4DR7E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr7E02
4X62I 1XHKA 1FWKA 2HKEA 4JI3E 1WUUA 2DIXA 1EA6A 3H4LA 4LF8E 4JI8E 4JI6E 2RS7A 4DV3I 4ZVIA 4DUZI 2NUFA 1XMOE 1KKHA 1X49A 3CWVA 2HK2A 4JG4A 2VF3A 4DR6E 2VQFE 1DI2A 5GMEA 3JAMQ 4WYQB 1XMQI 3V2UC 3WU4A 4OX9I 2V2ZA 1PVGA 1IBKI 4JI0E 5LMUE 1I94I 1QU6A 2DB2A 2NUEA 4DV2E 3OTOE 1FWLA 5CFFE 2LJPA 3WU6A 4DKKA 2N3GA 4DR1I 2HKJA 1MG7A 1XNQE 4LF7E 1J26A 4B3MI 4GKJE 4XTJA 2UUAE 3F0NA 4PU9A 4B3SE 2OI2A 1BKNA 3D4JA 5LMNI 3LPSA 1UHZA 1HNWE 1T4OA 4FWHA 1ZM9A 4P52A 3PYEA 2ZM6E 1N0UA 2UXDI 1IBLE 2UXCI 4DV5I 5IWAE 3ZM7A 3ZZ0A 3PYFA 4DV7I 1H74A 2DMYA 4LF6E 4JYAI 3ZZTA 2JY9A 1H72C 3ADGA 1FJGI 2JVAA 1H73A 3PYGA 4DR4E 2BM0A 4Z7YA 2UUCE 4K0KE 2F4VE 3J7AG 1WHNA 4JI2I 3J81C 3M6AA 1ZXMA 1X47A 2VQEI 4ED4A 4USMA 4JI0I 5LMUI 3HULA 1UILA 2LUQA 5BR8I 3OTOI 1S16A 4LF5E 3J7Yp 4JI1E 2EZ6A 4B3RI 4MYUA 3J80Q 4M2ZA 1EI1A 4USKA 4B3TI 1Z5CA 4DR5E 4DPWA 2UUAI 2HFSA 4DPXA 3K17A 4HYMA 5A2QQ 3ADIA 1Z0BA 1ELOA 1RC7A 4JI5I 1Z0TA 4YY3E 4URLA 4PRVA 1HNZE 2A2CA 4LFBE 3C4BA 3Q1QA 4DV0E 3LNUA 3WU5A 4KHPI 2X7IA 3V5RA 3HTXA 2NA2A 3ZZUA 5L3JA 4DR2I 2WW4A 1N33I 2UXBE 3VYXA 1FKAE 4DR4I 4NXME 1RR9A 1X48A 4X66E 1U2RA 3JAMC 1ZM4A 2L3CA 1HNXE 1ZM3A 1Z0CA 4GKKE 3LTOA 4X65E 4K0KI 2RTXA 4DXLA 2F4VI 2L2MA 2J7KA 1Z59A 4I3HA 4NXNE 4WUDA 1ZBTA 1MU5A 2V2VA 3T1YE 2E1RA 4LFCI 2DEJA 1YZ9A 4DU8A 2B3TB 4LF5I 4DV4E 4DV1I 2LTSA 4HACA 4DUYI 2B7VA 1J5EE 1KVKA 4DPUA 2NUGA 2ZBKB 2UU9E 2RS6A 3T1HE 3WU3A 2L3JA 4Z7CA 2UUBE 4LF4E 2R42A 3QT7A 4PRXA 3QT5A 4JI4E 4JI3I 1XNRE 1HNZI 4LF8I 4JI8I 4JI6I 2E5LE 4DV0I 4X62E 1N34E 1XMOI 4DV6E 4UTGA 1WHQA 5FLXQ 1YYOA 2LRSA 4M30A 4DR6I 2VQFI 2EFGA 1RQ0A 1B62A 5FLXC 4DPYA 1FNMA 4JV5E 2AJ4A 1PKPA 1GQEA 4LFAE 4RPFA 1HNXI 4X65I 1XMQE 1N32E 4WUCA 4DV2I 3B82A 4OX9E 4UT4A 1A6FA 4NXNI 3ZKBA 1XNQI 4LF7I 2L2NA 4GKJI 3J80C 4X64E 4M1KA 5LL6R 4B3SI 3LLHA 3GONA 1J5EI 1T4NA 1NZ0A 2UU9I 1QZRA 3T1HI 4EMDA 1HNWI 2X36A 4R1FA 5A2QC 2UUBI 1HR0E 2BM1A 3PYDA 2ZM6I 1NHHA 1IBLI 4DR7E 1FI4A 4DU7A 5IWAI 1VISA 4LF6I 2V34A 2UXDE 4FW9A 2E5LI 2UXCE 1N36E 4FWGA 2HHHE 4HY1A 1IBME 1N34I 4DV7E 4YHHE 4FN5A 4DV6I 1UEKA 4JYAE 2N3HA 2MDRA 1FJGE 2UUCI 4OOGC 2V2QA 4JV5I 2YT4A 2DEIA 3B8HA 4LFAI 3VYYA 4LF9E 4AQYE 1N32I 4DR3E 1MX0A 1ZXNA 2V8PA 4JI2E 2VQEE 1B63A 4JI1I 1Z0GA 1H7SA 2CPNA 4JI7E 5BR8E 2R3VA 1KIJA 1EKZA 4X64I 4DR5I 1YYWA 4KQVA 1PIEA 4B3RE 3B78A 1ZM2A 1DARA 4X8WA 1Z0WA 4B3TE 1RREA 4YY3I 3ADJA 3ADLA 3QT6A 4WFTA 4P7AA 2L33A 1HR0I 1KTVA 2IHR1 2ZITA 4HACB 4LFBI 4JI5E 2Q2EB 4DR7I 2NPFA 1N36I 2L2KB 4DV3E 2HHHI 1H7UA 4DUZE 1IBMI 2UXBI 4KHPE 3ZKDA 4YHHI 4NXMI 2A2DA 4X66I 1NHJA 4DR2E 1T4LB 1N0VC 5IT9Q 2RSMA 2KHXA 4GKKI 3J7AM 1YYKA 1N33E 2LTRA 1Z0VA 4HXZA 5IT9C 1K47A 1IBKE 3J81Q 5GMDA 1I94E 4LF9I 2LUPB 1OJ4A 4AQYI 4DR3I 3C4TA 2BV3A 3T1YI 2LJHA 4DPTA 4DV4I 4DR1E 4JI7I 2B7TA 2CZ9A 1Z0EA 3QT8A 2LBSB 4LFCE 2XEXA 4B3ME 2GS8A 1S4EA 4FWDA 4DV1E 2HK3A 4LF4I 4DUYE 5LMNE 1NHIA 4JI4I 1D6TA 1Z5AA 3K1JA 2HFUA 3P1XA 1STUA 1XNRI 1O0WA 4MYTA 4WUBA 4DV5E 1Z5BA
chains in the Genus database with same CATH superfamily
4BCAA 4X62I 1XHKA 2LE2A 2JE6A 2FGGA 1FWKA 2HKEA 4IZKB 4JI3E 1WUUA 2DIXA 1EA6A 3H4LA 4LF8E 4P7DA 4JI8E 4JI6E 2RS7A 2EPLX 4GEQB 4ZYDA 4DV3I 4ZVIA 2G7HA 3PS3A 4DUZI 2NUFA 2EN6A 1UBDC 2NABA 1XMOE 1KKHA 1X49A 3CWVA 2JEBB 2HK2A 4DMIA 2YRKA 2Z5BA 2EM5A 1RHYA 4BA2A 1B69A 3BBGA 3RMPA 2EOYA 3TQMA 4ZYEA 4JG4A 2VF3A 4DR6E 2J7JA 2VQFE 1DI2A 5GMEA 1A1KA 2V89A 2YTNA 3JAMQ 3IWCA 4WYQB 1BBOA 4WSPA 1XMQI 3V2UC 2YRHA 2EM6A 5AASA 1YHCA 1HK7A 3WU4A 3B4TA 3HJCA 4WXDA 4OX9I 2DMIA 4R8OA 2V2ZA 1PVGA 2BA1G 3GCMA 1IBKI 4JI0E 5LMUE 1I94I 3PRYA 2BA0D 5DNLA 2NN6B 1QU6A 2DB2A 2JT2A 4IFDD 4NHRA 2CT1A 2K4VA 2NUEA 2EMXA 2CTDA 2C39B 2PNZA 5K36E 2JYAA 4DV2E 3OTOE 1SFEA 2V88A 4P78A 5A6KA 2ELYA 2EM9A 5CFFE 2YU8A 4R2SA 2C38A 2RPCA 4R2EA 4DKKA 2BR2B 2LJPA 4F9BB 3WU6A 2HJJA 2N3GA 2J65A 2DLQA 4DR1I 2HKJA 5T6JA 2Z5BB 4KWYA 1XNQE 1MG7A 3CDIA 3F6GA 4LF7E 2EMLA 4R2QA 4LPFA 1J26A 2C37B 4B3MI 2L92A 4GKJE 4XTJA 5K36C 5IXMB 2UUAE 3F0NA 4PU9A 4B3SE 2OI2A 1BKNA 1E3PA 2R76A 1R6MA 1UN6B 5K36F 2EM2A 3D4JA 5LMNI 4IFDB 1TF6A 1UDOA 3LPSA 1UHZA 2GPIA 5ELWA 1HNWE 2YZTA 1X6HA 2KONA 1TF3A 2L6MA 1T4OA 2E1MA 4FWHA 1ZM9A 4P52A 3UK3C 2WNRA 2EM3A 2EOOA 3PYEA 4F54A 2PO2A 2ZM6E 1N0UA 2C38B 5A69A 1IBLE 2UXDI 2NN6F 2YTFA 2UXCI 3VK6A 4OZEA 4DV5I 4F9CB 5IWAE 1UDNA 2EMZA 2EOMA 3ZM7A 3ZZ0A 3PYFA 4GKKI 4DV7I 1H74A 2DMYA 4LF6E 4O43A 1L4SA 4JYAI 3ZZTA 2JY9A 3ZOQB 4BS9A 4NZVA 1H72C 5FWKA 3ADGA 3VHTB 1FJGI 2JVAA 1H73A 2EWLA 2EMHA 3HQ1A 2JXPA 2MC5A 1A1HA 3PYGA 2YTJA 4DR4E 2BM0A 4IFDC 3GLLA 4Z7YA 4IJDA 5DNXA 3CDJA 2EOHA 3JU0A 2WBSA 3KRNA 4OO1B 4IFDF 1X5WA 2PO2B 2UUCE 2EOQA 3J7AG 2F4VE 1WHNA 1ZBQA 3J81C 4BC9A 4K0KE 3M6AA 1ZXMA 5C0XA 2JR1A 4LU9A 4JI2I 1X47A 2EJ4A 1R6LA 2PO0B 2VQEI 2PO1A 1WRJA 5LLQA 2YTOA 2EPCA 1G2DC 4ED4A 4USMA 4JI0I 2D9HA 5C0XD 5LMUI 2EPXA 2HC5A 3HULA 4TUGA 1UILA 2LUQA 5BR8I 1WXRA 3C6MA 3OTOI 4OKGA 1S16A 3L7ZA 4R03A 4LF5E 4IZJB 2JEAB 3J7Yp 1PJQA 2JOXA 2YTEA 4JI1E 2EZ6A 4M9VC 4B3RI 4MYUA 3J80Q 4M2ZA 3LMLA 5EL9A 2EPZA 1EI1A 2BB8A 4USKA 4IS1C 4B3TI 1YFHA 1Z5CA 2I13A 4DR5E 3EPLA 4DPWA 1TN9A 2HFSA 3DD6A 2UUAI 4OO1C 4O24A 4DPXA 1PJTA 2WBTA 2EPUA 2VE7C 2EPOA 3DJWA 3K17A 4HYMA 5A2QQ 2EMGA 3K85A 3ADIA 4OO1F 1Z0BA 1ELOA 1RC7A 2EN3A 2YTPA 4JI5I 2L8TA 1Z0TA 4YY3E 3EPJA 4N3OA 5A6AA 3M85D 2LCEA 2EE8A 5AC5A 3OMLA 4URLA 2WP8A 4PRVA 1HNZE 2A2CA 2JOBA 1A1FA 4L8NA 1E3HA 2ENAA 4LFBE 3Q6NA 3C4BA 4ZYGA 5C0XE 3Q1QA 2GLIA 4DV0E 3LNUA 3WU5A 4KHPI 2X7IA 2EOSA 2EMYA 3V5RA 2K7IA 2NA2A 2LO3A 3HTXA 3ZZUA 5L3JA 4DR2I 2AE8A 2LJUA 2WW4A 5K36B 2BA0G 3M7ND 2HGHA 2DGCA 1N33I 2UXBE 3VYXA 2MC6A 2EM0A 1FKAE 1MEYC 5C0XC 4DR4I 2EQ0A 4NXME 1RR9A 1X48A 1X6EA 2EQ1A 3JAMC 4X66E 1U2RA 1UDQA 1ZM4A 2DLKA 2JP9A 2L3CA 2ODRD 4R2DA 5C0XF 1HNXE 1SR9A 1ZM3A 4WX9A 2GO3A 5DRPA 1Z0CA 2JE6B 3HPZA 4GKKE 3LTOA 4X65E 3JTZA 2RTXA 4DXLA 3BF2A 2F4VI 4K0KI 2L2MA 2EQ3A 1NEIA 4MLVA 3PS1A 2J7KA 1AH5A 2YSPA 1G2FC 1DGCA 1Z59A 3M99B 4I3HA 2MKNA 4R2CA 4NXNE 1ZBTA 4LTYA 4WUDA 1YUIA 3U1KA 2IERA 2EP3A 3EQ1A 2EPAA 4R2PA 1MU5A 2V2VA 4BA2B 4R2AA 2LT7A 3T1YE 2EN4A 4BMJA 2E1RA 5EKWA 4LFCI 2DEJA 1YZ9A 4DU8A 4O4KA 2B3TB 4LF5I 4DV4E 4DV1I 4QNJA 2LTSA 4HACA 2PRTA 4DUYI 2B7VA 2EOIA 1J5EE 1KVKA 3HKMA 3K6QA 2NUGA 2O3ZA 2ZBKB 4DPUA 2YTGA 1BB8A 2UU9E 2RS6A 3T1HE 2EMBA 2F8BA 3UHMA 3HXLA 3P76A 4Q28A 3WU3A 2L3JA 4Z7CA 5AC4A 4X9JA 1ZR9A 2PNZB 2UUBE 4N4RB 4LF4E 2ADRA 1IQOA 2R42A 3QT7A 3C6KA 4PRXA 3P3EA 4MU4A 5DRRA 2Q8UA 3QT5A 2A25A 4JI4E 1OYPA 2EL5A 1Y5YA 3KZZA 2WBUA 2EN8A 1X3CA 4JI3I 3THNA 1XNRE 1HNZI 4LF8I 1RMDA 4JI8I 4JI6I 2E5LE 5JEAA 2IOPA 5F3WA 2YSOA 1KYQA 4DV0I 2O1WA 4X62E 3THOB 2ODRC 1N34E 5JEAD 4MLQA 1XMOI 1XXEA 4L5NC 4DV6E 4UTGA 2PNMA 3L00A 3EPHA 1WHQA 2O1TA 5FLXQ 1YYOA 2LRSA 4M30A 2YU5A 4DR6I 2VQFI 1ZU1A 2MDGA 2EFGA 1A1IA 1RQ0A 1B62A 2WNRB 5FLXC 2EMKA 5A6BA 4DPYA 2YPNA 1FNMA 2WZOA 4JV5E 2O1VA 2YTQA 4U3DA 2AJ4A 1PKPA 5A6BD 1GQEA 2EM4A 4LFAE 4RPFA 1HNXI 4LCHA 1IQSA 4X65I 1XMQE 1N32E 4WUCA 4RHBB 4BC7A 1YUJA 4AIDA 4WSGA 4DV2I 3B82A 2EORA 4OX9E 4UT4A 2Z5CA 2EM7A 3P3GA 2V87A 4FW3A 1A6FA 2BBGA 3IWDA 4R2RA 5TSEA 4MU1A 4NXNI 3ZKBA 4BA1A 1Y4UA 2O1UA 1XNQI 4LF7I 1A1LA 4F6NA 2YTIA 3QG5C 2YRMA 3FIGA 2L2NA 4GKJI 2V8QB 3J80C 4LCGA 4X64E 5LL6R 4M1KA 5KL5A 3H1CA 1A1GA 4B3SI 5JEAE 3H09A 3LLHA 3GONA 5C0XB 1T4NA 1J5EI 2PO1B 2EPPA 1NZ0A 1OYSA 4MDTA 2UU9I 5IV8B 1QZRA 4NBQA 4EMDA 3T1HI 4IZKA 2FV4B 2IOQA 2VESA 1HNWI 5DROA 4IS9A 2M1SA 1P47A 2X36A 4R1FA 5A2QC 2GHFA 4AIMA 2UUBI 2V86A 1HR0E 2BM1A 3PYDA 2ZM6I 1NHHA 3L7ZB 1IBLI 3MSWA 3MHHC 5JEAC 4I8OA 2JEBA 3M7NG 2EM8A 1Z1BA 4DR7E 1FI4A 4DU7A 4HEIA 5IWAI 4BHCA 1VISA 1EH7A 5JEAF 4LF6I 3AV0A 4U3BA 2I9IA 2LMZA 2V34A 4WPYA 1Y6ZA 4FW6A 2UXDE 4M0VA 3Q6MA 3NZKA 2ENCA 4FW9A 2E5LI 2UXCE 4ZYHA 1N36E 4FWGA 4LOMA 2HHHE 4HY1A 1NCSA 1IBME 2FTXB 2MKDA 5AE2A 1N34I 1FWLA 4DV7E 4YHHE 1Y60A 4FN5A 2NN6A 3P06A 4DV6I 4FW7A 4MU3A 1UEKA 3U1YA 4JYAE 2C39A 2R1FA 3ECRA 4AM3A 2N3HA 1KJKA 2NN6D 4RH8A 2MDRA 1FJGE 2BR2A 1GTKA 2WP8B 1PDAA 2EL6A 2UUCI 3MHSC 2ENHA 5KL3A 4OOGC 1LLMC 2V2QA 4JV5I 2YT4A 1JK2A 2DEIA 4BBYA 2C37A 3B8HA 1T38A 4LFAI 3VYYA 1VI7A 1QNTA 4LF9E 4AQYE 1N32I 4DR3E 3KWRA 1MX0A 1ZXNA 2V8PA 4JI2E 2RQLA 2EN7A 2JPAA 2VQEE 1USVA 4IFDA 1B63A 2H36X 4JI1I 1P42A 2V85A 2DRPA 1Z0GA 1H7SA 3IWBA 1USUA 2CPNA 2EPMX 4JI7E 3DF6A 2M9AA 2EPNA 2EOJA 2VF1A 5BR8E 5DRQA 5KL2A 2R3VA 1KIJA 1EKZA 4X64I 1YPNA 4DR5I 1YYWA 2Z5EA 4KQVA 1PJSA 1OYRA 2EMFA 2EPRA 2BA1D 1PIEA 4B3RE 1BBGA 1ZM2A 3B78A 3F6HA 1DARA 4X8WA 2WCC3 1Z0WA 2EL4A 2NN6E 4B3TE 2EMCA 5KL7A 1RREA 1UDSA 4FW4A 4YY3I 3ADJA 3ADLA 1IMUA 3QT6A 4WFTA 4P7AA 2L33A 3AUZA 2EN1A 1HR0I 4F9AB 4KZSA 2IESA 1KTVA 2IHR1 2ZITA 4HACB 4LFBI 4JI5E 2Q2EB 2CG9A 4DR7I 2NPFA 2NN6C 4BHBA 5AE3A 4OO1A 2PNLA 1GZ6A 4MU0A 4Q35B 5KL4A 2EMWA 4HTGA 4OO1D 2M4IA 1N36I 2L2KB 4DV3E 2PO0A 2HHHI 1H7UA 4DUZE 1IBMI 2UXBI 4IFDE 4KHPE 3ZKDA 4YHHI 2CVEA 5AE1A 4NXMI 2A2DA 4J3DA 4X66I 2YTDA 1NHJA 1F2IG 1X6FA 4DR2E 1T4LB 1N0VC 5IT9Q 2RSMA 3PS2A 4FK5C 4O5GA 2KHXA 2CSHA 2M7QA 4IZJA 2JEAA 1YYKA 1N33E 2LTRA 4QNKA 2RSIA 1Z0VA 2VRDA 4HXZA 3J7AM 2KOUA 4IZJD 5IT9C 1YH8A 3P3CA 2EMIA 5JEAB 2EOFA 4F2JC 1K47A 2GO4A 5KL6A 1IBKE 3J81Q 2YWQA 5GMDA 1I94E 1DQ3A 4LF9I 2LUPB 1OJ4A 1EH8A 3BGHA 4TUIA 4AQYI 4DR3I 2V83A 3C4TA 2BV3A 3T1YI 2DSYA 1Y4SA 1YSAC 4FW5A 2LJHA 4DPTA 4ISAA 4LCFA 3KZYA 3M85G 2EOEA 4DV4I 3BIDA 2EOZA 4DR1E 4JI7I 2B7TA 2CZ9A 1Z0EA 2CGEA 3QT8A 2LBSB 2EOXA 4LFCE 5A6JA 2XEXA 4B3ME 1AAYA 1MGTA 2N8XA 2GS8A 1S4EA 4OO1E 5ADZA 4FWDA 4WXCA 2ELZA 4DV1E 2HK3A 2EPKX 4F6MA 4GZNC 2EN2A 1T39A 4LF4I 2JWOA 4DUYE 1ZAAC 5LMNE 2Z5CB 2F1DA 1NHIA 4JI4I 1D6TA 2EMAA 4BA1B 4J8ZA 1JK1A 1EH6A 2LV2A 2B9DA 5K36A 1N3GA 1Z5AA 3K1JA 2HFUA 5DNYA 2LVHA 3GMEA 3EPKA 1WJPA 4GQUA 3P1XA 1STUA 5K36D 3HPSA 4MQYA 1XNRI 1O0WA 4MYTA 4WUBA 2E72A 4DV5E 2GQ0A 1A1JA 1Z5BA
chains in the Genus database with same CATH topology
4BCAA 4X62I 1XHKA 2LE2A 2FGGA 1FWKA 2HKEA 4IZKB 4JI3E 1WUUA 2DIXA 1EA6A 3H4LA 4LF8E 4P7DA 4JI8E 4JI6E 2RS7A 4GEQB 4DV3I 4ZVIA 2G7HA 4DUZI 2NUFA 1XMOE 1KKHA 1X49A 3CWVA 2HK2A 4DMIA 2Z5BA 3RMPA 4JG4A 2VF3A 4DR6E 2VQFE 1DI2A 5GMEA 2V89A 3JAMQ 3IWCA 4WYQB 4WSPA 1XMQI 3V2UC 5AASA 1HK7A 3WU4A 3HJCA 4OX9I 4R8OA 2V2ZA 1PVGA 1IBKI 4JI0E 5LMUE 1I94I 3PRYA 1QU6A 2DB2A 2NUEA 2K4VA 4DV2E 3OTOE 1FWLA 2V88A 4P78A 5CFFE 2LJPA 3WU6A 4DKKA 4F9BB 2N3GA 4DR1I 2HKJA 5T6JA 2Z5BB 1MG7A 1XNQE 3F6GA 4LF7E 1J26A 4B3MI 2L92A 4GKJE 4XTJA 2UUAE 3F0NA 4PU9A 4B3SE 2OI2A 1BKNA 3D4JA 5LMNI 3LPSA 1UHZA 1HNWE 2YZTA 2KONA 2L6MA 1T4OA 2E1MA 4FWHA 1ZM9A 4P52A 3PYEA 4F54A 2ZM6E 1N0UA 2UXDI 1IBLE 2UXCI 3VK6A 4DV5I 4F9CB 5IWAE 3ZM7A 3ZZ0A 3PYFA 4DV7I 1H74A 2DMYA 4LF6E 4JYAI 3ZZTA 2JY9A 3ZOQB 4BS9A 1H72C 5FWKA 3ADGA 1FJGI 2JVAA 1H73A 2EWLA 3HQ1A 2MC5A 3PYGA 4DR4E 2BM0A 4Z7YA 3JU0A 2UUCE 3J7AG 2F4VE 4K0KE 1WHNA 1ZBQA 3J81C 4BC9A 3M6AA 4JI2I 1ZXMA 2JR1A 4LU9A 1X47A 2VQEI 4ED4A 4USMA 4JI0I 5LMUI 3HULA 4TUGA 1UILA 2LUQA 5BR8I 1WXRA 3OTOI 1S16A 4R03A 4LF5E 4IZJB 3J7Yp 2JOXA 4JI1E 2EZ6A 4B3RI 4MYUA 3J80Q 4M2ZA 3LMLA 1EI1A 4USKA 4B3TI 1Z5CA 4DR5E 4DPWA 2UUAI 2HFSA 4DPXA 2VE7C 3DJWA 3K17A 4HYMA 5A2QQ 3K85A 3ADIA 1Z0BA 1ELOA 1RC7A 4JI5I 2L8TA 1Z0TA 4YY3E 4N3OA 3OMLA 4URLA 4PRVA 1HNZE 2A2CA 2JOBA 4L8NA 4LFBE 3Q6NA 3C4BA 3Q1QA 4DV0E 3LNUA 3WU5A 4KHPI 2X7IA 3V5RA 3HTXA 2NA2A 3ZZUA 5L3JA 4DR2I 2WW4A 1N33I 2UXBE 3VYXA 2MC6A 1FKAE 4DR4I 4NXME 1RR9A 1X48A 3JAMC 4X66E 1U2RA 1ZM4A 2L3CA 2ODRD 1HNXE 1SR9A 1ZM3A 1Z0CA 3HPZA 4GKKE 3LTOA 4X65E 3JTZA 2RTXA 4DXLA 2F4VI 4K0KI 2L2MA 2J7KA 1Z59A 4I3HA 4NXNE 4WUDA 1ZBTA 4LTYA 1MU5A 2V2VA 3T1YE 4BMJA 2E1RA 4LFCI 2DEJA 1YZ9A 4DU8A 2B3TB 4LF5I 4DV4E 4DV1I 2LTSA 4HACA 4DUYI 2B7VA 1J5EE 1KVKA 4DPUA 3K6QA 2NUGA 2ZBKB 2UU9E 2RS6A 3T1HE 2F8BA 3HXLA 4Q28A 3WU3A 2L3JA 4Z7CA 2UUBE 4LF4E 2R42A 3QT7A 4PRXA 3QT5A 4JI4E 4JI3I 1XNRE 1HNZI 4LF8I 4JI8I 4JI6I 2E5LE 2IOPA 5F3WA 4DV0I 2O1WA 4X62E 2ODRC 1N34E 1XMOI 4L5NC 4DV6E 4UTGA 2PNMA 1WHQA 2O1TA 5FLXQ 1YYOA 2LRSA 4M30A 4DR6I 2VQFI 2EFGA 1RQ0A 1B62A 5FLXC 4DPYA 1FNMA 2WZOA 4JV5E 2O1VA 2AJ4A 1PKPA 1GQEA 4LFAE 4RPFA 1HNXI 4X65I 1XMQE 1N32E 4WUCA 4BC7A 4DV2I 3B82A 4OX9E 4UT4A 2Z5CA 2V87A 1A6FA 3IWDA 4NXNI 3ZKBA 1Y4UA 2O1UA 1XNQI 4LF7I 3FIGA 2L2NA 4GKJI 2V8QB 3J80C 4X64E 5LL6R 4M1KA 4B3SI 3H09A 3LLHA 3GONA 1J5EI 1T4NA 1NZ0A 2UU9I 1QZRA 3T1HI 4EMDA 4IZKA 2FV4B 2IOQA 1HNWI 2M1SA 2X36A 4R1FA 5A2QC 2UUBI 2V86A 1HR0E 2BM1A 3PYDA 2ZM6I 1NHHA 1IBLI 3MSWA 4I8OA 4DR7E 1FI4A 4DU7A 5IWAI 1VISA 4LF6I 3AV0A 2LMZA 2V34A 4WPYA 1Y6ZA 2UXDE 4M0VA 3Q6MA 4FW9A 2E5LI 2UXCE 1N36E 4FWGA 2HHHE 4HY1A 1IBME 2FTXB 5AE2A 1N34I 4DV7E 4YHHE 4FN5A 4DV6I 3P06A 1UEKA 4JYAE 2N3HA 2MDRA 1FJGE 2UUCI 4OOGC 2V2QA 4JV5I 2YT4A 2DEIA 4BBYA 3B8HA 4LFAI 3VYYA 4LF9E 4AQYE 1N32I 4DR3E 3KWRA 1MX0A 1ZXNA 2V8PA 4JI2E 2VQEE 1USVA 1B63A 2H36X 4JI1I 2V85A 1Z0GA 1H7SA 3IWBA 1USUA 2CPNA 4JI7E 3DF6A 2VF1A 5BR8E 2R3VA 1KIJA 1EKZA 4X64I 4DR5I 1YYWA 2Z5EA 4KQVA 1PIEA 4B3RE 3B78A 1ZM2A 3F6HA 1DARA 4X8WA 1Z0WA 4B3TE 1RREA 4YY3I 3ADJA 3ADLA 3QT6A 4WFTA 4P7AA 2L33A 3AUZA 1HR0I 4F9AB 4KZSA 1KTVA 2IHR1 2ZITA 4HACB 4LFBI 4JI5E 2Q2EB 2CG9A 4DR7I 2NPFA 5AE3A 2PNLA 1GZ6A 2M4IA 1N36I 2L2KB 4DV3E 2HHHI 1H7UA 4DUZE 1IBMI 2UXBI 4KHPE 3ZKDA 4YHHI 5AE1A 4NXMI 2A2DA 4X66I 1NHJA 4DR2E 1T4LB 1N0VC 5IT9Q 2RSMA 4IZJA 2M7QA 2KHXA 4GKKI 3J7AM 1YYKA 1N33E 2LTRA 1Z0VA 4HXZA 2KOUA 4IZJD 5IT9C 1K47A 1IBKE 3J81Q 5GMDA 1I94E 1DQ3A 4LF9I 2LUPB 1OJ4A 4AQYI 4TUIA 4DR3I 2V83A 3C4TA 2BV3A 3T1YI 2DSYA 1Y4SA 2LJHA 4DPTA 4DV4I 4DR1E 4JI7I 2B7TA 2CZ9A 1Z0EA 2CGEA 3QT8A 2LBSB 4LFCE 2XEXA 4B3ME 2GS8A 1S4EA 5ADZA 4FWDA 4DV1E 2HK3A 4LF4I 2JWOA 4DUYE 5LMNE 2Z5CB 1NHIA 4JI4I 1D6TA 4J8ZA 2B9DA 1Z5AA 3K1JA 2HFUA 5DNYA 3P1XA 1STUA 3HPSA 1XNRI 1O0WA 4MYTA 4WUBA 4DV5E 2GQ0A 1Z5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 I;  1XHK A;  1FWK A;  2HKE A;  4JI3 E;  1WUU A;  2DIX A;  1EA6 A;  3H4L A;  4LF8 E;  4JI8 E;  4JI6 E;  2RS7 A;  4DV3 I;  4ZVI A;  4DUZ I;  2NUF A;  1XMO E;  1KKH A;  1X49 A;  3CWV A;  2HK2 A;  4JG4 A;  2VF3 A;  4DR6 E;  2VQF E;  1DI2 A;  5GME A;  3JAM Q;  4WYQ B;  1XMQ I;  3V2U C;  3WU4 A;  4OX9 I;  2V2Z A;  1PVG A;  1IBK I;  4JI0 E;  5LMU E;  1I94 I;  1QU6 A;  2DB2 A;  2NUE A;  4DV2 E;  3OTO E;  1FWL A;  5CFF E;  2LJP A;  3WU6 A;  4DKK A;  2N3G A;  4DR1 I;  2HKJ A;  1MG7 A;  1XNQ E;  4LF7 E;  1J26 A;  4B3M I;  4GKJ E;  4XTJ A;  2UUA E;  3F0N A;  4PU9 A;  4B3S E;  2OI2 A;  1BKN A;  3D4J A;  5LMN I;  3LPS A;  1UHZ A;  1HNW E;  1T4O A;  4FWH A;  1ZM9 A;  4P52 A;  3PYE A;  2ZM6 E;  1N0U A;  2UXD I;  1IBL E;  2UXC I;  4DV5 I;  5IWA E;  3ZM7 A;  3ZZ0 A;  3PYF A;  4DV7 I;  1H74 A;  2DMY A;  4LF6 E;  4JYA I;  3ZZT A;  2JY9 A;  1H72 C;  3ADG A;  1FJG I;  2JVA A;  1H73 A;  3PYG A;  4DR4 E;  2BM0 A;  4Z7Y A;  2UUC E;  4K0K E;  2F4V E;  3J7A G;  1WHN A;  4JI2 I;  3J81 C;  3M6A A;  1ZXM A;  1X47 A;  2VQE I;  4ED4 A;  4USM A;  4JI0 I;  5LMU I;  3HUL A;  1UIL A;  2LUQ A;  5BR8 I;  3OTO I;  1S16 A;  4LF5 E;  3J7Y p;  4JI1 E;  2EZ6 A;  4B3R I;  4MYU A;  3J80 Q;  4M2Z A;  1EI1 A;  4USK A;  4B3T I;  1Z5C A;  4DR5 E;  4DPW A;  2UUA I;  2HFS A;  4DPX A;  3K17 A;  4HYM A;  5A2Q Q;  3ADI A;  1Z0B A;  1ELO A;  1RC7 A;  4JI5 I;  1Z0T A;  4YY3 E;  4URL A;  4PRV A;  1HNZ E;  2A2C A;  4LFB E;  3C4B A;  3Q1Q A;  4DV0 E;  3LNU A;  3WU5 A;  4KHP I;  2X7I A;  3V5R A;  3HTX A;  2NA2 A;  3ZZU A;  5L3J A;  4DR2 I;  2WW4 A;  1N33 I;  2UXB E;  3VYX A;  1FKA E;  4DR4 I;  4NXM E;  1RR9 A;  1X48 A;  4X66 E;  1U2R A;  3JAM C;  1ZM4 A;  2L3C A;  1HNX E;  1ZM3 A;  1Z0C A;  4GKK E;  3LTO A;  4X65 E;  4K0K I;  2RTX A;  4DXL A;  2F4V I;  2L2M A;  2J7K A;  1Z59 A;  4I3H A;  4NXN E;  4WUD A;  1ZBT A;  1MU5 A;  2V2V A;  3T1Y E;  2E1R A;  4LFC I;  2DEJ A;  1YZ9 A;  4DU8 A;  2B3T B;  4LF5 I;  4DV4 E;  4DV1 I;  2LTS A;  4HAC A;  4DUY I;  2B7V A;  1J5E E;  1KVK A;  4DPU A;  2NUG A;  2ZBK B;  2UU9 E;  2RS6 A;  3T1H E;  3WU3 A;  2L3J A;  4Z7C A;  2UUB E;  4LF4 E;  2R42 A;  3QT7 A;  4PRX A;  3QT5 A;  4JI4 E;  4JI3 I;  1XNR E;  1HNZ I;  4LF8 I;  4JI8 I;  4JI6 I;  2E5L E;  4DV0 I;  4X62 E;  1N34 E;  1XMO I;  4DV6 E;  4UTG A;  1WHQ A;  5FLX Q;  1YYO A;  2LRS A;  4M30 A;  4DR6 I;  2VQF I;  2EFG A;  1RQ0 A;  1B62 A;  5FLX C;  4DPY A;  1FNM A;  4JV5 E;  2AJ4 A;  1PKP A;  1GQE A;  4LFA E;  4RPF A;  1HNX I;  4X65 I;  1XMQ E;  1N32 E;  4WUC A;  4DV2 I;  3B82 A;  4OX9 E;  4UT4 A;  1A6F A;  4NXN I;  3ZKB A;  1XNQ I;  4LF7 I;  2L2N A;  4GKJ I;  3J80 C;  4X64 E;  4M1K A;  5LL6 R;  4B3S I;  3LLH A;  3GON A;  1J5E I;  1T4N A;  1NZ0 A;  2UU9 I;  1QZR A;  3T1H I;  4EMD A;  1HNW I;  2X36 A;  4R1F A;  5A2Q C;  2UUB I;  1HR0 E;  2BM1 A;  3PYD A;  2ZM6 I;  1NHH A;  1IBL I;  4DR7 E;  1FI4 A;  4DU7 A;  5IWA I;  1VIS A;  4LF6 I;  2V34 A;  2UXD E;  4FW9 A;  2E5L I;  2UXC E;  1N36 E;  4FWG A;  2HHH E;  4HY1 A;  1IBM E;  1N34 I;  4DV7 E;  4YHH E;  4FN5 A;  4DV6 I;  1UEK A;  4JYA E;  2N3H A;  2MDR A;  1FJG E;  2UUC I;  4OOG C;  2V2Q A;  4JV5 I;  2YT4 A;  2DEI A;  3B8H A;  4LFA I;  3VYY A;  4LF9 E;  4AQY E;  1N32 I;  4DR3 E;  1MX0 A;  1ZXN A;  2V8P A;  4JI2 E;  2VQE E;  1B63 A;  4JI1 I;  1Z0G A;  1H7S A;  2CPN A;  4JI7 E;  5BR8 E;  2R3V A;  1KIJ A;  1EKZ A;  4X64 I;  4DR5 I;  1YYW A;  4KQV A;  1PIE A;  4B3R E;  3B78 A;  1ZM2 A;  1DAR A;  4X8W A;  1Z0W A;  4B3T E;  1RRE A;  4YY3 I;  3ADJ A;  3ADL A;  3QT6 A;  4WFT A;  4P7A A;  2L33 A;  1HR0 I;  1KTV A;  2IHR 1;  2ZIT A;  4HAC B;  4LFB I;  4JI5 E;  2Q2E B;  4DR7 I;  2NPF A;  1N36 I;  2L2K B;  4DV3 E;  2HHH I;  1H7U A;  4DUZ E;  1IBM I;  2UXB I;  4KHP E;  3ZKD A;  4YHH I;  4NXM I;  2A2D A;  4X66 I;  1NHJ A;  4DR2 E;  1T4L B;  1N0V C;  5IT9 Q;  2RSM A;  2KHX A;  4GKK I;  3J7A M;  1YYK A;  1N33 E;  2LTR A;  1Z0V A;  4HXZ A;  5IT9 C;  1K47 A;  1IBK E;  3J81 Q;  5GMD A;  1I94 E;  4LF9 I;  2LUP B;  1OJ4 A;  4AQY I;  4DR3 I;  3C4T A;  2BV3 A;  3T1Y I;  2LJH A;  4DPT A;  4DV4 I;  4DR1 E;  4JI7 I;  2B7T A;  2CZ9 A;  1Z0E A;  3QT8 A;  2LBS B;  4LFC E;  2XEX A;  4B3M E;  2GS8 A;  1S4E A;  4FWD A;  4DV1 E;  2HK3 A;  4LF4 I;  4DUY E;  5LMN E;  1NHI A;  4JI4 I;  1D6T A;  1Z5A A;  3K1J A;  2HFU A;  3P1X A;  1STU A;  1XNR I;  1O0W A;  4MYT A;  4WUB A;  4DV5 E;  1Z5B A; 
#chains in the Genus database with same CATH topology
 4BCA A;  4X62 I;  1XHK A;  2LE2 A;  2JE6 A;  2FGG A;  1FWK A;  2HKE A;  4IZK B;  4JI3 E;  1WUU A;  2DIX A;  1EA6 A;  3H4L A;  4LF8 E;  4P7D A;  4JI8 E;  4JI6 E;  2RS7 A;  2EPL X;  4GEQ B;  4ZYD A;  4DV3 I;  4ZVI A;  2G7H A;  3PS3 A;  4DUZ I;  2NUF A;  2EN6 A;  1UBD C;  2NAB A;  1XMO E;  1KKH A;  1X49 A;  3CWV A;  2JEB B;  2HK2 A;  4DMI A;  2YRK A;  2Z5B A;  2EM5 A;  1RHY A;  4BA2 A;  1B69 A;  3BBG A;  3RMP A;  2EOY A;  3TQM A;  4ZYE A;  4JG4 A;  2VF3 A;  4DR6 E;  2J7J A;  2VQF E;  1DI2 A;  5GME A;  1A1K A;  2V89 A;  2YTN A;  3JAM Q;  3IWC A;  4WYQ B;  1BBO A;  4WSP A;  1XMQ I;  3V2U C;  2YRH A;  2EM6 A;  5AAS A;  1YHC A;  1HK7 A;  3WU4 A;  3B4T A;  3HJC A;  4WXD A;  4OX9 I;  2DMI A;  4R8O A;  2V2Z A;  1PVG A;  2BA1 G;  3GCM A;  1IBK I;  4JI0 E;  5LMU E;  1I94 I;  3PRY A;  2BA0 D;  5DNL A;  2NN6 B;  1QU6 A;  2DB2 A;  2JT2 A;  4IFD D;  4NHR A;  2CT1 A;  2K4V A;  2NUE A;  2EMX A;  2CTD A;  2C39 B;  2PNZ A;  5K36 E;  2JYA A;  4DV2 E;  3OTO E;  1SFE A;  2V88 A;  4P78 A;  5A6K A;  2ELY A;  2EM9 A;  5CFF E;  2YU8 A;  4R2S A;  2C38 A;  2RPC A;  4R2E A;  4DKK A;  2BR2 B;  2LJP A;  4F9B B;  3WU6 A;  2HJJ A;  2N3G A;  2J65 A;  2DLQ A;  4DR1 I;  2HKJ A;  5T6J A;  2Z5B B;  4KWY A;  1XNQ E;  1MG7 A;  3CDI A;  3F6G A;  4LF7 E;  2EML A;  4R2Q A;  4LPF A;  1J26 A;  2C37 B;  4B3M I;  2L92 A;  4GKJ E;  4XTJ A;  5K36 C;  5IXM B;  2UUA E;  3F0N A;  4PU9 A;  4B3S E;  2OI2 A;  1BKN A;  1E3P A;  2R76 A;  1R6M A;  1UN6 B;  5K36 F;  2EM2 A;  3D4J A;  5LMN I;  4IFD B;  1TF6 A;  1UDO A;  3LPS A;  1UHZ A;  2GPI A;  5ELW A;  1HNW E;  2YZT A;  1X6H A;  2KON A;  1TF3 A;  2L6M A;  1T4O A;  2E1M A;  4FWH A;  1ZM9 A;  4P52 A;  3UK3 C;  2WNR A;  2EM3 A;  2EOO A;  3PYE A;  4F54 A;  2PO2 A;  2ZM6 E;  1N0U A;  2C38 B;  5A69 A;  1IBL E;  2UXD I;  2NN6 F;  2YTF A;  2UXC I;  3VK6 A;  4OZE A;  4DV5 I;  4F9C B;  5IWA E;  1UDN A;  2EMZ A;  2EOM A;  3ZM7 A;  3ZZ0 A;  3PYF A;  4GKK I;  4DV7 I;  1H74 A;  2DMY A;  4LF6 E;  4O43 A;  1L4S A;  4JYA I;  3ZZT A;  2JY9 A;  3ZOQ B;  4BS9 A;  4NZV A;  1H72 C;  5FWK A;  3ADG A;  3VHT B;  1FJG I;  2JVA A;  1H73 A;  2EWL A;  2EMH A;  3HQ1 A;  2JXP A;  2MC5 A;  1A1H A;  3PYG A;  2YTJ A;  4DR4 E;  2BM0 A;  4IFD C;  3GLL A;  4Z7Y A;  4IJD A;  5DNX A;  3CDJ A;  2EOH A;  3JU0 A;  2WBS A;  3KRN A;  4OO1 B;  4IFD F;  1X5W A;  2PO2 B;  2UUC E;  2EOQ A;  3J7A G;  2F4V E;  1WHN A;  1ZBQ A;  3J81 C;  4BC9 A;  4K0K E;  3M6A A;  1ZXM A;  5C0X A;  2JR1 A;  4LU9 A;  4JI2 I;  1X47 A;  2EJ4 A;  1R6L A;  2PO0 B;  2VQE I;  2PO1 A;  1WRJ A;  5LLQ A;  2YTO A;  2EPC A;  1G2D C;  4ED4 A;  4USM A;  4JI0 I;  2D9H A;  5C0X D;  5LMU I;  2EPX A;  2HC5 A;  3HUL A;  4TUG A;  1UIL A;  2LUQ A;  5BR8 I;  1WXR A;  3C6M A;  3OTO I;  4OKG A;  1S16 A;  3L7Z A;  4R03 A;  4LF5 E;  4IZJ B;  2JEA B;  3J7Y p;  1PJQ A;  2JOX A;  2YTE A;  4JI1 E;  2EZ6 A;  4M9V C;  4B3R I;  4MYU A;  3J80 Q;  4M2Z A;  3LML A;  5EL9 A;  2EPZ A;  1EI1 A;  2BB8 A;  4USK A;  4IS1 C;  4B3T I;  1YFH A;  1Z5C A;  2I13 A;  4DR5 E;  3EPL A;  4DPW A;  1TN9 A;  2HFS A;  3DD6 A;  2UUA I;  4OO1 C;  4O24 A;  4DPX A;  1PJT A;  2WBT A;  2EPU A;  2VE7 C;  2EPO A;  3DJW A;  3K17 A;  4HYM A;  5A2Q Q;  2EMG A;  3K85 A;  3ADI A;  4OO1 F;  1Z0B A;  1ELO A;  1RC7 A;  2EN3 A;  2YTP A;  4JI5 I;  2L8T A;  1Z0T A;  4YY3 E;  3EPJ A;  4N3O A;  5A6A A;  3M85 D;  2LCE A;  2EE8 A;  5AC5 A;  3OML A;  4URL A;  2WP8 A;  4PRV A;  1HNZ E;  2A2C A;  2JOB A;  1A1F A;  4L8N A;  1E3H A;  2ENA A;  4LFB E;  3Q6N A;  3C4B A;  4ZYG A;  5C0X E;  3Q1Q A;  2GLI A;  4DV0 E;  3LNU A;  3WU5 A;  4KHP I;  2X7I A;  2EOS A;  2EMY A;  3V5R A;  2K7I A;  2NA2 A;  2LO3 A;  3HTX A;  3ZZU A;  5L3J A;  4DR2 I;  2AE8 A;  2LJU A;  2WW4 A;  5K36 B;  2BA0 G;  3M7N D;  2HGH A;  2DGC A;  1N33 I;  2UXB E;  3VYX A;  2MC6 A;  2EM0 A;  1FKA E;  1MEY C;  5C0X C;  4DR4 I;  2EQ0 A;  4NXM E;  1RR9 A;  1X48 A;  1X6E A;  2EQ1 A;  3JAM C;  4X66 E;  1U2R A;  1UDQ A;  1ZM4 A;  2DLK A;  2JP9 A;  2L3C A;  2ODR D;  4R2D A;  5C0X F;  1HNX E;  1SR9 A;  1ZM3 A;  4WX9 A;  2GO3 A;  5DRP A;  1Z0C A;  2JE6 B;  3HPZ A;  4GKK E;  3LTO A;  4X65 E;  3JTZ A;  2RTX A;  4DXL A;  3BF2 A;  2F4V I;  4K0K I;  2L2M A;  2EQ3 A;  1NEI A;  4MLV A;  3PS1 A;  2J7K A;  1AH5 A;  2YSP A;  1G2F C;  1DGC A;  1Z59 A;  3M99 B;  4I3H A;  2MKN A;  4R2C A;  4NXN E;  1ZBT A;  4LTY A;  4WUD A;  1YUI A;  3U1K A;  2IER A;  2EP3 A;  3EQ1 A;  2EPA A;  4R2P A;  1MU5 A;  2V2V A;  4BA2 B;  4R2A A;  2LT7 A;  3T1Y E;  2EN4 A;  4BMJ A;  2E1R A;  5EKW A;  4LFC I;  2DEJ A;  1YZ9 A;  4DU8 A;  4O4K A;  2B3T B;  4LF5 I;  4DV4 E;  4DV1 I;  4QNJ A;  2LTS A;  4HAC A;  2PRT A;  4DUY I;  2B7V A;  2EOI A;  1J5E E;  1KVK A;  3HKM A;  3K6Q A;  2NUG A;  2O3Z A;  2ZBK B;  4DPU A;  2YTG A;  1BB8 A;  2UU9 E;  2RS6 A;  3T1H E;  2EMB A;  2F8B A;  3UHM A;  3HXL A;  3P76 A;  4Q28 A;  3WU3 A;  2L3J A;  4Z7C A;  5AC4 A;  4X9J A;  1ZR9 A;  2PNZ B;  2UUB E;  4N4R B;  4LF4 E;  2ADR A;  1IQO A;  2R42 A;  3QT7 A;  3C6K A;  4PRX A;  3P3E A;  4MU4 A;  5DRR A;  2Q8U A;  3QT5 A;  2A25 A;  4JI4 E;  1OYP A;  2EL5 A;  1Y5Y A;  3KZZ A;  2WBU A;  2EN8 A;  1X3C A;  4JI3 I;  3THN A;  1XNR E;  1HNZ I;  4LF8 I;  1RMD A;  4JI8 I;  4JI6 I;  2E5L E;  5JEA A;  2IOP A;  5F3W A;  2YSO A;  1KYQ A;  4DV0 I;  2O1W A;  4X62 E;  3THO B;  2ODR C;  1N34 E;  5JEA D;  4MLQ A;  1XMO I;  1XXE A;  4L5N C;  4DV6 E;  4UTG A;  2PNM A;  3L00 A;  3EPH A;  1WHQ A;  2O1T A;  5FLX Q;  1YYO A;  2LRS A;  4M30 A;  2YU5 A;  4DR6 I;  2VQF I;  1ZU1 A;  2MDG A;  2EFG A;  1A1I A;  1RQ0 A;  1B62 A;  2WNR B;  5FLX C;  2EMK A;  5A6B A;  4DPY A;  2YPN A;  1FNM A;  2WZO A;  4JV5 E;  2O1V A;  2YTQ A;  4U3D A;  2AJ4 A;  1PKP A;  5A6B D;  1GQE A;  2EM4 A;  4LFA E;  4RPF A;  1HNX I;  4LCH A;  1IQS A;  4X65 I;  1XMQ E;  1N32 E;  4WUC A;  4RHB B;  4BC7 A;  1YUJ A;  4AID A;  4WSG A;  4DV2 I;  3B82 A;  2EOR A;  4OX9 E;  4UT4 A;  2Z5C A;  2EM7 A;  3P3G A;  2V87 A;  4FW3 A;  1A6F A;  2BBG A;  3IWD A;  4R2R A;  5TSE A;  4MU1 A;  4NXN I;  3ZKB A;  4BA1 A;  1Y4U A;  2O1U A;  1XNQ I;  4LF7 I;  1A1L A;  4F6N A;  2YTI A;  3QG5 C;  2YRM A;  3FIG A;  2L2N A;  4GKJ I;  2V8Q B;  3J80 C;  4LCG A;  4X64 E;  5LL6 R;  4M1K A;  5KL5 A;  3H1C A;  1A1G A;  4B3S I;  5JEA E;  3H09 A;  3LLH A;  3GON A;  5C0X B;  1T4N A;  1J5E I;  2PO1 B;  2EPP A;  1NZ0 A;  1OYS A;  4MDT A;  2UU9 I;  5IV8 B;  1QZR A;  4NBQ A;  4EMD A;  3T1H I;  4IZK A;  2FV4 B;  2IOQ A;  2VES A;  1HNW I;  5DRO A;  4IS9 A;  2M1S A;  1P47 A;  2X36 A;  4R1F A;  5A2Q C;  2GHF A;  4AIM A;  2UUB I;  2V86 A;  1HR0 E;  2BM1 A;  3PYD A;  2ZM6 I;  1NHH A;  3L7Z B;  1IBL I;  3MSW A;  3MHH C;  5JEA C;  4I8O A;  2JEB A;  3M7N G;  2EM8 A;  1Z1B A;  4DR7 E;  1FI4 A;  4DU7 A;  4HEI A;  5IWA I;  4BHC A;  1VIS A;  1EH7 A;  5JEA F;  4LF6 I;  3AV0 A;  4U3B A;  2I9I A;  2LMZ A;  2V34 A;  4WPY A;  1Y6Z A;  4FW6 A;  2UXD E;  4M0V A;  3Q6M A;  3NZK A;  2ENC A;  4FW9 A;  2E5L I;  2UXC E;  4ZYH A;  1N36 E;  4FWG A;  4LOM A;  2HHH E;  4HY1 A;  1NCS A;  1IBM E;  2FTX B;  2MKD A;  5AE2 A;  1N34 I;  1FWL A;  4DV7 E;  4YHH E;  1Y60 A;  4FN5 A;  2NN6 A;  3P06 A;  4DV6 I;  4FW7 A;  4MU3 A;  1UEK A;  3U1Y A;  4JYA E;  2C39 A;  2R1F A;  3ECR A;  4AM3 A;  2N3H A;  1KJK A;  2NN6 D;  4RH8 A;  2MDR A;  1FJG E;  2BR2 A;  1GTK A;  2WP8 B;  1PDA A;  2EL6 A;  2UUC I;  3MHS C;  2ENH A;  5KL3 A;  4OOG C;  1LLM C;  2V2Q A;  4JV5 I;  2YT4 A;  1JK2 A;  2DEI A;  4BBY A;  2C37 A;  3B8H A;  1T38 A;  4LFA I;  3VYY A;  1VI7 A;  1QNT A;  4LF9 E;  4AQY E;  1N32 I;  4DR3 E;  3KWR A;  1MX0 A;  1ZXN A;  2V8P A;  4JI2 E;  2RQL A;  2EN7 A;  2JPA A;  2VQE E;  1USV A;  4IFD A;  1B63 A;  2H36 X;  4JI1 I;  1P42 A;  2V85 A;  2DRP A;  1Z0G A;  1H7S A;  3IWB A;  1USU A;  2CPN A;  2EPM X;  4JI7 E;  3DF6 A;  2M9A A;  2EPN A;  2EOJ A;  2VF1 A;  5BR8 E;  5DRQ A;  5KL2 A;  2R3V A;  1KIJ A;  1EKZ A;  4X64 I;  1YPN A;  4DR5 I;  1YYW A;  2Z5E A;  4KQV A;  1PJS A;  1OYR A;  2EMF A;  2EPR A;  2BA1 D;  1PIE A;  4B3R E;  1BBG A;  1ZM2 A;  3B78 A;  3F6H A;  1DAR A;  4X8W A;  2WCC 3;  1Z0W A;  2EL4 A;  2NN6 E;  4B3T E;  2EMC A;  5KL7 A;  1RRE A;  1UDS A;  4FW4 A;  4YY3 I;  3ADJ A;  3ADL A;  1IMU A;  3QT6 A;  4WFT A;  4P7A A;  2L33 A;  3AUZ A;  2EN1 A;  1HR0 I;  4F9A B;  4KZS A;  2IES A;  1KTV A;  2IHR 1;  2ZIT A;  4HAC B;  4LFB I;  4JI5 E;  2Q2E B;  2CG9 A;  4DR7 I;  2NPF A;  2NN6 C;  4BHB A;  5AE3 A;  4OO1 A;  2PNL A;  1GZ6 A;  4MU0 A;  4Q35 B;  5KL4 A;  2EMW A;  4HTG A;  4OO1 D;  2M4I A;  1N36 I;  2L2K B;  4DV3 E;  2PO0 A;  2HHH I;  1H7U A;  4DUZ E;  1IBM I;  2UXB I;  4IFD E;  4KHP E;  3ZKD A;  4YHH I;  2CVE A;  5AE1 A;  4NXM I;  2A2D A;  4J3D A;  4X66 I;  2YTD A;  1NHJ A;  1F2I G;  1X6F A;  4DR2 E;  1T4L B;  1N0V C;  5IT9 Q;  2RSM A;  3PS2 A;  4FK5 C;  4O5G A;  2KHX A;  2CSH A;  2M7Q A;  4IZJ A;  2JEA A;  1YYK A;  1N33 E;  2LTR A;  4QNK A;  2RSI A;  1Z0V A;  2VRD A;  4HXZ A;  3J7A M;  2KOU A;  4IZJ D;  5IT9 C;  1YH8 A;  3P3C A;  2EMI A;  5JEA B;  2EOF A;  4F2J C;  1K47 A;  2GO4 A;  5KL6 A;  1IBK E;  3J81 Q;  2YWQ A;  5GMD A;  1I94 E;  1DQ3 A;  4LF9 I;  2LUP B;  1OJ4 A;  1EH8 A;  3BGH A;  4TUI A;  4AQY I;  4DR3 I;  2V83 A;  3C4T A;  2BV3 A;  3T1Y I;  2DSY A;  1Y4S A;  1YSA C;  4FW5 A;  2LJH A;  4DPT A;  4ISA A;  4LCF A;  3KZY A;  3M85 G;  2EOE A;  4DV4 I;  3BID A;  2EOZ A;  4DR1 E;  4JI7 I;  2B7T A;  2CZ9 A;  1Z0E A;  2CGE A;  3QT8 A;  2LBS B;  2EOX A;  4LFC E;  5A6J A;  2XEX A;  4B3M E;  1AAY A;  1MGT A;  2N8X A;  2GS8 A;  1S4E A;  4OO1 E;  5ADZ A;  4FWD A;  4WXC A;  2ELZ A;  4DV1 E;  2HK3 A;  2EPK X;  4F6M A;  4GZN C;  2EN2 A;  1T39 A;  4LF4 I;  2JWO A;  4DUY E;  1ZAA C;  5LMN E;  2Z5C B;  2F1D A;  1NHI A;  4JI4 I;  1D6T A;  2EMA A;  4BA1 B;  4J8Z A;  1JK1 A;  1EH6 A;  2LV2 A;  2B9D A;  5K36 A;  1N3G A;  1Z5A A;  3K1J A;  2HFU A;  5DNY A;  2LVH A;  3GME A;  3EPK A;  1WJP A;  4GQU A;  3P1X A;  1STU A;  5K36 D;  3HPS A;  4MQY A;  1XNR I;  1O0W A;  4MYT A;  4WUB A;  2E72 A;  4DV5 E;  2GQ0 A;  1A1J A;  1Z5B A; 
#chains in the Genus database with same CATH homology
 4BCA A;  4X62 I;  1XHK A;  2LE2 A;  2FGG A;  1FWK A;  2HKE A;  4IZK B;  4JI3 E;  1WUU A;  2DIX A;  1EA6 A;  3H4L A;  4LF8 E;  4P7D A;  4JI8 E;  4JI6 E;  2RS7 A;  4GEQ B;  4DV3 I;  4ZVI A;  2G7H A;  4DUZ I;  2NUF A;  1XMO E;  1KKH A;  1X49 A;  3CWV A;  2HK2 A;  4DMI A;  2Z5B A;  3RMP A;  4JG4 A;  2VF3 A;  4DR6 E;  2VQF E;  1DI2 A;  5GME A;  2V89 A;  3JAM Q;  3IWC A;  4WYQ B;  4WSP A;  1XMQ I;  3V2U C;  5AAS A;  1HK7 A;  3WU4 A;  3HJC A;  4OX9 I;  4R8O A;  2V2Z A;  1PVG A;  1IBK I;  4JI0 E;  5LMU E;  1I94 I;  3PRY A;  1QU6 A;  2DB2 A;  2NUE A;  2K4V A;  4DV2 E;  3OTO E;  1FWL A;  2V88 A;  4P78 A;  5CFF E;  2LJP A;  3WU6 A;  4DKK A;  4F9B B;  2N3G A;  4DR1 I;  2HKJ A;  5T6J A;  2Z5B B;  1MG7 A;  1XNQ E;  3F6G A;  4LF7 E;  1J26 A;  4B3M I;  2L92 A;  4GKJ E;  4XTJ A;  2UUA E;  3F0N A;  4PU9 A;  4B3S E;  2OI2 A;  1BKN A;  3D4J A;  5LMN I;  3LPS A;  1UHZ A;  1HNW E;  2YZT A;  2KON A;  2L6M A;  1T4O A;  2E1M A;  4FWH A;  1ZM9 A;  4P52 A;  3PYE A;  4F54 A;  2ZM6 E;  1N0U A;  2UXD I;  1IBL E;  2UXC I;  3VK6 A;  4DV5 I;  4F9C B;  5IWA E;  3ZM7 A;  3ZZ0 A;  3PYF A;  4DV7 I;  1H74 A;  2DMY A;  4LF6 E;  4JYA I;  3ZZT A;  2JY9 A;  3ZOQ B;  4BS9 A;  1H72 C;  5FWK A;  3ADG A;  1FJG I;  2JVA A;  1H73 A;  2EWL A;  3HQ1 A;  2MC5 A;  3PYG A;  4DR4 E;  2BM0 A;  4Z7Y A;  3JU0 A;  2UUC E;  3J7A G;  2F4V E;  4K0K E;  1WHN A;  1ZBQ A;  3J81 C;  4BC9 A;  3M6A A;  4JI2 I;  1ZXM A;  2JR1 A;  4LU9 A;  1X47 A;  2VQE I;  4ED4 A;  4USM A;  4JI0 I;  5LMU I;  3HUL A;  4TUG A;  1UIL A;  2LUQ A;  5BR8 I;  1WXR A;  3OTO I;  1S16 A;  4R03 A;  4LF5 E;  4IZJ B;  3J7Y p;  2JOX A;  4JI1 E;  2EZ6 A;  4B3R I;  4MYU A;  3J80 Q;  4M2Z A;  3LML A;  1EI1 A;  4USK A;  4B3T I;  1Z5C A;  4DR5 E;  4DPW A;  2UUA I;  2HFS A;  4DPX A;  2VE7 C;  3DJW A;  3K17 A;  4HYM A;  5A2Q Q;  3K85 A;  3ADI A;  1Z0B A;  1ELO A;  1RC7 A;  4JI5 I;  2L8T A;  1Z0T A;  4YY3 E;  4N3O A;  3OML A;  4URL A;  4PRV A;  1HNZ E;  2A2C A;  2JOB A;  4L8N A;  4LFB E;  3Q6N A;  3C4B A;  3Q1Q A;  4DV0 E;  3LNU A;  3WU5 A;  4KHP I;  2X7I A;  3V5R A;  3HTX A;  2NA2 A;  3ZZU A;  5L3J A;  4DR2 I;  2WW4 A;  1N33 I;  2UXB E;  3VYX A;  2MC6 A;  1FKA E;  4DR4 I;  4NXM E;  1RR9 A;  1X48 A;  3JAM C;  4X66 E;  1U2R A;  1ZM4 A;  2L3C A;  2ODR D;  1HNX E;  1SR9 A;  1ZM3 A;  1Z0C A;  3HPZ A;  4GKK E;  3LTO A;  4X65 E;  3JTZ A;  2RTX A;  4DXL A;  2F4V I;  4K0K I;  2L2M A;  2J7K A;  1Z59 A;  4I3H A;  4NXN E;  4WUD A;  1ZBT A;  4LTY A;  1MU5 A;  2V2V A;  3T1Y E;  4BMJ A;  2E1R A;  4LFC I;  2DEJ A;  1YZ9 A;  4DU8 A;  2B3T B;  4LF5 I;  4DV4 E;  4DV1 I;  2LTS A;  4HAC A;  4DUY I;  2B7V A;  1J5E E;  1KVK A;  4DPU A;  3K6Q A;  2NUG A;  2ZBK B;  2UU9 E;  2RS6 A;  3T1H E;  2F8B A;  3HXL A;  4Q28 A;  3WU3 A;  2L3J A;  4Z7C A;  2UUB E;  4LF4 E;  2R42 A;  3QT7 A;  4PRX A;  3QT5 A;  4JI4 E;  4JI3 I;  1XNR E;  1HNZ I;  4LF8 I;  4JI8 I;  4JI6 I;  2E5L E;  2IOP A;  5F3W A;  4DV0 I;  2O1W A;  4X62 E;  2ODR C;  1N34 E;  1XMO I;  4L5N C;  4DV6 E;  4UTG A;  2PNM A;  1WHQ A;  2O1T A;  5FLX Q;  1YYO A;  2LRS A;  4M30 A;  4DR6 I;  2VQF I;  2EFG A;  1RQ0 A;  1B62 A;  5FLX C;  4DPY A;  1FNM A;  2WZO A;  4JV5 E;  2O1V A;  2AJ4 A;  1PKP A;  1GQE A;  4LFA E;  4RPF A;  1HNX I;  4X65 I;  1XMQ E;  1N32 E;  4WUC A;  4BC7 A;  4DV2 I;  3B82 A;  4OX9 E;  4UT4 A;  2Z5C A;  2V87 A;  1A6F A;  3IWD A;  4NXN I;  3ZKB A;  1Y4U A;  2O1U A;  1XNQ I;  4LF7 I;  3FIG A;  2L2N A;  4GKJ I;  2V8Q B;  3J80 C;  4X64 E;  5LL6 R;  4M1K A;  4B3S I;  3H09 A;  3LLH A;  3GON A;  1J5E I;  1T4N A;  1NZ0 A;  2UU9 I;  1QZR A;  3T1H I;  4EMD A;  4IZK A;  2FV4 B;  2IOQ A;  1HNW I;  2M1S A;  2X36 A;  4R1F A;  5A2Q C;  2UUB I;  2V86 A;  1HR0 E;  2BM1 A;  3PYD A;  2ZM6 I;  1NHH A;  1IBL I;  3MSW A;  4I8O A;  4DR7 E;  1FI4 A;  4DU7 A;  5IWA I;  1VIS A;  4LF6 I;  3AV0 A;  2LMZ A;  2V34 A;  4WPY A;  1Y6Z A;  2UXD E;  4M0V A;  3Q6M A;  4FW9 A;  2E5L I;  2UXC E;  1N36 E;  4FWG A;  2HHH E;  4HY1 A;  1IBM E;  2FTX B;  5AE2 A;  1N34 I;  4DV7 E;  4YHH E;  4FN5 A;  4DV6 I;  3P06 A;  1UEK A;  4JYA E;  2N3H A;  2MDR A;  1FJG E;  2UUC I;  4OOG C;  2V2Q A;  4JV5 I;  2YT4 A;  2DEI A;  4BBY A;  3B8H A;  4LFA I;  3VYY A;  4LF9 E;  4AQY E;  1N32 I;  4DR3 E;  3KWR A;  1MX0 A;  1ZXN A;  2V8P A;  4JI2 E;  2VQE E;  1USV A;  1B63 A;  2H36 X;  4JI1 I;  2V85 A;  1Z0G A;  1H7S A;  3IWB A;  1USU A;  2CPN A;  4JI7 E;  3DF6 A;  2VF1 A;  5BR8 E;  2R3V A;  1KIJ A;  1EKZ A;  4X64 I;  4DR5 I;  1YYW A;  2Z5E A;  4KQV A;  1PIE A;  4B3R E;  3B78 A;  1ZM2 A;  3F6H A;  1DAR A;  4X8W A;  1Z0W A;  4B3T E;  1RRE A;  4YY3 I;  3ADJ A;  3ADL A;  3QT6 A;  4WFT A;  4P7A A;  2L33 A;  3AUZ A;  1HR0 I;  4F9A B;  4KZS A;  1KTV A;  2IHR 1;  2ZIT A;  4HAC B;  4LFB I;  4JI5 E;  2Q2E B;  2CG9 A;  4DR7 I;  2NPF A;  5AE3 A;  2PNL A;  1GZ6 A;  2M4I A;  1N36 I;  2L2K B;  4DV3 E;  2HHH I;  1H7U A;  4DUZ E;  1IBM I;  2UXB I;  4KHP E;  3ZKD A;  4YHH I;  5AE1 A;  4NXM I;  2A2D A;  4X66 I;  1NHJ A;  4DR2 E;  1T4L B;  1N0V C;  5IT9 Q;  2RSM A;  4IZJ A;  2M7Q A;  2KHX A;  4GKK I;  3J7A M;  1YYK A;  1N33 E;  2LTR A;  1Z0V A;  4HXZ A;  2KOU A;  4IZJ D;  5IT9 C;  1K47 A;  1IBK E;  3J81 Q;  5GMD A;  1I94 E;  1DQ3 A;  4LF9 I;  2LUP B;  1OJ4 A;  4AQY I;  4TUI A;  4DR3 I;  2V83 A;  3C4T A;  2BV3 A;  3T1Y I;  2DSY A;  1Y4S A;  2LJH A;  4DPT A;  4DV4 I;  4DR1 E;  4JI7 I;  2B7T A;  2CZ9 A;  1Z0E A;  2CGE A;  3QT8 A;  2LBS B;  4LFC E;  2XEX A;  4B3M E;  2GS8 A;  1S4E A;  5ADZ A;  4FWD A;  4DV1 E;  2HK3 A;  4LF4 I;  2JWO A;  4DUY E;  5LMN E;  2Z5C B;  1NHI A;  4JI4 I;  1D6T A;  4J8Z A;  2B9D A;  1Z5A A;  3K1J A;  2HFU A;  5DNY A;  3P1X A;  1STU A;  3HPS A;  1XNR I;  1O0W A;  4MYT A;  4WUB A;  4DV5 E;  2GQ0 A;  1Z5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...