PNZ A;  4DR7 I;  2WNR B;  1KYQ A;  3RMP A;  1X3C A;  2DLQ A;  1XHK A;  2YRM A;  3BGH A;  4WXD A;  2BR2 A;  4U3B A;  3EPJ A;  1PJQ A;  1N34 E;  4F2J C;  4DPX A;  2NA2 A;  2YZT A;  2MC6 A;  2A25 A;  3HTX A;  4F6M A;  5C0X D;  3P3C A;  1G2F C; 
#chains in the Genus database with same CATH homology
 4LFA E;  3ZM7 A;  1H74 A;  4B3M E;  4IZJ D;  2NUG A;  4IZJ B;  4JI6 E;  4JI5 I;  4DV1 I;  2DIX A;  4KHP I;  2JOX A;  4X64 E;  4X66 E;  1Y4S A;  1UIL A;  2EFG A;  1N33 I;  4X62 E;  3V2U C;  1X49 A;  1VIS A;  2R42 A;  4L8N A;  1Y4U A;  3HJC A;  3ZKD A;  5FLX C;  1S4E A;  2EWL A;  2V2Q A;  1Z0B A;  5LL6 R;  4JI8 E;  4FN5 A;  3J7A M;  2K4V A;  2A2D A;  4DV7 I;  3DF6 A;  2DEI A;  4I3H A;  4BC9 A;  2LTR A;  3QT7 A;  1HNW I;  1Z5C A;  3AV0 A;  4P7D A;  4F9A B;  4GKJ I;  3T1H E;  4LF4 I;  2F4V I;  1Z0T A;  2UU9 I;  2NUF A;  1X47 A;  1IBM E;  4TUG A;  5GMD A;  5FLX Q;  2OI2 A;  4LFB E;  2L6M A;  3DJW A;  2MC6 A;  1H73 A;  1J26 A;  1FI4 A;  4B3T I;  1H72 C;  2Z5C B;  4DV5 E;  1YYK A;  5BR8 I;  1I94 I;  4B3R I;  3F6G A;  4AQY I;  1NZ0 A;  3F6H A;  2WW4 A;  3PYG A;  2V86 A;  5CFF E;  4DR5 E;  2VE7 C;  2L3C A;  1FJG E;  4LF9 E;  3LML A;  4B3S E;  4DUY E;  4FWH A;  2E1M A;  5GME A;  3HPZ A;  4Z7Y A;  2BM0 A;  3C4B A;  1RRE A;  4F9C B;  1H7U A;  2O1T A;  4K0K E;  1Z0C A;  2RTX A;  1K47 A;  1IBL I;  4LF9 I;  3ADG A;  2HK2 A;  2E5L I;  3IWB A;  2V88 A;  4DKK A;  1N0U A;  3FIG A;  1N36 I;  1Z5A A;  2UUC I;  3J80 Q;  4DV4 E;  5BR8 E;  1I94 E;  2IOP A;  4JI7 I;  4DR4 E;  5AAS A;  1RC7 A;  5AE3 A;  4LFC E;  4DV2 E;  2CGE A;  1Z0V A;  2B7V A;  4JI1 E;  3QT5 A;  5DNY A;  2L2M A;  2IHR 1;  4Q28 A;  2WZO A;  1YZ9 A;  4BC7 A;  1WUU A;  1MU5 A;  1ELO A;  2UXB E;  2PNL A;  2CPN A;  1A6F A;  3WU4 A;  3ADJ A;  1ZXM A;  1DQ3 A;  5A2Q Q;  2L8T A;  4BBY A;  1O0W A;  5IT9 Q;  2EZ6 A;  4P78 A;  4DR3 I;  3HQ1 A;  1ZM3 A;  5LMN E;  4JI7 E;  2VQF E;  2UUA I;  3LLH A;  2M7Q A;  3M6A A;  3OML A;  1N33 E;  2O1W A;  3ZKB A;  4DUZ I;  4DPU A;  4IZK A;  2HK3 A;  1KVK A;  2Z5B B;  4JI5 E;  4JI6 I;  5FWK A;  4M1K A;  4EMD A;  2JWO A;  1N36 E;  1NHJ A;  4NXM E;  4R03 A;  4P7A A;  4LTY A;  4YHH E;  1GZ6 A;  4IZJ A;  4DR5 I;  1ZM4 A;  4LF5 I;  4LF8 E;  1KKH A;  2UXC I;  4NXM I;  1J5E E;  2LJP A;  4YY3 E;  4KZS A;  5IT9 C;  2V8P A;  3F0N A;  4TUI A;  2GS8 A;  3ZZU A;  1ZBQ A;  5T6J A;  1J5E I;  2IOQ A;  2LE2 A;  2UXC E;  4DUY I;  1HNX E;  4YHH I;  4JI3 E;  4JYA I;  3LTO A;  2MC5 A;  4BCA A;  4LU9 A;  3LPS A;  2LBS B;  3AUZ A;  2BM1 A;  2NPF A;  2F4V E;  4BMJ A;  4JI2 E;  1ZM2 A;  4WUB A;  3T1H I;  3OTO I;  4XTJ A;  5LMN I;  3ADI A;  2GQ0 A;  4LF7 E;  2N3H A;  4DR3 E;  1SR9 A;  2O1V A;  4J8Z A;  2ZM6 E;  1HNW E;  4LFB I;  2L33 A;  2LUP B;  1HR0 I;  4FWG A;  3T1Y I;  2RSM A;  3D4J A;  5L3J A;  4DR6 E;  1D6T A;  4LF4 E;  2KHX A;  3QT8 A;  4N3O A;  1Z0G A;  2L92 A;  4IZK B;  1B62 A;  4DPT A;  2HHH I;  2FTX B;  1UHZ A;  2JR1 A;  1USU A;  3PYD A;  4DR2 E;  3H09 A;  2LTS A;  1FNM A;  1HK7 A;  3T1Y E;  4DV7 E;  1HR0 E;  4JI1 I;  4JI8 I;  3Q6M A;  4P52 A;  4LFC I;  1FWL A;  2KOU A;  3ADL A;  4WPY A;  2JOB A;  2HHH E;  2F8B A;  2M1S A;  3IWD A;  4F9B B;  3OTO E;  3GON A;  1U2R A;  5AE2 A;  4DR1 I;  4FWD A;  3J7Y p;  4HAC A;  1B63 A;  2B7T A;  1X48 A;  4JYA E;  2MDR A;  3PYE A;  4JI3 I;  3B78 A;  4DV3 I;  2LMZ A;  1S16 A;  2ZM6 I;  1PVG A;  4DV2 I;  3JAM C;  4LF7 I;  4MYU A;  4K0K I;  3IWC A;  3KWR A;  4B3M I;  3WU5 A;  3J80 C;  2H36 X;  2LUQ A;  1DAR A;  4USM A;  3VK6 A;  1FJG I;  2X36 A;  4OX9 E;  4DR7 E;  4JG4 A;  4X65 E;  1RR9 A;  3WU6 A;  4B3R E;  1ZXN A;  4HAC B;  2ODR D;  3ZOQ B;  4JI0 I;  1HNZ E;  1FKA E;  2L3J A;  4DPY A;  4B3S I;  4DV3 E;  3MSW A;  2VF1 A;  4M0V A;  2Z5B A;  1RQ0 A;  1QU6 A;  3QT6 A;  1MG7 A;  1YYW A;  4DR1 E;  4ZVI A;  2N3G A;  2VQF I;  2LRS A;  3PYF A;  2NUE A;  2BV3 A;  3PRY A;  4OOG C;  3ZZT A;  2CG9 A;  4DUZ E;  1EA6 A;  2DB2 A;  4PU9 A;  4DMI A;  4JV5 I;  2E1R A;  2ZIT A;  2B3T B;  3K85 A;  3CWV A;  4GKJ E;  2UUA E;  5ADZ A;  2L2K B;  1XNR I;  4DR6 I;  4HY1 A;  4DV0 I;  4X8W A;  2HFS A;  4HXZ A;  1NHI A;  1STU A;  4I8O A;  4DV6 E;  2CZ9 A;  2V2V A;  4RPF A;  1T4N A;  3J7A G;  2UXB I;  4DV1 E;  1BKN A;  3K1J A;  1MX0 A;  1NHH A;  4JI2 I;  4DV4 I;  4LFA I;  2X7I A;  2JY9 A;  1N0V C;  3B82 A;  1DI2 A;  1N34 I;  2R3V A;  4DPW A;  2Z5C A;  3P06 A;  2G7H A;  2V8Q B;  4DV6 I;  2UUC E;  2PNM A;  1IBK I;  2DSY A;  4DV0 E;  1KTV A;  4LF8 I;  4LF5 E;  1EI1 A;  4R1F A;  1GQE A;  4WUD A;  5LMU E;  2LJH A;  4BS9 A;  3VYX A;  2V87 A;  1KIJ A;  2ZBK B;  4NXN I;  1UEK A;  4B3T E;  1WHN A;  4WSP A;  4WUC A;  1WXR A;  3H4L A;  5IWA E;  4AQY E;  4NXN E;  3C4T A;  3Q1Q A;  4M30 A;  1PIE A;  1Y6Z A;  3JAM Q;  4DV5 I;  5LMU I;  1T4O A;  2UXD E;  1YYO A;  4MYT A;  2V85 A;  3VYY A;  1HNZ I;  1OJ4 A;  1QZR A;  1IBM I;  1XMO E;  2L2N A;  2UUB E;  4GKK E;  1XMQ I;  2VQE I;  3K6Q A;  2Q2E B;  2ODR C;  4LF6 E;  2YT4 A;  2O1U A;  1N32 I;  4DU7 A;  2V2Z A;  1XNQ I;  1Z0E A;  1IBK E;  1EKZ A;  3LNU A;  4FW9 A;  3K17 A;  4UT4 A;  3WU3 A;  3ZZ0 A;  1USV A;  1T4L B;  4KHP E;  4DR4 I;  2HKJ A;  4R8O A;  4USK A;  3J81 Q;  4JI4 I;  4Z7C A;  4M2Z A;  4X62 I;  2V83 A;  4URL A;  1XNQ E;  4JI4 E;  2A2C A;  1Z0W A;  4HYM A;  2E5L E;  3HUL A;  3V5R A;  1IBL E;  2B9D A;  4X64 I;  4X66 I;  2HFU A;  2RS7 A;  4UTG A;  4JV5 E;  2RS6 A;  2FGG A;  2VF3 A;  1XNR E;  4WYQ B;  4DR2 I;  1N32 E;  1ZBT A;  5AE1 A;  2V34 A;  1H7S A;  1PKP A;  4GEQ B;  4LF6 I;  2HKE A;  4DXL A;  2UXD I;  4PRX A;  4ED4 A;  2VQE E;  2AJ4 A;  3J81 C;  1XMQ E;  2UUB I;  2DEJ A;  4GKK I;  3HXL A;  5IWA I;  1XMO I;  2J7K A;  2DMY A;  1Z5B A;  2M4I A;  2JVA A;  4L5N C;  1ZM9 A;  3HPS A;  4JI0 E;  4DU8 A;  1FWK A;  2UU9 E;  4PRV A;  3JTZ A;  2Z5E A;  3B8H A;  4WFT A;  2FV4 B;  3Q6N A;  5A2Q C;  3JU0 A;  2XEX A;  2KON A;  2V89 A;  1HNX I;  5F3W A;  1WHQ A;  3P1X A;  1Z59 A;  4YY3 I;  4X65 I;  4KQV A;  4OX9 I;  4DR7 I;  3RMP A;  1XHK A;  1N34 E;  4DPX A;  2NA2 A;  2YZT A;  4F54 A;  3HTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...