4DR7E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr7E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr7E02
1KTVA 1U2RA 4DV3E 4LF9E 1XNRE 3HULA 1Z0WA 1YYWA 1Z0GA 4YHHI 3ADGA 4OX9I 5LMNE 1PVGA 1N34I 1BKNA 4P7AA 3T1HE 3K17A 5L3JA 3WU6A 1B63A 2DB2A 4LF6E 2J7KA 2RS6A 4AQYI 2L2MA 2UXCI 4DR6E 4DUZE 1XMOE 1WUUA 1S16A 2AJ4A 1YYKA 1J26A 1H7SA 3LTOA 4WUBA 4LFCI 4DV4I 4Z7CA 4FWGA 3QT5A 1Z0BA 1HNWI 1Z5AA 4DPYA 1Z0EA 4M1KA 1QZRA 4DUYE 2EFGA 2MDRA 4LF8E 1N33I 4DR3I 2CZ9A 2DEJA 3QT7A 5A2QQ 2V2ZA 2NPFA 1X49A 4UTGA 4PU9A 4JI6E 2UXDI 4X64E 1RR9A 1D6TA 4JI1I 4WFTA 4LF5E 3VYXA 4NXME 1Z5CA 2R3VA 2DIXA 2LUQA 1X48A 1Z0TA 4RPFA 3WU5A 4X65I 5FLXC 4DV7I 2VQFI 1S4EA 3ZZTA 4DV3I 1IBLE 4WUCA 3VYYA 2IHR1 4DV5E 2UUAE 3T1YE 1H73A 4Z7YA 2ZM6I 5LMNI 2VQEE 1ZM2A 4DR2I 3J7AM 1FJGI 1WHNA 3J7AG 3H4LA 2DEIA 3J7Yp 1WHQA 2HHHE 1YZ9A 2LTSA 5LMUI 1IBKE 4K0KI 2N3HA 1XMOI 4DV0E 3J81C 2LJHA 1FKAE 4LF4E 1N32I 4LFAE 4UT4A 4DR4I 3JAMC 3V2UC 1UHZA 4DR1E 4I3HA 1PIEA 4JI7E 1ZM9A 4JI8I 4JG4A 1MX0A 2V2QA 1XMQE 3P1XA 1ZXMA 4DUYI 2UUBI 4B3SE 4LF8I 1STUA 4DR5E 2JY9A 1I94E 3ADLA 4NXNI 2LBSB 3ADIA 3OTOI 4GKJE 1UILA 2NA2A 4B3TE 3ADJA 4X64I 1YYOA 4DU7A 1HR0E 2HFSA 4JI0I 1HNXE 4DR7I 4DPWA 2RTXA 4LF5I 1RREA 2BV3A 2VF3A 4YY3E 1T4NA 4M2ZA 4MYUA 1J5EI 2E5LE 3B8HA 4DPXA 3J80C 4FWHA 4HXZA 1NHHA 3ZM7A 4OOGC 4X66E 3ZKBA 2B7VA 4B3RE 5GMDA 4KHPE 4LF7I 4DV6E 4FWDA 4DV5I 4JYAI 2UUAI 4HY1A 4JI4E 1FI4A 4B3ME 2A2DA 2X7IA 1N36E 4GKKE 5GMEA 5LL6R 4DV1E 1ZM3A 4LFBI 4JI3E 4HACB 5FLXQ 4JV5I 3LLHA 4HYMA 3D4JA 4X62I 3ZKDA 4USMA 1ZBTA 2L33A 4DV0I 3F0NA 4YHHE 2BM1A 4JI2E 2F4VI 1K47A 2NUEA 2V8PA 1ZXNA 3LPSA 4JI5I 3HTXA 2YT4A 2HK3A 4LF9I 1DARA 1XNRI 1H7UA 1EA6A 4DR5I 1KKHA 1UEKA 2X36A 2WW4A 1T4LB 5A2QC 1EI1A 1H72C 1NZ0A 2UXCE 1GQEA 4DPTA 1O0WA 4GKJI 1N0VC 2B3TB 1FWLA 3JAMQ 4LFCE 1HNXI 3T1HI 1NHIA 4DV2E 1HNWE 5IT9C 4YY3I 4LF6I 2OI2A 5CFFE 4DR6I 1N33E 4DUZI 4DR3E 1RC7A 3WU4A 2UXDE 3PYEA 1PKPA 2UU9E 2UUCE 2N3GA 4JI1E 4ED4A 2RSMA 1QU6A 4KHPI 2UXBE 4DKKA 3QT6A 2HKJA 4JI4I 3WU3A 2V2VA 2V34A 1Z59A 1Z0VA 2RS7A 2XEXA 4DV1I 4JI6I 1RQ0A 4X65E 2VQFE 4FW9A 1XNQE 2LRSA 3CWVA 1OJ4A 4DXLA 1IBME 3PYGA 2A2CA 4NXMI 3ZZ0A 1N0UA 3Q1QA 2ZBKB 4JI2I 2L3CA 2ZM6E 1HNZE 4DR2E 3B78A 5BR8E 1FJGE 2JVAA 2EZ6A 4XTJA 4P52A 3QT8A 1IBLI 5LMUE 3C4TA 4K0KE 3T1YI 4KQVA 3PYFA 1ZM4A 1N32E 2VQEI 4EMDA 4DR4E 2CPNA 4M30A 1X47A 4ZVIA 4DPUA 4JI8E 3GONA 3V5RA 4R1FA 2NUGA 4DV2I 5IWAE 2HHHI 4MYTA 1IBKI 1DI2A 2UUBE 4WUDA 2HK2A 4LF4I 4LFAI 4NXNE 4OX9E 3OTOE 4DR1I 1NHJA 4FN5A 2LTRA 4JI7I 3M6AA 1N34E 2UU9I 1Z0CA 1XMQI 2UUCI 4JI0E 4DR7E 3ZZUA 2HFUA 4B3SI 2UXBI 2LUPB 1XHKA 5IT9Q 1ELOA 1FWKA 4AQYE 1I94I 1J5EE 4X8WA 3K1JA 4USKA 4B3TI 2L2KB 2Q2EB 3J81Q 1A6FA 1HR0I 4DV4E 1T4OA 1MG7A 1B62A 1XNQI 2BM0A 2GS8A 4PRVA 1IBMI 4LF7E 2DMYA 2KHXA 4JYAE 1VISA 2E5LI 1KVKA 2L3JA 2E1RA 2HKEA 1H74A 2NUFA 3PYDA 1HNZI 4DU8A 4URLA 1KIJA 4HACA 5BR8I 1EKZA 4X66I 3B82A 2ZITA 4LFBE 4B3RI 2LJPA 1FNMA 3C4BA 4JV5E 4DV6I 1MU5A 4X62E 4B3MI 1N36I 2L2NA 4GKKI 2B7TA 2F4VE 3J80Q 4PRXA 1Z5BA 4DV7E 4JI3I 4WYQB 4JI5E 5IWAI 3LNUA 2R42A
chains in the Genus database with same CATH superfamily
1KYQA 5KL3A 2YZTA 5AE3A 1A1JA 1KTVA 1U2RA 4DV3E 4LF9E 1XNRE 3HULA 1YSAC 1Z0WA 5JEAA 4L5NC 2JYAA 1YYWA 1Z0GA 4YHHI 3ADGA 4P7DA 4OX9I 5LMNE 2O3ZA 1PVGA 2EL6A 3QG5C 1RMDA 5C0XC 4BC7A 2CG9A 1N34I 3AUZA 4GZNC 2ENAA 3ZOQB 4O4KA 5A6KA 2EMLA 2ENHA 1BKNA 4P7AA 2MKDA 3T1HE 4HTGA 1TN9A 3K17A 5L3JA 3WU6A 1B63A 1SFEA 4LCHA 2DB2A 3CDIA 3TQMA 4LF6E 2J7KA 2JEAB 1ZBQA 2RS6A 4AQYI 2PNZA 1IQSA 3B4TA 2L2MA 4Q35B 2UXCI 4DR6E 1DGCA 4DUZE 1XMOE 1WUUA 1S16A 2AJ4A 1YYKA 2JEBA 4NZVA 2GLIA 4FK5C 1J26A 3EPJA 1H7SA 3LTOA 1UDQA 4WUBA 3BF2A 5JEAD 4LFCI 4DV4I 2WP8B 4Z7CA 4FWGA 3KWRA 3QT5A 5DRPA 1Z0BA 1HNWI 1EH8A 1Z5AA 1PJSA 4DPYA 2HGHA 1Z0EA 4M1KA 1YUIA 2C38A 1QZRA 2GHFA 1T38A 1OYRA 4AIMA 4DUYE 2ODRD 2EFGA 2YTEA 2NN6B 2JR1A 2MDRA 3DD6A 4LF8E 4U3BA 4R2QA 2PO1A 1N33I 4DR3I 2CZ9A 2DEJA 3U1YA 3QT7A 4Q28A 2EM5A 4BA1B 2YTNA 5A2QQ 2EM7A 1Y5YA 1X5WA 2V2ZA 3H09A 4R2RA 2NPFA 1X49A 4UTGA 4PU9A 2YTFA 2LT7A 4WSGA 4L8NA 4X64E 4JI6E 1BB8A 1RR9A 2UXDI 1D6TA 3RMPA 4JI1I 1P42A 1HK7A 2BA1G 4WFTA 3PS2A 2YPNA 2EPRA 2EL5A 1NEIA 4LF5E 3HJCA 2C37A 4IZKA 5AC4A 2EOYA 3VYXA 4NXME 3P3CA 1Z5CA 4BMJA 2YTDA 3THOB 2R3VA 2DIXA 1PDAA 2VE7C 4ZYDA 4FW5A 4OO1B 1AH5A 2EQ0A 2EPNA 2LUQA 1X48A 1Z0TA 4RPFA 3WU5A 4X65I 5FLXC 4DV7I 2VQFI 1G2FC 2CGEA 3IWCA 1S4EA 3ZZTA 3MSWA 2EM4A 4DV3I 2K7IA 4FW6A 2YWQA 4O43A 1IBLE 2IOQA 3VYYA 4WUCA 2E1MA 2IHR1 3HXLA 2NABA 1HNZI 2JPAA 4HEIA 4DV5E 2UUAE 3T1YE 1H73A 5ADZA 4N4RB 4Z7YA 2DGCA 2EOMA 4TUGA 2ZM6I 5LMNI 2VESA 2KOUA 2VQEE 3DF6A 1ZM2A 5JEAC 4DR2I 3J7AM 4AM3A 1Z1BA 1X3CA 3VK6A 1FJGI 4MU0A 2WNRB 2JOXA 4RH8A 2B9DA 1WHNA 5F3WA 2CVEA 3J7AG 3H4LA 2EMZA 2PO0B 2EOEA 2EPMX 3J7Yp 4ZYEA 1WHQA 2HHHE 2DEIA 1YZ9A 4BA2B 2L8TA 1KJKA 2Z5CA 4WXDA 2BR2A 2LTSA 3M7ND 2ODRC 5LMUI 1F2IG 1IBKE 4R2DA 4K0KI 1WJPA 2N3HA 1XMOI 1EH7A 2AE8A 4DV0E 3J81C 2LJHA 1FKAE 4LF4E 2BB8A 1N32I 4LFAE 5K36A 4MU4A 2NN6F 4UT4A 4DR4I 2PO2A 2MDGA 3JAMC 2ELZA 1P47A 1Y4SA 3V2UC 4IFDB 1UHZA 4DR1E 4I3HA 5AC5A 4JI7E 1PIEA 1ZM9A 1MEYC 4JI8I 2O1UA 4JG4A 4IZJA 1MX0A 2V2QA 2EPLX 1XMQE 3IWBA 3P1XA 2A25A 1ZXMA 4R2CA 2ENCA 5DNXA 2LE2A 2O1TA 5DRRA 4R2EA 1A1HA 5K36F 1ZR9A 4DUYI 2C39A 2UUBI 4B3SE 1VI7A 4LF8I 1STUA 2RSIA 4WX9A 4LU9A 4DR5E 2JY9A 4F9BB 1I94E 3ADLA 4NXNI 2LBSB 1Y4UA 3ADIA 3OTOI 2V8QB 5DNLA 1Y60A 4GKJE 3U1KA 1QNTA 1UILA 2NA2A 2EM2A 4IJDA 3ECRA 3ADJA 4B3TE 1PJTA 4BC9A 4MDTA 2EPKX 3HPZA 4X64I 2EPPA 2V89A 1YYOA 4DU7A 4OO1F 2BBGA 1HR0E 2HFSA 5K36D 4JI0I 1HNXE 4DR7I 2HC5A 4DPWA 2EMKA 4R2SA 4QNKA 2EP3A 2RTXA 3NZKA 4LF5I 1RREA 4X9JA 2BV3A 2EJ4A 2ADRA 4YY3E 3EPHA 2VF3A 1GZ6A 1T4NA 4M2ZA 2EE8A 3THNA 3GMEA 5KL4A 4IZJD 2EMAA 2J7JA 4MYUA 1RHYA 1J5EI 2LJUA 2E5LE 2EOXA 3B8HA 3J80C 4DPXA 3M99B 4P78A 2LV2A 1X6HA 2M9AA 1ZAAC 2JXPA 5AASA 4MU1A 5T6JA 2EWLA 2J65A 3K6QA 5A6BA 4FWHA 1E3HA 4HXZA 1NHHA 2WBSA 2EOOA 4OOGC 4X66E 3ZM7A 3KZYA 2JE6B 3ZKBA 2B7VA 2BA0D 2G7HA 4B3RE 5GMDA 2E72A 2LMZA 5ELWA 2EM3A 2YTIA 4F9CB 4KHPE 2YTQA 4M9VC 2F8BA 4LF7I 2MKNA 3K85A 3M7NG 4DV6E 2GQ0A 1TF6A 4FWDA 3AV0A 1YFHA 1JK1A 2GO3A 4DV5I 2EN6A 2UUAI 4JYAI 4IFDA 5AE2A 4HY1A 4LPFA 4JI4E 1L4SA 4F6MA 4DMIA 1FI4A 4B3ME 2A2DA 2X7IA 1N36E 4BHBA 2LO3A 4BHCA 4GKKE 2DLKA 5LL6R 5GMEA 4DV1E 4N3OA 5K36E 1BBGA 2EQ1A 4QNJA 1ZM3A 4LFBI 3GLLA 2CSHA 4JI3E 4IFDF 4HACB 5FLXQ 2Q8UA 1A1LA 4JV5I 3LLHA 1X6EA 4HYMA 5LLQA 2GPIA 2V88A 3D4JA 4X62I 3M85D 1A1IA 3ZKDA 4USMA 1ZBTA 5A6BD 2PNLA 4KZSA 4FW4A 2L33A 2D9HA 1GTKA 3VHTB 1UBDC 3F6GA 2YU5A 4DV0I 1YH8A 3EPLA 2VRDA 2EQ3A 3F0NA 4YHHE 2BM1A 1YHCA 3EPKA 4JI2E 4BBYA 1UDNA 1K47A 2NUEA 2V8PA 2F4VI 1ZXNA 3LPSA 5FWKA 2L92A 3FIGA 4IFDD 2I9IA 2RPCA 4JI5I 3HTXA 2YT4A 3IWDA 5K36C 2M1SA 4GQUA 2EMBA 1AAYA 5C0XF 2JEAA 2YTJA 2HK3A 2EM8A 1YUJA 4LTYA 1DARA 3KZZA 2Z5BB 5EKWA 4LF9I 1XNRI 1H7UA 4ISAA 5IV8B 1G2DC 1EA6A 2GO4A 4DR5I 4M0VA 1KKHA 1UEKA 2IOPA 4TUIA 2X36A 3P76A 2WW4A 1T4LB 5A2QC 1EI1A 1H72C 1A1FA 1NZ0A 2UXCE 1UDSA 3Q6NA 1GQEA 4DPTA 1O0WA 2K4VA 2WP8A 4GKJI 5JEAB 2HJJA 1N0VC 1TF3A 2PNMA 2B3TB 1FWLA 2EPOA 1XXEA 3JAMQ 3GCMA 4LFCE 1HNXI 3T1HI 1NHIA 2NN6A 4DV2E 2DLQA 2H36X 1UN6B 1B69A 1HNWE 5IT9C 4YY3I 4NHRA 4LF6I 1IMUA 2OI2A 4BA1A 1BBOA 5CFFE 2EOSA 4DR6I 1N33E 4DUZI 4DR3E 5EL9A 2EMCA 2N8XA 3P3EA 2EOHA 2PNZB 4IFDE 1RC7A 1PJQA 4R03A 2FGGA 1MGTA 4O24A 2UXDE 2JEBB 3PYEA 1PKPA 4MU3A 2UU9E 2UUCE 3WU4A 2N3GA 4JI1E 4ED4A 2RSMA 1QU6A 4KHPI 2EMHA 3OMLA 4WPYA 2EM0A 1X6FA 2V87A 3C6KA 2EM6A 2UXBE 1T39A 2L6MA 4OO1A 4DKKA 3QT6A 2HKJA 3JTZA 2EOFA 4JI4I 2NN6D 2C38B 2YSPA 3WU3A 2V2VA 2V34A 1Z59A 1Z0VA 2RS7A 2DMIA 2PO1B 2XEXA 4RHBB 2M7QA 1LLMC 4DV1I 4JI6I 4IFDC 1RQ0A 4X65E 1YPNA 5KL6A 1JK2A 2VQFE 3MHSC 4FW9A 2BA1D 1XNQE 2JP9A 2LRSA 3CWVA 3P3GA 1OJ4A 4DXLA 3L7ZB 1IBME 3PYGA 2A2CA 4IS9A 3ZZ0A 4NXMI 1WXRA 5IXMB 1N0UA 3Q1QA 2R1FA 2C37B 4IZKB 2ZBKB 4FW7A 4JI2I 2WNRA 1ZU1A 2L3CA 4O5GA 2YRKA 2ZM6E 3BGHA 2EN2A 4OO1D 1HNZE 2V83A 2PO0A 4DR2E 2YTOA 1A1KA 2V86A 5BR8E 3B78A 2CT1A 2EN1A 1FJGE 4FW3A 4BA2A 2JVAA 2EZ6A 2EMIA 5JEAF 3L00A 2YRMA 2EMWA 1Y6ZA 4XTJA 2RQLA 4P52A 3QT8A 1IBLI 4LCGA 2F1DA 2YTPA 2LVHA 2EN8A 4IS1C 5LMUE 2NN6E 2WCC3 4LCFA 2PRTA 3C4TA 4K0KE 3T1YI 4KQVA 5C0XB 4F6NA 3PS1A 3KRNA 3BBGA 5A69A 3Q6MA 3PYFA 1ZM4A 1N32E 1IQOA 2VQEI 4EMDA 4DR4E 2CPNA 2WBTA 2JOBA 1X47A 4M30A 1USUA 2O1VA 4ZVIA 4DPUA 4KWYA 4JI8E 3GONA 3V5RA 1N3GA 4R1FA 4MLQA 2NUGA 4J8ZA 2EOIA 5KL5A 5IWAE 1E3PA 4DV2I 2HHHI 2CTDA 2MC5A 4MYTA 1IBKI 4NBQA 3HQ1A 2I13A 1DI2A 2UUBE 2NN6C 4WUDA 2HK2A 5C0XA 3LMLA 4R2AA 3F6HA 4R2PA 2BR2B 2Z5CB 4AIDA 4LF4I 2EL4A 4LFAI 4NXNE 3MHHC 4OO1E 2JT2A 3EQ1A 4OX9E 3BIDA 3OTOE 4GEQB 4DR1I 1NHJA 2LTRA 2IESA 2IERA 4FN5A 3M6AA 2EN3A 4R8OA 4OZEA 4JI7I 5K36B 1N34E 2UU9I 1Z0CA 1XMQI 2UUCI 2PO2B 1OYPA 3H1CA 3HPSA 3L7ZA 4JI0E 4DR7E 1UDOA 5DRQA 3ZZUA 2HFUA 2EMYA 4IZJB 4J3DA 4B3SI 2EPZA 2UXBI 2LUPB 4BCAA 1XHKA 3CDJA 2M4IA 2R76A 4OKGA 5IT9Q 5A6AA 1ELOA 5DROA 1FWKA 2EPXA 2EN7A 4WSPA 4AQYE 2KONA 4ZYHA 1I94I 1J5EE 2EMFA 2WZOA 2C39B 1SR9A 4X8WA 1A1GA 5KL7A 3K1JA 4USKA 4OO1C 5JEAE 4B3TI 2JE6A 2L2KB 2MC6A 5KL2A 2Q2EB 3J81Q 1DQ3A 3UHMA 5C0XD 1A6FA 2EN4A 1HR0I 4DV4E 1T4OA 1MG7A 1B62A 3HKMA 2EOJA 2EPUA 4ZYGA 2BM0A 1XNQI 2BA0G 2GS8A 4PRVA 1IBMI 4F9AB 4LF7E 2DMYA 2KHXA 2JWOA 2EPAA 4JYAE 1VISA 2E5LI 4U3DA 5DNYA 1KVKA 4MQYA 2L3JA 2EMXA 2E1RA 2HKEA 2YSOA 1EH6A 1H74A 2WBUA 2NUFA 5A6JA 3PYDA 3PS3A 1KIJA 3UK3C 3P06A 4HACA 4DU8A 4URLA 2Z5EA 5BR8I 4WXCA 1EKZA 4X66I 1NCSA 1WRJA 2VF1A 2EOQA 4MLVA 2FV4B 4LFBE 2ZITA 3B82A 2LJPA 4B3RI 4I8OA 1FNMA 3C4BA 4F2JC 2EMGA 2EM9A 4JV5E 3M85G 4DV6I 1MU5A 2LCEA 4X62E 1OYSA 5AE1A 4LOMA 2EORA 2ELYA 4B3MI 2O1WA 3JU0A 2YRHA 2YU8A 3C6MA 2EPCA 2YTGA 1N36I 4F54A 2L2NA 2FTXB 2B7TA 2DRPA 2DSYA 2F4VE 4PRXA 5C0XE 3J80Q 2EOZA 4GKKI 4BS9A 3PRYA 1R6LA 1Z5BA 5TSEA 4DV7E 2Z5BA 2V85A 3DJWA 4JI3I 4WYQB 4JI5E 5IWAI 1R6MA 3LNUA 2R42A 1USVA
chains in the Genus database with same CATH topology
2YZTA 5AE3A 1KTVA 1U2RA 4DV3E 4LF9E 1XNRE 3HULA 1Z0WA 4L5NC 1YYWA 1Z0GA 4YHHI 3ADGA 4P7DA 4OX9I 5LMNE 1PVGA 4BC7A 2CG9A 1N34I 3AUZA 3ZOQB 1BKNA 4P7AA 3T1HE 3K17A 5L3JA 3WU6A 1B63A 2DB2A 4LF6E 2J7KA 1ZBQA 2RS6A 4AQYI 2L2MA 2UXCI 4DR6E 4DUZE 1XMOE 1WUUA 1S16A 2AJ4A 1YYKA 1J26A 1H7SA 3LTOA 4WUBA 4LFCI 4DV4I 4Z7CA 4FWGA 3KWRA 3QT5A 1Z0BA 1HNWI 1Z5AA 4DPYA 1Z0EA 4M1KA 1QZRA 4DUYE 2ODRD 2EFGA 2JR1A 2MDRA 4LF8E 1N33I 4DR3I 2CZ9A 2DEJA 3QT7A 4Q28A 5A2QQ 2V2ZA 3H09A 2NPFA 1X49A 4UTGA 4PU9A 4JI6E 4L8NA 4X64E 1RR9A 2UXDI 1D6TA 3RMPA 4JI1I 1HK7A 4WFTA 4LF5E 3HJCA 4IZKA 3VYXA 4NXME 1Z5CA 4BMJA 2R3VA 2DIXA 2VE7C 2LUQA 1X48A 1Z0TA 4RPFA 3WU5A 4X65I 5FLXC 4DV7I 2VQFI 2CGEA 3IWCA 1S4EA 3ZZTA 3MSWA 4DV3I 1IBLE 2IOQA 3VYYA 4WUCA 2E1MA 2IHR1 3HXLA 4DV5E 1H73A 3T1YE 2UUAE 5ADZA 4Z7YA 2ZM6I 4TUGA 5LMNI 2KOUA 2VQEE 3DF6A 1ZM2A 4DR2I 3J7AM 3VK6A 1FJGI 2JOXA 2B9DA 1WHNA 5F3WA 3J7AG 3H4LA 2DEIA 3J7Yp 1WHQA 2HHHE 1YZ9A 2L8TA 2Z5CA 2LTSA 2ODRC 5LMUI 1IBKE 4K0KI 2N3HA 1XMOI 4DV0E 3J81C 2LJHA 1FKAE 4LF4E 1N32I 4LFAE 4UT4A 4DR4I 3JAMC 1Y4SA 3V2UC 1UHZA 4DR1E 4I3HA 1PIEA 4JI7E 1ZM9A 4JI8I 2O1UA 4JG4A 4IZJA 1MX0A 2V2QA 1XMQE 3IWBA 3P1XA 1ZXMA 2LE2A 2O1TA 4DUYI 2UUBI 4B3SE 4LF8I 1STUA 4DR5E 4LU9A 2JY9A 4F9BB 1I94E 3ADLA 4NXNI 2LBSB 1Y4UA 3ADIA 3OTOI 2V8QB 4GKJE 1UILA 2NA2A 4B3TE 3ADJA 4BC9A 3HPZA 4X64I 2V89A 1YYOA 4DU7A 1HR0E 2HFSA 4JI0I 1HNXE 4DR7I 4DPWA 2RTXA 4LF5I 1RREA 2BV3A 2VF3A 4YY3E 1GZ6A 1T4NA 4M2ZA 4IZJD 4MYUA 1J5EI 2E5LE 3B8HA 3J80C 4DPXA 4P78A 5AASA 5T6JA 2EWLA 4FWHA 3K6QA 4HXZA 1NHHA 3ZM7A 4OOGC 4X66E 3ZKBA 2B7VA 2G7HA 4B3RE 5GMDA 2LMZA 4F9CB 4KHPE 2F8BA 4LF7I 3K85A 4DV6E 2GQ0A 4FWDA 3AV0A 4DV5I 4JYAI 2UUAI 5AE2A 4HY1A 4JI4E 1FI4A 4DMIA 4B3ME 2A2DA 2X7IA 1N36E 4GKKE 5LL6R 5GMEA 4DV1E 4N3OA 1ZM3A 4LFBI 4JI3E 4HACB 5FLXQ 4JV5I 3LLHA 4HYMA 3D4JA 2V88A 4X62I 3ZKDA 4USMA 1ZBTA 2PNLA 4KZSA 2L33A 3F6GA 4DV0I 3F0NA 4YHHE 2BM1A 4JI2E 4BBYA 2F4VI 1K47A 2NUEA 2V8PA 1ZXNA 3LPSA 5FWKA 2L92A 3FIGA 4JI5I 3HTXA 2YT4A 3IWDA 2M1SA 2HK3A 2Z5BB 4LTYA 1DARA 4LF9I 1XNRI 1H7UA 1EA6A 4DR5I 4M0VA 1KKHA 1UEKA 2IOPA 4TUIA 2X36A 2WW4A 1T4LB 5A2QC 1EI1A 1H72C 1NZ0A 2UXCE 3Q6NA 1GQEA 4DPTA 1O0WA 2K4VA 4GKJI 1N0VC 2PNMA 2B3TB 1FWLA 3JAMQ 4LFCE 1HNXI 3T1HI 1NHIA 4DV2E 2H36X 1HNWE 5IT9C 4YY3I 4LF6I 2OI2A 5CFFE 4DR6I 1N33E 4DUZI 4DR3E 1RC7A 4R03A 2FGGA 3WU4A 2UXDE 3PYEA 1PKPA 2UU9E 2UUCE 2N3GA 4JI1E 4ED4A 2RSMA 1QU6A 4KHPI 3OMLA 4WPYA 2V87A 2UXBE 2L6MA 4DKKA 3QT6A 2HKJA 3JTZA 4JI4I 3WU3A 2V2VA 2V34A 1Z59A 1Z0VA 2RS7A 2XEXA 2M7QA 4DV1I 4JI6I 1RQ0A 4X65E 2VQFE 4FW9A 1XNQE 2LRSA 3CWVA 1OJ4A 4DXLA 1IBME 3PYGA 2A2CA 4NXMI 3ZZ0A 1WXRA 1N0UA 3Q1QA 4IZKB 2ZBKB 4JI2I 2L3CA 2ZM6E 1HNZE 2V83A 4DR2E 2V86A 5BR8E 3B78A 1FJGE 2JVAA 2EZ6A 1Y6ZA 4XTJA 4P52A 3QT8A 1IBLI 5LMUE 3C4TA 4K0KE 3T1YI 4KQVA 3Q6MA 3PYFA 1ZM4A 1N32E 2VQEI 4EMDA 4DR4E 2CPNA 2JOBA 1X47A 4M30A 1USUA 2O1VA 4ZVIA 4DPUA 4JI8E 3GONA 3V5RA 4R1FA 2NUGA 4J8ZA 4DV2I 5IWAE 2HHHI 2MC5A 4MYTA 1IBKI 3HQ1A 1DI2A 2UUBE 4WUDA 2HK2A 3LMLA 2Z5CB 3F6HA 4LF4I 4LFAI 4NXNE 4OX9E 3OTOE 4GEQB 4DR1I 1NHJA 2LTRA 4FN5A 4JI7I 3M6AA 4R8OA 1N34E 2UU9I 1Z0CA 1XMQI 2UUCI 3HPSA 4JI0E 4DR7E 3ZZUA 2HFUA 4IZJB 4B3SI 2UXBI 2LUPB 4BCAA 1XHKA 2M4IA 5IT9Q 1ELOA 1FWKA 4AQYE 4WSPA 1I94I 2KONA 1J5EE 2WZOA 1SR9A 4X8WA 3K1JA 4USKA 4B3TI 2L2KB 2MC6A 2Q2EB 3J81Q 1DQ3A 1A6FA 1HR0I 4DV4E 1T4OA 1MG7A 1B62A 1XNQI 2BM0A 2GS8A 4PRVA 1IBMI 4F9AB 4LF7E 2DMYA 2KHXA 2JWOA 4JYAE 1VISA 2E5LI 5DNYA 1KVKA 2L3JA 2E1RA 2HKEA 1H74A 2NUFA 3PYDA 1HNZI 4DU8A 4URLA 1KIJA 3P06A 4HACA 2Z5EA 5BR8I 1EKZA 4X66I 2VF1A 2ZITA 2FV4B 4LFBE 3B82A 4B3RI 2LJPA 4I8OA 1FNMA 3C4BA 4JV5E 4DV6I 1MU5A 4X62E 5AE1A 4B3MI 2O1WA 3JU0A 1N36I 4F54A 2L2NA 2FTXB 2B7TA 4GKKI 2DSYA 2F4VE 4PRXA 3J80Q 4BS9A 3PRYA 1Z5BA 4DV7E 2Z5BA 2V85A 3DJWA 4JI3I 4WYQB 4JI5E 5IWAI 3LNUA 2R42A 1USVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTV A;  1U2R A;  4DV3 E;  4LF9 E;  1XNR E;  3HUL A;  1Z0W A;  1YYW A;  1Z0G A;  4YHH I;  3ADG A;  4OX9 I;  5LMN E;  1PVG A;  1N34 I;  1BKN A;  4P7A A;  3T1H E;  3K17 A;  5L3J A;  3WU6 A;  1B63 A;  2DB2 A;  4LF6 E;  2J7K A;  2RS6 A;  4AQY I;  2L2M A;  2UXC I;  4DR6 E;  4DUZ E;  1XMO E;  1WUU A;  1S16 A;  2AJ4 A;  1YYK A;  1J26 A;  1H7S A;  3LTO A;  4WUB A;  4LFC I;  4DV4 I;  4Z7C A;  4FWG A;  3QT5 A;  1Z0B A;  1HNW I;  1Z5A A;  4DPY A;  1Z0E A;  4M1K A;  1QZR A;  4DUY E;  2EFG A;  2MDR A;  4LF8 E;  1N33 I;  4DR3 I;  2CZ9 A;  2DEJ A;  3QT7 A;  5A2Q Q;  2V2Z A;  2NPF A;  1X49 A;  4UTG A;  4PU9 A;  4JI6 E;  2UXD I;  4X64 E;  1RR9 A;  1D6T A;  4JI1 I;  4WFT A;  4LF5 E;  3VYX A;  4NXM E;  1Z5C A;  2R3V A;  2DIX A;  2LUQ A;  1X48 A;  1Z0T A;  4RPF A;  3WU5 A;  4X65 I;  5FLX C;  4DV7 I;  2VQF I;  1S4E A;  3ZZT A;  4DV3 I;  1IBL E;  4WUC A;  3VYY A;  2IHR 1;  4DV5 E;  2UUA E;  3T1Y E;  1H73 A;  4Z7Y A;  2ZM6 I;  5LMN I;  2VQE E;  1ZM2 A;  4DR2 I;  3J7A M;  1FJG I;  1WHN A;  3J7A G;  3H4L A;  2DEI A;  3J7Y p;  1WHQ A;  2HHH E;  1YZ9 A;  2LTS A;  5LMU I;  1IBK E;  4K0K I;  2N3H A;  1XMO I;  4DV0 E;  3J81 C;  2LJH A;  1FKA E;  4LF4 E;  1N32 I;  4LFA E;  4UT4 A;  4DR4 I;  3JAM C;  3V2U C;  1UHZ A;  4DR1 E;  4I3H A;  1PIE A;  4JI7 E;  1ZM9 A;  4JI8 I;  4JG4 A;  1MX0 A;  2V2Q A;  1XMQ E;  3P1X A;  1ZXM A;  4DUY I;  2UUB I;  4B3S E;  4LF8 I;  1STU A;  4DR5 E;  2JY9 A;  1I94 E;  3ADL A;  4NXN I;  2LBS B;  3ADI A;  3OTO I;  4GKJ E;  1UIL A;  2NA2 A;  4B3T E;  3ADJ A;  4X64 I;  1YYO A;  4DU7 A;  1HR0 E;  2HFS A;  4JI0 I;  1HNX E;  4DR7 I;  4DPW A;  2RTX A;  4LF5 I;  1RRE A;  2BV3 A;  2VF3 A;  4YY3 E;  1T4N A;  4M2Z A;  4MYU A;  1J5E I;  2E5L E;  3B8H A;  4DPX A;  3J80 C;  4FWH A;  4HXZ A;  1NHH A;  3ZM7 A;  4OOG C;  4X66 E;  3ZKB A;  2B7V A;  4B3R E;  5GMD A;  4KHP E;  4LF7 I;  4DV6 E;  4FWD A;  4DV5 I;  4JYA I;  2UUA I;  4HY1 A;  4JI4 E;  1FI4 A;  4B3M E;  2A2D A;  2X7I A;  1N36 E;  4GKK E;  5GME A;  5LL6 R;  4DV1 E;  1ZM3 A;  4LFB I;  4JI3 E;  4HAC B;  5FLX Q;  4JV5 I;  3LLH A;  4HYM A;  3D4J A;  4X62 I;  3ZKD A;  4USM A;  1ZBT A;  2L33 A;  4DV0 I;  3F0N A;  4YHH E;  2BM1 A;  4JI2 E;  2F4V I;  1K47 A;  2NUE A;  2V8P A;  1ZXN A;  3LPS A;  4JI5 I;  3HTX A;  2YT4 A;  2HK3 A;  4LF9 I;  1DAR A;  1XNR I;  1H7U A;  1EA6 A;  4DR5 I;  1KKH A;  1UEK A;  2X36 A;  2WW4 A;  1T4L B;  5A2Q C;  1EI1 A;  1H72 C;  1NZ0 A;  2UXC E;  1GQE A;  4DPT A;  1O0W A;  4GKJ I;  1N0V C;  2B3T B;  1FWL A;  3JAM Q;  4LFC E;  1HNX I;  3T1H I;  1NHI A;  4DV2 E;  1HNW E;  5IT9 C;  4YY3 I;  4LF6 I;  2OI2 A;  5CFF E;  4DR6 I;  1N33 E;  4DUZ I;  4DR3 E;  1RC7 A;  3WU4 A;  2UXD E;  3PYE A;  1PKP A;  2UU9 E;  2UUC E;  2N3G A;  4JI1 E;  4ED4 A;  2RSM A;  1QU6 A;  4KHP I;  2UXB E;  4DKK A;  3QT6 A;  2HKJ A;  4JI4 I;  3WU3 A;  2V2V A;  2V34 A;  1Z59 A;  1Z0V A;  2RS7 A;  2XEX A;  4DV1 I;  4JI6 I;  1RQ0 A;  4X65 E;  2VQF E;  4FW9 A;  1XNQ E;  2LRS A;  3CWV A;  1OJ4 A;  4DXL A;  1IBM E;  3PYG A;  2A2C A;  4NXM I;  3ZZ0 A;  1N0U A;  3Q1Q A;  2ZBK B;  4JI2 I;  2L3C A;  2ZM6 E;  1HNZ E;  4DR2 E;  3B78 A;  5BR8 E;  1FJG E;  2JVA A;  2EZ6 A;  4XTJ A;  4P52 A;  3QT8 A;  1IBL I;  5LMU E;  3C4T A;  4K0K E;  3T1Y I;  4KQV A;  3PYF A;  1ZM4 A;  1N32 E;  2VQE I;  4EMD A;  4DR4 E;  2CPN A;  4M30 A;  1X47 A;  4ZVI A;  4DPU A;  4JI8 E;  3GON A;  3V5R A;  4R1F A;  2NUG A;  4DV2 I;  5IWA E;  2HHH I;  4MYT A;  1IBK I;  1DI2 A;  2UUB E;  4WUD A;  2HK2 A;  4LF4 I;  4LFA I;  4NXN E;  4OX9 E;  3OTO E;  4DR1 I;  1NHJ A;  4FN5 A;  2LTR A;  4JI7 I;  3M6A A;  1N34 E;  2UU9 I;  1Z0C A;  1XMQ I;  2UUC I;  4JI0 E;  4DR7 E;  3ZZU A;  2HFU A;  4B3S I;  2UXB I;  2LUP B;  1XHK A;  5IT9 Q;  1ELO A;  1FWK A;  4AQY E;  1I94 I;  1J5E E;  4X8W A;  3K1J A;  4USK A;  4B3T I;  2L2K B;  2Q2E B;  3J81 Q;  1A6F A;  1HR0 I;  4DV4 E;  1T4O A;  1MG7 A;  1B62 A;  1XNQ I;  2BM0 A;  2GS8 A;  4PRV A;  1IBM I;  4LF7 E;  2DMY A;  2KHX A;  4JYA E;  1VIS A;  2E5L I;  1KVK A;  2L3J A;  2E1R A;  2HKE A;  1H74 A;  2NUF A;  3PYD A;  1HNZ I;  4DU8 A;  4URL A;  1KIJ A;  4HAC A;  5BR8 I;  1EKZ A;  4X66 I;  3B82 A;  2ZIT A;  4LFB E;  4B3R I;  2LJP A;  1FNM A;  3C4B A;  4JV5 E;  4DV6 I;  1MU5 A;  4X62 E;  4B3M I;  1N36 I;  2L2N A;  4GKK I;  2B7T A;  2F4V E;  3J80 Q;  4PRX A;  1Z5B A;  4DV7 E;  4JI3 I;  4WYQ B;  4JI5 E;  5IWA I;  3LNU A;  2R42 A; 
#chains in the Genus database with same CATH topology
 1KYQ A;  5KL3 A;  2YZT A;  5AE3 A;  1A1J A;  1KTV A;  1U2R A;  4DV3 E;  4LF9 E;  1XNR E;  3HUL A;  1YSA C;  1Z0W A;  5JEA A;  4L5N C;  2JYA A;  1YYW A;  1Z0G A;  4YHH I;  3ADG A;  4P7D A;  4OX9 I;  5LMN E;  2O3Z A;  1PVG A;  2EL6 A;  3QG5 C;  1RMD A;  5C0X C;  4BC7 A;  2CG9 A;  1N34 I;  3AUZ A;  4GZN C;  2ENA A;  3ZOQ B;  4O4K A;  5A6K A;  2EML A;  2ENH A;  1BKN A;  4P7A A;  2MKD A;  3T1H E;  4HTG A;  1TN9 A;  3K17 A;  5L3J A;  3WU6 A;  1B63 A;  1SFE A;  4LCH A;  2DB2 A;  3CDI A;  3TQM A;  4LF6 E;  2J7K A;  2JEA B;  1ZBQ A;  2RS6 A;  4AQY I;  2PNZ A;  1IQS A;  3B4T A;  2L2M A;  4Q35 B;  2UXC I;  4DR6 E;  1DGC A;  4DUZ E;  1XMO E;  1WUU A;  1S16 A;  2AJ4 A;  1YYK A;  2JEB A;  4NZV A;  2GLI A;  4FK5 C;  1J26 A;  3EPJ A;  1H7S A;  3LTO A;  1UDQ A;  4WUB A;  3BF2 A;  5JEA D;  4LFC I;  4DV4 I;  2WP8 B;  4Z7C A;  4FWG A;  3KWR A;  3QT5 A;  5DRP A;  1Z0B A;  1HNW I;  1EH8 A;  1Z5A A;  1PJS A;  4DPY A;  2HGH A;  1Z0E A;  4M1K A;  1YUI A;  2C38 A;  1QZR A;  2GHF A;  1T38 A;  1OYR A;  4AIM A;  4DUY E;  2ODR D;  2EFG A;  2YTE A;  2NN6 B;  2JR1 A;  2MDR A;  3DD6 A;  4LF8 E;  4U3B A;  4R2Q A;  2PO1 A;  1N33 I;  4DR3 I;  2CZ9 A;  2DEJ A;  3U1Y A;  3QT7 A;  4Q28 A;  2EM5 A;  4BA1 B;  2YTN A;  5A2Q Q;  2EM7 A;  1Y5Y A;  1X5W A;  2V2Z A;  3H09 A;  4R2R A;  2NPF A;  1X49 A;  4UTG A;  4PU9 A;  2YTF A;  2LT7 A;  4WSG A;  4L8N A;  4X64 E;  4JI6 E;  1BB8 A;  1RR9 A;  2UXD I;  1D6T A;  3RMP A;  4JI1 I;  1P42 A;  1HK7 A;  2BA1 G;  4WFT A;  3PS2 A;  2YPN A;  2EPR A;  2EL5 A;  1NEI A;  4LF5 E;  3HJC A;  2C37 A;  4IZK A;  5AC4 A;  2EOY A;  3VYX A;  4NXM E;  3P3C A;  1Z5C A;  4BMJ A;  2YTD A;  3THO B;  2R3V A;  2DIX A;  1PDA A;  2VE7 C;  4ZYD A;  4FW5 A;  4OO1 B;  1AH5 A;  2EQ0 A;  2EPN A;  2LUQ A;  1X48 A;  1Z0T A;  4RPF A;  3WU5 A;  4X65 I;  5FLX C;  4DV7 I;  2VQF I;  1G2F C;  2CGE A;  3IWC A;  1S4E A;  3ZZT A;  3MSW A;  2EM4 A;  4DV3 I;  2K7I A;  4FW6 A;  2YWQ A;  4O43 A;  1IBL E;  2IOQ A;  3VYY A;  4WUC A;  2E1M A;  2IHR 1;  3HXL A;  2NAB A;  1HNZ I;  2JPA A;  4HEI A;  4DV5 E;  2UUA E;  3T1Y E;  1H73 A;  5ADZ A;  4N4R B;  4Z7Y A;  2DGC A;  2EOM A;  4TUG A;  2ZM6 I;  5LMN I;  2VES A;  2KOU A;  2VQE E;  3DF6 A;  1ZM2 A;  5JEA C;  4DR2 I;  3J7A M;  4AM3 A;  1Z1B A;  1X3C A;  3VK6 A;  1FJG I;  4MU0 A;  2WNR B;  2JOX A;  4RH8 A;  2B9D A;  1WHN A;  5F3W A;  2CVE A;  3J7A G;  3H4L A;  2EMZ A;  2PO0 B;  2EOE A;  2EPM X;  3J7Y p;  4ZYE A;  1WHQ A;  2HHH E;  2DEI A;  1YZ9 A;  4BA2 B;  2L8T A;  1KJK A;  2Z5C A;  4WXD A;  2BR2 A;  2LTS A;  3M7N D;  2ODR C;  5LMU I;  1F2I G;  1IBK E;  4R2D A;  4K0K I;  1WJP A;  2N3H A;  1XMO I;  1EH7 A;  2AE8 A;  4DV0 E;  3J81 C;  2LJH A;  1FKA E;  4LF4 E;  2BB8 A;  1N32 I;  4LFA E;  5K36 A;  4MU4 A;  2NN6 F;  4UT4 A;  4DR4 I;  2PO2 A;  2MDG A;  3JAM C;  2ELZ A;  1P47 A;  1Y4S A;  3V2U C;  4IFD B;  1UHZ A;  4DR1 E;  4I3H A;  5AC5 A;  4JI7 E;  1PIE A;  1ZM9 A;  1MEY C;  4JI8 I;  2O1U A;  4JG4 A;  4IZJ A;  1MX0 A;  2V2Q A;  2EPL X;  1XMQ E;  3IWB A;  3P1X A;  2A25 A;  1ZXM A;  4R2C A;  2ENC A;  5DNX A;  2LE2 A;  2O1T A;  5DRR A;  4R2E A;  1A1H A;  5K36 F;  1ZR9 A;  4DUY I;  2C39 A;  2UUB I;  4B3S E;  1VI7 A;  4LF8 I;  1STU A;  2RSI A;  4WX9 A;  4LU9 A;  4DR5 E;  2JY9 A;  4F9B B;  1I94 E;  3ADL A;  4NXN I;  2LBS B;  1Y4U A;  3ADI A;  3OTO I;  2V8Q B;  5DNL A;  1Y60 A;  4GKJ E;  3U1K A;  1QNT A;  1UIL A;  2NA2 A;  2EM2 A;  4IJD A;  3ECR A;  3ADJ A;  4B3T E;  1PJT A;  4BC9 A;  4MDT A;  2EPK X;  3HPZ A;  4X64 I;  2EPP A;  2V89 A;  1YYO A;  4DU7 A;  4OO1 F;  2BBG A;  1HR0 E;  2HFS A;  5K36 D;  4JI0 I;  1HNX E;  4DR7 I;  2HC5 A;  4DPW A;  2EMK A;  4R2S A;  4QNK A;  2EP3 A;  2RTX A;  3NZK A;  4LF5 I;  1RRE A;  4X9J A;  2BV3 A;  2EJ4 A;  2ADR A;  4YY3 E;  3EPH A;  2VF3 A;  1GZ6 A;  1T4N A;  4M2Z A;  2EE8 A;  3THN A;  3GME A;  5KL4 A;  4IZJ D;  2EMA A;  2J7J A;  4MYU A;  1RHY A;  1J5E I;  2LJU A;  2E5L E;  2EOX A;  3B8H A;  3J80 C;  4DPX A;  3M99 B;  4P78 A;  2LV2 A;  1X6H A;  2M9A A;  1ZAA C;  2JXP A;  5AAS A;  4MU1 A;  5T6J A;  2EWL A;  2J65 A;  3K6Q A;  5A6B A;  4FWH A;  1E3H A;  4HXZ A;  1NHH A;  2WBS A;  2EOO A;  4OOG C;  4X66 E;  3ZM7 A;  3KZY A;  2JE6 B;  3ZKB A;  2B7V A;  2BA0 D;  2G7H A;  4B3R E;  5GMD A;  2E72 A;  2LMZ A;  5ELW A;  2EM3 A;  2YTI A;  4F9C B;  4KHP E;  2YTQ A;  4M9V C;  2F8B A;  4LF7 I;  2MKN A;  3K85 A;  3M7N G;  4DV6 E;  2GQ0 A;  1TF6 A;  4FWD A;  3AV0 A;  1YFH A;  1JK1 A;  2GO3 A;  4DV5 I;  2EN6 A;  2UUA I;  4JYA I;  4IFD A;  5AE2 A;  4HY1 A;  4LPF A;  4JI4 E;  1L4S A;  4F6M A;  4DMI A;  1FI4 A;  4B3M E;  2A2D A;  2X7I A;  1N36 E;  4BHB A;  2LO3 A;  4BHC A;  4GKK E;  2DLK A;  5LL6 R;  5GME A;  4DV1 E;  4N3O A;  5K36 E;  1BBG A;  2EQ1 A;  4QNJ A;  1ZM3 A;  4LFB I;  3GLL A;  2CSH A;  4JI3 E;  4IFD F;  4HAC B;  5FLX Q;  2Q8U A;  1A1L A;  4JV5 I;  3LLH A;  1X6E A;  4HYM A;  5LLQ A;  2GPI A;  2V88 A;  3D4J A;  4X62 I;  3M85 D;  1A1I A;  3ZKD A;  4USM A;  1ZBT A;  5A6B D;  2PNL A;  4KZS A;  4FW4 A;  2L33 A;  2D9H A;  1GTK A;  3VHT B;  1UBD C;  3F6G A;  2YU5 A;  4DV0 I;  1YH8 A;  3EPL A;  2VRD A;  2EQ3 A;  3F0N A;  4YHH E;  2BM1 A;  1YHC A;  3EPK A;  4JI2 E;  4BBY A;  1UDN A;  1K47 A;  2NUE A;  2V8P A;  2F4V I;  1ZXN A;  3LPS A;  5FWK A;  2L92 A;  3FIG A;  4IFD D;  2I9I A;  2RPC A;  4JI5 I;  3HTX A;  2YT4 A;  3IWD A;  5K36 C;  2M1S A;  4GQU A;  2EMB A;  1AAY A;  5C0X F;  2JEA A;  2YTJ A;  2HK3 A;  2EM8 A;  1YUJ A;  4LTY A;  1DAR A;  3KZZ A;  2Z5B B;  5EKW A;  4LF9 I;  1XNR I;  1H7U A;  4ISA A;  5IV8 B;  1G2D C;  1EA6 A;  2GO4 A;  4DR5 I;  4M0V A;  1KKH A;  1UEK A;  2IOP A;  4TUI A;  2X36 A;  3P76 A;  2WW4 A;  1T4L B;  5A2Q C;  1EI1 A;  1H72 C;  1A1F A;  1NZ0 A;  2UXC E;  1UDS A;  3Q6N A;  1GQE A;  4DPT A;  1O0W A;  2K4V A;  2WP8 A;  4GKJ I;  5JEA B;  2HJJ A;  1N0V C;  1TF3 A;  2PNM A;  2B3T B;  1FWL A;  2EPO A;  1XXE A;  3JAM Q;  3GCM A;  4LFC E;  1HNX I;  3T1H I;  1NHI A;  2NN6 A;  4DV2 E;  2DLQ A;  2H36 X;  1UN6 B;  1B69 A;  1HNW E;  5IT9 C;  4YY3 I;  4NHR A;  4LF6 I;  1IMU A;  2OI2 A;  4BA1 A;  1BBO A;  5CFF E;  2EOS A;  4DR6 I;  1N33 E;  4DUZ I;  4DR3 E;  5EL9 A;  2EMC A;  2N8X A;  3P3E A;  2EOH A;  2PNZ B;  4IFD E;  1RC7 A;  1PJQ A;  4R03 A;  2FGG A;  1MGT A;  4O24 A;  2UXD E;  2JEB B;  3PYE A;  1PKP A;  4MU3 A;  2UU9 E;  2UUC E;  3WU4 A;  2N3G A;  4JI1 E;  4ED4 A;  2RSM A;  1QU6 A;  4KHP I;  2EMH A;  3OML A;  4WPY A;  2EM0 A;  1X6F A;  2V87 A;  3C6K A;  2EM6 A;  2UXB E;  1T39 A;  2L6M A;  4OO1 A;  4DKK A;  3QT6 A;  2HKJ A;  3JTZ A;  2EOF A;  4JI4 I;  2NN6 D;  2C38 B;  2YSP A;  3WU3 A;  2V2V A;  2V34 A;  1Z59 A;  1Z0V A;  2RS7 A;  2DMI A;  2PO1 B;  2XEX A;  4RHB B;  2M7Q A;  1LLM C;  4DV1 I;  4JI6 I;  4IFD C;  1RQ0 A;  4X65 E;  1YPN A;  5KL6 A;  1JK2 A;  2VQF E;  3MHS C;  4FW9 A;  2BA1 D;  1XNQ E;  2JP9 A;  2LRS A;  3CWV A;  3P3G A;  1OJ4 A;  4DXL A;  3L7Z B;  1IBM E;  3PYG A;  2A2C A;  4IS9 A;  3ZZ0 A;  4NXM I;  1WXR A;  5IXM B;  1N0U A;  3Q1Q A;  2R1F A;  2C37 B;  4IZK B;  2ZBK B;  4FW7 A;  4JI2 I;  2WNR A;  1ZU1 A;  2L3C A;  4O5G A;  2YRK A;  2ZM6 E;  3BGH A;  2EN2 A;  4OO1 D;  1HNZ E;  2V83 A;  2PO0 A;  4DR2 E;  2YTO A;  1A1K A;  2V86 A;  5BR8 E;  3B78 A;  2CT1 A;  2EN1 A;  1FJG E;  4FW3 A;  4BA2 A;  2JVA A;  2EZ6 A;  2EMI A;  5JEA F;  3L00 A;  2YRM A;  2EMW A;  1Y6Z A;  4XTJ A;  2RQL A;  4P52 A;  3QT8 A;  1IBL I;  4LCG A;  2F1D A;  2YTP A;  2LVH A;  2EN8 A;  4IS1 C;  5LMU E;  2NN6 E;  2WCC 3;  4LCF A;  2PRT A;  3C4T A;  4K0K E;  3T1Y I;  4KQV A;  5C0X B;  4F6N A;  3PS1 A;  3KRN A;  3BBG A;  5A69 A;  3Q6M A;  3PYF A;  1ZM4 A;  1N32 E;  1IQO A;  2VQE I;  4EMD A;  4DR4 E;  2CPN A;  2WBT A;  2JOB A;  1X47 A;  4M30 A;  1USU A;  2O1V A;  4ZVI A;  4DPU A;  4KWY A;  4JI8 E;  3GON A;  3V5R A;  1N3G A;  4R1F A;  4MLQ A;  2NUG A;  4J8Z A;  2EOI A;  5KL5 A;  5IWA E;  1E3P A;  4DV2 I;  2HHH I;  2CTD A;  2MC5 A;  4MYT A;  1IBK I;  4NBQ A;  3HQ1 A;  2I13 A;  1DI2 A;  2UUB E;  2NN6 C;  4WUD A;  2HK2 A;  5C0X A;  3LML A;  4R2A A;  3F6H A;  4R2P A;  2BR2 B;  2Z5C B;  4AID A;  4LF4 I;  2EL4 A;  4LFA I;  4NXN E;  3MHH C;  4OO1 E;  2JT2 A;  3EQ1 A;  4OX9 E;  3BID A;  3OTO E;  4GEQ B;  4DR1 I;  1NHJ A;  2LTR A;  2IES A;  2IER A;  4FN5 A;  3M6A A;  2EN3 A;  4R8O A;  4OZE A;  4JI7 I;  5K36 B;  1N34 E;  2UU9 I;  1Z0C A;  1XMQ I;  2UUC I;  2PO2 B;  1OYP A;  3H1C A;  3HPS A;  3L7Z A;  4JI0 E;  4DR7 E;  1UDO A;  5DRQ A;  3ZZU A;  2HFU A;  2EMY A;  4IZJ B;  4J3D A;  4B3S I;  2EPZ A;  2UXB I;  2LUP B;  4BCA A;  1XHK A;  3CDJ A;  2M4I A;  2R76 A;  4OKG A;  5IT9 Q;  5A6A A;  1ELO A;  5DRO A;  1FWK A;  2EPX A;  2EN7 A;  4WSP A;  4AQY E;  2KON A;  4ZYH A;  1I94 I;  1J5E E;  2EMF A;  2WZO A;  2C39 B;  1SR9 A;  4X8W A;  1A1G A;  5KL7 A;  3K1J A;  4USK A;  4OO1 C;  5JEA E;  4B3T I;  2JE6 A;  2L2K B;  2MC6 A;  5KL2 A;  2Q2E B;  3J81 Q;  1DQ3 A;  3UHM A;  5C0X D;  1A6F A;  2EN4 A;  1HR0 I;  4DV4 E;  1T4O A;  1MG7 A;  1B62 A;  3HKM A;  2EOJ A;  2EPU A;  4ZYG A;  2BM0 A;  1XNQ I;  2BA0 G;  2GS8 A;  4PRV A;  1IBM I;  4F9A B;  4LF7 E;  2DMY A;  2KHX A;  2JWO A;  2EPA A;  4JYA E;  1VIS A;  2E5L I;  4U3D A;  5DNY A;  1KVK A;  4MQY A;  2L3J A;  2EMX A;  2E1R A;  2HKE A;  2YSO A;  1EH6 A;  1H74 A;  2WBU A;  2NUF A;  5A6J A;  3PYD A;  3PS3 A;  1KIJ A;  3UK3 C;  3P06 A;  4HAC A;  4DU8 A;  4URL A;  2Z5E A;  5BR8 I;  4WXC A;  1EKZ A;  4X66 I;  1NCS A;  1WRJ A;  2VF1 A;  2EOQ A;  4MLV A;  2FV4 B;  4LFB E;  2ZIT A;  3B82 A;  2LJP A;  4B3R I;  4I8O A;  1FNM A;  3C4B A;  4F2J C;  2EMG A;  2EM9 A;  4JV5 E;  3M85 G;  4DV6 I;  1MU5 A;  2LCE A;  4X62 E;  1OYS A;  5AE1 A;  4LOM A;  2EOR A;  2ELY A;  4B3M I;  2O1W A;  3JU0 A;  2YRH A;  2YU8 A;  3C6M A;  2EPC A;  2YTG A;  1N36 I;  4F54 A;  2L2N A;  2FTX B;  2B7T A;  2DRP A;  2DSY A;  2F4V E;  4PRX A;  5C0X E;  3J80 Q;  2EOZ A;  4GKK I;  4BS9 A;  3PRY A;  1R6L A;  1Z5B A;  5TSE A;  4DV7 E;  2Z5B A;  2V85 A;  3DJW A;  4JI3 I;  4WYQ B;  4JI5 E;  5IWA I;  1R6M A;  3LNU A;  2R42 A;  1USV A; 
#chains in the Genus database with same CATH homology
 2YZT A;  5AE3 A;  1KTV A;  1U2R A;  4DV3 E;  4LF9 E;  1XNR E;  3HUL A;  1Z0W A;  4L5N C;  1YYW A;  1Z0G A;  4YHH I;  3ADG A;  4P7D A;  4OX9 I;  5LMN E;  1PVG A;  4BC7 A;  2CG9 A;  1N34 I;  3AUZ A;  3ZOQ B;  1BKN A;  4P7A A;  3T1H E;  3K17 A;  5L3J A;  3WU6 A;  1B63 A;  2DB2 A;  4LF6 E;  2J7K A;  1ZBQ A;  2RS6 A;  4AQY I;  2L2M A;  2UXC I;  4DR6 E;  4DUZ E;  1XMO E;  1WUU A;  1S16 A;  2AJ4 A;  1YYK A;  1J26 A;  1H7S A;  3LTO A;  4WUB A;  4LFC I;  4DV4 I;  4Z7C A;  4FWG A;  3KWR A;  3QT5 A;  1Z0B A;  1HNW I;  1Z5A A;  4DPY A;  1Z0E A;  4M1K A;  1QZR A;  4DUY E;  2ODR D;  2EFG A;  2JR1 A;  2MDR A;  4LF8 E;  1N33 I;  4DR3 I;  2CZ9 A;  2DEJ A;  3QT7 A;  4Q28 A;  5A2Q Q;  2V2Z A;  3H09 A;  2NPF A;  1X49 A;  4UTG A;  4PU9 A;  4JI6 E;  4L8N A;  4X64 E;  1RR9 A;  2UXD I;  1D6T A;  3RMP A;  4JI1 I;  1HK7 A;  4WFT A;  4LF5 E;  3HJC A;  4IZK A;  3VYX A;  4NXM E;  1Z5C A;  4BMJ A;  2R3V A;  2DIX A;  2VE7 C;  2LUQ A;  1X48 A;  1Z0T A;  4RPF A;  3WU5 A;  4X65 I;  5FLX C;  4DV7 I;  2VQF I;  2CGE A;  3IWC A;  1S4E A;  3ZZT A;  3MSW A;  4DV3 I;  1IBL E;  2IOQ A;  3VYY A;  4WUC A;  2E1M A;  2IHR 1;  3HXL A;  4DV5 E;  1H73 A;  3T1Y E;  2UUA E;  5ADZ A;  4Z7Y A;  2ZM6 I;  4TUG A;  5LMN I;  2KOU A;  2VQE E;  3DF6 A;  1ZM2 A;  4DR2 I;  3J7A M;  3VK6 A;  1FJG I;  2JOX A;  2B9D A;  1WHN A;  5F3W A;  3J7A G;  3H4L A;  2DEI A;  3J7Y p;  1WHQ A;  2HHH E;  1YZ9 A;  2L8T A;  2Z5C A;  2LTS A;  2ODR C;  5LMU I;  1IBK E;  4K0K I;  2N3H A;  1XMO I;  4DV0 E;  3J81 C;  2LJH A;  1FKA E;  4LF4 E;  1N32 I;  4LFA E;  4UT4 A;  4DR4 I;  3JAM C;  1Y4S A;  3V2U C;  1UHZ A;  4DR1 E;  4I3H A;  1PIE A;  4JI7 E;  1ZM9 A;  4JI8 I;  2O1U A;  4JG4 A;  4IZJ A;  1MX0 A;  2V2Q A;  1XMQ E;  3IWB A;  3P1X A;  1ZXM A;  2LE2 A;  2O1T A;  4DUY I;  2UUB I;  4B3S E;  4LF8 I;  1STU A;  4DR5 E;  4LU9 A;  2JY9 A;  4F9B B;  1I94 E;  3ADL A;  4NXN I;  2LBS B;  1Y4U A;  3ADI A;  3OTO I;  2V8Q B;  4GKJ E;  1UIL A;  2NA2 A;  4B3T E;  3ADJ A;  4BC9 A;  3HPZ A;  4X64 I;  2V89 A;  1YYO A;  4DU7 A;  1HR0 E;  2HFS A;  4JI0 I;  1HNX E;  4DR7 I;  4DPW A;  2RTX A;  4LF5 I;  1RRE A;  2BV3 A;  2VF3 A;  4YY3 E;  1GZ6 A;  1T4N A;  4M2Z A;  4IZJ D;  4MYU A;  1J5E I;  2E5L E;  3B8H A;  3J80 C;  4DPX A;  4P78 A;  5AAS A;  5T6J A;  2EWL A;  4FWH A;  3K6Q A;  4HXZ A;  1NHH A;  3ZM7 A;  4OOG C;  4X66 E;  3ZKB A;  2B7V A;  2G7H A;  4B3R E;  5GMD A;  2LMZ A;  4F9C B;  4KHP E;  2F8B A;  4LF7 I;  3K85 A;  4DV6 E;  2GQ0 A;  4FWD A;  3AV0 A;  4DV5 I;  4JYA I;  2UUA I;  5AE2 A;  4HY1 A;  4JI4 E;  1FI4 A;  4DMI A;  4B3M E;  2A2D A;  2X7I A;  1N36 E;  4GKK E;  5LL6 R;  5GME A;  4DV1 E;  4N3O A;  1ZM3 A;  4LFB I;  4JI3 E;  4HAC B;  5FLX Q;  4JV5 I;  3LLH A;  4HYM A;  3D4J A;  2V88 A;  4X62 I;  3ZKD A;  4USM A;  1ZBT A;  2PNL A;  4KZS A;  2L33 A;  3F6G A;  4DV0 I;  3F0N A;  4YHH E;  2BM1 A;  4JI2 E;  4BBY A;  2F4V I;  1K47 A;  2NUE A;  2V8P A;  1ZXN A;  3LPS A;  5FWK A;  2L92 A;  3FIG A;  4JI5 I;  3HTX A;  2YT4 A;  3IWD A;  2M1S A;  2HK3 A;  2Z5B B;  4LTY A;  1DAR A;  4LF9 I;  1XNR I;  1H7U A;  1EA6 A;  4DR5 I;  4M0V A;  1KKH A;  1UEK A;  2IOP A;  4TUI A;  2X36 A;  2WW4 A;  1T4L B;  5A2Q C;  1EI1 A;  1H72 C;  1NZ0 A;  2UXC E;  3Q6N A;  1GQE A;  4DPT A;  1O0W A;  2K4V A;  4GKJ I;  1N0V C;  2PNM A;  2B3T B;  1FWL A;  3JAM Q;  4LFC E;  1HNX I;  3T1H I;  1NHI A;  4DV2 E;  2H36 X;  1HNW E;  5IT9 C;  4YY3 I;  4LF6 I;  2OI2 A;  5CFF E;  4DR6 I;  1N33 E;  4DUZ I;  4DR3 E;  1RC7 A;  4R03 A;  2FGG A;  3WU4 A;  2UXD E;  3PYE A;  1PKP A;  2UU9 E;  2UUC E;  2N3G A;  4JI1 E;  4ED4 A;  2RSM A;  1QU6 A;  4KHP I;  3OML A;  4WPY A;  2V87 A;  2UXB E;  2L6M A;  4DKK A;  3QT6 A;  2HKJ A;  3JTZ A;  4JI4 I;  3WU3 A;  2V2V A;  2V34 A;  1Z59 A;  1Z0V A;  2RS7 A;  2XEX A;  2M7Q A;  4DV1 I;  4JI6 I;  1RQ0 A;  4X65 E;  2VQF E;  4FW9 A;  1XNQ E;  2LRS A;  3CWV A;  1OJ4 A;  4DXL A;  1IBM E;  3PYG A;  2A2C A;  4NXM I;  3ZZ0 A;  1WXR A;  1N0U A;  3Q1Q A;  4IZK B;  2ZBK B;  4JI2 I;  2L3C A;  2ZM6 E;  1HNZ E;  2V83 A;  4DR2 E;  2V86 A;  5BR8 E;  3B78 A;  1FJG E;  2JVA A;  2EZ6 A;  1Y6Z A;  4XTJ A;  4P52 A;  3QT8 A;  1IBL I;  5LMU E;  3C4T A;  4K0K E;  3T1Y I;  4KQV A;  3Q6M A;  3PYF A;  1ZM4 A;  1N32 E;  2VQE I;  4EMD A;  4DR4 E;  2CPN A;  2JOB A;  1X47 A;  4M30 A;  1USU A;  2O1V A;  4ZVI A;  4DPU A;  4JI8 E;  3GON A;  3V5R A;  4R1F A;  2NUG A;  4J8Z A;  4DV2 I;  5IWA E;  2HHH I;  2MC5 A;  4MYT A;  1IBK I;  3HQ1 A;  1DI2 A;  2UUB E;  4WUD A;  2HK2 A;  3LML A;  2Z5C B;  3F6H A;  4LF4 I;  4LFA I;  4NXN E;  4OX9 E;  3OTO E;  4GEQ B;  4DR1 I;  1NHJ A;  2LTR A;  4FN5 A;  4JI7 I;  3M6A A;  4R8O A;  1N34 E;  2UU9 I;  1Z0C A;  1XMQ I;  2UUC I;  3HPS A;  4JI0 E;  4DR7 E;  3ZZU A;  2HFU A;  4IZJ B;  4B3S I;  2UXB I;  2LUP B;  4BCA A;  1XHK A;  2M4I A;  5IT9 Q;  1ELO A;  1FWK A;  4AQY E;  4WSP A;  1I94 I;  2KON A;  1J5E E;  2WZO A;  1SR9 A;  4X8W A;  3K1J A;  4USK A;  4B3T I;  2L2K B;  2MC6 A;  2Q2E B;  3J81 Q;  1DQ3 A;  1A6F A;  1HR0 I;  4DV4 E;  1T4O A;  1MG7 A;  1B62 A;  1XNQ I;  2BM0 A;  2GS8 A;  4PRV A;  1IBM I;  4F9A B;  4LF7 E;  2DMY A;  2KHX A;  2JWO A;  4JYA E;  1VIS A;  2E5L I;  5DNY A;  1KVK A;  2L3J A;  2E1R A;  2HKE A;  1H74 A;  2NUF A;  3PYD A;  1HNZ I;  4DU8 A;  4URL A;  1KIJ A;  3P06 A;  4HAC A;  2Z5E A;  5BR8 I;  1EKZ A;  4X66 I;  2VF1 A;  2ZIT A;  2FV4 B;  4LFB E;  3B82 A;  4B3R I;  2LJP A;  4I8O A;  1FNM A;  3C4B A;  4JV5 E;  4DV6 I;  1MU5 A;  4X62 E;  5AE1 A;  4B3M I;  2O1W A;  3JU0 A;  1N36 I;  4F54 A;  2L2N A;  2FTX B;  2B7T A;  4GKK I;  2DSY A;  2F4V E;  4PRX A;  3J80 Q;  4BS9 A;  3PRY A;  1Z5B A;  4DV7 E;  2Z5B A;  2V85 A;  3DJW A;  4JI3 I;  4WYQ B;  4JI5 E;  5IWA I;  3LNU A;  2R42 A;  1USV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...