4B3RE

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3rE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3rE02
1ZBTA 4WUBA 3J7AG 1ELOA 4DV3I 1ZXMA 1N33E 3QT5A 4X8WA 4DV1I 4DUZE 1Z59A 4DV2E 4JI1E 1N33I 3ZKBA 2UU9E 1S4EA 4DV2I 2UU9I 4WUCA 2RSMA 4JI8E 3D4JA 1IBKE 4UTGA 4M1KA 4FWHA 4AQYE 4YY3E 2UUAE 4ED4A 1KTVA 1ZXNA 5LMNE 3QT8A 4DV3E 1IBKI 4K0KE 2L3CA 3WU3A 4LFBE 4AQYI 4YY3I 2UXDE 2UUAI 2OI2A 4K0KI 4DUYE 4P7AA 3B78A 4LFBI 2UXDI 1EKZA 2NUGA 4DV5E 3LTOA 3B82A 4DUYI 5BR8E 2E5LE 4DV5I 3WU4A 1GQEA 4RPFA 5BR8I 2E5LI 4X66E 5CFFE 1H7UA 1X48A 3ZZ0A 4DU7A 2HK3A 3OTOE 1N36E 2VF3A 1T4NA 4LFCE 1Z5CA 2DMYA 4HACB 1Z0GA 1YZ9A 2UXBE 4JYAE 4PRXA 4DPYA 4Z7CA 4JV5E 4DR4E 2UXBI 3ADGA 4JYAI 2VQEE 2B3TB 4JI6E 3J81Q 1WUUA 4JV5I 4DR4I 2KHXA 4DV4E 4X64E 3ADLA 1T4OA 1RREA 2VQEI 4JI6I 1S16A 1EI1A 2V8PA 4DR5E 3LNUA 1Z0BA 2HKEA 1XNQI 4LF6I 3T1YE 2RTXA 4DV4I 4X64I 1U2RA 1HR0E 3QT7A 4HYMA 4DR5I 2NPFA 3T1YI 1FJGI 3F0NA 1HR0I 4DV7I 3C4TA 2HFSA 3ZKDA 4OX9E 4HXZA 3C4BA 5LL6R 4DPTA 1UHZA 4DKKA 2NUEA 2BV3A 4OX9I 4R1FA 4B3SE 2HKJA 4DPXA 4X65E 4URLA 1N32E 1KIJA 2V2VA 2CPNA 4B3SI 2R42A 4X65I 4JI2E 1N32I 1N0UA 2LUPB 2UXCI 4JI2I 4DV1E 1YYWA 2MDRA 4DU8A 5A2QC 3VYYA 4MYTA 2DEIA 4FWDA 3PYFA 5LMUE 3PYEA 2BM0A 1Z5BA 4WFTA 2E1RA 5LMUI 2JY9A 3WU5A 2LRSA 2VQFE 3V2UC 2B7VA 3P1XA 2EZ6A 1B62A 1YYKA 2VQFI 2L2KB 4LFAE 3LPSA 4DV6E 1DI2A 1MX0A 4NXNE 1Z0CA 3M6AA 3HULA 4JI3E 1N34E 4LFAI 2ZITA 4DV6I 1XMOE 1HNWE 4NXNI 4M2ZA 1MG7A 2HFUA 4JI3I 1N34I 4HY1A 5A2QQ 1XMOI 1NHIA 1WHNA 2ZBKB 1HNWI 2XEXA 3J81C 2LTSA 2J7KA 2YT4A 1J26A 3ADJA 4PU9A 2LUQA 1IBLI 1Z5AA 2B7TA 3K17A 3ZZTA 3B8HA 1HNXI 2DB2A 4JI5E 3VYXA 4P52A 1NHJA 2AJ4A 2ZM6I 1FKAE 4B3TI 4B3RE 2A2DA 1N0VC 4X62I 3PYDA 4MYUA 4JI5I 2X7IA 4DR1E 1D6TA 4B3RI 1XNQE 4LF6E 4DR1I 5IT9Q 4USMA 1FJGE 3J7AM 1NHHA 4DPUA 4DV7E 3T1HE 3Q1QA 4EMDA 2L2NA 3ADIA 1QU6A 4DV0E 3T1HI 2V34A 4HACA 1KKHA 2HK2A 1YYOA 4DR7E 4DV0I 2LTRA 1Z0TA 4OOGC 4DR7I 1H74A 2UXCE 2EFGA 4I3HA 2N3GA 1UILA 1ZM2A 4LF9E 1VISA 1H72C 2N3HA 1Z0EA 2L3JA 2RS7A 5IWAE 3J7Yp 4LF9I 1RQ0A 3PYGA 2RS6A 5IWAI 1X49A 2GS8A 1FWKA 4FW9A 1XNRE 1O0WA 1DARA 4LF5E 1STUA 1KVKA 3JAMC 1FWLA 2L33A 1XNRI 2V2ZA 4WYQB 4LF5I 4GKKI 3ZZUA 3HTXA 3ZM7A 2LJPA 4DR2E 2WW4A 2UUCI 2X36A 1ZM3A 1J5EE 2JVAA 4DR2I 1XMQE 2L2MA 1H73A 1UEKA 2LJHA 1J5EI 1XMQI 4DUZI 5FLXQ 4USKA 2Q2EB 1RR9A 1ZM4A 4JI1I 2IHR1 1PKPA 4LF8E 4KHPE 5IT9C 3JAMQ 4JI4E 4JI8I 1NZ0A 1IBLE 3V5RA 2HHHE 1MU5A 4LF8I 4KHPI 5L3JA 3LLHA 1FNMA 5LMNI 4JI4I 1HNXE 2DIXA 2HHHI 1EA6A 4ZVIA 2ZM6E 4B3TE 4X62E 4KQVA 1OJ4A 1X47A 1PIEA 1RC7A 2R3VA 2NUFA 4X66I 4LF7E 1BKNA 1PVGA 4Z7YA 2NA2A 1WHQA 4DPWA 3OTOI 1N36I 4FN5A 4LF7I 5GMEA 3J80C 3K1JA 4DXLA 4LFCI 4LF4E 4B3ME 4M30A 4NXME 1ZM9A 1H7SA 2BM1A 3CWVA 2CZ9A 4JI7E 4LF4I 4JI0E 4PRVA 4B3MI 4NXMI 1HNZE 4JI7I 1Z0WA 2UUBE 1T4LB 4UT4A 1XHKA 4JI0I 1HNZI 3GONA 2V2QA 2UUBI 3H4LA 4DR6E 1I94E 2F4VE 2A2CA 4GKJE 4DR6I 4YHHE 1I94I 1IBME 2F4VI 3QT6A 1QZRA 3J80Q 1K47A 1Z0VA 5FLXC 4GKJI 4WUDA 1FI4A 1A6FA 4YHHI 1IBMI 1B63A 4FWGA 4DR3E 4XTJA 4GKKE 4DR3I 5GMDA 2LBSB 2UUCE 2DEJA 3WU6A 4JG4A
chains in the Genus database with same CATH superfamily
1ZBTA 4MU3A 1L4SA 4WUBA 2YPNA 3J7AG 5JEAE 2PO2A 1ELOA 2JT2A 4WSPA 4DV3I 1ZXMA 1PJSA 4WPYA 1E3HA 2C37A 1N33E 3FIGA 3QT5A 4X8WA 4NZVA 4DV1I 4F6MA 2V8QB 1TF6A 2LVHA 4DUZE 2PNMA 4HEIA 2EMXA 1Z59A 4DV2E 4O4KA 4JI1E 1N33I 3ZKBA 4QNJA 2UU9E 3P3EA 2JE6B 3WU5A 4R2CA 5KL3A 1S4EA 1IQOA 3MHSC 4DV2I 1QNTA 4IFDA 1USUA 1PJQA 2UU9I 4WUCA 2M7QA 2RSMA 4OO1E 4JI8E 3MHHC 2PRTA 1IBKE 3D4JA 4UTGA 4BA1B 4M1KA 4FWHA 4AQYE 1MEYC 4YY3E 2UUAE 3TQMA 4IZKB 1KTVA 4J3DA 4ED4A 2MC6A 1P42A 1ZXNA 5LMNE 2NN6E 3QT8A 1IBKI 4K0KE 3RMPA 2L3CA 1EH7A 5A6BD 1UDNA 4LFBE 3WU3A 4YY3I 2UXDE 4AQYI 2EM3A 2UUAI 5IV8B 3M7ND 2OI2A 4K0KI 4DUYE 2HJJA 2EM9A 4P7AA 2V87A 2EJ4A 3B78A 4LFBI 2UXDI 2M9AA 4X9JA 1EKZA 2NUGA 4DV5E 1UN6B 3L00A 4F9AB 1A1FA 2NN6A 3B82A 3LTOA 3PS2A 2EN6A 4DUYI 5BR8E 2E5LE 1A1JA 1ZU1A 5DRRA 4DV5I 2M4IA 3WU4A 1GQEA 3AUZA 2KOUA 4RPFA 5BR8I 2E5LI 4X66E 4DMIA 2EM0A 3PS3A 2WNRA 5CFFE 1H7UA 4OO1C 1X48A 2EMKA 3ZZ0A 1Y6ZA 5FWKA 2ODRC 4MU0A 4DU7A 4P7DA 2HK3A 4LCGA 3QG5C 3OTOE 1N36E 2NN6C 3M7NG 2VF3A 2GPIA 2PNZA 3IWCA 1OYSA 2YZTA 3K6QA 1T4NA 4LFCE 1GZ6A 2BM1A 4KWYA 2DMYA 1Z5CA 4HACB 2VESA 5T6JA 5DRPA 1Z0GA 1YZ9A 2UXBE 4JYAE 4PRXA 4DPYA 5TSEA 1G2DC 1YUIA 4Z7CA 4F2JC 2EOJA 5AC5A 3P3GA 2JEAB 4JV5E 2YTGA 1N3GA 4DR4E 5A69A 1RHYA 2R1FA 2UXBI 3ADGA 4JYAI 2VQEE 2B3TB 2EMBA 2EPXA 4F54A 4JI6E 3UK3C 3J81Q 1WUUA 1YFHA 1IQSA 2EM4A 5KL5A 2KHXA 1HK7A 4DV4E 4X64E 3ADLA 1T4OA 4IZJA 3EPJA 5C0XA 2LO3A 1RREA 2E72A 2JEBA 4MU1A 2JPAA 4L8NA 1S16A 1EI1A 2V8PA 2VQEI 4DR5E 3LNUA 4JI6I 1Z0BA 2HKEA 4R2RA 4LF6I 1XNQI 3T1YE 3P76A 2RTXA 4DV4I 4X64I 2EQ3A 5KL2A 1HR0E 2EMFA 1U2RA 3PRYA 4NBQA 1Y4SA 4R2SA 3QT7A 4HYMA 4DR5I 5AE1A 4P78A 2NPFA 3T1YI 1FJGI 3F0NA 4L5NC 1AH5A 1HR0I 4DV7I 2GO4A 3C4TA 2HFSA 4BC7A 5DNXA 3ZKDA 4OX9E 4HXZA 2WCC3 3C4BA 4BS9A 5LL6R 1ZBQA 4DPTA 1KJKA 1UHZA 4DKKA 5C0XC 2EQ1A 1WJPA 2ADRA 4MDTA 2YTDA 3PS1A 1DQ3A 2NUEA 2BV3A 3HKMA 4R1FA 4OX9I 4B3SE 2Z5BA 2BR2B 2HKJA 2K4VA 4DPXA 2V85A 4X65E 2J65A 4URLA 1N32E 1KIJA 2V2VA 1BBGA 4IFDE 2CPNA 3LMLA 2WZOA 5K36D 4B3SI 4AM3A 3VHTB 4Q28A 1DGCA 2R42A 5KL4A 1NEIA 4X65I 5DNYA 4JI2E 1N32I 1N0UA 5ELWA 2Q8UA 2LUPB 3CWVA 2UXCI 5DROA 2PO1A 3L7ZA 2EE8A 2EN7A 4JI2I 4BBYA 3CDJA 2EOEA 5K36F 2Z5CB 2LJUA 4DV1E 3DF6A 1YYWA 2MDGA 2MDRA 5JEAB 4DU8A 5A2QC 3VYYA 2WBTA 4MYTA 3KZZA 2DEIA 4FWDA 2EMGA 2D9HA 4BC9A 2RSIA 3PYFA 5LMUE 3PYEA 3M99B 2BR2A 2FTXB 1WRJA 1NCSA 2GO3A 2BM0A 3Q6MA 4IJDA 1Z5BA 4WFTA 5KL6A 3ZOQB 2E1RA 4IFDC 4O43A 2R76A 2JY9A 5LMUI 2EPCA 2LRSA 4RH8A 2VQFE 1AAYA 1Y5YA 2O1WA 4R2DA 3H09A 4LCFA 2B7VA 4FK5C 3V2UC 3KWRA 5KL7A 5EKWA 3P1XA 2EZ6A 1B62A 3U1KA 4O5GA 1YYKA 2VQFI 1XMOI 2MKDA 3VK6A 2L2KB 4LFAE 3LPSA 4DV6E 1DI2A 3M85D 2IOPA 1X5WA 5JEAD 1MX0A 4NXNE 1Z0CA 2RQLA 3M6AA 2EQ0A 4TUIA 3HULA 4BHCA 4F6NA 4JI3E 4J8ZA 1N34E 4LFAI 1Z1BA 2ZITA 1UBDC 2L92A 4I8OA 1XMOE 4DV6I 4O24A 2CVEA 2YTEA 1HNWE 4NXNI 2EN4A 5A6BA 4M2ZA 1MG7A 2HFUA 4JI3I 1TN9A 1N34I 4HY1A 2C38B 3DJWA 5A2QQ 2JR1A 2EM5A 1OYPA 1NHIA 1WHNA 2EORA 3JU0A 4WX9A 4WXCA 2XEXA 2ZBKB 5JEAF 1HNWI 3J81C 2JE6A 1A1HA 4R2AA 1T39A 1T38A 3THOB 2LTSA 2YTPA 2J7KA 4OO1D 3BF2A 2VRDA 1PDAA 4LPFA 1BBOA 2YSOA 2YT4A 4U3BA 4N3OA 1J26A 4BA1A 2WBUA 3M85G 4IZKA 3ADJA 4QNKA 2EM7A 1EH8A 2V86A 4PU9A 2LUQA 1IBLI 2EN8A 2CT1A 2B7TA 1Z5AA 3Q6NA 3K17A 5EL9A 3ZZTA 4OO1F 2EN3A 3B8HA 4LOMA 1HNXI 2DB2A 2EOSA 4JI5E 2EWLA 3VYXA 4P52A 2NN6F 5C0XE 1NHJA 3ECRA 2AJ4A 2ZM6I 5A6KA 1FKAE 4B3TI 4B3RE 2FGGA 2A2DA 1N0VC 4X62I 3PYDA 4MYUA 3B4TA 4JI5I 2C39B 2X7IA 4MQYA 3IWDA 3F6HA 2EMYA 4JG4A 4DR1E 1D6TA 4B3RI 2PO0B 2YU5A 1XNQE 4LF6E 2YTQA 4BA2B 1SFEA 3P06A 2V88A 3MSWA 1X6EA 4MLVA 2GHFA 4DR1I 2JOBA 5IT9Q 2ENCA 1OYRA 3HQ1A 5K36B 4USMA 2EMLA 2EMCA 2EOQA 4R2PA 2EMHA 1FJGE 3J7AM 3EPKA 1NHHA 4AIMA 4ZYGA 4DV7E 1F2IG 4DPUA 3F6GA 3T1HE 3Q1QA 4BMJA 1YPNA 1LLMC 4EMDA 2L2NA 2BB8A 3ADIA 3KRNA 1QU6A 4DV0E 3EQ1A 2GLIA 2BA1G 3T1HI 1TF3A 2V89A 1KKHA 2V34A 4HACA 2HK2A 2DSYA 1YYOA 2MC5A 4DR7E 4U3DA 3AV0A 2VE7C 4DV0I 3CDIA 2L8TA 2LTRA 1Z0TA 2JEAA 1UDQA 4OOGC 2PNLA 4DR7I 2EOIA 3IWBA 1H74A 2WP8B 2DLQA 5C0XF 2UXCE 2EFGA 4N4RB 2M1SA 1GTKA 2EM8A 2DRPA 4I3HA 2MKNA 1PJTA 2N3GA 1UILA 2I13A 1ZM2A 2F1DA 4GZNC 3EPHA 2WBSA 2YSPA 4LF9E 1VISA 2BA0D 5K36A 1H72C 1X3CA 2N3HA 2PO2B 1Z0EA 2L3JA 2VF1A 2YRMA 4FW5A 4MLQA 2RS7A 2CSHA 2C37B 2EOXA 1P47A 5IWAE 3HJCA 3J7Yp 4LF9I 2O1TA 2YRKA 1X6FA 1RQ0A 3DD6A 3PYGA 4ISAA 2RS6A 2L6MA 5IWAI 1X6HA 2LV2A 4BHBA 3HPSA 3GCMA 1YHCA 1X49A 2JWOA 2LE2A 2ELZA 5A6JA 4WSGA 2AE8A 2GS8A 3U1YA 1FWKA 4FW9A 1XNRE 2YRHA 1O0WA 4FW6A 1DARA 4LF5E 2ELYA 1STUA 1KVKA 3K85A 2YTIA 3JAMC 4LTYA 1FWLA 3NZKA 2L33A 1XNRI 2V2ZA 4R2EA 4WYQB 2KONA 1IMUA 3H1CA 3ZZUA 4LF5I 3HTXA 4GKKI 2BA0G 4JV5I 1JK2A 4R8OA 2EOFA 3ZM7A 2LJPA 4DR2E 2DGCA 2LCEA 1E3PA 2WW4A 2UUCI 2X36A 2IOQA 3P3CA 4ZYEA 4NHRA 1ZM3A 4IFDF 4OO1B 1SR9A 2EOMA 1J5EE 2JVAA 4DR2I 1XMQE 1Y4UA 2Z5CA 2L2MA 5AASA 2JP9A 2DMIA 2NN6B 3GMEA 2V83A 1YSAC 1H73A 2LJHA 1UEKA 1YH8A 1J5EI 5JEAA 1YUJA 2EOZA 4BCAA 1XMQI 2DLKA 4DUZI 5A6AA 4USKA 2Q2EB 5FLXQ 4F9BB 1R6LA 1RR9A 5F3WA 1ZM4A 4JI1I 4M0VA 2IHR1 4F9CB 4RHBB 2EMIA 5AE2A 2EPOA 2WNRB 1ZAAC 2JYAA 2EOOA 1B69A 2IERA 1VI7A 2EN2A 1PKPA 4LF8E 4KHPE 4Q35B 5IT9C 3JAMQ 1A1GA 4JI4E 4JI8I 3BIDA 1NZ0A 4FW3A 2EPPA 1IBLE 3V5RA 2ODRD 2HHHE 2Z5EA 2PNZB 1MU5A 4LF8I 5JEAC 1USVA 4KHPI 3GLLA 2LMZA 3LLHA 1FNMA 4OO1A 5L3JA 1MGTA 5LMNI 4JI4I 2JOXA 3HXLA 2NN6D 1HNXE 2YTFA 2DIXA 4TUGA 1RMDA 2ENAA 2HHHI 2EPLX 2EPNA 3OMLA 1EA6A 4WXDA 1G2FC 5DNLA 4ZVIA 2ZM6E 1ZR9A 2FV4B 4B3TE 1A1IA 4X62E 4KQVA 1OJ4A 1X47A 2F8BA 1RC7A 1PIEA 2BA1D 2R3VA 2C38A 2EM6A 5C0XB 2JXPA 4IZJB 4FW7A 2EMAA 2JEBB 2HC5A 3C6KA 2NUFA 2EP3A 4X66I 4GQUA 2CTDA 2EL6A 4LU9A 4LF7E 3BBGA 4R03A 2BBGA 2A25A 1BKNA 1EH6A 1PVGA 4Z7YA 2LT7A 2NA2A 1WHQA 2EPMX 4DPWA 3OTOI 1N36I 4HTGA 4FN5A 5GMEA 4LF7I 5AE3A 4FW4A 5ADZA 3J80C 3K1JA 2EL5A 2EPRA 3THNA 4DXLA 4LFCI 1A1KA 2EMZA 2O1VA 4LF4E 2EPUA 2NABA 5DRQA 4B3ME 2EOYA 2YTNA 2YTOA 2EPAA 2EPKX 4M30A 4NXME 1H7SA 1R6MA 2YU8A 1ZM9A 2CZ9A 2Z5BB 4LCHA 4JI7E 5C0XD 4IZJD 4GEQB 2O3ZA 1BB8A 4LF4I 2HGHA 4ZYHA 4JI0E 4PRVA 2YTJA 4B3MI 4NXMI 2EN1A 1HNZE 2N8XA 4OKGA 5K36E 4JI7I 2C39A 3UHMA 1KYQA 2EPZA 1Z0WA 2EMWA 2UUBE 1T4LB 5IXMB 4IS9A 4AIDA 4UT4A 1XHKA 4MU4A 4JI0I 2PO0A 4ZYDA 1HNZI 3GONA 2PO1B 2J7JA 4BA2A 3L7ZB 4R2QA 2V2QA 2I9IA 4IFDB 2UUBI 3H4LA 5LLQA 1UDSA 2E1MA 4DR6E 2GQ0A 1I94E 2F4VE 4KZSA 3BGHA 2A2CA 1XXEA 4GKJE 2G7HA 4DR6I 2O1UA 5AC4A 2B9DA 1UDOA 4YHHE 1I94I 1IBME 2H36X 2F4VI 3QT6A 2ENHA 1QZRA 3J80Q 1K47A 5FLXC 1JK1A 1Z0VA 3HPZA 4GKJI 3EPLA 4WUDA 2YWQA 1FI4A 1A6FA 4IS1C 4YHHI 2EOHA 2K7IA 1IBMI 2CGEA 4DR4I 1B63A 2EL4A 1WXRA 4DR3E 4FWGA 4XTJA 4OZEA 3KZYA 4M9VC 1Y60A 4GKKE 5K36C 3JTZA 2IESA 4IFDD 4DR3I 1A1LA 2WP8A 5GMDA 2RPCA 2EM2A 2LBSB 2UUCE 2DEJA 2CG9A 3WU6A 4DV3E 3C6MA
chains in the Genus database with same CATH topology
1ZBTA 4WUBA 3J7AG 1ELOA 4WSPA 4DV3I 1ZXMA 4WPYA 1N33E 3FIGA 3QT5A 4X8WA 4DV1I 2V8QB 4DUZE 2PNMA 1Z59A 4DV2E 4JI1E 1N33I 3ZKBA 2UU9E 1S4EA 4DV2I 1USUA 2UU9I 4WUCA 2M7QA 2RSMA 4JI8E 3D4JA 1IBKE 4UTGA 4M1KA 4FWHA 4AQYE 4IZKB 4YY3E 2UUAE 4ED4A 1KTVA 2MC6A 1ZXNA 5LMNE 3QT8A 1IBKI 4K0KE 3RMPA 2L3CA 3WU3A 4LFBE 4AQYI 4YY3I 2UXDE 2UUAI 2OI2A 4K0KI 4DUYE 4P7AA 2V87A 3B78A 4LFBI 2UXDI 1EKZA 2NUGA 4DV5E 3LTOA 4F9AB 3B82A 4DUYI 5BR8E 2E5LE 4DV5I 2M4IA 3WU4A 1GQEA 3AUZA 2KOUA 4RPFA 5BR8I 2E5LI 4X66E 4DMIA 5CFFE 1H7UA 1X48A 3ZZ0A 1Y6ZA 5FWKA 2ODRC 4DU7A 4P7DA 2HK3A 3OTOE 1N36E 2VF3A 3IWCA 2YZTA 3K6QA 1T4NA 4LFCE 1GZ6A 1Z5CA 2DMYA 4HACB 5T6JA 1Z0GA 1YZ9A 2UXBE 4JYAE 4PRXA 4DPYA 4Z7CA 4JV5E 4DR4E 2UXBI 3ADGA 4JYAI 2VQEE 2B3TB 4F54A 4JI6E 3J81Q 1WUUA 1HK7A 4DR4I 4JV5I 2KHXA 4DV4E 4X64E 3ADLA 1T4OA 4IZJA 1RREA 2VQEI 4L8NA 1S16A 1EI1A 2V8PA 4JI6I 4DR5E 3LNUA 1Z0BA 2HKEA 1XNQI 4LF6I 3T1YE 2RTXA 4DV4I 4X64I 1U2RA 1HR0E 3PRYA 1Y4SA 3QT7A 4HYMA 4DR5I 5AE1A 4P78A 2NPFA 3T1YI 1FJGI 3F0NA 4L5NC 1HR0I 4DV7I 3C4TA 2HFSA 4BC7A 3ZKDA 4OX9E 4HXZA 3C4BA 4BS9A 5LL6R 1ZBQA 4DPTA 1UHZA 4DKKA 1DQ3A 2NUEA 2BV3A 4OX9I 4R1FA 4B3SE 2Z5BA 2HKJA 2K4VA 4DPXA 2V85A 4X65E 4URLA 1N32E 1KIJA 2V2VA 2CPNA 3LMLA 2WZOA 4B3SI 4Q28A 2R42A 4X65I 5DNYA 4JI2E 1N32I 1N0UA 2LUPB 2UXCI 4JI2I 4BBYA 2Z5CB 4DV1E 3DF6A 1YYWA 2MDRA 4DU8A 5A2QC 3VYYA 4MYTA 2DEIA 4FWDA 4BC9A 3PYFA 5LMUE 3PYEA 2FTXB 2BM0A 3Q6MA 1Z5BA 4WFTA 3ZOQB 2E1RA 5LMUI 2JY9A 3WU5A 2LRSA 2VQFE 2O1WA 3V2UC 3H09A 2B7VA 3KWRA 3P1XA 2EZ6A 1B62A 1YYKA 2VQFI 3VK6A 2L2KB 4LFAE 3LPSA 4DV6E 1DI2A 2IOPA 1MX0A 4NXNE 1Z0CA 3M6AA 4TUIA 3HULA 4JI3E 4J8ZA 1N34E 4LFAI 2ZITA 4DV6I 2L92A 4I8OA 1XMOE 1HNWE 4NXNI 4M2ZA 1MG7A 2HFUA 4JI3I 1N34I 4HY1A 3DJWA 5A2QQ 2JR1A 1XMOI 1NHIA 1WHNA 3JU0A 2ZBKB 2XEXA 1HNWI 3J81C 2LTSA 2J7KA 2YT4A 4N3OA 1J26A 4IZKA 3ADJA 2V86A 4PU9A 2LUQA 1IBLI 1Z5AA 2B7TA 3Q6NA 3K17A 3ZZTA 3B8HA 1HNXI 2DB2A 4JI5E 2EWLA 3VYXA 4P52A 1NHJA 2AJ4A 2ZM6I 1FKAE 4B3TI 4B3RE 2FGGA 2A2DA 1N0VC 4X62I 3PYDA 4MYUA 4JI5I 2X7IA 3IWDA 3F6HA 4JG4A 4DR1E 1D6TA 4B3RI 1XNQE 4LF6E 3P06A 2V88A 3MSWA 4DR1I 2JOBA 5IT9Q 3HQ1A 4USMA 1FJGE 3J7AM 1NHHA 4DPUA 4DV7E 3F6GA 3T1HE 3Q1QA 4BMJA 4EMDA 2L2NA 3ADIA 1QU6A 4DV0E 3T1HI 2V34A 2V89A 1KKHA 4HACA 2HK2A 2DSYA 1YYOA 2MC5A 4DR7E 3AV0A 2VE7C 4DV0I 2L8TA 2LTRA 1Z0TA 4OOGC 2PNLA 4DR7I 3IWBA 1H74A 2UXCE 2EFGA 2M1SA 4I3HA 2N3GA 1UILA 1ZM2A 4LF9E 1VISA 1H72C 2N3HA 1Z0EA 2L3JA 2VF1A 2RS7A 3HJCA 5IWAE 3J7Yp 4LF9I 2O1TA 1RQ0A 3PYGA 2RS6A 2L6MA 5IWAI 3HPSA 1X49A 2JWOA 2LE2A 2GS8A 1FWKA 4FW9A 1XNRE 1O0WA 1DARA 4LF5E 1STUA 1KVKA 3K85A 3JAMC 4LTYA 1FWLA 2L33A 1XNRI 2V2ZA 4WYQB 2KONA 4LF5I 4GKKI 3ZZUA 3HTXA 4R8OA 3ZM7A 2LJPA 4DR2E 2WW4A 2UUCI 2X36A 2IOQA 1ZM3A 1SR9A 1J5EE 2JVAA 4DR2I 1XMQE 1Y4UA 2Z5CA 2L2MA 5AASA 2V83A 1H73A 1UEKA 2LJHA 1J5EI 4BCAA 1XMQI 4DUZI 5FLXQ 4USKA 2Q2EB 4F9BB 1RR9A 5F3WA 1ZM4A 4JI1I 4M0VA 2IHR1 4F9CB 5AE2A 1PKPA 4LF8E 4KHPE 5IT9C 3JAMQ 4JI4E 4JI8I 1NZ0A 1IBLE 3V5RA 2ODRD 2HHHE 2Z5EA 1MU5A 4LF8I 4KHPI 1USVA 5L3JA 2LMZA 3LLHA 1FNMA 5LMNI 4JI4I 2JOXA 3HXLA 1HNXE 2DIXA 4TUGA 2HHHI 3OMLA 1EA6A 4ZVIA 2ZM6E 2FV4B 4B3TE 4X62E 4KQVA 1OJ4A 2F8BA 1X47A 1RC7A 1PIEA 2R3VA 4IZJB 2NUFA 4X66I 4LU9A 4LF7E 4R03A 1BKNA 1PVGA 4Z7YA 2NA2A 1WHQA 4DPWA 3OTOI 1N36I 4FN5A 4LF7I 5GMEA 5AE3A 5ADZA 3J80C 3K1JA 4DXLA 4LFCI 2O1VA 4LF4E 4B3ME 4M30A 4NXME 1ZM9A 1H7SA 2BM1A 3CWVA 2Z5BB 2CZ9A 4JI7E 4IZJD 4GEQB 4LF4I 4JI0E 4PRVA 4B3MI 4NXMI 1HNZE 4JI7I 1Z0WA 2UUBE 1T4LB 4UT4A 1XHKA 4JI0I 1HNZI 3GONA 2V2QA 2UUBI 3H4LA 2E1MA 4DR6E 2GQ0A 1I94E 2F4VE 4KZSA 2A2CA 4GKJE 2G7HA 4DR6I 2O1UA 2B9DA 4YHHE 1I94I 1IBME 2H36X 2F4VI 3QT6A 1QZRA 3J80Q 1K47A 5FLXC 1Z0VA 3HPZA 4GKJI 4WUDA 1FI4A 1A6FA 4YHHI 1IBMI 2CGEA 1B63A 4DR3E 1WXRA 4FWGA 4XTJA 4GKKE 3JTZA 4DR3I 5GMDA 2LBSB 2UUCE 2DEJA 2CG9A 3WU6A 4DV3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBT A;  4WUB A;  3J7A G;  1ELO A;  4DV3 I;  1ZXM A;  1N33 E;  3QT5 A;  4X8W A;  4DV1 I;  4DUZ E;  1Z59 A;  4DV2 E;  4JI1 E;  1N33 I;  3ZKB A;  2UU9 E;  1S4E A;  4DV2 I;  2UU9 I;  4WUC A;  2RSM A;  4JI8 E;  3D4J A;  1IBK E;  4UTG A;  4M1K A;  4FWH A;  4AQY E;  4YY3 E;  2UUA E;  4ED4 A;  1KTV A;  1ZXN A;  5LMN E;  3QT8 A;  4DV3 E;  1IBK I;  4K0K E;  2L3C A;  3WU3 A;  4LFB E;  4AQY I;  4YY3 I;  2UXD E;  2UUA I;  2OI2 A;  4K0K I;  4DUY E;  4P7A A;  3B78 A;  4LFB I;  2UXD I;  1EKZ A;  2NUG A;  4DV5 E;  3LTO A;  3B82 A;  4DUY I;  5BR8 E;  2E5L E;  4DV5 I;  3WU4 A;  1GQE A;  4RPF A;  5BR8 I;  2E5L I;  4X66 E;  5CFF E;  1H7U A;  1X48 A;  3ZZ0 A;  4DU7 A;  2HK3 A;  3OTO E;  1N36 E;  2VF3 A;  1T4N A;  4LFC E;  1Z5C A;  2DMY A;  4HAC B;  1Z0G A;  1YZ9 A;  2UXB E;  4JYA E;  4PRX A;  4DPY A;  4Z7C A;  4JV5 E;  4DR4 E;  2UXB I;  3ADG A;  4JYA I;  2VQE E;  2B3T B;  4JI6 E;  3J81 Q;  1WUU A;  4JV5 I;  4DR4 I;  2KHX A;  4DV4 E;  4X64 E;  3ADL A;  1T4O A;  1RRE A;  2VQE I;  4JI6 I;  1S16 A;  1EI1 A;  2V8P A;  4DR5 E;  3LNU A;  1Z0B A;  2HKE A;  1XNQ I;  4LF6 I;  3T1Y E;  2RTX A;  4DV4 I;  4X64 I;  1U2R A;  1HR0 E;  3QT7 A;  4HYM A;  4DR5 I;  2NPF A;  3T1Y I;  1FJG I;  3F0N A;  1HR0 I;  4DV7 I;  3C4T A;  2HFS A;  3ZKD A;  4OX9 E;  4HXZ A;  3C4B A;  5LL6 R;  4DPT A;  1UHZ A;  4DKK A;  2NUE A;  2BV3 A;  4OX9 I;  4R1F A;  4B3S E;  2HKJ A;  4DPX A;  4X65 E;  4URL A;  1N32 E;  1KIJ A;  2V2V A;  2CPN A;  4B3S I;  2R42 A;  4X65 I;  4JI2 E;  1N32 I;  1N0U A;  2LUP B;  2UXC I;  4JI2 I;  4DV1 E;  1YYW A;  2MDR A;  4DU8 A;  5A2Q C;  3VYY A;  4MYT A;  2DEI A;  4FWD A;  3PYF A;  5LMU E;  3PYE A;  2BM0 A;  1Z5B A;  4WFT A;  2E1R A;  5LMU I;  2JY9 A;  3WU5 A;  2LRS A;  2VQF E;  3V2U C;  2B7V A;  3P1X A;  2EZ6 A;  1B62 A;  1YYK A;  2VQF I;  2L2K B;  4LFA E;  3LPS A;  4DV6 E;  1DI2 A;  1MX0 A;  4NXN E;  1Z0C A;  3M6A A;  3HUL A;  4JI3 E;  1N34 E;  4LFA I;  2ZIT A;  4DV6 I;  1XMO E;  1HNW E;  4NXN I;  4M2Z A;  1MG7 A;  2HFU A;  4JI3 I;  1N34 I;  4HY1 A;  5A2Q Q;  1XMO I;  1NHI A;  1WHN A;  2ZBK B;  1HNW I;  2XEX A;  3J81 C;  2LTS A;  2J7K A;  2YT4 A;  1J26 A;  3ADJ A;  4PU9 A;  2LUQ A;  1IBL I;  1Z5A A;  2B7T A;  3K17 A;  3ZZT A;  3B8H A;  1HNX I;  2DB2 A;  4JI5 E;  3VYX A;  4P52 A;  1NHJ A;  2AJ4 A;  2ZM6 I;  1FKA E;  4B3T I;  4B3R E;  2A2D A;  1N0V C;  4X62 I;  3PYD A;  4MYU A;  4JI5 I;  2X7I A;  4DR1 E;  1D6T A;  4B3R I;  1XNQ E;  4LF6 E;  4DR1 I;  5IT9 Q;  4USM A;  1FJG E;  3J7A M;  1NHH A;  4DPU A;  4DV7 E;  3T1H E;  3Q1Q A;  4EMD A;  2L2N A;  3ADI A;  1QU6 A;  4DV0 E;  3T1H I;  2V34 A;  4HAC A;  1KKH A;  2HK2 A;  1YYO A;  4DR7 E;  4DV0 I;  2LTR A;  1Z0T A;  4OOG C;  4DR7 I;  1H74 A;  2UXC E;  2EFG A;  4I3H A;  2N3G A;  1UIL A;  1ZM2 A;  4LF9 E;  1VIS A;  1H72 C;  2N3H A;  1Z0E A;  2L3J A;  2RS7 A;  5IWA E;  3J7Y p;  4LF9 I;  1RQ0 A;  3PYG A;  2RS6 A;  5IWA I;  1X49 A;  2GS8 A;  1FWK A;  4FW9 A;  1XNR E;  1O0W A;  1DAR A;  4LF5 E;  1STU A;  1KVK A;  3JAM C;  1FWL A;  2L33 A;  1XNR I;  2V2Z A;  4WYQ B;  4LF5 I;  4GKK I;  3ZZU A;  3HTX A;  3ZM7 A;  2LJP A;  4DR2 E;  2WW4 A;  2UUC I;  2X36 A;  1ZM3 A;  1J5E E;  2JVA A;  4DR2 I;  1XMQ E;  2L2M A;  1H73 A;  1UEK A;  2LJH A;  1J5E I;  1XMQ I;  4DUZ I;  5FLX Q;  4USK A;  2Q2E B;  1RR9 A;  1ZM4 A;  4JI1 I;  2IHR 1;  1PKP A;  4LF8 E;  4KHP E;  5IT9 C;  3JAM Q;  4JI4 E;  4JI8 I;  1NZ0 A;  1IBL E;  3V5R A;  2HHH E;  1MU5 A;  4LF8 I;  4KHP I;  5L3J A;  3LLH A;  1FNM A;  5LMN I;  4JI4 I;  1HNX E;  2DIX A;  2HHH I;  1EA6 A;  4ZVI A;  2ZM6 E;  4B3T E;  4X62 E;  4KQV A;  1OJ4 A;  1X47 A;  1PIE A;  1RC7 A;  2R3V A;  2NUF A;  4X66 I;  4LF7 E;  1BKN A;  1PVG A;  4Z7Y A;  2NA2 A;  1WHQ A;  4DPW A;  3OTO I;  1N36 I;  4FN5 A;  4LF7 I;  5GME A;  3J80 C;  3K1J A;  4DXL A;  4LFC I;  4LF4 E;  4B3M E;  4M30 A;  4NXM E;  1ZM9 A;  1H7S A;  2BM1 A;  3CWV A;  2CZ9 A;  4JI7 E;  4LF4 I;  4JI0 E;  4PRV A;  4B3M I;  4NXM I;  1HNZ E;  4JI7 I;  1Z0W A;  2UUB E;  1T4L B;  4UT4 A;  1XHK A;  4JI0 I;  1HNZ I;  3GON A;  2V2Q A;  2UUB I;  3H4L A;  4DR6 E;  1I94 E;  2F4V E;  2A2C A;  4GKJ E;  4DR6 I;  4YHH E;  1I94 I;  1IBM E;  2F4V I;  3QT6 A;  1QZR A;  3J80 Q;  1K47 A;  1Z0V A;  5FLX C;  4GKJ I;  4WUD A;  1FI4 A;  1A6F A;  4YHH I;  1IBM I;  1B63 A;  4FWG A;  4DR3 E;  4XTJ A;  4GKK E;  4DR3 I;  5GMD A;  2LBS B;  2UUC E;  2DEJ A;  3WU6 A;  4JG4 A; 
#chains in the Genus database with same CATH topology
 1ZBT A;  4MU3 A;  1L4S A;  4WUB A;  2YPN A;  3J7A G;  5JEA E;  2PO2 A;  1ELO A;  2JT2 A;  4WSP A;  4DV3 I;  1ZXM A;  1PJS A;  4WPY A;  1E3H A;  2C37 A;  1N33 E;  3FIG A;  3QT5 A;  4X8W A;  4NZV A;  4DV1 I;  4F6M A;  2V8Q B;  1TF6 A;  2LVH A;  4DUZ E;  2PNM A;  4HEI A;  2EMX A;  1Z59 A;  4DV2 E;  4O4K A;  4JI1 E;  1N33 I;  3ZKB A;  4QNJ A;  2UU9 E;  3P3E A;  2JE6 B;  3WU5 A;  4R2C A;  5KL3 A;  1S4E A;  1IQO A;  3MHS C;  4DV2 I;  1QNT A;  4IFD A;  1USU A;  1PJQ A;  2UU9 I;  4WUC A;  2M7Q A;  2RSM A;  4OO1 E;  4JI8 E;  3MHH C;  2PRT A;  1IBK E;  3D4J A;  4UTG A;  4BA1 B;  4M1K A;  4FWH A;  4AQY E;  1MEY C;  4YY3 E;  2UUA E;  3TQM A;  4IZK B;  1KTV A;  4J3D A;  4ED4 A;  2MC6 A;  1P42 A;  1ZXN A;  5LMN E;  2NN6 E;  3QT8 A;  1IBK I;  4K0K E;  3RMP A;  2L3C A;  1EH7 A;  5A6B D;  1UDN A;  4LFB E;  3WU3 A;  4YY3 I;  2UXD E;  4AQY I;  2EM3 A;  2UUA I;  5IV8 B;  3M7N D;  2OI2 A;  4K0K I;  4DUY E;  2HJJ A;  2EM9 A;  4P7A A;  2V87 A;  2EJ4 A;  3B78 A;  4LFB I;  2UXD I;  2M9A A;  4X9J A;  1EKZ A;  2NUG A;  4DV5 E;  1UN6 B;  3L00 A;  4F9A B;  1A1F A;  2NN6 A;  3B82 A;  3LTO A;  3PS2 A;  2EN6 A;  4DUY I;  5BR8 E;  2E5L E;  1A1J A;  1ZU1 A;  5DRR A;  4DV5 I;  2M4I A;  3WU4 A;  1GQE A;  3AUZ A;  2KOU A;  4RPF A;  5BR8 I;  2E5L I;  4X66 E;  4DMI A;  2EM0 A;  3PS3 A;  2WNR A;  5CFF E;  1H7U A;  4OO1 C;  1X48 A;  2EMK A;  3ZZ0 A;  1Y6Z A;  5FWK A;  2ODR C;  4MU0 A;  4DU7 A;  4P7D A;  2HK3 A;  4LCG A;  3QG5 C;  3OTO E;  1N36 E;  2NN6 C;  3M7N G;  2VF3 A;  2GPI A;  2PNZ A;  3IWC A;  1OYS A;  2YZT A;  3K6Q A;  1T4N A;  4LFC E;  1GZ6 A;  2BM1 A;  4KWY A;  2DMY A;  1Z5C A;  4HAC B;  2VES A;  5T6J A;  5DRP A;  1Z0G A;  1YZ9 A;  2UXB E;  4JYA E;  4PRX A;  4DPY A;  5TSE A;  1G2D C;  1YUI A;  4Z7C A;  4F2J C;  2EOJ A;  5AC5 A;  3P3G A;  2JEA B;  4JV5 E;  2YTG A;  1N3G A;  4DR4 E;  5A69 A;  1RHY A;  2R1F A;  2UXB I;  3ADG A;  4JYA I;  2VQE E;  2B3T B;  2EMB A;  2EPX A;  4F54 A;  4JI6 E;  3UK3 C;  3J81 Q;  1WUU A;  1YFH A;  1IQS A;  2EM4 A;  5KL5 A;  2KHX A;  1HK7 A;  4DV4 E;  4X64 E;  3ADL A;  1T4O A;  4IZJ A;  3EPJ A;  5C0X A;  2LO3 A;  1RRE A;  2E72 A;  2JEB A;  4MU1 A;  2JPA A;  4L8N A;  1S16 A;  1EI1 A;  2V8P A;  2VQE I;  4DR5 E;  3LNU A;  4JI6 I;  1Z0B A;  2HKE A;  4R2R A;  4LF6 I;  1XNQ I;  3T1Y E;  3P76 A;  2RTX A;  4DV4 I;  4X64 I;  2EQ3 A;  5KL2 A;  1HR0 E;  2EMF A;  1U2R A;  3PRY A;  4NBQ A;  1Y4S A;  4R2S A;  3QT7 A;  4HYM A;  4DR5 I;  5AE1 A;  4P78 A;  2NPF A;  3T1Y I;  1FJG I;  3F0N A;  4L5N C;  1AH5 A;  1HR0 I;  4DV7 I;  2GO4 A;  3C4T A;  2HFS A;  4BC7 A;  5DNX A;  3ZKD A;  4OX9 E;  4HXZ A;  2WCC 3;  3C4B A;  4BS9 A;  5LL6 R;  1ZBQ A;  4DPT A;  1KJK A;  1UHZ A;  4DKK A;  5C0X C;  2EQ1 A;  1WJP A;  2ADR A;  4MDT A;  2YTD A;  3PS1 A;  1DQ3 A;  2NUE A;  2BV3 A;  3HKM A;  4R1F A;  4OX9 I;  4B3S E;  2Z5B A;  2BR2 B;  2HKJ A;  2K4V A;  4DPX A;  2V85 A;  4X65 E;  2J65 A;  4URL A;  1N32 E;  1KIJ A;  2V2V A;  1BBG A;  4IFD E;  2CPN A;  3LML A;  2WZO A;  5K36 D;  4B3S I;  4AM3 A;  3VHT B;  4Q28 A;  1DGC A;  2R42 A;  5KL4 A;  1NEI A;  4X65 I;  5DNY A;  4JI2 E;  1N32 I;  1N0U A;  5ELW A;  2Q8U A;  2LUP B;  3CWV A;  2UXC I;  5DRO A;  2PO1 A;  3L7Z A;  2EE8 A;  2EN7 A;  4JI2 I;  4BBY A;  3CDJ A;  2EOE A;  5K36 F;  2Z5C B;  2LJU A;  4DV1 E;  3DF6 A;  1YYW A;  2MDG A;  2MDR A;  5JEA B;  4DU8 A;  5A2Q C;  3VYY A;  2WBT A;  4MYT A;  3KZZ A;  2DEI A;  4FWD A;  2EMG A;  2D9H A;  4BC9 A;  2RSI A;  3PYF A;  5LMU E;  3PYE A;  3M99 B;  2BR2 A;  2FTX B;  1WRJ A;  1NCS A;  2GO3 A;  2BM0 A;  3Q6M A;  4IJD A;  1Z5B A;  4WFT A;  5KL6 A;  3ZOQ B;  2E1R A;  4IFD C;  4O43 A;  2R76 A;  2JY9 A;  5LMU I;  2EPC A;  2LRS A;  4RH8 A;  2VQF E;  1AAY A;  1Y5Y A;  2O1W A;  4R2D A;  3H09 A;  4LCF A;  2B7V A;  4FK5 C;  3V2U C;  3KWR A;  5KL7 A;  5EKW A;  3P1X A;  2EZ6 A;  1B62 A;  3U1K A;  4O5G A;  1YYK A;  2VQF I;  1XMO I;  2MKD A;  3VK6 A;  2L2K B;  4LFA E;  3LPS A;  4DV6 E;  1DI2 A;  3M85 D;  2IOP A;  1X5W A;  5JEA D;  1MX0 A;  4NXN E;  1Z0C A;  2RQL A;  3M6A A;  2EQ0 A;  4TUI A;  3HUL A;  4BHC A;  4F6N A;  4JI3 E;  4J8Z A;  1N34 E;  4LFA I;  1Z1B A;  2ZIT A;  1UBD C;  2L92 A;  4I8O A;  1XMO E;  4DV6 I;  4O24 A;  2CVE A;  2YTE A;  1HNW E;  4NXN I;  2EN4 A;  5A6B A;  4M2Z A;  1MG7 A;  2HFU A;  4JI3 I;  1TN9 A;  1N34 I;  4HY1 A;  2C38 B;  3DJW A;  5A2Q Q;  2JR1 A;  2EM5 A;  1OYP A;  1NHI A;  1WHN A;  2EOR A;  3JU0 A;  4WX9 A;  4WXC A;  2XEX A;  2ZBK B;  5JEA F;  1HNW I;  3J81 C;  2JE6 A;  1A1H A;  4R2A A;  1T39 A;  1T38 A;  3THO B;  2LTS A;  2YTP A;  2J7K A;  4OO1 D;  3BF2 A;  2VRD A;  1PDA A;  4LPF A;  1BBO A;  2YSO A;  2YT4 A;  4U3B A;  4N3O A;  1J26 A;  4BA1 A;  2WBU A;  3M85 G;  4IZK A;  3ADJ A;  4QNK A;  2EM7 A;  1EH8 A;  2V86 A;  4PU9 A;  2LUQ A;  1IBL I;  2EN8 A;  2CT1 A;  2B7T A;  1Z5A A;  3Q6N A;  3K17 A;  5EL9 A;  3ZZT A;  4OO1 F;  2EN3 A;  3B8H A;  4LOM A;  1HNX I;  2DB2 A;  2EOS A;  4JI5 E;  2EWL A;  3VYX A;  4P52 A;  2NN6 F;  5C0X E;  1NHJ A;  3ECR A;  2AJ4 A;  2ZM6 I;  5A6K A;  1FKA E;  4B3T I;  4B3R E;  2FGG A;  2A2D A;  1N0V C;  4X62 I;  3PYD A;  4MYU A;  3B4T A;  4JI5 I;  2C39 B;  2X7I A;  4MQY A;  3IWD A;  3F6H A;  2EMY A;  4JG4 A;  4DR1 E;  1D6T A;  4B3R I;  2PO0 B;  2YU5 A;  1XNQ E;  4LF6 E;  2YTQ A;  4BA2 B;  1SFE A;  3P06 A;  2V88 A;  3MSW A;  1X6E A;  4MLV A;  2GHF A;  4DR1 I;  2JOB A;  5IT9 Q;  2ENC A;  1OYR A;  3HQ1 A;  5K36 B;  4USM A;  2EML A;  2EMC A;  2EOQ A;  4R2P A;  2EMH A;  1FJG E;  3J7A M;  3EPK A;  1NHH A;  4AIM A;  4ZYG A;  4DV7 E;  1F2I G;  4DPU A;  3F6G A;  3T1H E;  3Q1Q A;  4BMJ A;  1YPN A;  1LLM C;  4EMD A;  2L2N A;  2BB8 A;  3ADI A;  3KRN A;  1QU6 A;  4DV0 E;  3EQ1 A;  2GLI A;  2BA1 G;  3T1H I;  1TF3 A;  2V89 A;  1KKH A;  2V34 A;  4HAC A;  2HK2 A;  2DSY A;  1YYO A;  2MC5 A;  4DR7 E;  4U3D A;  3AV0 A;  2VE7 C;  4DV0 I;  3CDI A;  2L8T A;  2LTR A;  1Z0T A;  2JEA A;  1UDQ A;  4OOG C;  2PNL A;  4DR7 I;  2EOI A;  3IWB A;  1H74 A;  2WP8 B;  2DLQ A;  5C0X F;  2UXC E;  2EFG A;  4N4R B;  2M1S A;  1GTK A;  2EM8 A;  2DRP A;  4I3H A;  2MKN A;  1PJT A;  2N3G A;  1UIL A;  2I13 A;  1ZM2 A;  2F1D A;  4GZN C;  3EPH A;  2WBS A;  2YSP A;  4LF9 E;  1VIS A;  2BA0 D;  5K36 A;  1H72 C;  1X3C A;  2N3H A;  2PO2 B;  1Z0E A;  2L3J A;  2VF1 A;  2YRM A;  4FW5 A;  4MLQ A;  2RS7 A;  2CSH A;  2C37 B;  2EOX A;  1P47 A;  5IWA E;  3HJC A;  3J7Y p;  4LF9 I;  2O1T A;  2YRK A;  1X6F A;  1RQ0 A;  3DD6 A;  3PYG A;  4ISA A;  2RS6 A;  2L6M A;  5IWA I;  1X6H A;  2LV2 A;  4BHB A;  3HPS A;  3GCM A;  1YHC A;  1X49 A;  2JWO A;  2LE2 A;  2ELZ A;  5A6J A;  4WSG A;  2AE8 A;  2GS8 A;  3U1Y A;  1FWK A;  4FW9 A;  1XNR E;  2YRH A;  1O0W A;  4FW6 A;  1DAR A;  4LF5 E;  2ELY A;  1STU A;  1KVK A;  3K85 A;  2YTI A;  3JAM C;  4LTY A;  1FWL A;  3NZK A;  2L33 A;  1XNR I;  2V2Z A;  4R2E A;  4WYQ B;  2KON A;  1IMU A;  3H1C A;  3ZZU A;  4LF5 I;  3HTX A;  4GKK I;  2BA0 G;  4JV5 I;  1JK2 A;  4R8O A;  2EOF A;  3ZM7 A;  2LJP A;  4DR2 E;  2DGC A;  2LCE A;  1E3P A;  2WW4 A;  2UUC I;  2X36 A;  2IOQ A;  3P3C A;  4ZYE A;  4NHR A;  1ZM3 A;  4IFD F;  4OO1 B;  1SR9 A;  2EOM A;  1J5E E;  2JVA A;  4DR2 I;  1XMQ E;  1Y4U A;  2Z5C A;  2L2M A;  5AAS A;  2JP9 A;  2DMI A;  2NN6 B;  3GME A;  2V83 A;  1YSA C;  1H73 A;  2LJH A;  1UEK A;  1YH8 A;  1J5E I;  5JEA A;  1YUJ A;  2EOZ A;  4BCA A;  1XMQ I;  2DLK A;  4DUZ I;  5A6A A;  4USK A;  2Q2E B;  5FLX Q;  4F9B B;  1R6L A;  1RR9 A;  5F3W A;  1ZM4 A;  4JI1 I;  4M0V A;  2IHR 1;  4F9C B;  4RHB B;  2EMI A;  5AE2 A;  2EPO A;  2WNR B;  1ZAA C;  2JYA A;  2EOO A;  1B69 A;  2IER A;  1VI7 A;  2EN2 A;  1PKP A;  4LF8 E;  4KHP E;  4Q35 B;  5IT9 C;  3JAM Q;  1A1G A;  4JI4 E;  4JI8 I;  3BID A;  1NZ0 A;  4FW3 A;  2EPP A;  1IBL E;  3V5R A;  2ODR D;  2HHH E;  2Z5E A;  2PNZ B;  1MU5 A;  4LF8 I;  5JEA C;  1USV A;  4KHP I;  3GLL A;  2LMZ A;  3LLH A;  1FNM A;  4OO1 A;  5L3J A;  1MGT A;  5LMN I;  4JI4 I;  2JOX A;  3HXL A;  2NN6 D;  1HNX E;  2YTF A;  2DIX A;  4TUG A;  1RMD A;  2ENA A;  2HHH I;  2EPL X;  2EPN A;  3OML A;  1EA6 A;  4WXD A;  1G2F C;  5DNL A;  4ZVI A;  2ZM6 E;  1ZR9 A;  2FV4 B;  4B3T E;  1A1I A;  4X62 E;  4KQV A;  1OJ4 A;  1X47 A;  2F8B A;  1RC7 A;  1PIE A;  2BA1 D;  2R3V A;  2C38 A;  2EM6 A;  5C0X B;  2JXP A;  4IZJ B;  4FW7 A;  2EMA A;  2JEB B;  2HC5 A;  3C6K A;  2NUF A;  2EP3 A;  4X66 I;  4GQU A;  2CTD A;  2EL6 A;  4LU9 A;  4LF7 E;  3BBG A;  4R03 A;  2BBG A;  2A25 A;  1BKN A;  1EH6 A;  1PVG A;  4Z7Y A;  2LT7 A;  2NA2 A;  1WHQ A;  2EPM X;  4DPW A;  3OTO I;  1N36 I;  4HTG A;  4FN5 A;  5GME A;  4LF7 I;  5AE3 A;  4FW4 A;  5ADZ A;  3J80 C;  3K1J A;  2EL5 A;  2EPR A;  3THN A;  4DXL A;  4LFC I;  1A1K A;  2EMZ A;  2O1V A;  4LF4 E;  2EPU A;  2NAB A;  5DRQ A;  4B3M E;  2EOY A;  2YTN A;  2YTO A;  2EPA A;  2EPK X;  4M30 A;  4NXM E;  1H7S A;  1R6M A;  2YU8 A;  1ZM9 A;  2CZ9 A;  2Z5B B;  4LCH A;  4JI7 E;  5C0X D;  4IZJ D;  4GEQ B;  2O3Z A;  1BB8 A;  4LF4 I;  2HGH A;  4ZYH A;  4JI0 E;  4PRV A;  2YTJ A;  4B3M I;  4NXM I;  2EN1 A;  1HNZ E;  2N8X A;  4OKG A;  5K36 E;  4JI7 I;  2C39 A;  3UHM A;  1KYQ A;  2EPZ A;  1Z0W A;  2EMW A;  2UUB E;  1T4L B;  5IXM B;  4IS9 A;  4AID A;  4UT4 A;  1XHK A;  4MU4 A;  4JI0 I;  2PO0 A;  4ZYD A;  1HNZ I;  3GON A;  2PO1 B;  2J7J A;  4BA2 A;  3L7Z B;  4R2Q A;  2V2Q A;  2I9I A;  4IFD B;  2UUB I;  3H4L A;  5LLQ A;  1UDS A;  2E1M A;  4DR6 E;  2GQ0 A;  1I94 E;  2F4V E;  4KZS A;  3BGH A;  2A2C A;  1XXE A;  4GKJ E;  2G7H A;  4DR6 I;  2O1U A;  5AC4 A;  2B9D A;  1UDO A;  4YHH E;  1I94 I;  1IBM E;  2H36 X;  2F4V I;  3QT6 A;  2ENH A;  1QZR A;  3J80 Q;  1K47 A;  5FLX C;  1JK1 A;  1Z0V A;  3HPZ A;  4GKJ I;  3EPL A;  4WUD A;  2YWQ A;  1FI4 A;  1A6F A;  4IS1 C;  4YHH I;  2EOH A;  2K7I A;  1IBM I;  2CGE A;  4DR4 I;  1B63 A;  2EL4 A;  1WXR A;  4DR3 E;  4FWG A;  4XTJ A;  4OZE A;  3KZY A;  4M9V C;  1Y60 A;  4GKK E;  5K36 C;  3JTZ A;  2IES A;  4IFD D;  4DR3 I;  1A1L A;  2WP8 A;  5GMD A;  2RPC A;  2EM2 A;  2LBS B;  2UUC E;  2DEJ A;  2CG9 A;  3WU6 A;  4DV3 E;  3C6M A; 
#chains in the Genus database with same CATH homology
 1ZBT A;  4WUB A;  3J7A G;  1ELO A;  4WSP A;  4DV3 I;  1ZXM A;  4WPY A;  1N33 E;  3FIG A;  3QT5 A;  4X8W A;  4DV1 I;  2V8Q B;  4DUZ E;  2PNM A;  1Z59 A;  4DV2 E;  4JI1 E;  1N33 I;  3ZKB A;  2UU9 E;  1S4E A;  4DV2 I;  1USU A;  2UU9 I;  4WUC A;  2M7Q A;  2RSM A;  4JI8 E;  3D4J A;  1IBK E;  4UTG A;  4M1K A;  4FWH A;  4AQY E;  4IZK B;  4YY3 E;  2UUA E;  4ED4 A;  1KTV A;  2MC6 A;  1ZXN A;  5LMN E;  3QT8 A;  1IBK I;  4K0K E;  3RMP A;  2L3C A;  3WU3 A;  4LFB E;  4AQY I;  4YY3 I;  2UXD E;  2UUA I;  2OI2 A;  4K0K I;  4DUY E;  4P7A A;  2V87 A;  3B78 A;  4LFB I;  2UXD I;  1EKZ A;  2NUG A;  4DV5 E;  3LTO A;  4F9A B;  3B82 A;  4DUY I;  5BR8 E;  2E5L E;  4DV5 I;  2M4I A;  3WU4 A;  1GQE A;  3AUZ A;  2KOU A;  4RPF A;  5BR8 I;  2E5L I;  4X66 E;  4DMI A;  5CFF E;  1H7U A;  1X48 A;  3ZZ0 A;  1Y6Z A;  5FWK A;  2ODR C;  4DU7 A;  4P7D A;  2HK3 A;  3OTO E;  1N36 E;  2VF3 A;  3IWC A;  2YZT A;  3K6Q A;  1T4N A;  4LFC E;  1GZ6 A;  1Z5C A;  2DMY A;  4HAC B;  5T6J A;  1Z0G A;  1YZ9 A;  2UXB E;  4JYA E;  4PRX A;  4DPY A;  4Z7C A;  4JV5 E;  4DR4 E;  2UXB I;  3ADG A;  4JYA I;  2VQE E;  2B3T B;  4F54 A;  4JI6 E;  3J81 Q;  1WUU A;  1HK7 A;  4DR4 I;  4JV5 I;  2KHX A;  4DV4 E;  4X64 E;  3ADL A;  1T4O A;  4IZJ A;  1RRE A;  2VQE I;  4L8N A;  1S16 A;  1EI1 A;  2V8P A;  4JI6 I;  4DR5 E;  3LNU A;  1Z0B A;  2HKE A;  1XNQ I;  4LF6 I;  3T1Y E;  2RTX A;  4DV4 I;  4X64 I;  1U2R A;  1HR0 E;  3PRY A;  1Y4S A;  3QT7 A;  4HYM A;  4DR5 I;  5AE1 A;  4P78 A;  2NPF A;  3T1Y I;  1FJG I;  3F0N A;  4L5N C;  1HR0 I;  4DV7 I;  3C4T A;  2HFS A;  4BC7 A;  3ZKD A;  4OX9 E;  4HXZ A;  3C4B A;  4BS9 A;  5LL6 R;  1ZBQ A;  4DPT A;  1UHZ A;  4DKK A;  1DQ3 A;  2NUE A;  2BV3 A;  4OX9 I;  4R1F A;  4B3S E;  2Z5B A;  2HKJ A;  2K4V A;  4DPX A;  2V85 A;  4X65 E;  4URL A;  1N32 E;  1KIJ A;  2V2V A;  2CPN A;  3LML A;  2WZO A;  4B3S I;  4Q28 A;  2R42 A;  4X65 I;  5DNY A;  4JI2 E;  1N32 I;  1N0U A;  2LUP B;  2UXC I;  4JI2 I;  4BBY A;  2Z5C B;  4DV1 E;  3DF6 A;  1YYW A;  2MDR A;  4DU8 A;  5A2Q C;  3VYY A;  4MYT A;  2DEI A;  4FWD A;  4BC9 A;  3PYF A;  5LMU E;  3PYE A;  2FTX B;  2BM0 A;  3Q6M A;  1Z5B A;  4WFT A;  3ZOQ B;  2E1R A;  5LMU I;  2JY9 A;  3WU5 A;  2LRS A;  2VQF E;  2O1W A;  3V2U C;  3H09 A;  2B7V A;  3KWR A;  3P1X A;  2EZ6 A;  1B62 A;  1YYK A;  2VQF I;  3VK6 A;  2L2K B;  4LFA E;  3LPS A;  4DV6 E;  1DI2 A;  2IOP A;  1MX0 A;  4NXN E;  1Z0C A;  3M6A A;  4TUI A;  3HUL A;  4JI3 E;  4J8Z A;  1N34 E;  4LFA I;  2ZIT A;  4DV6 I;  2L92 A;  4I8O A;  1XMO E;  1HNW E;  4NXN I;  4M2Z A;  1MG7 A;  2HFU A;  4JI3 I;  1N34 I;  4HY1 A;  3DJW A;  5A2Q Q;  2JR1 A;  1XMO I;  1NHI A;  1WHN A;  3JU0 A;  2ZBK B;  2XEX A;  1HNW I;  3J81 C;  2LTS A;  2J7K A;  2YT4 A;  4N3O A;  1J26 A;  4IZK A;  3ADJ A;  2V86 A;  4PU9 A;  2LUQ A;  1IBL I;  1Z5A A;  2B7T A;  3Q6N A;  3K17 A;  3ZZT A;  3B8H A;  1HNX I;  2DB2 A;  4JI5 E;  2EWL A;  3VYX A;  4P52 A;  1NHJ A;  2AJ4 A;  2ZM6 I;  1FKA E;  4B3T I;  4B3R E;  2FGG A;  2A2D A;  1N0V C;  4X62 I;  3PYD A;  4MYU A;  4JI5 I;  2X7I A;  3IWD A;  3F6H A;  4JG4 A;  4DR1 E;  1D6T A;  4B3R I;  1XNQ E;  4LF6 E;  3P06 A;  2V88 A;  3MSW A;  4DR1 I;  2JOB A;  5IT9 Q;  3HQ1 A;  4USM A;  1FJG E;  3J7A M;  1NHH A;  4DPU A;  4DV7 E;  3F6G A;  3T1H E;  3Q1Q A;  4BMJ A;  4EMD A;  2L2N A;  3ADI A;  1QU6 A;  4DV0 E;  3T1H I;  2V34 A;  2V89 A;  1KKH A;  4HAC A;  2HK2 A;  2DSY A;  1YYO A;  2MC5 A;  4DR7 E;  3AV0 A;  2VE7 C;  4DV0 I;  2L8T A;  2LTR A;  1Z0T A;  4OOG C;  2PNL A;  4DR7 I;  3IWB A;  1H74 A;  2UXC E;  2EFG A;  2M1S A;  4I3H A;  2N3G A;  1UIL A;  1ZM2 A;  4LF9 E;  1VIS A;  1H72 C;  2N3H A;  1Z0E A;  2L3J A;  2VF1 A;  2RS7 A;  3HJC A;  5IWA E;  3J7Y p;  4LF9 I;  2O1T A;  1RQ0 A;  3PYG A;  2RS6 A;  2L6M A;  5IWA I;  3HPS A;  1X49 A;  2JWO A;  2LE2 A;  2GS8 A;  1FWK A;  4FW9 A;  1XNR E;  1O0W A;  1DAR A;  4LF5 E;  1STU A;  1KVK A;  3K85 A;  3JAM C;  4LTY A;  1FWL A;  2L33 A;  1XNR I;  2V2Z A;  4WYQ B;  2KON A;  4LF5 I;  4GKK I;  3ZZU A;  3HTX A;  4R8O A;  3ZM7 A;  2LJP A;  4DR2 E;  2WW4 A;  2UUC I;  2X36 A;  2IOQ A;  1ZM3 A;  1SR9 A;  1J5E E;  2JVA A;  4DR2 I;  1XMQ E;  1Y4U A;  2Z5C A;  2L2M A;  5AAS A;  2V83 A;  1H73 A;  1UEK A;  2LJH A;  1J5E I;  4BCA A;  1XMQ I;  4DUZ I;  5FLX Q;  4USK A;  2Q2E B;  4F9B B;  1RR9 A;  5F3W A;  1ZM4 A;  4JI1 I;  4M0V A;  2IHR 1;  4F9C B;  5AE2 A;  1PKP A;  4LF8 E;  4KHP E;  5IT9 C;  3JAM Q;  4JI4 E;  4JI8 I;  1NZ0 A;  1IBL E;  3V5R A;  2ODR D;  2HHH E;  2Z5E A;  1MU5 A;  4LF8 I;  4KHP I;  1USV A;  5L3J A;  2LMZ A;  3LLH A;  1FNM A;  5LMN I;  4JI4 I;  2JOX A;  3HXL A;  1HNX E;  2DIX A;  4TUG A;  2HHH I;  3OML A;  1EA6 A;  4ZVI A;  2ZM6 E;  2FV4 B;  4B3T E;  4X62 E;  4KQV A;  1OJ4 A;  2F8B A;  1X47 A;  1RC7 A;  1PIE A;  2R3V A;  4IZJ B;  2NUF A;  4X66 I;  4LU9 A;  4LF7 E;  4R03 A;  1BKN A;  1PVG A;  4Z7Y A;  2NA2 A;  1WHQ A;  4DPW A;  3OTO I;  1N36 I;  4FN5 A;  4LF7 I;  5GME A;  5AE3 A;  5ADZ A;  3J80 C;  3K1J A;  4DXL A;  4LFC I;  2O1V A;  4LF4 E;  4B3M E;  4M30 A;  4NXM E;  1ZM9 A;  1H7S A;  2BM1 A;  3CWV A;  2Z5B B;  2CZ9 A;  4JI7 E;  4IZJ D;  4GEQ B;  4LF4 I;  4JI0 E;  4PRV A;  4B3M I;  4NXM I;  1HNZ E;  4JI7 I;  1Z0W A;  2UUB E;  1T4L B;  4UT4 A;  1XHK A;  4JI0 I;  1HNZ I;  3GON A;  2V2Q A;  2UUB I;  3H4L A;  2E1M A;  4DR6 E;  2GQ0 A;  1I94 E;  2F4V E;  4KZS A;  2A2C A;  4GKJ E;  2G7H A;  4DR6 I;  2O1U A;  2B9D A;  4YHH E;  1I94 I;  1IBM E;  2H36 X;  2F4V I;  3QT6 A;  1QZR A;  3J80 Q;  1K47 A;  5FLX C;  1Z0V A;  3HPZ A;  4GKJ I;  4WUD A;  1FI4 A;  1A6F A;  4YHH I;  1IBM I;  2CGE A;  1B63 A;  4DR3 E;  1WXR A;  4FWG A;  4XTJ A;  4GKK E;  3JTZ A;  4DR3 I;  5GMD A;  2LBS B;  2UUC E;  2DEJ A;  2CG9 A;  3WU6 A;  4DV3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...