4B3RE

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3rE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3rE02
1HNXE 1XHKA 2X36A 4JG4A 4KHPI 4JYAE 1FI4A 1KTVA 1YYOA 1ZXNA 4KQVA 1MX0A 5BR8I 1I94E 4FWHA 4GKJE 4MYTA 4DUZE 1S16A 1Z0BA 1HNWI 4JI5E 4AQYE 4NXNE 1ZM2A 2EZ6A 2L3CA 1ZBTA 1H7SA 1RC7A 3QT6A 3LTOA 2V8PA 4FWGA 2VQFE 3ZKDA 2MDRA 2NUEA 4B3SE 4LFAI 1NHJA 3B8HA 4LFCE 1J5EE 1HNZI 3C4TA 1IBLI 2V2QA 4B3TE 4DR3E 2E5LI 3J7Yp 2IHR1 2LRSA 4DV1I 3QT7A 2JY9A 1EA6A 4LF9I 1O0WA 4EMDA 4LF7I 4X66E 2UUCI 4LF5I 4YHHE 4DPUA 1N32E 4DR6E 1N0VC 4B3RI 4DV3I 4DR1I 5LL6R 3GONA 2N3GA 2UU9I 3H4LA 3LNUA 4P52A 1ZM4A 1XNQI 3J81C 4UTGA 4PRVA 3PYGA 4JI0I 4X8WA 4LF6E 4X62E 5FLXC 4DR2E 3QT5A 5LMNE 2CZ9A 2E1RA 3ZM7A 1WHNA 2HKJA 1U2RA 3J7AM 1UHZA 2RS7A 2A2DA 4LFBI 4JI4E 4DV6E 1EI1A 2B3TB 4B3MI 2HHHI 2KHXA 4OX9I 2ZM6I 4KHPE 4DV5E 4JI1E 4FN5A 5IWAI 3OTOI 1N36I 1PKPA 1FJGI 4USMA 3Q1QA 1T4NA 5LMUI 2HFUA 1HR0I 4X65E 4ZVIA 1WUUA 1DARA 3WU6A 4JI6I 1FKAE 2EFGA 1PIEA 3PYDA 1X47A 1XNRI 2UXDI 2GS8A 2LJPA 2UUAI 1N34I 1H74A 3C4BA 4LF8E 4NXMI 2HKEA 1GQEA 2CPNA 2LUQA 2NUFA 4XTJA 4HXZA 2HFSA 4WUBA 1MG7A 4DR5E 4JI8E 4DV1E 4DV2I 2XEXA 4WYQB 1RQ0A 4LF4E 4M2ZA 2UXCI 1MU5A 1PVGA 2Q2EB 3LLHA 4WFTA 1N33E 1NZ0A 2N3HA 2V2ZA 1XMOI 4K0KI 3ADGA 1DI2A 4B3RE 4YY3I 5L3JA 4DR1E 2VQEI 2UUBI 1EKZA 4DR7I 4GKKI 4JV5E 4X64I 3T1HI 1XNQE 4DPXA 4DUYI 5IT9Q 1IBME 4DV7E 2UXBE 2F4VE 4JI7E 1B63A 2RSMA 1HNXI 1Z5BA 1K47A 4P7AA 3P1XA 4JYAI 2LUPB 4LFBE 3WU5A 1XMQE 4JI3E 4DR4E 1A6FA 1B62A 1KKHA 1I94I 4GKJI 4DUZI 4OX9E 1H73A 4DPYA 4JI5I 4AQYI 4PRXA 2B7VA 3VYYA 5CFFE 3CWVA 4WUDA 3WU4A 5LMUE 2JVAA 2V2VA 4B3SI 4DV4E 1IBKE 2DB2A 4LFCI 4JI2E 1J5EI 2UXDE 1BKNA 4DV0E 4FWDA 4DR3I 4DU8A 2X7IA 5A2QQ 4RPFA 3V2UC 4M30A 4X66I 2R42A 4M1KA 1KIJA 5BR8E 3HTXA 1T4OA 3T1YI 4YHHI 4DKKA 1N32I 4DR6I 1HNWE 2BV3A 4DV2E 3K1JA 3WU3A 4DU7A 4HY1A 3D4JA 2ZBKB 1ZM9A 2AJ4A 1Z0TA 2R3VA 2VQEE 1QU6A 2UUBE 1YYWA 4LFAE 4LF6I 4X62I 4DR2I 5LMNI 4GKKE 1X48A 4USKA 1HNZE 3HULA 1IBLE 2YT4A 3V5RA 2E5LE 4DUYE 2V34A 4JI4I 4DV6I 3J7AG 4LF9E 4HYMA 4PU9A 2L2NA 4LF7E 3J80Q 1Z0VA 2L33A 2UUCE 2WW4A 5GMEA 4JI1I 4DV5I 4LF5E 1Z5CA 3ZZUA 3ZZ0A 2NA2A 4DV3E 3J80C 3ADJA 4DXLA 1QZRA 4X65I 2UU9E 5GMDA 1H72C 4R1FA 1Z0CA 1Z0EA 4Z7YA 1NHHA 2BM1A 4JI0E 3LPSA 3ZKBA 1NHIA 2HK3A 1STUA 5IT9C 2OI2A 3ADIA 4LF8I 3K17A 2LJHA 1Z59A 1FNMA 4DPTA 4B3ME 3B78A 2NUGA 2HHHE 1Z5AA 1RR9A 2ZM6E 4DR5I 4JI8I 1KVKA 1RREA 5IWAE 4LF4I 4NXNI 3OTOE 1T4LB 1X49A 1N36E 1ZM3A 1N33I 1N0UA 1FJGE 2L2MA 4Z7CA 3T1YE 1OJ4A 1HR0E 2VQFI 2LBSB 2L3JA 3J81Q 2BM0A 4ED4A 3M6AA 1YZ9A 4UT4A 1S4EA 4JI6E 2DEIA 4I3HA 5FLXQ 2DEJA 4HACA 4JV5I 1XNRE 4HACB 1Z0WA 4B3TI 3ADLA 2L2KB 1IBMI 2UUAE 1N34E 4DV7I 1ELOA 2UXBI 2F4VI 4JI7I 3VYXA 4URLA 4NXME 1ZXMA 1D6TA 3JAMQ 5A2QC 1H7UA 2ZITA 2HK2A 1XMQI 2LTSA 3QT8A 1UILA 2DMYA 4MYUA 1YYKA 4JI3I 4DR4I 4FW9A 1VISA 3PYFA 1J26A 4WUCA 2UXCE 3JAMC 2A2CA 2NPFA 2DIXA 1Z0GA 4DPWA 4K0KE 1XMOE 1WHQA 3F0NA 2RS6A 4YY3E 1FWKA 1FWLA 3ZZTA 3B82A 4DR7E 4X64E 3T1HE 4DV4I 1IBKI 2LTRA 2J7KA 2B7TA 2VF3A 4JI2I 3PYEA 2RTXA 4OOGC 1UEKA 4DV0I
chains in the Genus database with same CATH superfamily
1HNXE 1EH8A 4TUIA 4L5NC 1XHKA 4NHRA 3GLLA 1MGTA 2X36A 4JG4A 4KHPI 1A1GA 4JYAE 5AE2A 4R2RA 2YTFA 2WP8A 4MU4A 1FI4A 4FW5A 1RMDA 3NZKA 1KTVA 2WP8B 4MQYA 4R03A 1YYOA 1UBDC 1ZXNA 4KQVA 3AV0A 2EM4A 2K4VA 2L8TA 1MX0A 1Y6ZA 3K6QA 2WNRB 1DQ3A 3B4TA 5BR8I 4U3BA 1I94E 4FWHA 4GKJE 4MYTA 2EPPA 1USUA 4DUZE 1S16A 2YWQA 1TF6A 2O1WA 5DRQA 1Z0BA 1HNWI 4JI5E 4AQYE 4NXNE 2YU8A 1ZM2A 3BF2A 4R2QA 2EZ6A 2L3CA 1OYPA 1ZBTA 2EN1A 4R2EA 1H7SA 2BA1G 2YTPA 1RC7A 2JXPA 2BA1D 3QT6A 5KL2A 2IOPA 5DNYA 4F9CB 2WBUA 2V8PA 3LTOA 4FWGA 2VQFE 4LCHA 4LCFA 3KZYA 3CDJA 2CGEA 3M99B 3ZKDA 2MKNA 2MDRA 2NN6C 2NUEA 1L4SA 4B3SE 4LFAI 4WSPA 3EPKA 2VF1A 1NHJA 2C38A 4IS1C 3B8HA 1T39A 2R76A 4LFCE 1J5EE 4MU0A 3THNA 2JWOA 3LMLA 3C4TA 3EPHA 1HNZI 2PNZA 4F9BB 1IBLI 4GEQB 2I9IA 2V2QA 4B3TE 4DR3E 2WZOA 2E5LI 3J7Yp 5DNLA 2IHR1 3C6MA 1A1LA 2LRSA 1BBOA 2F8BA 3L7ZA 3QT7A 4U3DA 4DV1I 2JY9A 3MHHC 1EA6A 4LF9I 2EM6A 4KZSA 4OO1F 2BA0G 1O0WA 4EMDA 4LF7I 4X66E 2YU5A 2CTDA 4WXDA 2UUCI 2MC6A 3AUZA 2PO2B 1A1KA 4LF5I 3PS1A 5K36C 1SFEA 4YHHE 2DMIA 4DPUA 4O4KA 1N32E 4DR6E 1N0VC 2M4IA 4MDTA 4DV3I 4DR1I 2CT1A 4B3RI 2Z5BB 1ZU1A 3H1CA 3C6KA 2I13A 1T38A 3P3GA 5LL6R 3GONA 4RH8A 2LMZA 4P7DA 1F2IG 1SR9A 2N3GA 2UU9I 3H4LA 3LNUA 4P52A 2LE2A 1ZM4A 1XNQI 3J81C 3HKMA 5IXMB 4OO1A 1NEIA 4UTGA 4PRVA 3PYGA 5JEAE 4JI0I 2EPCA 1PJSA 4X8WA 3U1KA 5FLXC 4X62E 4LF6E 4DR2E 2EM9A 1WRJA 5LMNE 2GPIA 2CSHA 2CZ9A 3QT5A 1E3PA 2E1RA 2Z5CA 2PNLA 3FIGA 3ZM7A 1WHNA 2HKJA 1AAYA 1U2RA 2Z5CB 4FK5C 3J7AM 1UHZA 2RS7A 2A2DA 2O1TA 4LFBI 2J65A 1MEYC 2JEBB 4ISAA 4JI4E 4OO1C 4DV6E 1EI1A 2B3TB 4B3MI 2EN3A 2HHHI 2EMFA 2KHXA 2B9DA 2RPCA 4OX9I 4FW6A 2ZM6I 4KHPE 4P78A 5JEAF 5C0XC 2EMGA 2EJ4A 4DV5E 4JI1E 4FN5A 3KRNA 5IWAI 2FV4B 4TUGA 4BHBA 1YPNA 3OTOI 1ZBQA 1N36I 5T6JA 1PKPA 2N8XA 2EE8A 2EMXA 5EKWA 4USMA 2V83A 5JEAD 4DUYI 3Q1QA 1FJGI 1T4NA 5LMUI 1RHYA 2HFUA 1YSAC 4QNJA 4R2DA 1HR0I 4R2CA 4X65E 4F9AB 4ZVIA 4BBYA 2EN8A 2JYAA 3VK6A 3BIDA 1WUUA 1DARA 2EM7A 2ODRC 2AE8A 1UDOA 3WU6A 2EWLA 1FKAE 4AIMA 4JI6I 2EFGA 1PIEA 2M7QA 3PS2A 5ADZA 3PYDA 1X47A 1XNRI 2UXDI 2EL6A 2GS8A 2IOQA 2O3ZA 3DD6A 2YTIA 5JEAB 2LJPA 1GZ6A 2UUAI 5KL6A 1N34I 5F3WA 1H74A 3C4BA 2BBGA 2NABA 5KL5A 4LF8E 5A69A 4NXMI 2HKEA 1UDNA 1Z1BA 4WSGA 1GQEA 2CPNA 2LUQA 2EMZA 2EOSA 2WNRA 3EPLA 2YTNA 2EMHA 2NUFA 4N3OA 4XTJA 4HXZA 2PO0A 2HFSA 2PO0B 4WUBA 2EOEA 1MG7A 4DR5E 4ZYGA 4JI8E 4DV1E 2CG9A 5LLQA 4DV2I 4BA2A 2XEXA 1JK2A 4WYQB 2GO4A 4BA2B 1RQ0A 4LF4E 2EMLA 2DLKA 4M2ZA 2UXCI 3HQ1A 1MU5A 1PVGA 2Q2EB 4M0VA 3LLHA 4WFTA 2CVEA 2F1DA 1N33E 1NZ0A 2N3HA 2V2ZA 1XMOI 4K0KI 3ADGA 3U1YA 1DI2A 2E1MA 2M9AA 4B3RE 4YY3I 4BC9A 4DR1E 5L3JA 2VQEI 2UUBI 1EKZA 2IESA 2LCEA 2D9HA 5TSEA 4DR7I 4GKKI 3P3EA 2JOBA 4JV5E 4X64I 2EORA 3T1HI 2JEAB 1XNQE 4KWYA 3F6HA 4N4RB 2YTEA 2YTDA 3EQ1A 3HXLA 3KZZA 2GHFA 4WPYA 4WXCA 1IBME 4GZNC 3P76A 4DV7E 2UXBE 2YTQA 2F4VE 3QG5C 4JI7E 4NBQA 5K36D 2EL4A 2EPNA 5EL9A 2EOIA 1B63A 4AM3A 2RSMA 1HNXI 2DRPA 1Z5BA 2BA0D 1YH8A 4F6MA 1K47A 2JT2A 4P7AA 3P1XA 2YPNA 4JYAI 2PO2A 2LUPB 2M1SA 4F54A 4IZKA 2VESA 4LFBE 2EP3A 3WU5A 4IZKB 1XMQE 2V85A 1X6FA 4JI3E 4DR4E 2HJJA 1A6FA 1B62A 2Z5BA 2VQFI 2EL5A 5AE1A 1KKHA 4LU9A 1I94I 4X9JA 4LPFA 4GKJI 2JR1A 4DUZI 4IFDE 3GMEA 4OX9E 1H73A 3Q6NA 4DPYA 1KJKA 1E3HA 2IERA 3DJWA 2EM5A 4AQYI 4PRXA 4BS9A 2B7VA 4JI5I 2PO1A 4OKGA 3EPJA 3DF6A 4O24A 2PO1B 3VYYA 5CFFE 2FGGA 3KWRA 5KL3A 2KONA 3CWVA 4WUDA 3WU4A 2EMYA 4DMIA 4R2PA 2DLQA 3JU0A 4LTYA 1ZAAC 5LMUE 2YSOA 2J7JA 2JVAA 2BR2B 2V2VA 4NZVA 2EOJA 5IT9Q 4B3SI 4DV4E 3L00A 2JEBA 1IBKE 4MLQA 4ZYDA 2DB2A 1NCSA 4LFCI 4JI2E 1J5EI 2UXDE 1BKNA 4DV0E 4FWDA 2EQ1A 2E72A 2MKDA 4J8ZA 1BB8A 1P42A 4IS9A 4DU8A 4DR3I 2YTJA 2X7IA 5A2QQ 4BC7A 4RPFA 3V2UC 4IFDD 2LJUA 4QNKA 5A6JA 3TQMA 2ADRA 2EMIA 4M30A 4X66I 1PJQA 2HC5A 2EOQA 2R42A 3Q6MA 4M1KA 1KIJA 2DGCA 5BR8E 3HTXA 1T4OA 2EPXA 3T1YI 2EMKA 2ENHA 4YHHI 2EOYA 2ELZA 4Q28A 4DKKA 2JOXA 1GTKA 1N32I 4DR6I 1HNWE 2BV3A 4L8NA 4DV2E 3K1JA 2YSPA 3WU3A 4IFDB 2NN6E 4I8OA 1IQSA 1PDAA 2EQ0A 3IWDA 4DPXA 2C37B 1G2DC 4DU7A 4HY1A 4ZYHA 2EPZA 2EOFA 3D4JA 2VE7C 1YFHA 5A6AA 2ZBKB 4R2AA 2LVHA 5AC5A 1ZM9A 1IMUA 1KYQA 2AJ4A 5JEAA 1Z0TA 2R3VA 1IQOA 2WBSA 2VQEE 1QU6A 2UUBE 1YYWA 1X5WA 4LFAE 4LF6I 4X62I 1Y5YA 4DR2I 1JK1A 5LMNI 2EM0A 4GKKE 1X48A 4USKA 1HNZE 2EN4A 2YRHA 3HULA 1IBLE 2YT4A 5A6KA 2C39A 3V5RA 2EPLX 2C39B 2E5LE 4DUYE 2V34A 2NN6F 5JEAC 2EOMA 4JI4I 3P06A 5K36E 1QNTA 3J7AG 4DV6I 5FWKA 4LF9E 3JTZA 4GQUA 4HYMA 3PS3A 4PU9A 5KL4A 2V88A 2L2NA 2EPAA 3IWCA 4LF7E 2NN6D 3J80Q 1Z0VA 2EMCA 2L33A 2FTXB 2UUCE 3M85G 2WW4A 1R6LA 2EOZA 5GMEA 3M85D 4JI1I 4DV5I 4LF5E 3BGHA 1ZR9A 4O43A 1Z5CA 4OZEA 3ZZUA 4BA1A 2GO3A 1A1FA 3ZZ0A 4BA1B 2NA2A 4DV3E 3MSWA 2YTOA 5KL7A 3ADJA 3J80C 1A1HA 2PNMA 4DXLA 4HEIA 1QZRA 2NN6A 4X65I 2UU9E 1XXEA 5ELWA 1YHCA 5GMDA 2EN2A 2NN6B 2JEAA 3BBGA 5DNXA 5K36F 2EM3A 3F6GA 2KOUA 3VHTB 1H72C 2EOXA 4R1FA 1TF3A 1Z0CA 1Z0EA 4AIDA 3GCMA 4Z7YA 2LT7A 4BMJA 4F6NA 1NHHA 2WBTA 3HJCA 2BM1A 2EMWA 5AASA 4JI0E 2V87A 2JE6A 4OO1E 2YRKA 3LPSA 4F2JC 2JE6B 4HTGA 2YZTA 4LCGA 3ZKBA 3M7NG 5A6BD 4R2SA 1A1JA 1NHIA 3M7ND 2HK3A 1Y4UA 1STUA 4ZYEA 5IT9C 4IZJD 1UDSA 3ADIA 2OI2A 4LF8I 3K17A 5C0XE 2LJHA 2MC5A 2C38B 2EPRA 3MHSC 4MLVA 1Z59A 1FNMA 4DPTA 4B3ME 3B78A 2NUGA 2VRDA 2HHHE 1Z5AA 3CDIA 2PNZB 3RMPA 5DRRA 5K36A 1EH7A 1B69A 2A25A 5K36B 1RR9A 4IJDA 2R1FA 2ZM6E 4DR5I 5A6BA 4JI8I 2JPAA 1KVKA 4FW7A 1RREA 1WJPA 5AC4A 3L7ZB 4IZJA 2EMAA 2Q8UA 5IWAE 4LF4I 4NXNI 4IZJB 2V8QB 3OTOE 1T4LB 1X49A 4FW4A 1N36E 1ZM3A 1N33I 1N0UA 1FJGE 2L2MA 4BCAA 4Z7CA 3T1YE 4BHCA 1OJ4A 2Z5EA 2PRTA 2EM2A 4OO1D 2BR2A 5C0XF 3ZOQB 2YRMA 1A1IA 1HR0E 2H36X 3OMLA 2EPMX 2LBSB 2EPOA 3HPSA 2HGHA 2LV2A 2L3JA 2BM0A 2JP9A 4LOMA 3J81Q 4ED4A 2EN7A 3M6AA 1YZ9A 4UT4A 2ENCA 1S4EA 4JI6E 2DEIA 3PRYA 4I3HA 5DROA 2DEJA 5FLXQ 5C0XD 1Y4SA 4IFDF 2O1UA 4HACA 2YTGA 3P3CA 4FW3A 4R8OA 4M9VC 4JV5I 1XNRE 2EMBA 4HACB 2BB8A 1Z0WA 2DSYA 2K7IA 1YUJA 3ADLA 3THOB 4B3TI 2L92A 2L2KB 1IBMI 2V89A 2UUAE 3IWBA 1N34E 3UHMA 1ELOA 2EPUA 4DV7I 4OO1B 2UXBI 2F4VI 1BBGA 4JI7I 2O1VA 3VYXA 4URLA 4NXME 2V86A 2EOHA 5DRPA 1N3GA 5C0XA 1ZXMA 1AH5A 2ODRD 1UDQA 2WCC3 5C0XB 1D6TA 5A2QC 2ENAA 1H7UA 1USVA 3JAMQ 1LLMC 2ZITA 2RSIA 2HK2A 1XMQI 2LTSA 3UK3C 3QT8A 1UILA 2DMYA 3K85A 1YYKA 4MYUA 4JI3I 4MU1A 1G2FC 4DR4I 1PJTA 4FW9A 1EH6A 1X6HA 4IFDA 3H09A 1VISA 3PYFA 3HPZA 1J26A 4WUCA 2UXCE 2C37A 3JAMC 1Y60A 4WX9A 1TN9A 2EPKX 2A2CA 1OYSA 2DIXA 2NPFA 2L6MA 1HK7A 1R6MA 1Z0GA 4J3DA 4RHBB 4K0KE 1XMOE 4DPWA 1X3CA 1UN6B 1WHQA 2GLIA 3F0NA 2RS6A 4YY3E 2RQLA 1YUIA 2EM8A 2MDGA 2EN6A 2ELYA 1WXRA 1FWKA 1X6EA 2G7HA 1DGCA 1FWLA 4IFDC 3ZZTA 5AE3A 2GQ0A 5IV8B 1P47A 2EQ3A 3B82A 1OYRA 4DR7E 4O5GA 2EOOA 4X64E 3T1HE 4DV4I 1IBKI 1VI7A 2LTRA 2J7KA 2B7TA 2VF3A 2LO3A 3ECRA 4MU3A 4JI2I 3PYEA 2RTXA 4Q35B 4OOGC 1UEKA 4DV0I
chains in the Genus database with same CATH topology
1HNXE 1XHKA 4TUIA 4L5NC 2X36A 4JG4A 4KHPI 4JYAE 5AE2A 1FI4A 1KTVA 4R03A 1YYOA 1ZXNA 4KQVA 3AV0A 2K4VA 2L8TA 1MX0A 1Y6ZA 3K6QA 5BR8I 1DQ3A 1I94E 4FWHA 4GKJE 4MYTA 1USUA 4DUZE 1S16A 2O1WA 1Z0BA 1HNWI 4JI5E 4AQYE 4NXNE 1ZM2A 2EZ6A 2L3CA 1ZBTA 1H7SA 1RC7A 3QT6A 2IOPA 5DNYA 4F9CB 2V8PA 3LTOA 4FWGA 2VQFE 3ZKDA 2CGEA 2MDRA 2NUEA 4B3SE 4LFAI 4WSPA 2VF1A 1NHJA 3B8HA 4LFCE 1J5EE 2JWOA 3LMLA 3C4TA 1HNZI 4F9BB 1IBLI 4GEQB 2V2QA 4B3TE 4DR3E 2WZOA 2E5LI 3J7Yp 2IHR1 2LRSA 2F8BA 4DV1I 3QT7A 2JY9A 1EA6A 4LF9I 4KZSA 1O0WA 4EMDA 4LF7I 4X66E 2UUCI 2MC6A 3AUZA 4LF5I 4YHHE 4DPUA 1N32E 4DR6E 1N0VC 2M4IA 4B3RI 4DV3I 4DR1I 2Z5BB 5LL6R 3GONA 2LMZA 4P7DA 1SR9A 2N3GA 2UU9I 3H4LA 3LNUA 4P52A 2LE2A 1ZM4A 1XNQI 3J81C 4UTGA 4PRVA 3PYGA 4JI0I 4X8WA 5FLXC 4X62E 4LF6E 4DR2E 3QT5A 5LMNE 2CZ9A 2E1RA 2Z5CA 2PNLA 3FIGA 3ZM7A 1WHNA 2HKJA 1U2RA 2Z5CB 3J7AM 1UHZA 2RS7A 2A2DA 2O1TA 4LFBI 4JI4E 4DV6E 1EI1A 2B3TB 4B3MI 2HHHI 2KHXA 2B9DA 4OX9I 2ZM6I 4KHPE 4P78A 4DV5E 4JI1E 4FN5A 5IWAI 2FV4B 4TUGA 3OTOI 1ZBQA 1N36I 5T6JA 1PKPA 1FJGI 4USMA 3Q1QA 2V83A 1T4NA 5LMUI 2HFUA 1HR0I 4X65E 4F9AB 4ZVIA 4BBYA 1WUUA 3VK6A 1DARA 2ODRC 3WU6A 4JI6I 2EWLA 1FKAE 2EFGA 1PIEA 2M7QA 5ADZA 3PYDA 1X47A 1XNRI 2UXDI 2GS8A 2IOQA 2LJPA 1GZ6A 2UUAI 1N34I 5F3WA 1H74A 3C4BA 4LF8E 4NXMI 2HKEA 1GQEA 2CPNA 2LUQA 4N3OA 2NUFA 4XTJA 4HXZA 2HFSA 4WUBA 1MG7A 4DR5E 4JI8E 4DV1E 2CG9A 4DV2I 2XEXA 4WYQB 1RQ0A 4LF4E 4M2ZA 2UXCI 3HQ1A 1MU5A 1PVGA 2Q2EB 4M0VA 3LLHA 4WFTA 1N33E 1NZ0A 2N3HA 2V2ZA 1XMOI 4K0KI 3ADGA 1DI2A 2E1MA 4B3RE 4YY3I 4BC9A 4DR1E 5L3JA 2VQEI 2UUBI 1EKZA 4DR7I 4GKKI 2JOBA 4JV5E 4X64I 3T1HI 1XNQE 3F6HA 4DPXA 4DUYI 3HXLA 5IT9Q 4WPYA 1IBME 4DV7E 2UXBE 2F4VE 4JI7E 1B63A 2RSMA 1HNXI 1Z5BA 1K47A 4P7AA 3P1XA 4JYAI 2LUPB 2M1SA 4F54A 4IZKA 4LFBE 3WU5A 4IZKB 1XMQE 2V85A 4JI3E 4DR4E 1A6FA 1B62A 2Z5BA 5AE1A 1KKHA 4LU9A 1I94I 4GKJI 2JR1A 4DUZI 4OX9E 1H73A 3Q6NA 4DPYA 3DJWA 4JI5I 4AQYI 4PRXA 4BS9A 2B7VA 3DF6A 3VYYA 5CFFE 2FGGA 3KWRA 2KONA 3CWVA 4WUDA 3WU4A 4DMIA 4LTYA 3JU0A 5LMUE 2JVAA 2V2VA 4B3SI 4DV4E 1IBKE 2DB2A 4LFCI 4JI2E 1J5EI 2UXDE 1BKNA 4DV0E 4FWDA 4J8ZA 4DR3I 4DU8A 2X7IA 5A2QQ 4BC7A 4RPFA 3V2UC 4M30A 4X66I 2R42A 3Q6MA 4M1KA 1KIJA 5BR8E 3HTXA 1T4OA 3T1YI 4YHHI 4DKKA 4Q28A 2JOXA 1N32I 4DR6I 1HNWE 2BV3A 4L8NA 4DV2E 3K1JA 3WU3A 4I8OA 3IWDA 4DU7A 4HY1A 3D4JA 2VE7C 2ZBKB 1ZM9A 2AJ4A 1Z0TA 2R3VA 2VQEE 1QU6A 2UUBE 1YYWA 4LFAE 4LF6I 4X62I 4DR2I 5LMNI 4GKKE 1X48A 4USKA 1HNZE 3HULA 1IBLE 2YT4A 3V5RA 2E5LE 4DUYE 2V34A 4JI4I 3P06A 3J7AG 4DV6I 5FWKA 4LF9E 3JTZA 4HYMA 4PU9A 2V88A 2L2NA 4LF7E 3IWCA 3J80Q 1Z0VA 2L33A 2FTXB 2UUCE 2WW4A 5GMEA 4JI1I 4DV5I 4LF5E 1Z5CA 3ZZUA 3ZZ0A 2NA2A 4DV3E 3MSWA 3J80C 3ADJA 2PNMA 4DXLA 1QZRA 4X65I 2UU9E 5GMDA 3F6GA 2KOUA 1H72C 4R1FA 1Z0CA 1Z0EA 4Z7YA 4BMJA 1NHHA 3HJCA 2BM1A 5AASA 4JI0E 2V87A 3LPSA 2YZTA 3ZKBA 1NHIA 2HK3A 1Y4UA 1STUA 5IT9C 4IZJD 2OI2A 3ADIA 4LF8I 3K17A 2LJHA 2MC5A 1Z59A 1FNMA 4DPTA 4B3ME 3B78A 2NUGA 2HHHE 1Z5AA 3RMPA 1RR9A 2ZM6E 4DR5I 4JI8I 1KVKA 1RREA 4IZJA 5IWAE 4LF4I 4NXNI 4IZJB 2V8QB 3OTOE 1T4LB 1X49A 1N36E 1ZM3A 1N33I 1N0UA 1FJGE 2L2MA 4BCAA 4Z7CA 3T1YE 1OJ4A 2Z5EA 3ZOQB 1HR0E 2VQFI 2H36X 3OMLA 2LBSB 3HPSA 2L3JA 3J81Q 2BM0A 4ED4A 3M6AA 1YZ9A 4UT4A 1S4EA 4JI6E 2DEIA 3PRYA 4I3HA 5FLXQ 2DEJA 1Y4SA 2O1UA 4HACA 4JV5I 4R8OA 1XNRE 4HACB 1Z0WA 2DSYA 4B3TI 3ADLA 2L92A 2L2KB 1IBMI 2V89A 2UUAE 3IWBA 1N34E 4DV7I 1ELOA 2UXBI 2F4VI 4JI7I 2O1VA 3VYXA 4URLA 4NXME 2V86A 1ZXMA 2ODRD 1D6TA 5A2QC 1USVA 1H7UA 3JAMQ 2ZITA 2HK2A 1XMQI 2LTSA 3QT8A 1UILA 2DMYA 3K85A 1YYKA 4MYUA 4JI3I 4DR4I 4FW9A 3H09A 1VISA 3PYFA 3HPZA 1J26A 4WUCA 2UXCE 3JAMC 2A2CA 2NPFA 2DIXA 2L6MA 1HK7A 1Z0GA 4DPWA 4K0KE 1XMOE 1WHQA 3F0NA 2RS6A 4YY3E 1WXRA 1FWKA 2G7HA 1FWLA 3ZZTA 5AE3A 2GQ0A 3B82A 4DR7E 4X64E 3T1HE 4DV4I 1IBKI 2LTRA 2J7KA 2B7TA 2VF3A 4JI2I 3PYEA 2RTXA 4OOGC 1UEKA 4DV0I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX E;  1XHK A;  2X36 A;  4JG4 A;  4KHP I;  4JYA E;  1FI4 A;  1KTV A;  1YYO A;  1ZXN A;  4KQV A;  1MX0 A;  5BR8 I;  1I94 E;  4FWH A;  4GKJ E;  4MYT A;  4DUZ E;  1S16 A;  1Z0B A;  1HNW I;  4JI5 E;  4AQY E;  4NXN E;  1ZM2 A;  2EZ6 A;  2L3C A;  1ZBT A;  1H7S A;  1RC7 A;  3QT6 A;  3LTO A;  2V8P A;  4FWG A;  2VQF E;  3ZKD A;  2MDR A;  2NUE A;  4B3S E;  4LFA I;  1NHJ A;  3B8H A;  4LFC E;  1J5E E;  1HNZ I;  3C4T A;  1IBL I;  2V2Q A;  4B3T E;  4DR3 E;  2E5L I;  3J7Y p;  2IHR 1;  2LRS A;  4DV1 I;  3QT7 A;  2JY9 A;  1EA6 A;  4LF9 I;  1O0W A;  4EMD A;  4LF7 I;  4X66 E;  2UUC I;  4LF5 I;  4YHH E;  4DPU A;  1N32 E;  4DR6 E;  1N0V C;  4B3R I;  4DV3 I;  4DR1 I;  5LL6 R;  3GON A;  2N3G A;  2UU9 I;  3H4L A;  3LNU A;  4P52 A;  1ZM4 A;  1XNQ I;  3J81 C;  4UTG A;  4PRV A;  3PYG A;  4JI0 I;  4X8W A;  4LF6 E;  4X62 E;  5FLX C;  4DR2 E;  3QT5 A;  5LMN E;  2CZ9 A;  2E1R A;  3ZM7 A;  1WHN A;  2HKJ A;  1U2R A;  3J7A M;  1UHZ A;  2RS7 A;  2A2D A;  4LFB I;  4JI4 E;  4DV6 E;  1EI1 A;  2B3T B;  4B3M I;  2HHH I;  2KHX A;  4OX9 I;  2ZM6 I;  4KHP E;  4DV5 E;  4JI1 E;  4FN5 A;  5IWA I;  3OTO I;  1N36 I;  1PKP A;  1FJG I;  4USM A;  3Q1Q A;  1T4N A;  5LMU I;  2HFU A;  1HR0 I;  4X65 E;  4ZVI A;  1WUU A;  1DAR A;  3WU6 A;  4JI6 I;  1FKA E;  2EFG A;  1PIE A;  3PYD A;  1X47 A;  1XNR I;  2UXD I;  2GS8 A;  2LJP A;  2UUA I;  1N34 I;  1H74 A;  3C4B A;  4LF8 E;  4NXM I;  2HKE A;  1GQE A;  2CPN A;  2LUQ A;  2NUF A;  4XTJ A;  4HXZ A;  2HFS A;  4WUB A;  1MG7 A;  4DR5 E;  4JI8 E;  4DV1 E;  4DV2 I;  2XEX A;  4WYQ B;  1RQ0 A;  4LF4 E;  4M2Z A;  2UXC I;  1MU5 A;  1PVG A;  2Q2E B;  3LLH A;  4WFT A;  1N33 E;  1NZ0 A;  2N3H A;  2V2Z A;  1XMO I;  4K0K I;  3ADG A;  1DI2 A;  4B3R E;  4YY3 I;  5L3J A;  4DR1 E;  2VQE I;  2UUB I;  1EKZ A;  4DR7 I;  4GKK I;  4JV5 E;  4X64 I;  3T1H I;  1XNQ E;  4DPX A;  4DUY I;  5IT9 Q;  1IBM E;  4DV7 E;  2UXB E;  2F4V E;  4JI7 E;  1B63 A;  2RSM A;  1HNX I;  1Z5B A;  1K47 A;  4P7A A;  3P1X A;  4JYA I;  2LUP B;  4LFB E;  3WU5 A;  1XMQ E;  4JI3 E;  4DR4 E;  1A6F A;  1B62 A;  1KKH A;  1I94 I;  4GKJ I;  4DUZ I;  4OX9 E;  1H73 A;  4DPY A;  4JI5 I;  4AQY I;  4PRX A;  2B7V A;  3VYY A;  5CFF E;  3CWV A;  4WUD A;  3WU4 A;  5LMU E;  2JVA A;  2V2V A;  4B3S I;  4DV4 E;  1IBK E;  2DB2 A;  4LFC I;  4JI2 E;  1J5E I;  2UXD E;  1BKN A;  4DV0 E;  4FWD A;  4DR3 I;  4DU8 A;  2X7I A;  5A2Q Q;  4RPF A;  3V2U C;  4M30 A;  4X66 I;  2R42 A;  4M1K A;  1KIJ A;  5BR8 E;  3HTX A;  1T4O A;  3T1Y I;  4YHH I;  4DKK A;  1N32 I;  4DR6 I;  1HNW E;  2BV3 A;  4DV2 E;  3K1J A;  3WU3 A;  4DU7 A;  4HY1 A;  3D4J A;  2ZBK B;  1ZM9 A;  2AJ4 A;  1Z0T A;  2R3V A;  2VQE E;  1QU6 A;  2UUB E;  1YYW A;  4LFA E;  4LF6 I;  4X62 I;  4DR2 I;  5LMN I;  4GKK E;  1X48 A;  4USK A;  1HNZ E;  3HUL A;  1IBL E;  2YT4 A;  3V5R A;  2E5L E;  4DUY E;  2V34 A;  4JI4 I;  4DV6 I;  3J7A G;  4LF9 E;  4HYM A;  4PU9 A;  2L2N A;  4LF7 E;  3J80 Q;  1Z0V A;  2L33 A;  2UUC E;  2WW4 A;  5GME A;  4JI1 I;  4DV5 I;  4LF5 E;  1Z5C A;  3ZZU A;  3ZZ0 A;  2NA2 A;  4DV3 E;  3J80 C;  3ADJ A;  4DXL A;  1QZR A;  4X65 I;  2UU9 E;  5GMD A;  1H72 C;  4R1F A;  1Z0C A;  1Z0E A;  4Z7Y A;  1NHH A;  2BM1 A;  4JI0 E;  3LPS A;  3ZKB A;  1NHI A;  2HK3 A;  1STU A;  5IT9 C;  2OI2 A;  3ADI A;  4LF8 I;  3K17 A;  2LJH A;  1Z59 A;  1FNM A;  4DPT A;  4B3M E;  3B78 A;  2NUG A;  2HHH E;  1Z5A A;  1RR9 A;  2ZM6 E;  4DR5 I;  4JI8 I;  1KVK A;  1RRE A;  5IWA E;  4LF4 I;  4NXN I;  3OTO E;  1T4L B;  1X49 A;  1N36 E;  1ZM3 A;  1N33 I;  1N0U A;  1FJG E;  2L2M A;  4Z7C A;  3T1Y E;  1OJ4 A;  1HR0 E;  2VQF I;  2LBS B;  2L3J A;  3J81 Q;  2BM0 A;  4ED4 A;  3M6A A;  1YZ9 A;  4UT4 A;  1S4E A;  4JI6 E;  2DEI A;  4I3H A;  5FLX Q;  2DEJ A;  4HAC A;  4JV5 I;  1XNR E;  4HAC B;  1Z0W A;  4B3T I;  3ADL A;  2L2K B;  1IBM I;  2UUA E;  1N34 E;  4DV7 I;  1ELO A;  2UXB I;  2F4V I;  4JI7 I;  3VYX A;  4URL A;  4NXM E;  1ZXM A;  1D6T A;  3JAM Q;  5A2Q C;  1H7U A;  2ZIT A;  2HK2 A;  1XMQ I;  2LTS A;  3QT8 A;  1UIL A;  2DMY A;  4MYU A;  1YYK A;  4JI3 I;  4DR4 I;  4FW9 A;  1VIS A;  3PYF A;  1J26 A;  4WUC A;  2UXC E;  3JAM C;  2A2C A;  2NPF A;  2DIX A;  1Z0G A;  4DPW A;  4K0K E;  1XMO E;  1WHQ A;  3F0N A;  2RS6 A;  4YY3 E;  1FWK A;  1FWL A;  3ZZT A;  3B82 A;  4DR7 E;  4X64 E;  3T1H E;  4DV4 I;  1IBK I;  2LTR A;  2J7K A;  2B7T A;  2VF3 A;  4JI2 I;  3PYE A;  2RTX A;  4OOG C;  1UEK A;  4DV0 I; 
#chains in the Genus database with same CATH topology
 1HNX E;  1EH8 A;  4TUI A;  4L5N C;  1XHK A;  4NHR A;  3GLL A;  1MGT A;  2X36 A;  4JG4 A;  4KHP I;  1A1G A;  4JYA E;  5AE2 A;  4R2R A;  2YTF A;  2WP8 A;  4MU4 A;  1FI4 A;  4FW5 A;  1RMD A;  3NZK A;  1KTV A;  2WP8 B;  4MQY A;  4R03 A;  1YYO A;  1UBD C;  1ZXN A;  4KQV A;  3AV0 A;  2EM4 A;  2K4V A;  2L8T A;  1MX0 A;  1Y6Z A;  3K6Q A;  2WNR B;  1DQ3 A;  3B4T A;  5BR8 I;  4U3B A;  1I94 E;  4FWH A;  4GKJ E;  4MYT A;  2EPP A;  1USU A;  4DUZ E;  1S16 A;  2YWQ A;  1TF6 A;  2O1W A;  5DRQ A;  1Z0B A;  1HNW I;  4JI5 E;  4AQY E;  4NXN E;  2YU8 A;  1ZM2 A;  3BF2 A;  4R2Q A;  2EZ6 A;  2L3C A;  1OYP A;  1ZBT A;  2EN1 A;  4R2E A;  1H7S A;  2BA1 G;  2YTP A;  1RC7 A;  2JXP A;  2BA1 D;  3QT6 A;  5KL2 A;  2IOP A;  5DNY A;  4F9C B;  2WBU A;  2V8P A;  3LTO A;  4FWG A;  2VQF E;  4LCH A;  4LCF A;  3KZY A;  3CDJ A;  2CGE A;  3M99 B;  3ZKD A;  2MKN A;  2MDR A;  2NN6 C;  2NUE A;  1L4S A;  4B3S E;  4LFA I;  4WSP A;  3EPK A;  2VF1 A;  1NHJ A;  2C38 A;  4IS1 C;  3B8H A;  1T39 A;  2R76 A;  4LFC E;  1J5E E;  4MU0 A;  3THN A;  2JWO A;  3LML A;  3C4T A;  3EPH A;  1HNZ I;  2PNZ A;  4F9B B;  1IBL I;  4GEQ B;  2I9I A;  2V2Q A;  4B3T E;  4DR3 E;  2WZO A;  2E5L I;  3J7Y p;  5DNL A;  2IHR 1;  3C6M A;  1A1L A;  2LRS A;  1BBO A;  2F8B A;  3L7Z A;  3QT7 A;  4U3D A;  4DV1 I;  2JY9 A;  3MHH C;  1EA6 A;  4LF9 I;  2EM6 A;  4KZS A;  4OO1 F;  2BA0 G;  1O0W A;  4EMD A;  4LF7 I;  4X66 E;  2YU5 A;  2CTD A;  4WXD A;  2UUC I;  2MC6 A;  3AUZ A;  2PO2 B;  1A1K A;  4LF5 I;  3PS1 A;  5K36 C;  1SFE A;  4YHH E;  2DMI A;  4DPU A;  4O4K A;  1N32 E;  4DR6 E;  1N0V C;  2M4I A;  4MDT A;  4DV3 I;  4DR1 I;  2CT1 A;  4B3R I;  2Z5B B;  1ZU1 A;  3H1C A;  3C6K A;  2I13 A;  1T38 A;  3P3G A;  5LL6 R;  3GON A;  4RH8 A;  2LMZ A;  4P7D A;  1F2I G;  1SR9 A;  2N3G A;  2UU9 I;  3H4L A;  3LNU A;  4P52 A;  2LE2 A;  1ZM4 A;  1XNQ I;  3J81 C;  3HKM A;  5IXM B;  4OO1 A;  1NEI A;  4UTG A;  4PRV A;  3PYG A;  5JEA E;  4JI0 I;  2EPC A;  1PJS A;  4X8W A;  3U1K A;  5FLX C;  4X62 E;  4LF6 E;  4DR2 E;  2EM9 A;  1WRJ A;  5LMN E;  2GPI A;  2CSH A;  2CZ9 A;  3QT5 A;  1E3P A;  2E1R A;  2Z5C A;  2PNL A;  3FIG A;  3ZM7 A;  1WHN A;  2HKJ A;  1AAY A;  1U2R A;  2Z5C B;  4FK5 C;  3J7A M;  1UHZ A;  2RS7 A;  2A2D A;  2O1T A;  4LFB I;  2J65 A;  1MEY C;  2JEB B;  4ISA A;  4JI4 E;  4OO1 C;  4DV6 E;  1EI1 A;  2B3T B;  4B3M I;  2EN3 A;  2HHH I;  2EMF A;  2KHX A;  2B9D A;  2RPC A;  4OX9 I;  4FW6 A;  2ZM6 I;  4KHP E;  4P78 A;  5JEA F;  5C0X C;  2EMG A;  2EJ4 A;  4DV5 E;  4JI1 E;  4FN5 A;  3KRN A;  5IWA I;  2FV4 B;  4TUG A;  4BHB A;  1YPN A;  3OTO I;  1ZBQ A;  1N36 I;  5T6J A;  1PKP A;  2N8X A;  2EE8 A;  2EMX A;  5EKW A;  4USM A;  2V83 A;  5JEA D;  4DUY I;  3Q1Q A;  1FJG I;  1T4N A;  5LMU I;  1RHY A;  2HFU A;  1YSA C;  4QNJ A;  4R2D A;  1HR0 I;  4R2C A;  4X65 E;  4F9A B;  4ZVI A;  4BBY A;  2EN8 A;  2JYA A;  3VK6 A;  3BID A;  1WUU A;  1DAR A;  2EM7 A;  2ODR C;  2AE8 A;  1UDO A;  3WU6 A;  2EWL A;  1FKA E;  4AIM A;  4JI6 I;  2EFG A;  1PIE A;  2M7Q A;  3PS2 A;  5ADZ A;  3PYD A;  1X47 A;  1XNR I;  2UXD I;  2EL6 A;  2GS8 A;  2IOQ A;  2O3Z A;  3DD6 A;  2YTI A;  5JEA B;  2LJP A;  1GZ6 A;  2UUA I;  5KL6 A;  1N34 I;  5F3W A;  1H74 A;  3C4B A;  2BBG A;  2NAB A;  5KL5 A;  4LF8 E;  5A69 A;  4NXM I;  2HKE A;  1UDN A;  1Z1B A;  4WSG A;  1GQE A;  2CPN A;  2LUQ A;  2EMZ A;  2EOS A;  2WNR A;  3EPL A;  2YTN A;  2EMH A;  2NUF A;  4N3O A;  4XTJ A;  4HXZ A;  2PO0 A;  2HFS A;  2PO0 B;  4WUB A;  2EOE A;  1MG7 A;  4DR5 E;  4ZYG A;  4JI8 E;  4DV1 E;  2CG9 A;  5LLQ A;  4DV2 I;  4BA2 A;  2XEX A;  1JK2 A;  4WYQ B;  2GO4 A;  4BA2 B;  1RQ0 A;  4LF4 E;  2EML A;  2DLK A;  4M2Z A;  2UXC I;  3HQ1 A;  1MU5 A;  1PVG A;  2Q2E B;  4M0V A;  3LLH A;  4WFT A;  2CVE A;  2F1D A;  1N33 E;  1NZ0 A;  2N3H A;  2V2Z A;  1XMO I;  4K0K I;  3ADG A;  3U1Y A;  1DI2 A;  2E1M A;  2M9A A;  4B3R E;  4YY3 I;  4BC9 A;  4DR1 E;  5L3J A;  2VQE I;  2UUB I;  1EKZ A;  2IES A;  2LCE A;  2D9H A;  5TSE A;  4DR7 I;  4GKK I;  3P3E A;  2JOB A;  4JV5 E;  4X64 I;  2EOR A;  3T1H I;  2JEA B;  1XNQ E;  4KWY A;  3F6H A;  4N4R B;  2YTE A;  2YTD A;  3EQ1 A;  3HXL A;  3KZZ A;  2GHF A;  4WPY A;  4WXC A;  1IBM E;  4GZN C;  3P76 A;  4DV7 E;  2UXB E;  2YTQ A;  2F4V E;  3QG5 C;  4JI7 E;  4NBQ A;  5K36 D;  2EL4 A;  2EPN A;  5EL9 A;  2EOI A;  1B63 A;  4AM3 A;  2RSM A;  1HNX I;  2DRP A;  1Z5B A;  2BA0 D;  1YH8 A;  4F6M A;  1K47 A;  2JT2 A;  4P7A A;  3P1X A;  2YPN A;  4JYA I;  2PO2 A;  2LUP B;  2M1S A;  4F54 A;  4IZK A;  2VES A;  4LFB E;  2EP3 A;  3WU5 A;  4IZK B;  1XMQ E;  2V85 A;  1X6F A;  4JI3 E;  4DR4 E;  2HJJ A;  1A6F A;  1B62 A;  2Z5B A;  2VQF I;  2EL5 A;  5AE1 A;  1KKH A;  4LU9 A;  1I94 I;  4X9J A;  4LPF A;  4GKJ I;  2JR1 A;  4DUZ I;  4IFD E;  3GME A;  4OX9 E;  1H73 A;  3Q6N A;  4DPY A;  1KJK A;  1E3H A;  2IER A;  3DJW A;  2EM5 A;  4AQY I;  4PRX A;  4BS9 A;  2B7V A;  4JI5 I;  2PO1 A;  4OKG A;  3EPJ A;  3DF6 A;  4O24 A;  2PO1 B;  3VYY A;  5CFF E;  2FGG A;  3KWR A;  5KL3 A;  2KON A;  3CWV A;  4WUD A;  3WU4 A;  2EMY A;  4DMI A;  4R2P A;  2DLQ A;  3JU0 A;  4LTY A;  1ZAA C;  5LMU E;  2YSO A;  2J7J A;  2JVA A;  2BR2 B;  2V2V A;  4NZV A;  2EOJ A;  5IT9 Q;  4B3S I;  4DV4 E;  3L00 A;  2JEB A;  1IBK E;  4MLQ A;  4ZYD A;  2DB2 A;  1NCS A;  4LFC I;  4JI2 E;  1J5E I;  2UXD E;  1BKN A;  4DV0 E;  4FWD A;  2EQ1 A;  2E72 A;  2MKD A;  4J8Z A;  1BB8 A;  1P42 A;  4IS9 A;  4DU8 A;  4DR3 I;  2YTJ A;  2X7I A;  5A2Q Q;  4BC7 A;  4RPF A;  3V2U C;  4IFD D;  2LJU A;  4QNK A;  5A6J A;  3TQM A;  2ADR A;  2EMI A;  4M30 A;  4X66 I;  1PJQ A;  2HC5 A;  2EOQ A;  2R42 A;  3Q6M A;  4M1K A;  1KIJ A;  2DGC A;  5BR8 E;  3HTX A;  1T4O A;  2EPX A;  3T1Y I;  2EMK A;  2ENH A;  4YHH I;  2EOY A;  2ELZ A;  4Q28 A;  4DKK A;  2JOX A;  1GTK A;  1N32 I;  4DR6 I;  1HNW E;  2BV3 A;  4L8N A;  4DV2 E;  3K1J A;  2YSP A;  3WU3 A;  4IFD B;  2NN6 E;  4I8O A;  1IQS A;  1PDA A;  2EQ0 A;  3IWD A;  4DPX A;  2C37 B;  1G2D C;  4DU7 A;  4HY1 A;  4ZYH A;  2EPZ A;  2EOF A;  3D4J A;  2VE7 C;  1YFH A;  5A6A A;  2ZBK B;  4R2A A;  2LVH A;  5AC5 A;  1ZM9 A;  1IMU A;  1KYQ A;  2AJ4 A;  5JEA A;  1Z0T A;  2R3V A;  1IQO A;  2WBS A;  2VQE E;  1QU6 A;  2UUB E;  1YYW A;  1X5W A;  4LFA E;  4LF6 I;  4X62 I;  1Y5Y A;  4DR2 I;  1JK1 A;  5LMN I;  2EM0 A;  4GKK E;  1X48 A;  4USK A;  1HNZ E;  2EN4 A;  2YRH A;  3HUL A;  1IBL E;  2YT4 A;  5A6K A;  2C39 A;  3V5R A;  2EPL X;  2C39 B;  2E5L E;  4DUY E;  2V34 A;  2NN6 F;  5JEA C;  2EOM A;  4JI4 I;  3P06 A;  5K36 E;  1QNT A;  3J7A G;  4DV6 I;  5FWK A;  4LF9 E;  3JTZ A;  4GQU A;  4HYM A;  3PS3 A;  4PU9 A;  5KL4 A;  2V88 A;  2L2N A;  2EPA A;  3IWC A;  4LF7 E;  2NN6 D;  3J80 Q;  1Z0V A;  2EMC A;  2L33 A;  2FTX B;  2UUC E;  3M85 G;  2WW4 A;  1R6L A;  2EOZ A;  5GME A;  3M85 D;  4JI1 I;  4DV5 I;  4LF5 E;  3BGH A;  1ZR9 A;  4O43 A;  1Z5C A;  4OZE A;  3ZZU A;  4BA1 A;  2GO3 A;  1A1F A;  3ZZ0 A;  4BA1 B;  2NA2 A;  4DV3 E;  3MSW A;  2YTO A;  5KL7 A;  3ADJ A;  3J80 C;  1A1H A;  2PNM A;  4DXL A;  4HEI A;  1QZR A;  2NN6 A;  4X65 I;  2UU9 E;  1XXE A;  5ELW A;  1YHC A;  5GMD A;  2EN2 A;  2NN6 B;  2JEA A;  3BBG A;  5DNX A;  5K36 F;  2EM3 A;  3F6G A;  2KOU A;  3VHT B;  1H72 C;  2EOX A;  4R1F A;  1TF3 A;  1Z0C A;  1Z0E A;  4AID A;  3GCM A;  4Z7Y A;  2LT7 A;  4BMJ A;  4F6N A;  1NHH A;  2WBT A;  3HJC A;  2BM1 A;  2EMW A;  5AAS A;  4JI0 E;  2V87 A;  2JE6 A;  4OO1 E;  2YRK A;  3LPS A;  4F2J C;  2JE6 B;  4HTG A;  2YZT A;  4LCG A;  3ZKB A;  3M7N G;  5A6B D;  4R2S A;  1A1J A;  1NHI A;  3M7N D;  2HK3 A;  1Y4U A;  1STU A;  4ZYE A;  5IT9 C;  4IZJ D;  1UDS A;  3ADI A;  2OI2 A;  4LF8 I;  3K17 A;  5C0X E;  2LJH A;  2MC5 A;  2C38 B;  2EPR A;  3MHS C;  4MLV A;  1Z59 A;  1FNM A;  4DPT A;  4B3M E;  3B78 A;  2NUG A;  2VRD A;  2HHH E;  1Z5A A;  3CDI A;  2PNZ B;  3RMP A;  5DRR A;  5K36 A;  1EH7 A;  1B69 A;  2A25 A;  5K36 B;  1RR9 A;  4IJD A;  2R1F A;  2ZM6 E;  4DR5 I;  5A6B A;  4JI8 I;  2JPA A;  1KVK A;  4FW7 A;  1RRE A;  1WJP A;  5AC4 A;  3L7Z B;  4IZJ A;  2EMA A;  2Q8U A;  5IWA E;  4LF4 I;  4NXN I;  4IZJ B;  2V8Q B;  3OTO E;  1T4L B;  1X49 A;  4FW4 A;  1N36 E;  1ZM3 A;  1N33 I;  1N0U A;  1FJG E;  2L2M A;  4BCA A;  4Z7C A;  3T1Y E;  4BHC A;  1OJ4 A;  2Z5E A;  2PRT A;  2EM2 A;  4OO1 D;  2BR2 A;  5C0X F;  3ZOQ B;  2YRM A;  1A1I A;  1HR0 E;  2H36 X;  3OML A;  2EPM X;  2LBS B;  2EPO A;  3HPS A;  2HGH A;  2LV2 A;  2L3J A;  2BM0 A;  2JP9 A;  4LOM A;  3J81 Q;  4ED4 A;  2EN7 A;  3M6A A;  1YZ9 A;  4UT4 A;  2ENC A;  1S4E A;  4JI6 E;  2DEI A;  3PRY A;  4I3H A;  5DRO A;  2DEJ A;  5FLX Q;  5C0X D;  1Y4S A;  4IFD F;  2O1U A;  4HAC A;  2YTG A;  3P3C A;  4FW3 A;  4R8O A;  4M9V C;  4JV5 I;  1XNR E;  2EMB A;  4HAC B;  2BB8 A;  1Z0W A;  2DSY A;  2K7I A;  1YUJ A;  3ADL A;  3THO B;  4B3T I;  2L92 A;  2L2K B;  1IBM I;  2V89 A;  2UUA E;  3IWB A;  1N34 E;  3UHM A;  1ELO A;  2EPU A;  4DV7 I;  4OO1 B;  2UXB I;  2F4V I;  1BBG A;  4JI7 I;  2O1V A;  3VYX A;  4URL A;  4NXM E;  2V86 A;  2EOH A;  5DRP A;  1N3G A;  5C0X A;  1ZXM A;  1AH5 A;  2ODR D;  1UDQ A;  2WCC 3;  5C0X B;  1D6T A;  5A2Q C;  2ENA A;  1H7U A;  1USV A;  3JAM Q;  1LLM C;  2ZIT A;  2RSI A;  2HK2 A;  1XMQ I;  2LTS A;  3UK3 C;  3QT8 A;  1UIL A;  2DMY A;  3K85 A;  1YYK A;  4MYU A;  4JI3 I;  4MU1 A;  1G2F C;  4DR4 I;  1PJT A;  4FW9 A;  1EH6 A;  1X6H A;  4IFD A;  3H09 A;  1VIS A;  3PYF A;  3HPZ A;  1J26 A;  4WUC A;  2UXC E;  2C37 A;  3JAM C;  1Y60 A;  4WX9 A;  1TN9 A;  2EPK X;  2A2C A;  1OYS A;  2DIX A;  2NPF A;  2L6M A;  1HK7 A;  1R6M A;  1Z0G A;  4J3D A;  4RHB B;  4K0K E;  1XMO E;  4DPW A;  1X3C A;  1UN6 B;  1WHQ A;  2GLI A;  3F0N A;  2RS6 A;  4YY3 E;  2RQL A;  1YUI A;  2EM8 A;  2MDG A;  2EN6 A;  2ELY A;  1WXR A;  1FWK A;  1X6E A;  2G7H A;  1DGC A;  1FWL A;  4IFD C;  3ZZT A;  5AE3 A;  2GQ0 A;  5IV8 B;  1P47 A;  2EQ3 A;  3B82 A;  1OYR A;  4DR7 E;  4O5G A;  2EOO A;  4X64 E;  3T1H E;  4DV4 I;  1IBK I;  1VI7 A;  2LTR A;  2J7K A;  2B7T A;  2VF3 A;  2LO3 A;  3ECR A;  4MU3 A;  4JI2 I;  3PYE A;  2RTX A;  4Q35 B;  4OOG C;  1UEK A;  4DV0 I; 
#chains in the Genus database with same CATH homology
 1HNX E;  1XHK A;  4TUI A;  4L5N C;  2X36 A;  4JG4 A;  4KHP I;  4JYA E;  5AE2 A;  1FI4 A;  1KTV A;  4R03 A;  1YYO A;  1ZXN A;  4KQV A;  3AV0 A;  2K4V A;  2L8T A;  1MX0 A;  1Y6Z A;  3K6Q A;  5BR8 I;  1DQ3 A;  1I94 E;  4FWH A;  4GKJ E;  4MYT A;  1USU A;  4DUZ E;  1S16 A;  2O1W A;  1Z0B A;  1HNW I;  4JI5 E;  4AQY E;  4NXN E;  1ZM2 A;  2EZ6 A;  2L3C A;  1ZBT A;  1H7S A;  1RC7 A;  3QT6 A;  2IOP A;  5DNY A;  4F9C B;  2V8P A;  3LTO A;  4FWG A;  2VQF E;  3ZKD A;  2CGE A;  2MDR A;  2NUE A;  4B3S E;  4LFA I;  4WSP A;  2VF1 A;  1NHJ A;  3B8H A;  4LFC E;  1J5E E;  2JWO A;  3LML A;  3C4T A;  1HNZ I;  4F9B B;  1IBL I;  4GEQ B;  2V2Q A;  4B3T E;  4DR3 E;  2WZO A;  2E5L I;  3J7Y p;  2IHR 1;  2LRS A;  2F8B A;  4DV1 I;  3QT7 A;  2JY9 A;  1EA6 A;  4LF9 I;  4KZS A;  1O0W A;  4EMD A;  4LF7 I;  4X66 E;  2UUC I;  2MC6 A;  3AUZ A;  4LF5 I;  4YHH E;  4DPU A;  1N32 E;  4DR6 E;  1N0V C;  2M4I A;  4B3R I;  4DV3 I;  4DR1 I;  2Z5B B;  5LL6 R;  3GON A;  2LMZ A;  4P7D A;  1SR9 A;  2N3G A;  2UU9 I;  3H4L A;  3LNU A;  4P52 A;  2LE2 A;  1ZM4 A;  1XNQ I;  3J81 C;  4UTG A;  4PRV A;  3PYG A;  4JI0 I;  4X8W A;  5FLX C;  4X62 E;  4LF6 E;  4DR2 E;  3QT5 A;  5LMN E;  2CZ9 A;  2E1R A;  2Z5C A;  2PNL A;  3FIG A;  3ZM7 A;  1WHN A;  2HKJ A;  1U2R A;  2Z5C B;  3J7A M;  1UHZ A;  2RS7 A;  2A2D A;  2O1T A;  4LFB I;  4JI4 E;  4DV6 E;  1EI1 A;  2B3T B;  4B3M I;  2HHH I;  2KHX A;  2B9D A;  4OX9 I;  2ZM6 I;  4KHP E;  4P78 A;  4DV5 E;  4JI1 E;  4FN5 A;  5IWA I;  2FV4 B;  4TUG A;  3OTO I;  1ZBQ A;  1N36 I;  5T6J A;  1PKP A;  1FJG I;  4USM A;  3Q1Q A;  2V83 A;  1T4N A;  5LMU I;  2HFU A;  1HR0 I;  4X65 E;  4F9A B;  4ZVI A;  4BBY A;  1WUU A;  3VK6 A;  1DAR A;  2ODR C;  3WU6 A;  4JI6 I;  2EWL A;  1FKA E;  2EFG A;  1PIE A;  2M7Q A;  5ADZ A;  3PYD A;  1X47 A;  1XNR I;  2UXD I;  2GS8 A;  2IOQ A;  2LJP A;  1GZ6 A;  2UUA I;  1N34 I;  5F3W A;  1H74 A;  3C4B A;  4LF8 E;  4NXM I;  2HKE A;  1GQE A;  2CPN A;  2LUQ A;  4N3O A;  2NUF A;  4XTJ A;  4HXZ A;  2HFS A;  4WUB A;  1MG7 A;  4DR5 E;  4JI8 E;  4DV1 E;  2CG9 A;  4DV2 I;  2XEX A;  4WYQ B;  1RQ0 A;  4LF4 E;  4M2Z A;  2UXC I;  3HQ1 A;  1MU5 A;  1PVG A;  2Q2E B;  4M0V A;  3LLH A;  4WFT A;  1N33 E;  1NZ0 A;  2N3H A;  2V2Z A;  1XMO I;  4K0K I;  3ADG A;  1DI2 A;  2E1M A;  4B3R E;  4YY3 I;  4BC9 A;  4DR1 E;  5L3J A;  2VQE I;  2UUB I;  1EKZ A;  4DR7 I;  4GKK I;  2JOB A;  4JV5 E;  4X64 I;  3T1H I;  1XNQ E;  3F6H A;  4DPX A;  4DUY I;  3HXL A;  5IT9 Q;  4WPY A;  1IBM E;  4DV7 E;  2UXB E;  2F4V E;  4JI7 E;  1B63 A;  2RSM A;  1HNX I;  1Z5B A;  1K47 A;  4P7A A;  3P1X A;  4JYA I;  2LUP B;  2M1S A;  4F54 A;  4IZK A;  4LFB E;  3WU5 A;  4IZK B;  1XMQ E;  2V85 A;  4JI3 E;  4DR4 E;  1A6F A;  1B62 A;  2Z5B A;  5AE1 A;  1KKH A;  4LU9 A;  1I94 I;  4GKJ I;  2JR1 A;  4DUZ I;  4OX9 E;  1H73 A;  3Q6N A;  4DPY A;  3DJW A;  4JI5 I;  4AQY I;  4PRX A;  4BS9 A;  2B7V A;  3DF6 A;  3VYY A;  5CFF E;  2FGG A;  3KWR A;  2KON A;  3CWV A;  4WUD A;  3WU4 A;  4DMI A;  4LTY A;  3JU0 A;  5LMU E;  2JVA A;  2V2V A;  4B3S I;  4DV4 E;  1IBK E;  2DB2 A;  4LFC I;  4JI2 E;  1J5E I;  2UXD E;  1BKN A;  4DV0 E;  4FWD A;  4J8Z A;  4DR3 I;  4DU8 A;  2X7I A;  5A2Q Q;  4BC7 A;  4RPF A;  3V2U C;  4M30 A;  4X66 I;  2R42 A;  3Q6M A;  4M1K A;  1KIJ A;  5BR8 E;  3HTX A;  1T4O A;  3T1Y I;  4YHH I;  4DKK A;  4Q28 A;  2JOX A;  1N32 I;  4DR6 I;  1HNW E;  2BV3 A;  4L8N A;  4DV2 E;  3K1J A;  3WU3 A;  4I8O A;  3IWD A;  4DU7 A;  4HY1 A;  3D4J A;  2VE7 C;  2ZBK B;  1ZM9 A;  2AJ4 A;  1Z0T A;  2R3V A;  2VQE E;  1QU6 A;  2UUB E;  1YYW A;  4LFA E;  4LF6 I;  4X62 I;  4DR2 I;  5LMN I;  4GKK E;  1X48 A;  4USK A;  1HNZ E;  3HUL A;  1IBL E;  2YT4 A;  3V5R A;  2E5L E;  4DUY E;  2V34 A;  4JI4 I;  3P06 A;  3J7A G;  4DV6 I;  5FWK A;  4LF9 E;  3JTZ A;  4HYM A;  4PU9 A;  2V88 A;  2L2N A;  4LF7 E;  3IWC A;  3J80 Q;  1Z0V A;  2L33 A;  2FTX B;  2UUC E;  2WW4 A;  5GME A;  4JI1 I;  4DV5 I;  4LF5 E;  1Z5C A;  3ZZU A;  3ZZ0 A;  2NA2 A;  4DV3 E;  3MSW A;  3J80 C;  3ADJ A;  2PNM A;  4DXL A;  1QZR A;  4X65 I;  2UU9 E;  5GMD A;  3F6G A;  2KOU A;  1H72 C;  4R1F A;  1Z0C A;  1Z0E A;  4Z7Y A;  4BMJ A;  1NHH A;  3HJC A;  2BM1 A;  5AAS A;  4JI0 E;  2V87 A;  3LPS A;  2YZT A;  3ZKB A;  1NHI A;  2HK3 A;  1Y4U A;  1STU A;  5IT9 C;  4IZJ D;  2OI2 A;  3ADI A;  4LF8 I;  3K17 A;  2LJH A;  2MC5 A;  1Z59 A;  1FNM A;  4DPT A;  4B3M E;  3B78 A;  2NUG A;  2HHH E;  1Z5A A;  3RMP A;  1RR9 A;  2ZM6 E;  4DR5 I;  4JI8 I;  1KVK A;  1RRE A;  4IZJ A;  5IWA E;  4LF4 I;  4NXN I;  4IZJ B;  2V8Q B;  3OTO E;  1T4L B;  1X49 A;  1N36 E;  1ZM3 A;  1N33 I;  1N0U A;  1FJG E;  2L2M A;  4BCA A;  4Z7C A;  3T1Y E;  1OJ4 A;  2Z5E A;  3ZOQ B;  1HR0 E;  2VQF I;  2H36 X;  3OML A;  2LBS B;  3HPS A;  2L3J A;  3J81 Q;  2BM0 A;  4ED4 A;  3M6A A;  1YZ9 A;  4UT4 A;  1S4E A;  4JI6 E;  2DEI A;  3PRY A;  4I3H A;  5FLX Q;  2DEJ A;  1Y4S A;  2O1U A;  4HAC A;  4JV5 I;  4R8O A;  1XNR E;  4HAC B;  1Z0W A;  2DSY A;  4B3T I;  3ADL A;  2L92 A;  2L2K B;  1IBM I;  2V89 A;  2UUA E;  3IWB A;  1N34 E;  4DV7 I;  1ELO A;  2UXB I;  2F4V I;  4JI7 I;  2O1V A;  3VYX A;  4URL A;  4NXM E;  2V86 A;  1ZXM A;  2ODR D;  1D6T A;  5A2Q C;  1USV A;  1H7U A;  3JAM Q;  2ZIT A;  2HK2 A;  1XMQ I;  2LTS A;  3QT8 A;  1UIL A;  2DMY A;  3K85 A;  1YYK A;  4MYU A;  4JI3 I;  4DR4 I;  4FW9 A;  3H09 A;  1VIS A;  3PYF A;  3HPZ A;  1J26 A;  4WUC A;  2UXC E;  3JAM C;  2A2C A;  2NPF A;  2DIX A;  2L6M A;  1HK7 A;  1Z0G A;  4DPW A;  4K0K E;  1XMO E;  1WHQ A;  3F0N A;  2RS6 A;  4YY3 E;  1WXR A;  1FWK A;  2G7H A;  1FWL A;  3ZZT A;  5AE3 A;  2GQ0 A;  3B82 A;  4DR7 E;  4X64 E;  3T1H E;  4DV4 I;  1IBK I;  2LTR A;  2J7K A;  2B7T A;  2VF3 A;  4JI2 I;  3PYE A;  2RTX A;  4OOG C;  1UEK A;  4DV0 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...