4DR7E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr7E02
3ADIA 1N32E 3JAMC 5FLXQ 2UXCI 1YZ9A 3P1XA 4DV1E 1WHNA 3VYXA 1ELOA 1DARA 1FWKA 3ADJA 4RPFA 4DV6E 1N0VC 3QT5A 1ZM9A 1I94E 1X47A 1IBKE 2F4VE 2V2VA 3V2UC 1FI4A 4KHPI 4LF5E 3B8HA 4NXNE 2RS7A 2DB2A 5LL6R 1HNXE 4JI8E 4DPWA 2UUAI 4JI0I 4DR4I 1YYKA 4LF8I 1N34E 1FWLA 1N0UA 2HK3A 1H74A 2LJPA 3ZZTA 4GKJE 4X65E 3QT8A 5IWAI 3PYDA 3C4BA 2V8PA 4GKKE 4X66I 4PRVA 2HHHE 2Q2EB 4EMDA 1N32I 2LUQA 5A2QQ 3J7AM 4DV1I 2KHXA 2N3GA 1QZRA 1K47A 5FLXC 4DV6I 1XMOE 1I94I 1RR9A 1IBKI 1MX0A 2F4VI 4B3MI 2UXCE 2BM0A 2L2MA 4Z7CA 2E5LI 4JI1E 4WUDA 4LF5I 4NXNI 4JI8I 3ZZUA 1N34I 2NPFA 1QU6A 2BV3A 1Z0GA 1O0WA 2X36A 1H7SA 1ZXMA 4GKJI 4X65I 5LMUE 1IBLE 3K1JA 1YYOA 4LF7E 4X8WA 4GKKI 3WU5A 1EKZA 3Q1QA 2UUAE 4DR7E 4DV5E 4FWHA 4DR4E 2VF3A 2B7VA 3WU6A 4YY3I 1Z5CA 1Z5AA 4B3RE 1OJ4A 3PYFA 4DU8A 2L2KB 1HNZE 4WYQB 2OI2A 3CWVA 2HK2A 2DEJA 2NUGA 1H73A 4PU9A 5A2QC 4JV5E 1J5EE 1XMOI 4WUCA 4FN5A 4HACA 1XMQE 4DR2E 4LFCE 3ADGA 1ZM2A 4DR3E 4YHHI 4DPUA 4JI1I 1FNMA 1UEKA 3HTXA 2EZ6A 4FWDA 4B3ME 1B62A 4JI3E 2JY9A 4FWGA 1NHHA 2GS8A 5BR8E 2RS6A 2E5LE 5LMUI 3ZZ0A 1IBLI 2BM1A 4LF7I 3J7AG 4DV2I 2DIXA 1S4EA 4DR7I 4DV5I 1Z0EA 4DUZE 1RQ0A 4P7AA 4JI7E 4DV4I 2VQFE 2ZITA 4B3RI 1UHZA 2ZM6I 1KIJA 1MU5A 4XTJA 1HNZI 2NA2A 4DV3E 1PVGA 2A2DA 2NUEA 3J7Yp 4DU7A 4DKKA 2AJ4A 4K0KE 4JV5I 1J5EI 4JI2I 1XNRE 4YY3E 1XMQI 4DR2I 4LFCI 2UXBE 3B78A 4DR3I 4JI6E 1STUA 2R42A 2MDRA 4OOGC 1Z0TA 1HNWE 4USKA 2LTSA 3PYGA 3J81Q 2CPNA 2IHR1 4JI3I 3T1YE 2YT4A 4YHHE 5BR8I 1IBMI 1FJGE 1ZM4A 2R3VA 5IT9Q 1PIEA 3QT6A 5CFFE 1Z5BA 1RC7A 4DUZI 1EI1A 1KTVA 1WHQA 1NHIA 4JI7I 1UILA 1ZXNA 2VQFI 4PRXA 5LMNI 1N36E 4WUBA 1NZ0A 4DV3I 3ZKBA 2LUPB 2HFSA 4DV2E 2UXDE 2E1RA 4K0KI 4JI4E 2WW4A 3J80Q 4DV4E 1XNRI 3T1HE 2ZM6E 4KQVA 4JG4A 2UXBI 4LFBE 1Z59A 4JI6I 4WFTA 4X64E 3D4JA 4LFAE 4OX9E 1HNWI 4JI2E 3OTOE 2UUCE 1BKNA 2NUFA 1B63A 4UTGA 2LJHA 1DI2A 1U2RA 4ZVIA 4B3TE 3T1YI 4DR6E 1RREA 1S16A 3K17A 3ADLA 1FJGI 4X62E 3J81C 1PKPA 2LTRA 2B3TB 3B82A 4Z7YA 1Z0BA 5IT9C 2RTXA 1A6FA 4UT4A 1IBME 2DEIA 5L3JA 1N36I 3GONA 4HXZA 1NHJA 2HKJA 3WU4A 2UXDI 1T4OA 3LPSA 4LF4E 2V2QA 4HYMA 4DPYA 1ZBTA 4JI4I 4NXME 4DPTA 5GMDA 4DV0E 3T1HI 3HULA 4B3SI 1N33E 5LMNE 2CZ9A 4LF9E 2DMYA 2XEXA 4LFBI 2X7IA 3LTOA 2J7KA 3LNUA 3LLHA 1ZM3A 3J80C 4JI5E 4X64I 4JYAE 2UUBE 4LFAI 4OX9I 1X48A 2HKEA 2RSMA 3OTOI 2UU9E 3C4TA 2UUCI 4AQYE 1D6TA 1H72C 4B3TI 4DR6I 4USMA 1XHKA 4DXLA 2V34A 1EA6A 4X62I 4LF6I 4MYTA 4DV7I 2V2ZA 4DR1I 1KVKA 3ZKDA 3PYEA 2EFGA 2VQEE 1XNQE 1HR0E 3VYYA 4DUYE 4DR5E 3ZM7A 5GMEA 3V5RA 3JAMQ 1T4NA 2LRSA 1GQEA 4R1FA 4M2ZA 4LF4I 4HACB 4NXMI 3H4LA 2LBSB 2B7TA 4DV0I 1N33I 4LF9I 4P52A 2JVAA 2L2NA 4JI5I 2ZBKB 4JYAI 4MYUA 2UUBI 1MG7A 1HNXI 2L33A 2N3HA 4I3HA 1J26A 2UU9I 1KKHA 4B3SE 1H7UA 4M30A 1T4LB 4M1KA 4ED4A 4AQYI 1Z0VA 2A2CA 2HFUA 3F0NA 4KHPE 1FKAE 4DPXA 1X49A 2HHHI 4JI0E 3QT7A 4LF8E 4HY1A 1Z0WA 4URLA 1VISA 4FW9A 2VQEI 5IWAE 2L3JA 4LF6E 1XNQI 2L3CA 1HR0I 4DV7E 4DUYI 4DR5I 3WU3A 4DR1E 4X66E 1WUUA 1Z0CA 1YYWA 3M6AA
chains in the Genus database with same CATH superfamily
5K36D 2CT1A 3ADIA 3HJCA 1N32E 2Q8UA 2YTQA 3JAMC 4FW7A 3ZOQB 1YUJA 1GTKA 1YZ9A 5FLXQ 2UXCI 3P1XA 4DV1E 1WHNA 1PJQA 2JWOA 3VYXA 4O43A 2MC5A 4RHBB 1ELOA 1DARA 4ZYHA 2BR2B 3MHHC 2LV2A 1FWKA 3ADJA 4R03A 4RPFA 2EN7A 4DV6E 3F6HA 5JEAE 2CTDA 2LVHA 1N0VC 2M9AA 3QT5A 1ZM9A 1EH7A 1I94E 1X47A 1LLMC 3B8HA 1Y4SA 1IBKE 2EMFA 2F4VE 2V2VA 2KONA 2ODRD 2LO3A 3V2UC 1FI4A 2O1WA 2M1SA 2EL5A 4HTGA 4KHPI 3PS2A 4LF5E 4Q28A 4BMJA 4NXNE 2DSYA 2ADRA 1ZU1A 2RS7A 4P78A 4R8OA 4TUIA 5T6JA 2DB2A 5LL6R 2WNRB 4LPFA 1HNXE 4O5GA 4JI8E 3EPJA 4DPWA 2EPRA 2NN6A 4IZJB 2UUAI 4JI0I 2EM5A 3OMLA 2WCC3 2YTOA 1YYKA 4WX9A 1OYPA 1USUA 4DR4I 4LF8I 1N34E 2J7JA 1FWLA 1N0UA 2HK3A 5AE1A 1H74A 2LJPA 3ZZTA 2HGHA 5K36E 4GKJE 2VF1A 3JTZA 4X65E 2WP8A 3QT8A 2AE8A 4QNJA 5C0XD 4ZYDA 4J8ZA 5DROA 5IWAI 1XXEA 4OO1A 5A6AA 3EPKA 3PYDA 2EE8A 2EOEA 3AV0A 3C4BA 4F9BB 2V8PA 4LCHA 5DRRA 1TF6A 4GKKE 4X66I 4L8NA 2MKDA 4PRVA 2HHHE 4MLQA 3B4TA 2JP9A 2YRMA 2Q2EB 4OKGA 2ODRC 2JOBA 2VRDA 1TF3A 4EMDA 2EMGA 3EPLA 2RQLA 2PO0B 1N32I 2LUQA 5A2QQ 3J7AM 2V83A 4DV1I 2KHXA 5TSEA 1IQSA 5ELWA 2N3GA 1T38A 2EPUA 5EL9A 2N8XA 2RPCA 1QZRA 1VI7A 1K47A 4R2PA 2E1MA 5FLXC 4DV6I 1XMOE 2PO1B 1I94I 4WSPA 1RR9A 2JR1A 3KZYA 1IBKI 1WRJA 1MX0A 3H09A 2C38B 2F4VI 4B3MI 2UXCE 2CGEA 5JEAF 2BM0A 2L2MA 2LT7A 2GO4A 2PO2B 4Z7CA 5C0XE 1G2FC 4JI1E 2E5LI 2NN6D 4BC9A 4R2EA 4WUDA 4LF5I 4NXNI 1EH8A 3THNA 2NABA 4JI8I 5IV8B 3CDJA 2IOQA 4FW3A 2EL6A 2M7QA 3ZZUA 1ZR9A 2GO3A 4NBQA 2EPMX 2YSPA 2NPFA 1N34I 4OO1D 1QU6A 2BV3A 1Z0GA 1O0WA 3HKMA 2X36A 5DNYA 1H7SA 1ZXMA 2EPKX 1YPNA 1BBOA 3GCMA 4M9VC 5LMUE 1OYSA 1IBLE 3PS1A 4X65I 4GKJI 3K1JA 3HQ1A 1YYOA 1A1IA 2WZOA 2YU8A 4LF7E 4X8WA 1A1LA 3EPHA 2Z5CB 4GKKI 4F9CB 3WU5A 1EKZA 3Q1QA 2UUAE 4DR7E 2PNZB 4DV5E 2JE6A 4DR4E 4FWHA 4AM3A 2VF3A 2B7VA 2JYAA 2C39A 2R1FA 4F6MA 3WU6A 4M0VA 3L00A 4YY3I 2L92A 1Z5CA 1Y60A 5DRQA 2EPLX 1Z5AA 4B3RE 1OJ4A 2BA1D 2J65A 3PYFA 2JOXA 4DU8A 1RHYA 2L2KB 2NN6C 1HNZE 1N3GA 4WYQB 2BA1G 2OI2A 3CWVA 2HK2A 2F8BA 1RMDA 2NN6E 4MLVA 2DEJA 2NUGA 2HJJA 1H73A 4PU9A 4IFDE 3C6MA 2EN2A 5A2QC 2EN6A 1PDAA 2GHFA 1J5EE 4JV5E 1XMOI 4WUCA 3Q6MA 4FN5A 4HACA 1XMQE 4P7DA 4DR2E 4LFCE 2DLKA 4L5NC 3ADGA 1ZM2A 2VE7C 4LCGA 1UDQA 4IFDB 4OO1E 5KL4A 4DR3E 4I8OA 5A6JA 4YHHI 2YTIA 4DPUA 3GMEA 1WXRA 4JI1I 1FNMA 3ECRA 1UEKA 2YU5A 2JPAA 1NCSA 1IMUA 3HTXA 2EZ6A 4FWDA 2CVEA 4BC7A 2EPAA 4AIDA 1P47A 5C0XF 3GLLA 3M85G 4MU4A 5JEAB 1KYQA 4B3ME 4BA1B 1B62A 4JI3E 2JY9A 4FWGA 1NHHA 1A1HA 2GS8A 5BR8E 2ENAA 5AASA 2RS6A 2E5LE 2MKNA 1UDNA 3ZZ0A 4OZEA 5LMUI 1IBLI 2JEAA 3MHSC 4BBYA 2BM1A 4LF7I 2MC6A 2DRPA 2V87A 3J7AG 4FW5A 1G2DC 3M7NG 4LTYA 4DV2I 2DIXA 1TN9A 1S4EA 4DR7I 4DV5I 1Z0EA 4DMIA 4DUZE 2JEBB 3P3GA 3DJWA 1RQ0A 4FW6A 1KJKA 4P7AA 4ZYEA 2EMZA 2Z5BB 4LCFA 4JI7E 2F1DA 4DV4I 4IJDA 2VQFE 2ZITA 4B3RI 1UHZA 2ZM6I 1KIJA 3K85A 1MU5A 5K36B 3Q6NA 4XTJA 2NA2A 1HNZI 3AUZA 4DV3E 4IZKB 2EN3A 1PVGA 4IS1C 2A2DA 1R6LA 4WXDA 2NUEA 4MU3A 3J7Yp 5KL3A 4DKKA 2AJ4A 4DU7A 1ZBQA 2EP3A 3JU0A 4K0KE 3CDIA 4U3BA 1SR9A 1J5EI 2O1TA 4JI2I 4JV5I 2DGCA 1XNRE 4YY3E 1XMQI 4DR2I 4LFCI 2UXBE 3B78A 2IERA 4DR3I 2EM8A 4IFDF 4JI6E 3U1YA 1STUA 2C37B 1JK2A 2R42A 2MDRA 1UDOA 1E3HA 2V85A 4OOGC 1Z0TA 2BR2A 2H36X 3FIGA 2IOPA 3L7ZB 1A1FA 2EMKA 1HNWE 4USKA 3RMPA 5FWKA 1EH6A 2R76A 2LTSA 2EM3A 3PYGA 3J81Q 2DMIA 1A1JA 2CPNA 2IHR1 4JI3I 3T1YE 2EWLA 2YT4A 4MDTA 4MQYA 3U1KA 4YHHE 2YTGA 5BR8I 1X6FA 1IBMI 4O4KA 1FJGE 1ZM4A 2WBUA 2PNLA 2EQ3A 2R3VA 4X9JA 5IT9Q 4WSGA 2WNRA 5C0XB 1PIEA 3QT6A 1Z1BA 2M4IA 5CFFE 2ELZA 2YTJA 4R2SA 1UDSA 1DQ3A 2EMXA 4IZJA 2EOOA 1Z5BA 1RC7A 4BA2B 4DUZI 1EI1A 4ISAA 1KTVA 4TUGA 2IESA 1WHQA 1NHIA 2Z5EA 4JI7I 1UILA 3UK3C 1ZXNA 1UN6B 2VQFI 4PRXA 3K6QA 5LMNI 1X5WA 1N36E 2CG9A 2EQ1A 2RSIA 1BB8A 1X6EA 4WUBA 1A1GA 1NZ0A 1A1KA 4DV3I 5K36F 4R2QA 4FK5C 3ZKBA 2LUPB 4GQUA 1Y6ZA 2HFSA 4DV2E 2UXDE 2EMYA 4N3OA 3THOB 3LMLA 2E1RA 5ADZA 4K0KI 4JI4E 2WW4A 2YTNA 1R6MA 2YTFA 2EM9A 2EMIA 1X3CA 1ZAAC 3J80Q 4DV4E 4JI4I 3T1HE 5AC4A 2EN1A 1XNRI 5IXMB 2ZM6E 4KQVA 2MDGA 2PO0A 4JG4A 2UXBI 1NEIA 4LFBE 3KZZA 1Z59A 4JI6I 4WFTA 2YSOA 3M99B 4J3DA 2EMLA 4X64E 1Y4UA 3D4JA 2HC5A 2I13A 5JEAD 2EPOA 4GEQB 3VHTB 4LFAE 4OX9E 2NN6B 1DGCA 2LCEA 1HNWI 4N4RB 4JI2E 1WJPA 3OTOE 2PO1A 2UUCE 2L8TA 1BKNA 2NUFA 2FV4B 3C6KA 2EMHA 2LJHA 1DI2A 1B63A 1U2RA 2C38A 4B3TE 2ENHA 2EOQA 4UTGA 4DR6E 4ZVIA 2WP8B 3T1YI 2JT2A 2LMZA 1RREA 3HPZA 1S16A 3K17A 3ADLA 4F54A 1AAYA 2PO2A 4OO1B 4X62E 4BS9A 1FJGI 4IZJD 3J81C 1PKPA 2EOZA 3M85D 5A6KA 2LTRA 2B3TB 4WXCA 1P42A 2K7IA 1B69A 4IFDC 2EOJA 2EOMA 5KL6A 4O24A 2EM4A 3BF2A 3B82A 1Z0BA 5KL7A 4QNKA 3BGHA 2O1VA 4Z7YA 2EPCA 5IT9C 5DNLA 4AIMA 2RTXA 1L4SA 1A6FA 4UT4A 4RH8A 2O1UA 1IBME 5AE2A 3P76A 2K4VA 1QNTA 2YTEA 2DEIA 5L3JA 1N36I 3M7ND 5A6BA 4NZVA 3GONA 2GQ0A 4HXZA 1PJSA 2YZTA 1NHJA 2HKJA 5JEAC 2Z5CA 3WU4A 2EOIA 2UXDI 1T4OA 4BHCA 3LPSA 4LF4E 2PNZA 2DLQA 2V2QA 4GZNC 1ZBTA 3IWDA 2V88A 4NXME 4HYMA 4DPYA 2FGGA 5GMDA 4DPTA 5DNXA 4DV0E 3T1HI 1GZ6A 3HULA 4B3SI 4R2DA 1N33E 5LMNE 2CZ9A 4LF9E 2DMYA 3H1CA 2XEXA 4LFBI 2X7IA 4HEIA 2EM2A 3LTOA 2J7KA 2A25A 2EPZA 3LNUA 3LLHA 2D9HA 1ZM3A 4MU0A 3QG5C 5KL2A 3J80C 4JI5E 4X64I 2BBGA 2GPIA 4JYAE 2UUBE 5EKWA 3EQ1A 4LFAI 1PJTA 2E72A 4OX9I 4R2RA 3BIDA 1X48A 2NN6F 2HKEA 2RSMA 3DD6A 3OTOI 2UU9E 3C4TA 1JK1A 2UUCI 3DF6A 5K36C 4AQYE 2PNMA 1D6TA 1H72C 1Y5YA 4IS9A 4B3TI 4U3DA 2L6MA 2CSHA 4DR6I 4IFDA 4USMA 1XHKA 1MEYC 4DXLA 2LJUA 2V34A 5DRPA 2I9IA 1EA6A 4FW4A 4X62I 4LF6I 4OO1F 3KWRA 4MYTA 4DV7I 5KL5A 2V2ZA 4DR1I 1KVKA 2EQ0A 2EPXA 3F6GA 2JE6B 3ZKDA 4KZSA 2C39B 4KWYA 3PYEA 5JEAA 2YTDA 5A6BD 4BA1A 2EFGA 4BCAA 2EMAA 3HXLA 2YWQA 2VQEE 2EORA 3IWCA 4LU9A 1XNQE 2LE2A 2EM6A 1AH5A 3VYYA 4DUYE 4DR5E 1F2IG 1HR0E 4LOMA 3ZM7A 4F2JC 2EOFA 5GMEA 3UHMA 1USVA 3V5RA 1T4NA 1BBGA 3JAMQ 3IWBA 1IQOA 2LRSA 1GQEA 1X6HA 5AE3A 4R1FA 4M2ZA 5LLQA 1YH8A 4LF4I 2V89A 4HACB 4NXMI 2YRKA 2JEBA 2EPPA 1YSAC 2LBSB 3H4LA 4R2AA 2B7TA 4DV0I 2Z5BA 2EM0A 1N33I 3MSWA 4LF9I 2EM7A 5C0XC 4F6NA 2ENCA 3P3CA 4P52A 5K36A 2JVAA 2L2NA 4IZKA 2BA0D 4JI5I 2ZBKB 4JYAI 4MYUA 1SFEA 2WBSA 2UUBI 1MG7A 1HNXI 2EMCA 2L33A 4MU1A 2N3HA 4I3HA 3TQMA 1E3PA 2BA0G 1J26A 2EPNA 2EN4A 4IFDD 5A69A 2UU9I 1KKHA 3BBGA 4Q35B 4B3SE 3PRYA 1H7UA 3NZKA 4M30A 1T4LB 4M1KA 4ED4A 4AQYI 1UBDC 2FTXB 1YFHA 2EMWA 2KOUA 1Z0VA 2A2CA 1YUIA 2HFUA 3F0NA 2O3ZA 2JEAB 2ELYA 2EOXA 2YTPA 2V8QB 4KHPE 1YHCA 2C37A 2EMBA 1FKAE 4OO1C 2EOHA 4DPXA 4NHRA 4WPYA 3VK6A 2G7HA 2PRTA 1MGTA 2EJ4A 1X49A 3L7ZA 2HHHI 4JI0E 3QT7A 2YRHA 1HK7A 4LF8E 4BHBA 4HY1A 2JXPA 5AC5A 2B9DA 2BB8A 3HPSA 2EOYA 1Z0WA 4URLA 2EL4A 1VISA 4FW9A 2VQEI 5IWAE 3P06A 2V86A 2WBTA 2L3JA 4LF6E 1XNQI 2L3CA 1HR0I 4DV7E 1T39A 3P3EA 4DUYI 4DR5I 2GLIA 3WU3A 3PS3A 4DR1E 4X66E 1WUUA 3KRNA 5C0XA 2VESA 1Z0CA 1YYWA 2EOSA 4BA2A 3M6AA 4F9AB 2EN8A 4R2CA 4ZYGA 2YPNA 5F3WA 1OYRA
chains in the Genus database with same CATH topology
3ADIA 3HJCA 1N32E 3JAMC 5FLXQ 3ZOQB 2UXCI 1YZ9A 3P1XA 4DV1E 1WHNA 2JWOA 3VYXA 2MC5A 1ELOA 1DARA 1FWKA 3ADJA 4R03A 4RPFA 4DV6E 3F6HA 1N0VC 3QT5A 1ZM9A 1I94E 1X47A 1Y4SA 1IBKE 2F4VE 2V2VA 2KONA 2ODRD 3V2UC 1FI4A 2O1WA 2M1SA 4KHPI 4LF5E 4Q28A 4BMJA 4NXNE 2DSYA 4R8OA 2RS7A 3B8HA 4P78A 4TUIA 5T6JA 2DB2A 5LL6R 1HNXE 4JI8E 4DPWA 4IZJB 2UUAI 4JI0I 3OMLA 4DR4I 1YYKA 1USUA 4LF8I 1N34E 1FWLA 1N0UA 2HK3A 5AE1A 1H74A 2LJPA 3ZZTA 4GKJE 2VF1A 3JTZA 4X65E 3QT8A 4J8ZA 5IWAI 3PYDA 3AV0A 3C4BA 4F9BB 2V8PA 4GKKE 4X66I 4L8NA 4PRVA 2HHHE 2Q2EB 2ODRC 2JOBA 4EMDA 1N32I 2LUQA 5A2QQ 3J7AM 2V83A 4DV1I 2KHXA 2N3GA 1QZRA 1K47A 2E1MA 5FLXC 4DV6I 1XMOE 1I94I 4WSPA 1RR9A 2JR1A 1IBKI 1MX0A 3H09A 2F4VI 4B3MI 2UXCE 2CGEA 2BM0A 2L2MA 4Z7CA 2E5LI 4JI1E 4BC9A 4WUDA 4LF5I 4NXNI 4JI8I 2IOQA 2M7QA 3ZZUA 1N34I 2NPFA 1QU6A 2BV3A 1Z0GA 1O0WA 2X36A 5DNYA 1H7SA 1ZXMA 4GKJI 4X65I 5LMUE 1IBLE 3K1JA 3HQ1A 1YYOA 2WZOA 4LF7E 4X8WA 2Z5CB 4GKKI 4F9CB 3WU5A 1EKZA 3Q1QA 2UUAE 4DR7E 4DV5E 4FWHA 4DR4E 2VF3A 2B7VA 3WU6A 4M0VA 4YY3I 2L92A 1Z5CA 1Z5AA 4B3RE 1OJ4A 3PYFA 2JOXA 4DU8A 2L2KB 1HNZE 4WYQB 2OI2A 3CWVA 2HK2A 2F8BA 2DEJA 2NUGA 1H73A 4PU9A 5A2QC 4JV5E 1J5EE 1XMOI 4WUCA 3Q6MA 4FN5A 4HACA 1XMQE 4P7DA 4DR2E 4LFCE 4L5NC 3ADGA 1ZM2A 2VE7C 4DR3E 4I8OA 4YHHI 4DPUA 1WXRA 4JI1I 1FNMA 1UEKA 3HTXA 2EZ6A 4FWDA 4BC7A 4B3ME 1B62A 4JI3E 2JY9A 4FWGA 1NHHA 2GS8A 5BR8E 5AASA 2RS6A 2E5LE 5LMUI 3ZZ0A 1IBLI 4BBYA 2BM1A 4LF7I 2MC6A 2V87A 3J7AG 4LTYA 4DV2I 2DIXA 1S4EA 4DR7I 4DV5I 1Z0EA 4DMIA 4DUZE 3DJWA 1RQ0A 4P7AA 2Z5BB 4JI7E 4DV4I 2VQFE 2ZITA 4B3RI 1UHZA 2ZM6I 1KIJA 3K85A 1MU5A 3Q6NA 4XTJA 2NA2A 1HNZI 3AUZA 4DV3E 4IZKB 1PVGA 2A2DA 2NUEA 3J7Yp 4DU7A 4DKKA 2AJ4A 1ZBQA 3JU0A 4K0KE 4JV5I 1SR9A 1J5EI 2O1TA 4JI2I 1XNRE 4YY3E 1XMQI 4DR2I 4LFCI 2UXBE 3B78A 4DR3I 4JI6E 1STUA 2R42A 2MDRA 2V85A 4OOGC 1Z0TA 2H36X 3FIGA 2IOPA 1HNWE 4USKA 3RMPA 5FWKA 2LTSA 3PYGA 3J81Q 2CPNA 2IHR1 4JI3I 3T1YE 2EWLA 2YT4A 4YHHE 5BR8I 1IBMI 1FJGE 1ZM4A 2PNLA 2R3VA 5IT9Q 1PIEA 3QT6A 2M4IA 5CFFE 1DQ3A 4IZJA 1Z5BA 1RC7A 4DUZI 1EI1A 1KTVA 4TUGA 1WHQA 1NHIA 2Z5EA 4JI7I 1UILA 1ZXNA 2VQFI 4PRXA 3K6QA 5LMNI 1N36E 2CG9A 4WUBA 1NZ0A 4DV3I 3ZKBA 2LUPB 1Y6ZA 2HFSA 4DV2E 2UXDE 4N3OA 3LMLA 2E1RA 5ADZA 4K0KI 4JI4E 2WW4A 3J80Q 4DV4E 1XNRI 3T1HE 2ZM6E 4KQVA 4JG4A 2UXBI 4LFBE 1Z59A 4JI6I 4WFTA 4X64E 1Y4UA 3D4JA 4GEQB 4LFAE 4OX9E 1HNWI 4JI2E 3OTOE 2UUCE 2L8TA 1BKNA 2NUFA 2FV4B 1B63A 4UTGA 2LJHA 1DI2A 1U2RA 4ZVIA 4B3TE 3T1YI 4DR6E 2LMZA 1RREA 3HPZA 1S16A 3K17A 3ADLA 4F54A 1FJGI 4X62E 4BS9A 4IZJD 3J81C 1PKPA 2LTRA 2B3TB 3B82A 4Z7YA 1Z0BA 2O1VA 5IT9C 2RTXA 1A6FA 4UT4A 2O1UA 1IBME 5AE2A 2K4VA 2DEIA 5L3JA 1N36I 3GONA 2GQ0A 4HXZA 2YZTA 1NHJA 2HKJA 2Z5CA 3WU4A 2UXDI 1T4OA 3LPSA 4LF4E 2V2QA 4HYMA 4DPYA 1ZBTA 3IWDA 2V88A 4NXME 4DPTA 4JI4I 2FGGA 5GMDA 4DV0E 3T1HI 1GZ6A 3HULA 4B3SI 1N33E 5LMNE 2CZ9A 4LF9E 2DMYA 2XEXA 4LFBI 2X7IA 3LTOA 2J7KA 3LNUA 3LLHA 1ZM3A 3J80C 4JI5E 4X64I 4JYAE 2UUBE 4LFAI 4OX9I 1X48A 2HKEA 2RSMA 3OTOI 2UU9E 3C4TA 2UUCI 3DF6A 4AQYE 2PNMA 1D6TA 1H72C 4B3TI 2L6MA 4DR6I 4USMA 1XHKA 4DXLA 2V34A 1EA6A 4X62I 4LF6I 3KWRA 4MYTA 4DV7I 2V2ZA 4DR1I 1KVKA 3F6GA 3ZKDA 4KZSA 3PYEA 2EFGA 4BCAA 3HXLA 2VQEE 3IWCA 4LU9A 1XNQE 2LE2A 1HR0E 3VYYA 4DUYE 4DR5E 3ZM7A 5GMEA 1USVA 3V5RA 1T4NA 3JAMQ 3IWBA 2LRSA 1GQEA 5AE3A 4R1FA 4M2ZA 4LF4I 2V89A 4HACB 4NXMI 3H4LA 2LBSB 2B7TA 4DV0I 2Z5BA 1N33I 3MSWA 4LF9I 4P52A 2JVAA 2L2NA 4IZKA 4JI5I 2ZBKB 4JYAI 4MYUA 2UUBI 1MG7A 1HNXI 2L33A 2N3HA 4I3HA 1J26A 2UU9I 1KKHA 4B3SE 3PRYA 1H7UA 4M30A 1T4LB 4M1KA 4ED4A 4AQYI 2FTXB 1Z0VA 2KOUA 2A2CA 2HFUA 3F0NA 2V8QB 4KHPE 1FKAE 4DPXA 4WPYA 3VK6A 2G7HA 1X49A 2HHHI 4JI0E 3QT7A 1HK7A 4LF8E 4HY1A 2B9DA 3HPSA 1Z0WA 4URLA 1VISA 4FW9A 2VQEI 5IWAE 3P06A 2V86A 2L3JA 4LF6E 1XNQI 2L3CA 1HR0I 4DV7E 4DUYI 4DR5I 3WU3A 4DR1E 4X66E 1WUUA 1Z0CA 1YYWA 3M6AA 4F9AB 5F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADI A;  1N32 E;  3JAM C;  5FLX Q;  2UXC I;  1YZ9 A;  3P1X A;  4DV1 E;  1WHN A;  3VYX A;  1ELO A;  1DAR A;  1FWK A;  3ADJ A;  4RPF A;  4DV6 E;  1N0V C;  3QT5 A;  1ZM9 A;  1I94 E;  1X47 A;  1IBK E;  2F4V E;  2V2V A;  3V2U C;  1FI4 A;  4KHP I;  4LF5 E;  3B8H A;  4NXN E;  2RS7 A;  2DB2 A;  5LL6 R;  1HNX E;  4JI8 E;  4DPW A;  2UUA I;  4JI0 I;  4DR4 I;  1YYK A;  4LF8 I;  1N34 E;  1FWL A;  1N0U A;  2HK3 A;  1H74 A;  2LJP A;  3ZZT A;  4GKJ E;  4X65 E;  3QT8 A;  5IWA I;  3PYD A;  3C4B A;  2V8P A;  4GKK E;  4X66 I;  4PRV A;  2HHH E;  2Q2E B;  4EMD A;  1N32 I;  2LUQ A;  5A2Q Q;  3J7A M;  4DV1 I;  2KHX A;  2N3G A;  1QZR A;  1K47 A;  5FLX C;  4DV6 I;  1XMO E;  1I94 I;  1RR9 A;  1IBK I;  1MX0 A;  2F4V I;  4B3M I;  2UXC E;  2BM0 A;  2L2M A;  4Z7C A;  2E5L I;  4JI1 E;  4WUD A;  4LF5 I;  4NXN I;  4JI8 I;  3ZZU A;  1N34 I;  2NPF A;  1QU6 A;  2BV3 A;  1Z0G A;  1O0W A;  2X36 A;  1H7S A;  1ZXM A;  4GKJ I;  4X65 I;  5LMU E;  1IBL E;  3K1J A;  1YYO A;  4LF7 E;  4X8W A;  4GKK I;  3WU5 A;  1EKZ A;  3Q1Q A;  2UUA E;  4DR7 E;  4DV5 E;  4FWH A;  4DR4 E;  2VF3 A;  2B7V A;  3WU6 A;  4YY3 I;  1Z5C A;  1Z5A A;  4B3R E;  1OJ4 A;  3PYF A;  4DU8 A;  2L2K B;  1HNZ E;  4WYQ B;  2OI2 A;  3CWV A;  2HK2 A;  2DEJ A;  2NUG A;  1H73 A;  4PU9 A;  5A2Q C;  4JV5 E;  1J5E E;  1XMO I;  4WUC A;  4FN5 A;  4HAC A;  1XMQ E;  4DR2 E;  4LFC E;  3ADG A;  1ZM2 A;  4DR3 E;  4YHH I;  4DPU A;  4JI1 I;  1FNM A;  1UEK A;  3HTX A;  2EZ6 A;  4FWD A;  4B3M E;  1B62 A;  4JI3 E;  2JY9 A;  4FWG A;  1NHH A;  2GS8 A;  5BR8 E;  2RS6 A;  2E5L E;  5LMU I;  3ZZ0 A;  1IBL I;  2BM1 A;  4LF7 I;  3J7A G;  4DV2 I;  2DIX A;  1S4E A;  4DR7 I;  4DV5 I;  1Z0E A;  4DUZ E;  1RQ0 A;  4P7A A;  4JI7 E;  4DV4 I;  2VQF E;  2ZIT A;  4B3R I;  1UHZ A;  2ZM6 I;  1KIJ A;  1MU5 A;  4XTJ A;  1HNZ I;  2NA2 A;  4DV3 E;  1PVG A;  2A2D A;  2NUE A;  3J7Y p;  4DU7 A;  4DKK A;  2AJ4 A;  4K0K E;  4JV5 I;  1J5E I;  4JI2 I;  1XNR E;  4YY3 E;  1XMQ I;  4DR2 I;  4LFC I;  2UXB E;  3B78 A;  4DR3 I;  4JI6 E;  1STU A;  2R42 A;  2MDR A;  4OOG C;  1Z0T A;  1HNW E;  4USK A;  2LTS A;  3PYG A;  3J81 Q;  2CPN A;  2IHR 1;  4JI3 I;  3T1Y E;  2YT4 A;  4YHH E;  5BR8 I;  1IBM I;  1FJG E;  1ZM4 A;  2R3V A;  5IT9 Q;  1PIE A;  3QT6 A;  5CFF E;  1Z5B A;  1RC7 A;  4DUZ I;  1EI1 A;  1KTV A;  1WHQ A;  1NHI A;  4JI7 I;  1UIL A;  1ZXN A;  2VQF I;  4PRX A;  5LMN I;  1N36 E;  4WUB A;  1NZ0 A;  4DV3 I;  3ZKB A;  2LUP B;  2HFS A;  4DV2 E;  2UXD E;  2E1R A;  4K0K I;  4JI4 E;  2WW4 A;  3J80 Q;  4DV4 E;  1XNR I;  3T1H E;  2ZM6 E;  4KQV A;  4JG4 A;  2UXB I;  4LFB E;  1Z59 A;  4JI6 I;  4WFT A;  4X64 E;  3D4J A;  4LFA E;  4OX9 E;  1HNW I;  4JI2 E;  3OTO E;  2UUC E;  1BKN A;  2NUF A;  1B63 A;  4UTG A;  2LJH A;  1DI2 A;  1U2R A;  4ZVI A;  4B3T E;  3T1Y I;  4DR6 E;  1RRE A;  1S16 A;  3K17 A;  3ADL A;  1FJG I;  4X62 E;  3J81 C;  1PKP A;  2LTR A;  2B3T B;  3B82 A;  4Z7Y A;  1Z0B A;  5IT9 C;  2RTX A;  1A6F A;  4UT4 A;  1IBM E;  2DEI A;  5L3J A;  1N36 I;  3GON A;  4HXZ A;  1NHJ A;  2HKJ A;  3WU4 A;  2UXD I;  1T4O A;  3LPS A;  4LF4 E;  2V2Q A;  4HYM A;  4DPY A;  1ZBT A;  4JI4 I;  4NXM E;  4DPT A;  5GMD A;  4DV0 E;  3T1H I;  3HUL A;  4B3S I;  1N33 E;  5LMN E;  2CZ9 A;  4LF9 E;  2DMY A;  2XEX A;  4LFB I;  2X7I A;  3LTO A;  2J7K A;  3LNU A;  3LLH A;  1ZM3 A;  3J80 C;  4JI5 E;  4X64 I;  4JYA E;  2UUB E;  4LFA I;  4OX9 I;  1X48 A;  2HKE A;  2RSM A;  3OTO I;  2UU9 E;  3C4T A;  2UUC I;  4AQY E;  1D6T A;  1H72 C;  4B3T I;  4DR6 I;  4USM A;  1XHK A;  4DXL A;  2V34 A;  1EA6 A;  4X62 I;  4LF6 I;  4MYT A;  4DV7 I;  2V2Z A;  4DR1 I;  1KVK A;  3ZKD A;  3PYE A;  2EFG A;  2VQE E;  1XNQ E;  1HR0 E;  3VYY A;  4DUY E;  4DR5 E;  3ZM7 A;  5GME A;  3V5R A;  3JAM Q;  1T4N A;  2LRS A;  1GQE A;  4R1F A;  4M2Z A;  4LF4 I;  4HAC B;  4NXM I;  3H4L A;  2LBS B;  2B7T A;  4DV0 I;  1N33 I;  4LF9 I;  4P52 A;  2JVA A;  2L2N A;  4JI5 I;  2ZBK B;  4JYA I;  4MYU A;  2UUB I;  1MG7 A;  1HNX I;  2L33 A;  2N3H A;  4I3H A;  1J26 A;  2UU9 I;  1KKH A;  4B3S E;  1H7U A;  4M30 A;  1T4L B;  4M1K A;  4ED4 A;  4AQY I;  1Z0V A;  2A2C A;  2HFU A;  3F0N A;  4KHP E;  1FKA E;  4DPX A;  1X49 A;  2HHH I;  4JI0 E;  3QT7 A;  4LF8 E;  4HY1 A;  1Z0W A;  4URL A;  1VIS A;  4FW9 A;  2VQE I;  5IWA E;  2L3J A;  4LF6 E;  1XNQ I;  2L3C A;  1HR0 I;  4DV7 E;  4DUY I;  4DR5 I;  3WU3 A;  4DR1 E;  4X66 E;  1WUU A;  1Z0C A;  1YYW A;  3M6A A; 
#chains in the Genus database with same CATH topology
 5K36 D;  2CT1 A;  3ADI A;  3HJC A;  1N32 E;  2Q8U A;  2YTQ A;  3JAM C;  4FW7 A;  3ZOQ B;  1YUJ A;  1GTK A;  1YZ9 A;  5FLX Q;  2UXC I;  3P1X A;  4DV1 E;  1WHN A;  1PJQ A;  2JWO A;  3VYX A;  4O43 A;  2MC5 A;  4RHB B;  1ELO A;  1DAR A;  4ZYH A;  2BR2 B;  3MHH C;  2LV2 A;  1FWK A;  3ADJ A;  4R03 A;  4RPF A;  2EN7 A;  4DV6 E;  3F6H A;  5JEA E;  2CTD A;  2LVH A;  1N0V C;  2M9A A;  3QT5 A;  1ZM9 A;  1EH7 A;  1I94 E;  1X47 A;  1LLM C;  3B8H A;  1Y4S A;  1IBK E;  2EMF A;  2F4V E;  2V2V A;  2KON A;  2ODR D;  2LO3 A;  3V2U C;  1FI4 A;  2O1W A;  2M1S A;  2EL5 A;  4HTG A;  4KHP I;  3PS2 A;  4LF5 E;  4Q28 A;  4BMJ A;  4NXN E;  2DSY A;  2ADR A;  1ZU1 A;  2RS7 A;  4P78 A;  4R8O A;  4TUI A;  5T6J A;  2DB2 A;  5LL6 R;  2WNR B;  4LPF A;  1HNX E;  4O5G A;  4JI8 E;  3EPJ A;  4DPW A;  2EPR A;  2NN6 A;  4IZJ B;  2UUA I;  4JI0 I;  2EM5 A;  3OML A;  2WCC 3;  2YTO A;  1YYK A;  4WX9 A;  1OYP A;  1USU A;  4DR4 I;  4LF8 I;  1N34 E;  2J7J A;  1FWL A;  1N0U A;  2HK3 A;  5AE1 A;  1H74 A;  2LJP A;  3ZZT A;  2HGH A;  5K36 E;  4GKJ E;  2VF1 A;  3JTZ A;  4X65 E;  2WP8 A;  3QT8 A;  2AE8 A;  4QNJ A;  5C0X D;  4ZYD A;  4J8Z A;  5DRO A;  5IWA I;  1XXE A;  4OO1 A;  5A6A A;  3EPK A;  3PYD A;  2EE8 A;  2EOE A;  3AV0 A;  3C4B A;  4F9B B;  2V8P A;  4LCH A;  5DRR A;  1TF6 A;  4GKK E;  4X66 I;  4L8N A;  2MKD A;  4PRV A;  2HHH E;  4MLQ A;  3B4T A;  2JP9 A;  2YRM A;  2Q2E B;  4OKG A;  2ODR C;  2JOB A;  2VRD A;  1TF3 A;  4EMD A;  2EMG A;  3EPL A;  2RQL A;  2PO0 B;  1N32 I;  2LUQ A;  5A2Q Q;  3J7A M;  2V83 A;  4DV1 I;  2KHX A;  5TSE A;  1IQS A;  5ELW A;  2N3G A;  1T38 A;  2EPU A;  5EL9 A;  2N8X A;  2RPC A;  1QZR A;  1VI7 A;  1K47 A;  4R2P A;  2E1M A;  5FLX C;  4DV6 I;  1XMO E;  2PO1 B;  1I94 I;  4WSP A;  1RR9 A;  2JR1 A;  3KZY A;  1IBK I;  1WRJ A;  1MX0 A;  3H09 A;  2C38 B;  2F4V I;  4B3M I;  2UXC E;  2CGE A;  5JEA F;  2BM0 A;  2L2M A;  2LT7 A;  2GO4 A;  2PO2 B;  4Z7C A;  5C0X E;  1G2F C;  4JI1 E;  2E5L I;  2NN6 D;  4BC9 A;  4R2E A;  4WUD A;  4LF5 I;  4NXN I;  1EH8 A;  3THN A;  2NAB A;  4JI8 I;  5IV8 B;  3CDJ A;  2IOQ A;  4FW3 A;  2EL6 A;  2M7Q A;  3ZZU A;  1ZR9 A;  2GO3 A;  4NBQ A;  2EPM X;  2YSP A;  2NPF A;  1N34 I;  4OO1 D;  1QU6 A;  2BV3 A;  1Z0G A;  1O0W A;  3HKM A;  2X36 A;  5DNY A;  1H7S A;  1ZXM A;  2EPK X;  1YPN A;  1BBO A;  3GCM A;  4M9V C;  5LMU E;  1OYS A;  1IBL E;  3PS1 A;  4X65 I;  4GKJ I;  3K1J A;  3HQ1 A;  1YYO A;  1A1I A;  2WZO A;  2YU8 A;  4LF7 E;  4X8W A;  1A1L A;  3EPH A;  2Z5C B;  4GKK I;  4F9C B;  3WU5 A;  1EKZ A;  3Q1Q A;  2UUA E;  4DR7 E;  2PNZ B;  4DV5 E;  2JE6 A;  4DR4 E;  4FWH A;  4AM3 A;  2VF3 A;  2B7V A;  2JYA A;  2C39 A;  2R1F A;  4F6M A;  3WU6 A;  4M0V A;  3L00 A;  4YY3 I;  2L92 A;  1Z5C A;  1Y60 A;  5DRQ A;  2EPL X;  1Z5A A;  4B3R E;  1OJ4 A;  2BA1 D;  2J65 A;  3PYF A;  2JOX A;  4DU8 A;  1RHY A;  2L2K B;  2NN6 C;  1HNZ E;  1N3G A;  4WYQ B;  2BA1 G;  2OI2 A;  3CWV A;  2HK2 A;  2F8B A;  1RMD A;  2NN6 E;  4MLV A;  2DEJ A;  2NUG A;  2HJJ A;  1H73 A;  4PU9 A;  4IFD E;  3C6M A;  2EN2 A;  5A2Q C;  2EN6 A;  1PDA A;  2GHF A;  1J5E E;  4JV5 E;  1XMO I;  4WUC A;  3Q6M A;  4FN5 A;  4HAC A;  1XMQ E;  4P7D A;  4DR2 E;  4LFC E;  2DLK A;  4L5N C;  3ADG A;  1ZM2 A;  2VE7 C;  4LCG A;  1UDQ A;  4IFD B;  4OO1 E;  5KL4 A;  4DR3 E;  4I8O A;  5A6J A;  4YHH I;  2YTI A;  4DPU A;  3GME A;  1WXR A;  4JI1 I;  1FNM A;  3ECR A;  1UEK A;  2YU5 A;  2JPA A;  1NCS A;  1IMU A;  3HTX A;  2EZ6 A;  4FWD A;  2CVE A;  4BC7 A;  2EPA A;  4AID A;  1P47 A;  5C0X F;  3GLL A;  3M85 G;  4MU4 A;  5JEA B;  1KYQ A;  4B3M E;  4BA1 B;  1B62 A;  4JI3 E;  2JY9 A;  4FWG A;  1NHH A;  1A1H A;  2GS8 A;  5BR8 E;  2ENA A;  5AAS A;  2RS6 A;  2E5L E;  2MKN A;  1UDN A;  3ZZ0 A;  4OZE A;  5LMU I;  1IBL I;  2JEA A;  3MHS C;  4BBY A;  2BM1 A;  4LF7 I;  2MC6 A;  2DRP A;  2V87 A;  3J7A G;  4FW5 A;  1G2D C;  3M7N G;  4LTY A;  4DV2 I;  2DIX A;  1TN9 A;  1S4E A;  4DR7 I;  4DV5 I;  1Z0E A;  4DMI A;  4DUZ E;  2JEB B;  3P3G A;  3DJW A;  1RQ0 A;  4FW6 A;  1KJK A;  4P7A A;  4ZYE A;  2EMZ A;  2Z5B B;  4LCF A;  4JI7 E;  2F1D A;  4DV4 I;  4IJD A;  2VQF E;  2ZIT A;  4B3R I;  1UHZ A;  2ZM6 I;  1KIJ A;  3K85 A;  1MU5 A;  5K36 B;  3Q6N A;  4XTJ A;  2NA2 A;  1HNZ I;  3AUZ A;  4DV3 E;  4IZK B;  2EN3 A;  1PVG A;  4IS1 C;  2A2D A;  1R6L A;  4WXD A;  2NUE A;  4MU3 A;  3J7Y p;  5KL3 A;  4DKK A;  2AJ4 A;  4DU7 A;  1ZBQ A;  2EP3 A;  3JU0 A;  4K0K E;  3CDI A;  4U3B A;  1SR9 A;  1J5E I;  2O1T A;  4JI2 I;  4JV5 I;  2DGC A;  1XNR E;  4YY3 E;  1XMQ I;  4DR2 I;  4LFC I;  2UXB E;  3B78 A;  2IER A;  4DR3 I;  2EM8 A;  4IFD F;  4JI6 E;  3U1Y A;  1STU A;  2C37 B;  1JK2 A;  2R42 A;  2MDR A;  1UDO A;  1E3H A;  2V85 A;  4OOG C;  1Z0T A;  2BR2 A;  2H36 X;  3FIG A;  2IOP A;  3L7Z B;  1A1F A;  2EMK A;  1HNW E;  4USK A;  3RMP A;  5FWK A;  1EH6 A;  2R76 A;  2LTS A;  2EM3 A;  3PYG A;  3J81 Q;  2DMI A;  1A1J A;  2CPN A;  2IHR 1;  4JI3 I;  3T1Y E;  2EWL A;  2YT4 A;  4MDT A;  4MQY A;  3U1K A;  4YHH E;  2YTG A;  5BR8 I;  1X6F A;  1IBM I;  4O4K A;  1FJG E;  1ZM4 A;  2WBU A;  2PNL A;  2EQ3 A;  2R3V A;  4X9J A;  5IT9 Q;  4WSG A;  2WNR A;  5C0X B;  1PIE A;  3QT6 A;  1Z1B A;  2M4I A;  5CFF E;  2ELZ A;  2YTJ A;  4R2S A;  1UDS A;  1DQ3 A;  2EMX A;  4IZJ A;  2EOO A;  1Z5B A;  1RC7 A;  4BA2 B;  4DUZ I;  1EI1 A;  4ISA A;  1KTV A;  4TUG A;  2IES A;  1WHQ A;  1NHI A;  2Z5E A;  4JI7 I;  1UIL A;  3UK3 C;  1ZXN A;  1UN6 B;  2VQF I;  4PRX A;  3K6Q A;  5LMN I;  1X5W A;  1N36 E;  2CG9 A;  2EQ1 A;  2RSI A;  1BB8 A;  1X6E A;  4WUB A;  1A1G A;  1NZ0 A;  1A1K A;  4DV3 I;  5K36 F;  4R2Q A;  4FK5 C;  3ZKB A;  2LUP B;  4GQU A;  1Y6Z A;  2HFS A;  4DV2 E;  2UXD E;  2EMY A;  4N3O A;  3THO B;  3LML A;  2E1R A;  5ADZ A;  4K0K I;  4JI4 E;  2WW4 A;  2YTN A;  1R6M A;  2YTF A;  2EM9 A;  2EMI A;  1X3C A;  1ZAA C;  3J80 Q;  4DV4 E;  4JI4 I;  3T1H E;  5AC4 A;  2EN1 A;  1XNR I;  5IXM B;  2ZM6 E;  4KQV A;  2MDG A;  2PO0 A;  4JG4 A;  2UXB I;  1NEI A;  4LFB E;  3KZZ A;  1Z59 A;  4JI6 I;  4WFT A;  2YSO A;  3M99 B;  4J3D A;  2EML A;  4X64 E;  1Y4U A;  3D4J A;  2HC5 A;  2I13 A;  5JEA D;  2EPO A;  4GEQ B;  3VHT B;  4LFA E;  4OX9 E;  2NN6 B;  1DGC A;  2LCE A;  1HNW I;  4N4R B;  4JI2 E;  1WJP A;  3OTO E;  2PO1 A;  2UUC E;  2L8T A;  1BKN A;  2NUF A;  2FV4 B;  3C6K A;  2EMH A;  2LJH A;  1DI2 A;  1B63 A;  1U2R A;  2C38 A;  4B3T E;  2ENH A;  2EOQ A;  4UTG A;  4DR6 E;  4ZVI A;  2WP8 B;  3T1Y I;  2JT2 A;  2LMZ A;  1RRE A;  3HPZ A;  1S16 A;  3K17 A;  3ADL A;  4F54 A;  1AAY A;  2PO2 A;  4OO1 B;  4X62 E;  4BS9 A;  1FJG I;  4IZJ D;  3J81 C;  1PKP A;  2EOZ A;  3M85 D;  5A6K A;  2LTR A;  2B3T B;  4WXC A;  1P42 A;  2K7I A;  1B69 A;  4IFD C;  2EOJ A;  2EOM A;  5KL6 A;  4O24 A;  2EM4 A;  3BF2 A;  3B82 A;  1Z0B A;  5KL7 A;  4QNK A;  3BGH A;  2O1V A;  4Z7Y A;  2EPC A;  5IT9 C;  5DNL A;  4AIM A;  2RTX A;  1L4S A;  1A6F A;  4UT4 A;  4RH8 A;  2O1U A;  1IBM E;  5AE2 A;  3P76 A;  2K4V A;  1QNT A;  2YTE A;  2DEI A;  5L3J A;  1N36 I;  3M7N D;  5A6B A;  4NZV A;  3GON A;  2GQ0 A;  4HXZ A;  1PJS A;  2YZT A;  1NHJ A;  2HKJ A;  5JEA C;  2Z5C A;  3WU4 A;  2EOI A;  2UXD I;  1T4O A;  4BHC A;  3LPS A;  4LF4 E;  2PNZ A;  2DLQ A;  2V2Q A;  4GZN C;  1ZBT A;  3IWD A;  2V88 A;  4NXM E;  4HYM A;  4DPY A;  2FGG A;  5GMD A;  4DPT A;  5DNX A;  4DV0 E;  3T1H I;  1GZ6 A;  3HUL A;  4B3S I;  4R2D A;  1N33 E;  5LMN E;  2CZ9 A;  4LF9 E;  2DMY A;  3H1C A;  2XEX A;  4LFB I;  2X7I A;  4HEI A;  2EM2 A;  3LTO A;  2J7K A;  2A25 A;  2EPZ A;  3LNU A;  3LLH A;  2D9H A;  1ZM3 A;  4MU0 A;  3QG5 C;  5KL2 A;  3J80 C;  4JI5 E;  4X64 I;  2BBG A;  2GPI A;  4JYA E;  2UUB E;  5EKW A;  3EQ1 A;  4LFA I;  1PJT A;  2E72 A;  4OX9 I;  4R2R A;  3BID A;  1X48 A;  2NN6 F;  2HKE A;  2RSM A;  3DD6 A;  3OTO I;  2UU9 E;  3C4T A;  1JK1 A;  2UUC I;  3DF6 A;  5K36 C;  4AQY E;  2PNM A;  1D6T A;  1H72 C;  1Y5Y A;  4IS9 A;  4B3T I;  4U3D A;  2L6M A;  2CSH A;  4DR6 I;  4IFD A;  4USM A;  1XHK A;  1MEY C;  4DXL A;  2LJU A;  2V34 A;  5DRP A;  2I9I A;  1EA6 A;  4FW4 A;  4X62 I;  4LF6 I;  4OO1 F;  3KWR A;  4MYT A;  4DV7 I;  5KL5 A;  2V2Z A;  4DR1 I;  1KVK A;  2EQ0 A;  2EPX A;  3F6G A;  2JE6 B;  3ZKD A;  4KZS A;  2C39 B;  4KWY A;  3PYE A;  5JEA A;  2YTD A;  5A6B D;  4BA1 A;  2EFG A;  4BCA A;  2EMA A;  3HXL A;  2YWQ A;  2VQE E;  2EOR A;  3IWC A;  4LU9 A;  1XNQ E;  2LE2 A;  2EM6 A;  1AH5 A;  3VYY A;  4DUY E;  4DR5 E;  1F2I G;  1HR0 E;  4LOM A;  3ZM7 A;  4F2J C;  2EOF A;  5GME A;  3UHM A;  1USV A;  3V5R A;  1T4N A;  1BBG A;  3JAM Q;  3IWB A;  1IQO A;  2LRS A;  1GQE A;  1X6H A;  5AE3 A;  4R1F A;  4M2Z A;  5LLQ A;  1YH8 A;  4LF4 I;  2V89 A;  4HAC B;  4NXM I;  2YRK A;  2JEB A;  2EPP A;  1YSA C;  2LBS B;  3H4L A;  4R2A A;  2B7T A;  4DV0 I;  2Z5B A;  2EM0 A;  1N33 I;  3MSW A;  4LF9 I;  2EM7 A;  5C0X C;  4F6N A;  2ENC A;  3P3C A;  4P52 A;  5K36 A;  2JVA A;  2L2N A;  4IZK A;  2BA0 D;  4JI5 I;  2ZBK B;  4JYA I;  4MYU A;  1SFE A;  2WBS A;  2UUB I;  1MG7 A;  1HNX I;  2EMC A;  2L33 A;  4MU1 A;  2N3H A;  4I3H A;  3TQM A;  1E3P A;  2BA0 G;  1J26 A;  2EPN A;  2EN4 A;  4IFD D;  5A69 A;  2UU9 I;  1KKH A;  3BBG A;  4Q35 B;  4B3S E;  3PRY A;  1H7U A;  3NZK A;  4M30 A;  1T4L B;  4M1K A;  4ED4 A;  4AQY I;  1UBD C;  2FTX B;  1YFH A;  2EMW A;  2KOU A;  1Z0V A;  2A2C A;  1YUI A;  2HFU A;  3F0N A;  2O3Z A;  2JEA B;  2ELY A;  2EOX A;  2YTP A;  2V8Q B;  4KHP E;  1YHC A;  2C37 A;  2EMB A;  1FKA E;  4OO1 C;  2EOH A;  4DPX A;  4NHR A;  4WPY A;  3VK6 A;  2G7H A;  2PRT A;  1MGT A;  2EJ4 A;  1X49 A;  3L7Z A;  2HHH I;  4JI0 E;  3QT7 A;  2YRH A;  1HK7 A;  4LF8 E;  4BHB A;  4HY1 A;  2JXP A;  5AC5 A;  2B9D A;  2BB8 A;  3HPS A;  2EOY A;  1Z0W A;  4URL A;  2EL4 A;  1VIS A;  4FW9 A;  2VQE I;  5IWA E;  3P06 A;  2V86 A;  2WBT A;  2L3J A;  4LF6 E;  1XNQ I;  2L3C A;  1HR0 I;  4DV7 E;  1T39 A;  3P3E A;  4DUY I;  4DR5 I;  2GLI A;  3WU3 A;  3PS3 A;  4DR1 E;  4X66 E;  1WUU A;  3KRN A;  5C0X A;  2VES A;  1Z0C A;  1YYW A;  2EOS A;  4BA2 A;  3M6A A;  4F9A B;  2EN8 A;  4R2C A;  4ZYG A;  2YPN A;  5F3W A;  1OYR A; 
#chains in the Genus database with same CATH homology
 3ADI A;  3HJC A;  1N32 E;  3JAM C;  5FLX Q;  3ZOQ B;  2UXC I;  1YZ9 A;  3P1X A;  4DV1 E;  1WHN A;  2JWO A;  3VYX A;  2MC5 A;  1ELO A;  1DAR A;  1FWK A;  3ADJ A;  4R03 A;  4RPF A;  4DV6 E;  3F6H A;  1N0V C;  3QT5 A;  1ZM9 A;  1I94 E;  1X47 A;  1Y4S A;  1IBK E;  2F4V E;  2V2V A;  2KON A;  2ODR D;  3V2U C;  1FI4 A;  2O1W A;  2M1S A;  4KHP I;  4LF5 E;  4Q28 A;  4BMJ A;  4NXN E;  2DSY A;  4R8O A;  2RS7 A;  3B8H A;  4P78 A;  4TUI A;  5T6J A;  2DB2 A;  5LL6 R;  1HNX E;  4JI8 E;  4DPW A;  4IZJ B;  2UUA I;  4JI0 I;  3OML A;  4DR4 I;  1YYK A;  1USU A;  4LF8 I;  1N34 E;  1FWL A;  1N0U A;  2HK3 A;  5AE1 A;  1H74 A;  2LJP A;  3ZZT A;  4GKJ E;  2VF1 A;  3JTZ A;  4X65 E;  3QT8 A;  4J8Z A;  5IWA I;  3PYD A;  3AV0 A;  3C4B A;  4F9B B;  2V8P A;  4GKK E;  4X66 I;  4L8N A;  4PRV A;  2HHH E;  2Q2E B;  2ODR C;  2JOB A;  4EMD A;  1N32 I;  2LUQ A;  5A2Q Q;  3J7A M;  2V83 A;  4DV1 I;  2KHX A;  2N3G A;  1QZR A;  1K47 A;  2E1M A;  5FLX C;  4DV6 I;  1XMO E;  1I94 I;  4WSP A;  1RR9 A;  2JR1 A;  1IBK I;  1MX0 A;  3H09 A;  2F4V I;  4B3M I;  2UXC E;  2CGE A;  2BM0 A;  2L2M A;  4Z7C A;  2E5L I;  4JI1 E;  4BC9 A;  4WUD A;  4LF5 I;  4NXN I;  4JI8 I;  2IOQ A;  2M7Q A;  3ZZU A;  1N34 I;  2NPF A;  1QU6 A;  2BV3 A;  1Z0G A;  1O0W A;  2X36 A;  5DNY A;  1H7S A;  1ZXM A;  4GKJ I;  4X65 I;  5LMU E;  1IBL E;  3K1J A;  3HQ1 A;  1YYO A;  2WZO A;  4LF7 E;  4X8W A;  2Z5C B;  4GKK I;  4F9C B;  3WU5 A;  1EKZ A;  3Q1Q A;  2UUA E;  4DR7 E;  4DV5 E;  4FWH A;  4DR4 E;  2VF3 A;  2B7V A;  3WU6 A;  4M0V A;  4YY3 I;  2L92 A;  1Z5C A;  1Z5A A;  4B3R E;  1OJ4 A;  3PYF A;  2JOX A;  4DU8 A;  2L2K B;  1HNZ E;  4WYQ B;  2OI2 A;  3CWV A;  2HK2 A;  2F8B A;  2DEJ A;  2NUG A;  1H73 A;  4PU9 A;  5A2Q C;  4JV5 E;  1J5E E;  1XMO I;  4WUC A;  3Q6M A;  4FN5 A;  4HAC A;  1XMQ E;  4P7D A;  4DR2 E;  4LFC E;  4L5N C;  3ADG A;  1ZM2 A;  2VE7 C;  4DR3 E;  4I8O A;  4YHH I;  4DPU A;  1WXR A;  4JI1 I;  1FNM A;  1UEK A;  3HTX A;  2EZ6 A;  4FWD A;  4BC7 A;  4B3M E;  1B62 A;  4JI3 E;  2JY9 A;  4FWG A;  1NHH A;  2GS8 A;  5BR8 E;  5AAS A;  2RS6 A;  2E5L E;  5LMU I;  3ZZ0 A;  1IBL I;  4BBY A;  2BM1 A;  4LF7 I;  2MC6 A;  2V87 A;  3J7A G;  4LTY A;  4DV2 I;  2DIX A;  1S4E A;  4DR7 I;  4DV5 I;  1Z0E A;  4DMI A;  4DUZ E;  3DJW A;  1RQ0 A;  4P7A A;  2Z5B B;  4JI7 E;  4DV4 I;  2VQF E;  2ZIT A;  4B3R I;  1UHZ A;  2ZM6 I;  1KIJ A;  3K85 A;  1MU5 A;  3Q6N A;  4XTJ A;  2NA2 A;  1HNZ I;  3AUZ A;  4DV3 E;  4IZK B;  1PVG A;  2A2D A;  2NUE A;  3J7Y p;  4DU7 A;  4DKK A;  2AJ4 A;  1ZBQ A;  3JU0 A;  4K0K E;  4JV5 I;  1SR9 A;  1J5E I;  2O1T A;  4JI2 I;  1XNR E;  4YY3 E;  1XMQ I;  4DR2 I;  4LFC I;  2UXB E;  3B78 A;  4DR3 I;  4JI6 E;  1STU A;  2R42 A;  2MDR A;  2V85 A;  4OOG C;  1Z0T A;  2H36 X;  3FIG A;  2IOP A;  1HNW E;  4USK A;  3RMP A;  5FWK A;  2LTS A;  3PYG A;  3J81 Q;  2CPN A;  2IHR 1;  4JI3 I;  3T1Y E;  2EWL A;  2YT4 A;  4YHH E;  5BR8 I;  1IBM I;  1FJG E;  1ZM4 A;  2PNL A;  2R3V A;  5IT9 Q;  1PIE A;  3QT6 A;  2M4I A;  5CFF E;  1DQ3 A;  4IZJ A;  1Z5B A;  1RC7 A;  4DUZ I;  1EI1 A;  1KTV A;  4TUG A;  1WHQ A;  1NHI A;  2Z5E A;  4JI7 I;  1UIL A;  1ZXN A;  2VQF I;  4PRX A;  3K6Q A;  5LMN I;  1N36 E;  2CG9 A;  4WUB A;  1NZ0 A;  4DV3 I;  3ZKB A;  2LUP B;  1Y6Z A;  2HFS A;  4DV2 E;  2UXD E;  4N3O A;  3LML A;  2E1R A;  5ADZ A;  4K0K I;  4JI4 E;  2WW4 A;  3J80 Q;  4DV4 E;  1XNR I;  3T1H E;  2ZM6 E;  4KQV A;  4JG4 A;  2UXB I;  4LFB E;  1Z59 A;  4JI6 I;  4WFT A;  4X64 E;  1Y4U A;  3D4J A;  4GEQ B;  4LFA E;  4OX9 E;  1HNW I;  4JI2 E;  3OTO E;  2UUC E;  2L8T A;  1BKN A;  2NUF A;  2FV4 B;  1B63 A;  4UTG A;  2LJH A;  1DI2 A;  1U2R A;  4ZVI A;  4B3T E;  3T1Y I;  4DR6 E;  2LMZ A;  1RRE A;  3HPZ A;  1S16 A;  3K17 A;  3ADL A;  4F54 A;  1FJG I;  4X62 E;  4BS9 A;  4IZJ D;  3J81 C;  1PKP A;  2LTR A;  2B3T B;  3B82 A;  4Z7Y A;  1Z0B A;  2O1V A;  5IT9 C;  2RTX A;  1A6F A;  4UT4 A;  2O1U A;  1IBM E;  5AE2 A;  2K4V A;  2DEI A;  5L3J A;  1N36 I;  3GON A;  2GQ0 A;  4HXZ A;  2YZT A;  1NHJ A;  2HKJ A;  2Z5C A;  3WU4 A;  2UXD I;  1T4O A;  3LPS A;  4LF4 E;  2V2Q A;  4HYM A;  4DPY A;  1ZBT A;  3IWD A;  2V88 A;  4NXM E;  4DPT A;  4JI4 I;  2FGG A;  5GMD A;  4DV0 E;  3T1H I;  1GZ6 A;  3HUL A;  4B3S I;  1N33 E;  5LMN E;  2CZ9 A;  4LF9 E;  2DMY A;  2XEX A;  4LFB I;  2X7I A;  3LTO A;  2J7K A;  3LNU A;  3LLH A;  1ZM3 A;  3J80 C;  4JI5 E;  4X64 I;  4JYA E;  2UUB E;  4LFA I;  4OX9 I;  1X48 A;  2HKE A;  2RSM A;  3OTO I;  2UU9 E;  3C4T A;  2UUC I;  3DF6 A;  4AQY E;  2PNM A;  1D6T A;  1H72 C;  4B3T I;  2L6M A;  4DR6 I;  4USM A;  1XHK A;  4DXL A;  2V34 A;  1EA6 A;  4X62 I;  4LF6 I;  3KWR A;  4MYT A;  4DV7 I;  2V2Z A;  4DR1 I;  1KVK A;  3F6G A;  3ZKD A;  4KZS A;  3PYE A;  2EFG A;  4BCA A;  3HXL A;  2VQE E;  3IWC A;  4LU9 A;  1XNQ E;  2LE2 A;  1HR0 E;  3VYY A;  4DUY E;  4DR5 E;  3ZM7 A;  5GME A;  1USV A;  3V5R A;  1T4N A;  3JAM Q;  3IWB A;  2LRS A;  1GQE A;  5AE3 A;  4R1F A;  4M2Z A;  4LF4 I;  2V89 A;  4HAC B;  4NXM I;  3H4L A;  2LBS B;  2B7T A;  4DV0 I;  2Z5B A;  1N33 I;  3MSW A;  4LF9 I;  4P52 A;  2JVA A;  2L2N A;  4IZK A;  4JI5 I;  2ZBK B;  4JYA I;  4MYU A;  2UUB I;  1MG7 A;  1HNX I;  2L33 A;  2N3H A;  4I3H A;  1J26 A;  2UU9 I;  1KKH A;  4B3S E;  3PRY A;  1H7U A;  4M30 A;  1T4L B;  4M1K A;  4ED4 A;  4AQY I;  2FTX B;  1Z0V A;  2KOU A;  2A2C A;  2HFU A;  3F0N A;  2V8Q B;  4KHP E;  1FKA E;  4DPX A;  4WPY A;  3VK6 A;  2G7H A;  1X49 A;  2HHH I;  4JI0 E;  3QT7 A;  1HK7 A;  4LF8 E;  4HY1 A;  2B9D A;  3HPS A;  1Z0W A;  4URL A;  1VIS A;  4FW9 A;  2VQE I;  5IWA E;  3P06 A;  2V86 A;  2L3J A;  4LF6 E;  1XNQ I;  2L3C A;  1HR0 I;  4DV7 E;  4DUY I;  4DR5 I;  3WU3 A;  4DR1 E;  4X66 E;  1WUU A;  1Z0C A;  1YYW A;  3M6A A;  4F9A B;  5F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...