4B3RE

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3rE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3rE02
2VQFI 1YYWA 1XNQE 4KHPE 4HACB 1RREA 4DUYE 1MG7A 1KKHA 4DU7A 2UUBI 3ZZ0A 2HKJA 1ZM2A 2VQEI 5BR8I 4LF6I 2UUAI 2LRSA 4JI6E 4YY3E 4DPYA 2WW4A 1HNZI 4NXMI 4UTGA 2UU9E 1ELOA 1FJGI 3ZZUA 2ZM6I 1FKAE 2NUEA 1N36E 1EA6A 1N34E 1PVGA 1N32E 4Z7CA 5CFFE 2DEIA 2HK3A 5IWAE 4FWGA 2HHHI 2V34A 4X66E 2A2CA 4B3SI 1IBMI 3GONA 4YHHI 4DV5E 5FLXC 5LMNE 4MYTA 4DXLA 2RS7A 1RC7A 2DMYA 4GKKI 4X65I 2AJ4A 4LFAI 1T4NA 2UXBI 3QT6A 1HR0E 1K47A 1KVKA 1H7SA 5LMUI 1IBLI 4DV6I 3J80Q 2RS6A 2LJHA 2UUCE 4R1FA 3JAMC 4DR6E 4JYAI 4LF5E 3J81C 2V2VA 4DU8A 1PIEA 4GKJE 4P52A 2UXCI 3D4JA 1EI1A 1N33E 5IT9Q 4JI5E 4JI2E 1I94I 4B3MI 4PRXA 2R42A 1HNXE 3PYFA 3OTOE 4DV2E 1A6FA 1XNQI 4KHPI 4DUYI 2L2NA 5GMDA 2L3JA 3C4TA 2ZBKB 4DV0E 3LPSA 4ZVIA 3QT7A 4JI6I 4KQVA 1ZM4A 2R3VA 3T1YE 4DR5E 4HXZA 3HTXA 2UU9I 1N36I 4HACA 3ZKDA 5L3JA 4JI1E 2LJPA 1N34I 4X8WA 2NUFA 3J7AG 1N32I 4EMDA 4K0KE 2UXDE 5IWAI 2L2MA 4URLA 4X66I 1EKZA 3J7Yp 1XHKA 1S4EA 2BV3A 3QT5A 5LL6R 1RR9A 3B78A 4DV5I 4WFTA 2B3TB 5LMNI 1ZXNA 3WU6A 1FNMA 2LTRA 2NA2A 4JI3E 4DPUA 1HR0I 3B8HA 4DV1E 3WU3A 2UUCI 2KHXA 4DR6I 4LF5I 4GKJI 1Z59A 1ZXMA 3ZKBA 4DR1E 5A2QQ 4DR4E 1N33I 1Z0WA 4JI5I 4JI8E 4JI2I 1HNXI 4DR7E 3OTOI 4DV2I 4ED4A 4I3HA 4LF4E 4M30A 4DV7E 1H74A 4MYUA 2DB2A 1Z0EA 2V8PA 1WUUA 2BM1A 2N3GA 5IT9C 1KTVA 4DV0I 4JI4E 3PYGA 1FI4A 1N0UA 1YZ9A 4DV3E 3T1YI 4DR5I 1YYKA 1UEKA 4AQYE 1Z0VA 1NZ0A 2OI2A 1RQ0A 4LF8E 3PYEA 1X49A 2E5LE 4JI1I 1HNWE 1YYOA 2J7KA 4K0KI 2UXDI 1WHQA 4X62E 4WUCA 5FLXQ 4X64E 3WU5A 1NHIA 4B3RE 4DR3E 2B7TA 1FWLA 2Q2EB 1UHZA 3LLHA 4LFCE 4JV5E 3M6AA 2JVAA 4JI0E 4FWDA 2RSMA 2EZ6A 1KIJA 4DPXA 4JI3I 1MU5A 2EFGA 5GMEA 2L3CA 1DI2A 4DV1I 3ADIA 4OX9E 3J81Q 1VISA 3VYXA 2BM0A 3C4BA 1FWKA 4OOGC 1QZRA 3ADJA 4NXNE 4HY1A 2IHR1 1Z5CA 2X36A 1O0WA 1XMOE 2MDRA 3VYYA 2RTXA 4DR1I 2F4VE 2L2KB 4DR4I 4WUDA 2LBSB 4JI7E 4JI8I 2LUPB 2NPFA 3J7AM 4DR7I 4UT4A 4LF9E 4USMA 3P1XA 1N0VC 1UILA 4LF4I 4FWHA 4DV7I 1Z0BA 2E1RA 1X47A 4DKKA 1ZBTA 4LF7E 2V2QA 5A2QC 4WYQB 1Z0GA 1NHJA 4JI4I 4WUBA 2VF3A 4P7AA 3K1JA 4DV3I 4AQYI 3H4LA 1XNRE 1ZM9A 4XTJA 2XEXA 1T4OA 3QT8A 2JY9A 4LF8I 4JG4A 2E5LI 2X7IA 2A2DA 1HNWI 1U2RA 1STUA 1XMQE 3T1HE 3J80C 4X62I 4X64I 1D6TA 4DUZE 4LFBE 4B3RI 4PRVA 4DR3I 1PKPA 4DV4E 1IBKE 4B3TE 1Z0TA 3V5RA 4LFCI 1MX0A 4JV5I 4JI0I 2YT4A 2HFSA 4DPTA 2CZ9A 2GS8A 1BKNA 2CPNA 3Q1QA 1J5EE 4HYMA 1B62A 1X48A 4DR2E 2VQFE 2HK2A 1B63A 3LTOA 4OX9I 2UUBE 4M2ZA 2VQEE 3HULA 5BR8E 4LF6E 2LTSA 4USKA 2UUAE 2DIXA 4NXNI 1Z0CA 3PYDA 1HNZE 4M1KA 3ZZTA 1XMOI 4NXME 2F4VI 1T4LB 4JI7I 1FJGE 2ZM6E 1H73A 3K17A 3B82A 4LF9I 2L33A 3ZM7A 2HHHE 1WHNA 1Z5BA 1J26A 4B3SE 2HKEA 1IBME 4LF7I 2HFUA 4Z7YA 4YHHE 4FN5A 1H7UA 3JAMQ 2V2ZA 4GKKE 4X65E 1NHHA 4LFAE 1XNRI 3WU4A 4PU9A 2LUQA 1Z5AA 2UXBE 1H72C 3V2UC 5LMUE 1QU6A 1IBLE 4DV6E 1S16A 1ZM3A 4YY3I 3ADLA 1XMQI 3T1HI 4JYAE 3F0NA 3CWVA 4DUZI 4LFBI 4RPFA 2DEJA 4DV4I 2N3HA 2UXCE 4DPWA 1IBKI 3ADGA 4B3TI 1DARA 1OJ4A 3LNUA 1I94E 4FW9A 4B3ME 2B7VA 2ZITA 2NUGA 1J5EI 1GQEA 4DR2I
chains in the Genus database with same CATH superfamily
3M7NG 2VQFI 1YYWA 1XNQE 4BCAA 2PRTA 4KHPE 4HACB 3C6MA 2DRPA 1RREA 4LPFA 4U3BA 1WJPA 2E1MA 4DUYE 1MG7A 1KKHA 4FW6A 2ELYA 1A1IA 4DU7A 2UUBI 3ZZ0A 2EPMX 4BA2A 3KZZA 1ZM2A 2HKJA 2VQEI 5BR8I 4LF6I 2EM9A 4Q35B 2UUAI 2YU8A 2C39B 2EOOA 2LRSA 1T38A 2EOIA 1PJQA 4JI6E 2Z5CA 2EPOA 4FW7A 3P76A 4IJDA 4YY3E 2WW4A 4DPYA 5K36F 1A1HA 2YTEA 1HNZI 4O4KA 3GMEA 4NXMI 2C38A 4UTGA 2YU5A 2EMYA 4GEQB 2GLIA 2UU9E 1ELOA 1N34I 1FJGI 3ZZUA 2EN2A 3MSWA 1FKAE 2NUEA 2EM4A 1N36E 2ZM6I 1EA6A 2EORA 1N34E 1PVGA 4N3OA 1N32E 4Z7CA 5CFFE 2DGCA 2DEIA 5JEAD 2HK3A 2ENHA 4BC7A 5IWAE 4FWGA 3UHMA 1GTKA 2HHHI 2V34A 2EM8A 4X66E 2V8QB 2A2CA 4B3SI 5A6AA 2RSIA 2RPCA 1IBMI 3GONA 1USVA 4YHHI 3IWCA 4OO1F 4WX9A 2PNZA 5FLXC 4DV5E 1G2DC 5LMNE 4MYTA 4DXLA 5K36C 2RS7A 1RC7A 4MDTA 2EL6A 4IFDA 5LLQA 3KWRA 2DMYA 1NCSA 5AE1A 5ELWA 2NN6E 2EMXA 4GKKI 4X65I 4F9AB 4J8ZA 4M9VC 4L8NA 1T4NA 2AJ4A 4LFAI 1YH8A 2H36X 3L00A 5TSEA 2UXBI 3M85D 2I9IA 4ZYDA 3QT6A 4WSGA 1HR0E 2PO1A 1K47A 4O24A 1KVKA 1H7SA 5LMUI 1IBLI 4DV6I 3J80Q 2EMFA 1G2FC 1X3CA 2RS6A 5AC5A 5KL6A 2LJHA 2YTQA 2YRMA 3ECRA 1A1GA 3L7ZB 1Y5YA 2UUCE 4ISAA 5DRQA 4R1FA 3JAMC 2BBGA 4DR6E 4JYAI 2JT2A 4LF5E 4OO1C 2FV4B 1YFHA 4BS9A 2L92A 3J81C 1YUIA 2V2VA 1KJKA 4DU8A 2PO1B 5DRPA 3HPSA 1PIEA 2PNMA 5DNYA 2EM2A 4GKJE 2BA0G 3BF2A 5JEAF 5C0XB 4P52A 2UXCI 3D4JA 4R2RA 3IWDA 1EI1A 2BA0D 3EPHA 2EWLA 1N33E 2EMCA 2WP8B 2LJUA 5IT9Q 4JI5E 3IWBA 4JI2E 1I94I 4B3MI 2FGGA 4PRXA 2R42A 3Q6MA 3DF6A 1HNXE 4IFDD 3PYFA 3OTOE 2EN1A 4DV2E 1A6FA 3K85A 3JTZA 2JYAA 5EKWA 4N4RB 2GO4A 1XNQI 2F1DA 4KHPI 1WXRA 2WNRA 2JPAA 2L2NA 1E3HA 4AIDA 4BBYA 2WZOA 5A69A 4DUYI 2VRDA 5GMDA 2L3JA 1X6EA 2EPNA 3C4TA 3HQ1A 2JWOA 2EOXA 4WPYA 4GQUA 2EL5A 4IS9A 1MGTA 2EL4A 1BBGA 2L8TA 2VE7C 4ZYEA 4F2JC 2BR2B 2ZBKB 2VESA 4DV0E 2V89A 5JEAC 3LPSA 2EPLX 4ZVIA 3QT7A 4JI6I 2J7JA 4KQVA 4LCHA 1ZM4A 1ZAAC 2R3VA 3T1YE 4DR5E 5K36B 2L6MA 2ODRD 4FK5C 3EQ1A 1LLMC 4LU9A 4HXZA 3NZKA 2M9AA 1JK2A 3HTXA 3RMPA 2UU9I 5KL7A 5K36E 1N36I 1SFEA 2O1WA 4HACA 5KL5A 3ZKDA 4JI1E 3J7AG 2LJPA 2KONA 4X8WA 2GPIA 2NUFA 5L3JA 1N32I 1Y4SA 4EMDA 4ZYGA 2YTJA 4K0KE 2UXDE 5IWAI 2L2MA 1Z1BA 5F3WA 2YRHA 4URLA 4X66I 2EMAA 1EKZA 3J7Yp 4IFDF 2LE2A 1XHKA 1S4EA 1BB8A 2BV3A 4LCGA 5DNLA 3QT5A 5LL6R 3HKMA 1RR9A 2HGHA 3B78A 4DV5I 4WFTA 2B3TB 2Z5EA 5LMNI 3EPJA 1ZXNA 3WU6A 1YPNA 2LTRA 5KL2A 1UN6B 1FNMA 2EMLA 2EM0A 4OO1E 4KWYA 2MC6A 2DSYA 2NA2A 2EMKA 4JI3E 4DPUA 2F8BA 1HR0I 2EM5A 3B8HA 3C6KA 4DV1E 1HK7A 2EE8A 3WU3A 3MHHC 2GHFA 4P78A 2EOMA 2R1FA 3CDIA 2CGEA 2EPZA 2E72A 2V86A 4IFDC 1EH8A 3TQMA 2UUCI 2KHXA 3CDJA 1YUJA 4DR6I 4LF5I 2EQ3A 2Z5BB 4RHBB 2EOJA 1OYRA 2PNLA 4GKJI 1Z59A 1ZXMA 5DRRA 3ZKBA 1USUA 4DR1E 4HTGA 5A2QQ 4DR4E 1N33I 2EJ4A 1Z0WA 3BBGA 4AM3A 4JI5I 4JI8E 4JI2I 2NN6B 2EMZA 5JEAE 4KZSA 1HNXI 4DR7E 3OTOI 4DV2I 4ED4A 3B4TA 4OZEA 5A6KA 1P47A 4I3HA 1KYQA 2EN4A 2EM6A 2ODRC 2EMHA 4BHCA 4QNKA 3L7ZA 4BHBA 3HPZA 4LF4E 1A1LA 4M30A 4DV7E 1H74A 4FW4A 4R8OA 4MYUA 2DB2A 3BGHA 2MC5A 1Z0EA 3M85G 2V8PA 5AC4A 1L4SA 5DNXA 2DLKA 1WUUA 4R2EA 2CG9A 2YPNA 2A25A 2B9DA 2YZTA 2BM1A 2N3GA 4BA1A 4I8OA 5IT9C 1KTVA 5C0XA 4DV0I 4JI4E 2WBSA 2YTFA 4OKGA 2M4IA 3PYGA 1FI4A 2YWQA 1N0UA 3AUZA 1YZ9A 2HJJA 2JOXA 4DV3E 1YYKA 2WP8A 4DR5I 3T1YI 1UEKA 4AQYE 2EOHA 1UDNA 1Z0VA 4NHRA 1NZ0A 1A1FA 1RHYA 2OI2A 1RQ0A 4LF8E 3PYEA 4BA1B 1X49A 1IQSA 2GO3A 2E5LE 4JI1I 1HNWE 4BMJA 1PDAA 4IZKB 1YYOA 2J7KA 4K0KI 2YSPA 3VHTB 2UXDI 1A1JA 1WHQA 5KL4A 2JP9A 2BR2A 4X62E 4WUCA 5FLXQ 4X9JA 3BIDA 4X64E 3WU5A 2EMBA 3EPLA 1NHIA 4B3RE 4DR3E 2B7TA 5K36A 2YRKA 1FWLA 2Q2EB 1BBOA 2JOBA 1UHZA 3LLHA 4LFCE 4TUIA 3UK3C 1UDOA 4JV5E 3M6AA 2JVAA 4JI0E 3THOB 2RSMA 4WSPA 4FWDA 5C0XD 1YHCA 2EZ6A 1KIJA 3P3GA 1EH7A 4DPXA 2LCEA 2I13A 2RQLA 5AASA 1UDSA 4P7DA 4JI3I 2M7QA 4DMIA 1MU5A 3PS2A 2EFGA 2G7HA 2N8XA 5GMEA 2L3CA 1DI2A 4DV1I 3ADIA 3Q6NA 2V83A 1P42A 2LVHA 1Y4UA 2PO2B 4NBQA 4OX9E 2EPPA 3M99B 4HEIA 2NABA 1IQOA 2EPAA 3J81Q 2ENAA 4F6MA 1AAYA 1VISA 3VYXA 4J3DA 2BM0A 4MLQA 3C4BA 4R2SA 1FWKA 2PO0B 4OOGC 4MU0A 1QZRA 3ADJA 4NXNE 4IZJB 2EM3A 3F6GA 4BC9A 2IHR1 4HY1A 1Z5CA 2X36A 2V85A 2EM7A 2R76A 1O0WA 1XMOE 2KOUA 2MDRA 3VYYA 2RTXA 2YTDA 2F4VE 2L2KB 4DR1I 4DR4I 4WUDA 2C37B 2LBSB 4JI7E 5AE3A 4JI8I 3F6HA 4OO1B 2LUPB 2NPFA 3JU0A 1ZU1A 3J7AM 2CT1A 3PS3A 4DR7I 4GZNC 4UT4A 4IFDE 3H09A 4LF9E 4USMA 3P1XA 2EN8A 2WBTA 1N0VC 1UILA 2EN6A 2YTOA 2IESA 2EOEA 5C0XF 4LF4I 4FWHA 2EMWA 4L5NC 4DV7I 2V88A 1NEIA 1Z0BA 2E1RA 1EH6A 3KZYA 2JE6B 1X47A 2MKDA 1ZBTA 4DKKA 4LF7E 2Z5BA 2ADRA 2K7IA 2EN7A 2V2QA 1ZBQA 2GQ0A 2JEBB 1IMUA 5A2QC 1MEYC 4WYQB 2O1VA 4MU4A 1Z0GA 1NHJA 4JI4I 2EOZA 4WUBA 2VF3A 4P7AA 5IV8B 3K1JA 4DV3I 2DLQA 2ENCA 1F2IG 2WCC3 2JR1A 2MDGA 2YTPA 2NN6A 4AQYI 4Q28A 1XNRE 3H4LA 3M7ND 4F6NA 5IXMB 1ZM9A 4XTJA 2XEXA 3P3CA 5JEAB 1ZR9A 4WXDA 1T4OA 3QT8A 2JY9A 4LF8I 3QG5C 4JG4A 3DJWA 4R2DA 2E5LI 5C0XC 3HXLA 2X7IA 2A2DA 2K4VA 4R2PA 2LO3A 1STUA 1U2RA 1XXEA 2JEAB 1HNWI 1XMQE 4F9CB 3J80C 3T1HE 1TF6A 2BA1G 4LOMA 4R2AA 2BA1D 4X62I 3K6QA 2IOPA 4X64I 4BA2B 1D6TA 5AE2A 4DUZE 2MKNA 2WBUA 4LFBE 1UDQA 4PRVA 2IOQA 1TF3A 4DR3I 4B3RI 1PKPA 2D9HA 4TUGA 4DV4E 5T6JA 1IBKE 1N3GA 5A6JA 4R2CA 4B3TE 4RH8A 1Z0TA 2EPRA 2O3ZA 3V5RA 2Z5CB 4LFCI 1MX0A 4JV5I 1X6FA 4JI0I 2EPCA 2EOFA 2YT4A 1R6MA 2HFSA 4LCFA 2EOQA 2CZ9A 4DPTA 3AV0A 4QNJA 2GS8A 1Y6ZA 2C38B 1BKNA 2CPNA 4LTYA 3Q1QA 1J5EE 4HYMA 1B62A 2NN6D 4U3DA 2LMZA 1OYPA 1X5WA 1X48A 4DR2E 4IZKA 2VQFE 1DGCA 3DD6A 2DMIA 2EMIA 1OYSA 1UBDC 2HK2A 5EL9A 1B63A 3LTOA 1Y60A 3ZOQB 4OX9I 5A6BA 1WRJA 2UUBE 4M2ZA 4IS1C 3FIGA 4MLVA 3PRYA 2VQEE 3HULA 3KRNA 4WXCA 5BR8E 4LF6E 1DQ3A 2LTSA 4USKA 2UUAE 1TN9A 2DIXA 3HJCA 2EOYA 4NXNI 1Z0CA 2PNZB 5ADZA 4R03A 3PYDA 5KL3A 3U1YA 4ZYHA 2EMGA 3LMLA 1SR9A 2CVEA 1HNZE 4M1KA 3ZZTA 1XMOI 1VI7A 1T39A 1R6LA 4NXME 4IFDB 2F4VI 1AH5A 1T4LB 4JI7I 2EPUA 1FJGE 3U1KA 2ZM6E 1H73A 2M1SA 3K17A 4MU3A 3H1CA 3B82A 2PO2A 4LF9I 2L33A 3ZM7A 3OMLA 2HHHE 1WHNA 1Z5BA 1J26A 4B3SE 2HKEA 1X6HA 2PO0A 1IBME 4LF7I 2HFUA 3GLLA 4Z7YA 3P3EA 4IZJA 3MHSC 4YHHE 2NN6F 4FN5A 2BB8A 1E3PA 2O1TA 5A6BD 4NZVA 2YTNA 4AIMA 5FWKA 5C0XE 1H7UA 2EOSA 3EPKA 2ELZA 3JAMQ 2CSHA 2V2ZA 2IERA 1YSAC 2C37A 4GKKE 2Q8UA 4X65E 1NHHA 1GZ6A 4OO1A 2YTIA 4LFAE 1XNRI 3WU4A 4PU9A 2LUQA 1Z5AA 2UXBE 1H72C 2V87A 1B69A 2AE8A 4F54A 3V2UC 3P06A 1QNTA 5LMUE 1QU6A 1IBLE 4DV6E 1S16A 1ZM3A 2EQ1A 5K36D 2JE6A 4F9BB 4YY3I 3ADLA 1XMQI 3GCMA 3T1HI 4MU1A 3VK6A 4O43A 2WNRB 5DROA 2JEBA 4JYAE 1RMDA 2EN3A 3THNA 2NN6C 3F0NA 2EPKX 2EPXA 4O5GA 2O1UA 3CWVA 1JK1A 4DUZI 4LFBI 2EQ0A 4M0VA 4RPFA 2DEJA 1A1KA 4DV4I 1PJSA 4R2QA 2N3HA 2EP3A 2UXCE 1PJTA 4FW5A 3ADGA 4FW3A 4IZJD 4DPWA 1IBKI 2LT7A 4B3TI 1DARA 1OJ4A 3LNUA 2CTDA 2LV2A 2YTGA 2HC5A 1I94E 4FW9A 4B3ME 4MQYA 2FTXB 2JXPA 2VF1A 5JEAA 2B7VA 2ZITA 2NUGA 2C39A 3PS1A 2YSOA 1J5EI 1GQEA 2JEAA 2J65A 4OO1D 4DR2I
chains in the Genus database with same CATH topology
2VQFI 1YYWA 1XNQE 4BCAA 4KHPE 4HACB 1RREA 2E1MA 4DUYE 1MG7A 1KKHA 4DU7A 2UUBI 3ZZ0A 2HKJA 1ZM2A 2VQEI 5BR8I 4LF6I 2UUAI 2LRSA 4JI6E 2Z5CA 4YY3E 4DPYA 2WW4A 1HNZI 4NXMI 4UTGA 2UU9E 4GEQB 1ELOA 1FJGI 3ZZUA 2ZM6I 3MSWA 1FKAE 2NUEA 1N36E 1EA6A 1N34E 1PVGA 4N3OA 1N32E 4Z7CA 5CFFE 2DEIA 2HK3A 4BC7A 5IWAE 4FWGA 2HHHI 2V34A 4X66E 2V8QB 2A2CA 4B3SI 1IBMI 3GONA 1USVA 4YHHI 3IWCA 5FLXC 4DV5E 5LMNE 4MYTA 4DXLA 2RS7A 1RC7A 3KWRA 2DMYA 5AE1A 4GKKI 4X65I 4F9AB 4J8ZA 2AJ4A 4L8NA 1T4NA 4LFAI 2H36X 2UXBI 3QT6A 1HR0E 1K47A 1KVKA 1H7SA 5LMUI 1IBLI 4DV6I 3J80Q 2RS6A 2LJHA 2UUCE 4R1FA 3JAMC 4DR6E 4JYAI 4LF5E 2FV4B 4BS9A 2L92A 3J81C 2V2VA 4DU8A 3HPSA 1PIEA 2PNMA 5DNYA 4GKJE 4P52A 2UXCI 3D4JA 3IWDA 1EI1A 1N33E 2EWLA 5IT9Q 4JI5E 3IWBA 4JI2E 1I94I 4B3MI 2FGGA 4PRXA 2R42A 3Q6MA 3DF6A 1HNXE 3PYFA 3OTOE 4DV2E 1A6FA 3K85A 3JTZA 1XNQI 4KHPI 1WXRA 4DUYI 2L2NA 4BBYA 2WZOA 5GMDA 2L3JA 3HQ1A 3C4TA 4WPYA 2JWOA 2L8TA 2ZBKB 2VE7C 4DV0E 2V89A 3LPSA 4ZVIA 3QT7A 4JI6I 4KQVA 1ZM4A 2R3VA 3T1YE 4DR5E 2L6MA 2ODRD 4LU9A 4HXZA 3HTXA 3RMPA 2UU9I 1N36I 2O1WA 4HACA 3ZKDA 5L3JA 4JI1E 3J7AG 2LJPA 2KONA 4X8WA 2NUFA 1N34I 1N32I 1Y4SA 4EMDA 4K0KE 2UXDE 5IWAI 2L2MA 5F3WA 4URLA 4X66I 1EKZA 3J7Yp 2LE2A 1XHKA 1S4EA 2BV3A 3QT5A 5LL6R 1RR9A 3B78A 4DV5I 4WFTA 2B3TB 2Z5EA 5LMNI 1ZXNA 3WU6A 1FNMA 2LTRA 2MC6A 2DSYA 2NA2A 4JI3E 4DPUA 2F8BA 1HR0I 3B8HA 4DV1E 1HK7A 3WU3A 4P78A 2CGEA 2V86A 2UUCI 2KHXA 4DR6I 4LF5I 2Z5BB 2PNLA 4GKJI 1Z59A 1ZXMA 3ZKBA 1USUA 4DR1E 5A2QQ 4DR4E 1N33I 1Z0WA 4JI5I 4JI8E 4JI2I 4KZSA 1HNXI 4DR7E 3OTOI 4DV2I 4ED4A 4I3HA 2ODRC 4LF4E 3HPZA 4M30A 4DV7E 1H74A 4R8OA 4MYUA 2DB2A 2MC5A 1Z0EA 2V8PA 1WUUA 2CG9A 2YZTA 2B9DA 2BM1A 2N3GA 4I8OA 5IT9C 1KTVA 4DV0I 4JI4E 2M4IA 3PYGA 1FI4A 1N0UA 3AUZA 1YZ9A 2JOXA 4DV3E 4DR5I 1YYKA 3T1YI 1UEKA 4AQYE 1Z0VA 1NZ0A 2OI2A 1RQ0A 4LF8E 3PYEA 1X49A 2E5LE 4JI1I 1HNWE 4BMJA 4IZKB 1YYOA 2J7KA 4K0KI 2UXDI 1WHQA 4X62E 4WUCA 5FLXQ 4X64E 3WU5A 1NHIA 4B3RE 4DR3E 2B7TA 1FWLA 2Q2EB 2JOBA 1UHZA 3LLHA 4LFCE 4TUIA 4JV5E 3M6AA 2JVAA 4JI0E 4FWDA 2RSMA 4WSPA 2EZ6A 1KIJA 4DPXA 5AASA 4P7DA 4JI3I 2M7QA 4DMIA 1MU5A 2EFGA 2G7HA 5GMEA 2L3CA 1DI2A 4DV1I 3ADIA 3Q6NA 2V83A 1Y4UA 4OX9E 3J81Q 1VISA 3VYXA 2BM0A 3C4BA 1FWKA 4OOGC 1QZRA 3ADJA 4NXNE 4IZJB 4BC9A 3F6GA 4HY1A 2IHR1 1Z5CA 2X36A 2V85A 1O0WA 1XMOE 2KOUA 2MDRA 3VYYA 2RTXA 4DR1I 2F4VE 2L2KB 4DR4I 4WUDA 2LBSB 4JI7E 5AE3A 4JI8I 3F6HA 2LUPB 2NPFA 3JU0A 3J7AM 4DR7I 4UT4A 3H09A 4LF9E 4USMA 3P1XA 1N0VC 1UILA 4LF4I 4FWHA 4L5NC 4DV7I 2V88A 1Z0BA 2E1RA 1X47A 4DKKA 1ZBTA 4LF7E 2Z5BA 2V2QA 1ZBQA 2GQ0A 5A2QC 4WYQB 2O1VA 1Z0GA 1NHJA 4JI4I 4WUBA 2VF3A 4P7AA 3K1JA 4DV3I 2JR1A 4AQYI 4Q28A 1XNRE 3H4LA 1ZM9A 4XTJA 2XEXA 1T4OA 3QT8A 2JY9A 4LF8I 4JG4A 3DJWA 2E5LI 3HXLA 2X7IA 2A2DA 2K4VA 1HNWI 1U2RA 1STUA 1XMQE 4F9CB 3J80C 3T1HE 4X62I 3K6QA 2IOPA 4X64I 1D6TA 5AE2A 4DUZE 4LFBE 4B3RI 4PRVA 2IOQA 4DR3I 1PKPA 4TUGA 4DV4E 5T6JA 1IBKE 4B3TE 1Z0TA 3V5RA 2Z5CB 4LFCI 1MX0A 4JV5I 4JI0I 2YT4A 2HFSA 4DPTA 2CZ9A 3AV0A 2GS8A 1Y6ZA 1BKNA 2CPNA 4LTYA 3Q1QA 1J5EE 4HYMA 1B62A 2LMZA 1X48A 4DR2E 4IZKA 2VQFE 2HK2A 1B63A 3LTOA 3ZOQB 4OX9I 2UUBE 4M2ZA 3FIGA 3PRYA 2VQEE 3HULA 5BR8E 4LF6E 1DQ3A 2LTSA 4USKA 2UUAE 2DIXA 3HJCA 4NXNI 1Z0CA 5ADZA 4R03A 3PYDA 3LMLA 1SR9A 1HNZE 4M1KA 3ZZTA 1XMOI 4NXME 2F4VI 1T4LB 4JI7I 1FJGE 2ZM6E 1H73A 2M1SA 3K17A 3B82A 4LF9I 2L33A 3ZM7A 3OMLA 2HHHE 1WHNA 1Z5BA 1J26A 4B3SE 2HKEA 1IBME 4LF7I 2HFUA 4Z7YA 4IZJA 4YHHE 4FN5A 2O1TA 5FWKA 1H7UA 3JAMQ 2V2ZA 4GKKE 4X65E 1NHHA 1GZ6A 4LFAE 1XNRI 3WU4A 4PU9A 2LUQA 1Z5AA 2UXBE 1H72C 2V87A 4F54A 3V2UC 3P06A 5LMUE 1QU6A 1IBLE 4DV6E 1S16A 1ZM3A 4F9BB 4YY3I 3ADLA 1XMQI 3T1HI 3VK6A 4JYAE 3F0NA 2O1UA 3CWVA 4DUZI 4LFBI 4M0VA 4RPFA 2DEJA 4DV4I 2N3HA 2UXCE 4DPWA 1IBKI 3ADGA 4IZJD 4B3TI 1DARA 1OJ4A 3LNUA 1I94E 4FW9A 4B3ME 2FTXB 2VF1A 2B7VA 2ZITA 2NUGA 1J5EI 1GQEA 4DR2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF I;  1YYW A;  1XNQ E;  4KHP E;  4HAC B;  1RRE A;  4DUY E;  1MG7 A;  1KKH A;  4DU7 A;  2UUB I;  3ZZ0 A;  2HKJ A;  1ZM2 A;  2VQE I;  5BR8 I;  4LF6 I;  2UUA I;  2LRS A;  4JI6 E;  4YY3 E;  4DPY A;  2WW4 A;  1HNZ I;  4NXM I;  4UTG A;  2UU9 E;  1ELO A;  1FJG I;  3ZZU A;  2ZM6 I;  1FKA E;  2NUE A;  1N36 E;  1EA6 A;  1N34 E;  1PVG A;  1N32 E;  4Z7C A;  5CFF E;  2DEI A;  2HK3 A;  5IWA E;  4FWG A;  2HHH I;  2V34 A;  4X66 E;  2A2C A;  4B3S I;  1IBM I;  3GON A;  4YHH I;  4DV5 E;  5FLX C;  5LMN E;  4MYT A;  4DXL A;  2RS7 A;  1RC7 A;  2DMY A;  4GKK I;  4X65 I;  2AJ4 A;  4LFA I;  1T4N A;  2UXB I;  3QT6 A;  1HR0 E;  1K47 A;  1KVK A;  1H7S A;  5LMU I;  1IBL I;  4DV6 I;  3J80 Q;  2RS6 A;  2LJH A;  2UUC E;  4R1F A;  3JAM C;  4DR6 E;  4JYA I;  4LF5 E;  3J81 C;  2V2V A;  4DU8 A;  1PIE A;  4GKJ E;  4P52 A;  2UXC I;  3D4J A;  1EI1 A;  1N33 E;  5IT9 Q;  4JI5 E;  4JI2 E;  1I94 I;  4B3M I;  4PRX A;  2R42 A;  1HNX E;  3PYF A;  3OTO E;  4DV2 E;  1A6F A;  1XNQ I;  4KHP I;  4DUY I;  2L2N A;  5GMD A;  2L3J A;  3C4T A;  2ZBK B;  4DV0 E;  3LPS A;  4ZVI A;  3QT7 A;  4JI6 I;  4KQV A;  1ZM4 A;  2R3V A;  3T1Y E;  4DR5 E;  4HXZ A;  3HTX A;  2UU9 I;  1N36 I;  4HAC A;  3ZKD A;  5L3J A;  4JI1 E;  2LJP A;  1N34 I;  4X8W A;  2NUF A;  3J7A G;  1N32 I;  4EMD A;  4K0K E;  2UXD E;  5IWA I;  2L2M A;  4URL A;  4X66 I;  1EKZ A;  3J7Y p;  1XHK A;  1S4E A;  2BV3 A;  3QT5 A;  5LL6 R;  1RR9 A;  3B78 A;  4DV5 I;  4WFT A;  2B3T B;  5LMN I;  1ZXN A;  3WU6 A;  1FNM A;  2LTR A;  2NA2 A;  4JI3 E;  4DPU A;  1HR0 I;  3B8H A;  4DV1 E;  3WU3 A;  2UUC I;  2KHX A;  4DR6 I;  4LF5 I;  4GKJ I;  1Z59 A;  1ZXM A;  3ZKB A;  4DR1 E;  5A2Q Q;  4DR4 E;  1N33 I;  1Z0W A;  4JI5 I;  4JI8 E;  4JI2 I;  1HNX I;  4DR7 E;  3OTO I;  4DV2 I;  4ED4 A;  4I3H A;  4LF4 E;  4M30 A;  4DV7 E;  1H74 A;  4MYU A;  2DB2 A;  1Z0E A;  2V8P A;  1WUU A;  2BM1 A;  2N3G A;  5IT9 C;  1KTV A;  4DV0 I;  4JI4 E;  3PYG A;  1FI4 A;  1N0U A;  1YZ9 A;  4DV3 E;  3T1Y I;  4DR5 I;  1YYK A;  1UEK A;  4AQY E;  1Z0V A;  1NZ0 A;  2OI2 A;  1RQ0 A;  4LF8 E;  3PYE A;  1X49 A;  2E5L E;  4JI1 I;  1HNW E;  1YYO A;  2J7K A;  4K0K I;  2UXD I;  1WHQ A;  4X62 E;  4WUC A;  5FLX Q;  4X64 E;  3WU5 A;  1NHI A;  4B3R E;  4DR3 E;  2B7T A;  1FWL A;  2Q2E B;  1UHZ A;  3LLH A;  4LFC E;  4JV5 E;  3M6A A;  2JVA A;  4JI0 E;  4FWD A;  2RSM A;  2EZ6 A;  1KIJ A;  4DPX A;  4JI3 I;  1MU5 A;  2EFG A;  5GME A;  2L3C A;  1DI2 A;  4DV1 I;  3ADI A;  4OX9 E;  3J81 Q;  1VIS A;  3VYX A;  2BM0 A;  3C4B A;  1FWK A;  4OOG C;  1QZR A;  3ADJ A;  4NXN E;  4HY1 A;  2IHR 1;  1Z5C A;  2X36 A;  1O0W A;  1XMO E;  2MDR A;  3VYY A;  2RTX A;  4DR1 I;  2F4V E;  2L2K B;  4DR4 I;  4WUD A;  2LBS B;  4JI7 E;  4JI8 I;  2LUP B;  2NPF A;  3J7A M;  4DR7 I;  4UT4 A;  4LF9 E;  4USM A;  3P1X A;  1N0V C;  1UIL A;  4LF4 I;  4FWH A;  4DV7 I;  1Z0B A;  2E1R A;  1X47 A;  4DKK A;  1ZBT A;  4LF7 E;  2V2Q A;  5A2Q C;  4WYQ B;  1Z0G A;  1NHJ A;  4JI4 I;  4WUB A;  2VF3 A;  4P7A A;  3K1J A;  4DV3 I;  4AQY I;  3H4L A;  1XNR E;  1ZM9 A;  4XTJ A;  2XEX A;  1T4O A;  3QT8 A;  2JY9 A;  4LF8 I;  4JG4 A;  2E5L I;  2X7I A;  2A2D A;  1HNW I;  1U2R A;  1STU A;  1XMQ E;  3T1H E;  3J80 C;  4X62 I;  4X64 I;  1D6T A;  4DUZ E;  4LFB E;  4B3R I;  4PRV A;  4DR3 I;  1PKP A;  4DV4 E;  1IBK E;  4B3T E;  1Z0T A;  3V5R A;  4LFC I;  1MX0 A;  4JV5 I;  4JI0 I;  2YT4 A;  2HFS A;  4DPT A;  2CZ9 A;  2GS8 A;  1BKN A;  2CPN A;  3Q1Q A;  1J5E E;  4HYM A;  1B62 A;  1X48 A;  4DR2 E;  2VQF E;  2HK2 A;  1B63 A;  3LTO A;  4OX9 I;  2UUB E;  4M2Z A;  2VQE E;  3HUL A;  5BR8 E;  4LF6 E;  2LTS A;  4USK A;  2UUA E;  2DIX A;  4NXN I;  1Z0C A;  3PYD A;  1HNZ E;  4M1K A;  3ZZT A;  1XMO I;  4NXM E;  2F4V I;  1T4L B;  4JI7 I;  1FJG E;  2ZM6 E;  1H73 A;  3K17 A;  3B82 A;  4LF9 I;  2L33 A;  3ZM7 A;  2HHH E;  1WHN A;  1Z5B A;  1J26 A;  4B3S E;  2HKE A;  1IBM E;  4LF7 I;  2HFU A;  4Z7Y A;  4YHH E;  4FN5 A;  1H7U A;  3JAM Q;  2V2Z A;  4GKK E;  4X65 E;  1NHH A;  4LFA E;  1XNR I;  3WU4 A;  4PU9 A;  2LUQ A;  1Z5A A;  2UXB E;  1H72 C;  3V2U C;  5LMU E;  1QU6 A;  1IBL E;  4DV6 E;  1S16 A;  1ZM3 A;  4YY3 I;  3ADL A;  1XMQ I;  3T1H I;  4JYA E;  3F0N A;  3CWV A;  4DUZ I;  4LFB I;  4RPF A;  2DEJ A;  4DV4 I;  2N3H A;  2UXC E;  4DPW A;  1IBK I;  3ADG A;  4B3T I;  1DAR A;  1OJ4 A;  3LNU A;  1I94 E;  4FW9 A;  4B3M E;  2B7V A;  2ZIT A;  2NUG A;  1J5E I;  1GQE A;  4DR2 I; 
#chains in the Genus database with same CATH topology
 3M7N G;  2VQF I;  1YYW A;  1XNQ E;  4BCA A;  2PRT A;  4KHP E;  4HAC B;  3C6M A;  2DRP A;  1RRE A;  4LPF A;  4U3B A;  1WJP A;  2E1M A;  4DUY E;  1MG7 A;  1KKH A;  4FW6 A;  2ELY A;  1A1I A;  4DU7 A;  2UUB I;  3ZZ0 A;  2EPM X;  4BA2 A;  3KZZ A;  1ZM2 A;  2HKJ A;  2VQE I;  5BR8 I;  4LF6 I;  2EM9 A;  4Q35 B;  2UUA I;  2YU8 A;  2C39 B;  2EOO A;  2LRS A;  1T38 A;  2EOI A;  1PJQ A;  4JI6 E;  2Z5C A;  2EPO A;  4FW7 A;  3P76 A;  4IJD A;  4YY3 E;  2WW4 A;  4DPY A;  5K36 F;  1A1H A;  2YTE A;  1HNZ I;  4O4K A;  3GME A;  4NXM I;  2C38 A;  4UTG A;  2YU5 A;  2EMY A;  4GEQ B;  2GLI A;  2UU9 E;  1ELO A;  1N34 I;  1FJG I;  3ZZU A;  2EN2 A;  3MSW A;  1FKA E;  2NUE A;  2EM4 A;  1N36 E;  2ZM6 I;  1EA6 A;  2EOR A;  1N34 E;  1PVG A;  4N3O A;  1N32 E;  4Z7C A;  5CFF E;  2DGC A;  2DEI A;  5JEA D;  2HK3 A;  2ENH A;  4BC7 A;  5IWA E;  4FWG A;  3UHM A;  1GTK A;  2HHH I;  2V34 A;  2EM8 A;  4X66 E;  2V8Q B;  2A2C A;  4B3S I;  5A6A A;  2RSI A;  2RPC A;  1IBM I;  3GON A;  1USV A;  4YHH I;  3IWC A;  4OO1 F;  4WX9 A;  2PNZ A;  5FLX C;  4DV5 E;  1G2D C;  5LMN E;  4MYT A;  4DXL A;  5K36 C;  2RS7 A;  1RC7 A;  4MDT A;  2EL6 A;  4IFD A;  5LLQ A;  3KWR A;  2DMY A;  1NCS A;  5AE1 A;  5ELW A;  2NN6 E;  2EMX A;  4GKK I;  4X65 I;  4F9A B;  4J8Z A;  4M9V C;  4L8N A;  1T4N A;  2AJ4 A;  4LFA I;  1YH8 A;  2H36 X;  3L00 A;  5TSE A;  2UXB I;  3M85 D;  2I9I A;  4ZYD A;  3QT6 A;  4WSG A;  1HR0 E;  2PO1 A;  1K47 A;  4O24 A;  1KVK A;  1H7S A;  5LMU I;  1IBL I;  4DV6 I;  3J80 Q;  2EMF A;  1G2F C;  1X3C A;  2RS6 A;  5AC5 A;  5KL6 A;  2LJH A;  2YTQ A;  2YRM A;  3ECR A;  1A1G A;  3L7Z B;  1Y5Y A;  2UUC E;  4ISA A;  5DRQ A;  4R1F A;  3JAM C;  2BBG A;  4DR6 E;  4JYA I;  2JT2 A;  4LF5 E;  4OO1 C;  2FV4 B;  1YFH A;  4BS9 A;  2L92 A;  3J81 C;  1YUI A;  2V2V A;  1KJK A;  4DU8 A;  2PO1 B;  5DRP A;  3HPS A;  1PIE A;  2PNM A;  5DNY A;  2EM2 A;  4GKJ E;  2BA0 G;  3BF2 A;  5JEA F;  5C0X B;  4P52 A;  2UXC I;  3D4J A;  4R2R A;  3IWD A;  1EI1 A;  2BA0 D;  3EPH A;  2EWL A;  1N33 E;  2EMC A;  2WP8 B;  2LJU A;  5IT9 Q;  4JI5 E;  3IWB A;  4JI2 E;  1I94 I;  4B3M I;  2FGG A;  4PRX A;  2R42 A;  3Q6M A;  3DF6 A;  1HNX E;  4IFD D;  3PYF A;  3OTO E;  2EN1 A;  4DV2 E;  1A6F A;  3K85 A;  3JTZ A;  2JYA A;  5EKW A;  4N4R B;  2GO4 A;  1XNQ I;  2F1D A;  4KHP I;  1WXR A;  2WNR A;  2JPA A;  2L2N A;  1E3H A;  4AID A;  4BBY A;  2WZO A;  5A69 A;  4DUY I;  2VRD A;  5GMD A;  2L3J A;  1X6E A;  2EPN A;  3C4T A;  3HQ1 A;  2JWO A;  2EOX A;  4WPY A;  4GQU A;  2EL5 A;  4IS9 A;  1MGT A;  2EL4 A;  1BBG A;  2L8T A;  2VE7 C;  4ZYE A;  4F2J C;  2BR2 B;  2ZBK B;  2VES A;  4DV0 E;  2V89 A;  5JEA C;  3LPS A;  2EPL X;  4ZVI A;  3QT7 A;  4JI6 I;  2J7J A;  4KQV A;  4LCH A;  1ZM4 A;  1ZAA C;  2R3V A;  3T1Y E;  4DR5 E;  5K36 B;  2L6M A;  2ODR D;  4FK5 C;  3EQ1 A;  1LLM C;  4LU9 A;  4HXZ A;  3NZK A;  2M9A A;  1JK2 A;  3HTX A;  3RMP A;  2UU9 I;  5KL7 A;  5K36 E;  1N36 I;  1SFE A;  2O1W A;  4HAC A;  5KL5 A;  3ZKD A;  4JI1 E;  3J7A G;  2LJP A;  2KON A;  4X8W A;  2GPI A;  2NUF A;  5L3J A;  1N32 I;  1Y4S A;  4EMD A;  4ZYG A;  2YTJ A;  4K0K E;  2UXD E;  5IWA I;  2L2M A;  1Z1B A;  5F3W A;  2YRH A;  4URL A;  4X66 I;  2EMA A;  1EKZ A;  3J7Y p;  4IFD F;  2LE2 A;  1XHK A;  1S4E A;  1BB8 A;  2BV3 A;  4LCG A;  5DNL A;  3QT5 A;  5LL6 R;  3HKM A;  1RR9 A;  2HGH A;  3B78 A;  4DV5 I;  4WFT A;  2B3T B;  2Z5E A;  5LMN I;  3EPJ A;  1ZXN A;  3WU6 A;  1YPN A;  2LTR A;  5KL2 A;  1UN6 B;  1FNM A;  2EML A;  2EM0 A;  4OO1 E;  4KWY A;  2MC6 A;  2DSY A;  2NA2 A;  2EMK A;  4JI3 E;  4DPU A;  2F8B A;  1HR0 I;  2EM5 A;  3B8H A;  3C6K A;  4DV1 E;  1HK7 A;  2EE8 A;  3WU3 A;  3MHH C;  2GHF A;  4P78 A;  2EOM A;  2R1F A;  3CDI A;  2CGE A;  2EPZ A;  2E72 A;  2V86 A;  4IFD C;  1EH8 A;  3TQM A;  2UUC I;  2KHX A;  3CDJ A;  1YUJ A;  4DR6 I;  4LF5 I;  2EQ3 A;  2Z5B B;  4RHB B;  2EOJ A;  1OYR A;  2PNL A;  4GKJ I;  1Z59 A;  1ZXM A;  5DRR A;  3ZKB A;  1USU A;  4DR1 E;  4HTG A;  5A2Q Q;  4DR4 E;  1N33 I;  2EJ4 A;  1Z0W A;  3BBG A;  4AM3 A;  4JI5 I;  4JI8 E;  4JI2 I;  2NN6 B;  2EMZ A;  5JEA E;  4KZS A;  1HNX I;  4DR7 E;  3OTO I;  4DV2 I;  4ED4 A;  3B4T A;  4OZE A;  5A6K A;  1P47 A;  4I3H A;  1KYQ A;  2EN4 A;  2EM6 A;  2ODR C;  2EMH A;  4BHC A;  4QNK A;  3L7Z A;  4BHB A;  3HPZ A;  4LF4 E;  1A1L A;  4M30 A;  4DV7 E;  1H74 A;  4FW4 A;  4R8O A;  4MYU A;  2DB2 A;  3BGH A;  2MC5 A;  1Z0E A;  3M85 G;  2V8P A;  5AC4 A;  1L4S A;  5DNX A;  2DLK A;  1WUU A;  4R2E A;  2CG9 A;  2YPN A;  2A25 A;  2B9D A;  2YZT A;  2BM1 A;  2N3G A;  4BA1 A;  4I8O A;  5IT9 C;  1KTV A;  5C0X A;  4DV0 I;  4JI4 E;  2WBS A;  2YTF A;  4OKG A;  2M4I A;  3PYG A;  1FI4 A;  2YWQ A;  1N0U A;  3AUZ A;  1YZ9 A;  2HJJ A;  2JOX A;  4DV3 E;  1YYK A;  2WP8 A;  4DR5 I;  3T1Y I;  1UEK A;  4AQY E;  2EOH A;  1UDN A;  1Z0V A;  4NHR A;  1NZ0 A;  1A1F A;  1RHY A;  2OI2 A;  1RQ0 A;  4LF8 E;  3PYE A;  4BA1 B;  1X49 A;  1IQS A;  2GO3 A;  2E5L E;  4JI1 I;  1HNW E;  4BMJ A;  1PDA A;  4IZK B;  1YYO A;  2J7K A;  4K0K I;  2YSP A;  3VHT B;  2UXD I;  1A1J A;  1WHQ A;  5KL4 A;  2JP9 A;  2BR2 A;  4X62 E;  4WUC A;  5FLX Q;  4X9J A;  3BID A;  4X64 E;  3WU5 A;  2EMB A;  3EPL A;  1NHI A;  4B3R E;  4DR3 E;  2B7T A;  5K36 A;  2YRK A;  1FWL A;  2Q2E B;  1BBO A;  2JOB A;  1UHZ A;  3LLH A;  4LFC E;  4TUI A;  3UK3 C;  1UDO A;  4JV5 E;  3M6A A;  2JVA A;  4JI0 E;  3THO B;  2RSM A;  4WSP A;  4FWD A;  5C0X D;  1YHC A;  2EZ6 A;  1KIJ A;  3P3G A;  1EH7 A;  4DPX A;  2LCE A;  2I13 A;  2RQL A;  5AAS A;  1UDS A;  4P7D A;  4JI3 I;  2M7Q A;  4DMI A;  1MU5 A;  3PS2 A;  2EFG A;  2G7H A;  2N8X A;  5GME A;  2L3C A;  1DI2 A;  4DV1 I;  3ADI A;  3Q6N A;  2V83 A;  1P42 A;  2LVH A;  1Y4U A;  2PO2 B;  4NBQ A;  4OX9 E;  2EPP A;  3M99 B;  4HEI A;  2NAB A;  1IQO A;  2EPA A;  3J81 Q;  2ENA A;  4F6M A;  1AAY A;  1VIS A;  3VYX A;  4J3D A;  2BM0 A;  4MLQ A;  3C4B A;  4R2S A;  1FWK A;  2PO0 B;  4OOG C;  4MU0 A;  1QZR A;  3ADJ A;  4NXN E;  4IZJ B;  2EM3 A;  3F6G A;  4BC9 A;  2IHR 1;  4HY1 A;  1Z5C A;  2X36 A;  2V85 A;  2EM7 A;  2R76 A;  1O0W A;  1XMO E;  2KOU A;  2MDR A;  3VYY A;  2RTX A;  2YTD A;  2F4V E;  2L2K B;  4DR1 I;  4DR4 I;  4WUD A;  2C37 B;  2LBS B;  4JI7 E;  5AE3 A;  4JI8 I;  3F6H A;  4OO1 B;  2LUP B;  2NPF A;  3JU0 A;  1ZU1 A;  3J7A M;  2CT1 A;  3PS3 A;  4DR7 I;  4GZN C;  4UT4 A;  4IFD E;  3H09 A;  4LF9 E;  4USM A;  3P1X A;  2EN8 A;  2WBT A;  1N0V C;  1UIL A;  2EN6 A;  2YTO A;  2IES A;  2EOE A;  5C0X F;  4LF4 I;  4FWH A;  2EMW A;  4L5N C;  4DV7 I;  2V88 A;  1NEI A;  1Z0B A;  2E1R A;  1EH6 A;  3KZY A;  2JE6 B;  1X47 A;  2MKD A;  1ZBT A;  4DKK A;  4LF7 E;  2Z5B A;  2ADR A;  2K7I A;  2EN7 A;  2V2Q A;  1ZBQ A;  2GQ0 A;  2JEB B;  1IMU A;  5A2Q C;  1MEY C;  4WYQ B;  2O1V A;  4MU4 A;  1Z0G A;  1NHJ A;  4JI4 I;  2EOZ A;  4WUB A;  2VF3 A;  4P7A A;  5IV8 B;  3K1J A;  4DV3 I;  2DLQ A;  2ENC A;  1F2I G;  2WCC 3;  2JR1 A;  2MDG A;  2YTP A;  2NN6 A;  4AQY I;  4Q28 A;  1XNR E;  3H4L A;  3M7N D;  4F6N A;  5IXM B;  1ZM9 A;  4XTJ A;  2XEX A;  3P3C A;  5JEA B;  1ZR9 A;  4WXD A;  1T4O A;  3QT8 A;  2JY9 A;  4LF8 I;  3QG5 C;  4JG4 A;  3DJW A;  4R2D A;  2E5L I;  5C0X C;  3HXL A;  2X7I A;  2A2D A;  2K4V A;  4R2P A;  2LO3 A;  1STU A;  1U2R A;  1XXE A;  2JEA B;  1HNW I;  1XMQ E;  4F9C B;  3J80 C;  3T1H E;  1TF6 A;  2BA1 G;  4LOM A;  4R2A A;  2BA1 D;  4X62 I;  3K6Q A;  2IOP A;  4X64 I;  4BA2 B;  1D6T A;  5AE2 A;  4DUZ E;  2MKN A;  2WBU A;  4LFB E;  1UDQ A;  4PRV A;  2IOQ A;  1TF3 A;  4DR3 I;  4B3R I;  1PKP A;  2D9H A;  4TUG A;  4DV4 E;  5T6J A;  1IBK E;  1N3G A;  5A6J A;  4R2C A;  4B3T E;  4RH8 A;  1Z0T A;  2EPR A;  2O3Z A;  3V5R A;  2Z5C B;  4LFC I;  1MX0 A;  4JV5 I;  1X6F A;  4JI0 I;  2EPC A;  2EOF A;  2YT4 A;  1R6M A;  2HFS A;  4LCF A;  2EOQ A;  2CZ9 A;  4DPT A;  3AV0 A;  4QNJ A;  2GS8 A;  1Y6Z A;  2C38 B;  1BKN A;  2CPN A;  4LTY A;  3Q1Q A;  1J5E E;  4HYM A;  1B62 A;  2NN6 D;  4U3D A;  2LMZ A;  1OYP A;  1X5W A;  1X48 A;  4DR2 E;  4IZK A;  2VQF E;  1DGC A;  3DD6 A;  2DMI A;  2EMI A;  1OYS A;  1UBD C;  2HK2 A;  5EL9 A;  1B63 A;  3LTO A;  1Y60 A;  3ZOQ B;  4OX9 I;  5A6B A;  1WRJ A;  2UUB E;  4M2Z A;  4IS1 C;  3FIG A;  4MLV A;  3PRY A;  2VQE E;  3HUL A;  3KRN A;  4WXC A;  5BR8 E;  4LF6 E;  1DQ3 A;  2LTS A;  4USK A;  2UUA E;  1TN9 A;  2DIX A;  3HJC A;  2EOY A;  4NXN I;  1Z0C A;  2PNZ B;  5ADZ A;  4R03 A;  3PYD A;  5KL3 A;  3U1Y A;  4ZYH A;  2EMG A;  3LML A;  1SR9 A;  2CVE A;  1HNZ E;  4M1K A;  3ZZT A;  1XMO I;  1VI7 A;  1T39 A;  1R6L A;  4NXM E;  4IFD B;  2F4V I;  1AH5 A;  1T4L B;  4JI7 I;  2EPU A;  1FJG E;  3U1K A;  2ZM6 E;  1H73 A;  2M1S A;  3K17 A;  4MU3 A;  3H1C A;  3B82 A;  2PO2 A;  4LF9 I;  2L33 A;  3ZM7 A;  3OML A;  2HHH E;  1WHN A;  1Z5B A;  1J26 A;  4B3S E;  2HKE A;  1X6H A;  2PO0 A;  1IBM E;  4LF7 I;  2HFU A;  3GLL A;  4Z7Y A;  3P3E A;  4IZJ A;  3MHS C;  4YHH E;  2NN6 F;  4FN5 A;  2BB8 A;  1E3P A;  2O1T A;  5A6B D;  4NZV A;  2YTN A;  4AIM A;  5FWK A;  5C0X E;  1H7U A;  2EOS A;  3EPK A;  2ELZ A;  3JAM Q;  2CSH A;  2V2Z A;  2IER A;  1YSA C;  2C37 A;  4GKK E;  2Q8U A;  4X65 E;  1NHH A;  1GZ6 A;  4OO1 A;  2YTI A;  4LFA E;  1XNR I;  3WU4 A;  4PU9 A;  2LUQ A;  1Z5A A;  2UXB E;  1H72 C;  2V87 A;  1B69 A;  2AE8 A;  4F54 A;  3V2U C;  3P06 A;  1QNT A;  5LMU E;  1QU6 A;  1IBL E;  4DV6 E;  1S16 A;  1ZM3 A;  2EQ1 A;  5K36 D;  2JE6 A;  4F9B B;  4YY3 I;  3ADL A;  1XMQ I;  3GCM A;  3T1H I;  4MU1 A;  3VK6 A;  4O43 A;  2WNR B;  5DRO A;  2JEB A;  4JYA E;  1RMD A;  2EN3 A;  3THN A;  2NN6 C;  3F0N A;  2EPK X;  2EPX A;  4O5G A;  2O1U A;  3CWV A;  1JK1 A;  4DUZ I;  4LFB I;  2EQ0 A;  4M0V A;  4RPF A;  2DEJ A;  1A1K A;  4DV4 I;  1PJS A;  4R2Q A;  2N3H A;  2EP3 A;  2UXC E;  1PJT A;  4FW5 A;  3ADG A;  4FW3 A;  4IZJ D;  4DPW A;  1IBK I;  2LT7 A;  4B3T I;  1DAR A;  1OJ4 A;  3LNU A;  2CTD A;  2LV2 A;  2YTG A;  2HC5 A;  1I94 E;  4FW9 A;  4B3M E;  4MQY A;  2FTX B;  2JXP A;  2VF1 A;  5JEA A;  2B7V A;  2ZIT A;  2NUG A;  2C39 A;  3PS1 A;  2YSO A;  1J5E I;  1GQE A;  2JEA A;  2J65 A;  4OO1 D;  4DR2 I; 
#chains in the Genus database with same CATH homology
 2VQF I;  1YYW A;  1XNQ E;  4BCA A;  4KHP E;  4HAC B;  1RRE A;  2E1M A;  4DUY E;  1MG7 A;  1KKH A;  4DU7 A;  2UUB I;  3ZZ0 A;  2HKJ A;  1ZM2 A;  2VQE I;  5BR8 I;  4LF6 I;  2UUA I;  2LRS A;  4JI6 E;  2Z5C A;  4YY3 E;  4DPY A;  2WW4 A;  1HNZ I;  4NXM I;  4UTG A;  2UU9 E;  4GEQ B;  1ELO A;  1FJG I;  3ZZU A;  2ZM6 I;  3MSW A;  1FKA E;  2NUE A;  1N36 E;  1EA6 A;  1N34 E;  1PVG A;  4N3O A;  1N32 E;  4Z7C A;  5CFF E;  2DEI A;  2HK3 A;  4BC7 A;  5IWA E;  4FWG A;  2HHH I;  2V34 A;  4X66 E;  2V8Q B;  2A2C A;  4B3S I;  1IBM I;  3GON A;  1USV A;  4YHH I;  3IWC A;  5FLX C;  4DV5 E;  5LMN E;  4MYT A;  4DXL A;  2RS7 A;  1RC7 A;  3KWR A;  2DMY A;  5AE1 A;  4GKK I;  4X65 I;  4F9A B;  4J8Z A;  2AJ4 A;  4L8N A;  1T4N A;  4LFA I;  2H36 X;  2UXB I;  3QT6 A;  1HR0 E;  1K47 A;  1KVK A;  1H7S A;  5LMU I;  1IBL I;  4DV6 I;  3J80 Q;  2RS6 A;  2LJH A;  2UUC E;  4R1F A;  3JAM C;  4DR6 E;  4JYA I;  4LF5 E;  2FV4 B;  4BS9 A;  2L92 A;  3J81 C;  2V2V A;  4DU8 A;  3HPS A;  1PIE A;  2PNM A;  5DNY A;  4GKJ E;  4P52 A;  2UXC I;  3D4J A;  3IWD A;  1EI1 A;  1N33 E;  2EWL A;  5IT9 Q;  4JI5 E;  3IWB A;  4JI2 E;  1I94 I;  4B3M I;  2FGG A;  4PRX A;  2R42 A;  3Q6M A;  3DF6 A;  1HNX E;  3PYF A;  3OTO E;  4DV2 E;  1A6F A;  3K85 A;  3JTZ A;  1XNQ I;  4KHP I;  1WXR A;  4DUY I;  2L2N A;  4BBY A;  2WZO A;  5GMD A;  2L3J A;  3HQ1 A;  3C4T A;  4WPY A;  2JWO A;  2L8T A;  2ZBK B;  2VE7 C;  4DV0 E;  2V89 A;  3LPS A;  4ZVI A;  3QT7 A;  4JI6 I;  4KQV A;  1ZM4 A;  2R3V A;  3T1Y E;  4DR5 E;  2L6M A;  2ODR D;  4LU9 A;  4HXZ A;  3HTX A;  3RMP A;  2UU9 I;  1N36 I;  2O1W A;  4HAC A;  3ZKD A;  5L3J A;  4JI1 E;  3J7A G;  2LJP A;  2KON A;  4X8W A;  2NUF A;  1N34 I;  1N32 I;  1Y4S A;  4EMD A;  4K0K E;  2UXD E;  5IWA I;  2L2M A;  5F3W A;  4URL A;  4X66 I;  1EKZ A;  3J7Y p;  2LE2 A;  1XHK A;  1S4E A;  2BV3 A;  3QT5 A;  5LL6 R;  1RR9 A;  3B78 A;  4DV5 I;  4WFT A;  2B3T B;  2Z5E A;  5LMN I;  1ZXN A;  3WU6 A;  1FNM A;  2LTR A;  2MC6 A;  2DSY A;  2NA2 A;  4JI3 E;  4DPU A;  2F8B A;  1HR0 I;  3B8H A;  4DV1 E;  1HK7 A;  3WU3 A;  4P78 A;  2CGE A;  2V86 A;  2UUC I;  2KHX A;  4DR6 I;  4LF5 I;  2Z5B B;  2PNL A;  4GKJ I;  1Z59 A;  1ZXM A;  3ZKB A;  1USU A;  4DR1 E;  5A2Q Q;  4DR4 E;  1N33 I;  1Z0W A;  4JI5 I;  4JI8 E;  4JI2 I;  4KZS A;  1HNX I;  4DR7 E;  3OTO I;  4DV2 I;  4ED4 A;  4I3H A;  2ODR C;  4LF4 E;  3HPZ A;  4M30 A;  4DV7 E;  1H74 A;  4R8O A;  4MYU A;  2DB2 A;  2MC5 A;  1Z0E A;  2V8P A;  1WUU A;  2CG9 A;  2YZT A;  2B9D A;  2BM1 A;  2N3G A;  4I8O A;  5IT9 C;  1KTV A;  4DV0 I;  4JI4 E;  2M4I A;  3PYG A;  1FI4 A;  1N0U A;  3AUZ A;  1YZ9 A;  2JOX A;  4DV3 E;  4DR5 I;  1YYK A;  3T1Y I;  1UEK A;  4AQY E;  1Z0V A;  1NZ0 A;  2OI2 A;  1RQ0 A;  4LF8 E;  3PYE A;  1X49 A;  2E5L E;  4JI1 I;  1HNW E;  4BMJ A;  4IZK B;  1YYO A;  2J7K A;  4K0K I;  2UXD I;  1WHQ A;  4X62 E;  4WUC A;  5FLX Q;  4X64 E;  3WU5 A;  1NHI A;  4B3R E;  4DR3 E;  2B7T A;  1FWL A;  2Q2E B;  2JOB A;  1UHZ A;  3LLH A;  4LFC E;  4TUI A;  4JV5 E;  3M6A A;  2JVA A;  4JI0 E;  4FWD A;  2RSM A;  4WSP A;  2EZ6 A;  1KIJ A;  4DPX A;  5AAS A;  4P7D A;  4JI3 I;  2M7Q A;  4DMI A;  1MU5 A;  2EFG A;  2G7H A;  5GME A;  2L3C A;  1DI2 A;  4DV1 I;  3ADI A;  3Q6N A;  2V83 A;  1Y4U A;  4OX9 E;  3J81 Q;  1VIS A;  3VYX A;  2BM0 A;  3C4B A;  1FWK A;  4OOG C;  1QZR A;  3ADJ A;  4NXN E;  4IZJ B;  4BC9 A;  3F6G A;  4HY1 A;  2IHR 1;  1Z5C A;  2X36 A;  2V85 A;  1O0W A;  1XMO E;  2KOU A;  2MDR A;  3VYY A;  2RTX A;  4DR1 I;  2F4V E;  2L2K B;  4DR4 I;  4WUD A;  2LBS B;  4JI7 E;  5AE3 A;  4JI8 I;  3F6H A;  2LUP B;  2NPF A;  3JU0 A;  3J7A M;  4DR7 I;  4UT4 A;  3H09 A;  4LF9 E;  4USM A;  3P1X A;  1N0V C;  1UIL A;  4LF4 I;  4FWH A;  4L5N C;  4DV7 I;  2V88 A;  1Z0B A;  2E1R A;  1X47 A;  4DKK A;  1ZBT A;  4LF7 E;  2Z5B A;  2V2Q A;  1ZBQ A;  2GQ0 A;  5A2Q C;  4WYQ B;  2O1V A;  1Z0G A;  1NHJ A;  4JI4 I;  4WUB A;  2VF3 A;  4P7A A;  3K1J A;  4DV3 I;  2JR1 A;  4AQY I;  4Q28 A;  1XNR E;  3H4L A;  1ZM9 A;  4XTJ A;  2XEX A;  1T4O A;  3QT8 A;  2JY9 A;  4LF8 I;  4JG4 A;  3DJW A;  2E5L I;  3HXL A;  2X7I A;  2A2D A;  2K4V A;  1HNW I;  1U2R A;  1STU A;  1XMQ E;  4F9C B;  3J80 C;  3T1H E;  4X62 I;  3K6Q A;  2IOP A;  4X64 I;  1D6T A;  5AE2 A;  4DUZ E;  4LFB E;  4B3R I;  4PRV A;  2IOQ A;  4DR3 I;  1PKP A;  4TUG A;  4DV4 E;  5T6J A;  1IBK E;  4B3T E;  1Z0T A;  3V5R A;  2Z5C B;  4LFC I;  1MX0 A;  4JV5 I;  4JI0 I;  2YT4 A;  2HFS A;  4DPT A;  2CZ9 A;  3AV0 A;  2GS8 A;  1Y6Z A;  1BKN A;  2CPN A;  4LTY A;  3Q1Q A;  1J5E E;  4HYM A;  1B62 A;  2LMZ A;  1X48 A;  4DR2 E;  4IZK A;  2VQF E;  2HK2 A;  1B63 A;  3LTO A;  3ZOQ B;  4OX9 I;  2UUB E;  4M2Z A;  3FIG A;  3PRY A;  2VQE E;  3HUL A;  5BR8 E;  4LF6 E;  1DQ3 A;  2LTS A;  4USK A;  2UUA E;  2DIX A;  3HJC A;  4NXN I;  1Z0C A;  5ADZ A;  4R03 A;  3PYD A;  3LML A;  1SR9 A;  1HNZ E;  4M1K A;  3ZZT A;  1XMO I;  4NXM E;  2F4V I;  1T4L B;  4JI7 I;  1FJG E;  2ZM6 E;  1H73 A;  2M1S A;  3K17 A;  3B82 A;  4LF9 I;  2L33 A;  3ZM7 A;  3OML A;  2HHH E;  1WHN A;  1Z5B A;  1J26 A;  4B3S E;  2HKE A;  1IBM E;  4LF7 I;  2HFU A;  4Z7Y A;  4IZJ A;  4YHH E;  4FN5 A;  2O1T A;  5FWK A;  1H7U A;  3JAM Q;  2V2Z A;  4GKK E;  4X65 E;  1NHH A;  1GZ6 A;  4LFA E;  1XNR I;  3WU4 A;  4PU9 A;  2LUQ A;  1Z5A A;  2UXB E;  1H72 C;  2V87 A;  4F54 A;  3V2U C;  3P06 A;  5LMU E;  1QU6 A;  1IBL E;  4DV6 E;  1S16 A;  1ZM3 A;  4F9B B;  4YY3 I;  3ADL A;  1XMQ I;  3T1H I;  3VK6 A;  4JYA E;  3F0N A;  2O1U A;  3CWV A;  4DUZ I;  4LFB I;  4M0V A;  4RPF A;  2DEJ A;  4DV4 I;  2N3H A;  2UXC E;  4DPW A;  1IBK I;  3ADG A;  4IZJ D;  4B3T I;  1DAR A;  1OJ4 A;  3LNU A;  1I94 E;  4FW9 A;  4B3M E;  2FTX B;  2VF1 A;  2B7V A;  2ZIT A;  2NUG A;  1J5E I;  1GQE A;  4DR2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...