4AQYE

Structure of ribosome-apramycin complexes
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4aqyE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4aqyE02
3PYGA 4X8WA 4DV7I 4JI1I 4LF8I 1DI2A 3ZKBA 2E5LE 1H74A 1HNZI 2B7VA 2DIXA 4B3TE 4DV2E 1PIEA 2LUPB 1N32I 5IT9Q 2OI2A 4GKJE 2ZBKB 2L2NA 4DR7I 1N0UA 4DR6I 2F4VE 1MG7A 4USMA 4JI7E 1YZ9A 4YY3E 1WHQA 2L2MA 4HXZA 1FI4A 1QZRA 3PYEA 1WHNA 4GKKI 1BKNA 1H73A 3PYFA 4LFAE 2L3CA 1Z59A 2B3TB 3ADLA 4HY1A 1XHKA 4PRVA 2HK2A 2MDRA 4P7AA 4DV7E 4LF8E 2HKJA 4UTGA 1FKAE 5A2QQ 2LRSA 3J80Q 1KKHA 1NHIA 2L3JA 1H7UA 2HKEA 3QT7A 1XNQI 2UXBI 4DR7E 1HNWE 4DV3I 1KTVA 4NXMI 3T1YI 2ZM6I 1DARA 4HACA 3ADIA 4X64E 3OTOI 2V34A 4FN5A 4DV1E 4LF7E 3CWVA 1HNXE 1X49A 1O0WA 4OX9I 3VYYA 1IBKE 2A2DA 4NXNE 1ELOA 3B82A 2IHR1 4WYQB 4DPWA 4DUYI 4DV4E 4JI0I 2UUAI 4LFBE 1J26A 2RS7A 4JI6E 3T1HE 4DPTA 1RR9A 4X65I 2UU9I 1I94I 4ZVIA 1EKZA 1HR0E 1RC7A 1S4EA 3B8HA 4LF4I 2Q2EB 4JI2I 2R42A 4YHHI 1XMQI 3Q1QA 3ZM7A 5LMUI 4DV5E 4DV3E 2UUBI 2EZ6A 4FW9A 4LF6E 1ZM9A 4JI5I 4B3RI 1EI1A 1Z0BA 2VQFI 4WFTA 5BR8E 5GMDA 1FJGE 2EFGA 1D6TA 2A2CA 3ZZ0A 3GONA 4K0KI 4DUYE 1N0VC 2UXCE 4DR5I 1XMOI 4DR1I 1H7SA 3JAMC 2N3GA 4DV0I 4ED4A 1STUA 2UU9E 1I94E 4DV6E 1ZXMA 4X62I 2NUGA 1NHHA 3J81Q 1J5EI 5LMNE 3V5RA 4JI3E 1Z5CA 2BM1A 1IBLE 4JI4E 2R3VA 4HACB 3WU6A 4B3SI 4LF5I 1Z0TA 2X36A 4JV5I 1EA6A 4B3RE 4UT4A 1YYWA 4B3MI 1Z0WA 1N34E 1ZM4A 4DPXA 3LLHA 4JI1E 2NA2A 3H4LA 1ZBTA 2HK3A 2HHHI 1XMOE 1HNZE 1MU5A 1ZM2A 4JI8I 1IBMI 2V2VA 1U2RA 1N32E 1N33I 1H72C 1Z5BA 2UXDI 2UUCI 3ZKDA 1J5EE 3ZZUA 5CFFE 4DR6E 2LBSB 1QU6A 2DEJA 3JAMQ 5FLXC 2NUFA 2CPNA 4LFCI 4X66I 3LNUA 1YYOA 1B63A 4B3SE 4LF5E 3PYDA 2L2KB 4GKKE 5IWAI 4DR3I 4M1KA 4DUZI 3QT6A 1N36I 2DEIA 2ZITA 1UHZA 5GMEA 2DB2A 4OOGC 1MX0A 4I3HA 1FNMA 1Z0CA 3D4JA 4FWHA 1N33E 2UXDE 4DXLA 2UUCE 1XNQE 2UXBE 1T4LB 5IT9C 2N3HA 2LTRA 2RTXA 4NXME 3T1YE 2ZM6E 3J7AG 1Z0VA 3P1XA 4HYMA 4R1FA 3OTOE 4B3TI 1WUUA 3V2UC 1KVKA 2V2QA 4X66E 2X7IA 4GKJI 3LPSA 4OX9E 3M6AA 1OJ4A 1NZ0A 2F4VI 4DUZE 4JG4A 2V8PA 4XTJA 3ZZTA 4JI0E 2UUAE 1Z0GA 4JI7I 2LJPA 4YY3I 1YYKA 4DU7A 2KHXA 4X65E 2HFSA 1X48A 1UILA 4LFAI 5A2QC 1ZM3A 4FWGA 4LF4E 4JI2E 4YHHE 2LTSA 4DR4I 1XMQE 2BV3A 4DKKA 4EMDA 5LMUE 2UUBE 2XEXA 1RREA 3J7Yp 2B7TA 2JY9A 3LTOA 3F0NA 4JYAI 4JI5E 2VQFE 2NUEA 3C4BA 1HNWI 1GQEA 1S16A 4DU8A 4K0KE 2DMYA 4X64I 4DV1I 1FWKA 4LF7I 4DR5E 1T4NA 5L3JA 4DR1E 1HNXI 4KHPI 3HULA 1IBKI 4NXNI 4DV0E 1PVGA 2RS6A 1Z0EA 3WU5A 2RSMA 4WUBA 4LF9I 3C4TA 4X62E 4DV4I 4DR4E 4LFBI 4JI6I 3T1HI 4USKA 3QT5A 4Z7YA 3K1JA 2LJHA 1XNRI 2NPFA 1HR0I 3J7AM 4JV5E 4JYAE 2V2ZA 4B3ME 4DV5I 2VQEI 4DR2I 1KIJA 4AQYI 4DPUA 3WU4A 4M2ZA 1B62A 4LF6I 3ADGA 1Z5AA 2AJ4A 2HFUA 2HHHE 4KHPE 2JVAA 4JI8E 1PKPA 1IBME 3K17A 4Z7CA 5BR8I 2WW4A 1FJGI 1A6FA 2VF3A 2LUQA 4PU9A 4P52A 4LF9E 2YT4A 1FWLA 3HTXA 2UXCI 3J81C 1RQ0A 2E5LI 4M30A 4DPYA 1X47A 3ADJA 4URLA 4DV2I 4LFCE 2CZ9A 1XNRE 4FWDA 4DV6I 5IWAE 1T4OA 5FLXQ 4PRXA 5LL6R 5LMNI 2E1RA 2GS8A 4DR3E 1N36E 4JI3I 4MYTA 2VQEE 4DR2E 4RPFA 4AQYE 2L33A 1VISA 1IBLI 3WU3A 4JI4I 4MYUA 1K47A 1UEKA 3QT8A 1NHJA 3VYXA 1ZXNA 4KQVA 4WUDA 4WUCA 1N34I 2BM0A 3B78A 3J80C 2J7KA
chains in the Genus database with same CATH superfamily
2BB8A 4GZNC 2CGEA 2EMKA 1MEYC 3EPLA 3THNA 3PYGA 4X8WA 4DV7I 4JI1I 2EQ0A 1DI2A 4LF8I 2E1MA 3ZKBA 1Z1BA 1JK2A 2O3ZA 2E5LE 1H74A 2Z5CB 1HNZI 2B7VA 2LV2A 4FK5C 2DIXA 2EM8A 4DV2E 4B3TE 1PJSA 1PIEA 2LUPB 1N32I 5IT9Q 2OI2A 4GKJE 2ZBKB 2ELZA 2O1UA 2D9HA 2L2NA 3P3CA 4MDTA 4DR7I 4F9AB 3UK3C 5JEAB 2V85A 1OYPA 4AM3A 1N0UA 4DR6I 2F4VE 4IZJA 5FLXQ 1IMUA 5C0XA 1DQ3A 1MG7A 1A1FA 4USMA 3AUZA 4WSPA 2DRPA 2VF1A 2GLIA 5IXMB 4MLQA 4JI7E 1YZ9A 2CT1A 4YY3E 5K36A 1WHQA 2L2MA 4HXZA 3IWCA 4R2AA 2EMAA 4M9VC 1FI4A 1QZRA 3PYEA 4O4KA 1WHNA 4U3BA 4GKKI 1BKNA 1H73A 3PYFA 2M4IA 2EPMX 4LFAE 5KL4A 2L3CA 2NABA 4NZVA 5A69A 1Z59A 2B3TB 2E72A 5KL3A 3ADLA 1XHKA 2WNRB 4HY1A 1T39A 3P06A 3IWDA 4PRVA 1LLMC 1GZ6A 2HK2A 2Z5CA 4P7DA 4OO1D 5FWKA 2NN6D 2EOEA 2MDRA 1Y4SA 4P7AA 4DV7E 3C6MA 3DJWA 5IV8B 4LF8E 2HKJA 1A1HA 4UTGA 5A6KA 1T38A 1FKAE 5A2QQ 2ODRD 2YSPA 1ZU1A 5C0XE 2EMGA 1UDNA 2LRSA 3J80Q 4BCAA 5JEAA 1KKHA 3IWBA 2YTGA 3EPHA 1NHIA 2L3JA 2EPXA 1H7UA 2DMIA 1PDAA 4HEIA 2HKEA 3QT7A 5AC5A 2YTOA 5K36E 1XNQI 2UXBI 2L92A 4DR7E 1HNWE 1GTKA 4DV3I 1KTVA 2ENAA 4NXMI 3T1YI 2VESA 2ZM6I 2WP8A 1DARA 4HACA 4N3OA 1ZAAC 3HPSA 3ADIA 4IFDE 1Y5YA 4X64E 3OTOI 2V34A 4FN5A 4DV1E 4R8OA 3F6GA 4LF7E 3CWVA 3GLLA 4GEQB 2EPOA 3RMPA 4F6NA 4OO1C 2HC5A 1HNXE 1X49A 2NN6C 4BA2B 2N8XA 4ZYHA 1O0WA 4OX9I 3VYYA 1RMDA 1IQOA 2RQLA 2WNRA 3BGHA 1IBKE 5LLQA 4N4RB 4NXNE 1ELOA 2VRDA 2A2DA 3B82A 2IHR1 2M1SA 2BA0D 2EPNA 4WYQB 2KONA 1A1LA 1AAYA 4DPWA 5JEAE 1UBDC 2C38B 4DUYI 2EOIA 4DV4E 4JI0I 2UUAI 4DMIA 2V89A 4LFBE 1J26A 2RS7A 3F6HA 4JI6E 3T1HE 5C0XF 5A6BA 2M9AA 3HJCA 3Q6MA 3PRYA 2O1WA 4DPTA 2EM2A 3H09A 2C39A 1RR9A 2EQ1A 4X65I 5EL9A 2UU9I 1I94I 4ZVIA 1EKZA 4BMJA 5K36F 1HR0E 1RC7A 1S4EA 3B8HA 1UDOA 1DGCA 2YTFA 4LF4I 2Q2EB 4JI2I 2V87A 2JOXA 2R42A 4X9JA 4YHHI 1XMQI 3ZM7A 2PO1B 3Q1QA 1R6MA 2CG9A 3L7ZB 2M7QA 2WBSA 5LMUI 4DV5E 4DV3E 2UUBI 2EZ6A 2J7KA 4IFDF 2RSIA 4FW9A 2YU8A 1A1KA 3Q6NA 4BA2A 4IZJB 1N3GA 2EMYA 4LF6E 3DF6A 2JE6B 2PNZB 4BC7A 1ZM9A 4JI5I 4B3RI 4BHCA 1EI1A 1Z0BA 2VQFI 4WFTA 2C37A 5BR8E 2BR2B 2C38A 5GMDA 5JEAF 4OZEA 5K36B 2VE7C 3U1YA 1FJGE 3ZZUA 1YHCA 4FW6A 2K4VA 2EFGA 2EPKX 5EKWA 1D6TA 2JEBB 3C6KA 2A2CA 2GO4A 3ZZ0A 2EMHA 3GONA 3PS3A 2BA0G 4K0KI 4DUYE 3B4TA 1N0VC 1USUA 3ZOQB 1TF3A 4IFDB 2WBUA 2UXCE 4DR5I 1XMOI 2ELYA 4DR1I 1H7SA 3JTZA 2N3GA 3HQ1A 3JAMC 5DNLA 2MC5A 4DV0I 4I8OA 2LCEA 4IJDA 4ED4A 2PO1A 4O24A 2YPNA 1STUA 3BF2A 1YPNA 3ECRA 4DV6E 2GPIA 1I94E 2UU9E 1YH8A 1ZXMA 3L7ZA 4F54A 1R6LA 5KL5A 4MU0A 2EPRA 4NBQA 4X62I 2NUGA 1HK7A 1NHHA 3J81Q 1J5EI 5LMNE 2V8QB 2JXPA 3V5RA 4JI3E 2JE6A 2CTDA 2PNZA 2EL4A 2EMXA 4Q35B 1Z5CA 3BBGA 2BM1A 1IBLE 2PO2B 2V86A 4BHBA 4JI4E 2PO0B 5ADZA 2EPUA 4P78A 2R3VA 2WP8B 2EMZA 2JEAA 2BR2A 4HACB 5DRPA 3WU6A 2YRHA 4B3SI 5AE2A 4IZJD 1Z0TA 2X36A 4LF5I 4JV5I 5C0XD 2Z5EA 3AV0A 1EA6A 4B3RE 4BA1B 1EH6A 1VI7A 2JEBA 1YYWA 3KRNA 4UT4A 2F8BA 1Z0WA 4B3MI 2O1TA 5A6AA 4IFDA 2GO3A 1N34E 5K36D 4R2RA 5AE1A 1ZM4A 3M7ND 4J8ZA 4ISAA 1EH8A 3P3GA 2EPPA 3LLHA 4JI1E 2JPAA 4DPXA 1G2FC 2NA2A 3VK6A 3H4LA 1ZBTA 4F2JC 2HK3A 2PRTA 1XMOE 1HNZE 2HHHI 1MU5A 1ZM2A 2H36X 4JI8I 2WBTA 4MU4A 1IBMI 5AC4A 4O43A 2LT7A 2V2VA 3U1KA 2C39B 1U2RA 2EM4A 1NCSA 1N32E 1N33I 1H72C 1Z5BA 2UXDI 1EH7A 2UUCI 3ZKDA 2IOQA 4QNJA 5T6JA 2PO2A 1J5EE 3HXLA 5CFFE 2EOHA 2LBSB 1QU6A 2LO3A 4DR6E 2DEJA 2PO0A 2I13A 5JEAD 4BC9A 3JAMQ 5FLXC 2LVHA 2EPAA 1ZBQA 2FTXB 3TQMA 2NUFA 2CPNA 4F9CB 2DLKA 2YRMA 2EL6A 4BA1A 2R1FA 4LFCI 2YTJA 3KZYA 4IZKB 4X66I 3LNUA 1YYOA 1F2IG 1B63A 4M0VA 4WXCA 1A1JA 4B3SE 2L2KB 4LF5E 3PYDA 1Y4UA 4GKKE 4LOMA 5IWAI 2ODRC 4F6MA 4ZYDA 3DD6A 4DR3I 2PNMA 4M1KA 4DUZI 3QT6A 1N36I 2DEIA 3FIGA 2C37B 4FW4A 5DRQA 2NN6E 2DLQA 2I9IA 2ENCA 2ZITA 1UHZA 1PJQA 1YUJA 2LJUA 2PNLA 5GMEA 4R03A 4TUIA 2DB2A 2EMWA 3B78A 3M7NG 2V88A 4OOGC 2IESA 3JU0A 1L4SA 2EM9A 2EMBA 4HTGA 1MX0A 1P42A 2GHFA 2EM5A 4I3HA 1FNMA 2HJJA 3M85D 4R2EA 1Z0CA 1X6EA 1G2DC 3D4JA 4FWHA 2EN4A 5A6BD 2J7JA 2RPCA 4WPYA 1N33E 2UXDE 2EM3A 4DXLA 2UUCE 1ZR9A 1XNQE 2UXBE 5IT9C 1T4LB 2N3HA 2EPZA 2LTRA 2RTXA 4NXME 3T1YE 2CVEA 2ZM6E 2BA1D 2EP3A 3J7AG 4IZKA 1Z0VA 2YTEA 3P1XA 2MKNA 2JYAA 2EOFA 4HYMA 4LCHA 4R1FA 2FGGA 2EOYA 3HPZA 3OTOE 4B3TI 5KL6A 1WUUA 1WXRA 3P3EA 3V2UC 1KVKA 2V2QA 4BS9A 4X66E 2X7IA 3QG5C 4GKJI 1RHYA 3LPSA 2YTQA 4OX9E 3M6AA 2JEAB 2IOPA 1OJ4A 1NZ0A 4OO1F 2NN6F 2F4VI 2Z5BB 4DUZE 4QNKA 2EOXA 4JG4A 4MU3A 2V8PA 3L00A 2EWLA 4XTJA 1UN6B 3BIDA 4BBYA 3ZZTA 4JI0E 3K85A 2UUAE 2BBGA 4MLVA 1Z0GA 3PS1A 4JI7I 2LJPA 2EOSA 4YY3I 2EOZA 1X5WA 1YYKA 4DU7A 3CDIA 2KHXA 4X65E 2HFSA 2EMLA 2EM0A 1SR9A 1X48A 1UILA 2CSHA 4LFAI 4WSGA 4RH8A 5A2QC 1ZM3A 4FWGA 4LF4E 3M85G 4OO1B 4JI2E 4L5NC 5KL2A 2NN6B 4YHHE 2EORA 2LTSA 3MHHC 1XMQE 1P47A 2BV3A 4DKKA 2F1DA 4DR4I 3GCMA 1USVA 4EMDA 5LMUE 3VHTB 3EPJA 2UUBE 2EJ4A 2GQ0A 1PJTA 2YTDA 1BB8A 4WX9A 2EOJA 1B69A 1TF6A 4R2PA 1RREA 2XEXA 3J7Yp 4LTYA 4LPFA 2B7TA 5DROA 1MGTA 2BA1G 1X3CA 3GMEA 4O5GA 2JY9A 1X6FA 3LTOA 1BBOA 2EN3A 3F0NA 4JYAI 2Z5BA 4JI5E 2EN8A 2IERA 1E3HA 2VQFE 3MHSC 2NUEA 1IQSA 5DNYA 2BM0A 1Y60A 3C4BA 1HNWI 1TN9A 1WRJA 2EPCA 1XXEA 2MDGA 1GQEA 1S16A 1AH5A 4DU8A 4R2CA 4LCGA 2L8TA 2K7IA 4K0KE 2JR1A 2DMYA 4X64I 2DSYA 2L6MA 2V83A 4L8NA 1FWKA 2MKDA 4J3DA 4DR5E 2J65A 4DV1I 4LF7I 1T4NA 2MC6A 1KJKA 1QNTA 1YUIA 1E3PA 4DR1E 5L3JA 1HNXI 4IFDD 4KHPI 2EN6A 2WCC3 3HULA 4OO1A 1IBKI 2NN6A 4NXNI 4DV0E 1PVGA 2YTNA 3M99B 2A25A 2RS6A 1OYSA 4R2DA 2R76A 2YRKA 2JWOA 4TUGA 2RSMA 1Z0EA 4R2SA 1KYQA 4WUBA 3UHMA 3WU5A 5C0XC 4LF9I 3C4TA 4X62E 2EQ3A 4DV4I 4DR4E 2EM6A 1NEIA 4LFBI 2G7HA 3T1HI 4JI6I 1UDQA 2JP9A 3NZKA 3QT5A 4USKA 5TSEA 4Z7YA 5K36C 4U3DA 2ADRA 4NHRA 2EMIA 2EE8A 5KL7A 2LJHA 2EOQA 3KWRA 5AASA 2O1VA 3K1JA 4OKGA 2NPFA 1XNRI 1HR0I 3J7AM 4JV5E 3H1CA 4JYAE 2KOUA 4F9BB 4R2QA 4FW3A 2V2ZA 4LCFA 2Q8UA 1UDSA 4IFDC 4AIDA 4B3ME 2EOOA 3K6QA 4DV5I 4OO1E 2VQEI 4DR2I 1KIJA 4AQYI 4MU1A 3P76A 4DPUA 2YSOA 4ZYGA 3WU4A 4M2ZA 1BBGA 1SFEA 2YTPA 2WZOA 1YFHA 1YSAC 4AIMA 4LF6I 3MSWA 3ADGA 2EN2A 1Z5AA 4RHBB 2FV4B 2AJ4A 2HFUA 2HGHA 2HHHE 5JEAC 2EMFA 1A1IA 4KHPE 2JVAA 4Q28A 1PKPA 4JI8E 5A6JA 1IBME 3K17A 4Z7CA 5BR8I 2WW4A 2EN7A 4MQYA 1FJGI 1WJPA 5AE3A 1A6FA 2VF3A 2LUQA 1A1GA 4KWYA 4PU9A 4P52A 4LU9A 4LF9E 3THOB 2YT4A 4IS9A 1X6HA 2LE2A 3KZZA 1FWLA 3HTXA 2UXCI 2EM7A 3J81C 1RQ0A 2JT2A 5F3WA 2E5LI 4M30A 1JK1A 4DPYA 2B9DA 4ZYEA 1X47A 2YTIA 3ADJA 4URLA 4DV2I 2AE8A 3EQ1A 4LFCE 2CZ9A 1XNRE 4FWDA 4DV6I 2EN1A 4FW5A 3LMLA 2EPLX 5IWAE 1T4OA 2DGCA 2YZTA 5LL6R 2YU5A 2E1RA 4PRXA 2GS8A 1OYRA 5LMNI 4DR3E 1N36E 2YWQA 4JI3I 4MYTA 2VQEE 4DR2E 4RPFA 4AQYE 5DNXA 4KZSA 3CDJA 2L33A 1VISA 5ELWA 1IBLI 3WU3A 4JI4I 4MYUA 1K47A 3EPKA 2EOMA 2EMCA 1Y6ZA 1UEKA 3HKMA 5C0XB 3QT8A 3OMLA 5DRRA 4IS1C 1NHJA 2ENHA 4WXDA 4FW7A 2LMZA 3PS2A 3VYXA 1ZXNA 4GQUA 4KQVA 4WUCA 4WUDA 1N34I 1B62A 2JOBA 3J80C 2EL5A
chains in the Genus database with same CATH topology
2CGEA 3PYGA 4X8WA 4DV7I 4JI1I 4LF8I 1DI2A 2E1MA 3ZKBA 2E5LE 1H74A 2Z5CB 1HNZI 2B7VA 2DIXA 4B3TE 4DV2E 1PIEA 2LUPB 1N32I 5IT9Q 2OI2A 4GKJE 2ZBKB 2O1UA 2L2NA 4DR7I 4F9AB 2V85A 1N0UA 4DR6I 2F4VE 4IZJA 1DQ3A 1MG7A 4USMA 3AUZA 4WSPA 2VF1A 4JI7E 1YZ9A 4YY3E 1WHQA 2L2MA 4HXZA 3IWCA 1FI4A 1QZRA 3PYEA 1WHNA 4GKKI 1BKNA 1H73A 3PYFA 2M4IA 4LFAE 2L3CA 1Z59A 2B3TB 3ADLA 4HY1A 1XHKA 3P06A 3IWDA 4PRVA 1GZ6A 2HK2A 2Z5CA 4P7DA 5FWKA 2MDRA 1Y4SA 4P7AA 4DV7E 3DJWA 4LF8E 2HKJA 4UTGA 1FKAE 5A2QQ 2ODRD 2LRSA 3J80Q 4BCAA 1KKHA 3IWBA 1NHIA 2L3JA 1H7UA 2HKEA 3QT7A 1XNQI 2UXBI 2L92A 4DR7E 1HNWE 4DV3I 1KTVA 4NXMI 3T1YI 2ZM6I 1DARA 4HACA 4N3OA 3HPSA 3ADIA 4X64E 3OTOI 2V34A 4FN5A 4DV1E 4R8OA 3F6GA 4LF7E 3CWVA 4GEQB 3RMPA 1HNXE 1X49A 1O0WA 4OX9I 3VYYA 1IBKE 2A2DA 4NXNE 1ELOA 3B82A 2IHR1 2M1SA 4WYQB 2KONA 4DPWA 4DUYI 4DV4E 4JI0I 2UUAI 4DMIA 2V89A 4LFBE 1J26A 2RS7A 3F6HA 4JI6E 3T1HE 3Q6MA 3PRYA 2O1WA 4DPTA 3H09A 1RR9A 4X65I 2UU9I 1I94I 4ZVIA 1EKZA 4BMJA 1HR0E 1RC7A 1S4EA 3B8HA 4LF4I 2Q2EB 4JI2I 2V87A 2JOXA 2R42A 4YHHI 1XMQI 3Q1QA 3ZM7A 2CG9A 2M7QA 5LMUI 4DV5E 4DV3E 2UUBI 2EZ6A 4FW9A 3Q6NA 4IZJB 4LF6E 3DF6A 4BC7A 1ZM9A 4JI5I 4B3RI 1EI1A 1Z0BA 2VQFI 4WFTA 5BR8E 5GMDA 2VE7C 1FJGE 2K4VA 2EFGA 1D6TA 2A2CA 3ZZ0A 3GONA 4K0KI 4DUYE 1N0VC 1USUA 3ZOQB 2UXCE 4DR5I 1XMOI 4DR1I 1H7SA 3JTZA 2N3GA 3HQ1A 3JAMC 2MC5A 4DV0I 4I8OA 4ED4A 1STUA 2UU9E 1I94E 4DV6E 1ZXMA 4F54A 4X62I 2NUGA 1HK7A 1NHHA 3J81Q 1J5EI 5LMNE 2V8QB 3V5RA 4JI3E 1Z5CA 2BM1A 1IBLE 2V86A 4JI4E 5ADZA 2R3VA 4P78A 4HACB 3WU6A 4B3SI 4LF5I 5AE2A 4IZJD 1Z0TA 2X36A 4JV5I 2Z5EA 3AV0A 1EA6A 4B3RE 4UT4A 1YYWA 4B3MI 2F8BA 1Z0WA 2O1TA 1N34E 5AE1A 1ZM4A 4J8ZA 4DPXA 3LLHA 4JI1E 2NA2A 3VK6A 3H4LA 1ZBTA 2HK3A 2HHHI 1XMOE 1HNZE 1MU5A 1ZM2A 2H36X 4JI8I 1IBMI 2V2VA 1U2RA 1N32E 1N33I 1H72C 1Z5BA 2UXDI 2UUCI 3ZKDA 2IOQA 5T6JA 1J5EE 3HXLA 5CFFE 4DR6E 2LBSB 1QU6A 3ZZUA 2DEJA 4BC9A 3JAMQ 5FLXC 1ZBQA 2FTXB 2NUFA 2CPNA 4F9CB 4LFCI 4X66I 4IZKB 3LNUA 1YYOA 1B63A 4M0VA 4B3SE 4LF5E 3PYDA 2L2KB 1Y4UA 4GKKE 5IWAI 2ODRC 4DR3I 2PNMA 4M1KA 4DUZI 3QT6A 1N36I 2DEIA 3FIGA 2ZITA 1UHZA 2PNLA 5GMEA 4R03A 4TUIA 2DB2A 3B78A 2V88A 4OOGC 3JU0A 1MX0A 4I3HA 1FNMA 1Z0CA 3D4JA 4FWHA 4WPYA 1N33E 2UXDE 4DXLA 2UUCE 1XNQE 2UXBE 5IT9C 1T4LB 2N3HA 2LTRA 2RTXA 4NXME 3T1YE 2ZM6E 3J7AG 4IZKA 1Z0VA 3P1XA 4HYMA 4R1FA 2FGGA 3HPZA 3OTOE 4B3TI 1WUUA 1WXRA 3V2UC 1KVKA 2V2QA 4BS9A 4X66E 2X7IA 4GKJI 3LPSA 4OX9E 3M6AA 2IOPA 1OJ4A 1NZ0A 2F4VI 2Z5BB 4DUZE 4JG4A 2V8PA 2EWLA 4XTJA 4BBYA 3ZZTA 4JI0E 3K85A 2UUAE 1Z0GA 4JI7I 2LJPA 4YY3I 1YYKA 4DU7A 2KHXA 4X65E 2HFSA 1SR9A 1X48A 1UILA 4LFAI 5A2QC 1ZM3A 4FWGA 4LF4E 4JI2E 4L5NC 4YHHE 2LTSA 4DR4I 1XMQE 2BV3A 4DKKA 1USVA 4EMDA 5LMUE 2UUBE 2GQ0A 3HJCA 2XEXA 1RREA 3J7Yp 4LTYA 2B7TA 2JY9A 3LTOA 3F0NA 4JYAI 2Z5BA 4JI5E 2VQFE 2NUEA 5DNYA 2BM0A 3C4BA 1HNWI 1GQEA 1S16A 4DU8A 2L8TA 4K0KE 2JR1A 2DMYA 4X64I 2DSYA 2L6MA 2V83A 4L8NA 1FWKA 4DV1I 4LF7I 4DR5E 1T4NA 2MC6A 5L3JA 4DR1E 1HNXI 4KHPI 3HULA 1IBKI 4NXNI 4DV0E 1PVGA 2RS6A 1Z0EA 2JWOA 4TUGA 2RSMA 4WUBA 3WU5A 4LF9I 3C4TA 4X62E 4DV4I 4DR4E 4LFBI 2G7HA 3T1HI 4JI6I 4USKA 3QT5A 4Z7YA 3K1JA 2O1VA 2LJHA 5AASA 3KWRA 1XNRI 2NPFA 1HR0I 3J7AM 4JV5E 4JYAE 2KOUA 4F9BB 2V2ZA 4B3ME 3K6QA 4DV5I 2VQEI 4DR2I 1KIJA 4AQYI 4DPUA 3WU4A 4M2ZA 2WZOA 4LF6I 3MSWA 3ADGA 1Z5AA 2FV4B 2AJ4A 2HFUA 2HHHE 4KHPE 2JVAA 4Q28A 1PKPA 4JI8E 1IBME 3K17A 4Z7CA 5BR8I 2WW4A 1FJGI 5AE3A 1A6FA 2VF3A 2LUQA 4PU9A 4P52A 4LU9A 4LF9E 2YT4A 2LE2A 1FWLA 3HTXA 2UXCI 3J81C 1RQ0A 2E5LI 5F3WA 4M30A 4DPYA 2B9DA 1X47A 3ADJA 4URLA 4DV2I 4LFCE 2CZ9A 1XNRE 4FWDA 4DV6I 3LMLA 5IWAE 1T4OA 5FLXQ 2YZTA 5LL6R 4PRXA 2E1RA 5LMNI 2GS8A 4DR3E 1N36E 4JI3I 4MYTA 2VQEE 4DR2E 4RPFA 4AQYE 4KZSA 2L33A 1VISA 1IBLI 3WU3A 4JI4I 4MYUA 1K47A 1Y6ZA 1UEKA 3QT8A 3OMLA 1NHJA 2LMZA 3VYXA 1ZXNA 4KQVA 4WUDA 4WUCA 1N34I 1B62A 2JOBA 3J80C 2J7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYG A;  4X8W A;  4DV7 I;  4JI1 I;  4LF8 I;  1DI2 A;  3ZKB A;  2E5L E;  1H74 A;  1HNZ I;  2B7V A;  2DIX A;  4B3T E;  4DV2 E;  1PIE A;  2LUP B;  1N32 I;  5IT9 Q;  2OI2 A;  4GKJ E;  2ZBK B;  2L2N A;  4DR7 I;  1N0U A;  4DR6 I;  2F4V E;  1MG7 A;  4USM A;  4JI7 E;  1YZ9 A;  4YY3 E;  1WHQ A;  2L2M A;  4HXZ A;  1FI4 A;  1QZR A;  3PYE A;  1WHN A;  4GKK I;  1BKN A;  1H73 A;  3PYF A;  4LFA E;  2L3C A;  1Z59 A;  2B3T B;  3ADL A;  4HY1 A;  1XHK A;  4PRV A;  2HK2 A;  2MDR A;  4P7A A;  4DV7 E;  4LF8 E;  2HKJ A;  4UTG A;  1FKA E;  5A2Q Q;  2LRS A;  3J80 Q;  1KKH A;  1NHI A;  2L3J A;  1H7U A;  2HKE A;  3QT7 A;  1XNQ I;  2UXB I;  4DR7 E;  1HNW E;  4DV3 I;  1KTV A;  4NXM I;  3T1Y I;  2ZM6 I;  1DAR A;  4HAC A;  3ADI A;  4X64 E;  3OTO I;  2V34 A;  4FN5 A;  4DV1 E;  4LF7 E;  3CWV A;  1HNX E;  1X49 A;  1O0W A;  4OX9 I;  3VYY A;  1IBK E;  2A2D A;  4NXN E;  1ELO A;  3B82 A;  2IHR 1;  4WYQ B;  4DPW A;  4DUY I;  4DV4 E;  4JI0 I;  2UUA I;  4LFB E;  1J26 A;  2RS7 A;  4JI6 E;  3T1H E;  4DPT A;  1RR9 A;  4X65 I;  2UU9 I;  1I94 I;  4ZVI A;  1EKZ A;  1HR0 E;  1RC7 A;  1S4E A;  3B8H A;  4LF4 I;  2Q2E B;  4JI2 I;  2R42 A;  4YHH I;  1XMQ I;  3Q1Q A;  3ZM7 A;  5LMU I;  4DV5 E;  4DV3 E;  2UUB I;  2EZ6 A;  4FW9 A;  4LF6 E;  1ZM9 A;  4JI5 I;  4B3R I;  1EI1 A;  1Z0B A;  2VQF I;  4WFT A;  5BR8 E;  5GMD A;  1FJG E;  2EFG A;  1D6T A;  2A2C A;  3ZZ0 A;  3GON A;  4K0K I;  4DUY E;  1N0V C;  2UXC E;  4DR5 I;  1XMO I;  4DR1 I;  1H7S A;  3JAM C;  2N3G A;  4DV0 I;  4ED4 A;  1STU A;  2UU9 E;  1I94 E;  4DV6 E;  1ZXM A;  4X62 I;  2NUG A;  1NHH A;  3J81 Q;  1J5E I;  5LMN E;  3V5R A;  4JI3 E;  1Z5C A;  2BM1 A;  1IBL E;  4JI4 E;  2R3V A;  4HAC B;  3WU6 A;  4B3S I;  4LF5 I;  1Z0T A;  2X36 A;  4JV5 I;  1EA6 A;  4B3R E;  4UT4 A;  1YYW A;  4B3M I;  1Z0W A;  1N34 E;  1ZM4 A;  4DPX A;  3LLH A;  4JI1 E;  2NA2 A;  3H4L A;  1ZBT A;  2HK3 A;  2HHH I;  1XMO E;  1HNZ E;  1MU5 A;  1ZM2 A;  4JI8 I;  1IBM I;  2V2V A;  1U2R A;  1N32 E;  1N33 I;  1H72 C;  1Z5B A;  2UXD I;  2UUC I;  3ZKD A;  1J5E E;  3ZZU A;  5CFF E;  4DR6 E;  2LBS B;  1QU6 A;  2DEJ A;  3JAM Q;  5FLX C;  2NUF A;  2CPN A;  4LFC I;  4X66 I;  3LNU A;  1YYO A;  1B63 A;  4B3S E;  4LF5 E;  3PYD A;  2L2K B;  4GKK E;  5IWA I;  4DR3 I;  4M1K A;  4DUZ I;  3QT6 A;  1N36 I;  2DEI A;  2ZIT A;  1UHZ A;  5GME A;  2DB2 A;  4OOG C;  1MX0 A;  4I3H A;  1FNM A;  1Z0C A;  3D4J A;  4FWH A;  1N33 E;  2UXD E;  4DXL A;  2UUC E;  1XNQ E;  2UXB E;  1T4L B;  5IT9 C;  2N3H A;  2LTR A;  2RTX A;  4NXM E;  3T1Y E;  2ZM6 E;  3J7A G;  1Z0V A;  3P1X A;  4HYM A;  4R1F A;  3OTO E;  4B3T I;  1WUU A;  3V2U C;  1KVK A;  2V2Q A;  4X66 E;  2X7I A;  4GKJ I;  3LPS A;  4OX9 E;  3M6A A;  1OJ4 A;  1NZ0 A;  2F4V I;  4DUZ E;  4JG4 A;  2V8P A;  4XTJ A;  3ZZT A;  4JI0 E;  2UUA E;  1Z0G A;  4JI7 I;  2LJP A;  4YY3 I;  1YYK A;  4DU7 A;  2KHX A;  4X65 E;  2HFS A;  1X48 A;  1UIL A;  4LFA I;  5A2Q C;  1ZM3 A;  4FWG A;  4LF4 E;  4JI2 E;  4YHH E;  2LTS A;  4DR4 I;  1XMQ E;  2BV3 A;  4DKK A;  4EMD A;  5LMU E;  2UUB E;  2XEX A;  1RRE A;  3J7Y p;  2B7T A;  2JY9 A;  3LTO A;  3F0N A;  4JYA I;  4JI5 E;  2VQF E;  2NUE A;  3C4B A;  1HNW I;  1GQE A;  1S16 A;  4DU8 A;  4K0K E;  2DMY A;  4X64 I;  4DV1 I;  1FWK A;  4LF7 I;  4DR5 E;  1T4N A;  5L3J A;  4DR1 E;  1HNX I;  4KHP I;  3HUL A;  1IBK I;  4NXN I;  4DV0 E;  1PVG A;  2RS6 A;  1Z0E A;  3WU5 A;  2RSM A;  4WUB A;  4LF9 I;  3C4T A;  4X62 E;  4DV4 I;  4DR4 E;  4LFB I;  4JI6 I;  3T1H I;  4USK A;  3QT5 A;  4Z7Y A;  3K1J A;  2LJH A;  1XNR I;  2NPF A;  1HR0 I;  3J7A M;  4JV5 E;  4JYA E;  2V2Z A;  4B3M E;  4DV5 I;  2VQE I;  4DR2 I;  1KIJ A;  4AQY I;  4DPU A;  3WU4 A;  4M2Z A;  1B62 A;  4LF6 I;  3ADG A;  1Z5A A;  2AJ4 A;  2HFU A;  2HHH E;  4KHP E;  2JVA A;  4JI8 E;  1PKP A;  1IBM E;  3K17 A;  4Z7C A;  5BR8 I;  2WW4 A;  1FJG I;  1A6F A;  2VF3 A;  2LUQ A;  4PU9 A;  4P52 A;  4LF9 E;  2YT4 A;  1FWL A;  3HTX A;  2UXC I;  3J81 C;  1RQ0 A;  2E5L I;  4M30 A;  4DPY A;  1X47 A;  3ADJ A;  4URL A;  4DV2 I;  4LFC E;  2CZ9 A;  1XNR E;  4FWD A;  4DV6 I;  5IWA E;  1T4O A;  5FLX Q;  4PRX A;  5LL6 R;  5LMN I;  2E1R A;  2GS8 A;  4DR3 E;  1N36 E;  4JI3 I;  4MYT A;  2VQE E;  4DR2 E;  4RPF A;  4AQY E;  2L33 A;  1VIS A;  1IBL I;  3WU3 A;  4JI4 I;  4MYU A;  1K47 A;  1UEK A;  3QT8 A;  1NHJ A;  3VYX A;  1ZXN A;  4KQV A;  4WUD A;  4WUC A;  1N34 I;  2BM0 A;  3B78 A;  3J80 C;  2J7K A; 
#chains in the Genus database with same CATH topology
 2BB8 A;  4GZN C;  2CGE A;  2EMK A;  1MEY C;  3EPL A;  3THN A;  3PYG A;  4X8W A;  4DV7 I;  4JI1 I;  2EQ0 A;  1DI2 A;  4LF8 I;  2E1M A;  3ZKB A;  1Z1B A;  1JK2 A;  2O3Z A;  2E5L E;  1H74 A;  2Z5C B;  1HNZ I;  2B7V A;  2LV2 A;  4FK5 C;  2DIX A;  2EM8 A;  4DV2 E;  4B3T E;  1PJS A;  1PIE A;  2LUP B;  1N32 I;  5IT9 Q;  2OI2 A;  4GKJ E;  2ZBK B;  2ELZ A;  2O1U A;  2D9H A;  2L2N A;  3P3C A;  4MDT A;  4DR7 I;  4F9A B;  3UK3 C;  5JEA B;  2V85 A;  1OYP A;  4AM3 A;  1N0U A;  4DR6 I;  2F4V E;  4IZJ A;  5FLX Q;  1IMU A;  5C0X A;  1DQ3 A;  1MG7 A;  1A1F A;  4USM A;  3AUZ A;  4WSP A;  2DRP A;  2VF1 A;  2GLI A;  5IXM B;  4MLQ A;  4JI7 E;  1YZ9 A;  2CT1 A;  4YY3 E;  5K36 A;  1WHQ A;  2L2M A;  4HXZ A;  3IWC A;  4R2A A;  2EMA A;  4M9V C;  1FI4 A;  1QZR A;  3PYE A;  4O4K A;  1WHN A;  4U3B A;  4GKK I;  1BKN A;  1H73 A;  3PYF A;  2M4I A;  2EPM X;  4LFA E;  5KL4 A;  2L3C A;  2NAB A;  4NZV A;  5A69 A;  1Z59 A;  2B3T B;  2E72 A;  5KL3 A;  3ADL A;  1XHK A;  2WNR B;  4HY1 A;  1T39 A;  3P06 A;  3IWD A;  4PRV A;  1LLM C;  1GZ6 A;  2HK2 A;  2Z5C A;  4P7D A;  4OO1 D;  5FWK A;  2NN6 D;  2EOE A;  2MDR A;  1Y4S A;  4P7A A;  4DV7 E;  3C6M A;  3DJW A;  5IV8 B;  4LF8 E;  2HKJ A;  1A1H A;  4UTG A;  5A6K A;  1T38 A;  1FKA E;  5A2Q Q;  2ODR D;  2YSP A;  1ZU1 A;  5C0X E;  2EMG A;  1UDN A;  2LRS A;  3J80 Q;  4BCA A;  5JEA A;  1KKH A;  3IWB A;  2YTG A;  3EPH A;  1NHI A;  2L3J A;  2EPX A;  1H7U A;  2DMI A;  1PDA A;  4HEI A;  2HKE A;  3QT7 A;  5AC5 A;  2YTO A;  5K36 E;  1XNQ I;  2UXB I;  2L92 A;  4DR7 E;  1HNW E;  1GTK A;  4DV3 I;  1KTV A;  2ENA A;  4NXM I;  3T1Y I;  2VES A;  2ZM6 I;  2WP8 A;  1DAR A;  4HAC A;  4N3O A;  1ZAA C;  3HPS A;  3ADI A;  4IFD E;  1Y5Y A;  4X64 E;  3OTO I;  2V34 A;  4FN5 A;  4DV1 E;  4R8O A;  3F6G A;  4LF7 E;  3CWV A;  3GLL A;  4GEQ B;  2EPO A;  3RMP A;  4F6N A;  4OO1 C;  2HC5 A;  1HNX E;  1X49 A;  2NN6 C;  4BA2 B;  2N8X A;  4ZYH A;  1O0W A;  4OX9 I;  3VYY A;  1RMD A;  1IQO A;  2RQL A;  2WNR A;  3BGH A;  1IBK E;  5LLQ A;  4N4R B;  4NXN E;  1ELO A;  2VRD A;  2A2D A;  3B82 A;  2IHR 1;  2M1S A;  2BA0 D;  2EPN A;  4WYQ B;  2KON A;  1A1L A;  1AAY A;  4DPW A;  5JEA E;  1UBD C;  2C38 B;  4DUY I;  2EOI A;  4DV4 E;  4JI0 I;  2UUA I;  4DMI A;  2V89 A;  4LFB E;  1J26 A;  2RS7 A;  3F6H A;  4JI6 E;  3T1H E;  5C0X F;  5A6B A;  2M9A A;  3HJC A;  3Q6M A;  3PRY A;  2O1W A;  4DPT A;  2EM2 A;  3H09 A;  2C39 A;  1RR9 A;  2EQ1 A;  4X65 I;  5EL9 A;  2UU9 I;  1I94 I;  4ZVI A;  1EKZ A;  4BMJ A;  5K36 F;  1HR0 E;  1RC7 A;  1S4E A;  3B8H A;  1UDO A;  1DGC A;  2YTF A;  4LF4 I;  2Q2E B;  4JI2 I;  2V87 A;  2JOX A;  2R42 A;  4X9J A;  4YHH I;  1XMQ I;  3ZM7 A;  2PO1 B;  3Q1Q A;  1R6M A;  2CG9 A;  3L7Z B;  2M7Q A;  2WBS A;  5LMU I;  4DV5 E;  4DV3 E;  2UUB I;  2EZ6 A;  2J7K A;  4IFD F;  2RSI A;  4FW9 A;  2YU8 A;  1A1K A;  3Q6N A;  4BA2 A;  4IZJ B;  1N3G A;  2EMY A;  4LF6 E;  3DF6 A;  2JE6 B;  2PNZ B;  4BC7 A;  1ZM9 A;  4JI5 I;  4B3R I;  4BHC A;  1EI1 A;  1Z0B A;  2VQF I;  4WFT A;  2C37 A;  5BR8 E;  2BR2 B;  2C38 A;  5GMD A;  5JEA F;  4OZE A;  5K36 B;  2VE7 C;  3U1Y A;  1FJG E;  3ZZU A;  1YHC A;  4FW6 A;  2K4V A;  2EFG A;  2EPK X;  5EKW A;  1D6T A;  2JEB B;  3C6K A;  2A2C A;  2GO4 A;  3ZZ0 A;  2EMH A;  3GON A;  3PS3 A;  2BA0 G;  4K0K I;  4DUY E;  3B4T A;  1N0V C;  1USU A;  3ZOQ B;  1TF3 A;  4IFD B;  2WBU A;  2UXC E;  4DR5 I;  1XMO I;  2ELY A;  4DR1 I;  1H7S A;  3JTZ A;  2N3G A;  3HQ1 A;  3JAM C;  5DNL A;  2MC5 A;  4DV0 I;  4I8O A;  2LCE A;  4IJD A;  4ED4 A;  2PO1 A;  4O24 A;  2YPN A;  1STU A;  3BF2 A;  1YPN A;  3ECR A;  4DV6 E;  2GPI A;  1I94 E;  2UU9 E;  1YH8 A;  1ZXM A;  3L7Z A;  4F54 A;  1R6L A;  5KL5 A;  4MU0 A;  2EPR A;  4NBQ A;  4X62 I;  2NUG A;  1HK7 A;  1NHH A;  3J81 Q;  1J5E I;  5LMN E;  2V8Q B;  2JXP A;  3V5R A;  4JI3 E;  2JE6 A;  2CTD A;  2PNZ A;  2EL4 A;  2EMX A;  4Q35 B;  1Z5C A;  3BBG A;  2BM1 A;  1IBL E;  2PO2 B;  2V86 A;  4BHB A;  4JI4 E;  2PO0 B;  5ADZ A;  2EPU A;  4P78 A;  2R3V A;  2WP8 B;  2EMZ A;  2JEA A;  2BR2 A;  4HAC B;  5DRP A;  3WU6 A;  2YRH A;  4B3S I;  5AE2 A;  4IZJ D;  1Z0T A;  2X36 A;  4LF5 I;  4JV5 I;  5C0X D;  2Z5E A;  3AV0 A;  1EA6 A;  4B3R E;  4BA1 B;  1EH6 A;  1VI7 A;  2JEB A;  1YYW A;  3KRN A;  4UT4 A;  2F8B A;  1Z0W A;  4B3M I;  2O1T A;  5A6A A;  4IFD A;  2GO3 A;  1N34 E;  5K36 D;  4R2R A;  5AE1 A;  1ZM4 A;  3M7N D;  4J8Z A;  4ISA A;  1EH8 A;  3P3G A;  2EPP A;  3LLH A;  4JI1 E;  2JPA A;  4DPX A;  1G2F C;  2NA2 A;  3VK6 A;  3H4L A;  1ZBT A;  4F2J C;  2HK3 A;  2PRT A;  1XMO E;  1HNZ E;  2HHH I;  1MU5 A;  1ZM2 A;  2H36 X;  4JI8 I;  2WBT A;  4MU4 A;  1IBM I;  5AC4 A;  4O43 A;  2LT7 A;  2V2V A;  3U1K A;  2C39 B;  1U2R A;  2EM4 A;  1NCS A;  1N32 E;  1N33 I;  1H72 C;  1Z5B A;  2UXD I;  1EH7 A;  2UUC I;  3ZKD A;  2IOQ A;  4QNJ A;  5T6J A;  2PO2 A;  1J5E E;  3HXL A;  5CFF E;  2EOH A;  2LBS B;  1QU6 A;  2LO3 A;  4DR6 E;  2DEJ A;  2PO0 A;  2I13 A;  5JEA D;  4BC9 A;  3JAM Q;  5FLX C;  2LVH A;  2EPA A;  1ZBQ A;  2FTX B;  3TQM A;  2NUF A;  2CPN A;  4F9C B;  2DLK A;  2YRM A;  2EL6 A;  4BA1 A;  2R1F A;  4LFC I;  2YTJ A;  3KZY A;  4IZK B;  4X66 I;  3LNU A;  1YYO A;  1F2I G;  1B63 A;  4M0V A;  4WXC A;  1A1J A;  4B3S E;  2L2K B;  4LF5 E;  3PYD A;  1Y4U A;  4GKK E;  4LOM A;  5IWA I;  2ODR C;  4F6M A;  4ZYD A;  3DD6 A;  4DR3 I;  2PNM A;  4M1K A;  4DUZ I;  3QT6 A;  1N36 I;  2DEI A;  3FIG A;  2C37 B;  4FW4 A;  5DRQ A;  2NN6 E;  2DLQ A;  2I9I A;  2ENC A;  2ZIT A;  1UHZ A;  1PJQ A;  1YUJ A;  2LJU A;  2PNL A;  5GME A;  4R03 A;  4TUI A;  2DB2 A;  2EMW A;  3B78 A;  3M7N G;  2V88 A;  4OOG C;  2IES A;  3JU0 A;  1L4S A;  2EM9 A;  2EMB A;  4HTG A;  1MX0 A;  1P42 A;  2GHF A;  2EM5 A;  4I3H A;  1FNM A;  2HJJ A;  3M85 D;  4R2E A;  1Z0C A;  1X6E A;  1G2D C;  3D4J A;  4FWH A;  2EN4 A;  5A6B D;  2J7J A;  2RPC A;  4WPY A;  1N33 E;  2UXD E;  2EM3 A;  4DXL A;  2UUC E;  1ZR9 A;  1XNQ E;  2UXB E;  5IT9 C;  1T4L B;  2N3H A;  2EPZ A;  2LTR A;  2RTX A;  4NXM E;  3T1Y E;  2CVE A;  2ZM6 E;  2BA1 D;  2EP3 A;  3J7A G;  4IZK A;  1Z0V A;  2YTE A;  3P1X A;  2MKN A;  2JYA A;  2EOF A;  4HYM A;  4LCH A;  4R1F A;  2FGG A;  2EOY A;  3HPZ A;  3OTO E;  4B3T I;  5KL6 A;  1WUU A;  1WXR A;  3P3E A;  3V2U C;  1KVK A;  2V2Q A;  4BS9 A;  4X66 E;  2X7I A;  3QG5 C;  4GKJ I;  1RHY A;  3LPS A;  2YTQ A;  4OX9 E;  3M6A A;  2JEA B;  2IOP A;  1OJ4 A;  1NZ0 A;  4OO1 F;  2NN6 F;  2F4V I;  2Z5B B;  4DUZ E;  4QNK A;  2EOX A;  4JG4 A;  4MU3 A;  2V8P A;  3L00 A;  2EWL A;  4XTJ A;  1UN6 B;  3BID A;  4BBY A;  3ZZT A;  4JI0 E;  3K85 A;  2UUA E;  2BBG A;  4MLV A;  1Z0G A;  3PS1 A;  4JI7 I;  2LJP A;  2EOS A;  4YY3 I;  2EOZ A;  1X5W A;  1YYK A;  4DU7 A;  3CDI A;  2KHX A;  4X65 E;  2HFS A;  2EML A;  2EM0 A;  1SR9 A;  1X48 A;  1UIL A;  2CSH A;  4LFA I;  4WSG A;  4RH8 A;  5A2Q C;  1ZM3 A;  4FWG A;  4LF4 E;  3M85 G;  4OO1 B;  4JI2 E;  4L5N C;  5KL2 A;  2NN6 B;  4YHH E;  2EOR A;  2LTS A;  3MHH C;  1XMQ E;  1P47 A;  2BV3 A;  4DKK A;  2F1D A;  4DR4 I;  3GCM A;  1USV A;  4EMD A;  5LMU E;  3VHT B;  3EPJ A;  2UUB E;  2EJ4 A;  2GQ0 A;  1PJT A;  2YTD A;  1BB8 A;  4WX9 A;  2EOJ A;  1B69 A;  1TF6 A;  4R2P A;  1RRE A;  2XEX A;  3J7Y p;  4LTY A;  4LPF A;  2B7T A;  5DRO A;  1MGT A;  2BA1 G;  1X3C A;  3GME A;  4O5G A;  2JY9 A;  1X6F A;  3LTO A;  1BBO A;  2EN3 A;  3F0N A;  4JYA I;  2Z5B A;  4JI5 E;  2EN8 A;  2IER A;  1E3H A;  2VQF E;  3MHS C;  2NUE A;  1IQS A;  5DNY A;  2BM0 A;  1Y60 A;  3C4B A;  1HNW I;  1TN9 A;  1WRJ A;  2EPC A;  1XXE A;  2MDG A;  1GQE A;  1S16 A;  1AH5 A;  4DU8 A;  4R2C A;  4LCG A;  2L8T A;  2K7I A;  4K0K E;  2JR1 A;  2DMY A;  4X64 I;  2DSY A;  2L6M A;  2V83 A;  4L8N A;  1FWK A;  2MKD A;  4J3D A;  4DR5 E;  2J65 A;  4DV1 I;  4LF7 I;  1T4N A;  2MC6 A;  1KJK A;  1QNT A;  1YUI A;  1E3P A;  4DR1 E;  5L3J A;  1HNX I;  4IFD D;  4KHP I;  2EN6 A;  2WCC 3;  3HUL A;  4OO1 A;  1IBK I;  2NN6 A;  4NXN I;  4DV0 E;  1PVG A;  2YTN A;  3M99 B;  2A25 A;  2RS6 A;  1OYS A;  4R2D A;  2R76 A;  2YRK A;  2JWO A;  4TUG A;  2RSM A;  1Z0E A;  4R2S A;  1KYQ A;  4WUB A;  3UHM A;  3WU5 A;  5C0X C;  4LF9 I;  3C4T A;  4X62 E;  2EQ3 A;  4DV4 I;  4DR4 E;  2EM6 A;  1NEI A;  4LFB I;  2G7H A;  3T1H I;  4JI6 I;  1UDQ A;  2JP9 A;  3NZK A;  3QT5 A;  4USK A;  5TSE A;  4Z7Y A;  5K36 C;  4U3D A;  2ADR A;  4NHR A;  2EMI A;  2EE8 A;  5KL7 A;  2LJH A;  2EOQ A;  3KWR A;  5AAS A;  2O1V A;  3K1J A;  4OKG A;  2NPF A;  1XNR I;  1HR0 I;  3J7A M;  4JV5 E;  3H1C A;  4JYA E;  2KOU A;  4F9B B;  4R2Q A;  4FW3 A;  2V2Z A;  4LCF A;  2Q8U A;  1UDS A;  4IFD C;  4AID A;  4B3M E;  2EOO A;  3K6Q A;  4DV5 I;  4OO1 E;  2VQE I;  4DR2 I;  1KIJ A;  4AQY I;  4MU1 A;  3P76 A;  4DPU A;  2YSO A;  4ZYG A;  3WU4 A;  4M2Z A;  1BBG A;  1SFE A;  2YTP A;  2WZO A;  1YFH A;  1YSA C;  4AIM A;  4LF6 I;  3MSW A;  3ADG A;  2EN2 A;  1Z5A A;  4RHB B;  2FV4 B;  2AJ4 A;  2HFU A;  2HGH A;  2HHH E;  5JEA C;  2EMF A;  1A1I A;  4KHP E;  2JVA A;  4Q28 A;  1PKP A;  4JI8 E;  5A6J A;  1IBM E;  3K17 A;  4Z7C A;  5BR8 I;  2WW4 A;  2EN7 A;  4MQY A;  1FJG I;  1WJP A;  5AE3 A;  1A6F A;  2VF3 A;  2LUQ A;  1A1G A;  4KWY A;  4PU9 A;  4P52 A;  4LU9 A;  4LF9 E;  3THO B;  2YT4 A;  4IS9 A;  1X6H A;  2LE2 A;  3KZZ A;  1FWL A;  3HTX A;  2UXC I;  2EM7 A;  3J81 C;  1RQ0 A;  2JT2 A;  5F3W A;  2E5L I;  4M30 A;  1JK1 A;  4DPY A;  2B9D A;  4ZYE A;  1X47 A;  2YTI A;  3ADJ A;  4URL A;  4DV2 I;  2AE8 A;  3EQ1 A;  4LFC E;  2CZ9 A;  1XNR E;  4FWD A;  4DV6 I;  2EN1 A;  4FW5 A;  3LML A;  2EPL X;  5IWA E;  1T4O A;  2DGC A;  2YZT A;  5LL6 R;  2YU5 A;  2E1R A;  4PRX A;  2GS8 A;  1OYR A;  5LMN I;  4DR3 E;  1N36 E;  2YWQ A;  4JI3 I;  4MYT A;  2VQE E;  4DR2 E;  4RPF A;  4AQY E;  5DNX A;  4KZS A;  3CDJ A;  2L33 A;  1VIS A;  5ELW A;  1IBL I;  3WU3 A;  4JI4 I;  4MYU A;  1K47 A;  3EPK A;  2EOM A;  2EMC A;  1Y6Z A;  1UEK A;  3HKM A;  5C0X B;  3QT8 A;  3OML A;  5DRR A;  4IS1 C;  1NHJ A;  2ENH A;  4WXD A;  4FW7 A;  2LMZ A;  3PS2 A;  3VYX A;  1ZXN A;  4GQU A;  4KQV A;  4WUC A;  4WUD A;  1N34 I;  1B62 A;  2JOB A;  3J80 C;  2EL5 A; 
#chains in the Genus database with same CATH homology
 2CGE A;  3PYG A;  4X8W A;  4DV7 I;  4JI1 I;  4LF8 I;  1DI2 A;  2E1M A;  3ZKB A;  2E5L E;  1H74 A;  2Z5C B;  1HNZ I;  2B7V A;  2DIX A;  4B3T E;  4DV2 E;  1PIE A;  2LUP B;  1N32 I;  5IT9 Q;  2OI2 A;  4GKJ E;  2ZBK B;  2O1U A;  2L2N A;  4DR7 I;  4F9A B;  2V85 A;  1N0U A;  4DR6 I;  2F4V E;  4IZJ A;  1DQ3 A;  1MG7 A;  4USM A;  3AUZ A;  4WSP A;  2VF1 A;  4JI7 E;  1YZ9 A;  4YY3 E;  1WHQ A;  2L2M A;  4HXZ A;  3IWC A;  1FI4 A;  1QZR A;  3PYE A;  1WHN A;  4GKK I;  1BKN A;  1H73 A;  3PYF A;  2M4I A;  4LFA E;  2L3C A;  1Z59 A;  2B3T B;  3ADL A;  4HY1 A;  1XHK A;  3P06 A;  3IWD A;  4PRV A;  1GZ6 A;  2HK2 A;  2Z5C A;  4P7D A;  5FWK A;  2MDR A;  1Y4S A;  4P7A A;  4DV7 E;  3DJW A;  4LF8 E;  2HKJ A;  4UTG A;  1FKA E;  5A2Q Q;  2ODR D;  2LRS A;  3J80 Q;  4BCA A;  1KKH A;  3IWB A;  1NHI A;  2L3J A;  1H7U A;  2HKE A;  3QT7 A;  1XNQ I;  2UXB I;  2L92 A;  4DR7 E;  1HNW E;  4DV3 I;  1KTV A;  4NXM I;  3T1Y I;  2ZM6 I;  1DAR A;  4HAC A;  4N3O A;  3HPS A;  3ADI A;  4X64 E;  3OTO I;  2V34 A;  4FN5 A;  4DV1 E;  4R8O A;  3F6G A;  4LF7 E;  3CWV A;  4GEQ B;  3RMP A;  1HNX E;  1X49 A;  1O0W A;  4OX9 I;  3VYY A;  1IBK E;  2A2D A;  4NXN E;  1ELO A;  3B82 A;  2IHR 1;  2M1S A;  4WYQ B;  2KON A;  4DPW A;  4DUY I;  4DV4 E;  4JI0 I;  2UUA I;  4DMI A;  2V89 A;  4LFB E;  1J26 A;  2RS7 A;  3F6H A;  4JI6 E;  3T1H E;  3Q6M A;  3PRY A;  2O1W A;  4DPT A;  3H09 A;  1RR9 A;  4X65 I;  2UU9 I;  1I94 I;  4ZVI A;  1EKZ A;  4BMJ A;  1HR0 E;  1RC7 A;  1S4E A;  3B8H A;  4LF4 I;  2Q2E B;  4JI2 I;  2V87 A;  2JOX A;  2R42 A;  4YHH I;  1XMQ I;  3Q1Q A;  3ZM7 A;  2CG9 A;  2M7Q A;  5LMU I;  4DV5 E;  4DV3 E;  2UUB I;  2EZ6 A;  4FW9 A;  3Q6N A;  4IZJ B;  4LF6 E;  3DF6 A;  4BC7 A;  1ZM9 A;  4JI5 I;  4B3R I;  1EI1 A;  1Z0B A;  2VQF I;  4WFT A;  5BR8 E;  5GMD A;  2VE7 C;  1FJG E;  2K4V A;  2EFG A;  1D6T A;  2A2C A;  3ZZ0 A;  3GON A;  4K0K I;  4DUY E;  1N0V C;  1USU A;  3ZOQ B;  2UXC E;  4DR5 I;  1XMO I;  4DR1 I;  1H7S A;  3JTZ A;  2N3G A;  3HQ1 A;  3JAM C;  2MC5 A;  4DV0 I;  4I8O A;  4ED4 A;  1STU A;  2UU9 E;  1I94 E;  4DV6 E;  1ZXM A;  4F54 A;  4X62 I;  2NUG A;  1HK7 A;  1NHH A;  3J81 Q;  1J5E I;  5LMN E;  2V8Q B;  3V5R A;  4JI3 E;  1Z5C A;  2BM1 A;  1IBL E;  2V86 A;  4JI4 E;  5ADZ A;  2R3V A;  4P78 A;  4HAC B;  3WU6 A;  4B3S I;  4LF5 I;  5AE2 A;  4IZJ D;  1Z0T A;  2X36 A;  4JV5 I;  2Z5E A;  3AV0 A;  1EA6 A;  4B3R E;  4UT4 A;  1YYW A;  4B3M I;  2F8B A;  1Z0W A;  2O1T A;  1N34 E;  5AE1 A;  1ZM4 A;  4J8Z A;  4DPX A;  3LLH A;  4JI1 E;  2NA2 A;  3VK6 A;  3H4L A;  1ZBT A;  2HK3 A;  2HHH I;  1XMO E;  1HNZ E;  1MU5 A;  1ZM2 A;  2H36 X;  4JI8 I;  1IBM I;  2V2V A;  1U2R A;  1N32 E;  1N33 I;  1H72 C;  1Z5B A;  2UXD I;  2UUC I;  3ZKD A;  2IOQ A;  5T6J A;  1J5E E;  3HXL A;  5CFF E;  4DR6 E;  2LBS B;  1QU6 A;  3ZZU A;  2DEJ A;  4BC9 A;  3JAM Q;  5FLX C;  1ZBQ A;  2FTX B;  2NUF A;  2CPN A;  4F9C B;  4LFC I;  4X66 I;  4IZK B;  3LNU A;  1YYO A;  1B63 A;  4M0V A;  4B3S E;  4LF5 E;  3PYD A;  2L2K B;  1Y4U A;  4GKK E;  5IWA I;  2ODR C;  4DR3 I;  2PNM A;  4M1K A;  4DUZ I;  3QT6 A;  1N36 I;  2DEI A;  3FIG A;  2ZIT A;  1UHZ A;  2PNL A;  5GME A;  4R03 A;  4TUI A;  2DB2 A;  3B78 A;  2V88 A;  4OOG C;  3JU0 A;  1MX0 A;  4I3H A;  1FNM A;  1Z0C A;  3D4J A;  4FWH A;  4WPY A;  1N33 E;  2UXD E;  4DXL A;  2UUC E;  1XNQ E;  2UXB E;  5IT9 C;  1T4L B;  2N3H A;  2LTR A;  2RTX A;  4NXM E;  3T1Y E;  2ZM6 E;  3J7A G;  4IZK A;  1Z0V A;  3P1X A;  4HYM A;  4R1F A;  2FGG A;  3HPZ A;  3OTO E;  4B3T I;  1WUU A;  1WXR A;  3V2U C;  1KVK A;  2V2Q A;  4BS9 A;  4X66 E;  2X7I A;  4GKJ I;  3LPS A;  4OX9 E;  3M6A A;  2IOP A;  1OJ4 A;  1NZ0 A;  2F4V I;  2Z5B B;  4DUZ E;  4JG4 A;  2V8P A;  2EWL A;  4XTJ A;  4BBY A;  3ZZT A;  4JI0 E;  3K85 A;  2UUA E;  1Z0G A;  4JI7 I;  2LJP A;  4YY3 I;  1YYK A;  4DU7 A;  2KHX A;  4X65 E;  2HFS A;  1SR9 A;  1X48 A;  1UIL A;  4LFA I;  5A2Q C;  1ZM3 A;  4FWG A;  4LF4 E;  4JI2 E;  4L5N C;  4YHH E;  2LTS A;  4DR4 I;  1XMQ E;  2BV3 A;  4DKK A;  1USV A;  4EMD A;  5LMU E;  2UUB E;  2GQ0 A;  3HJC A;  2XEX A;  1RRE A;  3J7Y p;  4LTY A;  2B7T A;  2JY9 A;  3LTO A;  3F0N A;  4JYA I;  2Z5B A;  4JI5 E;  2VQF E;  2NUE A;  5DNY A;  2BM0 A;  3C4B A;  1HNW I;  1GQE A;  1S16 A;  4DU8 A;  2L8T A;  4K0K E;  2JR1 A;  2DMY A;  4X64 I;  2DSY A;  2L6M A;  2V83 A;  4L8N A;  1FWK A;  4DV1 I;  4LF7 I;  4DR5 E;  1T4N A;  2MC6 A;  5L3J A;  4DR1 E;  1HNX I;  4KHP I;  3HUL A;  1IBK I;  4NXN I;  4DV0 E;  1PVG A;  2RS6 A;  1Z0E A;  2JWO A;  4TUG A;  2RSM A;  4WUB A;  3WU5 A;  4LF9 I;  3C4T A;  4X62 E;  4DV4 I;  4DR4 E;  4LFB I;  2G7H A;  3T1H I;  4JI6 I;  4USK A;  3QT5 A;  4Z7Y A;  3K1J A;  2O1V A;  2LJH A;  5AAS A;  3KWR A;  1XNR I;  2NPF A;  1HR0 I;  3J7A M;  4JV5 E;  4JYA E;  2KOU A;  4F9B B;  2V2Z A;  4B3M E;  3K6Q A;  4DV5 I;  2VQE I;  4DR2 I;  1KIJ A;  4AQY I;  4DPU A;  3WU4 A;  4M2Z A;  2WZO A;  4LF6 I;  3MSW A;  3ADG A;  1Z5A A;  2FV4 B;  2AJ4 A;  2HFU A;  2HHH E;  4KHP E;  2JVA A;  4Q28 A;  1PKP A;  4JI8 E;  1IBM E;  3K17 A;  4Z7C A;  5BR8 I;  2WW4 A;  1FJG I;  5AE3 A;  1A6F A;  2VF3 A;  2LUQ A;  4PU9 A;  4P52 A;  4LU9 A;  4LF9 E;  2YT4 A;  2LE2 A;  1FWL A;  3HTX A;  2UXC I;  3J81 C;  1RQ0 A;  2E5L I;  5F3W A;  4M30 A;  4DPY A;  2B9D A;  1X47 A;  3ADJ A;  4URL A;  4DV2 I;  4LFC E;  2CZ9 A;  1XNR E;  4FWD A;  4DV6 I;  3LML A;  5IWA E;  1T4O A;  5FLX Q;  2YZT A;  5LL6 R;  4PRX A;  2E1R A;  5LMN I;  2GS8 A;  4DR3 E;  1N36 E;  4JI3 I;  4MYT A;  2VQE E;  4DR2 E;  4RPF A;  4AQY E;  4KZS A;  2L33 A;  1VIS A;  1IBL I;  3WU3 A;  4JI4 I;  4MYU A;  1K47 A;  1Y6Z A;  1UEK A;  3QT8 A;  3OML A;  1NHJ A;  2LMZ A;  3VYX A;  1ZXN A;  4KQV A;  4WUD A;  4WUC A;  1N34 I;  1B62 A;  2JOB A;  3J80 C;  2J7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...