4B3RE

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3rE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3rE02
1IBME 2X36A 2IHR1 3ZZUA 5LMUI 2HKJA 1XMQI 4M2ZA 5IWAE 4WUDA 1ZM9A 3LPSA 4B3ME 1XNRE 1Z5BA 4JI2E 3J7AM 4DUYI 1KTVA 1N36I 4JI5I 4DR1E 2BM0A 2N3HA 4B3SE 4LFCI 2VQFI 1B62A 2HK3A 4DV6E 2UUBE 5A2QC 3PYDA 4MYTA 2E5LE 2A2DA 1EI1A 2A2CA 4GKJE 2L2MA 4DV0I 3ADGA 4YY3I 4DR5I 4LFAI 2UXBI 2LUPB 1HNZI 1N34E 4JG4A 4JI0I 2UXCE 3Q1QA 1T4LB 4X64E 1X47A 2ZBKB 1XHKA 1T4OA 4P52A 2UU9I 4DKKA 1N32E 4P7AA 3ZKBA 3P1XA 4DV1E 4Z7YA 2F4VE 1H7SA 1PIEA 3M6AA 1UHZA 1FJGE 3HTXA 1H72C 4YHHI 4X62I 3JAMC 3ADIA 1KIJA 4LF4E 2VF3A 4JI6I 4LF5E 3ZZ0A 4X66E 4LF6E 5L3JA 4JV5I 4EMDA 4HACB 2RS7A 2J7KA 1Z0VA 1U2RA 4WFTA 1YYWA 1MG7A 4YY3E 2V34A 4DPWA 1J5EE 1Z0TA 4LF9E 2EFGA 1WHNA 4WYQB 1Z0BA 1HR0E 3LTOA 2RTXA 2UUAI 3ADJA 2HHHI 1FNMA 1RREA 1S4EA 1VISA 1ZBTA 4R1FA 4DR7E 4DR6E 4AQYI 5LMNI 5GMDA 3V5RA 3ZZTA 2L3JA 4DUZI 4X62E 1I94I 4JI1I 5BR8I 4LFBI 3CWVA 4HXZA 4K0KI 2ZITA 3VYXA 3C4TA 3VYYA 2L33A 3J81C 3B78A 1XNQE 1NHIA 2LBSB 2DEIA 4LF8I 1Z0WA 2ZM6E 4DR3I 4FWHA 4JI7E 3T1HE 4JI3I 3OTOE 5FLXQ 1HNWI 4B3TE 2VQEI 4M30A 4OX9E 2LJHA 1X48A 4JI4I 2DEJA 4DV4I 2EZ6A 1FKAE 4KHPI 1B63A 1Z59A 4B3RI 2V2VA 1PKPA 2UUCI 1EA6A 4OOGC 1IBKE 2N3GA 1N33E 4NXME 4DR4E 1HNXI 4DV2E 2HFSA 3T1YI 4JI8E 1ZXMA 5BR8E 2CPNA 4DV7I 4GKKE 4ED4A 1YZ9A 4JYAI 2UXDI 4X65I 1XMOI 5LMUE 3QT6A 3J7AG 1XMQE 4LF8E 3K17A 4DR3E 1QU6A 4RPFA 2OI2A 4LF7I 4DUYE 1N36E 4JI5E 3K1JA 4DPTA 1O0WA 1ZM4A 4LFCE 2VQFE 5GMEA 4ZVIA 1YYKA 3J7Yp 2NUEA 4DR2I 3LLHA 4DV5I 4DV0E 1WHQA 4LFAE 4DR5E 2UXBE 1HNZE 1RC7A 1MX0A 4NXNI 4FWDA 3T1YE 4JI0E 2XEXA 3D4JA 2V2QA 1H7UA 4DV3I 4PU9A 2L3CA 2JVAA 1PVGA 1FWLA 4DV7E 1IBMI 2LRSA 3ZKDA 2NA2A 4HY1A 5IWAI 5A2QQ 2UU9E 2L2KB 4B3MI 2B7TA 1XMOE 3V2UC 1XNRI 4JI2I 1T4NA 4YHHE 2LUQA 4DR1I 2CZ9A 2HKEA 1RQ0A 2DMYA 4JI6E 2NUGA 1J26A 5CFFE 4Z7CA 1EKZA 2UUBI 4DPXA 4JV5E 1D6TA 1KVKA 2E5LI 1MU5A 1UEKA 5IT9Q 4KQVA 4GKJI 1N34I 4HYMA 2UXCI 3JAMQ 4X64I 2V8PA 3B8HA 2RSMA 2AJ4A 4M1KA 3GONA 1IBLI 3J80Q 1Z0EA 4NXNE 4UT4A 2B3TB 2B7VA 1N32I 1WUUA 4DV1I 2F4VI 1BKNA 2UUAE 1FJGI 2HHHE 4DPYA 2V2ZA 4FWGA 1YYOA 4AQYE 5LMNE 4LF4I 4DXLA 2L2NA 2YT4A 4PRXA 4LF5I 4DUZE 1I94E 4X66I 4LF6I 1DARA 1ELOA 4JI1E 3PYEA 3PYFA 2MDRA 4X8WA 3WU4A 1KKHA 1Z0GA 1K47A 4LFBE 4K0KE 4I3HA 2GS8A 3B82A 1N0UA 2KHXA 1DI2A 2DIXA 4DU7A 1J5EI 1A6FA 4LF9I 2HK2A 2BM1A 1Z5CA 2WW4A 4JI3E 1HR0I 3C4BA 1IBLE 1HNWE 2LTRA 3QT8A 2VQEE 5IT9C 4PRVA 4DPUA 4DR7I 4DR6I 2R42A 4JI4E 4DV4E 3H4LA 4KHPE 4B3RE 3ADLA 3J81Q 5FLXC 1FWKA 2UUCE 2RS6A 3QT7A 3J80C 3WU5A 2HFUA 1NZ0A 2LJPA 4XTJA 1HNXE 3F0NA 1GQEA 3LNUA 2R3VA 1X49A 3QT5A 1UILA 3ZM7A 3HULA 1RR9A 2NPFA 4UTGA 1ZXNA 3WU3A 5LL6R 4HACA 1XNQI 4URLA 2Q2EB 2JY9A 2BV3A 1NHJA 2ZM6I 4JI7I 3T1HI 4JYAE 2UXDE 3OTOI 4X65E 2X7IA 4B3TI 1NHHA 1N0VC 1Z5AA 4B3SI 4OX9I 4USMA 2LTSA 4LF7E 4DV6I 4WUBA 4FN5A 2DB2A 2E1RA 1H73A 1FI4A 4WUCA 4MYUA 1IBKI 4FW9A 1N33I 4NXMI 4DR4I 4DV2I 2NUFA 1QZRA 4DR2E 1STUA 1ZM3A 4DV5E 4JI8I 4USKA 1ZM2A 4DU8A 4GKKI 1Z0CA 1H74A 3PYGA 4DV3E 3WU6A 1OJ4A 1S16A
chains in the Genus database with same CATH superfamily
1IBME 2X36A 2IHR1 2Z5EA 3ZZUA 5LMUI 2Q8UA 2HKJA 2BR2B 1XMQI 4M2ZA 2EOHA 1BBGA 1T39A 5IWAE 2EMXA 4WUDA 4WPYA 5C0XF 1ZM9A 2JEAA 3M99B 1A1HA 3LPSA 4GZNC 4B3ME 2JWOA 3MSWA 1XNRE 3B4TA 2EOSA 1Z5BA 4FW7A 4JI2E 3C6MA 4R2RA 3J7AM 4OO1F 4DUYI 1KTVA 1N36I 4JI5I 1KJKA 5C0XD 4DR1E 5KL6A 2BM0A 2N3HA 2EPMX 4B3SE 1X5WA 3U1YA 1USUA 5LLQA 3HQ1A 4F9CB 4LFCI 2VQFI 1IMUA 1B62A 4OO1D 2EM9A 4R03A 5KL3A 1Y4SA 4DV6E 2EN2A 2UUBE 2HK3A 5A2QC 1VI7A 2WBUA 3HKMA 2ODRD 3PYDA 4ZYGA 2YU8A 4MYTA 2EMGA 2E5LE 2LJUA 5AE2A 2A2DA 2WNRA 1EH7A 1EI1A 3GCMA 5ADZA 3THOB 2A2CA 1PDAA 4GKJE 2L2MA 4DV0I 3ADGA 4YY3I 2C39A 4DR5I 4LFAI 2UXBI 2LUPB 4N3OA 1HNZI 1N34E 2EN7A 1DGCA 4JG4A 5KL2A 3PS3A 2NN6E 4MDTA 2YTNA 2GPIA 2UXCE 4JI0I 3Q1QA 2YTFA 3RMPA 1T4LB 4X64E 5EKWA 1X47A 2EMKA 2ZBKB 3HPZA 1PJQA 2EN1A 1XHKA 4MU1A 2PRTA 5DNXA 1G2FC 1T4OA 2YPNA 4NZVA 1OYSA 4P52A 2UU9I 4DKKA 1N32E 2IOPA 4P7AA 3ZKBA 3P1XA 5A6JA 4DV1E 2F4VE 1H7SA 1PIEA 4Z7YA 3M6AA 1UHZA 5C0XA 1FJGE 3HTXA 1H72C 2BA0D 3IWDA 4YHHI 3AV0A 4X62I 2YRKA 3JAMC 1OJ4A 3ADIA 1KIJA 4MLQA 4OO1A 5K36F 4LF4E 1LLMC 2VF3A 4JI6I 5AC5A 3P3CA 2C38A 1YFHA 1YPNA 4IZJD 4LF5E 5KL5A 2YTOA 2BB8A 3ZZ0A 4X66E 2JP9A 2R1FA 4LF6E 2LV2A 5K36D 5L3JA 4JV5I 3THNA 2V83A 4EMDA 4HACB 1GZ6A 2RS7A 3JTZA 1USVA 4BA2B 1SFEA 2J7KA 5TSEA 1Z0VA 2KOUA 1U2RA 4R2PA 3FIGA 4FW5A 2HGHA 4WFTA 4J3DA 2DSYA 2J65A 2O3ZA 2EPKX 2EMIA 2WZOA 1YYWA 1MG7A 3F6GA 2EOOA 4YY3E 2V34A 5A6KA 4DPWA 2EOFA 1J5EE 1TN9A 1Z0TA 4LOMA 4LF9E 2EMYA 4TUIA 4MU0A 2EFGA 1WHNA 4WYQB 1PJSA 1P47A 1UBDC 1OYRA 1Z0BA 4OKGA 1HR0E 3LTOA 2RTXA 2UUAI 4IFDC 2EPZA 3ADJA 2PO0A 2HHHI 1FNMA 1RREA 1S4EA 1VISA 1ZBTA 4R1FA 2Z5BA 2JXPA 2EOEA 2CTDA 4DR7E 1EH6A 1WXRA 4DR6E 4AQYI 2NN6B 5LMNI 1ZR9A 4IZJA 5GMDA 3M85G 2HJJA 2M4IA 2EQ1A 3V5RA 5K36A 1N3GA 3ZZTA 2L3JA 3CDIA 3QG5C 1A1JA 2BA1D 4DUZI 4X62E 5C0XE 1I94I 1YSAC 2IOQA 4JI1I 3EPKA 1X3CA 2WBTA 3L7ZB 4BA1B 2PNLA 4ZYEA 4AM3A 3DF6A 4OO1E 2A25A 4R2DA 1XXEA 5BR8I 4LFBI 1ZBQA 2EMWA 3L00A 3CWVA 4HXZA 3VK6A 4K0KI 5AC4A 2CSHA 1YUIA 2WP8B 5A6AA 4RHBB 3P3GA 2PO1A 1NEIA 1QNTA 2ZITA 2EMHA 3VYXA 2L8TA 4LCGA 3C4TA 2O1TA 2FV4B 3LMLA 3VYYA 2L33A 2N8XA 2YWQA 2JEAB 3J81C 4BBYA 1BB8A 3B78A 1XNQE 1NHIA 2M7QA 2LBSB 2DEIA 4LF8I 1MGTA 1Z0WA 2IERA 2EPXA 2EN6A 2KONA 2ZM6E 4DR3I 4JI7E 3T1HE 2BBGA 4FWHA 5AE1A 1RMDA 3OTOE 4JI3I 3DD6A 2ENHA 5FLXQ 2PNZA 4B3TE 2DLQA 1HNWI 2NN6C 1S16A 1A1IA 2VE7C 2VQEI 4WXCA 3M7ND 4M30A 4KZSA 4OX9E 5JEAF 2LJHA 1X48A 1EH8A 3K85A 1X6FA 3U1KA 4JI4I 2DEJA 4DV4I 3PS1A 2EZ6A 2WNRB 1Y60A 2EE8A 1FKAE 2EMLA 4KHPI 2EOJA 2O1WA 2EPCA 5JEAD 2G7HA 2EOQA 2LE2A 2EPLX 1P42A 2PO2A 4IFDA 1B63A 1Z59A 2C39B 2FTXB 2V2VA 2LCEA 4B3RI 1PKPA 2UUCI 3HXLA 1EA6A 2VRDA 3C6KA 2LO3A 1X6EA 2V87A 4OOGC 1IBKE 2N3GA 1N33E 4WXDA 4NXME 4DR4E 1HNXI 1A1LA 4U3DA 2M1SA 4DV2E 5A69A 5K36E 2HFSA 1YHCA 2V85A 2YSPA 3EPJA 2MC6A 2ENCA 3EPHA 3T1YI 1JK1A 4FW6A 4JI8E 3DJWA 1YUJA 1ZXMA 2L6MA 3BF2A 5BR8E 5EL9A 2F8BA 2YU5A 1A1FA 2CPNA 4DV7I 4GKKE 4IS9A 4MU3A 5C0XB 1G2DC 4IFDD 4ED4A 2EWLA 1YZ9A 4JYAI 2UXDI 2JEBA 4X65I 5DNYA 3ECRA 1XMOI 4OO1B 1UN6B 2EM4A 2GHFA 5LMUE 3QT6A 3J7AG 1XMQE 1F2IG 4LF8E 2C38B 3K17A 2HC5A 2Z5CA 4DR3E 5AASA 4BC9A 4AIMA 2EMBA 5IXMB 1QU6A 5JEAA 3H09A 4RPFA 5FWKA 2OI2A 4LF7I 4DUYE 1N36E 4JI5E 2NABA 4NBQA 3K1JA 4DPTA 1O0WA 4BHCA 2EPOA 4M0VA 3PRYA 1YH8A 1ZM4A 3UHMA 2EOXA 4LFCE 2VQFE 2EM3A 5GMEA 4I8OA 2EORA 4F2JC 4ISAA 4ZVIA 1YYKA 2IESA 2ELZA 5T6JA 3IWCA 3J7Yp 2NUEA 4DR2I 3LLHA 2JT2A 4DV5I 5DROA 4O24A 4F9AB 4HEIA 2BA1G 4DV0E 1WHQA 4LFAE 4DR5E 2UXBE 1HNZE 1RC7A 2L92A 2EPNA 1MX0A 2O1UA 5A6BD 4FWDA 4QNKA 4NXNI 4OO1C 3T1YE 4L8NA 2FGGA 3BBGA 2PO0B 4JI0E 4LPFA 2XEXA 3D4JA 3TQMA 2V2QA 1H7UA 4DV3I 2Z5BB 4F6MA 2L3CA 2JVAA 2I13A 1PVGA 1UDOA 4LCHA 4PU9A 1FWLA 5DRRA 4IZJB 2EJ4A 4DV7E 1IBMI 2LRSA 2V8QB 1PJTA 3ZKDA 2NA2A 4HY1A 5K36B 5IWAI 5A2QQ 2UU9E 2EM5A 2L2KB 2EOYA 4IS1C 4IZKA 2I9IA 4B3MI 4R2CA 2B7TA 4BCAA 1XMOE 4O4KA 3V2UC 1XNRI 4GQUA 4JI2I 4P78A 3KWRA 1T4NA 4YHHE 2LUQA 4BMJA 2F1DA 2MKDA 4DR1I 2CZ9A 2HKEA 5AE3A 4LTYA 1RQ0A 2DMYA 4JI6E 2NUGA 2M9AA 4P7DA 1J26A 2PO1B 5CFFE 1R6LA 4Z7CA 1Y5YA 1EKZA 3M7NG 2YSOA 2C37A 2UUBI 2EL4A 5JEAE 2RQLA 2YTDA 4MU4A 2YTEA 4JV5E 4DPXA 1Y6ZA 1D6TA 1KVKA 2E5LI 1MU5A 1UEKA 5IT9Q 4KQVA 1WJPA 2JE6B 5A6BA 2LT7A 2CGEA 2EL6A 2EN4A 4GKJI 2R76A 4L5NC 1TF6A 4RH8A 5ELWA 1AH5A 1GTKA 2V88A 1N34I 2DRPA 4HYMA 2PNZB 5DRPA 5IV8B 4BS9A 4O5GA 2UXCI 3JAMQ 3MHSC 3MHHC 4X64I 2V8PA 3B8HA 4Q28A 2RSMA 2EPPA 2AE8A 2AJ4A 3GONA 5KL4A 4M1KA 1IBLI 3J80Q 1Z0EA 4NXNE 3PS2A 2V89A 4WX9A 4O43A 3CDJA 4UT4A 2B3TB 2B7VA 1N32I 1WUUA 4TUGA 4DV1I 2PO2B 2F4VI 2ELYA 1BKNA 2UUAE 4U3BA 3P3EA 1FJGI 4KWYA 3M85D 2HHHE 2H36X 1BBOA 4DPYA 2V2ZA 4FWGA 4R8OA 2EM7A 1YYOA 4AQYE 3HPSA 5LMNE 2JE6A 4LF4I 2BA0G 4DXLA 2JOBA 2BR2A 2L2NA 2YT4A 1A1KA 4M9VC 4PRXA 4WSPA 4LF5I 5DRQA 4DUZE 1I94E 4X66I 4LF6I 4GEQB 1DARA 1ELOA 4JI1E 3PYEA 3PYFA 2MDRA 4BHBA 3GMEA 1ZU1A 4X8WA 1R6MA 2EM2A 4BC7A 3JU0A 4IFDF 3WU4A 2EOMA 1KKHA 1Z0GA 4AIDA 4LFBE 2PNMA 2LMZA 4ZYDA 4K0KE 2J7JA 2DLKA 2JEBB 4N4RB 4R2EA 4I3HA 2GS8A 3BGHA 3B82A 3OMLA 5KL7A 1N0UA 2KHXA 1DI2A 2Z5CB 2DIXA 1NCSA 2CT1A 4DU7A 2EN3A 1J5EI 2YZTA 1A6FA 2D9HA 1Y4UA 5JEAB 4LF9I 2HK2A 2BM1A 1Z5CA 2EMAA 3Q6MA 2WW4A 1UDQA 4JI3E 1HR0I 1IQOA 3C4BA 1IBLE 1IQSA 2K7IA 1HNWE 3GLLA 2RPCA 3H1CA 2LTRA 3QT8A 4IJDA 2DMIA 2V86A 5F3WA 2YRMA 2VQEE 5IT9C 4PRVA 2K4VA 4DPUA 2MKNA 4DR7I 4WSGA 4DR6I 2R42A 1AAYA 4JI4E 3EPLA 1JK2A 4DV4E 2DGCA 3P76A 3H4LA 4X9JA 4KHPE 2EMZA 3ZOQB 2MC5A 2ADRA 4HTGA 3VHTB 4DMIA 2GO4A 4B3RE 1ZAAC 3ADLA 3J81Q 4Q35B 3HJCA 2EN8A 4IFDB 5FLXC 1TF3A 1FWKA 2UUCE 2RS6A 3J80C 3QT7A 3WU5A 2HFUA 3Q6NA 5C0XC 2NN6F 1NZ0A 1E3HA 1SR9A 2LJPA 1HNXE 4XTJA 4FK5C 3F0NA 4OZEA 2YTQA 1GQEA 3LNUA 2R3VA 1X49A 3QT5A 1UILA 3ZM7A 4FW3A 1KYQA 4ZYHA 2NN6D 3HULA 4QNJA 2LVHA 2YRHA 1RR9A 3F6HA 2NPFA 5JEAC 2ODRC 4UTGA 2YTGA 3IWBA 2EMFA 1UDSA 1ZXNA 3WU3A 2EQ3A 4IZKB 5LL6R 4LCFA 1OYPA 4HACA 3BIDA 2GLIA 4URLA 2Q2EB 2JY9A 4FW4A 1XNQI 3KZZA 2EOIA 2BV3A 4BA2A 1DQ3A 1X6HA 1NHJA 1T38A 1MEYC 2ZM6I 3T1HI 4JI7I 4LU9A 4JYAE 4NHRA 2UXDE 3OTOI 4X65E 2X7IA 2WBSA 2YTPA 4B3TI 3AUZA 1NHHA 4MQYA 3KZYA 2EM8A 2EPUA 1N0VC 1RHYA 2EP3A 1Z5AA 2YTJA 4B3SI 2C37B 4OX9I 2JOXA 4USMA 2VF1A 2JYAA 2LTSA 2CVEA 2GO3A 2B9DA 4F54A 4LF7E 3UK3C 1L4SA 4WUBA 4FN5A 4R2QA 4DV6I 2DB2A 3K6QA 2E1RA 3P06A 2EPAA 1H73A 1FI4A 4MLVA 2EOZA 4WUCA 1A1GA 1UDNA 2GQ0A 4MYUA 2MDGA 2ENAA 2VESA 4FW9A 1IBKI 1N33I 4J8ZA 2RSIA 1E3PA 4NXMI 4DR4I 2NN6A 2WCC3 4R2SA 4DV2I 1B69A 2NUFA 1QZRA 2CG9A 4DR2E 1STUA 4F9BB 1ZM3A 2JPAA 2EPRA 4DV5E 4F6NA 4JI8I 4USKA 2EM6A 5K36C 2E72A 1ZM2A 2EM0A 1WRJA 4DU8A 4GKKI 2E1MA 1Z0CA 1H74A 3L7ZA 4BA1A 4IFDE 5DNLA 2EL5A 1Z1BA 2O1VA 3PYGA 3EQ1A 2EMCA 4DV3E 2YTIA 3NZKA 2JR1A 2WP8A 3KRNA 3WU6A 1K47A 2EQ0A 1HK7A 4R2AA
chains in the Genus database with same CATH topology
1IBME 2X36A 2IHR1 2Z5EA 3ZZUA 5LMUI 2HKJA 1XMQI 4M2ZA 5IWAE 4WUDA 4WPYA 1ZM9A 3LPSA 4B3ME 2JWOA 3MSWA 1XNRE 1Z5BA 4JI2E 3J7AM 4DUYI 1KTVA 1N36I 4JI5I 4DR1E 2BM0A 2N3HA 4B3SE 1USUA 3HQ1A 4F9CB 4LFCI 2VQFI 1B62A 4R03A 1Y4SA 2HK3A 4DV6E 2UUBE 5A2QC 2ODRD 3PYDA 4MYTA 2E5LE 2A2DA 5AE2A 1EI1A 5ADZA 2A2CA 4GKJE 2L2MA 4DV0I 3ADGA 4YY3I 4DR5I 4LFAI 2UXBI 2LUPB 4N3OA 1HNZI 1N34E 4JG4A 4JI0I 2UXCE 3Q1QA 3RMPA 1T4LB 4X64E 1X47A 2ZBKB 3HPZA 1XHKA 1T4OA 4P52A 2UU9I 4DKKA 1N32E 2IOPA 4P7AA 3ZKBA 3P1XA 4DV1E 4Z7YA 2F4VE 1H7SA 1PIEA 3M6AA 1UHZA 1FJGE 3HTXA 1H72C 3IWDA 4YHHI 3AV0A 4X62I 3JAMC 1OJ4A 3ADIA 1KIJA 4LF4E 2VF3A 4JI6I 4IZJD 4LF5E 3ZZ0A 4X66E 4LF6E 5L3JA 4JV5I 4EMDA 2V83A 4HACB 1GZ6A 2RS7A 3JTZA 1USVA 2J7KA 1Z0VA 2KOUA 1U2RA 3FIGA 4WFTA 2DSYA 2WZOA 1YYWA 1MG7A 3F6GA 4YY3E 2V34A 4DPWA 1J5EE 1Z0TA 4LF9E 4TUIA 2EFGA 1WHNA 4WYQB 1Z0BA 1HR0E 3LTOA 2RTXA 2UUAI 3ADJA 2HHHI 1FNMA 1RREA 1S4EA 1VISA 1ZBTA 4R1FA 2Z5BA 4DR7E 4DR6E 1WXRA 4AQYI 5LMNI 4IZJA 5GMDA 2M4IA 3V5RA 3ZZTA 2L3JA 4DUZI 4X62E 1I94I 2IOQA 4JI1I 2PNLA 3DF6A 5BR8I 4LFBI 1ZBQA 3CWVA 4HXZA 3VK6A 4K0KI 2ZITA 3VYXA 2L8TA 3C4TA 2O1TA 2FV4B 3LMLA 3VYYA 2L33A 3J81C 4BBYA 3B78A 1XNQE 1NHIA 2M7QA 2LBSB 2DEIA 4LF8I 1Z0WA 2KONA 2ZM6E 4DR3I 4JI7E 3T1HE 4FWHA 4JI3I 5AE1A 3OTOE 5FLXQ 1HNWI 4B3TE 2VE7C 2VQEI 4M30A 4KZSA 4OX9E 2LJHA 1X48A 3K85A 4JI4I 2DEJA 4DV4I 2EZ6A 1FKAE 4KHPI 2O1WA 2LE2A 2G7HA 1B63A 1Z59A 4B3RI 2FTXB 2V2VA 1PKPA 2UUCI 3HXLA 1EA6A 2V87A 4OOGC 1IBKE 2N3GA 1N33E 4NXME 4DR4E 1HNXI 2M1SA 4DV2E 2HFSA 2V85A 3T1YI 2MC6A 4JI8E 3DJWA 1ZXMA 2L6MA 5BR8E 2F8BA 2CPNA 4DV7I 4GKKE 4ED4A 2EWLA 1YZ9A 4JYAI 2UXDI 4X65I 5DNYA 1XMOI 5LMUE 3QT6A 3J7AG 1XMQE 4LF8E 3K17A 2Z5CA 4DR3E 5AASA 4BC9A 1QU6A 3H09A 4RPFA 5FWKA 2OI2A 4LF7I 4DUYE 1N36E 4JI5E 3K1JA 4DPTA 1O0WA 4M0VA 3PRYA 1ZM4A 4LFCE 2VQFE 5GMEA 4I8OA 4ZVIA 1YYKA 5T6JA 3IWCA 3J7Yp 2NUEA 4DR2I 3LLHA 4DV5I 4F9AB 4DV0E 1WHQA 4LFAE 4DR5E 2UXBE 1HNZE 1RC7A 2L92A 1MX0A 2O1UA 4FWDA 4NXNI 3T1YE 4L8NA 2FGGA 4JI0E 2XEXA 3D4JA 2V2QA 1H7UA 4DV3I 2Z5BB 4PU9A 2L3CA 2JVAA 1PVGA 1FWLA 4IZJB 4DV7E 1IBMI 2LRSA 2V8QB 3ZKDA 2NA2A 4HY1A 5IWAI 5A2QQ 2UU9E 2L2KB 4IZKA 4B3MI 4BCAA 2B7TA 1XMOE 3V2UC 1XNRI 4JI2I 4P78A 3KWRA 1T4NA 4YHHE 2LUQA 4BMJA 4DR1I 2CZ9A 2HKEA 5AE3A 4LTYA 1RQ0A 2DMYA 2NUGA 1J26A 4P7DA 4JI6E 5CFFE 4Z7CA 1EKZA 2UUBI 4DPXA 4JV5E 1D6TA 1Y6ZA 1KVKA 2E5LI 1MU5A 1UEKA 5IT9Q 4KQVA 2CGEA 4GKJI 4L5NC 2V88A 1N34I 4HYMA 4BS9A 2UXCI 3JAMQ 4X64I 2V8PA 3B8HA 4Q28A 2RSMA 2AJ4A 4M1KA 3GONA 1IBLI 3J80Q 1Z0EA 4NXNE 2V89A 4UT4A 2B3TB 2B7VA 1N32I 1WUUA 4TUGA 4DV1I 2F4VI 1BKNA 2UUAE 1FJGI 2HHHE 2H36X 4DPYA 2V2ZA 4FWGA 4R8OA 1YYOA 4AQYE 3HPSA 5LMNE 4LF4I 4DXLA 2JOBA 2L2NA 2YT4A 4PRXA 4WSPA 4LF5I 4DUZE 1I94E 4X66I 4LF6I 4GEQB 1DARA 1ELOA 4JI1E 3PYEA 3PYFA 2MDRA 4X8WA 4BC7A 3JU0A 3WU4A 1KKHA 1Z0GA 4LFBE 2PNMA 2LMZA 4K0KE 4I3HA 2GS8A 3B82A 3OMLA 1N0UA 2KHXA 1DI2A 2Z5CB 2DIXA 4DU7A 1J5EI 2YZTA 1A6FA 1Y4UA 4LF9I 2HK2A 2BM1A 1Z5CA 3Q6MA 2WW4A 4JI3E 1HR0I 3C4BA 1IBLE 1HNWE 2LTRA 3QT8A 5F3WA 2V86A 2VQEE 5IT9C 4PRVA 2K4VA 4DPUA 4DR7I 4DR6I 2R42A 4JI4E 4DV4E 3H4LA 4KHPE 3ZOQB 2MC5A 4DMIA 4B3RE 3ADLA 3J81Q 3HJCA 5FLXC 1FWKA 2UUCE 2RS6A 3J80C 3QT7A 3WU5A 2HFUA 3Q6NA 1NZ0A 1SR9A 2LJPA 1HNXE 4XTJA 3F0NA 1GQEA 3LNUA 2R3VA 1X49A 3QT5A 1UILA 3ZM7A 3HULA 1RR9A 2NPFA 3F6HA 2ODRC 4UTGA 3IWBA 1ZXNA 3WU3A 4IZKB 5LL6R 4HACA 1XNQI 4URLA 2Q2EB 2JY9A 2BV3A 1DQ3A 1NHJA 2ZM6I 4JI7I 3T1HI 4LU9A 4JYAE 2UXDE 3OTOI 4X65E 2X7IA 4B3TI 3AUZA 1NHHA 1N0VC 1Z5AA 4B3SI 4OX9I 2JOXA 4USMA 2VF1A 2LTSA 2B9DA 4F54A 4LF7E 4DV6I 4WUBA 4FN5A 2DB2A 3K6QA 2E1RA 3P06A 1H73A 1FI4A 4WUCA 2GQ0A 4MYUA 1IBKI 4FW9A 1N33I 4J8ZA 4NXMI 4DR4I 4DV2I 2NUFA 1QZRA 2CG9A 4DR2E 1STUA 4F9BB 1ZM3A 4DV5E 4JI8I 4USKA 1ZM2A 4DU8A 4GKKI 2E1MA 1Z0CA 1H74A 3PYGA 2O1VA 4DV3E 2JR1A 3WU6A 1K47A 1HK7A 1S16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM E;  2X36 A;  2IHR 1;  3ZZU A;  5LMU I;  2HKJ A;  1XMQ I;  4M2Z A;  5IWA E;  4WUD A;  1ZM9 A;  3LPS A;  4B3M E;  1XNR E;  1Z5B A;  4JI2 E;  3J7A M;  4DUY I;  1KTV A;  1N36 I;  4JI5 I;  4DR1 E;  2BM0 A;  2N3H A;  4B3S E;  4LFC I;  2VQF I;  1B62 A;  2HK3 A;  4DV6 E;  2UUB E;  5A2Q C;  3PYD A;  4MYT A;  2E5L E;  2A2D A;  1EI1 A;  2A2C A;  4GKJ E;  2L2M A;  4DV0 I;  3ADG A;  4YY3 I;  4DR5 I;  4LFA I;  2UXB I;  2LUP B;  1HNZ I;  1N34 E;  4JG4 A;  4JI0 I;  2UXC E;  3Q1Q A;  1T4L B;  4X64 E;  1X47 A;  2ZBK B;  1XHK A;  1T4O A;  4P52 A;  2UU9 I;  4DKK A;  1N32 E;  4P7A A;  3ZKB A;  3P1X A;  4DV1 E;  4Z7Y A;  2F4V E;  1H7S A;  1PIE A;  3M6A A;  1UHZ A;  1FJG E;  3HTX A;  1H72 C;  4YHH I;  4X62 I;  3JAM C;  3ADI A;  1KIJ A;  4LF4 E;  2VF3 A;  4JI6 I;  4LF5 E;  3ZZ0 A;  4X66 E;  4LF6 E;  5L3J A;  4JV5 I;  4EMD A;  4HAC B;  2RS7 A;  2J7K A;  1Z0V A;  1U2R A;  4WFT A;  1YYW A;  1MG7 A;  4YY3 E;  2V34 A;  4DPW A;  1J5E E;  1Z0T A;  4LF9 E;  2EFG A;  1WHN A;  4WYQ B;  1Z0B A;  1HR0 E;  3LTO A;  2RTX A;  2UUA I;  3ADJ A;  2HHH I;  1FNM A;  1RRE A;  1S4E A;  1VIS A;  1ZBT A;  4R1F A;  4DR7 E;  4DR6 E;  4AQY I;  5LMN I;  5GMD A;  3V5R A;  3ZZT A;  2L3J A;  4DUZ I;  4X62 E;  1I94 I;  4JI1 I;  5BR8 I;  4LFB I;  3CWV A;  4HXZ A;  4K0K I;  2ZIT A;  3VYX A;  3C4T A;  3VYY A;  2L33 A;  3J81 C;  3B78 A;  1XNQ E;  1NHI A;  2LBS B;  2DEI A;  4LF8 I;  1Z0W A;  2ZM6 E;  4DR3 I;  4FWH A;  4JI7 E;  3T1H E;  4JI3 I;  3OTO E;  5FLX Q;  1HNW I;  4B3T E;  2VQE I;  4M30 A;  4OX9 E;  2LJH A;  1X48 A;  4JI4 I;  2DEJ A;  4DV4 I;  2EZ6 A;  1FKA E;  4KHP I;  1B63 A;  1Z59 A;  4B3R I;  2V2V A;  1PKP A;  2UUC I;  1EA6 A;  4OOG C;  1IBK E;  2N3G A;  1N33 E;  4NXM E;  4DR4 E;  1HNX I;  4DV2 E;  2HFS A;  3T1Y I;  4JI8 E;  1ZXM A;  5BR8 E;  2CPN A;  4DV7 I;  4GKK E;  4ED4 A;  1YZ9 A;  4JYA I;  2UXD I;  4X65 I;  1XMO I;  5LMU E;  3QT6 A;  3J7A G;  1XMQ E;  4LF8 E;  3K17 A;  4DR3 E;  1QU6 A;  4RPF A;  2OI2 A;  4LF7 I;  4DUY E;  1N36 E;  4JI5 E;  3K1J A;  4DPT A;  1O0W A;  1ZM4 A;  4LFC E;  2VQF E;  5GME A;  4ZVI A;  1YYK A;  3J7Y p;  2NUE A;  4DR2 I;  3LLH A;  4DV5 I;  4DV0 E;  1WHQ A;  4LFA E;  4DR5 E;  2UXB E;  1HNZ E;  1RC7 A;  1MX0 A;  4NXN I;  4FWD A;  3T1Y E;  4JI0 E;  2XEX A;  3D4J A;  2V2Q A;  1H7U A;  4DV3 I;  4PU9 A;  2L3C A;  2JVA A;  1PVG A;  1FWL A;  4DV7 E;  1IBM I;  2LRS A;  3ZKD A;  2NA2 A;  4HY1 A;  5IWA I;  5A2Q Q;  2UU9 E;  2L2K B;  4B3M I;  2B7T A;  1XMO E;  3V2U C;  1XNR I;  4JI2 I;  1T4N A;  4YHH E;  2LUQ A;  4DR1 I;  2CZ9 A;  2HKE A;  1RQ0 A;  2DMY A;  4JI6 E;  2NUG A;  1J26 A;  5CFF E;  4Z7C A;  1EKZ A;  2UUB I;  4DPX A;  4JV5 E;  1D6T A;  1KVK A;  2E5L I;  1MU5 A;  1UEK A;  5IT9 Q;  4KQV A;  4GKJ I;  1N34 I;  4HYM A;  2UXC I;  3JAM Q;  4X64 I;  2V8P A;  3B8H A;  2RSM A;  2AJ4 A;  4M1K A;  3GON A;  1IBL I;  3J80 Q;  1Z0E A;  4NXN E;  4UT4 A;  2B3T B;  2B7V A;  1N32 I;  1WUU A;  4DV1 I;  2F4V I;  1BKN A;  2UUA E;  1FJG I;  2HHH E;  4DPY A;  2V2Z A;  4FWG A;  1YYO A;  4AQY E;  5LMN E;  4LF4 I;  4DXL A;  2L2N A;  2YT4 A;  4PRX A;  4LF5 I;  4DUZ E;  1I94 E;  4X66 I;  4LF6 I;  1DAR A;  1ELO A;  4JI1 E;  3PYE A;  3PYF A;  2MDR A;  4X8W A;  3WU4 A;  1KKH A;  1Z0G A;  1K47 A;  4LFB E;  4K0K E;  4I3H A;  2GS8 A;  3B82 A;  1N0U A;  2KHX A;  1DI2 A;  2DIX A;  4DU7 A;  1J5E I;  1A6F A;  4LF9 I;  2HK2 A;  2BM1 A;  1Z5C A;  2WW4 A;  4JI3 E;  1HR0 I;  3C4B A;  1IBL E;  1HNW E;  2LTR A;  3QT8 A;  2VQE E;  5IT9 C;  4PRV A;  4DPU A;  4DR7 I;  4DR6 I;  2R42 A;  4JI4 E;  4DV4 E;  3H4L A;  4KHP E;  4B3R E;  3ADL A;  3J81 Q;  5FLX C;  1FWK A;  2UUC E;  2RS6 A;  3QT7 A;  3J80 C;  3WU5 A;  2HFU A;  1NZ0 A;  2LJP A;  4XTJ A;  1HNX E;  3F0N A;  1GQE A;  3LNU A;  2R3V A;  1X49 A;  3QT5 A;  1UIL A;  3ZM7 A;  3HUL A;  1RR9 A;  2NPF A;  4UTG A;  1ZXN A;  3WU3 A;  5LL6 R;  4HAC A;  1XNQ I;  4URL A;  2Q2E B;  2JY9 A;  2BV3 A;  1NHJ A;  2ZM6 I;  4JI7 I;  3T1H I;  4JYA E;  2UXD E;  3OTO I;  4X65 E;  2X7I A;  4B3T I;  1NHH A;  1N0V C;  1Z5A A;  4B3S I;  4OX9 I;  4USM A;  2LTS A;  4LF7 E;  4DV6 I;  4WUB A;  4FN5 A;  2DB2 A;  2E1R A;  1H73 A;  1FI4 A;  4WUC A;  4MYU A;  1IBK I;  4FW9 A;  1N33 I;  4NXM I;  4DR4 I;  4DV2 I;  2NUF A;  1QZR A;  4DR2 E;  1STU A;  1ZM3 A;  4DV5 E;  4JI8 I;  4USK A;  1ZM2 A;  4DU8 A;  4GKK I;  1Z0C A;  1H74 A;  3PYG A;  4DV3 E;  3WU6 A;  1OJ4 A;  1S16 A; 
#chains in the Genus database with same CATH topology
 1IBM E;  2X36 A;  2IHR 1;  2Z5E A;  3ZZU A;  5LMU I;  2Q8U A;  2HKJ A;  2BR2 B;  1XMQ I;  4M2Z A;  2EOH A;  1BBG A;  1T39 A;  5IWA E;  2EMX A;  4WUD A;  4WPY A;  5C0X F;  1ZM9 A;  2JEA A;  3M99 B;  1A1H A;  3LPS A;  4GZN C;  4B3M E;  2JWO A;  3MSW A;  1XNR E;  3B4T A;  2EOS A;  1Z5B A;  4FW7 A;  4JI2 E;  3C6M A;  4R2R A;  3J7A M;  4OO1 F;  4DUY I;  1KTV A;  1N36 I;  4JI5 I;  1KJK A;  5C0X D;  4DR1 E;  5KL6 A;  2BM0 A;  2N3H A;  2EPM X;  4B3S E;  1X5W A;  3U1Y A;  1USU A;  5LLQ A;  3HQ1 A;  4F9C B;  4LFC I;  2VQF I;  1IMU A;  1B62 A;  4OO1 D;  2EM9 A;  4R03 A;  5KL3 A;  1Y4S A;  4DV6 E;  2EN2 A;  2UUB E;  2HK3 A;  5A2Q C;  1VI7 A;  2WBU A;  3HKM A;  2ODR D;  3PYD A;  4ZYG A;  2YU8 A;  4MYT A;  2EMG A;  2E5L E;  2LJU A;  5AE2 A;  2A2D A;  2WNR A;  1EH7 A;  1EI1 A;  3GCM A;  5ADZ A;  3THO B;  2A2C A;  1PDA A;  4GKJ E;  2L2M A;  4DV0 I;  3ADG A;  4YY3 I;  2C39 A;  4DR5 I;  4LFA I;  2UXB I;  2LUP B;  4N3O A;  1HNZ I;  1N34 E;  2EN7 A;  1DGC A;  4JG4 A;  5KL2 A;  3PS3 A;  2NN6 E;  4MDT A;  2YTN A;  2GPI A;  2UXC E;  4JI0 I;  3Q1Q A;  2YTF A;  3RMP A;  1T4L B;  4X64 E;  5EKW A;  1X47 A;  2EMK A;  2ZBK B;  3HPZ A;  1PJQ A;  2EN1 A;  1XHK A;  4MU1 A;  2PRT A;  5DNX A;  1G2F C;  1T4O A;  2YPN A;  4NZV A;  1OYS A;  4P52 A;  2UU9 I;  4DKK A;  1N32 E;  2IOP A;  4P7A A;  3ZKB A;  3P1X A;  5A6J A;  4DV1 E;  2F4V E;  1H7S A;  1PIE A;  4Z7Y A;  3M6A A;  1UHZ A;  5C0X A;  1FJG E;  3HTX A;  1H72 C;  2BA0 D;  3IWD A;  4YHH I;  3AV0 A;  4X62 I;  2YRK A;  3JAM C;  1OJ4 A;  3ADI A;  1KIJ A;  4MLQ A;  4OO1 A;  5K36 F;  4LF4 E;  1LLM C;  2VF3 A;  4JI6 I;  5AC5 A;  3P3C A;  2C38 A;  1YFH A;  1YPN A;  4IZJ D;  4LF5 E;  5KL5 A;  2YTO A;  2BB8 A;  3ZZ0 A;  4X66 E;  2JP9 A;  2R1F A;  4LF6 E;  2LV2 A;  5K36 D;  5L3J A;  4JV5 I;  3THN A;  2V83 A;  4EMD A;  4HAC B;  1GZ6 A;  2RS7 A;  3JTZ A;  1USV A;  4BA2 B;  1SFE A;  2J7K A;  5TSE A;  1Z0V A;  2KOU A;  1U2R A;  4R2P A;  3FIG A;  4FW5 A;  2HGH A;  4WFT A;  4J3D A;  2DSY A;  2J65 A;  2O3Z A;  2EPK X;  2EMI A;  2WZO A;  1YYW A;  1MG7 A;  3F6G A;  2EOO A;  4YY3 E;  2V34 A;  5A6K A;  4DPW A;  2EOF A;  1J5E E;  1TN9 A;  1Z0T A;  4LOM A;  4LF9 E;  2EMY A;  4TUI A;  4MU0 A;  2EFG A;  1WHN A;  4WYQ B;  1PJS A;  1P47 A;  1UBD C;  1OYR A;  1Z0B A;  4OKG A;  1HR0 E;  3LTO A;  2RTX A;  2UUA I;  4IFD C;  2EPZ A;  3ADJ A;  2PO0 A;  2HHH I;  1FNM A;  1RRE A;  1S4E A;  1VIS A;  1ZBT A;  4R1F A;  2Z5B A;  2JXP A;  2EOE A;  2CTD A;  4DR7 E;  1EH6 A;  1WXR A;  4DR6 E;  4AQY I;  2NN6 B;  5LMN I;  1ZR9 A;  4IZJ A;  5GMD A;  3M85 G;  2HJJ A;  2M4I A;  2EQ1 A;  3V5R A;  5K36 A;  1N3G A;  3ZZT A;  2L3J A;  3CDI A;  3QG5 C;  1A1J A;  2BA1 D;  4DUZ I;  4X62 E;  5C0X E;  1I94 I;  1YSA C;  2IOQ A;  4JI1 I;  3EPK A;  1X3C A;  2WBT A;  3L7Z B;  4BA1 B;  2PNL A;  4ZYE A;  4AM3 A;  3DF6 A;  4OO1 E;  2A25 A;  4R2D A;  1XXE A;  5BR8 I;  4LFB I;  1ZBQ A;  2EMW A;  3L00 A;  3CWV A;  4HXZ A;  3VK6 A;  4K0K I;  5AC4 A;  2CSH A;  1YUI A;  2WP8 B;  5A6A A;  4RHB B;  3P3G A;  2PO1 A;  1NEI A;  1QNT A;  2ZIT A;  2EMH A;  3VYX A;  2L8T A;  4LCG A;  3C4T A;  2O1T A;  2FV4 B;  3LML A;  3VYY A;  2L33 A;  2N8X A;  2YWQ A;  2JEA B;  3J81 C;  4BBY A;  1BB8 A;  3B78 A;  1XNQ E;  1NHI A;  2M7Q A;  2LBS B;  2DEI A;  4LF8 I;  1MGT A;  1Z0W A;  2IER A;  2EPX A;  2EN6 A;  2KON A;  2ZM6 E;  4DR3 I;  4JI7 E;  3T1H E;  2BBG A;  4FWH A;  5AE1 A;  1RMD A;  3OTO E;  4JI3 I;  3DD6 A;  2ENH A;  5FLX Q;  2PNZ A;  4B3T E;  2DLQ A;  1HNW I;  2NN6 C;  1S16 A;  1A1I A;  2VE7 C;  2VQE I;  4WXC A;  3M7N D;  4M30 A;  4KZS A;  4OX9 E;  5JEA F;  2LJH A;  1X48 A;  1EH8 A;  3K85 A;  1X6F A;  3U1K A;  4JI4 I;  2DEJ A;  4DV4 I;  3PS1 A;  2EZ6 A;  2WNR B;  1Y60 A;  2EE8 A;  1FKA E;  2EML A;  4KHP I;  2EOJ A;  2O1W A;  2EPC A;  5JEA D;  2G7H A;  2EOQ A;  2LE2 A;  2EPL X;  1P42 A;  2PO2 A;  4IFD A;  1B63 A;  1Z59 A;  2C39 B;  2FTX B;  2V2V A;  2LCE A;  4B3R I;  1PKP A;  2UUC I;  3HXL A;  1EA6 A;  2VRD A;  3C6K A;  2LO3 A;  1X6E A;  2V87 A;  4OOG C;  1IBK E;  2N3G A;  1N33 E;  4WXD A;  4NXM E;  4DR4 E;  1HNX I;  1A1L A;  4U3D A;  2M1S A;  4DV2 E;  5A69 A;  5K36 E;  2HFS A;  1YHC A;  2V85 A;  2YSP A;  3EPJ A;  2MC6 A;  2ENC A;  3EPH A;  3T1Y I;  1JK1 A;  4FW6 A;  4JI8 E;  3DJW A;  1YUJ A;  1ZXM A;  2L6M A;  3BF2 A;  5BR8 E;  5EL9 A;  2F8B A;  2YU5 A;  1A1F A;  2CPN A;  4DV7 I;  4GKK E;  4IS9 A;  4MU3 A;  5C0X B;  1G2D C;  4IFD D;  4ED4 A;  2EWL A;  1YZ9 A;  4JYA I;  2UXD I;  2JEB A;  4X65 I;  5DNY A;  3ECR A;  1XMO I;  4OO1 B;  1UN6 B;  2EM4 A;  2GHF A;  5LMU E;  3QT6 A;  3J7A G;  1XMQ E;  1F2I G;  4LF8 E;  2C38 B;  3K17 A;  2HC5 A;  2Z5C A;  4DR3 E;  5AAS A;  4BC9 A;  4AIM A;  2EMB A;  5IXM B;  1QU6 A;  5JEA A;  3H09 A;  4RPF A;  5FWK A;  2OI2 A;  4LF7 I;  4DUY E;  1N36 E;  4JI5 E;  2NAB A;  4NBQ A;  3K1J A;  4DPT A;  1O0W A;  4BHC A;  2EPO A;  4M0V A;  3PRY A;  1YH8 A;  1ZM4 A;  3UHM A;  2EOX A;  4LFC E;  2VQF E;  2EM3 A;  5GME A;  4I8O A;  2EOR A;  4F2J C;  4ISA A;  4ZVI A;  1YYK A;  2IES A;  2ELZ A;  5T6J A;  3IWC A;  3J7Y p;  2NUE A;  4DR2 I;  3LLH A;  2JT2 A;  4DV5 I;  5DRO A;  4O24 A;  4F9A B;  4HEI A;  2BA1 G;  4DV0 E;  1WHQ A;  4LFA E;  4DR5 E;  2UXB E;  1HNZ E;  1RC7 A;  2L92 A;  2EPN A;  1MX0 A;  2O1U A;  5A6B D;  4FWD A;  4QNK A;  4NXN I;  4OO1 C;  3T1Y E;  4L8N A;  2FGG A;  3BBG A;  2PO0 B;  4JI0 E;  4LPF A;  2XEX A;  3D4J A;  3TQM A;  2V2Q A;  1H7U A;  4DV3 I;  2Z5B B;  4F6M A;  2L3C A;  2JVA A;  2I13 A;  1PVG A;  1UDO A;  4LCH A;  4PU9 A;  1FWL A;  5DRR A;  4IZJ B;  2EJ4 A;  4DV7 E;  1IBM I;  2LRS A;  2V8Q B;  1PJT A;  3ZKD A;  2NA2 A;  4HY1 A;  5K36 B;  5IWA I;  5A2Q Q;  2UU9 E;  2EM5 A;  2L2K B;  2EOY A;  4IS1 C;  4IZK A;  2I9I A;  4B3M I;  4R2C A;  2B7T A;  4BCA A;  1XMO E;  4O4K A;  3V2U C;  1XNR I;  4GQU A;  4JI2 I;  4P78 A;  3KWR A;  1T4N A;  4YHH E;  2LUQ A;  4BMJ A;  2F1D A;  2MKD A;  4DR1 I;  2CZ9 A;  2HKE A;  5AE3 A;  4LTY A;  1RQ0 A;  2DMY A;  4JI6 E;  2NUG A;  2M9A A;  4P7D A;  1J26 A;  2PO1 B;  5CFF E;  1R6L A;  4Z7C A;  1Y5Y A;  1EKZ A;  3M7N G;  2YSO A;  2C37 A;  2UUB I;  2EL4 A;  5JEA E;  2RQL A;  2YTD A;  4MU4 A;  2YTE A;  4JV5 E;  4DPX A;  1Y6Z A;  1D6T A;  1KVK A;  2E5L I;  1MU5 A;  1UEK A;  5IT9 Q;  4KQV A;  1WJP A;  2JE6 B;  5A6B A;  2LT7 A;  2CGE A;  2EL6 A;  2EN4 A;  4GKJ I;  2R76 A;  4L5N C;  1TF6 A;  4RH8 A;  5ELW A;  1AH5 A;  1GTK A;  2V88 A;  1N34 I;  2DRP A;  4HYM A;  2PNZ B;  5DRP A;  5IV8 B;  4BS9 A;  4O5G A;  2UXC I;  3JAM Q;  3MHS C;  3MHH C;  4X64 I;  2V8P A;  3B8H A;  4Q28 A;  2RSM A;  2EPP A;  2AE8 A;  2AJ4 A;  3GON A;  5KL4 A;  4M1K A;  1IBL I;  3J80 Q;  1Z0E A;  4NXN E;  3PS2 A;  2V89 A;  4WX9 A;  4O43 A;  3CDJ A;  4UT4 A;  2B3T B;  2B7V A;  1N32 I;  1WUU A;  4TUG A;  4DV1 I;  2PO2 B;  2F4V I;  2ELY A;  1BKN A;  2UUA E;  4U3B A;  3P3E A;  1FJG I;  4KWY A;  3M85 D;  2HHH E;  2H36 X;  1BBO A;  4DPY A;  2V2Z A;  4FWG A;  4R8O A;  2EM7 A;  1YYO A;  4AQY E;  3HPS A;  5LMN E;  2JE6 A;  4LF4 I;  2BA0 G;  4DXL A;  2JOB A;  2BR2 A;  2L2N A;  2YT4 A;  1A1K A;  4M9V C;  4PRX A;  4WSP A;  4LF5 I;  5DRQ A;  4DUZ E;  1I94 E;  4X66 I;  4LF6 I;  4GEQ B;  1DAR A;  1ELO A;  4JI1 E;  3PYE A;  3PYF A;  2MDR A;  4BHB A;  3GME A;  1ZU1 A;  4X8W A;  1R6M A;  2EM2 A;  4BC7 A;  3JU0 A;  4IFD F;  3WU4 A;  2EOM A;  1KKH A;  1Z0G A;  4AID A;  4LFB E;  2PNM A;  2LMZ A;  4ZYD A;  4K0K E;  2J7J A;  2DLK A;  2JEB B;  4N4R B;  4R2E A;  4I3H A;  2GS8 A;  3BGH A;  3B82 A;  3OML A;  5KL7 A;  1N0U A;  2KHX A;  1DI2 A;  2Z5C B;  2DIX A;  1NCS A;  2CT1 A;  4DU7 A;  2EN3 A;  1J5E I;  2YZT A;  1A6F A;  2D9H A;  1Y4U A;  5JEA B;  4LF9 I;  2HK2 A;  2BM1 A;  1Z5C A;  2EMA A;  3Q6M A;  2WW4 A;  1UDQ A;  4JI3 E;  1HR0 I;  1IQO A;  3C4B A;  1IBL E;  1IQS A;  2K7I A;  1HNW E;  3GLL A;  2RPC A;  3H1C A;  2LTR A;  3QT8 A;  4IJD A;  2DMI A;  2V86 A;  5F3W A;  2YRM A;  2VQE E;  5IT9 C;  4PRV A;  2K4V A;  4DPU A;  2MKN A;  4DR7 I;  4WSG A;  4DR6 I;  2R42 A;  1AAY A;  4JI4 E;  3EPL A;  1JK2 A;  4DV4 E;  2DGC A;  3P76 A;  3H4L A;  4X9J A;  4KHP E;  2EMZ A;  3ZOQ B;  2MC5 A;  2ADR A;  4HTG A;  3VHT B;  4DMI A;  2GO4 A;  4B3R E;  1ZAA C;  3ADL A;  3J81 Q;  4Q35 B;  3HJC A;  2EN8 A;  4IFD B;  5FLX C;  1TF3 A;  1FWK A;  2UUC E;  2RS6 A;  3J80 C;  3QT7 A;  3WU5 A;  2HFU A;  3Q6N A;  5C0X C;  2NN6 F;  1NZ0 A;  1E3H A;  1SR9 A;  2LJP A;  1HNX E;  4XTJ A;  4FK5 C;  3F0N A;  4OZE A;  2YTQ A;  1GQE A;  3LNU A;  2R3V A;  1X49 A;  3QT5 A;  1UIL A;  3ZM7 A;  4FW3 A;  1KYQ A;  4ZYH A;  2NN6 D;  3HUL A;  4QNJ A;  2LVH A;  2YRH A;  1RR9 A;  3F6H A;  2NPF A;  5JEA C;  2ODR C;  4UTG A;  2YTG A;  3IWB A;  2EMF A;  1UDS A;  1ZXN A;  3WU3 A;  2EQ3 A;  4IZK B;  5LL6 R;  4LCF A;  1OYP A;  4HAC A;  3BID A;  2GLI A;  4URL A;  2Q2E B;  2JY9 A;  4FW4 A;  1XNQ I;  3KZZ A;  2EOI A;  2BV3 A;  4BA2 A;  1DQ3 A;  1X6H A;  1NHJ A;  1T38 A;  1MEY C;  2ZM6 I;  3T1H I;  4JI7 I;  4LU9 A;  4JYA E;  4NHR A;  2UXD E;  3OTO I;  4X65 E;  2X7I A;  2WBS A;  2YTP A;  4B3T I;  3AUZ A;  1NHH A;  4MQY A;  3KZY A;  2EM8 A;  2EPU A;  1N0V C;  1RHY A;  2EP3 A;  1Z5A A;  2YTJ A;  4B3S I;  2C37 B;  4OX9 I;  2JOX A;  4USM A;  2VF1 A;  2JYA A;  2LTS A;  2CVE A;  2GO3 A;  2B9D A;  4F54 A;  4LF7 E;  3UK3 C;  1L4S A;  4WUB A;  4FN5 A;  4R2Q A;  4DV6 I;  2DB2 A;  3K6Q A;  2E1R A;  3P06 A;  2EPA A;  1H73 A;  1FI4 A;  4MLV A;  2EOZ A;  4WUC A;  1A1G A;  1UDN A;  2GQ0 A;  4MYU A;  2MDG A;  2ENA A;  2VES A;  4FW9 A;  1IBK I;  1N33 I;  4J8Z A;  2RSI A;  1E3P A;  4NXM I;  4DR4 I;  2NN6 A;  2WCC 3;  4R2S A;  4DV2 I;  1B69 A;  2NUF A;  1QZR A;  2CG9 A;  4DR2 E;  1STU A;  4F9B B;  1ZM3 A;  2JPA A;  2EPR A;  4DV5 E;  4F6N A;  4JI8 I;  4USK A;  2EM6 A;  5K36 C;  2E72 A;  1ZM2 A;  2EM0 A;  1WRJ A;  4DU8 A;  4GKK I;  2E1M A;  1Z0C A;  1H74 A;  3L7Z A;  4BA1 A;  4IFD E;  5DNL A;  2EL5 A;  1Z1B A;  2O1V A;  3PYG A;  3EQ1 A;  2EMC A;  4DV3 E;  2YTI A;  3NZK A;  2JR1 A;  2WP8 A;  3KRN A;  3WU6 A;  1K47 A;  2EQ0 A;  1HK7 A;  4R2A A; 
#chains in the Genus database with same CATH homology
 1IBM E;  2X36 A;  2IHR 1;  2Z5E A;  3ZZU A;  5LMU I;  2HKJ A;  1XMQ I;  4M2Z A;  5IWA E;  4WUD A;  4WPY A;  1ZM9 A;  3LPS A;  4B3M E;  2JWO A;  3MSW A;  1XNR E;  1Z5B A;  4JI2 E;  3J7A M;  4DUY I;  1KTV A;  1N36 I;  4JI5 I;  4DR1 E;  2BM0 A;  2N3H A;  4B3S E;  1USU A;  3HQ1 A;  4F9C B;  4LFC I;  2VQF I;  1B62 A;  4R03 A;  1Y4S A;  2HK3 A;  4DV6 E;  2UUB E;  5A2Q C;  2ODR D;  3PYD A;  4MYT A;  2E5L E;  2A2D A;  5AE2 A;  1EI1 A;  5ADZ A;  2A2C A;  4GKJ E;  2L2M A;  4DV0 I;  3ADG A;  4YY3 I;  4DR5 I;  4LFA I;  2UXB I;  2LUP B;  4N3O A;  1HNZ I;  1N34 E;  4JG4 A;  4JI0 I;  2UXC E;  3Q1Q A;  3RMP A;  1T4L B;  4X64 E;  1X47 A;  2ZBK B;  3HPZ A;  1XHK A;  1T4O A;  4P52 A;  2UU9 I;  4DKK A;  1N32 E;  2IOP A;  4P7A A;  3ZKB A;  3P1X A;  4DV1 E;  4Z7Y A;  2F4V E;  1H7S A;  1PIE A;  3M6A A;  1UHZ A;  1FJG E;  3HTX A;  1H72 C;  3IWD A;  4YHH I;  3AV0 A;  4X62 I;  3JAM C;  1OJ4 A;  3ADI A;  1KIJ A;  4LF4 E;  2VF3 A;  4JI6 I;  4IZJ D;  4LF5 E;  3ZZ0 A;  4X66 E;  4LF6 E;  5L3J A;  4JV5 I;  4EMD A;  2V83 A;  4HAC B;  1GZ6 A;  2RS7 A;  3JTZ A;  1USV A;  2J7K A;  1Z0V A;  2KOU A;  1U2R A;  3FIG A;  4WFT A;  2DSY A;  2WZO A;  1YYW A;  1MG7 A;  3F6G A;  4YY3 E;  2V34 A;  4DPW A;  1J5E E;  1Z0T A;  4LF9 E;  4TUI A;  2EFG A;  1WHN A;  4WYQ B;  1Z0B A;  1HR0 E;  3LTO A;  2RTX A;  2UUA I;  3ADJ A;  2HHH I;  1FNM A;  1RRE A;  1S4E A;  1VIS A;  1ZBT A;  4R1F A;  2Z5B A;  4DR7 E;  4DR6 E;  1WXR A;  4AQY I;  5LMN I;  4IZJ A;  5GMD A;  2M4I A;  3V5R A;  3ZZT A;  2L3J A;  4DUZ I;  4X62 E;  1I94 I;  2IOQ A;  4JI1 I;  2PNL A;  3DF6 A;  5BR8 I;  4LFB I;  1ZBQ A;  3CWV A;  4HXZ A;  3VK6 A;  4K0K I;  2ZIT A;  3VYX A;  2L8T A;  3C4T A;  2O1T A;  2FV4 B;  3LML A;  3VYY A;  2L33 A;  3J81 C;  4BBY A;  3B78 A;  1XNQ E;  1NHI A;  2M7Q A;  2LBS B;  2DEI A;  4LF8 I;  1Z0W A;  2KON A;  2ZM6 E;  4DR3 I;  4JI7 E;  3T1H E;  4FWH A;  4JI3 I;  5AE1 A;  3OTO E;  5FLX Q;  1HNW I;  4B3T E;  2VE7 C;  2VQE I;  4M30 A;  4KZS A;  4OX9 E;  2LJH A;  1X48 A;  3K85 A;  4JI4 I;  2DEJ A;  4DV4 I;  2EZ6 A;  1FKA E;  4KHP I;  2O1W A;  2LE2 A;  2G7H A;  1B63 A;  1Z59 A;  4B3R I;  2FTX B;  2V2V A;  1PKP A;  2UUC I;  3HXL A;  1EA6 A;  2V87 A;  4OOG C;  1IBK E;  2N3G A;  1N33 E;  4NXM E;  4DR4 E;  1HNX I;  2M1S A;  4DV2 E;  2HFS A;  2V85 A;  3T1Y I;  2MC6 A;  4JI8 E;  3DJW A;  1ZXM A;  2L6M A;  5BR8 E;  2F8B A;  2CPN A;  4DV7 I;  4GKK E;  4ED4 A;  2EWL A;  1YZ9 A;  4JYA I;  2UXD I;  4X65 I;  5DNY A;  1XMO I;  5LMU E;  3QT6 A;  3J7A G;  1XMQ E;  4LF8 E;  3K17 A;  2Z5C A;  4DR3 E;  5AAS A;  4BC9 A;  1QU6 A;  3H09 A;  4RPF A;  5FWK A;  2OI2 A;  4LF7 I;  4DUY E;  1N36 E;  4JI5 E;  3K1J A;  4DPT A;  1O0W A;  4M0V A;  3PRY A;  1ZM4 A;  4LFC E;  2VQF E;  5GME A;  4I8O A;  4ZVI A;  1YYK A;  5T6J A;  3IWC A;  3J7Y p;  2NUE A;  4DR2 I;  3LLH A;  4DV5 I;  4F9A B;  4DV0 E;  1WHQ A;  4LFA E;  4DR5 E;  2UXB E;  1HNZ E;  1RC7 A;  2L92 A;  1MX0 A;  2O1U A;  4FWD A;  4NXN I;  3T1Y E;  4L8N A;  2FGG A;  4JI0 E;  2XEX A;  3D4J A;  2V2Q A;  1H7U A;  4DV3 I;  2Z5B B;  4PU9 A;  2L3C A;  2JVA A;  1PVG A;  1FWL A;  4IZJ B;  4DV7 E;  1IBM I;  2LRS A;  2V8Q B;  3ZKD A;  2NA2 A;  4HY1 A;  5IWA I;  5A2Q Q;  2UU9 E;  2L2K B;  4IZK A;  4B3M I;  4BCA A;  2B7T A;  1XMO E;  3V2U C;  1XNR I;  4JI2 I;  4P78 A;  3KWR A;  1T4N A;  4YHH E;  2LUQ A;  4BMJ A;  4DR1 I;  2CZ9 A;  2HKE A;  5AE3 A;  4LTY A;  1RQ0 A;  2DMY A;  2NUG A;  1J26 A;  4P7D A;  4JI6 E;  5CFF E;  4Z7C A;  1EKZ A;  2UUB I;  4DPX A;  4JV5 E;  1D6T A;  1Y6Z A;  1KVK A;  2E5L I;  1MU5 A;  1UEK A;  5IT9 Q;  4KQV A;  2CGE A;  4GKJ I;  4L5N C;  2V88 A;  1N34 I;  4HYM A;  4BS9 A;  2UXC I;  3JAM Q;  4X64 I;  2V8P A;  3B8H A;  4Q28 A;  2RSM A;  2AJ4 A;  4M1K A;  3GON A;  1IBL I;  3J80 Q;  1Z0E A;  4NXN E;  2V89 A;  4UT4 A;  2B3T B;  2B7V A;  1N32 I;  1WUU A;  4TUG A;  4DV1 I;  2F4V I;  1BKN A;  2UUA E;  1FJG I;  2HHH E;  2H36 X;  4DPY A;  2V2Z A;  4FWG A;  4R8O A;  1YYO A;  4AQY E;  3HPS A;  5LMN E;  4LF4 I;  4DXL A;  2JOB A;  2L2N A;  2YT4 A;  4PRX A;  4WSP A;  4LF5 I;  4DUZ E;  1I94 E;  4X66 I;  4LF6 I;  4GEQ B;  1DAR A;  1ELO A;  4JI1 E;  3PYE A;  3PYF A;  2MDR A;  4X8W A;  4BC7 A;  3JU0 A;  3WU4 A;  1KKH A;  1Z0G A;  4LFB E;  2PNM A;  2LMZ A;  4K0K E;  4I3H A;  2GS8 A;  3B82 A;  3OML A;  1N0U A;  2KHX A;  1DI2 A;  2Z5C B;  2DIX A;  4DU7 A;  1J5E I;  2YZT A;  1A6F A;  1Y4U A;  4LF9 I;  2HK2 A;  2BM1 A;  1Z5C A;  3Q6M A;  2WW4 A;  4JI3 E;  1HR0 I;  3C4B A;  1IBL E;  1HNW E;  2LTR A;  3QT8 A;  5F3W A;  2V86 A;  2VQE E;  5IT9 C;  4PRV A;  2K4V A;  4DPU A;  4DR7 I;  4DR6 I;  2R42 A;  4JI4 E;  4DV4 E;  3H4L A;  4KHP E;  3ZOQ B;  2MC5 A;  4DMI A;  4B3R E;  3ADL A;  3J81 Q;  3HJC A;  5FLX C;  1FWK A;  2UUC E;  2RS6 A;  3J80 C;  3QT7 A;  3WU5 A;  2HFU A;  3Q6N A;  1NZ0 A;  1SR9 A;  2LJP A;  1HNX E;  4XTJ A;  3F0N A;  1GQE A;  3LNU A;  2R3V A;  1X49 A;  3QT5 A;  1UIL A;  3ZM7 A;  3HUL A;  1RR9 A;  2NPF A;  3F6H A;  2ODR C;  4UTG A;  3IWB A;  1ZXN A;  3WU3 A;  4IZK B;  5LL6 R;  4HAC A;  1XNQ I;  4URL A;  2Q2E B;  2JY9 A;  2BV3 A;  1DQ3 A;  1NHJ A;  2ZM6 I;  4JI7 I;  3T1H I;  4LU9 A;  4JYA E;  2UXD E;  3OTO I;  4X65 E;  2X7I A;  4B3T I;  3AUZ A;  1NHH A;  1N0V C;  1Z5A A;  4B3S I;  4OX9 I;  2JOX A;  4USM A;  2VF1 A;  2LTS A;  2B9D A;  4F54 A;  4LF7 E;  4DV6 I;  4WUB A;  4FN5 A;  2DB2 A;  3K6Q A;  2E1R A;  3P06 A;  1H73 A;  1FI4 A;  4WUC A;  2GQ0 A;  4MYU A;  1IBK I;  4FW9 A;  1N33 I;  4J8Z A;  4NXM I;  4DR4 I;  4DV2 I;  2NUF A;  1QZR A;  2CG9 A;  4DR2 E;  1STU A;  4F9B B;  1ZM3 A;  4DV5 E;  4JI8 I;  4USK A;  1ZM2 A;  4DU8 A;  4GKK I;  2E1M A;  1Z0C A;  1H74 A;  3PYG A;  2O1V A;  4DV3 E;  2JR1 A;  3WU6 A;  1K47 A;  1HK7 A;  1S16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...