4AQYE

Structure of ribosome-apramycin complexes
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4aqyE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4aqyE02
2LUPB 4B3SE 1N33E 2UXBE 2LRSA 2A2DA 2HKJA 4PRXA 4GKKE 2E5LI 2XEXA 4M30A 3ZKDA 5FLXQ 4JI4I 3C4BA 4B3TE 4B3TI 2DEIA 2DEJA 1NHIA 4AQYE 3WU6A 3ZM7A 1H73A 2F4VI 3J7Yp 4DV0E 1H7SA 1YYOA 3LLHA 3J7AM 1NHHA 4USMA 4B3RI 1VISA 2UUBE 4DR6E 1UEKA 2UXBI 1ZM4A 4M1KA 3J80Q 2NUGA 4FWHA 4JV5I 2UUCI 4LFBE 3ADJA 3ZKBA 2HFSA 4EMDA 2DIXA 4X62I 4X64E 4JI8E 4DPWA 4YHHI 3B82A 2UXCE 4WUDA 2RS6A 1H7UA 3H4LA 1YYWA 5GMEA 1IBKI 2UUBI 3K17A 4JI0E 3ADGA 4B3RE 5IT9C 4GKJI 4RPFA 1FI4A 2X36A 4OX9E 4DV4E 4FN5A 1Z0BA 3QT5A 4PU9A 4WUCA 4LF8I 2UUAI 2B7TA 4UT4A 4P52A 4DPTA 1FKAE 4JI3I 1RQ0A 1Z0GA 3WU4A 4YHHE 2ZBKB 4B3SI 1XMOE 4DR4I 4K0KE 4GKJE 4DR3E 1ZM9A 2NA2A 4JI0I 4JI7E 2ZM6E 1EKZA 4GKKI 2IHR1 3J7AG 2HHHI 4JV5E 4DV7I 3V2UC 3T1HI 2EFGA 3D4JA 4I3HA 4DUZE 1EA6A 4X64I 2RTXA 2EZ6A 1X48A 3VYYA 1EI1A 1Z59A 1Z0CA 1N32I 2L2MA 3B8HA 4K0KI 1Z5AA 2B7VA 3WU5A 1STUA 3JAMQ 4X65E 2L3JA 4MYUA 1MU5A 4JG4A 4DR1E 4LF5I 4HACA 1WUUA 4LF6E 3LPSA 4UTGA 4OOGC 4KHPI 1X47A 1HNZE 2VQEI 5CFFE 1FJGI 1RREA 4FWGA 2NUEA 4LFAI 3PYGA 2UU9I 2GS8A 1K47A 4DR7E 3ADIA 2RSMA 5L3JA 4WUBA 1YZ9A 2LTSA 2VF3A 4ZVIA 3J81Q 1S16A 2LUQA 4DU8A 5IWAI 2JVAA 2HKEA 4JI1I 4JI5I 2UXDE 5FLXC 4OX9I 1HR0E 2BV3A 4B3ME 1J5EI 1B63A 5BR8I 2HFUA 2L3CA 4USKA 3LNUA 4NXME 2R42A 1I94E 4DR5E 4JI6E 4DUYE 1YYKA 5A2QQ 1Z0VA 4DXLA 4DR5I 4JI6I 1XMQI 1T4OA 2ZM6I 4B3MI 4DR2I 1KIJA 4JI5E 4JI1E 4Z7CA 2RS7A 1HNZI 1ELOA 1Z5BA 1UHZA 1HR0I 4JI4E 2LJPA 2V8PA 4X66I 2A2CA 4DUYI 4JYAI 1N34I 2L2NA 2JY9A 2UU9E 3J81C 4P7AA 4YY3E 3T1YE 2V2VA 4X65I 1NZ0A 1Z0EA 4AQYI 1IBMI 2LTRA 1RR9A 2V2QA 3P1XA 5LMUI 4DPYA 2YT4A 1KKHA 4DV4I 4DR2E 2N3HA 1FNMA 1MG7A 1WHNA 2E5LE 4KHPE 4LF5E 4MYTA 3JAMC 1ZBTA 4ED4A 1PKPA 1D6TA 4LF4E 1GQEA 3M6AA 1HNWI 4DUZI 4WYQB 4KQVA 4DV7E 3T1HE 3J80C 4NXMI 2DMYA 4R1FA 4JI8I 4HYMA 1KVKA 2AJ4A 4DR4E 1XMOI 1XMQE 4NXNI 1ZXNA 2N3GA 1PIEA 1Z0TA 1FWKA 1DARA 1BKNA 1Z0WA 2OI2A 3PYEA 4DKKA 2HK2A 4XTJA 4DV3E 3Q1QA 2NPFA 4X62E 4LF8E 4DPUA 2BM0A 2L33A 3B78A 1WHQA 2CPNA 5IT9Q 4LFCE 4DV1I 1FJGE 2L2KB 2MDRA 1O0WA 2VQEE 5LMUE 4DV5I 1X49A 1UILA 2LBSB 1A6FA 1IBME 4JI2I 4M2ZA 1XNRI 1J26A 2BM1A 4JI3E 4DR7I 1ZXMA 1DI2A 1PVGA 4JI2E 5LMNI 5LMNE 1H74A 1XHKA 1MX0A 4WFTA 2UUAE 2KHXA 2CZ9A 1N0UA 2J7KA 3T1YI 3LTOA 4LF6I 4DV1E 1ZM3A 4LFCI 3F0NA 1N36I 5LL6R 2UXCI 1XNRE 4FWDA 4NXNE 2X7IA 4DV5E 3CWVA 4DV6E 1XNQE 1ZM2A 4JI7I 3HTXA 5BR8E 3ZZUA 4DR3I 2ZITA 3QT8A 2E1RA 1XNQI 4DV3I 1U2RA 3QT6A 4LFBI 4YY3I 5A2QC 2VQFI 3OTOI 1N36E 2HK3A 4DR6I 4JYAE 2Q2EB 4X8WA 1N33I 3PYFA 1H72C 3QT7A 4PRVA 2LJHA 4HY1A 2UXDI 1OJ4A 5GMDA 5IWAE 1T4NA 3PYDA 2DB2A 1QZRA 2B3TB 4DU7A 1HNXI 1HNXE 3ADLA 3HULA 4LF4I 4X66E 3GONA 4Z7YA 3ZZTA 3OTOE 3WU3A 1N34E 2VQFE 2V34A 4FW9A 1IBLI 4LF9I 1B62A 3V5RA 4URLA 1IBKE 4LF7E 4DR1I 2UUCE 1QU6A 4DPXA 1T4LB 1NHJA 3C4TA 1Z5CA 2WW4A 2V2ZA 1N0VC 1S4EA 4LF7I 1KTVA 1HNWE 3K1JA 1I94I 2HHHE 2NUFA 1N32E 4DV0I 2R3VA 4LFAE 3VYXA 1J5EE 4HACB 4DV2I 4DV2E 2F4VE 4HXZA 1RC7A 1IBLE 1FWLA 3ZZ0A 4DV6I 4LF9E
chains in the Genus database with same CATH superfamily
2LUPB 3PS1A 2FTXB 2EM8A 4B3SE 4IFDA 2N8XA 1N33E 2UXBE 5AE2A 2LRSA 2A2DA 2EM3A 2L6MA 2NN6C 2MKNA 2C39A 2HKJA 2RSIA 2EN4A 1IQSA 4PRXA 4GKKE 2E5LI 2XEXA 5TSEA 5KL2A 4LPFA 4M30A 3ZKDA 2EOEA 5FLXQ 2CT1A 4BBYA 4JI4I 3C4BA 4P78A 4B3TE 5A6BA 4MQYA 2DEIA 2DEJA 5C0XD 4B3TI 1NHIA 2I9IA 1WRJA 3DJWA 2J65A 2WP8A 4AQYE 3WU6A 4IZJB 1EH8A 3ZM7A 1H73A 2F4VI 2DLKA 2LCEA 2YRKA 4RHBB 3J7Yp 1P42A 2EOMA 2O1TA 4DV0E 4QNJA 2YTJA 1YYOA 1H7SA 2VESA 3LLHA 2MC6A 4MLQA 1NHHA 5EL9A 3U1KA 4USMA 3J7AM 4B3RI 1VISA 4O24A 2UUBE 5KL6A 4N3OA 2EMXA 4DR6E 4MU0A 1UEKA 2UXBI 1ZM4A 4M1KA 3J80Q 2C38B 2NUGA 4FWHA 3HPSA 2GO3A 4JV5I 2BA1G 2UUCI 1IMUA 2EPPA 3P76A 2EMAA 4LFBE 3ADJA 2R76A 4BCAA 2HFSA 3ZKBA 4EMDA 1P47A 2O3ZA 2DIXA 4X62I 1YPNA 3HXLA 2JWOA 4X64E 4JI8E 3M99B 2EN3A 1ZU1A 3EPLA 4DPWA 4YHHI 3B82A 2YTQA 2ODRC 2BA0D 2EM4A 2UXCE 4ZYHA 2NN6F 4WUDA 2EMHA 2RS6A 3JU0A 1H7UA 2JE6B 1MEYC 2C37B 3H4LA 2PO1A 5K36D 1TF3A 1YYWA 2PNMA 5GMEA 3TQMA 1IBKI 2UUBI 3K17A 4JI0E 4FW4A 3ADGA 4B3RE 4U3DA 3MHSC 2ENAA 5IT9C 1UDOA 4RPFA 4GKJI 2MDGA 1FI4A 1B69A 2X36A 1GZ6A 2EM5A 2EOQA 3HPZA 2M1SA 3OMLA 5AC5A 2M9AA 4DV4E 4OX9E 2YZTA 4FN5A 4OO1F 1Z0BA 3QT5A 2Z5BB 2EOYA 4PU9A 4LOMA 4R2PA 2PO0A 1YH8A 4WUCA 3IWDA 1AH5A 1BBOA 4LF8I 2PNZA 2UUAI 2B7TA 2ELYA 3Q6MA 1ZBQA 4AIDA 4NBQA 2VF1A 2EOXA 4LF9E 4UT4A 4P52A 5IV8B 3EPJA 4DPTA 1FKAE 2IESA 1WJPA 4WSGA 1RQ0A 4R03A 4BHCA 2JOXA 4JI3I 1Z0GA 3WU4A 3NZKA 4YHHE 5FWKA 2ZBKB 1SFEA 4B3SI 3P06A 4R2EA 2L8TA 4FW3A 1XMOE 5C0XB 4OO1A 4K0KE 4DR4I 2WCC3 2EPZA 1YUJA 4GKJE 3L7ZB 4DR3E 1ZM9A 4Q35B 2NA2A 4JI0I 5K36C 4JI7E 2ZM6E 1EKZA 4GKKI 2IHR1 3H09A 3J7AG 2VE7C 4IS1C 5DRPA 3MSWA 1F2IG 2LV2A 2HHHI 4JV5E 1X5WA 4IZJA 3V2UC 4DV7I 3T1HI 3M7ND 2EMBA 2EFGA 5C0XE 5A6JA 3D4JA 3GMEA 2YTEA 4L5NC 4F9CB 4DUZE 2EOFA 1EA6A 2NN6A 5DROA 4I3HA 4AIMA 4X64I 4F9AB 5DNYA 5KL5A 2RTXA 2EWLA 5A6AA 3BIDA 2JXPA 5KL4A 5DNXA 2EPCA 1USUA 2EZ6A 2J7JA 1X48A 3F6GA 2PO2B 3VYYA 1EI1A 3BGHA 1Z59A 3BF2A 4F6NA 4GZNC 1Z0CA 2C39B 1N32I 2L2MA 2YTNA 3B8HA 2Q8UA 3M85D 4OZEA 1OYPA 3QG5C 2JP9A 1Z5AA 4IJDA 4K0KI 2IERA 1A1IA 2B7VA 2K7IA 3WU5A 1STUA 1ZR9A 1YFHA 3HKMA 3JAMQ 4TUIA 4X65E 1RHYA 2L3JA 4MYUA 4KZSA 5DRQA 1MU5A 2MC5A 2V8QB 4WXDA 4R2DA 5AC4A 1G2FC 4DR1E 1UDQA 2PO2A 2WNRA 4JG4A 5K36B 4LF5I 4HACA 1WUUA 4O4KA 4LF6E 3LPSA 2WZOA 3C6MA 4UTGA 2RQLA 1X6FA 5AASA 5LLQA 4OOGC 4KHPI 1X47A 3ZOQB 1HNZE 2JEAA 3PS3A 3FIGA 2VQEI 1E3PA 1Y4SA 2WNRB 5K36A 2HJJA 5CFFE 1FJGI 1RREA 3MHHC 4O43A 2PNLA 4FWGA 2LVHA 3KZYA 2NUEA 4LFAI 3PYGA 2UU9I 1UN6B 1K47A 2GS8A 4DR7E 3ADIA 2RSMA 3L7ZA 2EPOA 1KYQA 2NN6E 5L3JA 4OO1B 2L92A 4WUBA 1YZ9A 2LTSA 2VF3A 1UDNA 2DLQA 3BBGA 2F1DA 4MU3A 2ENHA 4ZVIA 2EL6A 2PRTA 3J81Q 4ZYDA 2JEBA 2JPAA 1S16A 2DMIA 2LUQA 4OKGA 4DU8A 2GLIA 5IWAI 1TF6A 2JVAA 2YRHA 4WX9A 4R2QA 2HKEA 4JI1I 2EM6A 4JI5I 4IFDC 2UXDE 5FLXC 4OX9I 1HR0E 2NN6B 2BV3A 4B3ME 2EMYA 1L4SA 1J5EI 4F2JC 5K36F 4ZYGA 1B63A 2PNZB 1USVA 5BR8I 2HFUA 2L3CA 3THNA 5KL7A 4USKA 1AAYA 4F9BB 2CG9A 3CDJA 2M7QA 4BHBA 3LNUA 2H36X 4IS9A 2PO0B 4WPYA 4LU9A 4NXME 2KOUA 4RH8A 2EOIA 2R42A 1I94E 4DR5E 4JI6E 4DUYE 2EJ4A 1YYKA 5A2QQ 2Z5CB 1Z0VA 2EN2A 4DXLA 3VHTB 1BBGA 2EPRA 1Y60A 2Z5EA 3VK6A 4DR5I 2JOBA 1T4OA 1XMQI 4JI6I 3U1YA 3EPHA 3Q6NA 4BA2A 1NCSA 1HK7A 4BC7A 2ZM6I 2O1VA 4B3MI 2V83A 2GO4A 3PRYA 4DR2I 1KIJA 2YU5A 3B4TA 2PO1B 1SR9A 4JI5E 2JE6A 3KRNA 1PJSA 1X6HA 4JI1E 4Z7CA 2O1UA 3P3EA 4MU1A 2RS7A 4LTYA 2O1WA 4OO1C 2EPXA 3UHMA 2EP3A 1ELOA 1HNZI 1Z5BA 1UHZA 2EPAA 1HR0I 4JI4E 2DRPA 2ODRD 4IFDE 1YSAC 5AE3A 3JTZA 2LJPA 2I13A 1XXEA 2V8PA 4X66I 2A2CA 4DUYI 2EE8A 4JYAI 5DRRA 2Z5BA 1N34I 2L2NA 4MDTA 4FW6A 3EQ1A 2JY9A 1YUIA 2UU9E 3J81C 4P7DA 1BB8A 1IQOA 1EH7A 4P7AA 5C0XF 2EMZA 2M4IA 2YTPA 3C6KA 1OYSA 4YY3E 2ELZA 3T1YE 2V2VA 4X65I 1NZ0A 1Z0EA 2C38A 4AQYI 1IBMI 2LTRA 1A1LA 5JEAC 1UDSA 5IXMB 1RR9A 2Z5CA 2V2QA 3P1XA 5LMUI 4QNKA 2YPNA 1A1GA 4DPYA 2YT4A 4KWYA 2KONA 4ZYEA 1KKHA 1PJTA 2YTDA 2EMCA 4DV4I 3L00A 4DR2E 2N3HA 1FNMA 1MG7A 1WHNA 4MU4A 3JAMC 2EM0A 2E5LE 2YSOA 3DF6A 4LF5E 4KHPE 4MYTA 2EN7A 1ZBTA 4ED4A 1PKPA 1D6TA 4LF4E 1GQEA 4R2RA 2BR2B 3EPKA 2V85A 4OO1D 3CDIA 3M6AA 1HNWI 4DUZI 3K6QA 4WYQB 5ADZA 2FGGA 3H1CA 1KJKA 1PJQA 4KQVA 4DV7E 3T1HE 3J80C 4U3BA 2JEBB 1RMDA 2V88A 2CTDA 4NXMI 2G7HA 2CSHA 2DMYA 2EQ3A 2MKDA 2ADRA 1T38A 4IZJD 4R1FA 4LCHA 4JI8I 2YU8A 3GLLA 4HYMA 3PS2A 5A69A 4GQUA 4BS9A 2GQ0A 1KVKA 2AJ4A 2K4VA 4DR4E 2NN6D 1JK2A 1XMOI 1XMQE 1UBDC 1MGTA 2RPCA 1ZXNA 4NXNI 1PDAA 2N3GA 4IFDB 1QNTA 5JEAE 1PIEA 4R2CA 2YSPA 1Z0TA 2EOSA 2F8BA 1FWKA 1R6LA 1DARA 1X3CA 1BKNA 1Z0WA 2OI2A 3PYEA 2D9HA 4DKKA 1Z1BA 5C0XC 2R1FA 2HK2A 2BB8A 4XTJA 4DV3E 3Q1QA 2NPFA 4X62E 4LF8E 4DPUA 4BMJA 2BM0A 3AUZA 2EM7A 2L33A 4WXCA 3B78A 1WHQA 2CPNA 5IT9Q 4LFCE 4DV1I 3F6HA 3RMPA 2YTFA 1FJGE 2L2KB 1O0WA 2MDRA 4Q28A 2VQEE 2EQ1A 5LMUE 5JEAD 3IWCA 4BA1B 4DV5I 1X49A 1UILA 2LBSB 1VI7A 1A6FA 1R6MA 1IBME 4JI2I 4I8OA 4M2ZA 3GCMA 3M85G 1XNRI 1J26A 2BM1A 4JI3E 3HJCA 2LE2A 4DR7I 5KL3A 1ZXMA 1DI2A 1PVGA 4JI2E 5LMNI 5LMNE 1H74A 2BA1D 3LMLA 1XHKA 1MX0A 4WFTA 3DD6A 2UUAE 1Y5YA 2AE8A 2EMKA 3KZZA 2KHXA 4FK5C 1N0UA 2CZ9A 2EMGA 2V87A 2J7KA 4OO1E 5EKWA 3K85A 3T1YI 3LTOA 4LF6I 1Y4UA 2BA0G 2BR2A 2JR1A 4DV1E 5JEAB 1ZM3A 4LFCI 4M0VA 2DGCA 1GTKA 3F0NA 3IWBA 1N36I 4IFDF 4DMIA 5A6BD 5C0XA 2EMLA 5LL6R 2JT2A 2UXCI 1XNRE 4AM3A 4FWDA 1A1JA 4MLVA 3UK3C 1G2DC 4TUGA 2EOZA 4NXNE 2X7IA 4DV5E 2V89A 3CWVA 4DV6E 1XNQE 1ZM2A 2EL5A 1OYRA 4IZKA 2EPKX 3ECRA 4JI7I 1A1KA 1A1HA 3HTXA 1YHCA 2EQ0A 2EM9A 5BR8E 3ZZUA 4DR3I 2EOHA 2ZITA 2WBTA 2GPIA 3THOB 4HEIA 3QT8A 2E1RA 1XNQI 2EM2A 4DV3I 4IFDD 1U2RA 2EOJA 3QT6A 2EPUA 4LFBI 4L8NA 1JK1A 5AE1A 2CVEA 2LO3A 2YTOA 2CGEA 5DNLA 4YY3I 2YRMA 5A2QC 2VQFI 2HC5A 2EORA 3OTOI 1N36E 2HK3A 4DR6I 4F54A 1N3GA 3HQ1A 4IZKB 4R8OA 1DGCA 4JYAE 2Q2EB 4BA2B 2GHFA 4X8WA 5A6KA 5ELWA 2E1MA 5T6JA 2EPLX 1N33I 2DSYA 1X6EA 3PYFA 4FW7A 1H72C 3QT7A 2C37A 2LJHA 4HY1A 4PRVA 2UXDI 1OJ4A 5K36E 5GMDA 5IWAE 2ENCA 4R2AA 1Y6ZA 1T4NA 2EMIA 2YTIA 3PYDA 2DB2A 1QZRA 2B3TB 4X9JA 5JEAA 2EOOA 4NZVA 3M7NG 4DU7A 5JEAF 2IOPA 4J3DA 4WSPA 1HNXI 2LJUA 1HNXE 3ADLA 4F6MA 3P3CA 3HULA 4LF4I 4X66E 3GONA 4Z7YA 3ZZTA 1NEIA 2EN6A 3OTOE 3WU3A 4HTGA 1N34E 2VQFE 4BC9A 2LMZA 2V34A 4N4RB 1EH6A 4FW9A 2EMWA 2EL4A 2VRDA 2YWQA 5F3WA 1T39A 3P3GA 1DQ3A 1IBLI 2B9DA 4LF9I 1LLMC 2LT7A 1B62A 2EPNA 4M9VC 1ZAAC 2E72A 3V5RA 4URLA 2IOQA 4GEQB 4LCGA 1IBKE 4LF7E 4BA1A 2JYAA 4R2SA 4DR1I 2UUCE 2EN8A 2WP8B 1QU6A 4DPXA 1T4LB 1NHJA 3C4TA 1Z5CA 4LCFA 2WW4A 1E3HA 2EMFA 2V2ZA 4ISAA 2V86A 2YTGA 2JEAB 1N0VC 1S4EA 4LF7I 2NABA 1HNWE 1KTVA 4NHRA 1A1FA 2BBGA 3K1JA 1I94I 2HHHE 2WBUA 2NUFA 1N32E 4DV0I 3AV0A 2R3VA 4LFAE 2A25A 3VYXA 2EN1A 1J5EE 4HACB 2FV4B 4DV2I 4DV2E 1WXRA 2F4VE 2EPMX 3KWRA 1TN9A 4HXZA 4FW5A 4J8ZA 1RC7A 1IBLE 4O5GA 2HGHA 1FWLA 3ZZ0A 4DV6I 2WBSA
chains in the Genus database with same CATH topology
2LUPB 2FTXB 4B3SE 1N33E 2UXBE 5AE2A 2LRSA 2A2DA 2L6MA 2HKJA 4PRXA 4GKKE 2E5LI 2XEXA 4M30A 3ZKDA 5FLXQ 4BBYA 4JI4I 3C4BA 4P78A 4B3TE 4B3TI 2DEIA 2DEJA 1NHIA 3DJWA 4AQYE 3WU6A 4IZJB 3ZM7A 1H73A 2F4VI 3J7Yp 2O1TA 4DV0E 1H7SA 1YYOA 3LLHA 2MC6A 3J7AM 1NHHA 4USMA 4B3RI 1VISA 2UUBE 4N3OA 4DR6E 1UEKA 2UXBI 1ZM4A 4M1KA 3J80Q 2NUGA 4FWHA 3HPSA 4JV5I 2UUCI 4LFBE 3ADJA 3ZKBA 4BCAA 2HFSA 4EMDA 2DIXA 4X62I 3HXLA 2JWOA 4X64E 4JI8E 4DPWA 4YHHI 3B82A 2ODRC 2UXCE 4WUDA 2RS6A 3JU0A 1H7UA 3H4LA 1YYWA 2PNMA 5GMEA 1IBKI 2UUBI 3K17A 4JI0E 3ADGA 4B3RE 5IT9C 4GKJI 4RPFA 1FI4A 2X36A 1GZ6A 3HPZA 4OX9E 4DV4E 2M1SA 3OMLA 2YZTA 4FN5A 1Z0BA 3QT5A 2Z5BB 4PU9A 4WUCA 3IWDA 4LF8I 2UUAI 2B7TA 3Q6MA 1ZBQA 2VF1A 4UT4A 4P52A 4DPTA 1FKAE 4JI3I 1RQ0A 4R03A 2JOXA 1Z0GA 3WU4A 4YHHE 5FWKA 2ZBKB 4B3SI 3P06A 2L8TA 1XMOE 4DR4I 4K0KE 4GKJE 4DR3E 1ZM9A 2NA2A 4JI0I 4JI7E 2ZM6E 1EKZA 4GKKI 2IHR1 3H09A 3J7AG 2VE7C 3MSWA 2HHHI 4JV5E 4IZJA 3V2UC 4DV7I 3T1HI 2EFGA 3D4JA 4L5NC 4F9CB 4DUZE 1EA6A 4I3HA 4X64I 4F9AB 5DNYA 2RTXA 2EWLA 1USUA 2EZ6A 1X48A 3F6GA 3VYYA 1EI1A 1Z59A 1Z0CA 1N32I 2L2MA 3B8HA 4K0KI 1Z5AA 2B7VA 3WU5A 1STUA 3JAMQ 4TUIA 4X65E 2L3JA 4MYUA 4KZSA 1MU5A 2MC5A 2V8QB 4JG4A 4DR1E 4LF5I 4HACA 1WUUA 4LF6E 3LPSA 2WZOA 4UTGA 5AASA 4OOGC 4KHPI 1X47A 3ZOQB 1HNZE 3FIGA 2VQEI 1Y4SA 5CFFE 1FJGI 1RREA 4FWGA 2PNLA 2NUEA 4LFAI 3PYGA 2UU9I 2GS8A 1K47A 4DR7E 3ADIA 2RSMA 5L3JA 2L92A 4WUBA 1YZ9A 2LTSA 2VF3A 4ZVIA 3J81Q 1S16A 2LUQA 4DU8A 5IWAI 2JVAA 2HKEA 4JI1I 4JI5I 2UXDE 5FLXC 4OX9I 1HR0E 2BV3A 4B3ME 1J5EI 1B63A 1USVA 5BR8I 2HFUA 2L3CA 4USKA 2CG9A 4F9BB 3LNUA 2M7QA 2H36X 4WPYA 4LU9A 4NXME 2KOUA 2R42A 1I94E 4DR5E 4JI6E 4DUYE 1YYKA 5A2QQ 2Z5CB 1Z0VA 4DXLA 4DR5I 2Z5EA 1XMQI 3VK6A 4JI6I 2JOBA 1T4OA 3Q6NA 1HK7A 4BC7A 2ZM6I 2O1VA 4B3MI 2V83A 3PRYA 4DR2I 1KIJA 1SR9A 4JI5E 4JI1E 4Z7CA 2O1UA 2RS7A 4LTYA 2O1WA 1HNZI 1ELOA 1Z5BA 1UHZA 1HR0I 4JI4E 2ODRD 5AE3A 3JTZA 2LJPA 2V8PA 4X66I 2A2CA 4DUYI 4JYAI 2Z5BA 1N34I 2L2NA 2JY9A 2UU9E 3J81C 4P7DA 4P7AA 2M4IA 4YY3E 3T1YE 2V2VA 4X65I 1NZ0A 1Z0EA 4AQYI 1IBMI 2LTRA 1RR9A 2Z5CA 2V2QA 3P1XA 5LMUI 4DPYA 2YT4A 2KONA 1KKHA 4DV4I 4DR2E 2N3HA 1FNMA 1MG7A 1WHNA 3JAMC 2E5LE 4LF5E 4KHPE 3DF6A 4MYTA 1ZBTA 4ED4A 1PKPA 1D6TA 4LF4E 1GQEA 2V85A 3M6AA 1HNWI 4DUZI 3K6QA 4WYQB 5ADZA 2FGGA 4KQVA 4DV7E 3T1HE 3J80C 4NXMI 2V88A 2G7HA 2DMYA 4R1FA 4IZJD 4JI8I 4HYMA 4BS9A 2GQ0A 1KVKA 2AJ4A 2K4VA 4DR4E 1XMOI 1XMQE 4NXNI 1ZXNA 2N3GA 1PIEA 1Z0TA 2F8BA 1FWKA 1DARA 1BKNA 1Z0WA 2OI2A 3PYEA 4DKKA 2HK2A 4XTJA 4DV3E 3Q1QA 2NPFA 4X62E 4LF8E 4DPUA 4BMJA 2BM0A 3AUZA 2L33A 3B78A 1WHQA 2CPNA 5IT9Q 4LFCE 4DV1I 3F6HA 3RMPA 1FJGE 2L2KB 2MDRA 1O0WA 4Q28A 2VQEE 5LMUE 4DV5I 3IWCA 1X49A 1UILA 2LBSB 1A6FA 1IBME 4JI2I 4I8OA 4M2ZA 1XNRI 1J26A 2BM1A 4JI3E 3HJCA 2LE2A 4DR7I 1ZXMA 1DI2A 1PVGA 4JI2E 5LMNI 5LMNE 1H74A 3LMLA 1XHKA 1MX0A 4WFTA 2UUAE 2KHXA 2CZ9A 1N0UA 2V87A 2J7KA 3K85A 3T1YI 3LTOA 4LF6I 1Y4UA 2JR1A 4DV1E 1ZM3A 4LFCI 4M0VA 3F0NA 3IWBA 1N36I 4DMIA 5LL6R 2UXCI 1XNRE 4FWDA 4TUGA 4NXNE 2X7IA 4DV5E 2V89A 3CWVA 4DV6E 1XNQE 1ZM2A 4IZKA 4JI7I 3HTXA 5BR8E 3ZZUA 4DR3I 2ZITA 3QT8A 2E1RA 1XNQI 4DV3I 1U2RA 3QT6A 4LFBI 4L8NA 5AE1A 2CGEA 4YY3I 5A2QC 2VQFI 3OTOI 1N36E 2HK3A 4DR6I 4F54A 3HQ1A 4IZKB 4R8OA 4JYAE 2Q2EB 4X8WA 2E1MA 5T6JA 1N33I 2DSYA 3PYFA 1H72C 3QT7A 4PRVA 2LJHA 4HY1A 2UXDI 1OJ4A 5GMDA 5IWAE 1Y6ZA 1T4NA 3PYDA 2DB2A 1QZRA 2B3TB 4DU7A 2IOPA 4WSPA 1HNXI 1HNXE 3ADLA 3HULA 4LF4I 4X66E 3GONA 4Z7YA 3ZZTA 3OTOE 3WU3A 1N34E 2VQFE 4BC9A 2LMZA 2V34A 4FW9A 5F3WA 1DQ3A 1IBLI 2B9DA 4LF9I 1B62A 3V5RA 4URLA 2IOQA 4GEQB 1IBKE 4LF7E 4DR1I 2UUCE 1QU6A 4DPXA 1T4LB 1NHJA 3C4TA 1Z5CA 2WW4A 2V2ZA 2V86A 1N0VC 1S4EA 4LF7I 1KTVA 1HNWE 3K1JA 1I94I 2HHHE 2NUFA 1N32E 4DV0I 3AV0A 2R3VA 4LFAE 3VYXA 1J5EE 4HACB 2FV4B 4DV2I 4DV2E 1WXRA 2F4VE 3KWRA 4HXZA 4J8ZA 1RC7A 1IBLE 1FWLA 3ZZ0A 4DV6I 4LF9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUP B;  4B3S E;  1N33 E;  2UXB E;  2LRS A;  2A2D A;  2HKJ A;  4PRX A;  4GKK E;  2E5L I;  2XEX A;  4M30 A;  3ZKD A;  5FLX Q;  4JI4 I;  3C4B A;  4B3T E;  4B3T I;  2DEI A;  2DEJ A;  1NHI A;  4AQY E;  3WU6 A;  3ZM7 A;  1H73 A;  2F4V I;  3J7Y p;  4DV0 E;  1H7S A;  1YYO A;  3LLH A;  3J7A M;  1NHH A;  4USM A;  4B3R I;  1VIS A;  2UUB E;  4DR6 E;  1UEK A;  2UXB I;  1ZM4 A;  4M1K A;  3J80 Q;  2NUG A;  4FWH A;  4JV5 I;  2UUC I;  4LFB E;  3ADJ A;  3ZKB A;  2HFS A;  4EMD A;  2DIX A;  4X62 I;  4X64 E;  4JI8 E;  4DPW A;  4YHH I;  3B82 A;  2UXC E;  4WUD A;  2RS6 A;  1H7U A;  3H4L A;  1YYW A;  5GME A;  1IBK I;  2UUB I;  3K17 A;  4JI0 E;  3ADG A;  4B3R E;  5IT9 C;  4GKJ I;  4RPF A;  1FI4 A;  2X36 A;  4OX9 E;  4DV4 E;  4FN5 A;  1Z0B A;  3QT5 A;  4PU9 A;  4WUC A;  4LF8 I;  2UUA I;  2B7T A;  4UT4 A;  4P52 A;  4DPT A;  1FKA E;  4JI3 I;  1RQ0 A;  1Z0G A;  3WU4 A;  4YHH E;  2ZBK B;  4B3S I;  1XMO E;  4DR4 I;  4K0K E;  4GKJ E;  4DR3 E;  1ZM9 A;  2NA2 A;  4JI0 I;  4JI7 E;  2ZM6 E;  1EKZ A;  4GKK I;  2IHR 1;  3J7A G;  2HHH I;  4JV5 E;  4DV7 I;  3V2U C;  3T1H I;  2EFG A;  3D4J A;  4I3H A;  4DUZ E;  1EA6 A;  4X64 I;  2RTX A;  2EZ6 A;  1X48 A;  3VYY A;  1EI1 A;  1Z59 A;  1Z0C A;  1N32 I;  2L2M A;  3B8H A;  4K0K I;  1Z5A A;  2B7V A;  3WU5 A;  1STU A;  3JAM Q;  4X65 E;  2L3J A;  4MYU A;  1MU5 A;  4JG4 A;  4DR1 E;  4LF5 I;  4HAC A;  1WUU A;  4LF6 E;  3LPS A;  4UTG A;  4OOG C;  4KHP I;  1X47 A;  1HNZ E;  2VQE I;  5CFF E;  1FJG I;  1RRE A;  4FWG A;  2NUE A;  4LFA I;  3PYG A;  2UU9 I;  2GS8 A;  1K47 A;  4DR7 E;  3ADI A;  2RSM A;  5L3J A;  4WUB A;  1YZ9 A;  2LTS A;  2VF3 A;  4ZVI A;  3J81 Q;  1S16 A;  2LUQ A;  4DU8 A;  5IWA I;  2JVA A;  2HKE A;  4JI1 I;  4JI5 I;  2UXD E;  5FLX C;  4OX9 I;  1HR0 E;  2BV3 A;  4B3M E;  1J5E I;  1B63 A;  5BR8 I;  2HFU A;  2L3C A;  4USK A;  3LNU A;  4NXM E;  2R42 A;  1I94 E;  4DR5 E;  4JI6 E;  4DUY E;  1YYK A;  5A2Q Q;  1Z0V A;  4DXL A;  4DR5 I;  4JI6 I;  1XMQ I;  1T4O A;  2ZM6 I;  4B3M I;  4DR2 I;  1KIJ A;  4JI5 E;  4JI1 E;  4Z7C A;  2RS7 A;  1HNZ I;  1ELO A;  1Z5B A;  1UHZ A;  1HR0 I;  4JI4 E;  2LJP A;  2V8P A;  4X66 I;  2A2C A;  4DUY I;  4JYA I;  1N34 I;  2L2N A;  2JY9 A;  2UU9 E;  3J81 C;  4P7A A;  4YY3 E;  3T1Y E;  2V2V A;  4X65 I;  1NZ0 A;  1Z0E A;  4AQY I;  1IBM I;  2LTR A;  1RR9 A;  2V2Q A;  3P1X A;  5LMU I;  4DPY A;  2YT4 A;  1KKH A;  4DV4 I;  4DR2 E;  2N3H A;  1FNM A;  1MG7 A;  1WHN A;  2E5L E;  4KHP E;  4LF5 E;  4MYT A;  3JAM C;  1ZBT A;  4ED4 A;  1PKP A;  1D6T A;  4LF4 E;  1GQE A;  3M6A A;  1HNW I;  4DUZ I;  4WYQ B;  4KQV A;  4DV7 E;  3T1H E;  3J80 C;  4NXM I;  2DMY A;  4R1F A;  4JI8 I;  4HYM A;  1KVK A;  2AJ4 A;  4DR4 E;  1XMO I;  1XMQ E;  4NXN I;  1ZXN A;  2N3G A;  1PIE A;  1Z0T A;  1FWK A;  1DAR A;  1BKN A;  1Z0W A;  2OI2 A;  3PYE A;  4DKK A;  2HK2 A;  4XTJ A;  4DV3 E;  3Q1Q A;  2NPF A;  4X62 E;  4LF8 E;  4DPU A;  2BM0 A;  2L33 A;  3B78 A;  1WHQ A;  2CPN A;  5IT9 Q;  4LFC E;  4DV1 I;  1FJG E;  2L2K B;  2MDR A;  1O0W A;  2VQE E;  5LMU E;  4DV5 I;  1X49 A;  1UIL A;  2LBS B;  1A6F A;  1IBM E;  4JI2 I;  4M2Z A;  1XNR I;  1J26 A;  2BM1 A;  4JI3 E;  4DR7 I;  1ZXM A;  1DI2 A;  1PVG A;  4JI2 E;  5LMN I;  5LMN E;  1H74 A;  1XHK A;  1MX0 A;  4WFT A;  2UUA E;  2KHX A;  2CZ9 A;  1N0U A;  2J7K A;  3T1Y I;  3LTO A;  4LF6 I;  4DV1 E;  1ZM3 A;  4LFC I;  3F0N A;  1N36 I;  5LL6 R;  2UXC I;  1XNR E;  4FWD A;  4NXN E;  2X7I A;  4DV5 E;  3CWV A;  4DV6 E;  1XNQ E;  1ZM2 A;  4JI7 I;  3HTX A;  5BR8 E;  3ZZU A;  4DR3 I;  2ZIT A;  3QT8 A;  2E1R A;  1XNQ I;  4DV3 I;  1U2R A;  3QT6 A;  4LFB I;  4YY3 I;  5A2Q C;  2VQF I;  3OTO I;  1N36 E;  2HK3 A;  4DR6 I;  4JYA E;  2Q2E B;  4X8W A;  1N33 I;  3PYF A;  1H72 C;  3QT7 A;  4PRV A;  2LJH A;  4HY1 A;  2UXD I;  1OJ4 A;  5GMD A;  5IWA E;  1T4N A;  3PYD A;  2DB2 A;  1QZR A;  2B3T B;  4DU7 A;  1HNX I;  1HNX E;  3ADL A;  3HUL A;  4LF4 I;  4X66 E;  3GON A;  4Z7Y A;  3ZZT A;  3OTO E;  3WU3 A;  1N34 E;  2VQF E;  2V34 A;  4FW9 A;  1IBL I;  4LF9 I;  1B62 A;  3V5R A;  4URL A;  1IBK E;  4LF7 E;  4DR1 I;  2UUC E;  1QU6 A;  4DPX A;  1T4L B;  1NHJ A;  3C4T A;  1Z5C A;  2WW4 A;  2V2Z A;  1N0V C;  1S4E A;  4LF7 I;  1KTV A;  1HNW E;  3K1J A;  1I94 I;  2HHH E;  2NUF A;  1N32 E;  4DV0 I;  2R3V A;  4LFA E;  3VYX A;  1J5E E;  4HAC B;  4DV2 I;  4DV2 E;  2F4V E;  4HXZ A;  1RC7 A;  1IBL E;  1FWL A;  3ZZ0 A;  4DV6 I;  4LF9 E; 
#chains in the Genus database with same CATH topology
 2LUP B;  3PS1 A;  2FTX B;  2EM8 A;  4B3S E;  4IFD A;  2N8X A;  1N33 E;  2UXB E;  5AE2 A;  2LRS A;  2A2D A;  2EM3 A;  2L6M A;  2NN6 C;  2MKN A;  2C39 A;  2HKJ A;  2RSI A;  2EN4 A;  1IQS A;  4PRX A;  4GKK E;  2E5L I;  2XEX A;  5TSE A;  5KL2 A;  4LPF A;  4M30 A;  3ZKD A;  2EOE A;  5FLX Q;  2CT1 A;  4BBY A;  4JI4 I;  3C4B A;  4P78 A;  4B3T E;  5A6B A;  4MQY A;  2DEI A;  2DEJ A;  5C0X D;  4B3T I;  1NHI A;  2I9I A;  1WRJ A;  3DJW A;  2J65 A;  2WP8 A;  4AQY E;  3WU6 A;  4IZJ B;  1EH8 A;  3ZM7 A;  1H73 A;  2F4V I;  2DLK A;  2LCE A;  2YRK A;  4RHB B;  3J7Y p;  1P42 A;  2EOM A;  2O1T A;  4DV0 E;  4QNJ A;  2YTJ A;  1YYO A;  1H7S A;  2VES A;  3LLH A;  2MC6 A;  4MLQ A;  1NHH A;  5EL9 A;  3U1K A;  4USM A;  3J7A M;  4B3R I;  1VIS A;  4O24 A;  2UUB E;  5KL6 A;  4N3O A;  2EMX A;  4DR6 E;  4MU0 A;  1UEK A;  2UXB I;  1ZM4 A;  4M1K A;  3J80 Q;  2C38 B;  2NUG A;  4FWH A;  3HPS A;  2GO3 A;  4JV5 I;  2BA1 G;  2UUC I;  1IMU A;  2EPP A;  3P76 A;  2EMA A;  4LFB E;  3ADJ A;  2R76 A;  4BCA A;  2HFS A;  3ZKB A;  4EMD A;  1P47 A;  2O3Z A;  2DIX A;  4X62 I;  1YPN A;  3HXL A;  2JWO A;  4X64 E;  4JI8 E;  3M99 B;  2EN3 A;  1ZU1 A;  3EPL A;  4DPW A;  4YHH I;  3B82 A;  2YTQ A;  2ODR C;  2BA0 D;  2EM4 A;  2UXC E;  4ZYH A;  2NN6 F;  4WUD A;  2EMH A;  2RS6 A;  3JU0 A;  1H7U A;  2JE6 B;  1MEY C;  2C37 B;  3H4L A;  2PO1 A;  5K36 D;  1TF3 A;  1YYW A;  2PNM A;  5GME A;  3TQM A;  1IBK I;  2UUB I;  3K17 A;  4JI0 E;  4FW4 A;  3ADG A;  4B3R E;  4U3D A;  3MHS C;  2ENA A;  5IT9 C;  1UDO A;  4RPF A;  4GKJ I;  2MDG A;  1FI4 A;  1B69 A;  2X36 A;  1GZ6 A;  2EM5 A;  2EOQ A;  3HPZ A;  2M1S A;  3OML A;  5AC5 A;  2M9A A;  4DV4 E;  4OX9 E;  2YZT A;  4FN5 A;  4OO1 F;  1Z0B A;  3QT5 A;  2Z5B B;  2EOY A;  4PU9 A;  4LOM A;  4R2P A;  2PO0 A;  1YH8 A;  4WUC A;  3IWD A;  1AH5 A;  1BBO A;  4LF8 I;  2PNZ A;  2UUA I;  2B7T A;  2ELY A;  3Q6M A;  1ZBQ A;  4AID A;  4NBQ A;  2VF1 A;  2EOX A;  4LF9 E;  4UT4 A;  4P52 A;  5IV8 B;  3EPJ A;  4DPT A;  1FKA E;  2IES A;  1WJP A;  4WSG A;  1RQ0 A;  4R03 A;  4BHC A;  2JOX A;  4JI3 I;  1Z0G A;  3WU4 A;  3NZK A;  4YHH E;  5FWK A;  2ZBK B;  1SFE A;  4B3S I;  3P06 A;  4R2E A;  2L8T A;  4FW3 A;  1XMO E;  5C0X B;  4OO1 A;  4K0K E;  4DR4 I;  2WCC 3;  2EPZ A;  1YUJ A;  4GKJ E;  3L7Z B;  4DR3 E;  1ZM9 A;  4Q35 B;  2NA2 A;  4JI0 I;  5K36 C;  4JI7 E;  2ZM6 E;  1EKZ A;  4GKK I;  2IHR 1;  3H09 A;  3J7A G;  2VE7 C;  4IS1 C;  5DRP A;  3MSW A;  1F2I G;  2LV2 A;  2HHH I;  4JV5 E;  1X5W A;  4IZJ A;  3V2U C;  4DV7 I;  3T1H I;  3M7N D;  2EMB A;  2EFG A;  5C0X E;  5A6J A;  3D4J A;  3GME A;  2YTE A;  4L5N C;  4F9C B;  4DUZ E;  2EOF A;  1EA6 A;  2NN6 A;  5DRO A;  4I3H A;  4AIM A;  4X64 I;  4F9A B;  5DNY A;  5KL5 A;  2RTX A;  2EWL A;  5A6A A;  3BID A;  2JXP A;  5KL4 A;  5DNX A;  2EPC A;  1USU A;  2EZ6 A;  2J7J A;  1X48 A;  3F6G A;  2PO2 B;  3VYY A;  1EI1 A;  3BGH A;  1Z59 A;  3BF2 A;  4F6N A;  4GZN C;  1Z0C A;  2C39 B;  1N32 I;  2L2M A;  2YTN A;  3B8H A;  2Q8U A;  3M85 D;  4OZE A;  1OYP A;  3QG5 C;  2JP9 A;  1Z5A A;  4IJD A;  4K0K I;  2IER A;  1A1I A;  2B7V A;  2K7I A;  3WU5 A;  1STU A;  1ZR9 A;  1YFH A;  3HKM A;  3JAM Q;  4TUI A;  4X65 E;  1RHY A;  2L3J A;  4MYU A;  4KZS A;  5DRQ A;  1MU5 A;  2MC5 A;  2V8Q B;  4WXD A;  4R2D A;  5AC4 A;  1G2F C;  4DR1 E;  1UDQ A;  2PO2 A;  2WNR A;  4JG4 A;  5K36 B;  4LF5 I;  4HAC A;  1WUU A;  4O4K A;  4LF6 E;  3LPS A;  2WZO A;  3C6M A;  4UTG A;  2RQL A;  1X6F A;  5AAS A;  5LLQ A;  4OOG C;  4KHP I;  1X47 A;  3ZOQ B;  1HNZ E;  2JEA A;  3PS3 A;  3FIG A;  2VQE I;  1E3P A;  1Y4S A;  2WNR B;  5K36 A;  2HJJ A;  5CFF E;  1FJG I;  1RRE A;  3MHH C;  4O43 A;  2PNL A;  4FWG A;  2LVH A;  3KZY A;  2NUE A;  4LFA I;  3PYG A;  2UU9 I;  1UN6 B;  1K47 A;  2GS8 A;  4DR7 E;  3ADI A;  2RSM A;  3L7Z A;  2EPO A;  1KYQ A;  2NN6 E;  5L3J A;  4OO1 B;  2L92 A;  4WUB A;  1YZ9 A;  2LTS A;  2VF3 A;  1UDN A;  2DLQ A;  3BBG A;  2F1D A;  4MU3 A;  2ENH A;  4ZVI A;  2EL6 A;  2PRT A;  3J81 Q;  4ZYD A;  2JEB A;  2JPA A;  1S16 A;  2DMI A;  2LUQ A;  4OKG A;  4DU8 A;  2GLI A;  5IWA I;  1TF6 A;  2JVA A;  2YRH A;  4WX9 A;  4R2Q A;  2HKE A;  4JI1 I;  2EM6 A;  4JI5 I;  4IFD C;  2UXD E;  5FLX C;  4OX9 I;  1HR0 E;  2NN6 B;  2BV3 A;  4B3M E;  2EMY A;  1L4S A;  1J5E I;  4F2J C;  5K36 F;  4ZYG A;  1B63 A;  2PNZ B;  1USV A;  5BR8 I;  2HFU A;  2L3C A;  3THN A;  5KL7 A;  4USK A;  1AAY A;  4F9B B;  2CG9 A;  3CDJ A;  2M7Q A;  4BHB A;  3LNU A;  2H36 X;  4IS9 A;  2PO0 B;  4WPY A;  4LU9 A;  4NXM E;  2KOU A;  4RH8 A;  2EOI A;  2R42 A;  1I94 E;  4DR5 E;  4JI6 E;  4DUY E;  2EJ4 A;  1YYK A;  5A2Q Q;  2Z5C B;  1Z0V A;  2EN2 A;  4DXL A;  3VHT B;  1BBG A;  2EPR A;  1Y60 A;  2Z5E A;  3VK6 A;  4DR5 I;  2JOB A;  1T4O A;  1XMQ I;  4JI6 I;  3U1Y A;  3EPH A;  3Q6N A;  4BA2 A;  1NCS A;  1HK7 A;  4BC7 A;  2ZM6 I;  2O1V A;  4B3M I;  2V83 A;  2GO4 A;  3PRY A;  4DR2 I;  1KIJ A;  2YU5 A;  3B4T A;  2PO1 B;  1SR9 A;  4JI5 E;  2JE6 A;  3KRN A;  1PJS A;  1X6H A;  4JI1 E;  4Z7C A;  2O1U A;  3P3E A;  4MU1 A;  2RS7 A;  4LTY A;  2O1W A;  4OO1 C;  2EPX A;  3UHM A;  2EP3 A;  1ELO A;  1HNZ I;  1Z5B A;  1UHZ A;  2EPA A;  1HR0 I;  4JI4 E;  2DRP A;  2ODR D;  4IFD E;  1YSA C;  5AE3 A;  3JTZ A;  2LJP A;  2I13 A;  1XXE A;  2V8P A;  4X66 I;  2A2C A;  4DUY I;  2EE8 A;  4JYA I;  5DRR A;  2Z5B A;  1N34 I;  2L2N A;  4MDT A;  4FW6 A;  3EQ1 A;  2JY9 A;  1YUI A;  2UU9 E;  3J81 C;  4P7D A;  1BB8 A;  1IQO A;  1EH7 A;  4P7A A;  5C0X F;  2EMZ A;  2M4I A;  2YTP A;  3C6K A;  1OYS A;  4YY3 E;  2ELZ A;  3T1Y E;  2V2V A;  4X65 I;  1NZ0 A;  1Z0E A;  2C38 A;  4AQY I;  1IBM I;  2LTR A;  1A1L A;  5JEA C;  1UDS A;  5IXM B;  1RR9 A;  2Z5C A;  2V2Q A;  3P1X A;  5LMU I;  4QNK A;  2YPN A;  1A1G A;  4DPY A;  2YT4 A;  4KWY A;  2KON A;  4ZYE A;  1KKH A;  1PJT A;  2YTD A;  2EMC A;  4DV4 I;  3L00 A;  4DR2 E;  2N3H A;  1FNM A;  1MG7 A;  1WHN A;  4MU4 A;  3JAM C;  2EM0 A;  2E5L E;  2YSO A;  3DF6 A;  4LF5 E;  4KHP E;  4MYT A;  2EN7 A;  1ZBT A;  4ED4 A;  1PKP A;  1D6T A;  4LF4 E;  1GQE A;  4R2R A;  2BR2 B;  3EPK A;  2V85 A;  4OO1 D;  3CDI A;  3M6A A;  1HNW I;  4DUZ I;  3K6Q A;  4WYQ B;  5ADZ A;  2FGG A;  3H1C A;  1KJK A;  1PJQ A;  4KQV A;  4DV7 E;  3T1H E;  3J80 C;  4U3B A;  2JEB B;  1RMD A;  2V88 A;  2CTD A;  4NXM I;  2G7H A;  2CSH A;  2DMY A;  2EQ3 A;  2MKD A;  2ADR A;  1T38 A;  4IZJ D;  4R1F A;  4LCH A;  4JI8 I;  2YU8 A;  3GLL A;  4HYM A;  3PS2 A;  5A69 A;  4GQU A;  4BS9 A;  2GQ0 A;  1KVK A;  2AJ4 A;  2K4V A;  4DR4 E;  2NN6 D;  1JK2 A;  1XMO I;  1XMQ E;  1UBD C;  1MGT A;  2RPC A;  1ZXN A;  4NXN I;  1PDA A;  2N3G A;  4IFD B;  1QNT A;  5JEA E;  1PIE A;  4R2C A;  2YSP A;  1Z0T A;  2EOS A;  2F8B A;  1FWK A;  1R6L A;  1DAR A;  1X3C A;  1BKN A;  1Z0W A;  2OI2 A;  3PYE A;  2D9H A;  4DKK A;  1Z1B A;  5C0X C;  2R1F A;  2HK2 A;  2BB8 A;  4XTJ A;  4DV3 E;  3Q1Q A;  2NPF A;  4X62 E;  4LF8 E;  4DPU A;  4BMJ A;  2BM0 A;  3AUZ A;  2EM7 A;  2L33 A;  4WXC A;  3B78 A;  1WHQ A;  2CPN A;  5IT9 Q;  4LFC E;  4DV1 I;  3F6H A;  3RMP A;  2YTF A;  1FJG E;  2L2K B;  1O0W A;  2MDR A;  4Q28 A;  2VQE E;  2EQ1 A;  5LMU E;  5JEA D;  3IWC A;  4BA1 B;  4DV5 I;  1X49 A;  1UIL A;  2LBS B;  1VI7 A;  1A6F A;  1R6M A;  1IBM E;  4JI2 I;  4I8O A;  4M2Z A;  3GCM A;  3M85 G;  1XNR I;  1J26 A;  2BM1 A;  4JI3 E;  3HJC A;  2LE2 A;  4DR7 I;  5KL3 A;  1ZXM A;  1DI2 A;  1PVG A;  4JI2 E;  5LMN I;  5LMN E;  1H74 A;  2BA1 D;  3LML A;  1XHK A;  1MX0 A;  4WFT A;  3DD6 A;  2UUA E;  1Y5Y A;  2AE8 A;  2EMK A;  3KZZ A;  2KHX A;  4FK5 C;  1N0U A;  2CZ9 A;  2EMG A;  2V87 A;  2J7K A;  4OO1 E;  5EKW A;  3K85 A;  3T1Y I;  3LTO A;  4LF6 I;  1Y4U A;  2BA0 G;  2BR2 A;  2JR1 A;  4DV1 E;  5JEA B;  1ZM3 A;  4LFC I;  4M0V A;  2DGC A;  1GTK A;  3F0N A;  3IWB A;  1N36 I;  4IFD F;  4DMI A;  5A6B D;  5C0X A;  2EML A;  5LL6 R;  2JT2 A;  2UXC I;  1XNR E;  4AM3 A;  4FWD A;  1A1J A;  4MLV A;  3UK3 C;  1G2D C;  4TUG A;  2EOZ A;  4NXN E;  2X7I A;  4DV5 E;  2V89 A;  3CWV A;  4DV6 E;  1XNQ E;  1ZM2 A;  2EL5 A;  1OYR A;  4IZK A;  2EPK X;  3ECR A;  4JI7 I;  1A1K A;  1A1H A;  3HTX A;  1YHC A;  2EQ0 A;  2EM9 A;  5BR8 E;  3ZZU A;  4DR3 I;  2EOH A;  2ZIT A;  2WBT A;  2GPI A;  3THO B;  4HEI A;  3QT8 A;  2E1R A;  1XNQ I;  2EM2 A;  4DV3 I;  4IFD D;  1U2R A;  2EOJ A;  3QT6 A;  2EPU A;  4LFB I;  4L8N A;  1JK1 A;  5AE1 A;  2CVE A;  2LO3 A;  2YTO A;  2CGE A;  5DNL A;  4YY3 I;  2YRM A;  5A2Q C;  2VQF I;  2HC5 A;  2EOR A;  3OTO I;  1N36 E;  2HK3 A;  4DR6 I;  4F54 A;  1N3G A;  3HQ1 A;  4IZK B;  4R8O A;  1DGC A;  4JYA E;  2Q2E B;  4BA2 B;  2GHF A;  4X8W A;  5A6K A;  5ELW A;  2E1M A;  5T6J A;  2EPL X;  1N33 I;  2DSY A;  1X6E A;  3PYF A;  4FW7 A;  1H72 C;  3QT7 A;  2C37 A;  2LJH A;  4HY1 A;  4PRV A;  2UXD I;  1OJ4 A;  5K36 E;  5GMD A;  5IWA E;  2ENC A;  4R2A A;  1Y6Z A;  1T4N A;  2EMI A;  2YTI A;  3PYD A;  2DB2 A;  1QZR A;  2B3T B;  4X9J A;  5JEA A;  2EOO A;  4NZV A;  3M7N G;  4DU7 A;  5JEA F;  2IOP A;  4J3D A;  4WSP A;  1HNX I;  2LJU A;  1HNX E;  3ADL A;  4F6M A;  3P3C A;  3HUL A;  4LF4 I;  4X66 E;  3GON A;  4Z7Y A;  3ZZT A;  1NEI A;  2EN6 A;  3OTO E;  3WU3 A;  4HTG A;  1N34 E;  2VQF E;  4BC9 A;  2LMZ A;  2V34 A;  4N4R B;  1EH6 A;  4FW9 A;  2EMW A;  2EL4 A;  2VRD A;  2YWQ A;  5F3W A;  1T39 A;  3P3G A;  1DQ3 A;  1IBL I;  2B9D A;  4LF9 I;  1LLM C;  2LT7 A;  1B62 A;  2EPN A;  4M9V C;  1ZAA C;  2E72 A;  3V5R A;  4URL A;  2IOQ A;  4GEQ B;  4LCG A;  1IBK E;  4LF7 E;  4BA1 A;  2JYA A;  4R2S A;  4DR1 I;  2UUC E;  2EN8 A;  2WP8 B;  1QU6 A;  4DPX A;  1T4L B;  1NHJ A;  3C4T A;  1Z5C A;  4LCF A;  2WW4 A;  1E3H A;  2EMF A;  2V2Z A;  4ISA A;  2V86 A;  2YTG A;  2JEA B;  1N0V C;  1S4E A;  4LF7 I;  2NAB A;  1HNW E;  1KTV A;  4NHR A;  1A1F A;  2BBG A;  3K1J A;  1I94 I;  2HHH E;  2WBU A;  2NUF A;  1N32 E;  4DV0 I;  3AV0 A;  2R3V A;  4LFA E;  2A25 A;  3VYX A;  2EN1 A;  1J5E E;  4HAC B;  2FV4 B;  4DV2 I;  4DV2 E;  1WXR A;  2F4V E;  2EPM X;  3KWR A;  1TN9 A;  4HXZ A;  4FW5 A;  4J8Z A;  1RC7 A;  1IBL E;  4O5G A;  2HGH A;  1FWL A;  3ZZ0 A;  4DV6 I;  2WBS A; 
#chains in the Genus database with same CATH homology
 2LUP B;  2FTX B;  4B3S E;  1N33 E;  2UXB E;  5AE2 A;  2LRS A;  2A2D A;  2L6M A;  2HKJ A;  4PRX A;  4GKK E;  2E5L I;  2XEX A;  4M30 A;  3ZKD A;  5FLX Q;  4BBY A;  4JI4 I;  3C4B A;  4P78 A;  4B3T E;  4B3T I;  2DEI A;  2DEJ A;  1NHI A;  3DJW A;  4AQY E;  3WU6 A;  4IZJ B;  3ZM7 A;  1H73 A;  2F4V I;  3J7Y p;  2O1T A;  4DV0 E;  1H7S A;  1YYO A;  3LLH A;  2MC6 A;  3J7A M;  1NHH A;  4USM A;  4B3R I;  1VIS A;  2UUB E;  4N3O A;  4DR6 E;  1UEK A;  2UXB I;  1ZM4 A;  4M1K A;  3J80 Q;  2NUG A;  4FWH A;  3HPS A;  4JV5 I;  2UUC I;  4LFB E;  3ADJ A;  3ZKB A;  4BCA A;  2HFS A;  4EMD A;  2DIX A;  4X62 I;  3HXL A;  2JWO A;  4X64 E;  4JI8 E;  4DPW A;  4YHH I;  3B82 A;  2ODR C;  2UXC E;  4WUD A;  2RS6 A;  3JU0 A;  1H7U A;  3H4L A;  1YYW A;  2PNM A;  5GME A;  1IBK I;  2UUB I;  3K17 A;  4JI0 E;  3ADG A;  4B3R E;  5IT9 C;  4GKJ I;  4RPF A;  1FI4 A;  2X36 A;  1GZ6 A;  3HPZ A;  4OX9 E;  4DV4 E;  2M1S A;  3OML A;  2YZT A;  4FN5 A;  1Z0B A;  3QT5 A;  2Z5B B;  4PU9 A;  4WUC A;  3IWD A;  4LF8 I;  2UUA I;  2B7T A;  3Q6M A;  1ZBQ A;  2VF1 A;  4UT4 A;  4P52 A;  4DPT A;  1FKA E;  4JI3 I;  1RQ0 A;  4R03 A;  2JOX A;  1Z0G A;  3WU4 A;  4YHH E;  5FWK A;  2ZBK B;  4B3S I;  3P06 A;  2L8T A;  1XMO E;  4DR4 I;  4K0K E;  4GKJ E;  4DR3 E;  1ZM9 A;  2NA2 A;  4JI0 I;  4JI7 E;  2ZM6 E;  1EKZ A;  4GKK I;  2IHR 1;  3H09 A;  3J7A G;  2VE7 C;  3MSW A;  2HHH I;  4JV5 E;  4IZJ A;  3V2U C;  4DV7 I;  3T1H I;  2EFG A;  3D4J A;  4L5N C;  4F9C B;  4DUZ E;  1EA6 A;  4I3H A;  4X64 I;  4F9A B;  5DNY A;  2RTX A;  2EWL A;  1USU A;  2EZ6 A;  1X48 A;  3F6G A;  3VYY A;  1EI1 A;  1Z59 A;  1Z0C A;  1N32 I;  2L2M A;  3B8H A;  4K0K I;  1Z5A A;  2B7V A;  3WU5 A;  1STU A;  3JAM Q;  4TUI A;  4X65 E;  2L3J A;  4MYU A;  4KZS A;  1MU5 A;  2MC5 A;  2V8Q B;  4JG4 A;  4DR1 E;  4LF5 I;  4HAC A;  1WUU A;  4LF6 E;  3LPS A;  2WZO A;  4UTG A;  5AAS A;  4OOG C;  4KHP I;  1X47 A;  3ZOQ B;  1HNZ E;  3FIG A;  2VQE I;  1Y4S A;  5CFF E;  1FJG I;  1RRE A;  4FWG A;  2PNL A;  2NUE A;  4LFA I;  3PYG A;  2UU9 I;  2GS8 A;  1K47 A;  4DR7 E;  3ADI A;  2RSM A;  5L3J A;  2L92 A;  4WUB A;  1YZ9 A;  2LTS A;  2VF3 A;  4ZVI A;  3J81 Q;  1S16 A;  2LUQ A;  4DU8 A;  5IWA I;  2JVA A;  2HKE A;  4JI1 I;  4JI5 I;  2UXD E;  5FLX C;  4OX9 I;  1HR0 E;  2BV3 A;  4B3M E;  1J5E I;  1B63 A;  1USV A;  5BR8 I;  2HFU A;  2L3C A;  4USK A;  2CG9 A;  4F9B B;  3LNU A;  2M7Q A;  2H36 X;  4WPY A;  4LU9 A;  4NXM E;  2KOU A;  2R42 A;  1I94 E;  4DR5 E;  4JI6 E;  4DUY E;  1YYK A;  5A2Q Q;  2Z5C B;  1Z0V A;  4DXL A;  4DR5 I;  2Z5E A;  1XMQ I;  3VK6 A;  4JI6 I;  2JOB A;  1T4O A;  3Q6N A;  1HK7 A;  4BC7 A;  2ZM6 I;  2O1V A;  4B3M I;  2V83 A;  3PRY A;  4DR2 I;  1KIJ A;  1SR9 A;  4JI5 E;  4JI1 E;  4Z7C A;  2O1U A;  2RS7 A;  4LTY A;  2O1W A;  1HNZ I;  1ELO A;  1Z5B A;  1UHZ A;  1HR0 I;  4JI4 E;  2ODR D;  5AE3 A;  3JTZ A;  2LJP A;  2V8P A;  4X66 I;  2A2C A;  4DUY I;  4JYA I;  2Z5B A;  1N34 I;  2L2N A;  2JY9 A;  2UU9 E;  3J81 C;  4P7D A;  4P7A A;  2M4I A;  4YY3 E;  3T1Y E;  2V2V A;  4X65 I;  1NZ0 A;  1Z0E A;  4AQY I;  1IBM I;  2LTR A;  1RR9 A;  2Z5C A;  2V2Q A;  3P1X A;  5LMU I;  4DPY A;  2YT4 A;  2KON A;  1KKH A;  4DV4 I;  4DR2 E;  2N3H A;  1FNM A;  1MG7 A;  1WHN A;  3JAM C;  2E5L E;  4LF5 E;  4KHP E;  3DF6 A;  4MYT A;  1ZBT A;  4ED4 A;  1PKP A;  1D6T A;  4LF4 E;  1GQE A;  2V85 A;  3M6A A;  1HNW I;  4DUZ I;  3K6Q A;  4WYQ B;  5ADZ A;  2FGG A;  4KQV A;  4DV7 E;  3T1H E;  3J80 C;  4NXM I;  2V88 A;  2G7H A;  2DMY A;  4R1F A;  4IZJ D;  4JI8 I;  4HYM A;  4BS9 A;  2GQ0 A;  1KVK A;  2AJ4 A;  2K4V A;  4DR4 E;  1XMO I;  1XMQ E;  4NXN I;  1ZXN A;  2N3G A;  1PIE A;  1Z0T A;  2F8B A;  1FWK A;  1DAR A;  1BKN A;  1Z0W A;  2OI2 A;  3PYE A;  4DKK A;  2HK2 A;  4XTJ A;  4DV3 E;  3Q1Q A;  2NPF A;  4X62 E;  4LF8 E;  4DPU A;  4BMJ A;  2BM0 A;  3AUZ A;  2L33 A;  3B78 A;  1WHQ A;  2CPN A;  5IT9 Q;  4LFC E;  4DV1 I;  3F6H A;  3RMP A;  1FJG E;  2L2K B;  2MDR A;  1O0W A;  4Q28 A;  2VQE E;  5LMU E;  4DV5 I;  3IWC A;  1X49 A;  1UIL A;  2LBS B;  1A6F A;  1IBM E;  4JI2 I;  4I8O A;  4M2Z A;  1XNR I;  1J26 A;  2BM1 A;  4JI3 E;  3HJC A;  2LE2 A;  4DR7 I;  1ZXM A;  1DI2 A;  1PVG A;  4JI2 E;  5LMN I;  5LMN E;  1H74 A;  3LML A;  1XHK A;  1MX0 A;  4WFT A;  2UUA E;  2KHX A;  2CZ9 A;  1N0U A;  2V87 A;  2J7K A;  3K85 A;  3T1Y I;  3LTO A;  4LF6 I;  1Y4U A;  2JR1 A;  4DV1 E;  1ZM3 A;  4LFC I;  4M0V A;  3F0N A;  3IWB A;  1N36 I;  4DMI A;  5LL6 R;  2UXC I;  1XNR E;  4FWD A;  4TUG A;  4NXN E;  2X7I A;  4DV5 E;  2V89 A;  3CWV A;  4DV6 E;  1XNQ E;  1ZM2 A;  4IZK A;  4JI7 I;  3HTX A;  5BR8 E;  3ZZU A;  4DR3 I;  2ZIT A;  3QT8 A;  2E1R A;  1XNQ I;  4DV3 I;  1U2R A;  3QT6 A;  4LFB I;  4L8N A;  5AE1 A;  2CGE A;  4YY3 I;  5A2Q C;  2VQF I;  3OTO I;  1N36 E;  2HK3 A;  4DR6 I;  4F54 A;  3HQ1 A;  4IZK B;  4R8O A;  4JYA E;  2Q2E B;  4X8W A;  2E1M A;  5T6J A;  1N33 I;  2DSY A;  3PYF A;  1H72 C;  3QT7 A;  4PRV A;  2LJH A;  4HY1 A;  2UXD I;  1OJ4 A;  5GMD A;  5IWA E;  1Y6Z A;  1T4N A;  3PYD A;  2DB2 A;  1QZR A;  2B3T B;  4DU7 A;  2IOP A;  4WSP A;  1HNX I;  1HNX E;  3ADL A;  3HUL A;  4LF4 I;  4X66 E;  3GON A;  4Z7Y A;  3ZZT A;  3OTO E;  3WU3 A;  1N34 E;  2VQF E;  4BC9 A;  2LMZ A;  2V34 A;  4FW9 A;  5F3W A;  1DQ3 A;  1IBL I;  2B9D A;  4LF9 I;  1B62 A;  3V5R A;  4URL A;  2IOQ A;  4GEQ B;  1IBK E;  4LF7 E;  4DR1 I;  2UUC E;  1QU6 A;  4DPX A;  1T4L B;  1NHJ A;  3C4T A;  1Z5C A;  2WW4 A;  2V2Z A;  2V86 A;  1N0V C;  1S4E A;  4LF7 I;  1KTV A;  1HNW E;  3K1J A;  1I94 I;  2HHH E;  2NUF A;  1N32 E;  4DV0 I;  3AV0 A;  2R3V A;  4LFA E;  3VYX A;  1J5E E;  4HAC B;  2FV4 B;  4DV2 I;  4DV2 E;  1WXR A;  2F4V E;  3KWR A;  4HXZ A;  4J8Z A;  1RC7 A;  1IBL E;  1FWL A;  3ZZ0 A;  4DV6 I;  4LF9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...