4DR7E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr7E02
2X7IA 2UXDI 4X8WA 4FN5A 3LLHA 3M6AA 4R1FA 4B3RE 4JI5I 4DR1I 2MDRA 4DKKA 4DR5I 4USMA 4Z7YA 4B3MI 4GKKI 2B7VA 5LMUE 3VYYA 2Q2EB 1HR0E 3C4TA 3T1HE 1KVKA 1MX0A 1EKZA 4FWDA 1YYOA 4NXNI 1XNQI 2UUAI 3LPSA 2CPNA 1YZ9A 4PU9A 1KIJA 2HK3A 1HNXI 1K47A 4P52A 2RTXA 1ZM2A 1ZM9A 4LFAI 4USKA 1ZBTA 4X65E 3JAMC 1IBKI 2F4VI 4P7AA 2V2ZA 2N3HA 1Z5CA 4X66I 1T4LB 4JI7I 1ZXMA 1Z5AA 3T1YI 2X36A 1XMOE 5CFFE 4X62I 3V2UC 2UXCI 4JI1I 1IBLI 2L3CA 5LMNE 4DU7A 2VQEI 1Z0EA 3B82A 1H74A 2DMYA 4DR4E 2VQEE 4UTGA 1X49A 1BKNA 3ZKDA 4DV6E 4WUBA 2J7KA 3K1JA 4LF4I 1I94I 4DV7I 3Q1QA 4JYAI 2LTSA 3QT5A 2UUBI 2LBSB 4LF4E 4LF5I 3ADLA 2ZBKB 3D4JA 5A2QQ 4LF7I 1Z0GA 4NXMI 2JVAA 3QT6A 2UU9E 4I3HA 1UEKA 2B7TA 4K0KE 3ZM7A 2A2CA 2DB2A 1YYWA 2L33A 1H72C 3C4BA 4LF7E 2NUGA 3VYXA 3T1HI 5FLXC 1FNMA 2KHXA 2V2VA 1HR0I 1OJ4A 3P1XA 1IBKE 1DARA 1UILA 1N34I 2LTRA 4JI2I 4DR6I 4DUZI 4AQYI 2HFSA 3B8HA 4JI3E 4DV3E 2R3VA 1I94E 5IWAI 1YYKA 1N36I 4KQVA 4LFCE 4JI4E 4JI5E 2R42A 1X47A 3V5RA 4JV5E 2LUPB 1PIEA 5L3JA 1WHNA 4OOGC 2LRSA 4B3SI 1ZM3A 3WU3A 2E5LI 4WYQB 4LF6I 1PKPA 2V2QA 1STUA 4HACA 4LF5E 4LF6E 3B78A 2VF3A 4DXLA 4MYTA 3K17A 4GKJI 4DV7E 1X48A 4GKJE 4NXME 3WU5A 1HNXE 3QT8A 1J26A 1MU5A 2NPFA 2BM0A 2V8PA 4JV5I 1S4EA 4Z7CA 2ZM6I 4JI4I 1NHJA 1N32I 4LFCI 4DR7I 2GS8A 2BV3A 2L2NA 4YY3E 1FI4A 4DV6I 1VISA 4DUZE 2BM1A 1H73A 2ZM6E 1N32E 1QU6A 2IHR1 2DEJA 4FWGA 1RREA 2RS6A 4B3TI 1HNWE 5IT9C 4LF8I 4DR4I 4DUYI 4DV2I 2HK2A 4LFBI 3QT7A 3GONA 2DIXA 1XMOI 4WFTA 2HKEA 4DV2E 4JI1E 2EZ6A 4AQYE 4JI2E 5GMEA 4JI0E 4B3TE 4LF9E 4NXNE 3ADJA 4WUDA 1RR9A 2HFUA 2E5LE 1ELOA 4OX9E 3ZZ0A 4EMDA 5LMUI 1H7UA 1PVGA 4DV0I 4JYAE 3J7Yp 1FWLA 4DR7E 4JG4A 4DV1I 5LL6R 4DPTA 4PRXA 3LNUA 4DPWA 4HXZA 3F0NA 1XMQI 4DV4E 4URLA 4JI3I 1MG7A 1QZRA 4RPFA 1Z59A 4YY3I 4XTJA 1O0WA 2NUEA 4M30A 4DR5E 4ZVIA 1NHIA 4M1KA 1B62A 2NA2A 1NHHA 1B63A 4LFAE 3ADIA 4JI0I 2V34A 4B3SE 4B3RI 2UXCE 5A2QC 2JY9A 3OTOI 4LFBE 4X64I 2CZ9A 4UT4A 2YT4A 3PYGA 4WUCA 2UUAE 2AJ4A 3J7AM 4HYMA 1Z0BA 2EFGA 1HNZE 1UHZA 1A6FA 1Z0VA 5FLXQ 1GQEA 1RQ0A 2HKJA 2XEXA 1WHQA 1ZXNA 4JI8I 4DV1E 5BR8I 4PRVA 1FKAE 3J81C 2LJPA 4OX9I 2RSMA 2A2DA 4X62E 5IWAE 2UXDE 2DEIA 4M2ZA 2LUQA 1IBME 4DU8A 2L2KB 4DV5E 4DPXA 2OI2A 4DPYA 3J80C 4JI7E 1N33E 1N34E 4DR6E 2N3GA 4JI6E 3PYEA 2UXBI 4FW9A 1WUUA 2HHHE 1HNWI 3WU6A 3JAMQ 4DR2I 1T4NA 1D6TA 4K0KI 3ADGA 1XNRI 2UUCI 2WW4A 1XNQE 5GMDA 3PYFA 4DV0E 4KHPI 1S16A 2LJHA 4MYUA 1J5EI 4DR2E 4YHHE 1IBLE 1U2RA 1N36E 3ZZTA 1HNZI 3HTXA 4DV3I 1T4OA 4ED4A 4JI6I 2E1RA 2NUFA 4X66E 1Z0WA 4DV5I 1FWKA 3CWVA 1IBMI 3OTOE 4DR3I 4DR1E 1EA6A 2L3JA 4DUYE 3HULA 4LF8E 3J81Q 1N0VC 1EI1A 1FJGI 3ZKBA 4DPUA 2UU9I 4JI8E 1KTVA 1N0UA 1N33I 1NZ0A 3J80Q 4DV4I 2F4VE 2RS7A 4X65I 4KHPE 1XMQE 2UUBE 1Z5BA 4DR3E 1J5EE 4B3ME 4GKKE 2L2MA 3LTOA 5BR8E 3WU4A 1DI2A 3ZZUA 5IT9Q 3PYDA 3H4LA 1RC7A 1XHKA 2UUCE 1XNRE 1KKHA 4HY1A 4HACB 5LMNI 1Z0CA 4YHHI 2HHHI 2VQFE 1ZM4A 2UXBE 4LF9I 4X64E 3T1YE 2ZITA 1H7SA 3J7AG 1FJGE 4FWHA 2VQFI 1Z0TA 2B3TB
chains in the Genus database with same CATH superfamily
2FV4B 2X7IA 2UXDI 1X3CA 4X8WA 4FN5A 3LLHA 3M6AA 4R1FA 3THNA 2N8XA 4B3RE 4JI5I 4DR1I 2MDRA 4GZNC 4MDTA 2LV2A 4TUGA 2ADRA 4DKKA 4DR5I 1GZ6A 4J8ZA 4USMA 1QNTA 4OO1D 2C37A 3CDJA 2EMCA 2EOSA 2IERA 3JU0A 4Z7YA 4B3MI 4GKKI 4IFDF 4ZYEA 5JEAA 2B7VA 4KWYA 4LPFA 1PDAA 5AC5A 5LMUE 5AE2A 1PJQA 3VYYA 2Q2EB 2EPUA 1HR0E 2EMGA 3C4TA 2YSOA 3T1HE 2EOFA 4LTYA 1Z1BA 1KVKA 2EMWA 1EKZA 2NABA 1MX0A 2EWLA 1YYOA 2WZOA 4FWDA 1A1GA 2C39B 4U3DA 4NXNI 1XNQI 3IWBA 2UUAI 3LPSA 2CPNA 3BGHA 1YZ9A 4PU9A 1KIJA 1UDSA 2HK3A 4IFDB 3GMEA 1IMUA 5AE3A 4LOMA 1HNXI 1DGCA 1K47A 4P52A 2C39A 2RTXA 1X5WA 1ZM2A 1OYRA 1ZM9A 2VF1A 4LFAI 2CTDA 4R2PA 1ZBTA 4USKA 4R8OA 5FWKA 2RQLA 4X65E 4NHRA 3JAMC 1IBKI 3K6QA 2EN4A 1USUA 2F4VI 3UK3C 1R6MA 4P7AA 2V2ZA 2EMZA 2N3HA 2EL6A 1Z5CA 4X66I 1T4LB 1A1JA 4JI7I 2D9HA 1ZXMA 2PNMA 1Z5AA 3T1YI 2X36A 1XMOE 4OO1A 2EN7A 3TQMA 5CFFE 2EM5A 2M7QA 4X62I 2BA0G 2YU8A 3C6KA 2K4VA 2C37B 4OZEA 4JI1I 2EOZA 3V2UC 2PO1A 2UXCI 1IBLI 2L3CA 2EMBA 1T39A 4WX9A 2EN1A 5LMNE 2KONA 4FW4A 4DU7A 4OO1C 1ZU1A 3VHTB 3EPLA 1ZAAC 1Z0EA 2VQEI 3B82A 1H74A 2DMYA 4DR4E 2GO3A 2VQEE 4UTGA 1X49A 1BKNA 3BF2A 2YRHA 2CG9A 2CVEA 1TF3A 4N3OA 3ZKDA 4R2SA 4DV6E 1B69A 4WUBA 2J7KA 2NN6D 2EM7A 2FTXB 3K1JA 4LF4I 1I94I 2VRDA 1HK7A 5DROA 4DV7I 1YUJA 2M1SA 3Q1QA 2LTSA 4JYAI 4OKGA 3QT5A 2UUBI 2EQ1A 2LBSB 1HR0I 2IOPA 2ELYA 4LF4E 1OYSA 3M85G 2EM4A 4LF5I 3ADLA 1N3GA 2YTOA 1SR9A 2ZBKB 3Q6NA 2IOQA 3P76A 3D4JA 2JE6A 2JT2A 5C0XE 3HQ1A 5DNXA 5A2QQ 2EM9A 4LF7I 1Z0GA 4NXMI 1A1KA 2EM3A 2JVAA 4P78A 3QT6A 2UU9E 1UEKA 4I3HA 2B7TA 3KRNA 3EQ1A 2ENCA 2O1UA 2BBGA 3AV0A 4K0KE 3ZM7A 4IFDD 3THOB 2JEBB 2A2CA 4MLVA 2DB2A 1AH5A 4Q35B 2WNRA 3K85A 1YYWA 2L33A 3C4BA 4WSPA 1H72C 1Y4UA 2J65A 5C0XB 2EMHA 4LF7E 2NUGA 4R2QA 4ZYDA 1AAYA 3U1KA 4RHBB 3VYXA 2K7IA 3T1HI 5FLXC 1FNMA 2EOXA 2KHXA 2F1DA 5DNLA 2EOEA 2V2VA 1OJ4A 3P1XA 3B4TA 3MHSC 4R2RA 1IBKE 1DARA 1UILA 1N34I 2KOUA 2LTRA 4JI2I 4DR6I 4BMJA 4IZJD 4DUZI 4AQYI 2BA1G 2EPXA 2HFSA 3PS1A 2O3ZA 3B8HA 2YTPA 4JI3E 4F9BB 4DV3E 2LE2A 2DRPA 2R3VA 2ODRD 1I94E 5IWAI 3M85D 4IFDE 1YYKA 2ELZA 1N36I 4KQVA 4ZYGA 3GCMA 4LFCE 4JI4E 2YTNA 4JI5E 3L7ZA 2R42A 1X47A 2DLKA 2O1VA 2G7HA 3P3GA 3V5RA 4JV5E 3QG5C 2LUPB 1PIEA 1PJSA 2EM6A 2LCEA 2YTEA 5L3JA 4O43A 1WHNA 4OOGC 4BBYA 2AE8A 4DMIA 2MC6A 1BBGA 2LRSA 2EMLA 2EOHA 1ZM3A 4B3SI 2Z5EA 1G2DC 5DRRA 2Z5BB 1RHYA 1XXEA 2L92A 2MDGA 2NN6C 3WU3A 2E5LI 4WYQB 2WP8B 4R2CA 3EPHA 4LF6I 4NBQA 1PKPA 2V2QA 5KL6A 3AUZA 4L5NC 1STUA 4IS1C 1OYPA 4LF5E 4HACA 2EPRA 4LF6E 1L4SA 1BBOA 2JOXA 3OMLA 2MKNA 3B78A 2VF3A 2CSHA 2EMXA 4IS9A 2EN8A 1UDOA 2PO2B 4FW6A 4DXLA 4MYTA 3K17A 4GKJI 2JP9A 4BA2B 4DV7E 2NN6F 1X48A 2LT7A 1G2FC 4GKJE 4NXME 3WU5A 1HNXE 2I9IA 3L00A 2YPNA 2JOBA 4BC7A 1J26A 1MU5A 3QT8A 2EOIA 3EPJA 2EPPA 4QNJA 2NPFA 4BA1A 2BM0A 2V8PA 2EPCA 2WP8A 2YTDA 3HKMA 4JV5I 4LCFA 4WXDA 4F54A 4R2AA 4IJDA 4TUIA 2LO3A 1RMDA 1S4EA 4Z7CA 2ZM6I 4JI4I 1WRJA 1NHJA 1N32I 4BA1B 2EORA 4LFCI 4DR7I 4F6NA 2GS8A 5TSEA 5K36A 2BV3A 1X6EA 2L2NA 4M0VA 4IZKA 2L8TA 2EPNA 1UN6B 4YY3E 1FI4A 4R2DA 1UDNA 4DV6I 1VISA 3H1CA 4DUZE 5JEAF 2EM0A 2BM1A 2NN6A 2EMAA 1H73A 2ZM6E 1N32E 2EOJA 2YTGA 2GQ0A 1QU6A 2IHR1 1A1HA 2DEJA 4FWGA 2DSYA 1RREA 2RS6A 2EMIA 5C0XD 4B3TI 2EL5A 1X6FA 5K36D 1HNWE 5IT9C 4LF8I 2YRMA 2J7JA 4DR4I 4BHBA 4DUYI 4X9JA 2ODRC 4DV2I 2HK2A 4MQYA 4LCHA 4LFBI 2JXPA 2DIXA 3GONA 3QT7A 2PO0A 4WFTA 1XMOI 2HKEA 4DV2E 4JI1E 2EZ6A 4AQYE 1R6LA 3EPKA 1E3PA 3IWCA 2PRTA 4JI2E 5GMEA 2EOOA 4FW7A 4JI0E 4B3TE 3U1YA 2NN6E 2M9AA 3ADJA 4LF9E 4NXNE 4AM3A 4WUDA 1RR9A 2YTIA 2HFUA 2E5LE 2E72A 2LVHA 4OX9E 1ELOA 3ZZ0A 2RPCA 2V89A 2JYAA 4EMDA 3H09A 5LMUI 1A1FA 2EN3A 3BIDA 4BS9A 2WBTA 1H7UA 1PVGA 3JTZA 2JEBA 2BR2A 4FW3A 4DV0I 3HXLA 4JYAE 3J7Yp 1FWLA 4DR7E 5AASA 4JG4A 4DV1I 2VE7C 3FIGA 3KZZA 4FW5A 4IZKB 3M7ND 5T6JA 5LL6R 5A69A 2PNZA 3Q6MA 2BR2B 3LNUA 4PRXA 4DPTA 4DPWA 2JE6B 4HXZA 5JEAE 3HPSA 2JPAA 3F0NA 1XMQI 5DRQA 4DV4E 4URLA 1YSAC 4JI3I 1MG7A 1QZRA 4BC9A 5DNYA 4RPFA 1Z59A 1YH8A 4YY3I 3KWRA 2EN2A 3UHMA 4XTJA 1O0WA 2NUEA 4M30A 4DR5E 4ZVIA 2BB8A 1YFHA 1NHIA 4M1KA 2EQ0A 1B62A 3GLLA 2NA2A 2YWQA 4N4RB 2GLIA 1NHHA 3P3EA 1B63A 1P42A 4LFAE 4AIMA 3ADIA 2C38B 2V86A 3NZKA 2M4IA 4JI0I 2I13A 5JEAD 5KL7A 4ZYHA 2V83A 2DGCA 4B3SE 2V34A 4B3RI 2UXCE 4IZJA 5A2QC 4MU3A 2JY9A 5ELWA 3OTOI 5AC4A 1UBDC 3IWDA 4WPYA 4LFBE 1Y4SA 4X64I 5C0XC 2CZ9A 2EMYA 3M7NG 1KYQA 3RMPA 4UT4A 2YT4A 3PYGA 2V8QB 3MSWA 1JK1A 1YUIA 1KJKA 4WUCA 1NCSA 1IQSA 1X6HA 2UUAE 2AJ4A 1EH6A 3J7AM 2WCC3 2C38A 4HYMA 4F6MA 1HNZE 1UHZA 1Z0BA 2EFGA 1A6FA 2PNLA 1Z0VA 5FLXQ 2CT1A 1GQEA 4M9VC 1RQ0A 4Q28A 1JK2A 1ZBQA 2EPOA 2HKJA 2XEXA 1WHQA 2EN6A 1A1LA 4DV1E 1ZXNA 4JI8I 4I8OA 5BR8I 2EOYA 3P06A 4PRVA 3KZYA 1YHCA 1FKAE 3J81C 2V88A 4GEQB 3CDIA 2LMZA 2LJPA 4QNKA 1LLMC 2EM8A 5K36F 2GPIA 3PS2A 1PJTA 2RSMA 2A2DA 4OX9I 2RSIA 2NN6B 4X62E 3DJWA 5IWAE 2UXDE 2DEIA 1TF6A 4M2ZA 2LUQA 1IBME 4DU8A 5KL2A 2L2KB 1NEIA 4DV5E 2EPZA 2OI2A 4DPXA 4MU0A 4GQUA 2R76A 4DPYA 3J80C 4IZJB 3F6GA 2H36X 4JI7E 1N33E 1UDQA 2PO0B 1N34E 4DR6E 2N3GA 4BA2A 3BBGA 5F3WA 1WXRA 1SFEA 4JI6E 2EE8A 2YU5A 5K36B 3PYEA 2UXBI 4FW9A 1WUUA 4HEIA 2YTFA 2MKDA 2HHHE 1Y5YA 4OO1E 1HNWI 3WU6A 3VK6A 3JAMQ 2CGEA 1MEYC 4DR2I 4FK5C 1T4NA 2YSPA 1DQ3A 2MC5A 2DLQA 1D6TA 5JEAB 4K0KI 2HC5A 1E3HA 3ADGA 5A6BD 2JEAA 4F2JC 4HTGA 2GO4A 2UUCI 4O5GA 2WW4A 2PO2A 1XNRI 5IV8B 4MLQA 5IXMB 2WBSA 1XNQE 4AIDA 5GMDA 3PYFA 4DV0E 4LCGA 4OO1B 5ADZA 4KHPI 1S16A 3PRYA 4L8NA 2LJHA 4MYUA 1J5EI 4BHCA 4YHHE 4DR2E 2YTQA 1IBLE 1U2RA 5EKWA 1N36E 5LLQA 1EH8A 3ZZTA 2EPAA 4NZVA 1HNZI 3HTXA 4DV3I 2O1WA 1T4OA 4ED4A 5C0XF 4JI6I 3DF6A 3LMLA 2E1RA 1YPNA 2A25A 2YTJA 4BCAA 2IESA 4P7DA 1TN9A 2GHFA 4KZSA 2Z5BA 2YRKA 2F8BA 4O4KA 2NUFA 4X66E 4ISAA 4MU4A 1Z0WA 2B9DA 4DV5I 2EJ4A 2Q8UA 1FWKA 2EP3A 4RH8A 3CWVA 1IBMI 1Y6ZA 4OO1F 4J3DA 3OTOE 4LU9A 4DR3I 4DR1E 1EA6A 2L3JA 4DUYE 2ENAA 4IFDA 3HJCA 4LF8E 1EH7A 2Z5CB 3HULA 3J81Q 4WSGA 3F6HA 3C6MA 5KL3A 1P47A 1N0VC 2EMKA 4IFDC 1EI1A 1FJGI 2O1TA 2PO1B 3ZKBA 3DD6A 5A6BA 2PNZB 4DPUA 2UU9I 5A6JA 2V85A 4JI8E 5A6KA 1KTVA 1N0UA 5DRPA 1MGTA 2FGGA 2EOQA 1F2IG 3ZOQB 1N33I 5K36C 1Y60A 2L6MA 5A6AA 1NZ0A 3J80Q 3HPZA 1ZR9A 2BA1D 2HGHA 3PS3A 4R2EA 2Z5CA 2EPLX 1VI7A 2V87A 2EPMX 2EQ3A 4DV4I 4O24A 2F4VE 2RS7A 4X65I 4R03A 4KHPE 1A1IA 5KL5A 1XMQE 2UUBE 4MU1A 1Z5BA 1BB8A 2DMIA 2WNRB 2JWOA 4DR3E 1GTKA 1J5EE 4B3ME 4GKKE 2L2MA 4WXCA 2EPKX 5BR8E 3LTOA 3WU4A 1DI2A 4U3BA 2HJJA 2EM2A 3ZZUA 5AE1A 5IT9Q 3PYDA 3H4LA 1RC7A 1XHKA 2UUCE 1XNRE 1T38A 5KL4A 1IQOA 3P3CA 3L7ZB 2LJUA 2ENHA 5EL9A 1KKHA 4F9CB 4HACB 4HY1A 5LMNI 4F9AB 1Z0CA 4YHHI 1USVA 2VQFE 2HHHI 2R1FA 2EOMA 1ZM4A 2EMFA 2UXBE 3M99B 5K36E 2EL4A 5C0XA 4LF9I 2WBUA 4X64E 3T1YE 1WJPA 3MHHC 2ZITA 2BA0D 3ECRA 3J7AG 1H7SA 5JEAC 2JEAB 1FJGE 2VESA 2JR1A 4FWHA 2VQFI 1Z0TA 2YZTA 2E1MA 2B3TB
chains in the Genus database with same CATH topology
2FV4B 2X7IA 2UXDI 4X8WA 4FN5A 3LLHA 3M6AA 4R1FA 4B3RE 4JI5I 4DR1I 2MDRA 4TUGA 4DKKA 4DR5I 1GZ6A 4J8ZA 4USMA 3JU0A 4Z7YA 4B3MI 4GKKI 2B7VA 5LMUE 5AE2A 3VYYA 2Q2EB 1HR0E 3C4TA 3T1HE 4LTYA 1KVKA 1MX0A 1EKZA 4FWDA 2EWLA 1YYOA 2WZOA 4NXNI 1XNQI 3IWBA 2UUAI 3LPSA 2CPNA 1YZ9A 4PU9A 1KIJA 2HK3A 5AE3A 1HNXI 1K47A 4P52A 2RTXA 1ZM2A 1ZM9A 2VF1A 4LFAI 4USKA 1ZBTA 4R8OA 5FWKA 4X65E 3JAMC 1IBKI 3K6QA 2F4VI 1USUA 4P7AA 2V2ZA 2N3HA 1Z5CA 4X66I 1T4LB 4JI7I 1ZXMA 2PNMA 1Z5AA 3T1YI 2X36A 1XMOE 5CFFE 2M7QA 4X62I 2K4VA 3V2UC 4JI1I 2UXCI 1IBLI 2L3CA 5LMNE 2KONA 4DU7A 2VQEI 1Z0EA 3B82A 1H74A 2DMYA 4DR4E 2VQEE 4UTGA 1X49A 1BKNA 2CG9A 4N3OA 3ZKDA 4DV6E 4WUBA 2J7KA 3K1JA 2FTXB 4LF4I 1I94I 1HK7A 4DV7I 2M1SA 3Q1QA 2LTSA 4JYAI 3QT5A 2UUBI 2LBSB 2IOPA 4LF4E 4LF5I 3ADLA 2ZBKB 1SR9A 3Q6NA 2IOQA 3D4JA 3HQ1A 5A2QQ 4LF7I 1Z0GA 4NXMI 4P78A 2JVAA 3QT6A 2UU9E 1UEKA 4I3HA 2B7TA 2O1UA 3AV0A 4K0KE 3ZM7A 2A2CA 2DB2A 3K85A 1Y4UA 4WSPA 3C4BA 1H72C 1YYWA 2L33A 4LF7E 2NUGA 3VYXA 3T1HI 5FLXC 1FNMA 2KHXA 2V2VA 1HR0I 1OJ4A 3P1XA 1IBKE 1DARA 1UILA 1N34I 2KOUA 2LTRA 4JI2I 4DR6I 4BMJA 4IZJD 4DUZI 4AQYI 2HFSA 3B8HA 4JI3E 4F9BB 4DV3E 2LE2A 2R3VA 2ODRD 1I94E 5IWAI 1YYKA 1N36I 4KQVA 4LFCE 4JI4E 4JI5E 2R42A 1X47A 2O1VA 2G7HA 3V5RA 4JV5E 2LUPB 1PIEA 5L3JA 1WHNA 4OOGC 4BBYA 4DMIA 2MC6A 2LRSA 4B3SI 1ZM3A 2Z5EA 2Z5BB 2L92A 3WU3A 2E5LI 4WYQB 4LF6I 1PKPA 2V2QA 3AUZA 4L5NC 1STUA 4HACA 4LF5E 4LF6E 2JOXA 3OMLA 3B78A 2VF3A 4DXLA 4MYTA 3K17A 4GKJI 4DV7E 1X48A 4GKJE 4NXME 3WU5A 1HNXE 3QT8A 2JOBA 4BC7A 1J26A 1MU5A 2NPFA 2BM0A 2V8PA 4JV5I 4F54A 4TUIA 1S4EA 4Z7CA 2ZM6I 4JI4I 1NHJA 1N32I 4LFCI 4DR7I 2GS8A 2BV3A 2L2NA 4M0VA 4IZKA 2L8TA 4YY3E 1FI4A 4DV6I 1VISA 4DUZE 2BM1A 1H73A 2ZM6E 1N32E 2GQ0A 1QU6A 2IHR1 2DEJA 4FWGA 2DSYA 1RREA 2RS6A 4B3TI 1HNWE 5IT9C 4LF8I 4DR4I 4DUYI 2ODRC 4DV2I 2HK2A 4LFBI 2DIXA 3GONA 3QT7A 1XMOI 4WFTA 2HKEA 4DV2E 4JI1E 2EZ6A 4AQYE 3IWCA 4JI2E 5GMEA 4JI0E 4B3TE 4LF9E 4NXNE 3ADJA 4WUDA 1RR9A 2HFUA 2E5LE 1ELOA 4OX9E 3ZZ0A 2V89A 4EMDA 3H09A 5LMUI 4BS9A 1H7UA 1PVGA 4DV0I 3JTZA 3HXLA 4JYAE 3J7Yp 1FWLA 4DR7E 5AASA 4JG4A 4DV1I 2VE7C 3FIGA 4IZKB 5T6JA 5LL6R 3Q6MA 4PRXA 4DPTA 3LNUA 4DPWA 4HXZA 3HPSA 3F0NA 1XMQI 4DV4E 4URLA 4JI3I 1MG7A 1QZRA 4BC9A 5DNYA 4RPFA 1Z59A 4YY3I 3KWRA 4XTJA 1O0WA 2NUEA 4M30A 4DR5E 4ZVIA 1NHIA 4M1KA 1B62A 2NA2A 1NHHA 1B63A 4LFAE 3ADIA 2V86A 2M4IA 4JI0I 2V34A 2V83A 4B3SE 4B3RI 2UXCE 4IZJA 5A2QC 2JY9A 3OTOI 3IWDA 4WPYA 4LFBE 1Y4SA 4X64I 2CZ9A 3RMPA 4UT4A 2YT4A 3PYGA 2V8QB 3MSWA 4WUCA 2UUAE 2AJ4A 3J7AM 4HYMA 1HNZE 1UHZA 1Z0BA 2EFGA 1A6FA 2PNLA 1Z0VA 5FLXQ 1GQEA 1RQ0A 4Q28A 1ZBQA 2HKJA 2XEXA 1WHQA 1ZXNA 4JI8I 4DV1E 5BR8I 4I8OA 3P06A 4PRVA 1FKAE 3J81C 2V88A 4GEQB 2LMZA 2LJPA 4OX9I 2RSMA 2A2DA 4X62E 3DJWA 5IWAE 2UXDE 2DEIA 4M2ZA 2LUQA 1IBME 4DU8A 2L2KB 4DV5E 4DPXA 2OI2A 4DPYA 3J80C 4IZJB 3F6GA 2H36X 4JI7E 1N33E 1N34E 4DR6E 2N3GA 5F3WA 1WXRA 4JI6E 3PYEA 2UXBI 4FW9A 1WUUA 2HHHE 1HNWI 3WU6A 3VK6A 3JAMQ 2CGEA 4DR2I 1T4NA 1DQ3A 2MC5A 1D6TA 4K0KI 3ADGA 1XNRI 2UUCI 2WW4A 1XNQE 5GMDA 3PYFA 4DV0E 5ADZA 4KHPI 1S16A 3PRYA 4L8NA 2LJHA 4MYUA 1J5EI 4DR2E 4YHHE 1IBLE 1U2RA 1N36E 3ZZTA 1HNZI 3HTXA 4DV3I 2O1WA 1T4OA 4ED4A 4JI6I 3DF6A 3LMLA 2E1RA 4BCAA 4P7DA 4KZSA 2Z5BA 2F8BA 2NUFA 4X66E 1Z0WA 2B9DA 4DV5I 1FWKA 3CWVA 1IBMI 1Y6ZA 3OTOE 4LU9A 4DR3I 4DR1E 1EA6A 2L3JA 4DUYE 3HJCA 4LF8E 2Z5CB 3HULA 3J81Q 3F6HA 1N0VC 1EI1A 1FJGI 2O1TA 3ZKBA 4DPUA 2UU9I 2V85A 4JI8E 1KTVA 1N0UA 2FGGA 3ZOQB 1N33I 2L6MA 1NZ0A 3J80Q 3HPZA 2Z5CA 2V87A 4DV4I 2F4VE 2RS7A 4X65I 4R03A 4KHPE 1XMQE 2UUBE 1Z5BA 2JWOA 4DR3E 1J5EE 4B3ME 4GKKE 2L2MA 3LTOA 5BR8E 3WU4A 1DI2A 3ZZUA 5AE1A 5IT9Q 3PYDA 3H4LA 1RC7A 1XHKA 2UUCE 1XNRE 1KKHA 4F9CB 4HACB 4HY1A 5LMNI 4F9AB 1Z0CA 4YHHI 1USVA 2VQFE 2HHHI 1ZM4A 2UXBE 4LF9I 4X64E 3T1YE 2ZITA 3J7AG 1H7SA 1FJGE 2JR1A 4FWHA 2VQFI 1Z0TA 2YZTA 2E1MA 2B3TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7I A;  2UXD I;  4X8W A;  4FN5 A;  3LLH A;  3M6A A;  4R1F A;  4B3R E;  4JI5 I;  4DR1 I;  2MDR A;  4DKK A;  4DR5 I;  4USM A;  4Z7Y A;  4B3M I;  4GKK I;  2B7V A;  5LMU E;  3VYY A;  2Q2E B;  1HR0 E;  3C4T A;  3T1H E;  1KVK A;  1MX0 A;  1EKZ A;  4FWD A;  1YYO A;  4NXN I;  1XNQ I;  2UUA I;  3LPS A;  2CPN A;  1YZ9 A;  4PU9 A;  1KIJ A;  2HK3 A;  1HNX I;  1K47 A;  4P52 A;  2RTX A;  1ZM2 A;  1ZM9 A;  4LFA I;  4USK A;  1ZBT A;  4X65 E;  3JAM C;  1IBK I;  2F4V I;  4P7A A;  2V2Z A;  2N3H A;  1Z5C A;  4X66 I;  1T4L B;  4JI7 I;  1ZXM A;  1Z5A A;  3T1Y I;  2X36 A;  1XMO E;  5CFF E;  4X62 I;  3V2U C;  2UXC I;  4JI1 I;  1IBL I;  2L3C A;  5LMN E;  4DU7 A;  2VQE I;  1Z0E A;  3B82 A;  1H74 A;  2DMY A;  4DR4 E;  2VQE E;  4UTG A;  1X49 A;  1BKN A;  3ZKD A;  4DV6 E;  4WUB A;  2J7K A;  3K1J A;  4LF4 I;  1I94 I;  4DV7 I;  3Q1Q A;  4JYA I;  2LTS A;  3QT5 A;  2UUB I;  2LBS B;  4LF4 E;  4LF5 I;  3ADL A;  2ZBK B;  3D4J A;  5A2Q Q;  4LF7 I;  1Z0G A;  4NXM I;  2JVA A;  3QT6 A;  2UU9 E;  4I3H A;  1UEK A;  2B7T A;  4K0K E;  3ZM7 A;  2A2C A;  2DB2 A;  1YYW A;  2L33 A;  1H72 C;  3C4B A;  4LF7 E;  2NUG A;  3VYX A;  3T1H I;  5FLX C;  1FNM A;  2KHX A;  2V2V A;  1HR0 I;  1OJ4 A;  3P1X A;  1IBK E;  1DAR A;  1UIL A;  1N34 I;  2LTR A;  4JI2 I;  4DR6 I;  4DUZ I;  4AQY I;  2HFS A;  3B8H A;  4JI3 E;  4DV3 E;  2R3V A;  1I94 E;  5IWA I;  1YYK A;  1N36 I;  4KQV A;  4LFC E;  4JI4 E;  4JI5 E;  2R42 A;  1X47 A;  3V5R A;  4JV5 E;  2LUP B;  1PIE A;  5L3J A;  1WHN A;  4OOG C;  2LRS A;  4B3S I;  1ZM3 A;  3WU3 A;  2E5L I;  4WYQ B;  4LF6 I;  1PKP A;  2V2Q A;  1STU A;  4HAC A;  4LF5 E;  4LF6 E;  3B78 A;  2VF3 A;  4DXL A;  4MYT A;  3K17 A;  4GKJ I;  4DV7 E;  1X48 A;  4GKJ E;  4NXM E;  3WU5 A;  1HNX E;  3QT8 A;  1J26 A;  1MU5 A;  2NPF A;  2BM0 A;  2V8P A;  4JV5 I;  1S4E A;  4Z7C A;  2ZM6 I;  4JI4 I;  1NHJ A;  1N32 I;  4LFC I;  4DR7 I;  2GS8 A;  2BV3 A;  2L2N A;  4YY3 E;  1FI4 A;  4DV6 I;  1VIS A;  4DUZ E;  2BM1 A;  1H73 A;  2ZM6 E;  1N32 E;  1QU6 A;  2IHR 1;  2DEJ A;  4FWG A;  1RRE A;  2RS6 A;  4B3T I;  1HNW E;  5IT9 C;  4LF8 I;  4DR4 I;  4DUY I;  4DV2 I;  2HK2 A;  4LFB I;  3QT7 A;  3GON A;  2DIX A;  1XMO I;  4WFT A;  2HKE A;  4DV2 E;  4JI1 E;  2EZ6 A;  4AQY E;  4JI2 E;  5GME A;  4JI0 E;  4B3T E;  4LF9 E;  4NXN E;  3ADJ A;  4WUD A;  1RR9 A;  2HFU A;  2E5L E;  1ELO A;  4OX9 E;  3ZZ0 A;  4EMD A;  5LMU I;  1H7U A;  1PVG A;  4DV0 I;  4JYA E;  3J7Y p;  1FWL A;  4DR7 E;  4JG4 A;  4DV1 I;  5LL6 R;  4DPT A;  4PRX A;  3LNU A;  4DPW A;  4HXZ A;  3F0N A;  1XMQ I;  4DV4 E;  4URL A;  4JI3 I;  1MG7 A;  1QZR A;  4RPF A;  1Z59 A;  4YY3 I;  4XTJ A;  1O0W A;  2NUE A;  4M30 A;  4DR5 E;  4ZVI A;  1NHI A;  4M1K A;  1B62 A;  2NA2 A;  1NHH A;  1B63 A;  4LFA E;  3ADI A;  4JI0 I;  2V34 A;  4B3S E;  4B3R I;  2UXC E;  5A2Q C;  2JY9 A;  3OTO I;  4LFB E;  4X64 I;  2CZ9 A;  4UT4 A;  2YT4 A;  3PYG A;  4WUC A;  2UUA E;  2AJ4 A;  3J7A M;  4HYM A;  1Z0B A;  2EFG A;  1HNZ E;  1UHZ A;  1A6F A;  1Z0V A;  5FLX Q;  1GQE A;  1RQ0 A;  2HKJ A;  2XEX A;  1WHQ A;  1ZXN A;  4JI8 I;  4DV1 E;  5BR8 I;  4PRV A;  1FKA E;  3J81 C;  2LJP A;  4OX9 I;  2RSM A;  2A2D A;  4X62 E;  5IWA E;  2UXD E;  2DEI A;  4M2Z A;  2LUQ A;  1IBM E;  4DU8 A;  2L2K B;  4DV5 E;  4DPX A;  2OI2 A;  4DPY A;  3J80 C;  4JI7 E;  1N33 E;  1N34 E;  4DR6 E;  2N3G A;  4JI6 E;  3PYE A;  2UXB I;  4FW9 A;  1WUU A;  2HHH E;  1HNW I;  3WU6 A;  3JAM Q;  4DR2 I;  1T4N A;  1D6T A;  4K0K I;  3ADG A;  1XNR I;  2UUC I;  2WW4 A;  1XNQ E;  5GMD A;  3PYF A;  4DV0 E;  4KHP I;  1S16 A;  2LJH A;  4MYU A;  1J5E I;  4DR2 E;  4YHH E;  1IBL E;  1U2R A;  1N36 E;  3ZZT A;  1HNZ I;  3HTX A;  4DV3 I;  1T4O A;  4ED4 A;  4JI6 I;  2E1R A;  2NUF A;  4X66 E;  1Z0W A;  4DV5 I;  1FWK A;  3CWV A;  1IBM I;  3OTO E;  4DR3 I;  4DR1 E;  1EA6 A;  2L3J A;  4DUY E;  3HUL A;  4LF8 E;  3J81 Q;  1N0V C;  1EI1 A;  1FJG I;  3ZKB A;  4DPU A;  2UU9 I;  4JI8 E;  1KTV A;  1N0U A;  1N33 I;  1NZ0 A;  3J80 Q;  4DV4 I;  2F4V E;  2RS7 A;  4X65 I;  4KHP E;  1XMQ E;  2UUB E;  1Z5B A;  4DR3 E;  1J5E E;  4B3M E;  4GKK E;  2L2M A;  3LTO A;  5BR8 E;  3WU4 A;  1DI2 A;  3ZZU A;  5IT9 Q;  3PYD A;  3H4L A;  1RC7 A;  1XHK A;  2UUC E;  1XNR E;  1KKH A;  4HY1 A;  4HAC B;  5LMN I;  1Z0C A;  4YHH I;  2HHH I;  2VQF E;  1ZM4 A;  2UXB E;  4LF9 I;  4X64 E;  3T1Y E;  2ZIT A;  1H7S A;  3J7A G;  1FJG E;  4FWH A;  2VQF I;  1Z0T A;  2B3T B; 
#chains in the Genus database with same CATH topology
 2FV4 B;  2X7I A;  2UXD I;  1X3C A;  4X8W A;  4FN5 A;  3LLH A;  3M6A A;  4R1F A;  3THN A;  2N8X A;  4B3R E;  4JI5 I;  4DR1 I;  2MDR A;  4GZN C;  4MDT A;  2LV2 A;  4TUG A;  2ADR A;  4DKK A;  4DR5 I;  1GZ6 A;  4J8Z A;  4USM A;  1QNT A;  4OO1 D;  2C37 A;  3CDJ A;  2EMC A;  2EOS A;  2IER A;  3JU0 A;  4Z7Y A;  4B3M I;  4GKK I;  4IFD F;  4ZYE A;  5JEA A;  2B7V A;  4KWY A;  4LPF A;  1PDA A;  5AC5 A;  5LMU E;  5AE2 A;  1PJQ A;  3VYY A;  2Q2E B;  2EPU A;  1HR0 E;  2EMG A;  3C4T A;  2YSO A;  3T1H E;  2EOF A;  4LTY A;  1Z1B A;  1KVK A;  2EMW A;  1EKZ A;  2NAB A;  1MX0 A;  2EWL A;  1YYO A;  2WZO A;  4FWD A;  1A1G A;  2C39 B;  4U3D A;  4NXN I;  1XNQ I;  3IWB A;  2UUA I;  3LPS A;  2CPN A;  3BGH A;  1YZ9 A;  4PU9 A;  1KIJ A;  1UDS A;  2HK3 A;  4IFD B;  3GME A;  1IMU A;  5AE3 A;  4LOM A;  1HNX I;  1DGC A;  1K47 A;  4P52 A;  2C39 A;  2RTX A;  1X5W A;  1ZM2 A;  1OYR A;  1ZM9 A;  2VF1 A;  4LFA I;  2CTD A;  4R2P A;  1ZBT A;  4USK A;  4R8O A;  5FWK A;  2RQL A;  4X65 E;  4NHR A;  3JAM C;  1IBK I;  3K6Q A;  2EN4 A;  1USU A;  2F4V I;  3UK3 C;  1R6M A;  4P7A A;  2V2Z A;  2EMZ A;  2N3H A;  2EL6 A;  1Z5C A;  4X66 I;  1T4L B;  1A1J A;  4JI7 I;  2D9H A;  1ZXM A;  2PNM A;  1Z5A A;  3T1Y I;  2X36 A;  1XMO E;  4OO1 A;  2EN7 A;  3TQM A;  5CFF E;  2EM5 A;  2M7Q A;  4X62 I;  2BA0 G;  2YU8 A;  3C6K A;  2K4V A;  2C37 B;  4OZE A;  4JI1 I;  2EOZ A;  3V2U C;  2PO1 A;  2UXC I;  1IBL I;  2L3C A;  2EMB A;  1T39 A;  4WX9 A;  2EN1 A;  5LMN E;  2KON A;  4FW4 A;  4DU7 A;  4OO1 C;  1ZU1 A;  3VHT B;  3EPL A;  1ZAA C;  1Z0E A;  2VQE I;  3B82 A;  1H74 A;  2DMY A;  4DR4 E;  2GO3 A;  2VQE E;  4UTG A;  1X49 A;  1BKN A;  3BF2 A;  2YRH A;  2CG9 A;  2CVE A;  1TF3 A;  4N3O A;  3ZKD A;  4R2S A;  4DV6 E;  1B69 A;  4WUB A;  2J7K A;  2NN6 D;  2EM7 A;  2FTX B;  3K1J A;  4LF4 I;  1I94 I;  2VRD A;  1HK7 A;  5DRO A;  4DV7 I;  1YUJ A;  2M1S A;  3Q1Q A;  2LTS A;  4JYA I;  4OKG A;  3QT5 A;  2UUB I;  2EQ1 A;  2LBS B;  1HR0 I;  2IOP A;  2ELY A;  4LF4 E;  1OYS A;  3M85 G;  2EM4 A;  4LF5 I;  3ADL A;  1N3G A;  2YTO A;  1SR9 A;  2ZBK B;  3Q6N A;  2IOQ A;  3P76 A;  3D4J A;  2JE6 A;  2JT2 A;  5C0X E;  3HQ1 A;  5DNX A;  5A2Q Q;  2EM9 A;  4LF7 I;  1Z0G A;  4NXM I;  1A1K A;  2EM3 A;  2JVA A;  4P78 A;  3QT6 A;  2UU9 E;  1UEK A;  4I3H A;  2B7T A;  3KRN A;  3EQ1 A;  2ENC A;  2O1U A;  2BBG A;  3AV0 A;  4K0K E;  3ZM7 A;  4IFD D;  3THO B;  2JEB B;  2A2C A;  4MLV A;  2DB2 A;  1AH5 A;  4Q35 B;  2WNR A;  3K85 A;  1YYW A;  2L33 A;  3C4B A;  4WSP A;  1H72 C;  1Y4U A;  2J65 A;  5C0X B;  2EMH A;  4LF7 E;  2NUG A;  4R2Q A;  4ZYD A;  1AAY A;  3U1K A;  4RHB B;  3VYX A;  2K7I A;  3T1H I;  5FLX C;  1FNM A;  2EOX A;  2KHX A;  2F1D A;  5DNL A;  2EOE A;  2V2V A;  1OJ4 A;  3P1X A;  3B4T A;  3MHS C;  4R2R A;  1IBK E;  1DAR A;  1UIL A;  1N34 I;  2KOU A;  2LTR A;  4JI2 I;  4DR6 I;  4BMJ A;  4IZJ D;  4DUZ I;  4AQY I;  2BA1 G;  2EPX A;  2HFS A;  3PS1 A;  2O3Z A;  3B8H A;  2YTP A;  4JI3 E;  4F9B B;  4DV3 E;  2LE2 A;  2DRP A;  2R3V A;  2ODR D;  1I94 E;  5IWA I;  3M85 D;  4IFD E;  1YYK A;  2ELZ A;  1N36 I;  4KQV A;  4ZYG A;  3GCM A;  4LFC E;  4JI4 E;  2YTN A;  4JI5 E;  3L7Z A;  2R42 A;  1X47 A;  2DLK A;  2O1V A;  2G7H A;  3P3G A;  3V5R A;  4JV5 E;  3QG5 C;  2LUP B;  1PIE A;  1PJS A;  2EM6 A;  2LCE A;  2YTE A;  5L3J A;  4O43 A;  1WHN A;  4OOG C;  4BBY A;  2AE8 A;  4DMI A;  2MC6 A;  1BBG A;  2LRS A;  2EML A;  2EOH A;  1ZM3 A;  4B3S I;  2Z5E A;  1G2D C;  5DRR A;  2Z5B B;  1RHY A;  1XXE A;  2L92 A;  2MDG A;  2NN6 C;  3WU3 A;  2E5L I;  4WYQ B;  2WP8 B;  4R2C A;  3EPH A;  4LF6 I;  4NBQ A;  1PKP A;  2V2Q A;  5KL6 A;  3AUZ A;  4L5N C;  1STU A;  4IS1 C;  1OYP A;  4LF5 E;  4HAC A;  2EPR A;  4LF6 E;  1L4S A;  1BBO A;  2JOX A;  3OML A;  2MKN A;  3B78 A;  2VF3 A;  2CSH A;  2EMX A;  4IS9 A;  2EN8 A;  1UDO A;  2PO2 B;  4FW6 A;  4DXL A;  4MYT A;  3K17 A;  4GKJ I;  2JP9 A;  4BA2 B;  4DV7 E;  2NN6 F;  1X48 A;  2LT7 A;  1G2F C;  4GKJ E;  4NXM E;  3WU5 A;  1HNX E;  2I9I A;  3L00 A;  2YPN A;  2JOB A;  4BC7 A;  1J26 A;  1MU5 A;  3QT8 A;  2EOI A;  3EPJ A;  2EPP A;  4QNJ A;  2NPF A;  4BA1 A;  2BM0 A;  2V8P A;  2EPC A;  2WP8 A;  2YTD A;  3HKM A;  4JV5 I;  4LCF A;  4WXD A;  4F54 A;  4R2A A;  4IJD A;  4TUI A;  2LO3 A;  1RMD A;  1S4E A;  4Z7C A;  2ZM6 I;  4JI4 I;  1WRJ A;  1NHJ A;  1N32 I;  4BA1 B;  2EOR A;  4LFC I;  4DR7 I;  4F6N A;  2GS8 A;  5TSE A;  5K36 A;  2BV3 A;  1X6E A;  2L2N A;  4M0V A;  4IZK A;  2L8T A;  2EPN A;  1UN6 B;  4YY3 E;  1FI4 A;  4R2D A;  1UDN A;  4DV6 I;  1VIS A;  3H1C A;  4DUZ E;  5JEA F;  2EM0 A;  2BM1 A;  2NN6 A;  2EMA A;  1H73 A;  2ZM6 E;  1N32 E;  2EOJ A;  2YTG A;  2GQ0 A;  1QU6 A;  2IHR 1;  1A1H A;  2DEJ A;  4FWG A;  2DSY A;  1RRE A;  2RS6 A;  2EMI A;  5C0X D;  4B3T I;  2EL5 A;  1X6F A;  5K36 D;  1HNW E;  5IT9 C;  4LF8 I;  2YRM A;  2J7J A;  4DR4 I;  4BHB A;  4DUY I;  4X9J A;  2ODR C;  4DV2 I;  2HK2 A;  4MQY A;  4LCH A;  4LFB I;  2JXP A;  2DIX A;  3GON A;  3QT7 A;  2PO0 A;  4WFT A;  1XMO I;  2HKE A;  4DV2 E;  4JI1 E;  2EZ6 A;  4AQY E;  1R6L A;  3EPK A;  1E3P A;  3IWC A;  2PRT A;  4JI2 E;  5GME A;  2EOO A;  4FW7 A;  4JI0 E;  4B3T E;  3U1Y A;  2NN6 E;  2M9A A;  3ADJ A;  4LF9 E;  4NXN E;  4AM3 A;  4WUD A;  1RR9 A;  2YTI A;  2HFU A;  2E5L E;  2E72 A;  2LVH A;  4OX9 E;  1ELO A;  3ZZ0 A;  2RPC A;  2V89 A;  2JYA A;  4EMD A;  3H09 A;  5LMU I;  1A1F A;  2EN3 A;  3BID A;  4BS9 A;  2WBT A;  1H7U A;  1PVG A;  3JTZ A;  2JEB A;  2BR2 A;  4FW3 A;  4DV0 I;  3HXL A;  4JYA E;  3J7Y p;  1FWL A;  4DR7 E;  5AAS A;  4JG4 A;  4DV1 I;  2VE7 C;  3FIG A;  3KZZ A;  4FW5 A;  4IZK B;  3M7N D;  5T6J A;  5LL6 R;  5A69 A;  2PNZ A;  3Q6M A;  2BR2 B;  3LNU A;  4PRX A;  4DPT A;  4DPW A;  2JE6 B;  4HXZ A;  5JEA E;  3HPS A;  2JPA A;  3F0N A;  1XMQ I;  5DRQ A;  4DV4 E;  4URL A;  1YSA C;  4JI3 I;  1MG7 A;  1QZR A;  4BC9 A;  5DNY A;  4RPF A;  1Z59 A;  1YH8 A;  4YY3 I;  3KWR A;  2EN2 A;  3UHM A;  4XTJ A;  1O0W A;  2NUE A;  4M30 A;  4DR5 E;  4ZVI A;  2BB8 A;  1YFH A;  1NHI A;  4M1K A;  2EQ0 A;  1B62 A;  3GLL A;  2NA2 A;  2YWQ A;  4N4R B;  2GLI A;  1NHH A;  3P3E A;  1B63 A;  1P42 A;  4LFA E;  4AIM A;  3ADI A;  2C38 B;  2V86 A;  3NZK A;  2M4I A;  4JI0 I;  2I13 A;  5JEA D;  5KL7 A;  4ZYH A;  2V83 A;  2DGC A;  4B3S E;  2V34 A;  4B3R I;  2UXC E;  4IZJ A;  5A2Q C;  4MU3 A;  2JY9 A;  5ELW A;  3OTO I;  5AC4 A;  1UBD C;  3IWD A;  4WPY A;  4LFB E;  1Y4S A;  4X64 I;  5C0X C;  2CZ9 A;  2EMY A;  3M7N G;  1KYQ A;  3RMP A;  4UT4 A;  2YT4 A;  3PYG A;  2V8Q B;  3MSW A;  1JK1 A;  1YUI A;  1KJK A;  4WUC A;  1NCS A;  1IQS A;  1X6H A;  2UUA E;  2AJ4 A;  1EH6 A;  3J7A M;  2WCC 3;  2C38 A;  4HYM A;  4F6M A;  1HNZ E;  1UHZ A;  1Z0B A;  2EFG A;  1A6F A;  2PNL A;  1Z0V A;  5FLX Q;  2CT1 A;  1GQE A;  4M9V C;  1RQ0 A;  4Q28 A;  1JK2 A;  1ZBQ A;  2EPO A;  2HKJ A;  2XEX A;  1WHQ A;  2EN6 A;  1A1L A;  4DV1 E;  1ZXN A;  4JI8 I;  4I8O A;  5BR8 I;  2EOY A;  3P06 A;  4PRV A;  3KZY A;  1YHC A;  1FKA E;  3J81 C;  2V88 A;  4GEQ B;  3CDI A;  2LMZ A;  2LJP A;  4QNK A;  1LLM C;  2EM8 A;  5K36 F;  2GPI A;  3PS2 A;  1PJT A;  2RSM A;  2A2D A;  4OX9 I;  2RSI A;  2NN6 B;  4X62 E;  3DJW A;  5IWA E;  2UXD E;  2DEI A;  1TF6 A;  4M2Z A;  2LUQ A;  1IBM E;  4DU8 A;  5KL2 A;  2L2K B;  1NEI A;  4DV5 E;  2EPZ A;  2OI2 A;  4DPX A;  4MU0 A;  4GQU A;  2R76 A;  4DPY A;  3J80 C;  4IZJ B;  3F6G A;  2H36 X;  4JI7 E;  1N33 E;  1UDQ A;  2PO0 B;  1N34 E;  4DR6 E;  2N3G A;  4BA2 A;  3BBG A;  5F3W A;  1WXR A;  1SFE A;  4JI6 E;  2EE8 A;  2YU5 A;  5K36 B;  3PYE A;  2UXB I;  4FW9 A;  1WUU A;  4HEI A;  2YTF A;  2MKD A;  2HHH E;  1Y5Y A;  4OO1 E;  1HNW I;  3WU6 A;  3VK6 A;  3JAM Q;  2CGE A;  1MEY C;  4DR2 I;  4FK5 C;  1T4N A;  2YSP A;  1DQ3 A;  2MC5 A;  2DLQ A;  1D6T A;  5JEA B;  4K0K I;  2HC5 A;  1E3H A;  3ADG A;  5A6B D;  2JEA A;  4F2J C;  4HTG A;  2GO4 A;  2UUC I;  4O5G A;  2WW4 A;  2PO2 A;  1XNR I;  5IV8 B;  4MLQ A;  5IXM B;  2WBS A;  1XNQ E;  4AID A;  5GMD A;  3PYF A;  4DV0 E;  4LCG A;  4OO1 B;  5ADZ A;  4KHP I;  1S16 A;  3PRY A;  4L8N A;  2LJH A;  4MYU A;  1J5E I;  4BHC A;  4YHH E;  4DR2 E;  2YTQ A;  1IBL E;  1U2R A;  5EKW A;  1N36 E;  5LLQ A;  1EH8 A;  3ZZT A;  2EPA A;  4NZV A;  1HNZ I;  3HTX A;  4DV3 I;  2O1W A;  1T4O A;  4ED4 A;  5C0X F;  4JI6 I;  3DF6 A;  3LML A;  2E1R A;  1YPN A;  2A25 A;  2YTJ A;  4BCA A;  2IES A;  4P7D A;  1TN9 A;  2GHF A;  4KZS A;  2Z5B A;  2YRK A;  2F8B A;  4O4K A;  2NUF A;  4X66 E;  4ISA A;  4MU4 A;  1Z0W A;  2B9D A;  4DV5 I;  2EJ4 A;  2Q8U A;  1FWK A;  2EP3 A;  4RH8 A;  3CWV A;  1IBM I;  1Y6Z A;  4OO1 F;  4J3D A;  3OTO E;  4LU9 A;  4DR3 I;  4DR1 E;  1EA6 A;  2L3J A;  4DUY E;  2ENA A;  4IFD A;  3HJC A;  4LF8 E;  1EH7 A;  2Z5C B;  3HUL A;  3J81 Q;  4WSG A;  3F6H A;  3C6M A;  5KL3 A;  1P47 A;  1N0V C;  2EMK A;  4IFD C;  1EI1 A;  1FJG I;  2O1T A;  2PO1 B;  3ZKB A;  3DD6 A;  5A6B A;  2PNZ B;  4DPU A;  2UU9 I;  5A6J A;  2V85 A;  4JI8 E;  5A6K A;  1KTV A;  1N0U A;  5DRP A;  1MGT A;  2FGG A;  2EOQ A;  1F2I G;  3ZOQ B;  1N33 I;  5K36 C;  1Y60 A;  2L6M A;  5A6A A;  1NZ0 A;  3J80 Q;  3HPZ A;  1ZR9 A;  2BA1 D;  2HGH A;  3PS3 A;  4R2E A;  2Z5C A;  2EPL X;  1VI7 A;  2V87 A;  2EPM X;  2EQ3 A;  4DV4 I;  4O24 A;  2F4V E;  2RS7 A;  4X65 I;  4R03 A;  4KHP E;  1A1I A;  5KL5 A;  1XMQ E;  2UUB E;  4MU1 A;  1Z5B A;  1BB8 A;  2DMI A;  2WNR B;  2JWO A;  4DR3 E;  1GTK A;  1J5E E;  4B3M E;  4GKK E;  2L2M A;  4WXC A;  2EPK X;  5BR8 E;  3LTO A;  3WU4 A;  1DI2 A;  4U3B A;  2HJJ A;  2EM2 A;  3ZZU A;  5AE1 A;  5IT9 Q;  3PYD A;  3H4L A;  1RC7 A;  1XHK A;  2UUC E;  1XNR E;  1T38 A;  5KL4 A;  1IQO A;  3P3C A;  3L7Z B;  2LJU A;  2ENH A;  5EL9 A;  1KKH A;  4F9C B;  4HAC B;  4HY1 A;  5LMN I;  4F9A B;  1Z0C A;  4YHH I;  1USV A;  2VQF E;  2HHH I;  2R1F A;  2EOM A;  1ZM4 A;  2EMF A;  2UXB E;  3M99 B;  5K36 E;  2EL4 A;  5C0X A;  4LF9 I;  2WBU A;  4X64 E;  3T1Y E;  1WJP A;  3MHH C;  2ZIT A;  2BA0 D;  3ECR A;  3J7A G;  1H7S A;  5JEA C;  2JEA B;  1FJG E;  2VES A;  2JR1 A;  4FWH A;  2VQF I;  1Z0T A;  2YZT A;  2E1M A;  2B3T B; 
#chains in the Genus database with same CATH homology
 2FV4 B;  2X7I A;  2UXD I;  4X8W A;  4FN5 A;  3LLH A;  3M6A A;  4R1F A;  4B3R E;  4JI5 I;  4DR1 I;  2MDR A;  4TUG A;  4DKK A;  4DR5 I;  1GZ6 A;  4J8Z A;  4USM A;  3JU0 A;  4Z7Y A;  4B3M I;  4GKK I;  2B7V A;  5LMU E;  5AE2 A;  3VYY A;  2Q2E B;  1HR0 E;  3C4T A;  3T1H E;  4LTY A;  1KVK A;  1MX0 A;  1EKZ A;  4FWD A;  2EWL A;  1YYO A;  2WZO A;  4NXN I;  1XNQ I;  3IWB A;  2UUA I;  3LPS A;  2CPN A;  1YZ9 A;  4PU9 A;  1KIJ A;  2HK3 A;  5AE3 A;  1HNX I;  1K47 A;  4P52 A;  2RTX A;  1ZM2 A;  1ZM9 A;  2VF1 A;  4LFA I;  4USK A;  1ZBT A;  4R8O A;  5FWK A;  4X65 E;  3JAM C;  1IBK I;  3K6Q A;  2F4V I;  1USU A;  4P7A A;  2V2Z A;  2N3H A;  1Z5C A;  4X66 I;  1T4L B;  4JI7 I;  1ZXM A;  2PNM A;  1Z5A A;  3T1Y I;  2X36 A;  1XMO E;  5CFF E;  2M7Q A;  4X62 I;  2K4V A;  3V2U C;  4JI1 I;  2UXC I;  1IBL I;  2L3C A;  5LMN E;  2KON A;  4DU7 A;  2VQE I;  1Z0E A;  3B82 A;  1H74 A;  2DMY A;  4DR4 E;  2VQE E;  4UTG A;  1X49 A;  1BKN A;  2CG9 A;  4N3O A;  3ZKD A;  4DV6 E;  4WUB A;  2J7K A;  3K1J A;  2FTX B;  4LF4 I;  1I94 I;  1HK7 A;  4DV7 I;  2M1S A;  3Q1Q A;  2LTS A;  4JYA I;  3QT5 A;  2UUB I;  2LBS B;  2IOP A;  4LF4 E;  4LF5 I;  3ADL A;  2ZBK B;  1SR9 A;  3Q6N A;  2IOQ A;  3D4J A;  3HQ1 A;  5A2Q Q;  4LF7 I;  1Z0G A;  4NXM I;  4P78 A;  2JVA A;  3QT6 A;  2UU9 E;  1UEK A;  4I3H A;  2B7T A;  2O1U A;  3AV0 A;  4K0K E;  3ZM7 A;  2A2C A;  2DB2 A;  3K85 A;  1Y4U A;  4WSP A;  3C4B A;  1H72 C;  1YYW A;  2L33 A;  4LF7 E;  2NUG A;  3VYX A;  3T1H I;  5FLX C;  1FNM A;  2KHX A;  2V2V A;  1HR0 I;  1OJ4 A;  3P1X A;  1IBK E;  1DAR A;  1UIL A;  1N34 I;  2KOU A;  2LTR A;  4JI2 I;  4DR6 I;  4BMJ A;  4IZJ D;  4DUZ I;  4AQY I;  2HFS A;  3B8H A;  4JI3 E;  4F9B B;  4DV3 E;  2LE2 A;  2R3V A;  2ODR D;  1I94 E;  5IWA I;  1YYK A;  1N36 I;  4KQV A;  4LFC E;  4JI4 E;  4JI5 E;  2R42 A;  1X47 A;  2O1V A;  2G7H A;  3V5R A;  4JV5 E;  2LUP B;  1PIE A;  5L3J A;  1WHN A;  4OOG C;  4BBY A;  4DMI A;  2MC6 A;  2LRS A;  4B3S I;  1ZM3 A;  2Z5E A;  2Z5B B;  2L92 A;  3WU3 A;  2E5L I;  4WYQ B;  4LF6 I;  1PKP A;  2V2Q A;  3AUZ A;  4L5N C;  1STU A;  4HAC A;  4LF5 E;  4LF6 E;  2JOX A;  3OML A;  3B78 A;  2VF3 A;  4DXL A;  4MYT A;  3K17 A;  4GKJ I;  4DV7 E;  1X48 A;  4GKJ E;  4NXM E;  3WU5 A;  1HNX E;  3QT8 A;  2JOB A;  4BC7 A;  1J26 A;  1MU5 A;  2NPF A;  2BM0 A;  2V8P A;  4JV5 I;  4F54 A;  4TUI A;  1S4E A;  4Z7C A;  2ZM6 I;  4JI4 I;  1NHJ A;  1N32 I;  4LFC I;  4DR7 I;  2GS8 A;  2BV3 A;  2L2N A;  4M0V A;  4IZK A;  2L8T A;  4YY3 E;  1FI4 A;  4DV6 I;  1VIS A;  4DUZ E;  2BM1 A;  1H73 A;  2ZM6 E;  1N32 E;  2GQ0 A;  1QU6 A;  2IHR 1;  2DEJ A;  4FWG A;  2DSY A;  1RRE A;  2RS6 A;  4B3T I;  1HNW E;  5IT9 C;  4LF8 I;  4DR4 I;  4DUY I;  2ODR C;  4DV2 I;  2HK2 A;  4LFB I;  2DIX A;  3GON A;  3QT7 A;  1XMO I;  4WFT A;  2HKE A;  4DV2 E;  4JI1 E;  2EZ6 A;  4AQY E;  3IWC A;  4JI2 E;  5GME A;  4JI0 E;  4B3T E;  4LF9 E;  4NXN E;  3ADJ A;  4WUD A;  1RR9 A;  2HFU A;  2E5L E;  1ELO A;  4OX9 E;  3ZZ0 A;  2V89 A;  4EMD A;  3H09 A;  5LMU I;  4BS9 A;  1H7U A;  1PVG A;  4DV0 I;  3JTZ A;  3HXL A;  4JYA E;  3J7Y p;  1FWL A;  4DR7 E;  5AAS A;  4JG4 A;  4DV1 I;  2VE7 C;  3FIG A;  4IZK B;  5T6J A;  5LL6 R;  3Q6M A;  4PRX A;  4DPT A;  3LNU A;  4DPW A;  4HXZ A;  3HPS A;  3F0N A;  1XMQ I;  4DV4 E;  4URL A;  4JI3 I;  1MG7 A;  1QZR A;  4BC9 A;  5DNY A;  4RPF A;  1Z59 A;  4YY3 I;  3KWR A;  4XTJ A;  1O0W A;  2NUE A;  4M30 A;  4DR5 E;  4ZVI A;  1NHI A;  4M1K A;  1B62 A;  2NA2 A;  1NHH A;  1B63 A;  4LFA E;  3ADI A;  2V86 A;  2M4I A;  4JI0 I;  2V34 A;  2V83 A;  4B3S E;  4B3R I;  2UXC E;  4IZJ A;  5A2Q C;  2JY9 A;  3OTO I;  3IWD A;  4WPY A;  4LFB E;  1Y4S A;  4X64 I;  2CZ9 A;  3RMP A;  4UT4 A;  2YT4 A;  3PYG A;  2V8Q B;  3MSW A;  4WUC A;  2UUA E;  2AJ4 A;  3J7A M;  4HYM A;  1HNZ E;  1UHZ A;  1Z0B A;  2EFG A;  1A6F A;  2PNL A;  1Z0V A;  5FLX Q;  1GQE A;  1RQ0 A;  4Q28 A;  1ZBQ A;  2HKJ A;  2XEX A;  1WHQ A;  1ZXN A;  4JI8 I;  4DV1 E;  5BR8 I;  4I8O A;  3P06 A;  4PRV A;  1FKA E;  3J81 C;  2V88 A;  4GEQ B;  2LMZ A;  2LJP A;  4OX9 I;  2RSM A;  2A2D A;  4X62 E;  3DJW A;  5IWA E;  2UXD E;  2DEI A;  4M2Z A;  2LUQ A;  1IBM E;  4DU8 A;  2L2K B;  4DV5 E;  4DPX A;  2OI2 A;  4DPY A;  3J80 C;  4IZJ B;  3F6G A;  2H36 X;  4JI7 E;  1N33 E;  1N34 E;  4DR6 E;  2N3G A;  5F3W A;  1WXR A;  4JI6 E;  3PYE A;  2UXB I;  4FW9 A;  1WUU A;  2HHH E;  1HNW I;  3WU6 A;  3VK6 A;  3JAM Q;  2CGE A;  4DR2 I;  1T4N A;  1DQ3 A;  2MC5 A;  1D6T A;  4K0K I;  3ADG A;  1XNR I;  2UUC I;  2WW4 A;  1XNQ E;  5GMD A;  3PYF A;  4DV0 E;  5ADZ A;  4KHP I;  1S16 A;  3PRY A;  4L8N A;  2LJH A;  4MYU A;  1J5E I;  4DR2 E;  4YHH E;  1IBL E;  1U2R A;  1N36 E;  3ZZT A;  1HNZ I;  3HTX A;  4DV3 I;  2O1W A;  1T4O A;  4ED4 A;  4JI6 I;  3DF6 A;  3LML A;  2E1R A;  4BCA A;  4P7D A;  4KZS A;  2Z5B A;  2F8B A;  2NUF A;  4X66 E;  1Z0W A;  2B9D A;  4DV5 I;  1FWK A;  3CWV A;  1IBM I;  1Y6Z A;  3OTO E;  4LU9 A;  4DR3 I;  4DR1 E;  1EA6 A;  2L3J A;  4DUY E;  3HJC A;  4LF8 E;  2Z5C B;  3HUL A;  3J81 Q;  3F6H A;  1N0V C;  1EI1 A;  1FJG I;  2O1T A;  3ZKB A;  4DPU A;  2UU9 I;  2V85 A;  4JI8 E;  1KTV A;  1N0U A;  2FGG A;  3ZOQ B;  1N33 I;  2L6M A;  1NZ0 A;  3J80 Q;  3HPZ A;  2Z5C A;  2V87 A;  4DV4 I;  2F4V E;  2RS7 A;  4X65 I;  4R03 A;  4KHP E;  1XMQ E;  2UUB E;  1Z5B A;  2JWO A;  4DR3 E;  1J5E E;  4B3M E;  4GKK E;  2L2M A;  3LTO A;  5BR8 E;  3WU4 A;  1DI2 A;  3ZZU A;  5AE1 A;  5IT9 Q;  3PYD A;  3H4L A;  1RC7 A;  1XHK A;  2UUC E;  1XNR E;  1KKH A;  4F9C B;  4HAC B;  4HY1 A;  5LMN I;  4F9A B;  1Z0C A;  4YHH I;  1USV A;  2VQF E;  2HHH I;  1ZM4 A;  2UXB E;  4LF9 I;  4X64 E;  3T1Y E;  2ZIT A;  3J7A G;  1H7S A;  1FJG E;  2JR1 A;  4FWH A;  2VQF I;  1Z0T A;  2YZT A;  2E1M A;  2B3T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...