4DR7E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr7E02
2LUQA 1N33E 4KHPI 1N34I 1IBLI 3LLHA 4LF5I 1T4OA 4NXNE 2MDRA 4LF9I 3V5RA 2NPFA 4X62E 1FJGE 4JYAE 1N36I 2UUBE 2VQFE 1MG7A 4JI1E 1EA6A 2BV3A 4R1FA 1XNRE 4KQVA 2HK2A 4ZVIA 1IBKI 3PYDA 1Z5BA 2LUPB 4P52A 4DUZI 1N32E 1HNXI 4DV5I 4URLA 2HKJA 3J7AG 2RTXA 3ADIA 1FWKA 2V2QA 4DR7I 4LFBI 1ELOA 2N3GA 5FLXQ 4DV1I 1FI4A 2E1RA 3GONA 2LBSB 1MX0A 4PRXA 4B3TI 1Z5AA 1EI1A 2ZM6E 4Z7YA 1RQ0A 4DPXA 4HXZA 2EZ6A 4GKJI 1ZM9A 1B62A 4LF8E 1ZXMA 2UXDI 4X66E 1YYKA 4LFAE 4X65E 1Z0TA 2BM0A 1HNWE 4DV3I 1QU6A 4DR1E 4DV7E 4WUCA 2V2VA 4B3MI 3J80C 4DPTA 4JI7E 2LTRA 4LF7E 1XMOE 4DPUA 3WU3A 4OX9I 1PVGA 4P7AA 4GKKI 3C4BA 2YT4A 2NUEA 4JV5E 1WUUA 2L2NA 1MU5A 2HKEA 1RREA 3F0NA 4YY3I 2UXCI 4DR2I 2UU9I 1FNMA 5IWAE 1XMQI 2B3TB 2UUAE 2L2MA 2R42A 5GMDA 3Q1QA 2HFUA 4DU8A 4XTJA 2ZBKB 1O0WA 5IT9Q 3PYGA 2EFGA 3ADLA 4JI5E 4JI6I 1J26A 2HHHE 4LF6I 3C4TA 4USMA 5A2QC 4DUYI 1S4EA 4FWDA 4DR6E 1J5EI 4NXMI 4LF4E 5LMUI 1EKZA 5BR8E 4DKKA 4HACB 4WYQB 1S16A 4HY1A 2UUCE 2ZITA 1HNZI 5LMNI 3ZM7A 5GMEA 4DV6E 2E5LI 1UEKA 3ZKBA 1I94E 1GQEA 4DR4E 2KHXA 4HYMA 2LJPA 2CZ9A 1KKHA 1IBME 4JI2I 4X64I 4RPFA 4MYUA 1PIEA 4JI8E 3WU4A 2DEIA 2F4VI 4DPYA 4LFCE 2L33A 1Z0EA 1XNQI 2RS7A 2V8PA 2X36A 4YHHI 2L3JA 2XEXA 4DV4I 4KHPE 5LL6R 1N34E 1IBLE 4LF5E 3J7AM 3B78A 2DB2A 2DMYA 1Z0VA 4WUDA 4LF9E 4WUBA 3V2UC 4HACA 4DPWA 4Z7CA 1T4NA 2IHR1 1N36E 2HFSA 1Z0GA 4DR3I 1Z0BA 4JI4I 1X49A 3ADGA 1WHQA 1IBKE 2B7TA 2NUGA 3WU6A 4JI0I 1HR0I 4K0KI 2OI2A 4DUZE 3P1XA 1ZM3A 3QT6A 2VQEI 4JI3E 1HNXE 1BKNA 1X48A 3T1YI 4DV5E 4B3RI 2L2KB 2L3CA 3WU5A 2LJHA 4LFBE 4DR7E 2VF3A 4UTGA 4DV1E 2UXBI 2RS6A 4FWGA 3CWVA 1YYOA 5FLXC 4PU9A 1Z59A 3J81C 3OTOI 4B3TE 4DV0I 3T1HI 1NHHA 4GKJE 3ZZUA 4DV2I 2UXDE 2N3HA 1DI2A 1QZRA 5CFFE 2R3VA 4DV3E 3ZKDA 1KIJA 4B3SI 1RR9A 4DR5I 2A2DA 4B3ME 2DEJA 4PRVA 1N33I 1UILA 1FKAE 4NXNI 4OX9E 4GKKE 2WW4A 2LTSA 3D4JA 1K47A 1H72C 4FW9A 4YY3E 4X62I 1Z5CA 2UXCE 4DR2E 2UU9E 4JYAI 1FJGI 1NHJA 1Z0WA 3M6AA 2UUBI 4M2ZA 1XMQE 2VQFI 4JI1I 3H4LA 1H7UA 1XNRI 4MYTA 4AQYE 1YYWA 3HULA 4JI6E 3K17A 1UHZA 4DXLA 4LF6E 1N32I 4USKA 5IT9C 4DUYE 4ED4A 1OJ4A 2Q2EB 1J5EE 4NXME 1A6FA 5LMUE 3ZZ0A 2NA2A 3JAMC 4JG4A 2RSMA 1NHIA 1HNZE 5LMNE 2CPNA 2E5LE 1H73A 5L3JA 2ZM6I 3ZZTA 4WFTA 2NUFA 4LF8I 4X66I 4LFAI 2BM1A 3B82A 4X65I 3J80Q 4JI3I 1HNWI 4JI2E 1D6TA 4X64E 4DR1I 1N0UA 4DV7I 4EMDA 2F4VE 1KVKA 1ZBTA 1B63A 4UT4A 4JI7I 2B7VA 4LF7I 1FWLA 1XMOI 2V34A 3J81Q 1X47A 1XNQE 3QT5A 4JV5I 1XHKA 4FWHA 4YHHE 1H74A 4DV4E 1DARA 5IWAI 2UUAI 2LRSA 1Z0CA 5A2QQ 1YZ9A 3K1JA 4JI5I 2GS8A 2HHHI 4DR3E 4M1KA 2JVAA 3ADJA 4JI4E 3J7Yp 3VYXA 4X8WA 4JI0E 3QT8A 1HR0E 2AJ4A 4K0KE 4DR6I 2X7IA 3VYYA 3PYFA 2J7KA 2VQEE 4LF4I 5BR8I 3T1YE 1U2RA 4B3RE 2UUCI 3LPSA 4DV6I 1NZ0A 2DIXA 4OOGC 2UXBE 3HTXA 4DU7A 1I94I 4AQYI 4DR4I 1ZXNA 3B8HA 3PYEA 2HK3A 1ZM2A 1N0VC 1WHNA 1T4LB 4FN5A 3OTOE 1IBMI 4DV0E 1PKPA 3T1HE 3LNUA 1KTVA 3QT7A 1H7SA 4JI8I 3JAMQ 4DV2E 1RC7A 4I3HA 2JY9A 1STUA 4LFCI 4M30A 3LTOA 1ZM4A 1VISA 4B3SE 2V2ZA 2A2CA 4DR5E
chains in the Genus database with same CATH superfamily
1PDAA 4BBYA 5AE1A 2LUQA 5JEAF 1N33E 4KHPI 4F9CB 1N34I 2N8XA 1IQSA 2CT1A 3LLHA 3GMEA 2EMCA 1IBLI 4LF5I 1TF3A 1T4OA 4IFDF 4NXNE 2LMZA 1BBOA 2C37A 2EM6A 2MDRA 4Q28A 3K85A 4LF9I 2JP9A 3V5RA 1G2DC 2NPFA 4TUIA 4X62E 3PS3A 1L4SA 1FJGE 4JYAE 2JEBB 1N36I 2UUBE 4LCGA 2Z5EA 2DSYA 2VQFE 2PO0A 2K7IA 2YTEA 3PRYA 1MG7A 4JI1E 1DQ3A 1EA6A 1MEYC 2BV3A 4R1FA 1XNRE 4IZJB 4KQVA 2YTGA 2EP3A 2HK2A 4ZVIA 3B4TA 1IBKI 2MKNA 2WZOA 1PJSA 3THOB 2EOXA 3PYDA 4MU0A 1Z5BA 4R2DA 4WSPA 2LUPB 4P52A 2G7HA 4ZYHA 2V8QB 4ISAA 5JEAB 4DUZI 1YUJA 2A25A 4ZYEA 5DNYA 1N32E 4R2QA 1HNXI 2YWQA 4WXDA 5K36C 4IFDB 4DV5I 1TF6A 2EL5A 4URLA 4BA1A 5A6JA 2F1DA 5KL2A 3HJCA 2HKJA 2WP8B 4BCAA 2RTXA 2EOQA 1X3CA 3ADIA 3J7AG 2AE8A 1FWKA 2V2QA 3U1YA 4DR7I 1ELOA 4LFBI 2PO1A 2N3GA 5KL4A 5FLXQ 4DMIA 2CTDA 2V86A 4QNKA 4DV1I 2JE6A 2EOFA 2NN6C 1FI4A 2E1RA 3GONA 2LBSB 3BBGA 2BA0D 2PNLA 1MX0A 2LE2A 4PRXA 2EMIA 3PS2A 4LOMA 4WPYA 2EOJA 2ELZA 2GHFA 2Q8UA 4B3TI 2JEAB 1Z5AA 3LMLA 3KZYA 2YRMA 4IZKB 3IWDA 2ZM6E 2YTDA 1RQ0A 3IWCA 1EI1A 2EZ6A 4HXZA 4Z7YA 2LCEA 3UHMA 3ZOQB 1ZM9A 4GKJI 1B62A 4R2SA 1HK7A 4LF8E 2VESA 5AE3A 1OYPA 4HTGA 2LVHA 1LLMC 1ZXMA 4X66E 2UXDI 2E1MA 4L5NC 1YYKA 4F9BB 2EMWA 2LO3A 4LFAE 2NN6E 4X65E 1Z0TA 2BM0A 1HNWE 1VI7A 4WSGA 2FV4B 4N3OA 1ZBQA 2JEBA 2PNZB 1QU6A 4O24A 4DV3I 4DR1E 1UDSA 2HGHA 4DV7E 2D9HA 4WUCA 2V2VA 5ADZA 2V89A 4AIDA 2NN6F 3J80C 4IZJA 4DPTA 1EH6A 4B3MI 3M99B 4JI7E 3KWRA 2EOIA 2GPIA 2LTRA 1Z1BA 1A1KA 4LF7E 4IZJD 1XMOE 4DPUA 3WU3A 1GTKA 4OX9I 1PVGA 4P7AA 2FTXB 4GKKI 3EPLA 3C4BA 2YT4A 2NUEA 4JV5E 1WUUA 5JEAA 1F2IG 2IOPA 2L2NA 1MU5A 2EQ0A 1Y4UA 2CVEA 2HKEA 1RREA 3F0NA 3BF2A 4YY3I 4IFDA 4F9AB 5JEAD 2UXCI 4DR2I 2UU9I 2EPMX 1FNMA 5IWAE 2BB8A 4FW3A 1XMQI 2YTFA 4NBQA 4IFDD 2B3TB 2EN7A 2RPCA 2EMGA 1PJTA 4L8NA 4R8OA 2UUAE 2L2MA 2IERA 2R42A 5AASA 5GMDA 1BBGA 3Q1QA 2HFUA 4DU8A 1A1HA 4XTJA 2ZBKB 1O0WA 2EM5A 4WXCA 5IT9Q 2Z5BB 3PYGA 2JYAA 2EFGA 3ADLA 2EMBA 4JI5E 2NN6B 4JI6I 5T6JA 2HHHE 1J26A 2WBUA 4LF6I 1WJPA 4BS9A 2EPOA 3C4TA 4USMA 2M4IA 2I9IA 2YZTA 3BIDA 5A2QC 3RMPA 2JEAA 2L8TA 4IZKA 2EORA 1RMDA 2EMZA 3THNA 4J8ZA 2L92A 4DUYI 1S4EA 2O3ZA 4FWDA 3ECRA 2EMLA 2EMXA 4DR6E 1J5EI 4NXMI 4LF4E 5LMUI 2EMYA 1EKZA 5BR8E 4DKKA 4HACB 4O43A 5A6BA 1USVA 2EL6A 4WYQB 1S16A 2EN8A 2R1FA 3HQ1A 2IOQA 4MU1A 4HY1A 2PNZA 4AM3A 2UUCE 4GQUA 2HJJA 2ZITA 3HXLA 2EPNA 4TUGA 4R2EA 1HNZI 5A6BD 3M7ND 5C0XC 5LMNI 2DLKA 4R03A 5LLQA 5GMEA 3ZM7A 5IV8B 4DV6E 2E5LI 3IWBA 2EOEA 3VHTB 1A1LA 3HPSA 3VK6A 1Y4SA 1UEKA 3ZKBA 1I94E 3OMLA 3DF6A 4R2CA 1GQEA 3HKMA 4DR4E 2KHXA 2R76A 5ELWA 4IS9A 4HYMA 2LJPA 2CZ9A 1KKHA 2CSHA 1IBME 4JI2I 2JR1A 4X64I 2KOUA 2ENAA 4MYUA 3MHSC 4RPFA 1PIEA 4JI8E 5KL3A 3WU4A 1WRJA 2EQ1A 2O1TA 2Z5BA 5C0XE 2DEIA 2F4VI 2ENCA 4DPYA 3F6GA 4LFCE 2GLIA 2EMFA 2L33A 2EPAA 1Z0EA 2EQ3A 4U3DA 5C0XF 2NN6A 1XNQI 2RS7A 5AC5A 2WBSA 4NHRA 4BHCA 2V8PA 2X36A 4YHHI 2VE7C 2EN1A 2NN6D 1B69A 5TSEA 2L3JA 2XEXA 4DV4I 2ELYA 5LL6R 4KHPE 2V88A 1N34E 1IBLE 4LF5E 4LTYA 2H36X 1UDNA 3J7AM 2BR2B 3B78A 2DB2A 2DMYA 1Z0VA 4J3DA 4WUDA 4LF9E 2GQ0A 4WUBA 3V2UC 4HACA 4DPWA 4AIMA 4Z7CA 1T4NA 2IHR1 1N36E 2HFSA 3H1CA 5K36E 1XXEA 1Z0GA 4P7DA 4DR3I 1G2FC 2BA1D 2VF1A 1Z0BA 4JI4I 1X49A 3ADGA 1WHQA 2EOSA 1IBKE 2B7TA 2YTQA 4NZVA 2NUGA 5C0XB 2DMIA 3WU6A 1X6HA 4JI0I 5K36F 3JU0A 1HR0I 1N3GA 4KZSA 4K0KI 2OI2A 2ODRC 2GO3A 2JT2A 4F6MA 2EL4A 4DUZE 2EN4A 3P1XA 1ZM3A 3QT6A 2KONA 2YRKA 4JI3E 2VQEI 1HNXE 1BKNA 2PRTA 1X48A 3T1YI 4DV5E 4R2AA 2C38A 4B3RI 2L2KB 3CDIA 2L3CA 2L6MA 3WU5A 2E72A 4F54A 2FGGA 2PO2B 3GCMA 2C39B 4BC9A 2LJHA 1AAYA 4LFBE 4DR7E 2CGEA 2CG9A 2VF3A 2Z5CB 4UTGA 3EPKA 3C6MA 4ZYDA 5DRQA 3MSWA 2O1WA 1ZR9A 4DV1E 4OKGA 2UXBI 2RS6A 5IXMB 4FWGA 3UK3C 2EWLA 3CWVA 2WBTA 2EM3A 1YYOA 2EMAA 2EMKA 3KRNA 3L7ZB 5FLXC 4Q35B 1NCSA 4X9JA 4PU9A 1Z59A 5K36B 2EPLX 3J81C 2EE8A 1YHCA 4B3TE 3OTOI 3GLLA 4DV0I 1EH8A 1NHHA 3T1HI 4M0VA 2BA0G 4GKJE 3ZZUA 1YUIA 1NEIA 4OO1C 2EN2A 2BR2A 2V83A 1KYQA 5EKWA 2BA1G 4DV2I 2UXDE 2N3HA 1DI2A 4BHBA 1UDOA 1QZRA 2WNRB 5CFFE 2R3VA 4MU3A 4DV3E 2EPZA 4MQYA 3ZKDA 2EOZA 5A69A 3TQMA 3F6HA 3MHHC 5F3WA 1YSAC 1KIJA 4B3SI 1RR9A 4DR5I 2A2DA 4B3ME 1YFHA 1DGCA 4BC7A 2DEJA 5C0XA 4PRVA 2YTOA 1N33I 2EPUA 1UILA 3HPZA 4QNJA 4GZNC 1FKAE 4U3BA 2EM8A 1IQOA 4OO1E 2EM4A 4NXNI 5C0XD 4OX9E 2BBGA 4GKKE 2WW4A 3M85D 2LTSA 3Q6NA 4O5GA 3D4JA 1K47A 4FW6A 2EPRA 4FK5C 1H72C 4IFDC 4FW9A 4R2PA 4YY3E 1YH8A 1Z5CA 4X62I 4OO1F 2UXCE 4DR2E 2UU9E 4JYAI 1FJGI 1Y5YA 1NHJA 1Z0WA 3M6AA 2UUBI 5AC4A 4N4RB 1XMQE 4M2ZA 2VQFI 2PO2A 2C39A 4JI1I 3H4LA 5KL7A 2MDGA 1H7UA 4MYTA 2EN3A 5FWKA 2Z5CA 1XNRI 4R2RA 4BA2B 2EOMA 2V85A 4AQYE 2GO4A 1YYWA 2EMHA 3HULA 3K6QA 5DRRA 4JI6E 2B9DA 3K17A 1UHZA 3KZZA 1ZAAC 4FW4A 4DXLA 3L7ZA 4LF6E 2LV2A 1N32I 2C38B 1UDQA 4USKA 5K36A 5IT9C 4KWYA 1ZU1A 3C6KA 3NZKA 2NABA 1KJKA 2PNMA 5K36D 4DUYE 4ED4A 1OJ4A 2JPAA 3L00A 2Q2EB 2K4VA 1J5EE 4OO1B 4NXME 1JK1A 5DROA 1A6FA 5LMUE 4OZEA 3ZZ0A 2RQLA 2NA2A 3JAMC 3P3CA 4JG4A 2WNRA 2RSMA 1X6EA 3AUZA 3U1KA 3JTZA 2M1SA 1NHIA 1SR9A 2J65A 3CDJA 3PS1A 1HNZE 3M85G 4O4KA 2YTNA 5LMNE 3EPJA 2DLQA 1R6MA 4MDTA 4P78A 2CPNA 2E5LE 1H73A 2J7JA 5L3JA 2ZM6I 4MLVA 3ZZTA 4WFTA 1P42A 2NUFA 3M7NG 2HC5A 4LF8I 2MC5A 4X66I 1A1GA 4LFAI 4RH8A 1UN6B 2BM1A 3B82A 4X65I 3J80Q 4JI3I 1HNWI 4JI2E 3EPHA 1D6TA 1R6LA 2MKDA 3AV0A 4X64E 3H09A 2MC6A 2ODRD 2EPXA 4DR1I 2YPNA 4FW5A 2YTPA 2V87A 1N0UA 1BB8A 4DV7I 4MLQA 4EMDA 2EJ4A 1MGTA 2F4VE 2YSPA 1KVKA 1ZBTA 1B63A 4UT4A 1T39A 4BA2A 4JI7I 1UBDC 2B7VA 1PJQA 3P3EA 4MU4A 4LF7I 1FWLA 1XMOI 2V34A 1Y60A 1X47A 3J81Q 1XNQE 3FIGA 5A6AA 3QT5A 4JV5I 1P47A 2EM0A 1XHKA 1A1IA 4YHHE 1H74A 2I13A 4RHBB 4FWHA 2ADRA 4DV4E 3DD6A 4LCHA 2JXPA 4ZYGA 1DARA 5IWAI 2YTIA 1OYRA 2UUAI 2LRSA 4HEIA 4OO1A 4F2JC 2RSIA 2JOXA 2EM2A 2YTJA 1Z0CA 5A2QQ 1YZ9A 4OO1D 1RHYA 3K1JA 1GZ6A 4I8OA 4JI5I 3P06A 4F6NA 2GS8A 2EOYA 1OYSA 1YPNA 2HHHI 5AE2A 1A1JA 4WX9A 4DR3E 2JWOA 4LPFA 4M1KA 2JVAA 3ADJA 4JI4E 3J7Yp 4LCFA 2F8BA 3VYXA 2YU8A 4X8WA 4JI0E 2LJUA 3QT8A 4FW7A 1HR0E 1IMUA 2EPKX 4LU9A 2DRPA 2AJ4A 4K0KE 2EM7A 4DR6I 2X7IA 2VRDA 5A6KA 3VYYA 2C37B 3PYFA 3EQ1A 1SFEA 2EPPA 2VQEE 1E3HA 2J7KA 4LF4I 3BGHA 1X6FA 5BR8I 1Y6ZA 4M9VC 2YSOA 3T1YE 1E3PA 1U2RA 4B3RE 1JK2A 2LT7A 1QNTA 5KL6A 2UUCI 3P76A 2EOOA 2PO0B 1TN9A 2EM9A 3LPSA 2M7QA 1EH7A 2WP8A 3P3GA 4DV6I 1NZ0A 2O1VA 5DNLA 2YU5A 2DIXA 4OOGC 2UXBE 5EL9A 3HTXA 2M9AA 5KL5A 2IESA 4DU7A 5JEAC 4GEQB 4AQYI 2EPCA 1I94I 4DR4I 4BMJA 1ZXNA 3DJWA 3B8HA 2EN6A 3PYEA 2HK3A 1ZM2A 1N0VC 2O1UA 5DNXA 5DRPA 1AH5A 1WHNA 4IJDA 1T4LB 4FN5A 3OTOE 1IBMI 4DV0E 1PKPA 3T1HE 3LNUA 1KTVA 4BA1B 2ENHA 3QT7A 2DGCA 1H7SA 4JI8I 3JAMQ 1USUA 2WCC3 2YRHA 2PO1B 1T38A 4DV2E 1RC7A 4I3HA 2JY9A 3Q6MA 1STUA 1X5WA 4LFCI 2EOHA 4DPXA 2JE6B 4IS1C 4M30A 3QG5C 1WXRA 3LTOA 5JEAE 2JOBA 1ZM4A 1VISA 4IFDE 4B3SE 1A1FA 2V2ZA 2A2CA 4DR5E
chains in the Genus database with same CATH topology
4BBYA 5AE1A 2LUQA 1N33E 4KHPI 4F9CB 1N34I 1IBLI 3LLHA 4LF5I 1T4OA 4NXNE 2LMZA 2MDRA 4Q28A 3K85A 4LF9I 3V5RA 2NPFA 4TUIA 4X62E 1FJGE 4JYAE 1N36I 2UUBE 2Z5EA 2DSYA 2VQFE 3PRYA 1MG7A 4JI1E 1DQ3A 1EA6A 2BV3A 4R1FA 1XNRE 4IZJB 4KQVA 2HK2A 4ZVIA 1IBKI 2WZOA 3PYDA 1Z5BA 4WSPA 2LUPB 4P52A 2G7HA 4DUZI 2V8QB 5DNYA 1N32E 1HNXI 4DV5I 4URLA 3HJCA 2HKJA 3Q6NA 4BCAA 2RTXA 3J7AG 3ADIA 1FWKA 2V2QA 4DR7I 4LFBI 1ELOA 2N3GA 5FLXQ 4DMIA 2V86A 4DV1I 1FI4A 2E1RA 3GONA 2LBSB 2PNLA 1MX0A 2LE2A 4PRXA 4WPYA 4B3TI 1Z5AA 3LMLA 4IZKB 3IWDA 2ZM6E 1EI1A 1RQ0A 3IWCA 4HXZA 2EZ6A 4Z7YA 4DPXA 4GKJI 3ZOQB 1ZM9A 1B62A 1HK7A 4LF8E 5AE3A 1ZXMA 2UXDI 4X66E 2E1MA 4L5NC 1YYKA 4F9BB 4LFAE 4X65E 1Z0TA 2BM0A 1HNWE 2FV4B 4N3OA 1ZBQA 4DV3I 1QU6A 4DR1E 4DV7E 4WUCA 2V2VA 5ADZA 2V89A 4B3MI 4IZJA 3J80C 4DPTA 4JI7E 3KWRA 2LTRA 4LF7E 4IZJD 1XMOE 4DPUA 3WU3A 4OX9I 1PVGA 4P7AA 2FTXB 4GKKI 3C4BA 2YT4A 2NUEA 4JV5E 1WUUA 2IOPA 2L2NA 1MU5A 1Y4UA 2HKEA 1RREA 3F0NA 4YY3I 4F9AB 2UXCI 4DR2I 2UU9I 1FNMA 5IWAE 1XMQI 2B3TB 2UUAE 4R8OA 4L8NA 2Z5BB 2L2MA 2R42A 5AASA 5GMDA 3Q1QA 2HFUA 4DU8A 4XTJA 2ZBKB 1O0WA 5IT9Q 3PYGA 2EFGA 3ADLA 4JI5E 4JI6I 5T6JA 2HHHE 1J26A 4LF6I 4BS9A 3C4TA 4USMA 2M4IA 2YZTA 5A2QC 3RMPA 2L8TA 4IZKA 4J8ZA 2L92A 4DUYI 1S4EA 4FWDA 4DR6E 1J5EI 4NXMI 4LF4E 5LMUI 1EKZA 5BR8E 4DKKA 4HACB 1USVA 4WYQB 1S16A 2IOQA 3HQ1A 4HY1A 2UUCE 2ZITA 3HXLA 4TUGA 1HNZI 5LMNI 4R03A 3ZM7A 5GMEA 4DV6E 2E5LI 3IWBA 3HPSA 3VK6A 1Y4SA 1UEKA 3ZKBA 1I94E 3OMLA 3DF6A 1GQEA 4DR4E 2KHXA 4HYMA 2LJPA 2CZ9A 1KKHA 1IBME 4JI2I 2JR1A 4X64I 2KOUA 4RPFA 4MYUA 1PIEA 4JI8E 3WU4A 2O1TA 2Z5BA 2DEIA 2F4VI 4DPYA 3F6GA 4LFCE 2L33A 1Z0EA 1XNQI 2RS7A 2V8PA 2X36A 4YHHI 2VE7C 2L3JA 2XEXA 4DV4I 4KHPE 5LL6R 2V88A 1N34E 1IBLE 4LF5E 4LTYA 2H36X 3J7AM 3B78A 2DB2A 2DMYA 1Z0VA 4WUDA 4LF9E 2GQ0A 4WUBA 3V2UC 4HACA 4DPWA 4Z7CA 1T4NA 2IHR1 1N36E 2HFSA 1Z0GA 4P7DA 4DR3I 2VF1A 1Z0BA 4JI4I 1X49A 3ADGA 1WHQA 1IBKE 2B7TA 2NUGA 3WU6A 4JI0I 3JU0A 1HR0I 4KZSA 4K0KI 2OI2A 2ODRC 4DUZE 3P1XA 1ZM3A 3QT6A 2VQEI 2KONA 4JI3E 1HNXE 1BKNA 1X48A 3T1YI 4DV5E 4B3RI 2L2KB 2L3CA 2L6MA 3WU5A 4F54A 2FGGA 2CG9A 4BC9A 2LJHA 2CGEA 4LFBE 4DR7E 2VF3A 2Z5CB 4UTGA 3MSWA 2O1WA 4DV1E 2UXBI 2RS6A 4FWGA 2EWLA 3CWVA 1YYOA 5FLXC 4PU9A 1Z59A 3J81C 3OTOI 4B3TE 4DV0I 3T1HI 1NHHA 4M0VA 4GKJE 3ZZUA 2V83A 4DV2I 2UXDE 2N3HA 1DI2A 1QZRA 5CFFE 2R3VA 4DV3E 3ZKDA 1KIJA 3F6HA 5F3WA 4B3SI 1RR9A 4DR5I 2A2DA 4B3ME 2DEJA 4BC7A 4PRVA 1N33I 1UILA 3HPZA 1FKAE 4NXNI 4OX9E 4GKKE 2WW4A 2LTSA 3D4JA 1K47A 1H72C 4FW9A 4YY3E 4X62I 1Z5CA 2UXCE 4DR2E 2UU9E 4JYAI 1FJGI 1NHJA 1Z0WA 3M6AA 2UUBI 4M2ZA 1XMQE 2VQFI 4JI1I 3H4LA 1H7UA 1XNRI 4MYTA 5FWKA 2Z5CA 2V85A 4AQYE 1YYWA 3HULA 3K6QA 4JI6E 2B9DA 3K17A 1UHZA 4DXLA 4LF6E 1N32I 4USKA 5IT9C 2PNMA 4DUYE 4ED4A 1OJ4A 2Q2EB 2K4VA 1J5EE 4NXME 1A6FA 5LMUE 3ZZ0A 2NA2A 3JAMC 4JG4A 2RSMA 3AUZA 3JTZA 2M1SA 1NHIA 1SR9A 1HNZE 5LMNE 4P78A 2CPNA 2E5LE 1H73A 5L3JA 2ZM6I 3ZZTA 4WFTA 2NUFA 4LF8I 2MC5A 4X66I 4LFAI 2BM1A 3B82A 4X65I 3J80Q 4JI3I 1HNWI 4JI2E 1D6TA 3AV0A 4X64E 3H09A 2MC6A 2ODRD 4DR1I 2V87A 1N0UA 4DV7I 4EMDA 2F4VE 1KVKA 1ZBTA 1B63A 4UT4A 4JI7I 2B7VA 4LF7I 1FWLA 1XMOI 2V34A 3J81Q 1X47A 1XNQE 3FIGA 3QT5A 4JV5I 1XHKA 4FWHA 4YHHE 1H74A 4DV4E 1DARA 5IWAI 2UUAI 2LRSA 2JOXA 1Z0CA 5A2QQ 1YZ9A 3K1JA 1GZ6A 4I8OA 4JI5I 3P06A 2GS8A 2HHHI 5AE2A 4DR3E 2JWOA 4M1KA 2JVAA 3ADJA 4JI4E 3J7Yp 2F8BA 3VYXA 4X8WA 4JI0E 3QT8A 1HR0E 2AJ4A 4LU9A 4K0KE 4DR6I 2X7IA 3VYYA 3PYFA 2J7KA 2VQEE 4LF4I 5BR8I 1Y6ZA 3T1YE 1U2RA 4B3RE 2UUCI 3LPSA 2M7QA 4DV6I 1NZ0A 2O1VA 2DIXA 4OOGC 2UXBE 3HTXA 4DU7A 1I94I 4GEQB 4AQYI 4DR4I 4BMJA 1ZXNA 3DJWA 3B8HA 3PYEA 2HK3A 1ZM2A 1N0VC 2O1UA 1WHNA 1T4LB 4FN5A 3OTOE 1IBMI 4DV0E 1PKPA 3T1HE 3LNUA 1KTVA 3QT7A 1H7SA 4JI8I 3JAMQ 1USUA 4DV2E 1RC7A 4I3HA 2JY9A 3Q6MA 1STUA 4LFCI 4M30A 1WXRA 3LTOA 2JOBA 1ZM4A 1VISA 4B3SE 2V2ZA 2A2CA 4DR5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUQ A;  1N33 E;  4KHP I;  1N34 I;  1IBL I;  3LLH A;  4LF5 I;  1T4O A;  4NXN E;  2MDR A;  4LF9 I;  3V5R A;  2NPF A;  4X62 E;  1FJG E;  4JYA E;  1N36 I;  2UUB E;  2VQF E;  1MG7 A;  4JI1 E;  1EA6 A;  2BV3 A;  4R1F A;  1XNR E;  4KQV A;  2HK2 A;  4ZVI A;  1IBK I;  3PYD A;  1Z5B A;  2LUP B;  4P52 A;  4DUZ I;  1N32 E;  1HNX I;  4DV5 I;  4URL A;  2HKJ A;  3J7A G;  2RTX A;  3ADI A;  1FWK A;  2V2Q A;  4DR7 I;  4LFB I;  1ELO A;  2N3G A;  5FLX Q;  4DV1 I;  1FI4 A;  2E1R A;  3GON A;  2LBS B;  1MX0 A;  4PRX A;  4B3T I;  1Z5A A;  1EI1 A;  2ZM6 E;  4Z7Y A;  1RQ0 A;  4DPX A;  4HXZ A;  2EZ6 A;  4GKJ I;  1ZM9 A;  1B62 A;  4LF8 E;  1ZXM A;  2UXD I;  4X66 E;  1YYK A;  4LFA E;  4X65 E;  1Z0T A;  2BM0 A;  1HNW E;  4DV3 I;  1QU6 A;  4DR1 E;  4DV7 E;  4WUC A;  2V2V A;  4B3M I;  3J80 C;  4DPT A;  4JI7 E;  2LTR A;  4LF7 E;  1XMO E;  4DPU A;  3WU3 A;  4OX9 I;  1PVG A;  4P7A A;  4GKK I;  3C4B A;  2YT4 A;  2NUE A;  4JV5 E;  1WUU A;  2L2N A;  1MU5 A;  2HKE A;  1RRE A;  3F0N A;  4YY3 I;  2UXC I;  4DR2 I;  2UU9 I;  1FNM A;  5IWA E;  1XMQ I;  2B3T B;  2UUA E;  2L2M A;  2R42 A;  5GMD A;  3Q1Q A;  2HFU A;  4DU8 A;  4XTJ A;  2ZBK B;  1O0W A;  5IT9 Q;  3PYG A;  2EFG A;  3ADL A;  4JI5 E;  4JI6 I;  1J26 A;  2HHH E;  4LF6 I;  3C4T A;  4USM A;  5A2Q C;  4DUY I;  1S4E A;  4FWD A;  4DR6 E;  1J5E I;  4NXM I;  4LF4 E;  5LMU I;  1EKZ A;  5BR8 E;  4DKK A;  4HAC B;  4WYQ B;  1S16 A;  4HY1 A;  2UUC E;  2ZIT A;  1HNZ I;  5LMN I;  3ZM7 A;  5GME A;  4DV6 E;  2E5L I;  1UEK A;  3ZKB A;  1I94 E;  1GQE A;  4DR4 E;  2KHX A;  4HYM A;  2LJP A;  2CZ9 A;  1KKH A;  1IBM E;  4JI2 I;  4X64 I;  4RPF A;  4MYU A;  1PIE A;  4JI8 E;  3WU4 A;  2DEI A;  2F4V I;  4DPY A;  4LFC E;  2L33 A;  1Z0E A;  1XNQ I;  2RS7 A;  2V8P A;  2X36 A;  4YHH I;  2L3J A;  2XEX A;  4DV4 I;  4KHP E;  5LL6 R;  1N34 E;  1IBL E;  4LF5 E;  3J7A M;  3B78 A;  2DB2 A;  2DMY A;  1Z0V A;  4WUD A;  4LF9 E;  4WUB A;  3V2U C;  4HAC A;  4DPW A;  4Z7C A;  1T4N A;  2IHR 1;  1N36 E;  2HFS A;  1Z0G A;  4DR3 I;  1Z0B A;  4JI4 I;  1X49 A;  3ADG A;  1WHQ A;  1IBK E;  2B7T A;  2NUG A;  3WU6 A;  4JI0 I;  1HR0 I;  4K0K I;  2OI2 A;  4DUZ E;  3P1X A;  1ZM3 A;  3QT6 A;  2VQE I;  4JI3 E;  1HNX E;  1BKN A;  1X48 A;  3T1Y I;  4DV5 E;  4B3R I;  2L2K B;  2L3C A;  3WU5 A;  2LJH A;  4LFB E;  4DR7 E;  2VF3 A;  4UTG A;  4DV1 E;  2UXB I;  2RS6 A;  4FWG A;  3CWV A;  1YYO A;  5FLX C;  4PU9 A;  1Z59 A;  3J81 C;  3OTO I;  4B3T E;  4DV0 I;  3T1H I;  1NHH A;  4GKJ E;  3ZZU A;  4DV2 I;  2UXD E;  2N3H A;  1DI2 A;  1QZR A;  5CFF E;  2R3V A;  4DV3 E;  3ZKD A;  1KIJ A;  4B3S I;  1RR9 A;  4DR5 I;  2A2D A;  4B3M E;  2DEJ A;  4PRV A;  1N33 I;  1UIL A;  1FKA E;  4NXN I;  4OX9 E;  4GKK E;  2WW4 A;  2LTS A;  3D4J A;  1K47 A;  1H72 C;  4FW9 A;  4YY3 E;  4X62 I;  1Z5C A;  2UXC E;  4DR2 E;  2UU9 E;  4JYA I;  1FJG I;  1NHJ A;  1Z0W A;  3M6A A;  2UUB I;  4M2Z A;  1XMQ E;  2VQF I;  4JI1 I;  3H4L A;  1H7U A;  1XNR I;  4MYT A;  4AQY E;  1YYW A;  3HUL A;  4JI6 E;  3K17 A;  1UHZ A;  4DXL A;  4LF6 E;  1N32 I;  4USK A;  5IT9 C;  4DUY E;  4ED4 A;  1OJ4 A;  2Q2E B;  1J5E E;  4NXM E;  1A6F A;  5LMU E;  3ZZ0 A;  2NA2 A;  3JAM C;  4JG4 A;  2RSM A;  1NHI A;  1HNZ E;  5LMN E;  2CPN A;  2E5L E;  1H73 A;  5L3J A;  2ZM6 I;  3ZZT A;  4WFT A;  2NUF A;  4LF8 I;  4X66 I;  4LFA I;  2BM1 A;  3B82 A;  4X65 I;  3J80 Q;  4JI3 I;  1HNW I;  4JI2 E;  1D6T A;  4X64 E;  4DR1 I;  1N0U A;  4DV7 I;  4EMD A;  2F4V E;  1KVK A;  1ZBT A;  1B63 A;  4UT4 A;  4JI7 I;  2B7V A;  4LF7 I;  1FWL A;  1XMO I;  2V34 A;  3J81 Q;  1X47 A;  1XNQ E;  3QT5 A;  4JV5 I;  1XHK A;  4FWH A;  4YHH E;  1H74 A;  4DV4 E;  1DAR A;  5IWA I;  2UUA I;  2LRS A;  1Z0C A;  5A2Q Q;  1YZ9 A;  3K1J A;  4JI5 I;  2GS8 A;  2HHH I;  4DR3 E;  4M1K A;  2JVA A;  3ADJ A;  4JI4 E;  3J7Y p;  3VYX A;  4X8W A;  4JI0 E;  3QT8 A;  1HR0 E;  2AJ4 A;  4K0K E;  4DR6 I;  2X7I A;  3VYY A;  3PYF A;  2J7K A;  2VQE E;  4LF4 I;  5BR8 I;  3T1Y E;  1U2R A;  4B3R E;  2UUC I;  3LPS A;  4DV6 I;  1NZ0 A;  2DIX A;  4OOG C;  2UXB E;  3HTX A;  4DU7 A;  1I94 I;  4AQY I;  4DR4 I;  1ZXN A;  3B8H A;  3PYE A;  2HK3 A;  1ZM2 A;  1N0V C;  1WHN A;  1T4L B;  4FN5 A;  3OTO E;  1IBM I;  4DV0 E;  1PKP A;  3T1H E;  3LNU A;  1KTV A;  3QT7 A;  1H7S A;  4JI8 I;  3JAM Q;  4DV2 E;  1RC7 A;  4I3H A;  2JY9 A;  1STU A;  4LFC I;  4M30 A;  3LTO A;  1ZM4 A;  1VIS A;  4B3S E;  2V2Z A;  2A2C A;  4DR5 E; 
#chains in the Genus database with same CATH topology
 1PDA A;  4BBY A;  5AE1 A;  2LUQ A;  5JEA F;  1N33 E;  4KHP I;  4F9C B;  1N34 I;  2N8X A;  1IQS A;  2CT1 A;  3LLH A;  3GME A;  2EMC A;  1IBL I;  4LF5 I;  1TF3 A;  1T4O A;  4IFD F;  4NXN E;  2LMZ A;  1BBO A;  2C37 A;  2EM6 A;  2MDR A;  4Q28 A;  3K85 A;  4LF9 I;  2JP9 A;  3V5R A;  1G2D C;  2NPF A;  4TUI A;  4X62 E;  3PS3 A;  1L4S A;  1FJG E;  4JYA E;  2JEB B;  1N36 I;  2UUB E;  4LCG A;  2Z5E A;  2DSY A;  2VQF E;  2PO0 A;  2K7I A;  2YTE A;  3PRY A;  1MG7 A;  4JI1 E;  1DQ3 A;  1EA6 A;  1MEY C;  2BV3 A;  4R1F A;  1XNR E;  4IZJ B;  4KQV A;  2YTG A;  2EP3 A;  2HK2 A;  4ZVI A;  3B4T A;  1IBK I;  2MKN A;  2WZO A;  1PJS A;  3THO B;  2EOX A;  3PYD A;  4MU0 A;  1Z5B A;  4R2D A;  4WSP A;  2LUP B;  4P52 A;  2G7H A;  4ZYH A;  2V8Q B;  4ISA A;  5JEA B;  4DUZ I;  1YUJ A;  2A25 A;  4ZYE A;  5DNY A;  1N32 E;  4R2Q A;  1HNX I;  2YWQ A;  4WXD A;  5K36 C;  4IFD B;  4DV5 I;  1TF6 A;  2EL5 A;  4URL A;  4BA1 A;  5A6J A;  2F1D A;  5KL2 A;  3HJC A;  2HKJ A;  2WP8 B;  4BCA A;  2RTX A;  2EOQ A;  1X3C A;  3ADI A;  3J7A G;  2AE8 A;  1FWK A;  2V2Q A;  3U1Y A;  4DR7 I;  1ELO A;  4LFB I;  2PO1 A;  2N3G A;  5KL4 A;  5FLX Q;  4DMI A;  2CTD A;  2V86 A;  4QNK A;  4DV1 I;  2JE6 A;  2EOF A;  2NN6 C;  1FI4 A;  2E1R A;  3GON A;  2LBS B;  3BBG A;  2BA0 D;  2PNL A;  1MX0 A;  2LE2 A;  4PRX A;  2EMI A;  3PS2 A;  4LOM A;  4WPY A;  2EOJ A;  2ELZ A;  2GHF A;  2Q8U A;  4B3T I;  2JEA B;  1Z5A A;  3LML A;  3KZY A;  2YRM A;  4IZK B;  3IWD A;  2ZM6 E;  2YTD A;  1RQ0 A;  3IWC A;  1EI1 A;  2EZ6 A;  4HXZ A;  4Z7Y A;  2LCE A;  3UHM A;  3ZOQ B;  1ZM9 A;  4GKJ I;  1B62 A;  4R2S A;  1HK7 A;  4LF8 E;  2VES A;  5AE3 A;  1OYP A;  4HTG A;  2LVH A;  1LLM C;  1ZXM A;  4X66 E;  2UXD I;  2E1M A;  4L5N C;  1YYK A;  4F9B B;  2EMW A;  2LO3 A;  4LFA E;  2NN6 E;  4X65 E;  1Z0T A;  2BM0 A;  1HNW E;  1VI7 A;  4WSG A;  2FV4 B;  4N3O A;  1ZBQ A;  2JEB A;  2PNZ B;  1QU6 A;  4O24 A;  4DV3 I;  4DR1 E;  1UDS A;  2HGH A;  4DV7 E;  2D9H A;  4WUC A;  2V2V A;  5ADZ A;  2V89 A;  4AID A;  2NN6 F;  3J80 C;  4IZJ A;  4DPT A;  1EH6 A;  4B3M I;  3M99 B;  4JI7 E;  3KWR A;  2EOI A;  2GPI A;  2LTR A;  1Z1B A;  1A1K A;  4LF7 E;  4IZJ D;  1XMO E;  4DPU A;  3WU3 A;  1GTK A;  4OX9 I;  1PVG A;  4P7A A;  2FTX B;  4GKK I;  3EPL A;  3C4B A;  2YT4 A;  2NUE A;  4JV5 E;  1WUU A;  5JEA A;  1F2I G;  2IOP A;  2L2N A;  1MU5 A;  2EQ0 A;  1Y4U A;  2CVE A;  2HKE A;  1RRE A;  3F0N A;  3BF2 A;  4YY3 I;  4IFD A;  4F9A B;  5JEA D;  2UXC I;  4DR2 I;  2UU9 I;  2EPM X;  1FNM A;  5IWA E;  2BB8 A;  4FW3 A;  1XMQ I;  2YTF A;  4NBQ A;  4IFD D;  2B3T B;  2EN7 A;  2RPC A;  2EMG A;  1PJT A;  4L8N A;  4R8O A;  2UUA E;  2L2M A;  2IER A;  2R42 A;  5AAS A;  5GMD A;  1BBG A;  3Q1Q A;  2HFU A;  4DU8 A;  1A1H A;  4XTJ A;  2ZBK B;  1O0W A;  2EM5 A;  4WXC A;  5IT9 Q;  2Z5B B;  3PYG A;  2JYA A;  2EFG A;  3ADL A;  2EMB A;  4JI5 E;  2NN6 B;  4JI6 I;  5T6J A;  2HHH E;  1J26 A;  2WBU A;  4LF6 I;  1WJP A;  4BS9 A;  2EPO A;  3C4T A;  4USM A;  2M4I A;  2I9I A;  2YZT A;  3BID A;  5A2Q C;  3RMP A;  2JEA A;  2L8T A;  4IZK A;  2EOR A;  1RMD A;  2EMZ A;  3THN A;  4J8Z A;  2L92 A;  4DUY I;  1S4E A;  2O3Z A;  4FWD A;  3ECR A;  2EML A;  2EMX A;  4DR6 E;  1J5E I;  4NXM I;  4LF4 E;  5LMU I;  2EMY A;  1EKZ A;  5BR8 E;  4DKK A;  4HAC B;  4O43 A;  5A6B A;  1USV A;  2EL6 A;  4WYQ B;  1S16 A;  2EN8 A;  2R1F A;  3HQ1 A;  2IOQ A;  4MU1 A;  4HY1 A;  2PNZ A;  4AM3 A;  2UUC E;  4GQU A;  2HJJ A;  2ZIT A;  3HXL A;  2EPN A;  4TUG A;  4R2E A;  1HNZ I;  5A6B D;  3M7N D;  5C0X C;  5LMN I;  2DLK A;  4R03 A;  5LLQ A;  5GME A;  3ZM7 A;  5IV8 B;  4DV6 E;  2E5L I;  3IWB A;  2EOE A;  3VHT B;  1A1L A;  3HPS A;  3VK6 A;  1Y4S A;  1UEK A;  3ZKB A;  1I94 E;  3OML A;  3DF6 A;  4R2C A;  1GQE A;  3HKM A;  4DR4 E;  2KHX A;  2R76 A;  5ELW A;  4IS9 A;  4HYM A;  2LJP A;  2CZ9 A;  1KKH A;  2CSH A;  1IBM E;  4JI2 I;  2JR1 A;  4X64 I;  2KOU A;  2ENA A;  4MYU A;  3MHS C;  4RPF A;  1PIE A;  4JI8 E;  5KL3 A;  3WU4 A;  1WRJ A;  2EQ1 A;  2O1T A;  2Z5B A;  5C0X E;  2DEI A;  2F4V I;  2ENC A;  4DPY A;  3F6G A;  4LFC E;  2GLI A;  2EMF A;  2L33 A;  2EPA A;  1Z0E A;  2EQ3 A;  4U3D A;  5C0X F;  2NN6 A;  1XNQ I;  2RS7 A;  5AC5 A;  2WBS A;  4NHR A;  4BHC A;  2V8P A;  2X36 A;  4YHH I;  2VE7 C;  2EN1 A;  2NN6 D;  1B69 A;  5TSE A;  2L3J A;  2XEX A;  4DV4 I;  2ELY A;  5LL6 R;  4KHP E;  2V88 A;  1N34 E;  1IBL E;  4LF5 E;  4LTY A;  2H36 X;  1UDN A;  3J7A M;  2BR2 B;  3B78 A;  2DB2 A;  2DMY A;  1Z0V A;  4J3D A;  4WUD A;  4LF9 E;  2GQ0 A;  4WUB A;  3V2U C;  4HAC A;  4DPW A;  4AIM A;  4Z7C A;  1T4N A;  2IHR 1;  1N36 E;  2HFS A;  3H1C A;  5K36 E;  1XXE A;  1Z0G A;  4P7D A;  4DR3 I;  1G2F C;  2BA1 D;  2VF1 A;  1Z0B A;  4JI4 I;  1X49 A;  3ADG A;  1WHQ A;  2EOS A;  1IBK E;  2B7T A;  2YTQ A;  4NZV A;  2NUG A;  5C0X B;  2DMI A;  3WU6 A;  1X6H A;  4JI0 I;  5K36 F;  3JU0 A;  1HR0 I;  1N3G A;  4KZS A;  4K0K I;  2OI2 A;  2ODR C;  2GO3 A;  2JT2 A;  4F6M A;  2EL4 A;  4DUZ E;  2EN4 A;  3P1X A;  1ZM3 A;  3QT6 A;  2KON A;  2YRK A;  4JI3 E;  2VQE I;  1HNX E;  1BKN A;  2PRT A;  1X48 A;  3T1Y I;  4DV5 E;  4R2A A;  2C38 A;  4B3R I;  2L2K B;  3CDI A;  2L3C A;  2L6M A;  3WU5 A;  2E72 A;  4F54 A;  2FGG A;  2PO2 B;  3GCM A;  2C39 B;  4BC9 A;  2LJH A;  1AAY A;  4LFB E;  4DR7 E;  2CGE A;  2CG9 A;  2VF3 A;  2Z5C B;  4UTG A;  3EPK A;  3C6M A;  4ZYD A;  5DRQ A;  3MSW A;  2O1W A;  1ZR9 A;  4DV1 E;  4OKG A;  2UXB I;  2RS6 A;  5IXM B;  4FWG A;  3UK3 C;  2EWL A;  3CWV A;  2WBT A;  2EM3 A;  1YYO A;  2EMA A;  2EMK A;  3KRN A;  3L7Z B;  5FLX C;  4Q35 B;  1NCS A;  4X9J A;  4PU9 A;  1Z59 A;  5K36 B;  2EPL X;  3J81 C;  2EE8 A;  1YHC A;  4B3T E;  3OTO I;  3GLL A;  4DV0 I;  1EH8 A;  1NHH A;  3T1H I;  4M0V A;  2BA0 G;  4GKJ E;  3ZZU A;  1YUI A;  1NEI A;  4OO1 C;  2EN2 A;  2BR2 A;  2V83 A;  1KYQ A;  5EKW A;  2BA1 G;  4DV2 I;  2UXD E;  2N3H A;  1DI2 A;  4BHB A;  1UDO A;  1QZR A;  2WNR B;  5CFF E;  2R3V A;  4MU3 A;  4DV3 E;  2EPZ A;  4MQY A;  3ZKD A;  2EOZ A;  5A69 A;  3TQM A;  3F6H A;  3MHH C;  5F3W A;  1YSA C;  1KIJ A;  4B3S I;  1RR9 A;  4DR5 I;  2A2D A;  4B3M E;  1YFH A;  1DGC A;  4BC7 A;  2DEJ A;  5C0X A;  4PRV A;  2YTO A;  1N33 I;  2EPU A;  1UIL A;  3HPZ A;  4QNJ A;  4GZN C;  1FKA E;  4U3B A;  2EM8 A;  1IQO A;  4OO1 E;  2EM4 A;  4NXN I;  5C0X D;  4OX9 E;  2BBG A;  4GKK E;  2WW4 A;  3M85 D;  2LTS A;  3Q6N A;  4O5G A;  3D4J A;  1K47 A;  4FW6 A;  2EPR A;  4FK5 C;  1H72 C;  4IFD C;  4FW9 A;  4R2P A;  4YY3 E;  1YH8 A;  1Z5C A;  4X62 I;  4OO1 F;  2UXC E;  4DR2 E;  2UU9 E;  4JYA I;  1FJG I;  1Y5Y A;  1NHJ A;  1Z0W A;  3M6A A;  2UUB I;  5AC4 A;  4N4R B;  1XMQ E;  4M2Z A;  2VQF I;  2PO2 A;  2C39 A;  4JI1 I;  3H4L A;  5KL7 A;  2MDG A;  1H7U A;  4MYT A;  2EN3 A;  5FWK A;  2Z5C A;  1XNR I;  4R2R A;  4BA2 B;  2EOM A;  2V85 A;  4AQY E;  2GO4 A;  1YYW A;  2EMH A;  3HUL A;  3K6Q A;  5DRR A;  4JI6 E;  2B9D A;  3K17 A;  1UHZ A;  3KZZ A;  1ZAA C;  4FW4 A;  4DXL A;  3L7Z A;  4LF6 E;  2LV2 A;  1N32 I;  2C38 B;  1UDQ A;  4USK A;  5K36 A;  5IT9 C;  4KWY A;  1ZU1 A;  3C6K A;  3NZK A;  2NAB A;  1KJK A;  2PNM A;  5K36 D;  4DUY E;  4ED4 A;  1OJ4 A;  2JPA A;  3L00 A;  2Q2E B;  2K4V A;  1J5E E;  4OO1 B;  4NXM E;  1JK1 A;  5DRO A;  1A6F A;  5LMU E;  4OZE A;  3ZZ0 A;  2RQL A;  2NA2 A;  3JAM C;  3P3C A;  4JG4 A;  2WNR A;  2RSM A;  1X6E A;  3AUZ A;  3U1K A;  3JTZ A;  2M1S A;  1NHI A;  1SR9 A;  2J65 A;  3CDJ A;  3PS1 A;  1HNZ E;  3M85 G;  4O4K A;  2YTN A;  5LMN E;  3EPJ A;  2DLQ A;  1R6M A;  4MDT A;  4P78 A;  2CPN A;  2E5L E;  1H73 A;  2J7J A;  5L3J A;  2ZM6 I;  4MLV A;  3ZZT A;  4WFT A;  1P42 A;  2NUF A;  3M7N G;  2HC5 A;  4LF8 I;  2MC5 A;  4X66 I;  1A1G A;  4LFA I;  4RH8 A;  1UN6 B;  2BM1 A;  3B82 A;  4X65 I;  3J80 Q;  4JI3 I;  1HNW I;  4JI2 E;  3EPH A;  1D6T A;  1R6L A;  2MKD A;  3AV0 A;  4X64 E;  3H09 A;  2MC6 A;  2ODR D;  2EPX A;  4DR1 I;  2YPN A;  4FW5 A;  2YTP A;  2V87 A;  1N0U A;  1BB8 A;  4DV7 I;  4MLQ A;  4EMD A;  2EJ4 A;  1MGT A;  2F4V E;  2YSP A;  1KVK A;  1ZBT A;  1B63 A;  4UT4 A;  1T39 A;  4BA2 A;  4JI7 I;  1UBD C;  2B7V A;  1PJQ A;  3P3E A;  4MU4 A;  4LF7 I;  1FWL A;  1XMO I;  2V34 A;  1Y60 A;  1X47 A;  3J81 Q;  1XNQ E;  3FIG A;  5A6A A;  3QT5 A;  4JV5 I;  1P47 A;  2EM0 A;  1XHK A;  1A1I A;  4YHH E;  1H74 A;  2I13 A;  4RHB B;  4FWH A;  2ADR A;  4DV4 E;  3DD6 A;  4LCH A;  2JXP A;  4ZYG A;  1DAR A;  5IWA I;  2YTI A;  1OYR A;  2UUA I;  2LRS A;  4HEI A;  4OO1 A;  4F2J C;  2RSI A;  2JOX A;  2EM2 A;  2YTJ A;  1Z0C A;  5A2Q Q;  1YZ9 A;  4OO1 D;  1RHY A;  3K1J A;  1GZ6 A;  4I8O A;  4JI5 I;  3P06 A;  4F6N A;  2GS8 A;  2EOY A;  1OYS A;  1YPN A;  2HHH I;  5AE2 A;  1A1J A;  4WX9 A;  4DR3 E;  2JWO A;  4LPF A;  4M1K A;  2JVA A;  3ADJ A;  4JI4 E;  3J7Y p;  4LCF A;  2F8B A;  3VYX A;  2YU8 A;  4X8W A;  4JI0 E;  2LJU A;  3QT8 A;  4FW7 A;  1HR0 E;  1IMU A;  2EPK X;  4LU9 A;  2DRP A;  2AJ4 A;  4K0K E;  2EM7 A;  4DR6 I;  2X7I A;  2VRD A;  5A6K A;  3VYY A;  2C37 B;  3PYF A;  3EQ1 A;  1SFE A;  2EPP A;  2VQE E;  1E3H A;  2J7K A;  4LF4 I;  3BGH A;  1X6F A;  5BR8 I;  1Y6Z A;  4M9V C;  2YSO A;  3T1Y E;  1E3P A;  1U2R A;  4B3R E;  1JK2 A;  2LT7 A;  1QNT A;  5KL6 A;  2UUC I;  3P76 A;  2EOO A;  2PO0 B;  1TN9 A;  2EM9 A;  3LPS A;  2M7Q A;  1EH7 A;  2WP8 A;  3P3G A;  4DV6 I;  1NZ0 A;  2O1V A;  5DNL A;  2YU5 A;  2DIX A;  4OOG C;  2UXB E;  5EL9 A;  3HTX A;  2M9A A;  5KL5 A;  2IES A;  4DU7 A;  5JEA C;  4GEQ B;  4AQY I;  2EPC A;  1I94 I;  4DR4 I;  4BMJ A;  1ZXN A;  3DJW A;  3B8H A;  2EN6 A;  3PYE A;  2HK3 A;  1ZM2 A;  1N0V C;  2O1U A;  5DNX A;  5DRP A;  1AH5 A;  1WHN A;  4IJD A;  1T4L B;  4FN5 A;  3OTO E;  1IBM I;  4DV0 E;  1PKP A;  3T1H E;  3LNU A;  1KTV A;  4BA1 B;  2ENH A;  3QT7 A;  2DGC A;  1H7S A;  4JI8 I;  3JAM Q;  1USU A;  2WCC 3;  2YRH A;  2PO1 B;  1T38 A;  4DV2 E;  1RC7 A;  4I3H A;  2JY9 A;  3Q6M A;  1STU A;  1X5W A;  4LFC I;  2EOH A;  4DPX A;  2JE6 B;  4IS1 C;  4M30 A;  3QG5 C;  1WXR A;  3LTO A;  5JEA E;  2JOB A;  1ZM4 A;  1VIS A;  4IFD E;  4B3S E;  1A1F A;  2V2Z A;  2A2C A;  4DR5 E; 
#chains in the Genus database with same CATH homology
 4BBY A;  5AE1 A;  2LUQ A;  1N33 E;  4KHP I;  4F9C B;  1N34 I;  1IBL I;  3LLH A;  4LF5 I;  1T4O A;  4NXN E;  2LMZ A;  2MDR A;  4Q28 A;  3K85 A;  4LF9 I;  3V5R A;  2NPF A;  4TUI A;  4X62 E;  1FJG E;  4JYA E;  1N36 I;  2UUB E;  2Z5E A;  2DSY A;  2VQF E;  3PRY A;  1MG7 A;  4JI1 E;  1DQ3 A;  1EA6 A;  2BV3 A;  4R1F A;  1XNR E;  4IZJ B;  4KQV A;  2HK2 A;  4ZVI A;  1IBK I;  2WZO A;  3PYD A;  1Z5B A;  4WSP A;  2LUP B;  4P52 A;  2G7H A;  4DUZ I;  2V8Q B;  5DNY A;  1N32 E;  1HNX I;  4DV5 I;  4URL A;  3HJC A;  2HKJ A;  3Q6N A;  4BCA A;  2RTX A;  3J7A G;  3ADI A;  1FWK A;  2V2Q A;  4DR7 I;  4LFB I;  1ELO A;  2N3G A;  5FLX Q;  4DMI A;  2V86 A;  4DV1 I;  1FI4 A;  2E1R A;  3GON A;  2LBS B;  2PNL A;  1MX0 A;  2LE2 A;  4PRX A;  4WPY A;  4B3T I;  1Z5A A;  3LML A;  4IZK B;  3IWD A;  2ZM6 E;  1EI1 A;  1RQ0 A;  3IWC A;  4HXZ A;  2EZ6 A;  4Z7Y A;  4DPX A;  4GKJ I;  3ZOQ B;  1ZM9 A;  1B62 A;  1HK7 A;  4LF8 E;  5AE3 A;  1ZXM A;  2UXD I;  4X66 E;  2E1M A;  4L5N C;  1YYK A;  4F9B B;  4LFA E;  4X65 E;  1Z0T A;  2BM0 A;  1HNW E;  2FV4 B;  4N3O A;  1ZBQ A;  4DV3 I;  1QU6 A;  4DR1 E;  4DV7 E;  4WUC A;  2V2V A;  5ADZ A;  2V89 A;  4B3M I;  4IZJ A;  3J80 C;  4DPT A;  4JI7 E;  3KWR A;  2LTR A;  4LF7 E;  4IZJ D;  1XMO E;  4DPU A;  3WU3 A;  4OX9 I;  1PVG A;  4P7A A;  2FTX B;  4GKK I;  3C4B A;  2YT4 A;  2NUE A;  4JV5 E;  1WUU A;  2IOP A;  2L2N A;  1MU5 A;  1Y4U A;  2HKE A;  1RRE A;  3F0N A;  4YY3 I;  4F9A B;  2UXC I;  4DR2 I;  2UU9 I;  1FNM A;  5IWA E;  1XMQ I;  2B3T B;  2UUA E;  4R8O A;  4L8N A;  2Z5B B;  2L2M A;  2R42 A;  5AAS A;  5GMD A;  3Q1Q A;  2HFU A;  4DU8 A;  4XTJ A;  2ZBK B;  1O0W A;  5IT9 Q;  3PYG A;  2EFG A;  3ADL A;  4JI5 E;  4JI6 I;  5T6J A;  2HHH E;  1J26 A;  4LF6 I;  4BS9 A;  3C4T A;  4USM A;  2M4I A;  2YZT A;  5A2Q C;  3RMP A;  2L8T A;  4IZK A;  4J8Z A;  2L92 A;  4DUY I;  1S4E A;  4FWD A;  4DR6 E;  1J5E I;  4NXM I;  4LF4 E;  5LMU I;  1EKZ A;  5BR8 E;  4DKK A;  4HAC B;  1USV A;  4WYQ B;  1S16 A;  2IOQ A;  3HQ1 A;  4HY1 A;  2UUC E;  2ZIT A;  3HXL A;  4TUG A;  1HNZ I;  5LMN I;  4R03 A;  3ZM7 A;  5GME A;  4DV6 E;  2E5L I;  3IWB A;  3HPS A;  3VK6 A;  1Y4S A;  1UEK A;  3ZKB A;  1I94 E;  3OML A;  3DF6 A;  1GQE A;  4DR4 E;  2KHX A;  4HYM A;  2LJP A;  2CZ9 A;  1KKH A;  1IBM E;  4JI2 I;  2JR1 A;  4X64 I;  2KOU A;  4RPF A;  4MYU A;  1PIE A;  4JI8 E;  3WU4 A;  2O1T A;  2Z5B A;  2DEI A;  2F4V I;  4DPY A;  3F6G A;  4LFC E;  2L33 A;  1Z0E A;  1XNQ I;  2RS7 A;  2V8P A;  2X36 A;  4YHH I;  2VE7 C;  2L3J A;  2XEX A;  4DV4 I;  4KHP E;  5LL6 R;  2V88 A;  1N34 E;  1IBL E;  4LF5 E;  4LTY A;  2H36 X;  3J7A M;  3B78 A;  2DB2 A;  2DMY A;  1Z0V A;  4WUD A;  4LF9 E;  2GQ0 A;  4WUB A;  3V2U C;  4HAC A;  4DPW A;  4Z7C A;  1T4N A;  2IHR 1;  1N36 E;  2HFS A;  1Z0G A;  4P7D A;  4DR3 I;  2VF1 A;  1Z0B A;  4JI4 I;  1X49 A;  3ADG A;  1WHQ A;  1IBK E;  2B7T A;  2NUG A;  3WU6 A;  4JI0 I;  3JU0 A;  1HR0 I;  4KZS A;  4K0K I;  2OI2 A;  2ODR C;  4DUZ E;  3P1X A;  1ZM3 A;  3QT6 A;  2VQE I;  2KON A;  4JI3 E;  1HNX E;  1BKN A;  1X48 A;  3T1Y I;  4DV5 E;  4B3R I;  2L2K B;  2L3C A;  2L6M A;  3WU5 A;  4F54 A;  2FGG A;  2CG9 A;  4BC9 A;  2LJH A;  2CGE A;  4LFB E;  4DR7 E;  2VF3 A;  2Z5C B;  4UTG A;  3MSW A;  2O1W A;  4DV1 E;  2UXB I;  2RS6 A;  4FWG A;  2EWL A;  3CWV A;  1YYO A;  5FLX C;  4PU9 A;  1Z59 A;  3J81 C;  3OTO I;  4B3T E;  4DV0 I;  3T1H I;  1NHH A;  4M0V A;  4GKJ E;  3ZZU A;  2V83 A;  4DV2 I;  2UXD E;  2N3H A;  1DI2 A;  1QZR A;  5CFF E;  2R3V A;  4DV3 E;  3ZKD A;  1KIJ A;  3F6H A;  5F3W A;  4B3S I;  1RR9 A;  4DR5 I;  2A2D A;  4B3M E;  2DEJ A;  4BC7 A;  4PRV A;  1N33 I;  1UIL A;  3HPZ A;  1FKA E;  4NXN I;  4OX9 E;  4GKK E;  2WW4 A;  2LTS A;  3D4J A;  1K47 A;  1H72 C;  4FW9 A;  4YY3 E;  4X62 I;  1Z5C A;  2UXC E;  4DR2 E;  2UU9 E;  4JYA I;  1FJG I;  1NHJ A;  1Z0W A;  3M6A A;  2UUB I;  4M2Z A;  1XMQ E;  2VQF I;  4JI1 I;  3H4L A;  1H7U A;  1XNR I;  4MYT A;  5FWK A;  2Z5C A;  2V85 A;  4AQY E;  1YYW A;  3HUL A;  3K6Q A;  4JI6 E;  2B9D A;  3K17 A;  1UHZ A;  4DXL A;  4LF6 E;  1N32 I;  4USK A;  5IT9 C;  2PNM A;  4DUY E;  4ED4 A;  1OJ4 A;  2Q2E B;  2K4V A;  1J5E E;  4NXM E;  1A6F A;  5LMU E;  3ZZ0 A;  2NA2 A;  3JAM C;  4JG4 A;  2RSM A;  3AUZ A;  3JTZ A;  2M1S A;  1NHI A;  1SR9 A;  1HNZ E;  5LMN E;  4P78 A;  2CPN A;  2E5L E;  1H73 A;  5L3J A;  2ZM6 I;  3ZZT A;  4WFT A;  2NUF A;  4LF8 I;  2MC5 A;  4X66 I;  4LFA I;  2BM1 A;  3B82 A;  4X65 I;  3J80 Q;  4JI3 I;  1HNW I;  4JI2 E;  1D6T A;  3AV0 A;  4X64 E;  3H09 A;  2MC6 A;  2ODR D;  4DR1 I;  2V87 A;  1N0U A;  4DV7 I;  4EMD A;  2F4V E;  1KVK A;  1ZBT A;  1B63 A;  4UT4 A;  4JI7 I;  2B7V A;  4LF7 I;  1FWL A;  1XMO I;  2V34 A;  3J81 Q;  1X47 A;  1XNQ E;  3FIG A;  3QT5 A;  4JV5 I;  1XHK A;  4FWH A;  4YHH E;  1H74 A;  4DV4 E;  1DAR A;  5IWA I;  2UUA I;  2LRS A;  2JOX A;  1Z0C A;  5A2Q Q;  1YZ9 A;  3K1J A;  1GZ6 A;  4I8O A;  4JI5 I;  3P06 A;  2GS8 A;  2HHH I;  5AE2 A;  4DR3 E;  2JWO A;  4M1K A;  2JVA A;  3ADJ A;  4JI4 E;  3J7Y p;  2F8B A;  3VYX A;  4X8W A;  4JI0 E;  3QT8 A;  1HR0 E;  2AJ4 A;  4LU9 A;  4K0K E;  4DR6 I;  2X7I A;  3VYY A;  3PYF A;  2J7K A;  2VQE E;  4LF4 I;  5BR8 I;  1Y6Z A;  3T1Y E;  1U2R A;  4B3R E;  2UUC I;  3LPS A;  2M7Q A;  4DV6 I;  1NZ0 A;  2O1V A;  2DIX A;  4OOG C;  2UXB E;  3HTX A;  4DU7 A;  1I94 I;  4GEQ B;  4AQY I;  4DR4 I;  4BMJ A;  1ZXN A;  3DJW A;  3B8H A;  3PYE A;  2HK3 A;  1ZM2 A;  1N0V C;  2O1U A;  1WHN A;  1T4L B;  4FN5 A;  3OTO E;  1IBM I;  4DV0 E;  1PKP A;  3T1H E;  3LNU A;  1KTV A;  3QT7 A;  1H7S A;  4JI8 I;  3JAM Q;  1USU A;  4DV2 E;  1RC7 A;  4I3H A;  2JY9 A;  3Q6M A;  1STU A;  4LFC I;  4M30 A;  1WXR A;  3LTO A;  2JOB A;  1ZM4 A;  1VIS A;  4B3S E;  2V2Z A;  2A2C A;  4DR5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...