4AQYE

Structure of ribosome-apramycin complexes
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4aqyE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4aqyE02
4DPXA 4EMDA 2UXBE 4NXNE 4DV2I 4DV7I 2HFSA 4WFTA 2DEJA 2UU9I 3JAMQ 2VQFI 1Z0CA 4UT4A 4JI8I 4DR3I 1FNMA 4X66I 4DPTA 3M6AA 3PYDA 1FJGI 1KVKA 2HHHI 4DR7E 4OOGC 2NUGA 1Z0VA 2NUFA 4JI4I 4JI1E 3LNUA 4DPUA 1Z5BA 4GKKE 3D4JA 1HNWE 5IWAI 2UUCI 4GKJE 4P7AA 2JY9A 3PYGA 5LL6R 4LFCE 1ZXMA 4FW9A 1J5EI 2A2DA 1B62A 4DV0E 4LF5E 4I3HA 4B3RI 2ZM6I 4JI2I 1YYKA 4DKKA 5LMNE 4DUZE 3ADJA 3J7AG 1O0WA 1FI4A 2VQEE 1YZ9A 1Z5AA 4DV1I 4JYAE 1H7UA 4LF4I 3OTOE 2L2KB 3GONA 4LFAE 4NXMI 1HR0E 1ZXNA 2EFGA 1IBKI 4JI6E 2DIXA 4DR4E 1T4LB 3ZKBA 4JI0I 4JI7E 1Z0BA 1BKNA 4DPYA 2YT4A 1H72C 1MX0A 1Z5CA 3VYYA 1FWLA 1ZM9A 4X64I 4LF9E 2HKJA 4JI5I 1MG7A 4P52A 1U2RA 4X62E 4LF8I 3LTOA 2DMYA 3H4LA 2LRSA 4WUCA 4LF6E 1IBME 4Z7YA 4B3SE 3J7AM 5A2QC 4GKKI 2VF3A 1HNWI 3QT7A 1NZ0A 1QU6A 4WYQB 2NPFA 4GKJI 2NUEA 1ZM4A 2UXDI 2X36A 2CPNA 2GS8A 4JG4A 4LFBE 4B3TE 1N33E 3LLHA 3J80Q 2UUAE 3QT8A 3J81Q 1PVGA 1I94E 3K17A 2N3GA 1WHQA 5LMNI 4X65E 4DV6I 4DUZI 4LF7E 1X47A 4B3ME 3JAMC 4JV5E 2UXCE 4PRVA 4JYAI 4PU9A 2L2MA 4YY3E 4FWDA 2LJPA 1NHJA 4DR4I 2HFUA 4DR5E 2E5LE 1YYWA 3ZZ0A 1XNQI 1XMOE 5BR8E 2ZBKB 1N36E 1N34I 2HK3A 1XNRE 4PRXA 3C4TA 1FKAE 2HKEA 4DXLA 4OX9I 4USMA 1T4OA 4DV5E 4LF9I 1XHKA 2RS6A 2AJ4A 1HNXE 3QT5A 1Z59A 2BV3A 1ZM2A 1XMQE 1Z0GA 2CZ9A 2N3HA 2B7TA 2LUPB 2RSMA 4B3SI 1WHNA 4DR1E 1S16A 1EI1A 4KHPE 4LFBI 4B3TI 2BM0A 3PYFA 5L3JA 2DB2A 2UUAI 4DU7A 1I94I 2UUBE 1H74A 3ZZTA 4X65I 4DUYE 4LF7I 3V5RA 4B3MI 1Z0TA 2UXCI 2UXBI 4NXNI 1KTVA 4UTGA 4DV7E 3ADLA 5IT9Q 2V34A 2ZITA 2UU9E 4HY1A 2X7IA 1D6TA 4DR2E 5GMDA 4WUBA 4JI8E 1NHHA 4X66E 2E5LI 1N0VC 1QZRA 2RS7A 1XMOI 3T1HE 4DR7I 3CWVA 5BR8I 2JVAA 3Q1QA 1N0UA 4JI4E 4MYTA 4JI1I 5GMEA 1RR9A 1H7SA 2WW4A 4XTJA 1DARA 1J26A 4DV5I 2UUCE 4R1FA 3J80C 3J81C 2LUQA 2B7VA 2F4VE 4ZVIA 4LFCI 1EKZA 1UHZA 4DV0I 4LF5I 4DV4E 2NA2A 1ELOA 4FWGA 1UEKA 5FLXQ 4AQYE 2ZM6E 2L2NA 3LPSA 3F0NA 4K0KE 2VQEI 2V2QA 1Z0WA 3OTOI 4LF4E 2EZ6A 1IBLE 3ADIA 4LFAI 1HR0I 2LTSA 4FN5A 1RC7A 1N32E 1K47A 3ZM7A 4JI6I 2HK2A 1STUA 2UUBI 1X48A 1YYOA 1MU5A 1FWKA 4JI7I 4JI0E 4USKA 2L3JA 4HYMA 1A6FA 5LMUE 3B8HA 4URLA 4DR2I 2KHXA 4JI3E 4ED4A 4X64E 2V8PA 2DEIA 4JI5E 4M1KA 1S4EA 4X62I 4X8WA 1PIEA 1DI2A 4LF8E 2E1RA 3T1HI 2BM1A 4WUDA 3ZZUA 3WU4A 4FWHA 1T4NA 4LF6I 1UILA 1IBMI 1PKPA 3V2UC 3WU6A 4DV3E 4DR6E 4RPFA 3WU5A 1H73A 2F4VI 2UXDE 2LJHA 1HNZE 2IHR1 1N33I 4DV4I 3B78A 2L3CA 4YHHE 2R42A 4MYUA 3T1YE 4AQYI 5IT9C 4DV6E 4K0KI 4JV5I 4KQVA 2V2VA 4DV2E 2R3VA 1IBLI 3C4BA 1B63A 4YY3I 1WUUA 2A2CA 4DPWA 2VQFE 1N32I 2V2ZA 4HACB 2RTXA 4DR3E 2L33A 3HTXA 4DR5I 1GQEA 4M2ZA 1FJGE 2HHHE 1XNQE 1N36I 1XNRI 5CFFE 1N34E 1KKHA 4HXZA 3J7Yp 5LMUI 1Z0EA 2B3TB 3QT6A 4OX9E 5IWAE 4JI3I 1NHIA 2MDRA 5FLXC 3VYXA 1HNXI 2LBSB 2OI2A 1XMQI 1J5EE 4B3RE 1ZBTA 4HACA 4JI2E 3PYEA 3K1JA 3HULA 1EA6A 4DV3I 1ZM3A 1RREA 4DR6I 4DR1I 1OJ4A 4DV1E 1KIJA 1RQ0A 3WU3A 4KHPI 3ZKDA 1VISA 5A2QQ 1HNZI 4NXME 4DU8A 1X49A 2LTRA 3ADGA 4Z7CA 2Q2EB 4YHHI 1IBKE 2XEXA 4M30A 3T1YI 3P1XA 2J7KA 3B82A 4DUYI
chains in the Genus database with same CATH superfamily
2GPIA 1TF3A 3KRNA 1Z1BA 2DSYA 3PRYA 4DPXA 4WX9A 2EPKX 4FW5A 1X3CA 2VRDA 2PNMA 2M9AA 4EMDA 2UXBE 4NXNE 2C37A 4DV2I 2ELYA 1KYQA 3K6QA 5T6JA 4BC7A 2WCC3 4F9BB 2HGHA 4WFTA 2E1MA 2HFSA 4LCFA 4R2RA 4OO1A 2DEJA 2UU9I 2EM0A 5KL3A 2C38B 3JAMQ 2VQFI 1PJTA 1Z0CA 4UT4A 4MDTA 4MU0A 4JI8I 2EOOA 4DR3I 2D9HA 3IWCA 1FNMA 4DPTA 2IOQA 3M6AA 4X66I 4NHRA 3PYDA 1PDAA 1Y5YA 1A1GA 1FJGI 1KVKA 4O43A 2HHHI 2YSPA 4DR7E 1SFEA 4OOGC 2MKNA 1BBGA 3C6MA 2V8QB 2NUGA 1Z0VA 4IS1C 2NUFA 4WXDA 1OYSA 4JI4I 2ODRC 4M9VC 3Q6NA 4JI1E 1USVA 2R76A 4I8OA 2WBUA 2BA0D 1Z5BA 3LNUA 4DPUA 3HPSA 2YTFA 4GKKE 3D4JA 4IFDC 1HNWE 2JOXA 1E3PA 5IWAI 2UUCI 2JXPA 2EMIA 4GKJE 3EQ1A 3PS3A 4P7AA 2JY9A 3PYGA 5LL6R 4BA2A 4LFCE 1ZXMA 2EPCA 1YH8A 1RMDA 2PO0B 4FW9A 1J5EI 2A2DA 1B62A 4DV0E 4LF5E 1E3HA 2BA1D 2C38A 2EM7A 4I3HA 3QG5C 4R2AA 5A6JA 3CDIA 2LCEA 3UK3C 2NN6B 4B3RI 2ZM6I 4JI2I 1YYKA 4DKKA 5KL5A 5LMNE 2J7JA 4DUZE 3ADJA 3J7AG 1VI7A 1O0WA 2ENCA 1FI4A 2EOSA 4AM3A 2VQEE 4M0VA 3AUZA 1A1JA 3L00A 1YZ9A 4JYAE 1H7UA 1Z5AA 3OTOE 4DV1I 4LF4I 2L2KB 3GONA 4LFAE 3JTZA 4BMJA 2Z5EA 1TF6A 2EPPA 4NXMI 1WXRA 2EPMX 1HR0E 1ZXNA 2EPLX 4FW4A 3EPLA 1F2IG 4U3BA 1X5WA 2V83A 2EFGA 1ZR9A 1IBKI 4QNJA 5AE1A 4JI6E 2EMGA 3HQ1A 2DIXA 2VF1A 4DR4E 4R8OA 1T4LB 2Z5BB 2ODRD 2PO2B 2V86A 4F6MA 3ZKBA 2EMFA 2EMCA 4JI0I 3DJWA 4JI7E 2PO0A 1Z0BA 1BKNA 2JWOA 4IFDD 4HTGA 2YT4A 1KJKA 1H72C 5EKWA 1MX0A 1Z5CA 4DPYA 4ZYDA 2EPNA 2EQ3A 3FIGA 2NN6A 3KWRA 3VYYA 2JEBB 3HKMA 1FWLA 3DF6A 1A1IA 4DV7I 1ZM9A 1TN9A 4X64I 3IWBA 4IFDF 2I13A 4LF9E 2HKJA 4JI5I 1MG7A 1X6EA 4ZYEA 4P52A 1HK7A 1U2RA 3GMEA 3M7NG 4X62E 4LF8I 3MSWA 2EPOA 2WNRB 3LTOA 2DMYA 1R6LA 3H4LA 5C0XB 2LRSA 4WUCA 2M7QA 1YFHA 2EOJA 3NZKA 4OZEA 4ZYHA 4LF6E 1IBME 4Z7YA 2O1WA 3BF2A 4FK5C 4B3SE 5A2QC 2V88A 2IERA 5FWKA 3J7AM 4WXCA 2VF3A 4GKKI 1HNWI 5K36B 3QT7A 2EN3A 1QU6A 4WYQB 1NZ0A 2Z5BA 1PJQA 2PNLA 1OYRA 2EOIA 2PO2A 2EMLA 2WBSA 2NPFA 2H36X 4GKJI 2NUEA 1LLMC 1ZM4A 2UXDI 2X36A 2YRMA 4DMIA 3LMLA 1AAYA 2CPNA 3M99B 2GS8A 2JT2A 4JG4A 4LFBE 1X6FA 4B3TE 1N33E 3B4TA 3LLHA 4IJDA 2I9IA 2J7KA 2JEBA 2JPAA 2GO3A 2EOQA 3J80Q 2UUAE 3QT8A 3J81Q 1PVGA 1I94E 4R2QA 2JE6B 3K17A 4BBYA 2N3GA 2YPNA 2N8XA 1WHQA 5LMNI 4X65E 2MKDA 4DV6I 4DUZI 4LF7E 1X47A 4B3ME 3JAMC 1UDSA 4J8ZA 1DQ3A 4JV5E 2UXCE 2ELZA 4PRVA 2WNRA 4JYAI 4PU9A 5C0XA 1EH6A 2L2MA 2C39B 4R2DA 1T39A 4YY3E 2EE8A 4ISAA 2EM6A 1G2FC 5DRQA 2F8BA 3P3EA 2YRHA 5K36A 3CDJA 4FWDA 2LJPA 1WRJA 1USUA 1NHJA 4DR4I 4WPYA 2MC6A 5DNYA 2HFUA 1OYPA 4DR5E 2E5LE 1YYWA 3Q6MA 4OKGA 2DMIA 3ZZ0A 1XNQI 1XMOE 5BR8E 2ZBKB 4IFDB 1N36E 1N34I 2HK3A 1SR9A 1XNRE 4PRXA 3C4TA 2B9DA 2EL4A 2RSIA 1FKAE 2E72A 1IQOA 5AASA 2CTDA 2HKEA 4GQUA 2JOBA 2PNZB 4DXLA 2LO3A 1GTKA 2JE6A 2BB8A 1Y4UA 4OX9I 2EM4A 4Q28A 2PO1B 1N3GA 4USMA 1T4OA 2L8TA 4DV5E 4LF9I 1XHKA 2BR2B 2RS6A 2AJ4A 1HNXE 3QT5A 1Z59A 2EORA 2IESA 5A6BA 2V89A 2V87A 2BV3A 2C39A 1ZM2A 1XMQE 1Z0GA 4BA1B 2CZ9A 3EPKA 2M4IA 2MDGA 4GZNC 2N3HA 1YUIA 2JEAB 2B7TA 5TSEA 2RSMA 2LUPB 4B3SI 2EPXA 1WHNA 2YTIA 2EN1A 2EOMA 2GHFA 2LJUA 1XXEA 2YTGA 4DR1E 4R2PA 1YUJA 1R6MA 1S16A 3UHMA 2EPUA 1EI1A 5DROA 3EPHA 1EH8A 4IFDA 4KHPE 2MC5A 1MEYC 2F1DA 5DNXA 4LFBI 4B3TI 2BM0A 2YTDA 2PNZA 3PYFA 1MGTA 2GLIA 1YHCA 5F3WA 4ZYGA 4TUIA 5L3JA 2DB2A 2UUAI 2PO1A 4DU7A 3M85D 2UUBE 1H74A 2K4VA 4LCHA 4N4RB 3ZZTA 1I94I 4IZJD 2YTNA 2BR2A 2YU5A 4X65I 4DUYE 2O1UA 4MU3A 4LF7I 4RH8A 3V5RA 4KWYA 5A69A 4B3MI 1Z0TA 2NN6C 2UXCI 3OTOI 2WBTA 3L7ZB 3P06A 2EQ1A 3EPJA 2UXBI 4NXNI 2L6MA 1KTVA 4FW3A 4UTGA 4BA1A 4F9CB 4DV7E 3ADLA 5IT9Q 4HEIA 2EQ0A 2V34A 2WP8B 2VESA 2JEAA 1IMUA 2ZITA 2UU9E 4HY1A 4LCGA 5KL2A 2EMZA 4O4KA 2X7IA 1D6TA 1B69A 5ADZA 4DR2E 2Z5CB 4R2CA 4RHBB 5GMDA 4WUBA 4JI8E 1NHHA 4BS9A 4X66E 2EMHA 2G7HA 4FW6A 2E5LI 5AC4A 4R2SA 1N0VC 1QZRA 2IOPA 2EM5A 2RS7A 1XMOI 1X6HA 3T1HE 4DR7I 3CWVA 2CT1A 5BR8I 3U1KA 2EJ4A 3GCMA 2JVAA 2EL5A 3AV0A 1WJPA 1ZAAC 4JI4E 1N0UA 3Q1QA 4MYTA 4JI1I 2CG9A 2EM3A 4L8NA 3HJCA 2YTQA 5GMEA 1G2DC 1RR9A 1H7SA 2WW4A 4XTJA 5JEAC 2EN6A 1YSAC 1DARA 1J26A 4DV5I 2KOUA 2UUCE 4R1FA 3J80C 3J81C 3L7ZA 2LUQA 2B7VA 2F4VE 3PS1A 2EMBA 1L4SA 2EMKA 4ZVIA 4LFCI 2EOYA 2EOEA 2ENAA 5KL6A 1EKZA 1P42A 3MHHC 2GO4A 2DGCA 2WP8A 4LPFA 1UHZA 4R2EA 4DV0I 1UBDC 4DV4E 4LF5I 2NA2A 1ELOA 4MLQA 4FWGA 1UDQA 2CSHA 4BHCA 1UEKA 2Z5CA 5FLXQ 2EMAA 2NN6D 4AQYE 2ZM6E 3ECRA 5C0XC 2L2NA 5DRRA 2ADRA 3LPSA 4F54A 5IV8B 3F0NA 4F6NA 4NBQA 1UDOA 4K0KE 4OO1C 2VQEI 2O1VA 2EWLA 2V2QA 2VE7C 4MLVA 4LF4E 1Z0WA 2BA0G 5A6AA 2YSOA 2EZ6A 5DRPA 1IBLE 2DLKA 3ADIA 2NN6F 1DGCA 4IS9A 4LFAI 1HR0I 2EOZA 2LTSA 2YRKA 4FN5A 1RC7A 3P76A 2J65A 3P3CA 1N32E 4N3OA 1K47A 3ZM7A 5KL7A 2HK2A 2L92A 1STUA 2UUBI 1ZBQA 4MQYA 4JI6I 1NCSA 4IZJB 2JR1A 2V85A 1X48A 2EOHA 2JYAA 2LMZA 3KZYA 1YYOA 1MU5A 2EL6A 1FWKA 1A1KA 4LOMA 2BA1G 3BBGA 4JI7I 4JI0E 4USKA 2L3JA 4HYMA 2NN6E 4LTYA 5JEAD 1A6FA 2GQ0A 2EMWA 2YTJA 5LMUE 2EMYA 1RHYA 3B8HA 4AIMA 4URLA 4DR2I 2EN8A 2EPAA 2KHXA 2M1SA 2NABA 5AC5A 2EM8A 4JI3E 2O1TA 3DD6A 4ED4A 4X64E 4NZVA 3K85A 5JEAF 2V8PA 1UDNA 2DEIA 2HJJA 2FV4B 2AE8A 4JI5E 3BGHA 1Y6ZA 4M1KA 4MU1A 1S4EA 4X62I 4X8WA 1PIEA 1DI2A 4LF8E 2E1RA 3T1HI 2BM1A 4WUDA 3ZZUA 3M85G 2Q8UA 3WU4A 5C0XD 3P3GA 2HC5A 4FWHA 1T4NA 2YU8A 3THNA 2K7IA 4LF6I 1UILA 1YPNA 1IBMI 4OO1D 1PKPA 3V2UC 3H1CA 3WU6A 4IZJA 4DV3E 1AH5A 5K36D 5EL9A 4DR6E 1T38A 4RPFA 2EM2A 5JEAE 3WU5A 2CGEA 1H73A 5K36C 4P78A 4TUGA 5C0XF 4X9JA 2F4VI 3ZOQB 5AE2A 2FTXB 4OO1F 2UXDE 2LJHA 2EN2A 2KONA 4L5NC 1HNZE 1Y4SA 2IHR1 1N33I 2EM9A 5K36F 4DV4I 2BBGA 3B78A 2L3CA 2CVEA 2LT7A 4Q35B 5IXMB 4YHHE 2R42A 1PJSA 4MYUA 3T1YE 5IT9C 1JK1A 4AQYI 4DV6E 5C0XE 4K0KI 4JV5I 3OMLA 4KQVA 5LLQA 2V2VA 5DNLA 4OO1E 2YTEA 4BC9A 4DV2E 2R3VA 4MU4A 3C4BA 1IBLI 5A6KA 2RQLA 1NEIA 1B63A 5A6BD 1WUUA 4YY3I 5K36E 2A2CA 4DPWA 2FGGA 4IZKB 4FW7A 2VQFE 4WSPA 1N32I 2V2ZA 4HACB 2RTXA 4DR3E 2LVHA 1ZU1A 1JK2A 2L33A 3THOB 3HTXA 4DR5I 1UN6B 1GQEA 2EPZA 3IWDA 4M2ZA 1FJGE 4KZSA 2HHHE 1XNQE 1N36I 2JP9A 1XNRI 3HXLA 2R1FA 5CFFE 1P47A 1N34E 1KKHA 5JEAB 2ENHA 4AIDA 4F2JC 2EN4A 4BCAA 4BHBA 4HXZA 4O5GA 4F9AB 3J7Yp 3GLLA 2PRTA 1Z0EA 5LMUI 2EN7A 2B3TB 3QT6A 3TQMA 4OX9E 1A1FA 2YZTA 5IWAE 2EOXA 2LV2A 2YTOA 4JI3I 1NHIA 2MDRA 4WSGA 4QNKA 2YWQA 5FLXC 3VK6A 3VYXA 1HNXI 1QNTA 1BBOA 2EMXA 2LBSB 1Y60A 2DLQA 3HPZA 3RMPA 2OI2A 5ELWA 1XMQI 4BA2B 4O24A 4J3DA 1J5EE 2C37B 4R03A 3F6GA 2DRPA 4IZKA 1BB8A 3MHSC 4OO1B 4B3RE 1A1HA 1ZBTA 3HULA 4JI2E 3PYEA 3K1JA 4HACA 1EA6A 4DV3I 5AE3A 4P7DA 1ZM3A 1RREA 4DR6I 4DR1I 1OJ4A 4IFDE 2WZOA 2EOFA 2EPRA 3H09A 4GEQB 3JU0A 1EH7A 4DV1E 1KIJA 1RQ0A 3WU3A 4KHPI 3KZZA 5JEAA 3F6HA 3VHTB 1VISA 3ZKDA 2O3ZA 5A2QQ 1HNZI 2LE2A 4NXME 3PS2A 1IQSA 3C6KA 3M7ND 4DU8A 1X49A 2LTRA 2A25A 2YTPA 3ADGA 4LU9A 1A1LA 4Z7CA 2Q2EB 4YHHI 1IBKE 3BIDA 2EP3A 2XEXA 2RPCA 4U3DA 4M30A 3T1YI 1GZ6A 3P1XA 5KL4A 3U1YA 3B82A 4DUYI
chains in the Genus database with same CATH topology
3PRYA 2DSYA 4DPXA 2PNMA 4EMDA 2UXBE 4NXNE 4DV2I 5T6JA 4BC7A 3K6QA 4DV7I 2HFSA 4F9BB 4WFTA 2E1MA 2DEJA 2UU9I 3JAMQ 2VQFI 1Z0CA 4UT4A 4JI8I 4DR3I 3IWCA 1FNMA 4DPTA 2IOQA 3M6AA 4X66I 3PYDA 1FJGI 1KVKA 2HHHI 4DR7E 4OOGC 2NUGA 1Z0VA 2V8QB 2NUFA 4JI4I 2ODRC 3Q6NA 4JI1E 1USVA 4I8OA 3LNUA 4DPUA 1Z5BA 3HPSA 4GKKE 3D4JA 1HNWE 2JOXA 5IWAI 2UUCI 4GKJE 4P7AA 2JY9A 3PYGA 5LL6R 4LFCE 1ZXMA 4FW9A 1J5EI 2A2DA 1B62A 4DV0E 4LF5E 4I3HA 4B3RI 2ZM6I 4JI2I 1YYKA 4DKKA 5LMNE 4DUZE 3ADJA 3J7AG 1O0WA 1FI4A 2VQEE 4M0VA 3AUZA 1YZ9A 1Z5AA 4DV1I 1H7UA 4JYAE 4LF4I 3OTOE 2L2KB 3GONA 4LFAE 3JTZA 4BMJA 2Z5EA 4NXMI 1WXRA 1HR0E 1ZXNA 2V83A 2EFGA 1IBKI 5AE1A 4JI6E 3HQ1A 2DIXA 2VF1A 4DR4E 4R8OA 1T4LB 2Z5BB 2ODRD 2V86A 3ZKBA 4JI0I 3DJWA 4JI7E 1Z0BA 1BKNA 2JWOA 4DPYA 2YT4A 1H72C 1MX0A 1Z5CA 3FIGA 3KWRA 3VYYA 1FWLA 3DF6A 1ZM9A 4X64I 3IWBA 4LF9E 2HKJA 4JI5I 1MG7A 4P52A 1HK7A 1U2RA 4X62E 4LF8I 3MSWA 3LTOA 2DMYA 3H4LA 2LRSA 4WUCA 2M7QA 4LF6E 1IBME 4Z7YA 2O1WA 4B3SE 3J7AM 5A2QC 2V88A 4GKKI 5FWKA 2VF3A 1HNWI 3QT7A 1NZ0A 1QU6A 4WYQB 2Z5BA 2PNLA 2NPFA 2H36X 4GKJI 2NUEA 1ZM4A 2UXDI 2X36A 4DMIA 3LMLA 2CPNA 2GS8A 4JG4A 4LFBE 4B3TE 1N33E 3LLHA 3J80Q 2UUAE 3QT8A 3J81Q 1PVGA 1I94E 3K17A 4BBYA 2N3GA 1WHQA 5LMNI 4X65E 4DV6I 4DUZI 4LF7E 1X47A 4B3ME 3JAMC 4J8ZA 1DQ3A 4JV5E 2UXCE 4PRVA 4JYAI 4PU9A 2L2MA 4YY3E 2F8BA 4FWDA 2LJPA 1USUA 1NHJA 4DR4I 4WPYA 2MC6A 5DNYA 2HFUA 4DR5E 2E5LE 1YYWA 3Q6MA 3ZZ0A 1XNQI 1XMOE 5BR8E 2ZBKB 1N36E 1N34I 2HK3A 1SR9A 1XNRE 4PRXA 3C4TA 2B9DA 1FKAE 5AASA 2HKEA 2JOBA 4DXLA 1Y4UA 4OX9I 4Q28A 4USMA 1T4OA 2L8TA 4DV5E 4LF9I 1XHKA 2RS6A 2AJ4A 1HNXE 3QT5A 1Z59A 2BV3A 2V89A 2V87A 1ZM2A 1XMQE 1Z0GA 2CZ9A 2M4IA 2N3HA 2B7TA 2LUPB 2RSMA 4B3SI 1WHNA 4DR1E 1S16A 1EI1A 4KHPE 2MC5A 4LFBI 4B3TI 2BM0A 3PYFA 5F3WA 5L3JA 4TUIA 2DB2A 2UUAI 4DU7A 1I94I 2UUBE 1H74A 2K4VA 3ZZTA 4IZJD 4X65I 4DUYE 2O1UA 4LF7I 3V5RA 4B3MI 1Z0TA 2UXCI 3P06A 2UXBI 4NXNI 2L6MA 1KTVA 4UTGA 4F9CB 4DV7E 3ADLA 5IT9Q 2V34A 2ZITA 2UU9E 4HY1A 2X7IA 1D6TA 5ADZA 4DR2E 2Z5CB 5GMDA 4WUBA 4JI8E 1NHHA 4BS9A 4X66E 2G7HA 2E5LI 1N0VC 1QZRA 2IOPA 2RS7A 1XMOI 3T1HE 4DR7I 3CWVA 5BR8I 2JVAA 3AV0A 3Q1QA 1N0UA 4JI4E 4MYTA 4JI1I 2CG9A 4L8NA 3HJCA 5GMEA 1RR9A 1H7SA 2WW4A 4XTJA 1DARA 1J26A 4DV5I 2KOUA 2UUCE 4R1FA 3J80C 3J81C 2LUQA 2B7VA 2F4VE 4ZVIA 4LFCI 1EKZA 1UHZA 4DV0I 4LF5I 4DV4E 2NA2A 1ELOA 4FWGA 1UEKA 2Z5CA 5FLXQ 4AQYE 2ZM6E 2L2NA 3LPSA 4F54A 3F0NA 4K0KE 2VQEI 2O1VA 2EWLA 2V2QA 2VE7C 1Z0WA 4LF4E 3OTOI 2EZ6A 1IBLE 3ADIA 4LFAI 1HR0I 2LTSA 4FN5A 1RC7A 1N32E 4N3OA 1K47A 3ZM7A 4JI6I 2HK2A 2L92A 1STUA 2UUBI 1ZBQA 4IZJB 2JR1A 2V85A 1X48A 2LMZA 1YYOA 1MU5A 1FWKA 4JI7I 4JI0E 4USKA 2L3JA 4HYMA 4LTYA 1A6FA 2GQ0A 5LMUE 3B8HA 4URLA 4DR2I 2KHXA 2M1SA 2O1TA 4JI3E 4ED4A 4X64E 3K85A 2V8PA 2DEIA 2FV4B 4JI5E 1Y6ZA 4M1KA 1S4EA 4X62I 4X8WA 1PIEA 1DI2A 4LF8E 2E1RA 3T1HI 2BM1A 4WUDA 3ZZUA 3WU4A 4FWHA 1T4NA 4LF6I 1UILA 1IBMI 1PKPA 3V2UC 3WU6A 4IZJA 4DV3E 4DR6E 4RPFA 3WU5A 2CGEA 1H73A 4P78A 4TUGA 2F4VI 3ZOQB 5AE2A 2FTXB 2UXDE 2LJHA 2KONA 4L5NC 1HNZE 1Y4SA 2IHR1 1N33I 4DV4I 3B78A 2L3CA 4YHHE 2R42A 4MYUA 3T1YE 5IT9C 4AQYI 4DV6E 4K0KI 4JV5I 3OMLA 4KQVA 2V2VA 4BC9A 4DV2E 2R3VA 1IBLI 3C4BA 1B63A 4YY3I 1WUUA 2A2CA 4DPWA 2FGGA 4IZKB 2VQFE 4WSPA 1N32I 2V2ZA 4HACB 2RTXA 4DR3E 2L33A 3HTXA 4DR5I 1GQEA 3IWDA 4M2ZA 1FJGE 4KZSA 2HHHE 1XNQE 1N36I 1XNRI 3HXLA 5CFFE 1N34E 1KKHA 4BCAA 4HXZA 4F9AB 3J7Yp 5LMUI 1Z0EA 2B3TB 3QT6A 4OX9E 2YZTA 5IWAE 4JI3I 1NHIA 2MDRA 5FLXC 3VK6A 3VYXA 1HNXI 2LBSB 3HPZA 3RMPA 2OI2A 1XMQI 1J5EE 4R03A 3F6GA 4IZKA 4B3RE 1ZBTA 3HULA 4JI2E 3PYEA 3K1JA 4HACA 1EA6A 4DV3I 5AE3A 4P7DA 1ZM3A 1RREA 4DR6I 4DR1I 1OJ4A 2WZOA 3H09A 4GEQB 3JU0A 4DV1E 1KIJA 1RQ0A 3WU3A 4KHPI 3F6HA 3ZKDA 1VISA 5A2QQ 1HNZI 2LE2A 4NXME 4DU8A 1X49A 2LTRA 4LU9A 3ADGA 4Z7CA 2Q2EB 4YHHI 1IBKE 2XEXA 4M30A 3T1YI 1GZ6A 3P1XA 2J7KA 3B82A 4DUYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPX A;  4EMD A;  2UXB E;  4NXN E;  4DV2 I;  4DV7 I;  2HFS A;  4WFT A;  2DEJ A;  2UU9 I;  3JAM Q;  2VQF I;  1Z0C A;  4UT4 A;  4JI8 I;  4DR3 I;  1FNM A;  4X66 I;  4DPT A;  3M6A A;  3PYD A;  1FJG I;  1KVK A;  2HHH I;  4DR7 E;  4OOG C;  2NUG A;  1Z0V A;  2NUF A;  4JI4 I;  4JI1 E;  3LNU A;  4DPU A;  1Z5B A;  4GKK E;  3D4J A;  1HNW E;  5IWA I;  2UUC I;  4GKJ E;  4P7A A;  2JY9 A;  3PYG A;  5LL6 R;  4LFC E;  1ZXM A;  4FW9 A;  1J5E I;  2A2D A;  1B62 A;  4DV0 E;  4LF5 E;  4I3H A;  4B3R I;  2ZM6 I;  4JI2 I;  1YYK A;  4DKK A;  5LMN E;  4DUZ E;  3ADJ A;  3J7A G;  1O0W A;  1FI4 A;  2VQE E;  1YZ9 A;  1Z5A A;  4DV1 I;  4JYA E;  1H7U A;  4LF4 I;  3OTO E;  2L2K B;  3GON A;  4LFA E;  4NXM I;  1HR0 E;  1ZXN A;  2EFG A;  1IBK I;  4JI6 E;  2DIX A;  4DR4 E;  1T4L B;  3ZKB A;  4JI0 I;  4JI7 E;  1Z0B A;  1BKN A;  4DPY A;  2YT4 A;  1H72 C;  1MX0 A;  1Z5C A;  3VYY A;  1FWL A;  1ZM9 A;  4X64 I;  4LF9 E;  2HKJ A;  4JI5 I;  1MG7 A;  4P52 A;  1U2R A;  4X62 E;  4LF8 I;  3LTO A;  2DMY A;  3H4L A;  2LRS A;  4WUC A;  4LF6 E;  1IBM E;  4Z7Y A;  4B3S E;  3J7A M;  5A2Q C;  4GKK I;  2VF3 A;  1HNW I;  3QT7 A;  1NZ0 A;  1QU6 A;  4WYQ B;  2NPF A;  4GKJ I;  2NUE A;  1ZM4 A;  2UXD I;  2X36 A;  2CPN A;  2GS8 A;  4JG4 A;  4LFB E;  4B3T E;  1N33 E;  3LLH A;  3J80 Q;  2UUA E;  3QT8 A;  3J81 Q;  1PVG A;  1I94 E;  3K17 A;  2N3G A;  1WHQ A;  5LMN I;  4X65 E;  4DV6 I;  4DUZ I;  4LF7 E;  1X47 A;  4B3M E;  3JAM C;  4JV5 E;  2UXC E;  4PRV A;  4JYA I;  4PU9 A;  2L2M A;  4YY3 E;  4FWD A;  2LJP A;  1NHJ A;  4DR4 I;  2HFU A;  4DR5 E;  2E5L E;  1YYW A;  3ZZ0 A;  1XNQ I;  1XMO E;  5BR8 E;  2ZBK B;  1N36 E;  1N34 I;  2HK3 A;  1XNR E;  4PRX A;  3C4T A;  1FKA E;  2HKE A;  4DXL A;  4OX9 I;  4USM A;  1T4O A;  4DV5 E;  4LF9 I;  1XHK A;  2RS6 A;  2AJ4 A;  1HNX E;  3QT5 A;  1Z59 A;  2BV3 A;  1ZM2 A;  1XMQ E;  1Z0G A;  2CZ9 A;  2N3H A;  2B7T A;  2LUP B;  2RSM A;  4B3S I;  1WHN A;  4DR1 E;  1S16 A;  1EI1 A;  4KHP E;  4LFB I;  4B3T I;  2BM0 A;  3PYF A;  5L3J A;  2DB2 A;  2UUA I;  4DU7 A;  1I94 I;  2UUB E;  1H74 A;  3ZZT A;  4X65 I;  4DUY E;  4LF7 I;  3V5R A;  4B3M I;  1Z0T A;  2UXC I;  2UXB I;  4NXN I;  1KTV A;  4UTG A;  4DV7 E;  3ADL A;  5IT9 Q;  2V34 A;  2ZIT A;  2UU9 E;  4HY1 A;  2X7I A;  1D6T A;  4DR2 E;  5GMD A;  4WUB A;  4JI8 E;  1NHH A;  4X66 E;  2E5L I;  1N0V C;  1QZR A;  2RS7 A;  1XMO I;  3T1H E;  4DR7 I;  3CWV A;  5BR8 I;  2JVA A;  3Q1Q A;  1N0U A;  4JI4 E;  4MYT A;  4JI1 I;  5GME A;  1RR9 A;  1H7S A;  2WW4 A;  4XTJ A;  1DAR A;  1J26 A;  4DV5 I;  2UUC E;  4R1F A;  3J80 C;  3J81 C;  2LUQ A;  2B7V A;  2F4V E;  4ZVI A;  4LFC I;  1EKZ A;  1UHZ A;  4DV0 I;  4LF5 I;  4DV4 E;  2NA2 A;  1ELO A;  4FWG A;  1UEK A;  5FLX Q;  4AQY E;  2ZM6 E;  2L2N A;  3LPS A;  3F0N A;  4K0K E;  2VQE I;  2V2Q A;  1Z0W A;  3OTO I;  4LF4 E;  2EZ6 A;  1IBL E;  3ADI A;  4LFA I;  1HR0 I;  2LTS A;  4FN5 A;  1RC7 A;  1N32 E;  1K47 A;  3ZM7 A;  4JI6 I;  2HK2 A;  1STU A;  2UUB I;  1X48 A;  1YYO A;  1MU5 A;  1FWK A;  4JI7 I;  4JI0 E;  4USK A;  2L3J A;  4HYM A;  1A6F A;  5LMU E;  3B8H A;  4URL A;  4DR2 I;  2KHX A;  4JI3 E;  4ED4 A;  4X64 E;  2V8P A;  2DEI A;  4JI5 E;  4M1K A;  1S4E A;  4X62 I;  4X8W A;  1PIE A;  1DI2 A;  4LF8 E;  2E1R A;  3T1H I;  2BM1 A;  4WUD A;  3ZZU A;  3WU4 A;  4FWH A;  1T4N A;  4LF6 I;  1UIL A;  1IBM I;  1PKP A;  3V2U C;  3WU6 A;  4DV3 E;  4DR6 E;  4RPF A;  3WU5 A;  1H73 A;  2F4V I;  2UXD E;  2LJH A;  1HNZ E;  2IHR 1;  1N33 I;  4DV4 I;  3B78 A;  2L3C A;  4YHH E;  2R42 A;  4MYU A;  3T1Y E;  4AQY I;  5IT9 C;  4DV6 E;  4K0K I;  4JV5 I;  4KQV A;  2V2V A;  4DV2 E;  2R3V A;  1IBL I;  3C4B A;  1B63 A;  4YY3 I;  1WUU A;  2A2C A;  4DPW A;  2VQF E;  1N32 I;  2V2Z A;  4HAC B;  2RTX A;  4DR3 E;  2L33 A;  3HTX A;  4DR5 I;  1GQE A;  4M2Z A;  1FJG E;  2HHH E;  1XNQ E;  1N36 I;  1XNR I;  5CFF E;  1N34 E;  1KKH A;  4HXZ A;  3J7Y p;  5LMU I;  1Z0E A;  2B3T B;  3QT6 A;  4OX9 E;  5IWA E;  4JI3 I;  1NHI A;  2MDR A;  5FLX C;  3VYX A;  1HNX I;  2LBS B;  2OI2 A;  1XMQ I;  1J5E E;  4B3R E;  1ZBT A;  4HAC A;  4JI2 E;  3PYE A;  3K1J A;  3HUL A;  1EA6 A;  4DV3 I;  1ZM3 A;  1RRE A;  4DR6 I;  4DR1 I;  1OJ4 A;  4DV1 E;  1KIJ A;  1RQ0 A;  3WU3 A;  4KHP I;  3ZKD A;  1VIS A;  5A2Q Q;  1HNZ I;  4NXM E;  4DU8 A;  1X49 A;  2LTR A;  3ADG A;  4Z7C A;  2Q2E B;  4YHH I;  1IBK E;  2XEX A;  4M30 A;  3T1Y I;  3P1X A;  2J7K A;  3B82 A;  4DUY I; 
#chains in the Genus database with same CATH topology
 2GPI A;  1TF3 A;  3KRN A;  1Z1B A;  2DSY A;  3PRY A;  4DPX A;  4WX9 A;  2EPK X;  4FW5 A;  1X3C A;  2VRD A;  2PNM A;  2M9A A;  4EMD A;  2UXB E;  4NXN E;  2C37 A;  4DV2 I;  2ELY A;  1KYQ A;  3K6Q A;  5T6J A;  4BC7 A;  2WCC 3;  4F9B B;  2HGH A;  4WFT A;  2E1M A;  2HFS A;  4LCF A;  4R2R A;  4OO1 A;  2DEJ A;  2UU9 I;  2EM0 A;  5KL3 A;  2C38 B;  3JAM Q;  2VQF I;  1PJT A;  1Z0C A;  4UT4 A;  4MDT A;  4MU0 A;  4JI8 I;  2EOO A;  4DR3 I;  2D9H A;  3IWC A;  1FNM A;  4DPT A;  2IOQ A;  3M6A A;  4X66 I;  4NHR A;  3PYD A;  1PDA A;  1Y5Y A;  1A1G A;  1FJG I;  1KVK A;  4O43 A;  2HHH I;  2YSP A;  4DR7 E;  1SFE A;  4OOG C;  2MKN A;  1BBG A;  3C6M A;  2V8Q B;  2NUG A;  1Z0V A;  4IS1 C;  2NUF A;  4WXD A;  1OYS A;  4JI4 I;  2ODR C;  4M9V C;  3Q6N A;  4JI1 E;  1USV A;  2R76 A;  4I8O A;  2WBU A;  2BA0 D;  1Z5B A;  3LNU A;  4DPU A;  3HPS A;  2YTF A;  4GKK E;  3D4J A;  4IFD C;  1HNW E;  2JOX A;  1E3P A;  5IWA I;  2UUC I;  2JXP A;  2EMI A;  4GKJ E;  3EQ1 A;  3PS3 A;  4P7A A;  2JY9 A;  3PYG A;  5LL6 R;  4BA2 A;  4LFC E;  1ZXM A;  2EPC A;  1YH8 A;  1RMD A;  2PO0 B;  4FW9 A;  1J5E I;  2A2D A;  1B62 A;  4DV0 E;  4LF5 E;  1E3H A;  2BA1 D;  2C38 A;  2EM7 A;  4I3H A;  3QG5 C;  4R2A A;  5A6J A;  3CDI A;  2LCE A;  3UK3 C;  2NN6 B;  4B3R I;  2ZM6 I;  4JI2 I;  1YYK A;  4DKK A;  5KL5 A;  5LMN E;  2J7J A;  4DUZ E;  3ADJ A;  3J7A G;  1VI7 A;  1O0W A;  2ENC A;  1FI4 A;  2EOS A;  4AM3 A;  2VQE E;  4M0V A;  3AUZ A;  1A1J A;  3L00 A;  1YZ9 A;  4JYA E;  1H7U A;  1Z5A A;  3OTO E;  4DV1 I;  4LF4 I;  2L2K B;  3GON A;  4LFA E;  3JTZ A;  4BMJ A;  2Z5E A;  1TF6 A;  2EPP A;  4NXM I;  1WXR A;  2EPM X;  1HR0 E;  1ZXN A;  2EPL X;  4FW4 A;  3EPL A;  1F2I G;  4U3B A;  1X5W A;  2V83 A;  2EFG A;  1ZR9 A;  1IBK I;  4QNJ A;  5AE1 A;  4JI6 E;  2EMG A;  3HQ1 A;  2DIX A;  2VF1 A;  4DR4 E;  4R8O A;  1T4L B;  2Z5B B;  2ODR D;  2PO2 B;  2V86 A;  4F6M A;  3ZKB A;  2EMF A;  2EMC A;  4JI0 I;  3DJW A;  4JI7 E;  2PO0 A;  1Z0B A;  1BKN A;  2JWO A;  4IFD D;  4HTG A;  2YT4 A;  1KJK A;  1H72 C;  5EKW A;  1MX0 A;  1Z5C A;  4DPY A;  4ZYD A;  2EPN A;  2EQ3 A;  3FIG A;  2NN6 A;  3KWR A;  3VYY A;  2JEB B;  3HKM A;  1FWL A;  3DF6 A;  1A1I A;  4DV7 I;  1ZM9 A;  1TN9 A;  4X64 I;  3IWB A;  4IFD F;  2I13 A;  4LF9 E;  2HKJ A;  4JI5 I;  1MG7 A;  1X6E A;  4ZYE A;  4P52 A;  1HK7 A;  1U2R A;  3GME A;  3M7N G;  4X62 E;  4LF8 I;  3MSW A;  2EPO A;  2WNR B;  3LTO A;  2DMY A;  1R6L A;  3H4L A;  5C0X B;  2LRS A;  4WUC A;  2M7Q A;  1YFH A;  2EOJ A;  3NZK A;  4OZE A;  4ZYH A;  4LF6 E;  1IBM E;  4Z7Y A;  2O1W A;  3BF2 A;  4FK5 C;  4B3S E;  5A2Q C;  2V88 A;  2IER A;  5FWK A;  3J7A M;  4WXC A;  2VF3 A;  4GKK I;  1HNW I;  5K36 B;  3QT7 A;  2EN3 A;  1QU6 A;  4WYQ B;  1NZ0 A;  2Z5B A;  1PJQ A;  2PNL A;  1OYR A;  2EOI A;  2PO2 A;  2EML A;  2WBS A;  2NPF A;  2H36 X;  4GKJ I;  2NUE A;  1LLM C;  1ZM4 A;  2UXD I;  2X36 A;  2YRM A;  4DMI A;  3LML A;  1AAY A;  2CPN A;  3M99 B;  2GS8 A;  2JT2 A;  4JG4 A;  4LFB E;  1X6F A;  4B3T E;  1N33 E;  3B4T A;  3LLH A;  4IJD A;  2I9I A;  2J7K A;  2JEB A;  2JPA A;  2GO3 A;  2EOQ A;  3J80 Q;  2UUA E;  3QT8 A;  3J81 Q;  1PVG A;  1I94 E;  4R2Q A;  2JE6 B;  3K17 A;  4BBY A;  2N3G A;  2YPN A;  2N8X A;  1WHQ A;  5LMN I;  4X65 E;  2MKD A;  4DV6 I;  4DUZ I;  4LF7 E;  1X47 A;  4B3M E;  3JAM C;  1UDS A;  4J8Z A;  1DQ3 A;  4JV5 E;  2UXC E;  2ELZ A;  4PRV A;  2WNR A;  4JYA I;  4PU9 A;  5C0X A;  1EH6 A;  2L2M A;  2C39 B;  4R2D A;  1T39 A;  4YY3 E;  2EE8 A;  4ISA A;  2EM6 A;  1G2F C;  5DRQ A;  2F8B A;  3P3E A;  2YRH A;  5K36 A;  3CDJ A;  4FWD A;  2LJP A;  1WRJ A;  1USU A;  1NHJ A;  4DR4 I;  4WPY A;  2MC6 A;  5DNY A;  2HFU A;  1OYP A;  4DR5 E;  2E5L E;  1YYW A;  3Q6M A;  4OKG A;  2DMI A;  3ZZ0 A;  1XNQ I;  1XMO E;  5BR8 E;  2ZBK B;  4IFD B;  1N36 E;  1N34 I;  2HK3 A;  1SR9 A;  1XNR E;  4PRX A;  3C4T A;  2B9D A;  2EL4 A;  2RSI A;  1FKA E;  2E72 A;  1IQO A;  5AAS A;  2CTD A;  2HKE A;  4GQU A;  2JOB A;  2PNZ B;  4DXL A;  2LO3 A;  1GTK A;  2JE6 A;  2BB8 A;  1Y4U A;  4OX9 I;  2EM4 A;  4Q28 A;  2PO1 B;  1N3G A;  4USM A;  1T4O A;  2L8T A;  4DV5 E;  4LF9 I;  1XHK A;  2BR2 B;  2RS6 A;  2AJ4 A;  1HNX E;  3QT5 A;  1Z59 A;  2EOR A;  2IES A;  5A6B A;  2V89 A;  2V87 A;  2BV3 A;  2C39 A;  1ZM2 A;  1XMQ E;  1Z0G A;  4BA1 B;  2CZ9 A;  3EPK A;  2M4I A;  2MDG A;  4GZN C;  2N3H A;  1YUI A;  2JEA B;  2B7T A;  5TSE A;  2RSM A;  2LUP B;  4B3S I;  2EPX A;  1WHN A;  2YTI A;  2EN1 A;  2EOM A;  2GHF A;  2LJU A;  1XXE A;  2YTG A;  4DR1 E;  4R2P A;  1YUJ A;  1R6M A;  1S16 A;  3UHM A;  2EPU A;  1EI1 A;  5DRO A;  3EPH A;  1EH8 A;  4IFD A;  4KHP E;  2MC5 A;  1MEY C;  2F1D A;  5DNX A;  4LFB I;  4B3T I;  2BM0 A;  2YTD A;  2PNZ A;  3PYF A;  1MGT A;  2GLI A;  1YHC A;  5F3W A;  4ZYG A;  4TUI A;  5L3J A;  2DB2 A;  2UUA I;  2PO1 A;  4DU7 A;  3M85 D;  2UUB E;  1H74 A;  2K4V A;  4LCH A;  4N4R B;  3ZZT A;  1I94 I;  4IZJ D;  2YTN A;  2BR2 A;  2YU5 A;  4X65 I;  4DUY E;  2O1U A;  4MU3 A;  4LF7 I;  4RH8 A;  3V5R A;  4KWY A;  5A69 A;  4B3M I;  1Z0T A;  2NN6 C;  2UXC I;  3OTO I;  2WBT A;  3L7Z B;  3P06 A;  2EQ1 A;  3EPJ A;  2UXB I;  4NXN I;  2L6M A;  1KTV A;  4FW3 A;  4UTG A;  4BA1 A;  4F9C B;  4DV7 E;  3ADL A;  5IT9 Q;  4HEI A;  2EQ0 A;  2V34 A;  2WP8 B;  2VES A;  2JEA A;  1IMU A;  2ZIT A;  2UU9 E;  4HY1 A;  4LCG A;  5KL2 A;  2EMZ A;  4O4K A;  2X7I A;  1D6T A;  1B69 A;  5ADZ A;  4DR2 E;  2Z5C B;  4R2C A;  4RHB B;  5GMD A;  4WUB A;  4JI8 E;  1NHH A;  4BS9 A;  4X66 E;  2EMH A;  2G7H A;  4FW6 A;  2E5L I;  5AC4 A;  4R2S A;  1N0V C;  1QZR A;  2IOP A;  2EM5 A;  2RS7 A;  1XMO I;  1X6H A;  3T1H E;  4DR7 I;  3CWV A;  2CT1 A;  5BR8 I;  3U1K A;  2EJ4 A;  3GCM A;  2JVA A;  2EL5 A;  3AV0 A;  1WJP A;  1ZAA C;  4JI4 E;  1N0U A;  3Q1Q A;  4MYT A;  4JI1 I;  2CG9 A;  2EM3 A;  4L8N A;  3HJC A;  2YTQ A;  5GME A;  1G2D C;  1RR9 A;  1H7S A;  2WW4 A;  4XTJ A;  5JEA C;  2EN6 A;  1YSA C;  1DAR A;  1J26 A;  4DV5 I;  2KOU A;  2UUC E;  4R1F A;  3J80 C;  3J81 C;  3L7Z A;  2LUQ A;  2B7V A;  2F4V E;  3PS1 A;  2EMB A;  1L4S A;  2EMK A;  4ZVI A;  4LFC I;  2EOY A;  2EOE A;  2ENA A;  5KL6 A;  1EKZ A;  1P42 A;  3MHH C;  2GO4 A;  2DGC A;  2WP8 A;  4LPF A;  1UHZ A;  4R2E A;  4DV0 I;  1UBD C;  4DV4 E;  4LF5 I;  2NA2 A;  1ELO A;  4MLQ A;  4FWG A;  1UDQ A;  2CSH A;  4BHC A;  1UEK A;  2Z5C A;  5FLX Q;  2EMA A;  2NN6 D;  4AQY E;  2ZM6 E;  3ECR A;  5C0X C;  2L2N A;  5DRR A;  2ADR A;  3LPS A;  4F54 A;  5IV8 B;  3F0N A;  4F6N A;  4NBQ A;  1UDO A;  4K0K E;  4OO1 C;  2VQE I;  2O1V A;  2EWL A;  2V2Q A;  2VE7 C;  4MLV A;  4LF4 E;  1Z0W A;  2BA0 G;  5A6A A;  2YSO A;  2EZ6 A;  5DRP A;  1IBL E;  2DLK A;  3ADI A;  2NN6 F;  1DGC A;  4IS9 A;  4LFA I;  1HR0 I;  2EOZ A;  2LTS A;  2YRK A;  4FN5 A;  1RC7 A;  3P76 A;  2J65 A;  3P3C A;  1N32 E;  4N3O A;  1K47 A;  3ZM7 A;  5KL7 A;  2HK2 A;  2L92 A;  1STU A;  2UUB I;  1ZBQ A;  4MQY A;  4JI6 I;  1NCS A;  4IZJ B;  2JR1 A;  2V85 A;  1X48 A;  2EOH A;  2JYA A;  2LMZ A;  3KZY A;  1YYO A;  1MU5 A;  2EL6 A;  1FWK A;  1A1K A;  4LOM A;  2BA1 G;  3BBG A;  4JI7 I;  4JI0 E;  4USK A;  2L3J A;  4HYM A;  2NN6 E;  4LTY A;  5JEA D;  1A6F A;  2GQ0 A;  2EMW A;  2YTJ A;  5LMU E;  2EMY A;  1RHY A;  3B8H A;  4AIM A;  4URL A;  4DR2 I;  2EN8 A;  2EPA A;  2KHX A;  2M1S A;  2NAB A;  5AC5 A;  2EM8 A;  4JI3 E;  2O1T A;  3DD6 A;  4ED4 A;  4X64 E;  4NZV A;  3K85 A;  5JEA F;  2V8P A;  1UDN A;  2DEI A;  2HJJ A;  2FV4 B;  2AE8 A;  4JI5 E;  3BGH A;  1Y6Z A;  4M1K A;  4MU1 A;  1S4E A;  4X62 I;  4X8W A;  1PIE A;  1DI2 A;  4LF8 E;  2E1R A;  3T1H I;  2BM1 A;  4WUD A;  3ZZU A;  3M85 G;  2Q8U A;  3WU4 A;  5C0X D;  3P3G A;  2HC5 A;  4FWH A;  1T4N A;  2YU8 A;  3THN A;  2K7I A;  4LF6 I;  1UIL A;  1YPN A;  1IBM I;  4OO1 D;  1PKP A;  3V2U C;  3H1C A;  3WU6 A;  4IZJ A;  4DV3 E;  1AH5 A;  5K36 D;  5EL9 A;  4DR6 E;  1T38 A;  4RPF A;  2EM2 A;  5JEA E;  3WU5 A;  2CGE A;  1H73 A;  5K36 C;  4P78 A;  4TUG A;  5C0X F;  4X9J A;  2F4V I;  3ZOQ B;  5AE2 A;  2FTX B;  4OO1 F;  2UXD E;  2LJH A;  2EN2 A;  2KON A;  4L5N C;  1HNZ E;  1Y4S A;  2IHR 1;  1N33 I;  2EM9 A;  5K36 F;  4DV4 I;  2BBG A;  3B78 A;  2L3C A;  2CVE A;  2LT7 A;  4Q35 B;  5IXM B;  4YHH E;  2R42 A;  1PJS A;  4MYU A;  3T1Y E;  5IT9 C;  1JK1 A;  4AQY I;  4DV6 E;  5C0X E;  4K0K I;  4JV5 I;  3OML A;  4KQV A;  5LLQ A;  2V2V A;  5DNL A;  4OO1 E;  2YTE A;  4BC9 A;  4DV2 E;  2R3V A;  4MU4 A;  3C4B A;  1IBL I;  5A6K A;  2RQL A;  1NEI A;  1B63 A;  5A6B D;  1WUU A;  4YY3 I;  5K36 E;  2A2C A;  4DPW A;  2FGG A;  4IZK B;  4FW7 A;  2VQF E;  4WSP A;  1N32 I;  2V2Z A;  4HAC B;  2RTX A;  4DR3 E;  2LVH A;  1ZU1 A;  1JK2 A;  2L33 A;  3THO B;  3HTX A;  4DR5 I;  1UN6 B;  1GQE A;  2EPZ A;  3IWD A;  4M2Z A;  1FJG E;  4KZS A;  2HHH E;  1XNQ E;  1N36 I;  2JP9 A;  1XNR I;  3HXL A;  2R1F A;  5CFF E;  1P47 A;  1N34 E;  1KKH A;  5JEA B;  2ENH A;  4AID A;  4F2J C;  2EN4 A;  4BCA A;  4BHB A;  4HXZ A;  4O5G A;  4F9A B;  3J7Y p;  3GLL A;  2PRT A;  1Z0E A;  5LMU I;  2EN7 A;  2B3T B;  3QT6 A;  3TQM A;  4OX9 E;  1A1F A;  2YZT A;  5IWA E;  2EOX A;  2LV2 A;  2YTO A;  4JI3 I;  1NHI A;  2MDR A;  4WSG A;  4QNK A;  2YWQ A;  5FLX C;  3VK6 A;  3VYX A;  1HNX I;  1QNT A;  1BBO A;  2EMX A;  2LBS B;  1Y60 A;  2DLQ A;  3HPZ A;  3RMP A;  2OI2 A;  5ELW A;  1XMQ I;  4BA2 B;  4O24 A;  4J3D A;  1J5E E;  2C37 B;  4R03 A;  3F6G A;  2DRP A;  4IZK A;  1BB8 A;  3MHS C;  4OO1 B;  4B3R E;  1A1H A;  1ZBT A;  3HUL A;  4JI2 E;  3PYE A;  3K1J A;  4HAC A;  1EA6 A;  4DV3 I;  5AE3 A;  4P7D A;  1ZM3 A;  1RRE A;  4DR6 I;  4DR1 I;  1OJ4 A;  4IFD E;  2WZO A;  2EOF A;  2EPR A;  3H09 A;  4GEQ B;  3JU0 A;  1EH7 A;  4DV1 E;  1KIJ A;  1RQ0 A;  3WU3 A;  4KHP I;  3KZZ A;  5JEA A;  3F6H A;  3VHT B;  1VIS A;  3ZKD A;  2O3Z A;  5A2Q Q;  1HNZ I;  2LE2 A;  4NXM E;  3PS2 A;  1IQS A;  3C6K A;  3M7N D;  4DU8 A;  1X49 A;  2LTR A;  2A25 A;  2YTP A;  3ADG A;  4LU9 A;  1A1L A;  4Z7C A;  2Q2E B;  4YHH I;  1IBK E;  3BID A;  2EP3 A;  2XEX A;  2RPC A;  4U3D A;  4M30 A;  3T1Y I;  1GZ6 A;  3P1X A;  5KL4 A;  3U1Y A;  3B82 A;  4DUY I; 
#chains in the Genus database with same CATH homology
 3PRY A;  2DSY A;  4DPX A;  2PNM A;  4EMD A;  2UXB E;  4NXN E;  4DV2 I;  5T6J A;  4BC7 A;  3K6Q A;  4DV7 I;  2HFS A;  4F9B B;  4WFT A;  2E1M A;  2DEJ A;  2UU9 I;  3JAM Q;  2VQF I;  1Z0C A;  4UT4 A;  4JI8 I;  4DR3 I;  3IWC A;  1FNM A;  4DPT A;  2IOQ A;  3M6A A;  4X66 I;  3PYD A;  1FJG I;  1KVK A;  2HHH I;  4DR7 E;  4OOG C;  2NUG A;  1Z0V A;  2V8Q B;  2NUF A;  4JI4 I;  2ODR C;  3Q6N A;  4JI1 E;  1USV A;  4I8O A;  3LNU A;  4DPU A;  1Z5B A;  3HPS A;  4GKK E;  3D4J A;  1HNW E;  2JOX A;  5IWA I;  2UUC I;  4GKJ E;  4P7A A;  2JY9 A;  3PYG A;  5LL6 R;  4LFC E;  1ZXM A;  4FW9 A;  1J5E I;  2A2D A;  1B62 A;  4DV0 E;  4LF5 E;  4I3H A;  4B3R I;  2ZM6 I;  4JI2 I;  1YYK A;  4DKK A;  5LMN E;  4DUZ E;  3ADJ A;  3J7A G;  1O0W A;  1FI4 A;  2VQE E;  4M0V A;  3AUZ A;  1YZ9 A;  1Z5A A;  4DV1 I;  1H7U A;  4JYA E;  4LF4 I;  3OTO E;  2L2K B;  3GON A;  4LFA E;  3JTZ A;  4BMJ A;  2Z5E A;  4NXM I;  1WXR A;  1HR0 E;  1ZXN A;  2V83 A;  2EFG A;  1IBK I;  5AE1 A;  4JI6 E;  3HQ1 A;  2DIX A;  2VF1 A;  4DR4 E;  4R8O A;  1T4L B;  2Z5B B;  2ODR D;  2V86 A;  3ZKB A;  4JI0 I;  3DJW A;  4JI7 E;  1Z0B A;  1BKN A;  2JWO A;  4DPY A;  2YT4 A;  1H72 C;  1MX0 A;  1Z5C A;  3FIG A;  3KWR A;  3VYY A;  1FWL A;  3DF6 A;  1ZM9 A;  4X64 I;  3IWB A;  4LF9 E;  2HKJ A;  4JI5 I;  1MG7 A;  4P52 A;  1HK7 A;  1U2R A;  4X62 E;  4LF8 I;  3MSW A;  3LTO A;  2DMY A;  3H4L A;  2LRS A;  4WUC A;  2M7Q A;  4LF6 E;  1IBM E;  4Z7Y A;  2O1W A;  4B3S E;  3J7A M;  5A2Q C;  2V88 A;  4GKK I;  5FWK A;  2VF3 A;  1HNW I;  3QT7 A;  1NZ0 A;  1QU6 A;  4WYQ B;  2Z5B A;  2PNL A;  2NPF A;  2H36 X;  4GKJ I;  2NUE A;  1ZM4 A;  2UXD I;  2X36 A;  4DMI A;  3LML A;  2CPN A;  2GS8 A;  4JG4 A;  4LFB E;  4B3T E;  1N33 E;  3LLH A;  3J80 Q;  2UUA E;  3QT8 A;  3J81 Q;  1PVG A;  1I94 E;  3K17 A;  4BBY A;  2N3G A;  1WHQ A;  5LMN I;  4X65 E;  4DV6 I;  4DUZ I;  4LF7 E;  1X47 A;  4B3M E;  3JAM C;  4J8Z A;  1DQ3 A;  4JV5 E;  2UXC E;  4PRV A;  4JYA I;  4PU9 A;  2L2M A;  4YY3 E;  2F8B A;  4FWD A;  2LJP A;  1USU A;  1NHJ A;  4DR4 I;  4WPY A;  2MC6 A;  5DNY A;  2HFU A;  4DR5 E;  2E5L E;  1YYW A;  3Q6M A;  3ZZ0 A;  1XNQ I;  1XMO E;  5BR8 E;  2ZBK B;  1N36 E;  1N34 I;  2HK3 A;  1SR9 A;  1XNR E;  4PRX A;  3C4T A;  2B9D A;  1FKA E;  5AAS A;  2HKE A;  2JOB A;  4DXL A;  1Y4U A;  4OX9 I;  4Q28 A;  4USM A;  1T4O A;  2L8T A;  4DV5 E;  4LF9 I;  1XHK A;  2RS6 A;  2AJ4 A;  1HNX E;  3QT5 A;  1Z59 A;  2BV3 A;  2V89 A;  2V87 A;  1ZM2 A;  1XMQ E;  1Z0G A;  2CZ9 A;  2M4I A;  2N3H A;  2B7T A;  2LUP B;  2RSM A;  4B3S I;  1WHN A;  4DR1 E;  1S16 A;  1EI1 A;  4KHP E;  2MC5 A;  4LFB I;  4B3T I;  2BM0 A;  3PYF A;  5F3W A;  5L3J A;  4TUI A;  2DB2 A;  2UUA I;  4DU7 A;  1I94 I;  2UUB E;  1H74 A;  2K4V A;  3ZZT A;  4IZJ D;  4X65 I;  4DUY E;  2O1U A;  4LF7 I;  3V5R A;  4B3M I;  1Z0T A;  2UXC I;  3P06 A;  2UXB I;  4NXN I;  2L6M A;  1KTV A;  4UTG A;  4F9C B;  4DV7 E;  3ADL A;  5IT9 Q;  2V34 A;  2ZIT A;  2UU9 E;  4HY1 A;  2X7I A;  1D6T A;  5ADZ A;  4DR2 E;  2Z5C B;  5GMD A;  4WUB A;  4JI8 E;  1NHH A;  4BS9 A;  4X66 E;  2G7H A;  2E5L I;  1N0V C;  1QZR A;  2IOP A;  2RS7 A;  1XMO I;  3T1H E;  4DR7 I;  3CWV A;  5BR8 I;  2JVA A;  3AV0 A;  3Q1Q A;  1N0U A;  4JI4 E;  4MYT A;  4JI1 I;  2CG9 A;  4L8N A;  3HJC A;  5GME A;  1RR9 A;  1H7S A;  2WW4 A;  4XTJ A;  1DAR A;  1J26 A;  4DV5 I;  2KOU A;  2UUC E;  4R1F A;  3J80 C;  3J81 C;  2LUQ A;  2B7V A;  2F4V E;  4ZVI A;  4LFC I;  1EKZ A;  1UHZ A;  4DV0 I;  4LF5 I;  4DV4 E;  2NA2 A;  1ELO A;  4FWG A;  1UEK A;  2Z5C A;  5FLX Q;  4AQY E;  2ZM6 E;  2L2N A;  3LPS A;  4F54 A;  3F0N A;  4K0K E;  2VQE I;  2O1V A;  2EWL A;  2V2Q A;  2VE7 C;  1Z0W A;  4LF4 E;  3OTO I;  2EZ6 A;  1IBL E;  3ADI A;  4LFA I;  1HR0 I;  2LTS A;  4FN5 A;  1RC7 A;  1N32 E;  4N3O A;  1K47 A;  3ZM7 A;  4JI6 I;  2HK2 A;  2L92 A;  1STU A;  2UUB I;  1ZBQ A;  4IZJ B;  2JR1 A;  2V85 A;  1X48 A;  2LMZ A;  1YYO A;  1MU5 A;  1FWK A;  4JI7 I;  4JI0 E;  4USK A;  2L3J A;  4HYM A;  4LTY A;  1A6F A;  2GQ0 A;  5LMU E;  3B8H A;  4URL A;  4DR2 I;  2KHX A;  2M1S A;  2O1T A;  4JI3 E;  4ED4 A;  4X64 E;  3K85 A;  2V8P A;  2DEI A;  2FV4 B;  4JI5 E;  1Y6Z A;  4M1K A;  1S4E A;  4X62 I;  4X8W A;  1PIE A;  1DI2 A;  4LF8 E;  2E1R A;  3T1H I;  2BM1 A;  4WUD A;  3ZZU A;  3WU4 A;  4FWH A;  1T4N A;  4LF6 I;  1UIL A;  1IBM I;  1PKP A;  3V2U C;  3WU6 A;  4IZJ A;  4DV3 E;  4DR6 E;  4RPF A;  3WU5 A;  2CGE A;  1H73 A;  4P78 A;  4TUG A;  2F4V I;  3ZOQ B;  5AE2 A;  2FTX B;  2UXD E;  2LJH A;  2KON A;  4L5N C;  1HNZ E;  1Y4S A;  2IHR 1;  1N33 I;  4DV4 I;  3B78 A;  2L3C A;  4YHH E;  2R42 A;  4MYU A;  3T1Y E;  5IT9 C;  4AQY I;  4DV6 E;  4K0K I;  4JV5 I;  3OML A;  4KQV A;  2V2V A;  4BC9 A;  4DV2 E;  2R3V A;  1IBL I;  3C4B A;  1B63 A;  4YY3 I;  1WUU A;  2A2C A;  4DPW A;  2FGG A;  4IZK B;  2VQF E;  4WSP A;  1N32 I;  2V2Z A;  4HAC B;  2RTX A;  4DR3 E;  2L33 A;  3HTX A;  4DR5 I;  1GQE A;  3IWD A;  4M2Z A;  1FJG E;  4KZS A;  2HHH E;  1XNQ E;  1N36 I;  1XNR I;  3HXL A;  5CFF E;  1N34 E;  1KKH A;  4BCA A;  4HXZ A;  4F9A B;  3J7Y p;  5LMU I;  1Z0E A;  2B3T B;  3QT6 A;  4OX9 E;  2YZT A;  5IWA E;  4JI3 I;  1NHI A;  2MDR A;  5FLX C;  3VK6 A;  3VYX A;  1HNX I;  2LBS B;  3HPZ A;  3RMP A;  2OI2 A;  1XMQ I;  1J5E E;  4R03 A;  3F6G A;  4IZK A;  4B3R E;  1ZBT A;  3HUL A;  4JI2 E;  3PYE A;  3K1J A;  4HAC A;  1EA6 A;  4DV3 I;  5AE3 A;  4P7D A;  1ZM3 A;  1RRE A;  4DR6 I;  4DR1 I;  1OJ4 A;  2WZO A;  3H09 A;  4GEQ B;  3JU0 A;  4DV1 E;  1KIJ A;  1RQ0 A;  3WU3 A;  4KHP I;  3F6H A;  3ZKD A;  1VIS A;  5A2Q Q;  1HNZ I;  2LE2 A;  4NXM E;  4DU8 A;  1X49 A;  2LTR A;  4LU9 A;  3ADG A;  4Z7C A;  2Q2E B;  4YHH I;  1IBK E;  2XEX A;  4M30 A;  3T1Y I;  1GZ6 A;  3P1X A;  2J7K A;  3B82 A;  4DUY I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...