4AQYE

Structure of ribosome-apramycin complexes
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4aqyE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4aqyE02
2RSMA 5LMUE 3Q1QA 4DPUA 4DV3I 2UXCI 3ZZUA 4LF7I 4USKA 4DPWA 4UT4A 4B3RI 1Z0TA 2F4VI 1FNMA 4WUBA 4I3HA 2V8PA 1ZM2A 4M1KA 4DR2E 1ZM3A 3T1YE 2B7TA 4AQYE 5LMUI 4JI7E 1Z0GA 4JI3I 2DEJA 1D6TA 4NXNE 4HXZA 3PYGA 4B3ME 4DV0E 2OI2A 3T1YI 4AQYI 4JI7I 1B62A 4Z7YA 1N32E 4YY3E 4HYMA 4LFAE 3OTOE 4X64E 5L3JA 4DV1I 1H7UA 4B3MI 4PU9A 1N34I 4LFCE 4FN5A 5FLXQ 4P7AA 3WU6A 2CPNA 1FKAE 3J7Yp 2V2VA 1HNWE 4X64I 1PIEA 3OTOI 4JV5I 4LF9E 3QT6A 4FWHA 1RREA 1QZRA 2E5LE 1N36E 1Z0VA 3ADJA 4DR5E 4JI8E 4LFCI 4OOGC 2KHXA 1BKNA 2V34A 3ZZ0A 2X7IA 2DMYA 4DV5E 4HACB 2E5LI 4R1FA 1NHHA 1DARA 2BM1A 2R3VA 2L2NA 3WU3A 4DR5I 2HK2A 4WUDA 5GMDA 2J7KA 4DR1E 2DB2A 2JY9A 4UTGA 1PVGA 4ED4A 5FLXC 2DEIA 1H73A 3PYFA 2LUQA 3LLHA 1XNQE 4X62E 2HKEA 1FWKA 3V5RA 4DPYA 4RPFA 4FWDA 2LUPB 2GS8A 4MYUA 4JI0I 2NA2A 4DXLA 2N3GA 1YYKA 2VQFE 1FWLA 4DUZI 1Z5BA 1XNQI 1DI2A 2A2CA 4USMA 2V2QA 2B7VA 1WUUA 1IBLE 4JI4E 5GMEA 2ZITA 1HR0E 1FJGE 4FW9A 1X49A 2VQFI 2NUEA 1T4NA 4JI5E 3HULA 1MG7A 1IBLI 2NPFA 3GONA 2DIXA 3V2UC 1Z5CA 1HR0I 1FJGI 1XMQE 2IHR1 4GKJE 3T1HE 4DR6E 2UXBE 4EMDA 4X66E 1MX0A 3WU5A 3J7AG 4JI5I 4NXME 2V2ZA 1HNXE 1XMQI 4GKJI 3T1HI 4GKKE 3K17A 5IT9Q 4LF5E 2BV3A 3P1XA 1H72C 4X66I 4DR2I 1XNRE 2HKJA 2UU9E 1YYOA 1N33E 1GQEA 1WHQA 3PYDA 3ADLA 1S16A 1HNXI 1WHNA 4LF4E 4K0KE 1B63A 2ZM6E 3C4TA 4NXNI 4GKKI 2LRSA 4LF5I 3B78A 3H4LA 1HNZE 1XNRI 4DV0I 2UU9I 1N33I 1UHZA 4JYAE 1N32I 4PRVA 4LF4I 4YY3I 4K0KI 4LFAI 1H74A 3ADIA 4OX9E 1ZM9A 4ZVIA 2HHHE 3VYXA 2LBSB 2JVAA 2MDRA 3CWVA 1IBKE 2LTRA 4DV2E 3LPSA 4DU7A 3LNUA 4DR4E 5IT9C 1HNWI 4JI6E 4OX9I 4LF9I 4HACA 2HHHI 1N36I 1IBKI 1UILA 4JI8I 4DV2I 2BM0A 2LTSA 2UUAE 1KVKA 1RC7A 2LJHA 4DV5I 2VQEE 4WUCA 3D4JA 4DV6E 1ZM4A 1KTVA 2RTXA 4DR1I 4JG4A 3C4BA 2R42A 4DR7E 1RR9A 5LMNE 1VISA 1Z0CA 1O0WA 4KHPE 1EI1A 2AJ4A 2VQEI 2B3TB 1ZBTA 4X62I 3LTOA 4DR7I 1MU5A 1EA6A 4B3SE 4KHPI 2X36A 3J80Q 1ZXMA 4URLA 1NHIA 3QT7A 4LFBE 1S4EA 2HFSA 1XHKA 1X47A 4YHHE 4JI4I 4B3SI 4Z7CA 2UUBE 3ZKBA 2WW4A 2NUFA 4LF7E 2UUCE 2RS7A 2A2DA 1IBME 5A2QQ 4X65E 3JAMQ 1ELOA 4M30A 2L33A 1J5EE 4X8WA 2UUBI 2XEXA 2YT4A 2EZ6A 4JI3E 4DUYE 2UUCI 1X48A 3WU4A 4DR6I 2UXBI 4WFTA 4JI1E 1IBMI 5IWAE 1KIJA 1H7SA 4NXMI 3J7AM 4X65I 4JI2E 1A6FA 1NZ0A 3J80C 1J5EI 4DUYI 1K47A 4FWGA 5CFFE 4JI1I 5BR8E 1YYWA 4DV1E 5IWAI 2CZ9A 4JI2I 3ZM7A 3M6AA 1N34E 2ZM6I 1PKPA 2L2KB 1EKZA 2HFUA 5A2QC 2ZBKB 1KKHA 3QT8A 5BR8I 1HNZI 4JV5E 3JAMC 4DV7E 1Z5AA 1I94E 4JYAI 2NUGA 2L3JA 3PYEA 1ZXNA 2UXDE 2LJPA 4MYTA 4WYQB 5LL6R 2VF3A 2L3CA 3F0NA 4DV7I 4P52A 1N0VC 1I94I 4PRXA 4LF8E 4DR4I 4JI6I 3VYYA 4B3TE 2UXDI 1XMOE 2Q2EB 4KQVA 1U2RA 2EFGA 4DR3E 1Z0EA 2E1RA 2UUAI 4LF6E 4LF8I 2HK3A 4B3TI 4M2ZA 1XMOI 1STUA 1UEKA 4DPTA 4DV6I 4DR3I 3J81Q 4XTJA 1T4LB 4JI0E 4LF6I 4DUZE 3B8HA 5LMNI 3QT5A 1Z0BA 4DKKA 1FI4A 1QU6A 2N3HA 1J26A 1NHJA 3HTXA 3ZZTA 4DPXA 4DU8A 1YZ9A 1T4OA 1Z0WA 2RS6A 4DV4E 1RQ0A 4HY1A 4DV3E 2UXCE 1Z59A 3K1JA 3B82A 4B3RE 4LFBI 2F4VE 1N0UA 4YHHI 1OJ4A 2L2MA 3ADGA 3ZKDA 4DV4I 3J81C
chains in the Genus database with same CATH superfamily
2RSMA 5LMUE 3Q1QA 4DPUA 1SFEA 2EPMX 2C38A 2EN3A 4DV3I 2YTNA 4IFDC 2IERA 3ZZUA 2UXCI 4LF7I 4USKA 4DPWA 4LPFA 3U1KA 4UT4A 4B3RI 1Z0TA 2F4VI 1FNMA 4WUBA 3M7ND 5K36C 4I3HA 2DRPA 2V8PA 5KL3A 2DLQA 2EOXA 1BB8A 1ZM2A 2EL5A 4M1KA 2EM3A 5A6BD 4DR2E 1BBOA 1ZM3A 3T1YE 2B7TA 4AQYE 5LMUI 2EOQA 5K36D 4JI7E 1Z0GA 4JI3I 2DEJA 4MU1A 1D6TA 2BB8A 5ADZA 1ZAAC 4NXNE 2O1TA 1ZU1A 3P06A 4MDTA 2JOXA 3GMEA 4HXZA 3PYGA 1OYRA 4LTYA 4B3ME 4DV0E 2M4IA 2OI2A 5JEAA 3T1YI 4BA1A 3RMPA 4AQYI 2GO4A 2V86A 1B62A 2A25A 4Z7YA 4JI7I 1N32E 3HKMA 3MSWA 4YY3E 4HYMA 4LFAE 3OTOE 4X64E 1T38A 5L3JA 2Q8UA 4DV1I 5KL5A 4DV2I 2BA1G 2EM7A 1YUIA 1WXRA 1H7UA 3DJWA 4B3MI 3Q6NA 4PU9A 1N34I 4OO1D 1A1GA 4LFCE 4FN5A 5FLXQ 2EOEA 2NN6B 4P7AA 3WU6A 2CPNA 1FKAE 3EPLA 5JEAD 2R76A 2YTFA 3THOB 3M85D 2YWQA 4R2AA 2EMGA 3J7Yp 2V2VA 2YTIA 1HNWE 1PIEA 4X64I 3OTOI 5C0XB 4LF9E 4NHRA 3P3GA 4L5NC 3QT6A 1RREA 4FWHA 4ISAA 2LJUA 1QZRA 2Z5EA 2E5LE 1N36E 1E3PA 1Z0VA 3ADJA 2BA0D 1A1JA 2MC5A 4DR5E 3P76A 2Z5CB 2PO1B 4JI8E 2K7IA 5ELWA 4OOGC 4LFCI 3U1YA 1WRJA 2WBUA 2BA0G 2KHXA 4TUIA 1GZ6A 2VF1A 1BKNA 1E3HA 1ZR9A 2EMBA 2C39B 3M99B 2V34A 2Z5BA 3PRYA 3ZZ0A 4F9AB 2EOFA 4ZYHA 2X7IA 2DMYA 4DV5E 4HACB 2E5LI 2YTOA 4R1FA 1NHHA 1LLMC 2EMZA 1DARA 2BM1A 2L2NA 2R3VA 3WU3A 4DR5I 2MKNA 2PO0A 2HK2A 4WUDA 5GMDA 2J7KA 4DR1E 1A1IA 1IQSA 1X5WA 4X9JA 2EOZA 2DGCA 3BBGA 2DB2A 2AE8A 2MDGA 4P78A 2EPLX 4FW6A 4IFDD 2I9IA 2JY9A 2J65A 4UTGA 1PVGA 4ED4A 2EN1A 5FLXC 3TQMA 2DEIA 4BA2A 2EPZA 5EKWA 3KRNA 4BBYA 5DNYA 4IZJA 4LCHA 1H73A 3PYFA 2DMIA 2LUQA 3LLHA 4KZSA 4BCAA 1NCSA 5AASA 5AE3A 4O43A 1XNQE 4X62E 2EMKA 2HKEA 3VHTB 4OO1E 2CG9A 2JEBA 1X6FA 2EPRA 2L8TA 3HJCA 4FW5A 5JEAE 1FWKA 5A69A 3V5RA 2EP3A 4DPYA 2WNRB 4RPFA 2LUPB 4FWDA 1HK7A 1TN9A 1IQOA 1A1KA 2GS8A 4MYUA 4JI0I 4HTGA 2JT2A 2NA2A 4DXLA 2N3GA 1YYKA 2VQFE 1FWLA 4F6MA 4DUZI 5KL4A 2ELZA 2PNZB 1Z5BA 2EOJA 4RH8A 4WXDA 1DI2A 4J3DA 4P7DA 1XNQI 2M1SA 2A2CA 2V2QA 4USMA 2B7VA 1WUUA 2NN6C 1SR9A 3EQ1A 5T6JA 1IBLE 4JI4E 1KJKA 2EORA 2V88A 2ZITA 5GMEA 1HR0E 1Y6ZA 1FJGE 1X3CA 5C0XC 1T39A 2WP8B 2EMIA 2EMCA 2YZTA 4OO1F 2EMXA 4FW9A 1X49A 2VQFI 2WCC3 5DRPA 2NUEA 1T4NA 2EPOA 2V85A 3PS3A 4F2JC 2R1FA 4JI5E 3HULA 3PS1A 2EN2A 1MG7A 1IBLI 1ZBQA 4WXCA 2NPFA 3GONA 2DIXA 3V2UC 4AIDA 2YTPA 2EMAA 4J8ZA 4BHBA 1XMQE 2IHR1 4GKJE 1Z5CA 3T1HE 3C6MA 2IOQA 2V89A 2CGEA 2YSPA 4IFDE 1R6MA 5IXMB 4FW3A 4DR6E 4WSPA 2UXBE 3EPKA 1UDNA 4X66E 1MX0A 3J7AG 2O1UA 3WU5A 5K36E 1JK2A 4JI5I 3M7NG 5KL6A 4NXME 4R2QA 4WX9A 1B69A 3ZOQB 1RMDA 2V2ZA 1A1HA 1HNXE 1A1FA 4LCGA 1XMQI 2CVEA 4GKJI 1EH6A 3T1HI 2GLIA 2EOSA 4GKKE 4IJDA 4M0VA 3K17A 5IT9Q 1Y4SA 2EMHA 4LF5E 4JV5I 4OO1A 2BV3A 3P1XA 1H72C 2EPKX 4X66I 4DR2I 2LT7A 1XNRE 2HKJA 2JR1A 1YYOA 2UU9E 4MLQA 1N33E 2YSOA 2F1DA 1GQEA 2EMYA 1TF3A 2JP9A 3AV0A 4IFDF 1WHQA 3PYDA 3ADLA 2ODRC 1S16A 2RPCA 1HNXI 1KYQA 2B9DA 2C37B 1WHNA 4LF4E 4K0KE 1DGCA 2ZM6E 3C4TA 1B63A 5K36F 4NXNI 4GKKI 2V83A 2LRSA 1X6HA 2O1WA 4R2EA 2V87A 2EMFA 4LF5I 3B78A 3H4LA 4RHBB 4OKGA 1HNZE 1XNRI 4DV0I 4IZKB 2UU9I 2NN6A 1N33I 4I8OA 3P3CA 2GQ0A 1AH5A 4F9CB 5A6AA 1UHZA 4JYAE 1N32I 3UHMA 4PRVA 4LF4I 4YY3I 4K0KI 4LFAI 2E1MA 4BHCA 1H74A 3L7ZA 3ADIA 4OX9E 1ZM9A 4ZVIA 2HHHE 3H1CA 1DQ3A 3VYXA 2YTDA 2LBSB 3M85G 2JVAA 2MDRA 2EPCA 3CWVA 3DD6A 1IBKE 2Z5CA 2JYAA 2G7HA 2LTRA 2PO1A 4R2PA 3UK3C 4DV2E 2IESA 2MKDA 2WZOA 3LPSA 4DU7A 3LNUA 2LMZA 4QNJA 2NN6D 4IFDA 5IT9C 4DR4E 1HNWI 4JI6E 4OX9I 1GTKA 4LF9I 4HACA 2EQ0A 2LCEA 3HPSA 2HHHI 5C0XD 1N36I 1VI7A 4N3OA 5K36A 2IOPA 4MQYA 1YH8A 1YSAC 2BR2B 3P3EA 1IBKI 2EM9A 1UILA 4Q35B 5KL7A 1MGTA 2JE6B 4JI8I 2EOHA 2EJ4A 2EM0A 3GLLA 4NZVA 4ZYDA 2LTSA 2UUAE 2BM0A 4GQUA 1Y60A 1KVKA 5A6JA 2EM5A 2F8BA 2EM4A 4R2DA 1RC7A 1RHYA 2LJHA 2EN4A 4DV5I 3KZZA 2VQEE 1P42A 4IS1C 2GO3A 1Y4UA 2EE8A 3D4JA 4WUCA 4DV6E 2WBSA 1ZM4A 2V8QB 1USUA 1FJGI 1KTVA 2RTXA 1Y5YA 1IMUA 2YU5A 4GEQB 4DR1I 5IV8B 2BBGA 4JG4A 3C4BA 3EPJA 2O3ZA 4DR7E 1RR9A 5LMNE 1VISA 2R42A 1Z0CA 2PO0B 1PJQA 2DSYA 1O0WA 2JXPA 4KHPE 1EI1A 2AJ4A 2PO2A 2VQEI 2EOMA 2GHFA 2B3TB 3IWCA 3VK6A 1ZBTA 2L92A 2EQ3A 3K6QA 4X62I 3LTOA 4DR7I 2M9AA 4ZYEA 5DRRA 1MU5A 2NN6E 4IZJB 1EA6A 2EL4A 5DNLA 2ODRD 5JEAC 3BIDA 2EWLA 4B3SE 4KHPI 1YPNA 5LLQA 2X36A 2FV4B 4F6NA 5C0XE 1UN6B 3J80Q 1ZXMA 2L6MA 4WSGA 4FK5C 1EH8A 1L4SA 2PNLA 4MLVA 4URLA 1AAYA 1NHIA 3QT7A 4FW4A 4LFBE 1S4EA 1YFHA 2HFSA 2EN6A 1XHKA 1X47A 2VRDA 4YHHE 4JI4I 3F6GA 5DNXA 4B3SI 4U3DA 3HXLA 1Z1BA 4Z7CA 2UUBE 2JEAB 3K85A 3ZKBA 2WW4A 2NUFA 2KOUA 4LF7E 2YTJA 2UUCE 4M9VC 2NN6F 2RS7A 4BC9A 2A2DA 1N3GA 2YU8A 4WPYA 1IBME 5A2QQ 4AIMA 2PNMA 4BC7A 4X65E 5C0XF 2HJJA 4MU4A 1ELOA 3JAMQ 4M30A 2L33A 1J5EE 4X8WA 2N8XA 2UUBI 2XEXA 2PRTA 2YT4A 2EZ6A 2RQLA 2EQ1A 4JI3E 4DUYE 1YHCA 2LE2A 1PJSA 2C38B 2UUCI 1X48A 3WU4A 1PJTA 4DR6I 4WFTA 2UXBI 4JI1E 1IBMI 3IWDA 5IWAE 2CTDA 2JPAA 3AUZA 1KIJA 2YTGA 1H7SA 4NXMI 4BS9A 4X65I 3J7AM 4JI2E 2LV2A 2NABA 1A6FA 2C37A 1UDSA 1NZ0A 3J80C 1J5EI 2RSIA 4NBQA 2ADRA 3CDJA 2ENHA 4DUYI 1K47A 1QNTA 4FWGA 2GPIA 5CFFE 4IZKA 4O4KA 4JI1I 5BR8E 1YYWA 4DV1E 5IWAI 5DRQA 2I13A 5EL9A 2EMWA 1YUJA 2CZ9A 2E72A 1MEYC 3ZM7A 2ELYA 4JI2I 5AC4A 3MHHC 4LOMA 4OO1B 3THNA 3M6AA 1N34E 4GZNC 5C0XA 5DROA 2ZM6I 1PKPA 5JEAB 4BA1B 1G2FC 2L2KB 4F9BB 1EKZA 5A2QC 2HFUA 2BA1D 2ZBKB 5KL2A 1KKHA 3QT8A 2HC5A 3JTZA 4R8OA 5BR8I 1X6EA 2YRHA 4JV5E 4LU9A 3JAMC 1HNZI 4DV7E 1Z5AA 1PDAA 1I94E 3OMLA 2EN8A 2FGGA 2C39A 4JYAI 3B4TA 3BGHA 2NUGA 3FIGA 4MU0A 2L3JA 2YTQA 1JK1A 2H36X 3PYEA 4FW7A 1F2IG 4F54A 4IS9A 1ZXNA 3IWBA 2UXDE 2DLKA 2LJPA 2BR2A 4MYTA 2EPNA 4WYQB 5LL6R 1OYSA 2VF3A 2EMLA 4U3BA 2EL6A 2CT1A 2L3CA 2JE6A 3F0NA 1HR0I 3L7ZB 4P52A 2ENCA 4DV7I 1N0VC 1R6LA 1I94I 2VE7C 1WJPA 4TUGA 2EPUA 3LMLA 1USVA 3GCMA 4PRXA 3QG5C 1P47A 4LF8E 4DR4I 3BF2A 4JI6I 2D9HA 3VYYA 2YTEA 3HPZA 4B3TE 1UDQA 2UXDI 2EN7A 1XMOE 2Q2EB 3DF6A 4KQVA 3KZYA 4EMDA 1U2RA 4ZYGA 4IFDB 2EFGA 4R03A 4DR3E 1Z0EA 2Z5BB 1TF6A 3CDIA 2E1RA 5AC5A 2UUAI 2EPAA 2VESA 4LF6E 3NZKA 5K36B 2KONA 2JWOA 4LF8I 5TSEA 4KWYA 4BMJA 2HK3A 2WNRA 4B3TI 4M2ZA 1XMOI 3JU0A 2EM2A 2EPXA 2EOIA 2O1VA 1STUA 1EH7A 1UEKA 4DPTA 2HGHA 2LVHA 4DV6I 2EM6A 2PNZA 4DR3I 4LCFA 4DMIA 2YPNA 4QNKA 4MU3A 1BBGA 1T4LB 4XTJA 3J81Q 4JI0E 2YRKA 4LF6I 4OO1C 2JOBA 4DUZE 4BA2B 5A6KA 3B8HA 5LMNI 2ENAA 3C6KA 4R2RA 3QT5A 4R2CA 2WBTA 2WP8A 3F6HA 4DKKA 1Z0BA 1FI4A 2YRMA 1NEIA 2JEBB 1QU6A 2EM8A 4OZEA 2J7JA 2N3HA 3H09A 1OYPA 4R2SA 1UDOA 1J26A 1NHJA 2MC6A 2PO2B 3HTXA 3L00A 4O5GA 3ZZTA 5FWKA 1A1LA 4DPXA 2EOYA 2M7QA 4DU8A 4Q28A 1YZ9A 1T4OA 1Z0WA 3ECRA 4HEIA 4IZJD 2RS6A 2JEAA 4L8NA 1RQ0A 4DV4E 4HY1A 4N4RB 3KWRA 2LO3A 4DV3E 2UXCE 3EPHA 3Q6MA 3PS2A 4O24A 1Z59A 3K1JA 3MHSC 1G2DC 2CSHA 4AM3A 3B82A 4B3RE 1XXEA 4LFBI 5A6BA 2F4VE 1N0UA 2K4VA 4YHHI 5JEAF 5F3WA 2EPPA 2EOOA 2FTXB 3HQ1A 5AE2A 1OJ4A 2L2MA 3ADGA 1UBDC 5AE1A 3ZKDA 4DV4I 3J81C
chains in the Genus database with same CATH topology
2RSMA 5LMUE 3Q1QA 4DPUA 4DV3I 2UXCI 3ZZUA 4LF7I 4USKA 4DPWA 4UT4A 4B3RI 1Z0TA 2F4VI 1FNMA 4WUBA 4I3HA 2V8PA 1ZM2A 4M1KA 4DR2E 1ZM3A 3T1YE 2B7TA 4AQYE 5LMUI 4JI7E 1Z0GA 4JI3I 2DEJA 1D6TA 5ADZA 4NXNE 2O1TA 3P06A 2JOXA 4HXZA 3PYGA 4LTYA 4B3ME 4DV0E 2M4IA 2OI2A 3T1YI 3RMPA 4AQYI 2V86A 1B62A 4Z7YA 4JI7I 1N32E 3MSWA 4YY3E 4HYMA 4LFAE 3OTOE 4X64E 5L3JA 4DV1I 1WXRA 1H7UA 3DJWA 4B3MI 3Q6NA 4PU9A 1N34I 4LFCE 4FN5A 5FLXQ 4P7AA 3WU6A 2CPNA 1FKAE 3J7Yp 2V2VA 1HNWE 4X64I 1PIEA 3OTOI 4JV5I 4LF9E 3QT6A 4L5NC 4FWHA 1RREA 1QZRA 2Z5EA 2E5LE 1N36E 1Z0VA 3ADJA 2MC5A 4DR5E 2Z5CB 4JI8E 4LFCI 4OOGC 2KHXA 4TUIA 1GZ6A 2VF1A 1BKNA 2V34A 2Z5BA 3PRYA 3ZZ0A 4F9AB 2X7IA 2DMYA 4DV5E 4HACB 2E5LI 4R1FA 1NHHA 1DARA 2BM1A 2R3VA 2L2NA 3WU3A 4DR5I 2HK2A 4WUDA 5GMDA 2J7KA 4DR1E 2DB2A 4P78A 2JY9A 4UTGA 1PVGA 4ED4A 5FLXC 2DEIA 4BBYA 5DNYA 4IZJA 1H73A 3PYFA 4BCAA 2LUQA 3LLHA 4KZSA 5AE3A 1XNQE 5AASA 4X62E 2HKEA 2CG9A 3HJCA 2L8TA 1FWKA 3V5RA 4DPYA 4RPFA 2LUPB 4FWDA 1HK7A 2GS8A 4MYUA 4JI0I 2NA2A 4DXLA 2N3GA 1YYKA 2VQFE 1FWLA 4DUZI 1Z5BA 1XNQI 1DI2A 4P7DA 2M1SA 2A2CA 2V2QA 4USMA 2B7VA 1WUUA 1SR9A 5T6JA 1IBLE 4JI4E 5GMEA 2V88A 2ZITA 1HR0E 1Y6ZA 1FJGE 2YZTA 4FW9A 1X49A 2VQFI 2NUEA 1T4NA 2V85A 4JI5E 3HULA 1MG7A 1IBLI 1ZBQA 2NPFA 3GONA 2DIXA 3V2UC 4J8ZA 1Z5CA 1HR0I 1XMQE 1FJGI 2IHR1 4GKJE 2IOQA 3T1HE 2V89A 2CGEA 4DR6E 4WSPA 2UXBE 4EMDA 4X66E 1MX0A 3J7AG 2O1UA 3WU5A 4JI5I 4NXME 3ZOQB 2V2ZA 1HNXE 1XMQI 4GKJI 3T1HI 4GKKE 4M0VA 3K17A 5IT9Q 1Y4SA 4LF5E 2BV3A 3P1XA 1H72C 4X66I 4DR2I 1XNRE 2HKJA 2JR1A 1YYOA 2UU9E 1N33E 1GQEA 3AV0A 1WHQA 3PYDA 3ADLA 2ODRC 1S16A 1HNXI 2B9DA 4K0KE 1WHNA 4LF4E 1B63A 2ZM6E 3C4TA 4NXNI 4GKKI 2V83A 2LRSA 2O1WA 2V87A 4LF5I 3B78A 3H4LA 1HNZE 1XNRI 4DV0I 4IZKB 2UU9I 1N33I 4I8OA 2GQ0A 4F9CB 1UHZA 4JYAE 1N32I 4PRVA 4LF4I 4YY3I 4K0KI 4LFAI 2E1MA 1H74A 3ADIA 4OX9E 1ZM9A 4ZVIA 2HHHE 1DQ3A 3VYXA 2LBSB 2JVAA 2MDRA 3CWVA 1IBKE 2Z5CA 2G7HA 2LTRA 4DV2E 2WZOA 3LPSA 4DU7A 3LNUA 2LMZA 5IT9C 4DR4E 1HNWI 4JI6E 4OX9I 4LF9I 4HACA 2HHHI 3HPSA 1N36I 4N3OA 2IOPA 1IBKI 1UILA 4JI8I 4DV2I 2BM0A 2LTSA 2UUAE 1KVKA 2F8BA 1RC7A 2LJHA 4DV5I 2VQEE 1Y4UA 4WUCA 3D4JA 4DV6E 1ZM4A 2V8QB 1USUA 1KTVA 2RTXA 4GEQB 4DR1I 4JG4A 3C4BA 2R42A 4DR7E 1RR9A 5LMNE 1VISA 1Z0CA 2DSYA 1O0WA 4KHPE 1EI1A 2AJ4A 2VQEI 2B3TB 3IWCA 3VK6A 1ZBTA 2L92A 3K6QA 4X62I 3LTOA 4DR7I 1MU5A 4IZJB 1EA6A 2ODRD 2EWLA 4B3SE 4KHPI 2X36A 2FV4B 3J80Q 1ZXMA 2L6MA 2PNLA 4URLA 1NHIA 3QT7A 4LFBE 1S4EA 2HFSA 1XHKA 1X47A 4YHHE 4JI4I 3F6GA 4B3SI 3HXLA 4Z7CA 2UUBE 3K85A 3ZKBA 2WW4A 2NUFA 2KOUA 4LF7E 2UUCE 2RS7A 4BC9A 2A2DA 4WPYA 1IBME 5A2QQ 2PNMA 4BC7A 4X65E 3JAMQ 1ELOA 4M30A 2L33A 1J5EE 4X8WA 2UUBI 2XEXA 2YT4A 2EZ6A 4JI3E 4DUYE 2LE2A 2UUCI 1X48A 3WU4A 4DR6I 2UXBI 4WFTA 4JI1E 1IBMI 3IWDA 5IWAE 3AUZA 1KIJA 1H7SA 4NXMI 3J7AM 4BS9A 4X65I 4JI2E 1A6FA 1NZ0A 3J80C 1J5EI 4DUYI 1K47A 4FWGA 5CFFE 4IZKA 4JI1I 5BR8E 1YYWA 4DV1E 5IWAI 2CZ9A 4JI2I 3ZM7A 3M6AA 1N34E 2ZM6I 1PKPA 2L2KB 4F9BB 1EKZA 5A2QC 2HFUA 2ZBKB 1KKHA 3QT8A 3JTZA 4R8OA 5BR8I 1HNZI 4JV5E 4LU9A 3JAMC 4DV7E 1Z5AA 1I94E 3OMLA 2FGGA 4JYAI 2NUGA 3FIGA 2L3JA 3PYEA 2H36X 4F54A 1ZXNA 3IWBA 2UXDE 2LJPA 4MYTA 4WYQB 5LL6R 2VF3A 2L3CA 3F0NA 4DV7I 4P52A 1N0VC 1I94I 2VE7C 4TUGA 3LMLA 1USVA 4PRXA 4LF8E 4DR4I 4JI6I 3VYYA 4B3TE 3HPZA 2UXDI 1XMOE 2Q2EB 3DF6A 4KQVA 1U2RA 2EFGA 4R03A 4DR3E 1Z0EA 2Z5BB 2E1RA 2UUAI 4LF6E 2KONA 2JWOA 4LF8I 4BMJA 2HK3A 4B3TI 4M2ZA 1XMOI 3JU0A 2O1VA 1STUA 1UEKA 4DPTA 4DV6I 4DR3I 4DMIA 3J81Q 4XTJA 1T4LB 4JI0E 4LF6I 2JOBA 4DUZE 3B8HA 5LMNI 3QT5A 3F6HA 4DKKA 1Z0BA 1FI4A 1QU6A 2N3HA 3H09A 1J26A 1NHJA 2MC6A 3HTXA 3ZZTA 5FWKA 4DPXA 2M7QA 4DU8A 4Q28A 1YZ9A 1T4OA 1Z0WA 4IZJD 2RS6A 4L8NA 1RQ0A 4DV4E 4HY1A 3KWRA 3Q6MA 4DV3E 2UXCE 1Z59A 3K1JA 3B82A 4B3RE 4LFBI 2F4VE 1N0UA 2K4VA 4YHHI 5F3WA 2FTXB 3HQ1A 5AE2A 1OJ4A 2L2MA 3ADGA 5AE1A 3ZKDA 4DV4I 3J81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSM A;  5LMU E;  3Q1Q A;  4DPU A;  4DV3 I;  2UXC I;  3ZZU A;  4LF7 I;  4USK A;  4DPW A;  4UT4 A;  4B3R I;  1Z0T A;  2F4V I;  1FNM A;  4WUB A;  4I3H A;  2V8P A;  1ZM2 A;  4M1K A;  4DR2 E;  1ZM3 A;  3T1Y E;  2B7T A;  4AQY E;  5LMU I;  4JI7 E;  1Z0G A;  4JI3 I;  2DEJ A;  1D6T A;  4NXN E;  4HXZ A;  3PYG A;  4B3M E;  4DV0 E;  2OI2 A;  3T1Y I;  4AQY I;  4JI7 I;  1B62 A;  4Z7Y A;  1N32 E;  4YY3 E;  4HYM A;  4LFA E;  3OTO E;  4X64 E;  5L3J A;  4DV1 I;  1H7U A;  4B3M I;  4PU9 A;  1N34 I;  4LFC E;  4FN5 A;  5FLX Q;  4P7A A;  3WU6 A;  2CPN A;  1FKA E;  3J7Y p;  2V2V A;  1HNW E;  4X64 I;  1PIE A;  3OTO I;  4JV5 I;  4LF9 E;  3QT6 A;  4FWH A;  1RRE A;  1QZR A;  2E5L E;  1N36 E;  1Z0V A;  3ADJ A;  4DR5 E;  4JI8 E;  4LFC I;  4OOG C;  2KHX A;  1BKN A;  2V34 A;  3ZZ0 A;  2X7I A;  2DMY A;  4DV5 E;  4HAC B;  2E5L I;  4R1F A;  1NHH A;  1DAR A;  2BM1 A;  2R3V A;  2L2N A;  3WU3 A;  4DR5 I;  2HK2 A;  4WUD A;  5GMD A;  2J7K A;  4DR1 E;  2DB2 A;  2JY9 A;  4UTG A;  1PVG A;  4ED4 A;  5FLX C;  2DEI A;  1H73 A;  3PYF A;  2LUQ A;  3LLH A;  1XNQ E;  4X62 E;  2HKE A;  1FWK A;  3V5R A;  4DPY A;  4RPF A;  4FWD A;  2LUP B;  2GS8 A;  4MYU A;  4JI0 I;  2NA2 A;  4DXL A;  2N3G A;  1YYK A;  2VQF E;  1FWL A;  4DUZ I;  1Z5B A;  1XNQ I;  1DI2 A;  2A2C A;  4USM A;  2V2Q A;  2B7V A;  1WUU A;  1IBL E;  4JI4 E;  5GME A;  2ZIT A;  1HR0 E;  1FJG E;  4FW9 A;  1X49 A;  2VQF I;  2NUE A;  1T4N A;  4JI5 E;  3HUL A;  1MG7 A;  1IBL I;  2NPF A;  3GON A;  2DIX A;  3V2U C;  1Z5C A;  1HR0 I;  1FJG I;  1XMQ E;  2IHR 1;  4GKJ E;  3T1H E;  4DR6 E;  2UXB E;  4EMD A;  4X66 E;  1MX0 A;  3WU5 A;  3J7A G;  4JI5 I;  4NXM E;  2V2Z A;  1HNX E;  1XMQ I;  4GKJ I;  3T1H I;  4GKK E;  3K17 A;  5IT9 Q;  4LF5 E;  2BV3 A;  3P1X A;  1H72 C;  4X66 I;  4DR2 I;  1XNR E;  2HKJ A;  2UU9 E;  1YYO A;  1N33 E;  1GQE A;  1WHQ A;  3PYD A;  3ADL A;  1S16 A;  1HNX I;  1WHN A;  4LF4 E;  4K0K E;  1B63 A;  2ZM6 E;  3C4T A;  4NXN I;  4GKK I;  2LRS A;  4LF5 I;  3B78 A;  3H4L A;  1HNZ E;  1XNR I;  4DV0 I;  2UU9 I;  1N33 I;  1UHZ A;  4JYA E;  1N32 I;  4PRV A;  4LF4 I;  4YY3 I;  4K0K I;  4LFA I;  1H74 A;  3ADI A;  4OX9 E;  1ZM9 A;  4ZVI A;  2HHH E;  3VYX A;  2LBS B;  2JVA A;  2MDR A;  3CWV A;  1IBK E;  2LTR A;  4DV2 E;  3LPS A;  4DU7 A;  3LNU A;  4DR4 E;  5IT9 C;  1HNW I;  4JI6 E;  4OX9 I;  4LF9 I;  4HAC A;  2HHH I;  1N36 I;  1IBK I;  1UIL A;  4JI8 I;  4DV2 I;  2BM0 A;  2LTS A;  2UUA E;  1KVK A;  1RC7 A;  2LJH A;  4DV5 I;  2VQE E;  4WUC A;  3D4J A;  4DV6 E;  1ZM4 A;  1KTV A;  2RTX A;  4DR1 I;  4JG4 A;  3C4B A;  2R42 A;  4DR7 E;  1RR9 A;  5LMN E;  1VIS A;  1Z0C A;  1O0W A;  4KHP E;  1EI1 A;  2AJ4 A;  2VQE I;  2B3T B;  1ZBT A;  4X62 I;  3LTO A;  4DR7 I;  1MU5 A;  1EA6 A;  4B3S E;  4KHP I;  2X36 A;  3J80 Q;  1ZXM A;  4URL A;  1NHI A;  3QT7 A;  4LFB E;  1S4E A;  2HFS A;  1XHK A;  1X47 A;  4YHH E;  4JI4 I;  4B3S I;  4Z7C A;  2UUB E;  3ZKB A;  2WW4 A;  2NUF A;  4LF7 E;  2UUC E;  2RS7 A;  2A2D A;  1IBM E;  5A2Q Q;  4X65 E;  3JAM Q;  1ELO A;  4M30 A;  2L33 A;  1J5E E;  4X8W A;  2UUB I;  2XEX A;  2YT4 A;  2EZ6 A;  4JI3 E;  4DUY E;  2UUC I;  1X48 A;  3WU4 A;  4DR6 I;  2UXB I;  4WFT A;  4JI1 E;  1IBM I;  5IWA E;  1KIJ A;  1H7S A;  4NXM I;  3J7A M;  4X65 I;  4JI2 E;  1A6F A;  1NZ0 A;  3J80 C;  1J5E I;  4DUY I;  1K47 A;  4FWG A;  5CFF E;  4JI1 I;  5BR8 E;  1YYW A;  4DV1 E;  5IWA I;  2CZ9 A;  4JI2 I;  3ZM7 A;  3M6A A;  1N34 E;  2ZM6 I;  1PKP A;  2L2K B;  1EKZ A;  2HFU A;  5A2Q C;  2ZBK B;  1KKH A;  3QT8 A;  5BR8 I;  1HNZ I;  4JV5 E;  3JAM C;  4DV7 E;  1Z5A A;  1I94 E;  4JYA I;  2NUG A;  2L3J A;  3PYE A;  1ZXN A;  2UXD E;  2LJP A;  4MYT A;  4WYQ B;  5LL6 R;  2VF3 A;  2L3C A;  3F0N A;  4DV7 I;  4P52 A;  1N0V C;  1I94 I;  4PRX A;  4LF8 E;  4DR4 I;  4JI6 I;  3VYY A;  4B3T E;  2UXD I;  1XMO E;  2Q2E B;  4KQV A;  1U2R A;  2EFG A;  4DR3 E;  1Z0E A;  2E1R A;  2UUA I;  4LF6 E;  4LF8 I;  2HK3 A;  4B3T I;  4M2Z A;  1XMO I;  1STU A;  1UEK A;  4DPT A;  4DV6 I;  4DR3 I;  3J81 Q;  4XTJ A;  1T4L B;  4JI0 E;  4LF6 I;  4DUZ E;  3B8H A;  5LMN I;  3QT5 A;  1Z0B A;  4DKK A;  1FI4 A;  1QU6 A;  2N3H A;  1J26 A;  1NHJ A;  3HTX A;  3ZZT A;  4DPX A;  4DU8 A;  1YZ9 A;  1T4O A;  1Z0W A;  2RS6 A;  4DV4 E;  1RQ0 A;  4HY1 A;  4DV3 E;  2UXC E;  1Z59 A;  3K1J A;  3B82 A;  4B3R E;  4LFB I;  2F4V E;  1N0U A;  4YHH I;  1OJ4 A;  2L2M A;  3ADG A;  3ZKD A;  4DV4 I;  3J81 C; 
#chains in the Genus database with same CATH topology
 2RSM A;  5LMU E;  3Q1Q A;  4DPU A;  1SFE A;  2EPM X;  2C38 A;  2EN3 A;  4DV3 I;  2YTN A;  4IFD C;  2IER A;  3ZZU A;  2UXC I;  4LF7 I;  4USK A;  4DPW A;  4LPF A;  3U1K A;  4UT4 A;  4B3R I;  1Z0T A;  2F4V I;  1FNM A;  4WUB A;  3M7N D;  5K36 C;  4I3H A;  2DRP A;  2V8P A;  5KL3 A;  2DLQ A;  2EOX A;  1BB8 A;  1ZM2 A;  2EL5 A;  4M1K A;  2EM3 A;  5A6B D;  4DR2 E;  1BBO A;  1ZM3 A;  3T1Y E;  2B7T A;  4AQY E;  5LMU I;  2EOQ A;  5K36 D;  4JI7 E;  1Z0G A;  4JI3 I;  2DEJ A;  4MU1 A;  1D6T A;  2BB8 A;  5ADZ A;  1ZAA C;  4NXN E;  2O1T A;  1ZU1 A;  3P06 A;  4MDT A;  2JOX A;  3GME A;  4HXZ A;  3PYG A;  1OYR A;  4LTY A;  4B3M E;  4DV0 E;  2M4I A;  2OI2 A;  5JEA A;  3T1Y I;  4BA1 A;  3RMP A;  4AQY I;  2GO4 A;  2V86 A;  1B62 A;  2A25 A;  4Z7Y A;  4JI7 I;  1N32 E;  3HKM A;  3MSW A;  4YY3 E;  4HYM A;  4LFA E;  3OTO E;  4X64 E;  1T38 A;  5L3J A;  2Q8U A;  4DV1 I;  5KL5 A;  4DV2 I;  2BA1 G;  2EM7 A;  1YUI A;  1WXR A;  1H7U A;  3DJW A;  4B3M I;  3Q6N A;  4PU9 A;  1N34 I;  4OO1 D;  1A1G A;  4LFC E;  4FN5 A;  5FLX Q;  2EOE A;  2NN6 B;  4P7A A;  3WU6 A;  2CPN A;  1FKA E;  3EPL A;  5JEA D;  2R76 A;  2YTF A;  3THO B;  3M85 D;  2YWQ A;  4R2A A;  2EMG A;  3J7Y p;  2V2V A;  2YTI A;  1HNW E;  1PIE A;  4X64 I;  3OTO I;  5C0X B;  4LF9 E;  4NHR A;  3P3G A;  4L5N C;  3QT6 A;  1RRE A;  4FWH A;  4ISA A;  2LJU A;  1QZR A;  2Z5E A;  2E5L E;  1N36 E;  1E3P A;  1Z0V A;  3ADJ A;  2BA0 D;  1A1J A;  2MC5 A;  4DR5 E;  3P76 A;  2Z5C B;  2PO1 B;  4JI8 E;  2K7I A;  5ELW A;  4OOG C;  4LFC I;  3U1Y A;  1WRJ A;  2WBU A;  2BA0 G;  2KHX A;  4TUI A;  1GZ6 A;  2VF1 A;  1BKN A;  1E3H A;  1ZR9 A;  2EMB A;  2C39 B;  3M99 B;  2V34 A;  2Z5B A;  3PRY A;  3ZZ0 A;  4F9A B;  2EOF A;  4ZYH A;  2X7I A;  2DMY A;  4DV5 E;  4HAC B;  2E5L I;  2YTO A;  4R1F A;  1NHH A;  1LLM C;  2EMZ A;  1DAR A;  2BM1 A;  2L2N A;  2R3V A;  3WU3 A;  4DR5 I;  2MKN A;  2PO0 A;  2HK2 A;  4WUD A;  5GMD A;  2J7K A;  4DR1 E;  1A1I A;  1IQS A;  1X5W A;  4X9J A;  2EOZ A;  2DGC A;  3BBG A;  2DB2 A;  2AE8 A;  2MDG A;  4P78 A;  2EPL X;  4FW6 A;  4IFD D;  2I9I A;  2JY9 A;  2J65 A;  4UTG A;  1PVG A;  4ED4 A;  2EN1 A;  5FLX C;  3TQM A;  2DEI A;  4BA2 A;  2EPZ A;  5EKW A;  3KRN A;  4BBY A;  5DNY A;  4IZJ A;  4LCH A;  1H73 A;  3PYF A;  2DMI A;  2LUQ A;  3LLH A;  4KZS A;  4BCA A;  1NCS A;  5AAS A;  5AE3 A;  4O43 A;  1XNQ E;  4X62 E;  2EMK A;  2HKE A;  3VHT B;  4OO1 E;  2CG9 A;  2JEB A;  1X6F A;  2EPR A;  2L8T A;  3HJC A;  4FW5 A;  5JEA E;  1FWK A;  5A69 A;  3V5R A;  2EP3 A;  4DPY A;  2WNR B;  4RPF A;  2LUP B;  4FWD A;  1HK7 A;  1TN9 A;  1IQO A;  1A1K A;  2GS8 A;  4MYU A;  4JI0 I;  4HTG A;  2JT2 A;  2NA2 A;  4DXL A;  2N3G A;  1YYK A;  2VQF E;  1FWL A;  4F6M A;  4DUZ I;  5KL4 A;  2ELZ A;  2PNZ B;  1Z5B A;  2EOJ A;  4RH8 A;  4WXD A;  1DI2 A;  4J3D A;  4P7D A;  1XNQ I;  2M1S A;  2A2C A;  2V2Q A;  4USM A;  2B7V A;  1WUU A;  2NN6 C;  1SR9 A;  3EQ1 A;  5T6J A;  1IBL E;  4JI4 E;  1KJK A;  2EOR A;  2V88 A;  2ZIT A;  5GME A;  1HR0 E;  1Y6Z A;  1FJG E;  1X3C A;  5C0X C;  1T39 A;  2WP8 B;  2EMI A;  2EMC A;  2YZT A;  4OO1 F;  2EMX A;  4FW9 A;  1X49 A;  2VQF I;  2WCC 3;  5DRP A;  2NUE A;  1T4N A;  2EPO A;  2V85 A;  3PS3 A;  4F2J C;  2R1F A;  4JI5 E;  3HUL A;  3PS1 A;  2EN2 A;  1MG7 A;  1IBL I;  1ZBQ A;  4WXC A;  2NPF A;  3GON A;  2DIX A;  3V2U C;  4AID A;  2YTP A;  2EMA A;  4J8Z A;  4BHB A;  1XMQ E;  2IHR 1;  4GKJ E;  1Z5C A;  3T1H E;  3C6M A;  2IOQ A;  2V89 A;  2CGE A;  2YSP A;  4IFD E;  1R6M A;  5IXM B;  4FW3 A;  4DR6 E;  4WSP A;  2UXB E;  3EPK A;  1UDN A;  4X66 E;  1MX0 A;  3J7A G;  2O1U A;  3WU5 A;  5K36 E;  1JK2 A;  4JI5 I;  3M7N G;  5KL6 A;  4NXM E;  4R2Q A;  4WX9 A;  1B69 A;  3ZOQ B;  1RMD A;  2V2Z A;  1A1H A;  1HNX E;  1A1F A;  4LCG A;  1XMQ I;  2CVE A;  4GKJ I;  1EH6 A;  3T1H I;  2GLI A;  2EOS A;  4GKK E;  4IJD A;  4M0V A;  3K17 A;  5IT9 Q;  1Y4S A;  2EMH A;  4LF5 E;  4JV5 I;  4OO1 A;  2BV3 A;  3P1X A;  1H72 C;  2EPK X;  4X66 I;  4DR2 I;  2LT7 A;  1XNR E;  2HKJ A;  2JR1 A;  1YYO A;  2UU9 E;  4MLQ A;  1N33 E;  2YSO A;  2F1D A;  1GQE A;  2EMY A;  1TF3 A;  2JP9 A;  3AV0 A;  4IFD F;  1WHQ A;  3PYD A;  3ADL A;  2ODR C;  1S16 A;  2RPC A;  1HNX I;  1KYQ A;  2B9D A;  2C37 B;  1WHN A;  4LF4 E;  4K0K E;  1DGC A;  2ZM6 E;  3C4T A;  1B63 A;  5K36 F;  4NXN I;  4GKK I;  2V83 A;  2LRS A;  1X6H A;  2O1W A;  4R2E A;  2V87 A;  2EMF A;  4LF5 I;  3B78 A;  3H4L A;  4RHB B;  4OKG A;  1HNZ E;  1XNR I;  4DV0 I;  4IZK B;  2UU9 I;  2NN6 A;  1N33 I;  4I8O A;  3P3C A;  2GQ0 A;  1AH5 A;  4F9C B;  5A6A A;  1UHZ A;  4JYA E;  1N32 I;  3UHM A;  4PRV A;  4LF4 I;  4YY3 I;  4K0K I;  4LFA I;  2E1M A;  4BHC A;  1H74 A;  3L7Z A;  3ADI A;  4OX9 E;  1ZM9 A;  4ZVI A;  2HHH E;  3H1C A;  1DQ3 A;  3VYX A;  2YTD A;  2LBS B;  3M85 G;  2JVA A;  2MDR A;  2EPC A;  3CWV A;  3DD6 A;  1IBK E;  2Z5C A;  2JYA A;  2G7H A;  2LTR A;  2PO1 A;  4R2P A;  3UK3 C;  4DV2 E;  2IES A;  2MKD A;  2WZO A;  3LPS A;  4DU7 A;  3LNU A;  2LMZ A;  4QNJ A;  2NN6 D;  4IFD A;  5IT9 C;  4DR4 E;  1HNW I;  4JI6 E;  4OX9 I;  1GTK A;  4LF9 I;  4HAC A;  2EQ0 A;  2LCE A;  3HPS A;  2HHH I;  5C0X D;  1N36 I;  1VI7 A;  4N3O A;  5K36 A;  2IOP A;  4MQY A;  1YH8 A;  1YSA C;  2BR2 B;  3P3E A;  1IBK I;  2EM9 A;  1UIL A;  4Q35 B;  5KL7 A;  1MGT A;  2JE6 B;  4JI8 I;  2EOH A;  2EJ4 A;  2EM0 A;  3GLL A;  4NZV A;  4ZYD A;  2LTS A;  2UUA E;  2BM0 A;  4GQU A;  1Y60 A;  1KVK A;  5A6J A;  2EM5 A;  2F8B A;  2EM4 A;  4R2D A;  1RC7 A;  1RHY A;  2LJH A;  2EN4 A;  4DV5 I;  3KZZ A;  2VQE E;  1P42 A;  4IS1 C;  2GO3 A;  1Y4U A;  2EE8 A;  3D4J A;  4WUC A;  4DV6 E;  2WBS A;  1ZM4 A;  2V8Q B;  1USU A;  1FJG I;  1KTV A;  2RTX A;  1Y5Y A;  1IMU A;  2YU5 A;  4GEQ B;  4DR1 I;  5IV8 B;  2BBG A;  4JG4 A;  3C4B A;  3EPJ A;  2O3Z A;  4DR7 E;  1RR9 A;  5LMN E;  1VIS A;  2R42 A;  1Z0C A;  2PO0 B;  1PJQ A;  2DSY A;  1O0W A;  2JXP A;  4KHP E;  1EI1 A;  2AJ4 A;  2PO2 A;  2VQE I;  2EOM A;  2GHF A;  2B3T B;  3IWC A;  3VK6 A;  1ZBT A;  2L92 A;  2EQ3 A;  3K6Q A;  4X62 I;  3LTO A;  4DR7 I;  2M9A A;  4ZYE A;  5DRR A;  1MU5 A;  2NN6 E;  4IZJ B;  1EA6 A;  2EL4 A;  5DNL A;  2ODR D;  5JEA C;  3BID A;  2EWL A;  4B3S E;  4KHP I;  1YPN A;  5LLQ A;  2X36 A;  2FV4 B;  4F6N A;  5C0X E;  1UN6 B;  3J80 Q;  1ZXM A;  2L6M A;  4WSG A;  4FK5 C;  1EH8 A;  1L4S A;  2PNL A;  4MLV A;  4URL A;  1AAY A;  1NHI A;  3QT7 A;  4FW4 A;  4LFB E;  1S4E A;  1YFH A;  2HFS A;  2EN6 A;  1XHK A;  1X47 A;  2VRD A;  4YHH E;  4JI4 I;  3F6G A;  5DNX A;  4B3S I;  4U3D A;  3HXL A;  1Z1B A;  4Z7C A;  2UUB E;  2JEA B;  3K85 A;  3ZKB A;  2WW4 A;  2NUF A;  2KOU A;  4LF7 E;  2YTJ A;  2UUC E;  4M9V C;  2NN6 F;  2RS7 A;  4BC9 A;  2A2D A;  1N3G A;  2YU8 A;  4WPY A;  1IBM E;  5A2Q Q;  4AIM A;  2PNM A;  4BC7 A;  4X65 E;  5C0X F;  2HJJ A;  4MU4 A;  1ELO A;  3JAM Q;  4M30 A;  2L33 A;  1J5E E;  4X8W A;  2N8X A;  2UUB I;  2XEX A;  2PRT A;  2YT4 A;  2EZ6 A;  2RQL A;  2EQ1 A;  4JI3 E;  4DUY E;  1YHC A;  2LE2 A;  1PJS A;  2C38 B;  2UUC I;  1X48 A;  3WU4 A;  1PJT A;  4DR6 I;  4WFT A;  2UXB I;  4JI1 E;  1IBM I;  3IWD A;  5IWA E;  2CTD A;  2JPA A;  3AUZ A;  1KIJ A;  2YTG A;  1H7S A;  4NXM I;  4BS9 A;  4X65 I;  3J7A M;  4JI2 E;  2LV2 A;  2NAB A;  1A6F A;  2C37 A;  1UDS A;  1NZ0 A;  3J80 C;  1J5E I;  2RSI A;  4NBQ A;  2ADR A;  3CDJ A;  2ENH A;  4DUY I;  1K47 A;  1QNT A;  4FWG A;  2GPI A;  5CFF E;  4IZK A;  4O4K A;  4JI1 I;  5BR8 E;  1YYW A;  4DV1 E;  5IWA I;  5DRQ A;  2I13 A;  5EL9 A;  2EMW A;  1YUJ A;  2CZ9 A;  2E72 A;  1MEY C;  3ZM7 A;  2ELY A;  4JI2 I;  5AC4 A;  3MHH C;  4LOM A;  4OO1 B;  3THN A;  3M6A A;  1N34 E;  4GZN C;  5C0X A;  5DRO A;  2ZM6 I;  1PKP A;  5JEA B;  4BA1 B;  1G2F C;  2L2K B;  4F9B B;  1EKZ A;  5A2Q C;  2HFU A;  2BA1 D;  2ZBK B;  5KL2 A;  1KKH A;  3QT8 A;  2HC5 A;  3JTZ A;  4R8O A;  5BR8 I;  1X6E A;  2YRH A;  4JV5 E;  4LU9 A;  3JAM C;  1HNZ I;  4DV7 E;  1Z5A A;  1PDA A;  1I94 E;  3OML A;  2EN8 A;  2FGG A;  2C39 A;  4JYA I;  3B4T A;  3BGH A;  2NUG A;  3FIG A;  4MU0 A;  2L3J A;  2YTQ A;  1JK1 A;  2H36 X;  3PYE A;  4FW7 A;  1F2I G;  4F54 A;  4IS9 A;  1ZXN A;  3IWB A;  2UXD E;  2DLK A;  2LJP A;  2BR2 A;  4MYT A;  2EPN A;  4WYQ B;  5LL6 R;  1OYS A;  2VF3 A;  2EML A;  4U3B A;  2EL6 A;  2CT1 A;  2L3C A;  2JE6 A;  3F0N A;  1HR0 I;  3L7Z B;  4P52 A;  2ENC A;  4DV7 I;  1N0V C;  1R6L A;  1I94 I;  2VE7 C;  1WJP A;  4TUG A;  2EPU A;  3LML A;  1USV A;  3GCM A;  4PRX A;  3QG5 C;  1P47 A;  4LF8 E;  4DR4 I;  3BF2 A;  4JI6 I;  2D9H A;  3VYY A;  2YTE A;  3HPZ A;  4B3T E;  1UDQ A;  2UXD I;  2EN7 A;  1XMO E;  2Q2E B;  3DF6 A;  4KQV A;  3KZY A;  4EMD A;  1U2R A;  4ZYG A;  4IFD B;  2EFG A;  4R03 A;  4DR3 E;  1Z0E A;  2Z5B B;  1TF6 A;  3CDI A;  2E1R A;  5AC5 A;  2UUA I;  2EPA A;  2VES A;  4LF6 E;  3NZK A;  5K36 B;  2KON A;  2JWO A;  4LF8 I;  5TSE A;  4KWY A;  4BMJ A;  2HK3 A;  2WNR A;  4B3T I;  4M2Z A;  1XMO I;  3JU0 A;  2EM2 A;  2EPX A;  2EOI A;  2O1V A;  1STU A;  1EH7 A;  1UEK A;  4DPT A;  2HGH A;  2LVH A;  4DV6 I;  2EM6 A;  2PNZ A;  4DR3 I;  4LCF A;  4DMI A;  2YPN A;  4QNK A;  4MU3 A;  1BBG A;  1T4L B;  4XTJ A;  3J81 Q;  4JI0 E;  2YRK A;  4LF6 I;  4OO1 C;  2JOB A;  4DUZ E;  4BA2 B;  5A6K A;  3B8H A;  5LMN I;  2ENA A;  3C6K A;  4R2R A;  3QT5 A;  4R2C A;  2WBT A;  2WP8 A;  3F6H A;  4DKK A;  1Z0B A;  1FI4 A;  2YRM A;  1NEI A;  2JEB B;  1QU6 A;  2EM8 A;  4OZE A;  2J7J A;  2N3H A;  3H09 A;  1OYP A;  4R2S A;  1UDO A;  1J26 A;  1NHJ A;  2MC6 A;  2PO2 B;  3HTX A;  3L00 A;  4O5G A;  3ZZT A;  5FWK A;  1A1L A;  4DPX A;  2EOY A;  2M7Q A;  4DU8 A;  4Q28 A;  1YZ9 A;  1T4O A;  1Z0W A;  3ECR A;  4HEI A;  4IZJ D;  2RS6 A;  2JEA A;  4L8N A;  1RQ0 A;  4DV4 E;  4HY1 A;  4N4R B;  3KWR A;  2LO3 A;  4DV3 E;  2UXC E;  3EPH A;  3Q6M A;  3PS2 A;  4O24 A;  1Z59 A;  3K1J A;  3MHS C;  1G2D C;  2CSH A;  4AM3 A;  3B82 A;  4B3R E;  1XXE A;  4LFB I;  5A6B A;  2F4V E;  1N0U A;  2K4V A;  4YHH I;  5JEA F;  5F3W A;  2EPP A;  2EOO A;  2FTX B;  3HQ1 A;  5AE2 A;  1OJ4 A;  2L2M A;  3ADG A;  1UBD C;  5AE1 A;  3ZKD A;  4DV4 I;  3J81 C; 
#chains in the Genus database with same CATH homology
 2RSM A;  5LMU E;  3Q1Q A;  4DPU A;  4DV3 I;  2UXC I;  3ZZU A;  4LF7 I;  4USK A;  4DPW A;  4UT4 A;  4B3R I;  1Z0T A;  2F4V I;  1FNM A;  4WUB A;  4I3H A;  2V8P A;  1ZM2 A;  4M1K A;  4DR2 E;  1ZM3 A;  3T1Y E;  2B7T A;  4AQY E;  5LMU I;  4JI7 E;  1Z0G A;  4JI3 I;  2DEJ A;  1D6T A;  5ADZ A;  4NXN E;  2O1T A;  3P06 A;  2JOX A;  4HXZ A;  3PYG A;  4LTY A;  4B3M E;  4DV0 E;  2M4I A;  2OI2 A;  3T1Y I;  3RMP A;  4AQY I;  2V86 A;  1B62 A;  4Z7Y A;  4JI7 I;  1N32 E;  3MSW A;  4YY3 E;  4HYM A;  4LFA E;  3OTO E;  4X64 E;  5L3J A;  4DV1 I;  1WXR A;  1H7U A;  3DJW A;  4B3M I;  3Q6N A;  4PU9 A;  1N34 I;  4LFC E;  4FN5 A;  5FLX Q;  4P7A A;  3WU6 A;  2CPN A;  1FKA E;  3J7Y p;  2V2V A;  1HNW E;  4X64 I;  1PIE A;  3OTO I;  4JV5 I;  4LF9 E;  3QT6 A;  4L5N C;  4FWH A;  1RRE A;  1QZR A;  2Z5E A;  2E5L E;  1N36 E;  1Z0V A;  3ADJ A;  2MC5 A;  4DR5 E;  2Z5C B;  4JI8 E;  4LFC I;  4OOG C;  2KHX A;  4TUI A;  1GZ6 A;  2VF1 A;  1BKN A;  2V34 A;  2Z5B A;  3PRY A;  3ZZ0 A;  4F9A B;  2X7I A;  2DMY A;  4DV5 E;  4HAC B;  2E5L I;  4R1F A;  1NHH A;  1DAR A;  2BM1 A;  2R3V A;  2L2N A;  3WU3 A;  4DR5 I;  2HK2 A;  4WUD A;  5GMD A;  2J7K A;  4DR1 E;  2DB2 A;  4P78 A;  2JY9 A;  4UTG A;  1PVG A;  4ED4 A;  5FLX C;  2DEI A;  4BBY A;  5DNY A;  4IZJ A;  1H73 A;  3PYF A;  4BCA A;  2LUQ A;  3LLH A;  4KZS A;  5AE3 A;  1XNQ E;  5AAS A;  4X62 E;  2HKE A;  2CG9 A;  3HJC A;  2L8T A;  1FWK A;  3V5R A;  4DPY A;  4RPF A;  2LUP B;  4FWD A;  1HK7 A;  2GS8 A;  4MYU A;  4JI0 I;  2NA2 A;  4DXL A;  2N3G A;  1YYK A;  2VQF E;  1FWL A;  4DUZ I;  1Z5B A;  1XNQ I;  1DI2 A;  4P7D A;  2M1S A;  2A2C A;  2V2Q A;  4USM A;  2B7V A;  1WUU A;  1SR9 A;  5T6J A;  1IBL E;  4JI4 E;  5GME A;  2V88 A;  2ZIT A;  1HR0 E;  1Y6Z A;  1FJG E;  2YZT A;  4FW9 A;  1X49 A;  2VQF I;  2NUE A;  1T4N A;  2V85 A;  4JI5 E;  3HUL A;  1MG7 A;  1IBL I;  1ZBQ A;  2NPF A;  3GON A;  2DIX A;  3V2U C;  4J8Z A;  1Z5C A;  1HR0 I;  1XMQ E;  1FJG I;  2IHR 1;  4GKJ E;  2IOQ A;  3T1H E;  2V89 A;  2CGE A;  4DR6 E;  4WSP A;  2UXB E;  4EMD A;  4X66 E;  1MX0 A;  3J7A G;  2O1U A;  3WU5 A;  4JI5 I;  4NXM E;  3ZOQ B;  2V2Z A;  1HNX E;  1XMQ I;  4GKJ I;  3T1H I;  4GKK E;  4M0V A;  3K17 A;  5IT9 Q;  1Y4S A;  4LF5 E;  2BV3 A;  3P1X A;  1H72 C;  4X66 I;  4DR2 I;  1XNR E;  2HKJ A;  2JR1 A;  1YYO A;  2UU9 E;  1N33 E;  1GQE A;  3AV0 A;  1WHQ A;  3PYD A;  3ADL A;  2ODR C;  1S16 A;  1HNX I;  2B9D A;  4K0K E;  1WHN A;  4LF4 E;  1B63 A;  2ZM6 E;  3C4T A;  4NXN I;  4GKK I;  2V83 A;  2LRS A;  2O1W A;  2V87 A;  4LF5 I;  3B78 A;  3H4L A;  1HNZ E;  1XNR I;  4DV0 I;  4IZK B;  2UU9 I;  1N33 I;  4I8O A;  2GQ0 A;  4F9C B;  1UHZ A;  4JYA E;  1N32 I;  4PRV A;  4LF4 I;  4YY3 I;  4K0K I;  4LFA I;  2E1M A;  1H74 A;  3ADI A;  4OX9 E;  1ZM9 A;  4ZVI A;  2HHH E;  1DQ3 A;  3VYX A;  2LBS B;  2JVA A;  2MDR A;  3CWV A;  1IBK E;  2Z5C A;  2G7H A;  2LTR A;  4DV2 E;  2WZO A;  3LPS A;  4DU7 A;  3LNU A;  2LMZ A;  5IT9 C;  4DR4 E;  1HNW I;  4JI6 E;  4OX9 I;  4LF9 I;  4HAC A;  2HHH I;  3HPS A;  1N36 I;  4N3O A;  2IOP A;  1IBK I;  1UIL A;  4JI8 I;  4DV2 I;  2BM0 A;  2LTS A;  2UUA E;  1KVK A;  2F8B A;  1RC7 A;  2LJH A;  4DV5 I;  2VQE E;  1Y4U A;  4WUC A;  3D4J A;  4DV6 E;  1ZM4 A;  2V8Q B;  1USU A;  1KTV A;  2RTX A;  4GEQ B;  4DR1 I;  4JG4 A;  3C4B A;  2R42 A;  4DR7 E;  1RR9 A;  5LMN E;  1VIS A;  1Z0C A;  2DSY A;  1O0W A;  4KHP E;  1EI1 A;  2AJ4 A;  2VQE I;  2B3T B;  3IWC A;  3VK6 A;  1ZBT A;  2L92 A;  3K6Q A;  4X62 I;  3LTO A;  4DR7 I;  1MU5 A;  4IZJ B;  1EA6 A;  2ODR D;  2EWL A;  4B3S E;  4KHP I;  2X36 A;  2FV4 B;  3J80 Q;  1ZXM A;  2L6M A;  2PNL A;  4URL A;  1NHI A;  3QT7 A;  4LFB E;  1S4E A;  2HFS A;  1XHK A;  1X47 A;  4YHH E;  4JI4 I;  3F6G A;  4B3S I;  3HXL A;  4Z7C A;  2UUB E;  3K85 A;  3ZKB A;  2WW4 A;  2NUF A;  2KOU A;  4LF7 E;  2UUC E;  2RS7 A;  4BC9 A;  2A2D A;  4WPY A;  1IBM E;  5A2Q Q;  2PNM A;  4BC7 A;  4X65 E;  3JAM Q;  1ELO A;  4M30 A;  2L33 A;  1J5E E;  4X8W A;  2UUB I;  2XEX A;  2YT4 A;  2EZ6 A;  4JI3 E;  4DUY E;  2LE2 A;  2UUC I;  1X48 A;  3WU4 A;  4DR6 I;  2UXB I;  4WFT A;  4JI1 E;  1IBM I;  3IWD A;  5IWA E;  3AUZ A;  1KIJ A;  1H7S A;  4NXM I;  3J7A M;  4BS9 A;  4X65 I;  4JI2 E;  1A6F A;  1NZ0 A;  3J80 C;  1J5E I;  4DUY I;  1K47 A;  4FWG A;  5CFF E;  4IZK A;  4JI1 I;  5BR8 E;  1YYW A;  4DV1 E;  5IWA I;  2CZ9 A;  4JI2 I;  3ZM7 A;  3M6A A;  1N34 E;  2ZM6 I;  1PKP A;  2L2K B;  4F9B B;  1EKZ A;  5A2Q C;  2HFU A;  2ZBK B;  1KKH A;  3QT8 A;  3JTZ A;  4R8O A;  5BR8 I;  1HNZ I;  4JV5 E;  4LU9 A;  3JAM C;  4DV7 E;  1Z5A A;  1I94 E;  3OML A;  2FGG A;  4JYA I;  2NUG A;  3FIG A;  2L3J A;  3PYE A;  2H36 X;  4F54 A;  1ZXN A;  3IWB A;  2UXD E;  2LJP A;  4MYT A;  4WYQ B;  5LL6 R;  2VF3 A;  2L3C A;  3F0N A;  4DV7 I;  4P52 A;  1N0V C;  1I94 I;  2VE7 C;  4TUG A;  3LML A;  1USV A;  4PRX A;  4LF8 E;  4DR4 I;  4JI6 I;  3VYY A;  4B3T E;  3HPZ A;  2UXD I;  1XMO E;  2Q2E B;  3DF6 A;  4KQV A;  1U2R A;  2EFG A;  4R03 A;  4DR3 E;  1Z0E A;  2Z5B B;  2E1R A;  2UUA I;  4LF6 E;  2KON A;  2JWO A;  4LF8 I;  4BMJ A;  2HK3 A;  4B3T I;  4M2Z A;  1XMO I;  3JU0 A;  2O1V A;  1STU A;  1UEK A;  4DPT A;  4DV6 I;  4DR3 I;  4DMI A;  3J81 Q;  4XTJ A;  1T4L B;  4JI0 E;  4LF6 I;  2JOB A;  4DUZ E;  3B8H A;  5LMN I;  3QT5 A;  3F6H A;  4DKK A;  1Z0B A;  1FI4 A;  1QU6 A;  2N3H A;  3H09 A;  1J26 A;  1NHJ A;  2MC6 A;  3HTX A;  3ZZT A;  5FWK A;  4DPX A;  2M7Q A;  4DU8 A;  4Q28 A;  1YZ9 A;  1T4O A;  1Z0W A;  4IZJ D;  2RS6 A;  4L8N A;  1RQ0 A;  4DV4 E;  4HY1 A;  3KWR A;  3Q6M A;  4DV3 E;  2UXC E;  1Z59 A;  3K1J A;  3B82 A;  4B3R E;  4LFB I;  2F4V E;  1N0U A;  2K4V A;  4YHH I;  5F3W A;  2FTX B;  3HQ1 A;  5AE2 A;  1OJ4 A;  2L2M A;  3ADG A;  5AE1 A;  3ZKD A;  4DV4 I;  3J81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...