4NXNE

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4nxnE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxnE02
2UXBI 4LF6E 1XMOE 4LFAI 3ADGA 5FLXQ 1XMQE 1H7SA 5LMNE 2RTXA 4M2ZA 1MU5A 1IBLI 4R1FA 2HHHI 3V2UC 4X65I 3OTOI 2E1RA 4B3SI 4PU9A 3B78A 2L2NA 4LF4E 3WU4A 2UU9I 4JI6E 4HY1A 3K1JA 1NHIA 1Z0EA 3J80Q 4HACB 1QZRA 1K47A 4B3MI 1HNWE 2B3TB 4K0KE 2WW4A 5GMEA 1HNXE 4WUCA 1H72C 3J7Yp 1Z0TA 4LFBE 5A2QC 3ZKDA 2UUAI 1FJGE 2HK2A 1D6TA 4X64I 4LF5I 4JV5E 3QT8A 4FWDA 1XNRI 4NXME 4GKKI 1XMQI 1PVGA 2BM0A 2V2VA 1RR9A 3QT5A 1HNZI 1Z0WA 2UXBE 2VQFE 1MG7A 2VQEE 5A2QQ 4LFAE 4JI3I 1U2RA 2V8PA 3T1HI 1T4OA 1N34I 1IBLE 1N36E 4FWHA 1ZM9A 4X65E 3HULA 5BR8I 2F4VE 4B3SE 4WUDA 4X8WA 4XTJA 3VYYA 1IBME 2LUPB 3B8HA 1FKAE 1KTVA 4JI5I 2NUFA 1OJ4A 1Z0CA 4P52A 1IBKI 2ZM6E 5CFFE 2ZBKB 4PRVA 3LNUA 2CZ9A 2V34A 2RSMA 1DARA 1YYOA 1ZXNA 4DR1E 5FLXC 2Q2EB 1Z5AA 4ED4A 1DI2A 4DR3E 2LBSB 2L2MA 4JV5I 2VF3A 1EA6A 2UUAE 2LJPA 2UUBE 1Z0GA 4LF5E 4DPXA 4GKJI 4DV6I 4DPWA 1XNRE 5L3JA 2VQFI 2A2DA 2VQEI 4GKKE 2RS7A 1H73A 1I94E 3M6AA 1FNMA 1HNZE 1N36I 1WHNA 2AJ4A 3J80C 4DPYA 4JI3E 4FWGA 2F4VI 4DKKA 2UXDI 4YHHI 3V5RA 3T1HE 1N34E 5IWAE 1IBMI 1BKNA 2A2CA 4MYUA 5BR8E 1S16A 2N3HA 3Q1QA 4YY3E 1H7UA 4LF7I 3PYFA 4USMA 3WU5A 4FW9A 2ZM6I 1N32E 2HFSA 4NXNE 1PIEA 4JI5E 4X66I 1B63A 2L2KB 4UTGA 1IBKE 4DR1I 3D4JA 1FI4A 4DR3I 4OX9E 4JI1I 1NHJA 2UUBI 3VYXA 4ZVIA 2E5LI 4DU8A 2UXCI 3C4TA 4JI2E 1KIJA 2EFGA 3WU6A 1HR0I 1YYKA 4DU7A 3QT7A 1I94I 3QT6A 3ZM7A 1GQEA 1H74A 4KQVA 4GKJE 2GS8A 4DV6E 3B82A 1A6FA 4DR5I 3HTXA 2R42A 4DPTA 3J7AG 2RS6A 5IWAI 4DXLA 4DR2I 3JAMC 1O0WA 1RC7A 1YZ9A 2UXDE 1X48A 1N0UA 4YHHE 4YY3I 1XHKA 2NPFA 2DB2A 2JVAA 2B7TA 4M1KA 1N32I 4NXNI 4DR6E 4LF7E 1Z0BA 4HXZA 4DR7E 1UILA 1NZ0A 4DUZE 2OI2A 3JAMQ 2J7KA 4OX9I 4X66E 1Z5CA 4JI4I 4DV4I 4JI0E 3CWVA 4DV5I 3H4LA 2NUGA 3F0NA 4X62I 4RPFA 1S4EA 1VISA 2V2QA 4JI2I 3LTOA 4B3RI 4JI1E 4JYAE 2E5LE 2DMYA 1Z0VA 2UXCE 2DEJA 2L3JA 1EI1A 1HR0E 2ZITA 4DUYE 1T4NA 1WUUA 4URLA 2DIXA 2LTRA 4KHPI 3ZKBA 2BM1A 2N3GA 4LFCI 1XNQI 1UHZA 3LLHA 4HYMA 4JI8E 1Z5BA 4USKA 4DR5E 1UEKA 3WU3A 4DR2E 4WFTA 2NA2A 4AQYI 2L3CA 4DV0E 1MX0A 1FWLA 2UUCI 2LTSA 4DV3I 1ELOA 1RREA 4DR6I 3J7AM 4JI7I 2V2ZA 4LF9I 1ZBTA 4DR7I 1KVKA 4DUZI 2DEIA 1J26A 4DR4I 1T4LB 2HK3A 4JI0I 2X7IA 4MYTA 5IT9Q 1KKHA 5LL6R 1J5EI 5GMDA 4DPUA 2LJHA 4B3TE 4JI4E 4DV4E 4DV2I 4DV5E 4JYAI 4X62E 3ZZ0A 4Z7CA 4DV7E 4FN5A 4UT4A 4M30A 5LMUI 2JY9A 2HKJA 4B3RE 4DUYI 2XEXA 2R3VA 1PKPA 3PYEA 1N33E 2BV3A 1FWKA 4JI8I 3LPSA 4KHPE 4DV1I 1Z59A 3J81C 3T1YE 4LFCE 1XNQE 2YT4A 1EKZA 4LF6I 1XMOI 4PRXA 4DV0I 4LF8E 5LMNI 2CPNA 4I3HA 4AQYE 2HKEA 2UUCE 1NHHA 4DV3E 4WYQB 4JI7E 3PYGA 3K17A 3P1XA 4LF9E 2KHXA 2MDRA 2HHHE 1ZM4A 3J81Q 1B62A 2EZ6A 3C4BA 1QU6A 4LF4I 3OTOE 4DR4E 4JG4A 2LUQA 4B3TI 3ZZUA 1ZXMA 4JI6I 1X47A 4DV7I 1J5EE 4OOGC 3ADLA 1ZM3A 1YYWA 4DV2E 2NUEA 3ADJA 1HNWI 2UU9E 4K0KI 1X49A 1ZM2A 4P7AA 4EMDA 3GONA 1HNXI 2LRSA 2B7VA 4LFBI 1RQ0A 4B3ME 5LMUE 2IHR1 1N33I 4Z7YA 3ADIA 3ZZTA 1FJGI 2HFUA 2L33A 1STUA 3T1YI 4HACA 4NXMI 4WUBA 4X64E 4LF8I 4DV1E 5IT9C 3PYDA 1N0VC 2X36A 1WHQA
chains in the Genus database with same CATH superfamily
5IXMB 2UXBI 3KZYA 1OYPA 1TN9A 4LF6E 1XMOE 1TF3A 3Q6MA 4LFAI 3ADGA 2EPCA 5FLXQ 1XMQE 1H7SA 1TF6A 2LCEA 5LMNE 3P3EA 4F9BB 2RTXA 1G2DC 4M2ZA 1MU5A 1IBLI 4R1FA 1BBGA 2HHHI 3V2UC 2YTFA 2RQLA 4X65I 3OTOI 1UDSA 2LO3A 3KWRA 2E1RA 2V88A 2K4VA 1UDQA 2J65A 4B3SI 1ZBQA 2HJJA 2YPNA 4PU9A 2N8XA 2LT7A 3B78A 4IZJB 2L2NA 1A1GA 5DRRA 4LCGA 4LF4E 4MU3A 3WU4A 2EL5A 4WPYA 5IV8B 2ODRC 1A1JA 4IS1C 1R6LA 2D9HA 2UU9I 4JI6E 2EWLA 4HY1A 1A1FA 3K1JA 1NHIA 1Z0EA 2X36A 1USUA 1QNTA 2JOXA 3J80Q 4HACB 1QZRA 1K47A 4BA2B 4B3MI 1HNWE 2B3TB 4K0KE 1T39A 1Z1BA 5C0XA 2WW4A 1OYSA 4LCHA 4FW5A 5A69A 5GMEA 1YPNA 5F3WA 5K36C 4NZVA 1HNXE 4WUCA 1H72C 4BS9A 3P3CA 3J7Yp 1Z0TA 4LFBE 1HK7A 5A2QC 3ZKDA 2BA0G 4N3OA 2UUAI 2BR2B 1FJGE 2HK2A 2EQ3A 1D6TA 4IFDF 5KL3A 4R2AA 1KJKA 2DLQA 4X64I 2EPAA 2LE2A 3M85G 2EOFA 3GLLA 4LF5I 2VESA 4JV5E 3QT8A 4FWDA 2RPCA 2DLKA 1JK1A 2ODRD 2GO3A 2JE6A 1XNRI 2O1VA 2EMXA 2NN6B 2DGCA 4O24A 4NXME 4GKKI 2LV2A 4WSGA 2F1DA 4M9VC 4N4RB 1PVGA 1XMQI 2BM0A 2V2VA 1RR9A 3QT5A 1HNZI 1Z0WA 1MEYC 4WX9A 2UXBE 2M9AA 4ZYHA 2YSPA 1USVA 2VQFE 4WXCA 4OZEA 1MG7A 2VQEE 5A2QQ 4O5GA 4LFAE 4JI3I 1U2RA 2V8PA 5KL7A 3T1HI 1T4OA 1PJQA 2EMHA 1N34I 1MGTA 2YTEA 1IBLE 5K36D 3ZM7A 2GPIA 1Y5YA 1N36E 4FWHA 2DSYA 2EM4A 3C6MA 4L8NA 4X65E 1ZM9A 3HULA 1NEIA 2ELYA 2GO4A 2F4VE 5BR8I 5C0XB 5AC4A 4TUIA 3U1YA 4B3SE 2V86A 4WUDA 4X8WA 4XTJA 5EKWA 3VYYA 2JT2A 1IBME 5ELWA 1R6MA 2LUPB 3B8HA 1FKAE 1KTVA 2RSIA 4I8OA 2NN6E 4JI5I 2WZOA 2NUFA 1OJ4A 3EPHA 5K36B 2EN4A 3CDIA 2EM5A 1Z0CA 4P52A 1IBKI 2ZM6E 5CFFE 4J8ZA 1X6FA 2ZBKB 4PRVA 2JYAA 3LNUA 5C0XC 2YTJA 2CZ9A 2JE6B 2V34A 5JEAA 2PO1A 2RSMA 5A6KA 1RMDA 1DARA 1YYOA 2EE8A 1ZXNA 4DR1E 2JOBA 5FLXC 2YTOA 2Q2EB 4R2DA 1Z5AA 2Z5EA 4AIMA 4ED4A 2PNZB 3AV0A 1DI2A 2CSHA 1WXRA 4DR3E 4P78A 2LBSB 2L2MA 2F8BA 5KL2A 5KL6A 2EOYA 1YHCA 2EN7A 3MHSC 2Z5BB 4JV5I 4BHBA 2EOJA 2VF3A 2GLIA 2EPZA 2WBSA 1EA6A 2M4IA 2UUAE 2EMLA 2LJPA 2EMIA 2UUBE 1Z0GA 1SFEA 1WJPA 2PO0B 3THNA 4LF5E 1EH6A 2IERA 1F2IG 4DPXA 4GKJI 4DV6I 2EM7A 4GEQB 5DNYA 4DPWA 1XNRE 5L3JA 3VK6A 2VQFI 2A2DA 2VQEI 4GKKE 2RS7A 1H73A 4OO1A 4MLVA 1I94E 3M6AA 2JEAA 1FNMA 2EN8A 2BA1D 1HNZE 2L6MA 5C0XD 1N36I 2EPLX 1WHNA 2MKNA 2AJ4A 4BC7A 4F6MA 1YFHA 3J80C 2WNRA 2EOMA 2ENCA 4JI3E 4DPYA 4FWGA 2F4VI 2B9DA 4DKKA 2UXDI 1Y4UA 4YHHI 3V5RA 2MC5A 4MQYA 5DNXA 1PJTA 3T1HE 4FW4A 1N34E 2M1SA 5IWAE 1IBMI 3PS1A 1X3CA 1BKNA 1YH8A 2JEBA 5DROA 2A2CA 3BIDA 1N3GA 2NN6F 3HJCA 4MYUA 4BMJA 3K85A 1A1IA 5BR8E 2I13A 3KZZA 2N3HA 4F54A 5AE3A 3EPLA 4YY3E 1S16A 2EJ4A 2C37A 2WP8B 3Q1QA 4F6NA 1H7UA 1EH8A 2YRMA 4BCAA 4LF7I 3PYFA 4USMA 3WU5A 4FW9A 2ZM6I 2HC5A 5A6BD 4P7DA 2ELZA 3HPZA 1N32E 1Y6ZA 2HFSA 2O3ZA 4NXNE 2C38A 1PIEA 2LMZA 3UK3C 4JI5E 5JEAC 3IWBA 4J3DA 1B63A 4X66I 2L2KB 4BA1B 2KONA 1PDAA 3HKMA 4Q28A 4UTGA 1IBKE 2V89A 4DR1I 2C39B 3D4JA 1FI4A 1P42A 4DR3I 2EN1A 2EPUA 4ZYDA 4R2RA 2ADRA 5KL4A 4OX9E 3H1CA 2V87A 5KL5A 2PRTA 3PS3A 4JI1I 1NHJA 3P3GA 2EQ1A 2UUBI 3VYXA 2EPMX 4ZVIA 2G7HA 2E5LI 4DU8A 3BGHA 2BB8A 2EPKX 4R2QA 2MC6A 1E3PA 2UXCI 5K36E 3C4TA 4JI2E 1KIJA 3M99B 2HGHA 2EFGA 3WU6A 1HR0I 1YYKA 4MDTA 1B69A 3EPJA 2EOIA 3MHHC 1KYQA 2YU8A 4DU7A 1EH7A 5A6BA 3QT7A 1I94I 4OO1C 3AUZA 2BA0D 3QT6A 3UHMA 2EM9A 4MU1A 1GQEA 5AE2A 2EOZA 1H74A 4KQVA 2EPPA 4GKJE 4DV6E 1X6HA 2GS8A 2EPOA 2VF1A 2O1WA 4IFDA 5JEAD 2EMFA 3B82A 3M85D 2I9IA 3PRYA 1A6FA 2EN2A 4DR5I 3HTXA 2R42A 3IWCA 1UN6B 4AIDA 3J7AG 4DPTA 2EP3A 2RS6A 2YSOA 4LTYA 4LPFA 5IWAI 4OKGA 4DXLA 4DR2I 3JAMC 1PJSA 3ECRA 1O0WA 1RC7A 1YZ9A 1AAYA 2J7JA 1LLMC 4R8OA 2IOQA 2UXDE 1X48A 1N0UA 4FW7A 4YHHE 1P47A 4YY3I 1JK2A 4F9CB 1XHKA 2NPFA 2DB2A 2JVAA 2EM2A 2VE7C 2B7TA 4M1KA 1N32I 4NXNI 1AH5A 2YRHA 4DR6E 4LF7E 1Z0BA 2Z5CA 4U3BA 3M7NG 4OO1D 4HXZA 1A1KA 4DR7E 1UILA 1NZ0A 4DUZE 2EPXA 2OI2A 3JAMQ 2MKDA 2J7KA 4OX9I 4X66E 1Z5CA 3C6KA 4QNJA 4JI4I 3KRNA 4GQUA 4DV4I 4JI0E 1E3HA 2JPAA 3CWVA 2YWQA 4DV5I 3H4LA 1Y60A 2NUGA 3F0NA 4R2PA 1ZU1A 5LLQA 4X62I 4RPFA 1S4EA 2A25A 2EOOA 2WBTA 3ZOQB 5AASA 5FWKA 1VISA 3H09A 2V2QA 5K36F 5C0XE 4WXDA 5TSEA 2WCC3 4JI2I 1ZAAC 2AE8A 3LTOA 4B3RI 1YSAC 4JI1E 4JYAE 2PNMA 5A6JA 2WBUA 1DGCA 2EOSA 2JR1A 2E5LE 2DMYA 1Z0VA 2UXCE 1HNWI 5DRPA 2R1FA 2DEJA 2O1TA 1UBDC 4IZJA 3BBGA 3HXLA 2L3JA 2IOPA 4IFDC 1EI1A 2EN3A 1HR0E 2CT1A 2YU5A 4DUYE 2ZITA 1T4NA 2Q8UA 1WUUA 2DIXA 3NZKA 4URLA 2LTRA 3L7ZA 4QNKA 4KHPI 3MSWA 2FTXB 3ZKBA 3RMPA 2N3GA 3K6QA 2BM1A 4LFCI 1XNQI 2EM8A 1UHZA 2GHFA 1UDOA 3LLHA 4HYMA 4Q35B 2Z5CB 4JI8E 1Z5BA 4USKA 5DRQA 2LJUA 4DR5E 4BA2A 1IQOA 2EN6A 2VRDA 2GQ0A 5JEAB 1OYRA 2L92A 2PO1B 2EL6A 3WU3A 4DR2E 2YTNA 2LVHA 4WFTA 1A1LA 2NA2A 1L4SA 4IZKA 4AQYI 2L3CA 2DMIA 4DV0E 3HQ1A 1FWLA 1MX0A 2UUCI 4WSPA 3DF6A 2LTSA 4DV3I 1ELOA 1RREA 4F2JC 4FW3A 3J7AM 4JI7I 4DR6I 2EMKA 1WRJA 4TUGA 2H36X 2BR2A 4NHRA 2V2ZA 3GMEA 1T38A 1ZBTA 4LF9I 1X6EA 5AC5A 4DR7I 1KVKA 4DUZI 1UDNA 2PNLA 2DEIA 1J26A 4DR4I 1T4LB 2EMGA 1ZR9A 4IFDD 2EOQA 2V8QB 2HK3A 4JI0I 1A1HA 2X7IA 4MYTA 2NN6A 4ZYEA 4MLQA 5IT9Q 1KKHA 4MU0A 5LL6R 1J5EI 2BBGA 5GMDA 4DPUA 4KZSA 4O43A 4FK5C 5C0XF 2EPRA 2LJHA 4FW6A 4B3TE 4JI4E 4DV4E 4OO1B 3L7ZB 4DV2I 3P76A 3U1KA 4DV5E 2EOEA 2JEAB 4RHBB 5JEAE 1SR9A 4BHCA 4JYAI 3BF2A 3TQMA 4X62E 3EQ1A 4DV7E 3ZZ0A 4Z7CA 4FN5A 3OMLA 2WNRB 2EPNA 2YTPA 2KOUA 3VHTB 4R2EA 2ENAA 1YUIA 4LOMA 4UT4A 4R03A 4M30A 4LU9A 1IQSA 5LMUI 2JY9A 2HKJA 2V85A 2EL4A 4B3RE 4DUYI 2FV4B 2M7QA 2L8TA 2CG9A 2R3VA 2XEXA 2E1MA 3EPKA 2JEBB 4IZKB 2YTIA 1NCSA 2YTQA 1BBOA 1PKPA 4MU4A 3PYEA 2C37B 1RHYA 1N33E 2BV3A 1FWKA 4JI8I 3LPSA 2K7IA 5EL9A 4KHPE 4DV1I 3F6GA 3DJWA 2CTDA 2C38B 1G2FC 3J81C 1Z59A 3T1YE 2O1UA 4IJDA 4LFCE 2YT4A 1XNQE 3P06A 4OO1E 1EKZA 3PS2A 4LF6I 1XMOI 4PRXA 4AM3A 3GCMA 4DV0I 2ENHA 4LF8E 3L00A 2EMWA 5LMNI 4ZYGA 2CPNA 5ADZA 4L5NC 2YTDA 2PNZA 4I3HA 4HEIA 3Q6NA 2EM3A 4AQYE 1GZ6A 4U3DA 3QG5C 2HKEA 2EM6A 2EMYA 2Z5BA 4IZJD 2UUCE 5T6JA 1NHHA 4DV3E 2EOHA 2MDGA 4WYQB 2EMZA 4JI7E 3PYGA 3K17A 3P1XA 3IWDA 2DRPA 4LF9E 2NN6C 2KHXA 2MDRA 2HHHE 1ZM4A 2E72A 1B62A 2EZ6A 2PO0A 3C4BA 1QU6A 2PO2A 3J81Q 4LF4I 3OTOE 4R2SA 4DR4E 4JG4A 2JP9A 2LUQA 4F9AB 4B3TI 4BC9A 5JEAF 3ZZUA 1ZXMA 2NABA 1BB8A 4DMIA 4JI6I 4LCFA 1X47A 3FIGA 4DV7I 3JU0A 4IFDB 1J5EE 2EQ0A 2JXPA 3M7ND 5A6AA 4OOGC 3LMLA 3ADLA 4NBQA 1ZM3A 1YYWA 4GZNC 4DV2E 2JWOA 3ADJA 3JTZA 2NUEA 4RH8A 1IMUA 2UU9E 2CGEA 4M0VA 2R76A 1X49A 1X5WA 1Y4SA 3DD6A 1ZM2A 4K0KI 1GTKA 4BBYA 4P7AA 2YZTA 2YRKA 2EMCA 4EMDA 5AE1A 3GONA 4ISAA 2FGGA 1HNXI 2LRSA 4O4KA 2IESA 2EM0A 2B7VA 2YTGA 1VI7A 1DQ3A 1RQ0A 4R2CA 3CDJA 2EMAA 4B3ME 3F6HA 4LFBI 5LMUE 2IHR1 1N33I 4Z7YA 3ADIA 3THOB 3ZZTA 1FJGI 1YUJA 5K36A 2HFUA 2L33A 2WP8A 2NN6D 4IS9A 2EOXA 4OO1F 1STUA 2EORA 3T1YI 2EMBA 4HTGA 1XXEA 2BA1G 4HACA 2CVEA 5DNLA 4NXMI 3HPSA 4X64E 4WUBA 4BA1A 2V83A 4LF8I 4KWYA 2PO2B 4DV1E 4IFDE 5IT9C 4X9JA 3PYDA 1N0VC 2C39A 3B4TA 1UEKA 1WHQA
chains in the Genus database with same CATH topology
2UXBI 4LF6E 1XMOE 3Q6MA 4LFAI 3ADGA 5FLXQ 1XMQE 1H7SA 5LMNE 4F9BB 2RTXA 4M2ZA 1MU5A 1IBLI 4R1FA 2HHHI 3V2UC 4X65I 3OTOI 3KWRA 2E1RA 2V88A 2K4VA 4B3SI 1ZBQA 4PU9A 3B78A 4IZJB 2L2NA 4LF4E 3WU4A 4WPYA 2ODRC 2UU9I 4JI6E 2EWLA 4HY1A 3K1JA 1NHIA 1Z0EA 2X36A 1USUA 2JOXA 3J80Q 4HACB 1QZRA 1K47A 4B3MI 1HNWE 2B3TB 4K0KE 2WW4A 5GMEA 5F3WA 1HNXE 4WUCA 1H72C 4BS9A 3J7Yp 1Z0TA 4LFBE 1HK7A 5A2QC 3ZKDA 4N3OA 2UUAI 1FJGE 2HK2A 1D6TA 4X64I 2LE2A 4LF5I 4JV5E 3QT8A 4FWDA 1XNRI 2ODRD 2O1VA 4NXME 4GKKI 1XMQI 1PVGA 2BM0A 2V2VA 1RR9A 3QT5A 1HNZI 1Z0WA 2UXBE 1USVA 2VQFE 1MG7A 2VQEE 5A2QQ 4LFAE 4JI3I 1U2RA 2V8PA 3T1HI 1T4OA 1N34I 1IBLE 1N36E 4FWHA 2DSYA 1ZM9A 4L8NA 4X65E 3HULA 5BR8I 2F4VE 4TUIA 4B3SE 2V86A 4WUDA 4X8WA 4XTJA 3VYYA 1IBME 2LUPB 3B8HA 1FKAE 1KTVA 4I8OA 4JI5I 2WZOA 2NUFA 1OJ4A 1Z0CA 4P52A 1IBKI 2ZM6E 5CFFE 4J8ZA 2ZBKB 4PRVA 3LNUA 2CZ9A 2V34A 2RSMA 1DARA 1YYOA 1ZXNA 4DR1E 2JOBA 5FLXC 2Q2EB 2Z5EA 1Z5AA 4ED4A 3AV0A 1DI2A 1WXRA 4DR3E 4P78A 2LBSB 2L2MA 2F8BA 2Z5BB 4JV5I 2VF3A 1EA6A 2M4IA 2UUAE 2LJPA 2UUBE 1Z0GA 4LF5E 4DPXA 4GKJI 4DV6I 4GEQB 5DNYA 4DPWA 1XNRE 5L3JA 3VK6A 2VQFI 2A2DA 2VQEI 4GKKE 2RS7A 1H73A 1I94E 3M6AA 1FNMA 1HNZE 2L6MA 1N36I 1WHNA 2AJ4A 4BC7A 3J80C 4DPYA 4JI3E 4FWGA 2F4VI 2B9DA 4DKKA 2UXDI 1Y4UA 4YHHI 3V5RA 2MC5A 3T1HE 1N34E 2M1SA 5IWAE 1IBMI 1BKNA 2A2CA 3HJCA 4MYUA 4BMJA 3K85A 5BR8E 1S16A 2N3HA 4F54A 5AE3A 3Q1QA 4YY3E 1H7UA 4BCAA 4LF7I 3PYFA 4USMA 3WU5A 4FW9A 2ZM6I 4P7DA 3HPZA 1N32E 1Y6ZA 2HFSA 4NXNE 1PIEA 2LMZA 4JI5E 4X66I 3IWBA 1B63A 2L2KB 2KONA 4UTGA 4Q28A 1IBKE 2V89A 4DR1I 3D4JA 1FI4A 4DR3I 4OX9E 2V87A 4JI1I 1NHJA 2UUBI 3VYXA 4ZVIA 2G7HA 2E5LI 4DU8A 2UXCI 2MC6A 3C4TA 4JI2E 1KIJA 2EFGA 3WU6A 1HR0I 1YYKA 4DU7A 3QT7A 1I94I 3AUZA 3QT6A 3ZM7A 1GQEA 5AE2A 1H74A 4KQVA 4GKJE 2GS8A 4DV6E 2O1WA 2VF1A 3B82A 3PRYA 1A6FA 4DR5I 3HTXA 2R42A 3IWCA 3J7AG 4DPTA 2RS6A 4LTYA 5IWAI 4DXLA 4DR2I 3JAMC 1O0WA 1RC7A 1YZ9A 4R8OA 2IOQA 2UXDE 1X48A 1N0UA 4YHHE 4YY3I 4F9CB 1XHKA 2NPFA 2DB2A 2JVAA 2VE7C 2B7TA 4M1KA 1N32I 4NXNI 4DR6E 4LF7E 1Z0BA 2Z5CA 4HXZA 4DR7E 1UILA 1NZ0A 4DUZE 2OI2A 3JAMQ 2J7KA 4OX9I 4X66E 1Z5CA 4JI4I 4DV4I 4JI0E 3CWVA 4DV5I 3H4LA 2NUGA 3F0NA 4X62I 4RPFA 1S4EA 5AASA 3ZOQB 5FWKA 1VISA 3H09A 2V2QA 4JI2I 3LTOA 4B3RI 4JI1E 4JYAE 2PNMA 2JR1A 2E5LE 2DMYA 1Z0VA 2UXCE 2DEJA 4IZJA 2O1TA 3HXLA 2L3JA 2IOPA 1EI1A 1HR0E 2ZITA 4DUYE 1T4NA 1WUUA 4URLA 2DIXA 2LTRA 4KHPI 3MSWA 2FTXB 3ZKBA 3RMPA 2N3GA 3K6QA 2BM1A 4LFCI 1XNQI 1UHZA 3LLHA 4HYMA 2Z5CB 4JI8E 1Z5BA 4USKA 4DR5E 2GQ0A 2L92A 3WU3A 4DR2E 4WFTA 2NA2A 4IZKA 4AQYI 2L3CA 4DV0E 3HQ1A 1FWLA 1MX0A 2UUCI 4WSPA 3DF6A 2LTSA 4DV3I 1ELOA 1RREA 4DR6I 3J7AM 4JI7I 4TUGA 2H36X 2V2ZA 4LF9I 1ZBTA 4DR7I 1KVKA 4DUZI 2PNLA 2DEIA 1J26A 4DR4I 1T4LB 2V8QB 2HK3A 4JI0I 2X7IA 4MYTA 5IT9Q 1KKHA 5LL6R 1J5EI 5GMDA 4DPUA 4KZSA 2LJHA 4B3TE 4JI4E 4DV4E 4DV2I 4DV5E 1SR9A 4JYAI 4X62E 3ZZ0A 4Z7CA 4DV7E 4FN5A 3OMLA 2KOUA 4UT4A 4R03A 4M30A 4LU9A 5LMUI 2JY9A 2HKJA 2V85A 4B3RE 4DUYI 2FV4B 2M7QA 2L8TA 2CG9A 2R3VA 2XEXA 2E1MA 4IZKB 1PKPA 3PYEA 1N33E 2BV3A 1FWKA 4JI8I 3LPSA 4KHPE 4DV1I 3F6GA 3DJWA 3J81C 1Z59A 3T1YE 2O1UA 4LFCE 1XNQE 2YT4A 3P06A 1EKZA 4LF6I 1XMOI 4PRXA 4DV0I 4LF8E 5LMNI 2CPNA 5ADZA 4L5NC 4I3HA 3Q6NA 4AQYE 1GZ6A 2HKEA 2Z5BA 4IZJD 2UUCE 5T6JA 1NHHA 4DV3E 4WYQB 4JI7E 3PYGA 3K17A 3P1XA 3IWDA 4LF9E 2KHXA 2MDRA 2HHHE 1ZM4A 3J81Q 1B62A 2EZ6A 3C4BA 1QU6A 4LF4I 3OTOE 4DR4E 4JG4A 2LUQA 4F9AB 4B3TI 4BC9A 3ZZUA 1ZXMA 4DMIA 4JI6I 1X47A 3FIGA 4DV7I 3JU0A 1J5EE 4OOGC 3LMLA 3ADLA 1ZM3A 1YYWA 4DV2E 2JWOA 3ADJA 3JTZA 2NUEA 2CGEA 1HNWI 2UU9E 4M0VA 1Y4SA 1X49A 4K0KI 1ZM2A 4BBYA 4P7AA 2YZTA 4EMDA 5AE1A 3GONA 2FGGA 1HNXI 2LRSA 2B7VA 1DQ3A 1RQ0A 4LFBI 4B3ME 3F6HA 5LMUE 2IHR1 1N33I 4Z7YA 3ADIA 3ZZTA 1FJGI 2HFUA 2L33A 1STUA 3T1YI 4HACA 4NXMI 3HPSA 4X64E 4WUBA 4LF8I 2V83A 4DV1E 5IT9C 3PYDA 1N0VC 1UEKA 1WHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB I;  4LF6 E;  1XMO E;  4LFA I;  3ADG A;  5FLX Q;  1XMQ E;  1H7S A;  5LMN E;  2RTX A;  4M2Z A;  1MU5 A;  1IBL I;  4R1F A;  2HHH I;  3V2U C;  4X65 I;  3OTO I;  2E1R A;  4B3S I;  4PU9 A;  3B78 A;  2L2N A;  4LF4 E;  3WU4 A;  2UU9 I;  4JI6 E;  4HY1 A;  3K1J A;  1NHI A;  1Z0E A;  3J80 Q;  4HAC B;  1QZR A;  1K47 A;  4B3M I;  1HNW E;  2B3T B;  4K0K E;  2WW4 A;  5GME A;  1HNX E;  4WUC A;  1H72 C;  3J7Y p;  1Z0T A;  4LFB E;  5A2Q C;  3ZKD A;  2UUA I;  1FJG E;  2HK2 A;  1D6T A;  4X64 I;  4LF5 I;  4JV5 E;  3QT8 A;  4FWD A;  1XNR I;  4NXM E;  4GKK I;  1XMQ I;  1PVG A;  2BM0 A;  2V2V A;  1RR9 A;  3QT5 A;  1HNZ I;  1Z0W A;  2UXB E;  2VQF E;  1MG7 A;  2VQE E;  5A2Q Q;  4LFA E;  4JI3 I;  1U2R A;  2V8P A;  3T1H I;  1T4O A;  1N34 I;  1IBL E;  1N36 E;  4FWH A;  1ZM9 A;  4X65 E;  3HUL A;  5BR8 I;  2F4V E;  4B3S E;  4WUD A;  4X8W A;  4XTJ A;  3VYY A;  1IBM E;  2LUP B;  3B8H A;  1FKA E;  1KTV A;  4JI5 I;  2NUF A;  1OJ4 A;  1Z0C A;  4P52 A;  1IBK I;  2ZM6 E;  5CFF E;  2ZBK B;  4PRV A;  3LNU A;  2CZ9 A;  2V34 A;  2RSM A;  1DAR A;  1YYO A;  1ZXN A;  4DR1 E;  5FLX C;  2Q2E B;  1Z5A A;  4ED4 A;  1DI2 A;  4DR3 E;  2LBS B;  2L2M A;  4JV5 I;  2VF3 A;  1EA6 A;  2UUA E;  2LJP A;  2UUB E;  1Z0G A;  4LF5 E;  4DPX A;  4GKJ I;  4DV6 I;  4DPW A;  1XNR E;  5L3J A;  2VQF I;  2A2D A;  2VQE I;  4GKK E;  2RS7 A;  1H73 A;  1I94 E;  3M6A A;  1FNM A;  1HNZ E;  1N36 I;  1WHN A;  2AJ4 A;  3J80 C;  4DPY A;  4JI3 E;  4FWG A;  2F4V I;  4DKK A;  2UXD I;  4YHH I;  3V5R A;  3T1H E;  1N34 E;  5IWA E;  1IBM I;  1BKN A;  2A2C A;  4MYU A;  5BR8 E;  1S16 A;  2N3H A;  3Q1Q A;  4YY3 E;  1H7U A;  4LF7 I;  3PYF A;  4USM A;  3WU5 A;  4FW9 A;  2ZM6 I;  1N32 E;  2HFS A;  4NXN E;  1PIE A;  4JI5 E;  4X66 I;  1B63 A;  2L2K B;  4UTG A;  1IBK E;  4DR1 I;  3D4J A;  1FI4 A;  4DR3 I;  4OX9 E;  4JI1 I;  1NHJ A;  2UUB I;  3VYX A;  4ZVI A;  2E5L I;  4DU8 A;  2UXC I;  3C4T A;  4JI2 E;  1KIJ A;  2EFG A;  3WU6 A;  1HR0 I;  1YYK A;  4DU7 A;  3QT7 A;  1I94 I;  3QT6 A;  3ZM7 A;  1GQE A;  1H74 A;  4KQV A;  4GKJ E;  2GS8 A;  4DV6 E;  3B82 A;  1A6F A;  4DR5 I;  3HTX A;  2R42 A;  4DPT A;  3J7A G;  2RS6 A;  5IWA I;  4DXL A;  4DR2 I;  3JAM C;  1O0W A;  1RC7 A;  1YZ9 A;  2UXD E;  1X48 A;  1N0U A;  4YHH E;  4YY3 I;  1XHK A;  2NPF A;  2DB2 A;  2JVA A;  2B7T A;  4M1K A;  1N32 I;  4NXN I;  4DR6 E;  4LF7 E;  1Z0B A;  4HXZ A;  4DR7 E;  1UIL A;  1NZ0 A;  4DUZ E;  2OI2 A;  3JAM Q;  2J7K A;  4OX9 I;  4X66 E;  1Z5C A;  4JI4 I;  4DV4 I;  4JI0 E;  3CWV A;  4DV5 I;  3H4L A;  2NUG A;  3F0N A;  4X62 I;  4RPF A;  1S4E A;  1VIS A;  2V2Q A;  4JI2 I;  3LTO A;  4B3R I;  4JI1 E;  4JYA E;  2E5L E;  2DMY A;  1Z0V A;  2UXC E;  2DEJ A;  2L3J A;  1EI1 A;  1HR0 E;  2ZIT A;  4DUY E;  1T4N A;  1WUU A;  4URL A;  2DIX A;  2LTR A;  4KHP I;  3ZKB A;  2BM1 A;  2N3G A;  4LFC I;  1XNQ I;  1UHZ A;  3LLH A;  4HYM A;  4JI8 E;  1Z5B A;  4USK A;  4DR5 E;  1UEK A;  3WU3 A;  4DR2 E;  4WFT A;  2NA2 A;  4AQY I;  2L3C A;  4DV0 E;  1MX0 A;  1FWL A;  2UUC I;  2LTS A;  4DV3 I;  1ELO A;  1RRE A;  4DR6 I;  3J7A M;  4JI7 I;  2V2Z A;  4LF9 I;  1ZBT A;  4DR7 I;  1KVK A;  4DUZ I;  2DEI A;  1J26 A;  4DR4 I;  1T4L B;  2HK3 A;  4JI0 I;  2X7I A;  4MYT A;  5IT9 Q;  1KKH A;  5LL6 R;  1J5E I;  5GMD A;  4DPU A;  2LJH A;  4B3T E;  4JI4 E;  4DV4 E;  4DV2 I;  4DV5 E;  4JYA I;  4X62 E;  3ZZ0 A;  4Z7C A;  4DV7 E;  4FN5 A;  4UT4 A;  4M30 A;  5LMU I;  2JY9 A;  2HKJ A;  4B3R E;  4DUY I;  2XEX A;  2R3V A;  1PKP A;  3PYE A;  1N33 E;  2BV3 A;  1FWK A;  4JI8 I;  3LPS A;  4KHP E;  4DV1 I;  1Z59 A;  3J81 C;  3T1Y E;  4LFC E;  1XNQ E;  2YT4 A;  1EKZ A;  4LF6 I;  1XMO I;  4PRX A;  4DV0 I;  4LF8 E;  5LMN I;  2CPN A;  4I3H A;  4AQY E;  2HKE A;  2UUC E;  1NHH A;  4DV3 E;  4WYQ B;  4JI7 E;  3PYG A;  3K17 A;  3P1X A;  4LF9 E;  2KHX A;  2MDR A;  2HHH E;  1ZM4 A;  3J81 Q;  1B62 A;  2EZ6 A;  3C4B A;  1QU6 A;  4LF4 I;  3OTO E;  4DR4 E;  4JG4 A;  2LUQ A;  4B3T I;  3ZZU A;  1ZXM A;  4JI6 I;  1X47 A;  4DV7 I;  1J5E E;  4OOG C;  3ADL A;  1ZM3 A;  1YYW A;  4DV2 E;  2NUE A;  3ADJ A;  1HNW I;  2UU9 E;  4K0K I;  1X49 A;  1ZM2 A;  4P7A A;  4EMD A;  3GON A;  1HNX I;  2LRS A;  2B7V A;  4LFB I;  1RQ0 A;  4B3M E;  5LMU E;  2IHR 1;  1N33 I;  4Z7Y A;  3ADI A;  3ZZT A;  1FJG I;  2HFU A;  2L33 A;  1STU A;  3T1Y I;  4HAC A;  4NXM I;  4WUB A;  4X64 E;  4LF8 I;  4DV1 E;  5IT9 C;  3PYD A;  1N0V C;  2X36 A;  1WHQ A; 
#chains in the Genus database with same CATH topology
 5IXM B;  2UXB I;  3KZY A;  1OYP A;  1TN9 A;  4LF6 E;  1XMO E;  1TF3 A;  3Q6M A;  4LFA I;  3ADG A;  2EPC A;  5FLX Q;  1XMQ E;  1H7S A;  1TF6 A;  2LCE A;  5LMN E;  3P3E A;  4F9B B;  2RTX A;  1G2D C;  4M2Z A;  1MU5 A;  1IBL I;  4R1F A;  1BBG A;  2HHH I;  3V2U C;  2YTF A;  2RQL A;  4X65 I;  3OTO I;  1UDS A;  2LO3 A;  3KWR A;  2E1R A;  2V88 A;  2K4V A;  1UDQ A;  2J65 A;  4B3S I;  1ZBQ A;  2HJJ A;  2YPN A;  4PU9 A;  2N8X A;  2LT7 A;  3B78 A;  4IZJ B;  2L2N A;  1A1G A;  5DRR A;  4LCG A;  4LF4 E;  4MU3 A;  3WU4 A;  2EL5 A;  4WPY A;  5IV8 B;  2ODR C;  1A1J A;  4IS1 C;  1R6L A;  2D9H A;  2UU9 I;  4JI6 E;  2EWL A;  4HY1 A;  1A1F A;  3K1J A;  1NHI A;  1Z0E A;  2X36 A;  1USU A;  1QNT A;  2JOX A;  3J80 Q;  4HAC B;  1QZR A;  1K47 A;  4BA2 B;  4B3M I;  1HNW E;  2B3T B;  4K0K E;  1T39 A;  1Z1B A;  5C0X A;  2WW4 A;  1OYS A;  4LCH A;  4FW5 A;  5A69 A;  5GME A;  1YPN A;  5F3W A;  5K36 C;  4NZV A;  1HNX E;  4WUC A;  1H72 C;  4BS9 A;  3P3C A;  3J7Y p;  1Z0T A;  4LFB E;  1HK7 A;  5A2Q C;  3ZKD A;  2BA0 G;  4N3O A;  2UUA I;  2BR2 B;  1FJG E;  2HK2 A;  2EQ3 A;  1D6T A;  4IFD F;  5KL3 A;  4R2A A;  1KJK A;  2DLQ A;  4X64 I;  2EPA A;  2LE2 A;  3M85 G;  2EOF A;  3GLL A;  4LF5 I;  2VES A;  4JV5 E;  3QT8 A;  4FWD A;  2RPC A;  2DLK A;  1JK1 A;  2ODR D;  2GO3 A;  2JE6 A;  1XNR I;  2O1V A;  2EMX A;  2NN6 B;  2DGC A;  4O24 A;  4NXM E;  4GKK I;  2LV2 A;  4WSG A;  2F1D A;  4M9V C;  4N4R B;  1PVG A;  1XMQ I;  2BM0 A;  2V2V A;  1RR9 A;  3QT5 A;  1HNZ I;  1Z0W A;  1MEY C;  4WX9 A;  2UXB E;  2M9A A;  4ZYH A;  2YSP A;  1USV A;  2VQF E;  4WXC A;  4OZE A;  1MG7 A;  2VQE E;  5A2Q Q;  4O5G A;  4LFA E;  4JI3 I;  1U2R A;  2V8P A;  5KL7 A;  3T1H I;  1T4O A;  1PJQ A;  2EMH A;  1N34 I;  1MGT A;  2YTE A;  1IBL E;  5K36 D;  3ZM7 A;  2GPI A;  1Y5Y A;  1N36 E;  4FWH A;  2DSY A;  2EM4 A;  3C6M A;  4L8N A;  4X65 E;  1ZM9 A;  3HUL A;  1NEI A;  2ELY A;  2GO4 A;  2F4V E;  5BR8 I;  5C0X B;  5AC4 A;  4TUI A;  3U1Y A;  4B3S E;  2V86 A;  4WUD A;  4X8W A;  4XTJ A;  5EKW A;  3VYY A;  2JT2 A;  1IBM E;  5ELW A;  1R6M A;  2LUP B;  3B8H A;  1FKA E;  1KTV A;  2RSI A;  4I8O A;  2NN6 E;  4JI5 I;  2WZO A;  2NUF A;  1OJ4 A;  3EPH A;  5K36 B;  2EN4 A;  3CDI A;  2EM5 A;  1Z0C A;  4P52 A;  1IBK I;  2ZM6 E;  5CFF E;  4J8Z A;  1X6F A;  2ZBK B;  4PRV A;  2JYA A;  3LNU A;  5C0X C;  2YTJ A;  2CZ9 A;  2JE6 B;  2V34 A;  5JEA A;  2PO1 A;  2RSM A;  5A6K A;  1RMD A;  1DAR A;  1YYO A;  2EE8 A;  1ZXN A;  4DR1 E;  2JOB A;  5FLX C;  2YTO A;  2Q2E B;  4R2D A;  1Z5A A;  2Z5E A;  4AIM A;  4ED4 A;  2PNZ B;  3AV0 A;  1DI2 A;  2CSH A;  1WXR A;  4DR3 E;  4P78 A;  2LBS B;  2L2M A;  2F8B A;  5KL2 A;  5KL6 A;  2EOY A;  1YHC A;  2EN7 A;  3MHS C;  2Z5B B;  4JV5 I;  4BHB A;  2EOJ A;  2VF3 A;  2GLI A;  2EPZ A;  2WBS A;  1EA6 A;  2M4I A;  2UUA E;  2EML A;  2LJP A;  2EMI A;  2UUB E;  1Z0G A;  1SFE A;  1WJP A;  2PO0 B;  3THN A;  4LF5 E;  1EH6 A;  2IER A;  1F2I G;  4DPX A;  4GKJ I;  4DV6 I;  2EM7 A;  4GEQ B;  5DNY A;  4DPW A;  1XNR E;  5L3J A;  3VK6 A;  2VQF I;  2A2D A;  2VQE I;  4GKK E;  2RS7 A;  1H73 A;  4OO1 A;  4MLV A;  1I94 E;  3M6A A;  2JEA A;  1FNM A;  2EN8 A;  2BA1 D;  1HNZ E;  2L6M A;  5C0X D;  1N36 I;  2EPL X;  1WHN A;  2MKN A;  2AJ4 A;  4BC7 A;  4F6M A;  1YFH A;  3J80 C;  2WNR A;  2EOM A;  2ENC A;  4JI3 E;  4DPY A;  4FWG A;  2F4V I;  2B9D A;  4DKK A;  2UXD I;  1Y4U A;  4YHH I;  3V5R A;  2MC5 A;  4MQY A;  5DNX A;  1PJT A;  3T1H E;  4FW4 A;  1N34 E;  2M1S A;  5IWA E;  1IBM I;  3PS1 A;  1X3C A;  1BKN A;  1YH8 A;  2JEB A;  5DRO A;  2A2C A;  3BID A;  1N3G A;  2NN6 F;  3HJC A;  4MYU A;  4BMJ A;  3K85 A;  1A1I A;  5BR8 E;  2I13 A;  3KZZ A;  2N3H A;  4F54 A;  5AE3 A;  3EPL A;  4YY3 E;  1S16 A;  2EJ4 A;  2C37 A;  2WP8 B;  3Q1Q A;  4F6N A;  1H7U A;  1EH8 A;  2YRM A;  4BCA A;  4LF7 I;  3PYF A;  4USM A;  3WU5 A;  4FW9 A;  2ZM6 I;  2HC5 A;  5A6B D;  4P7D A;  2ELZ A;  3HPZ A;  1N32 E;  1Y6Z A;  2HFS A;  2O3Z A;  4NXN E;  2C38 A;  1PIE A;  2LMZ A;  3UK3 C;  4JI5 E;  5JEA C;  3IWB A;  4J3D A;  1B63 A;  4X66 I;  2L2K B;  4BA1 B;  2KON A;  1PDA A;  3HKM A;  4Q28 A;  4UTG A;  1IBK E;  2V89 A;  4DR1 I;  2C39 B;  3D4J A;  1FI4 A;  1P42 A;  4DR3 I;  2EN1 A;  2EPU A;  4ZYD A;  4R2R A;  2ADR A;  5KL4 A;  4OX9 E;  3H1C A;  2V87 A;  5KL5 A;  2PRT A;  3PS3 A;  4JI1 I;  1NHJ A;  3P3G A;  2EQ1 A;  2UUB I;  3VYX A;  2EPM X;  4ZVI A;  2G7H A;  2E5L I;  4DU8 A;  3BGH A;  2BB8 A;  2EPK X;  4R2Q A;  2MC6 A;  1E3P A;  2UXC I;  5K36 E;  3C4T A;  4JI2 E;  1KIJ A;  3M99 B;  2HGH A;  2EFG A;  3WU6 A;  1HR0 I;  1YYK A;  4MDT A;  1B69 A;  3EPJ A;  2EOI A;  3MHH C;  1KYQ A;  2YU8 A;  4DU7 A;  1EH7 A;  5A6B A;  3QT7 A;  1I94 I;  4OO1 C;  3AUZ A;  2BA0 D;  3QT6 A;  3UHM A;  2EM9 A;  4MU1 A;  1GQE A;  5AE2 A;  2EOZ A;  1H74 A;  4KQV A;  2EPP A;  4GKJ E;  4DV6 E;  1X6H A;  2GS8 A;  2EPO A;  2VF1 A;  2O1W A;  4IFD A;  5JEA D;  2EMF A;  3B82 A;  3M85 D;  2I9I A;  3PRY A;  1A6F A;  2EN2 A;  4DR5 I;  3HTX A;  2R42 A;  3IWC A;  1UN6 B;  4AID A;  3J7A G;  4DPT A;  2EP3 A;  2RS6 A;  2YSO A;  4LTY A;  4LPF A;  5IWA I;  4OKG A;  4DXL A;  4DR2 I;  3JAM C;  1PJS A;  3ECR A;  1O0W A;  1RC7 A;  1YZ9 A;  1AAY A;  2J7J A;  1LLM C;  4R8O A;  2IOQ A;  2UXD E;  1X48 A;  1N0U A;  4FW7 A;  4YHH E;  1P47 A;  4YY3 I;  1JK2 A;  4F9C B;  1XHK A;  2NPF A;  2DB2 A;  2JVA A;  2EM2 A;  2VE7 C;  2B7T A;  4M1K A;  1N32 I;  4NXN I;  1AH5 A;  2YRH A;  4DR6 E;  4LF7 E;  1Z0B A;  2Z5C A;  4U3B A;  3M7N G;  4OO1 D;  4HXZ A;  1A1K A;  4DR7 E;  1UIL A;  1NZ0 A;  4DUZ E;  2EPX A;  2OI2 A;  3JAM Q;  2MKD A;  2J7K A;  4OX9 I;  4X66 E;  1Z5C A;  3C6K A;  4QNJ A;  4JI4 I;  3KRN A;  4GQU A;  4DV4 I;  4JI0 E;  1E3H A;  2JPA A;  3CWV A;  2YWQ A;  4DV5 I;  3H4L A;  1Y60 A;  2NUG A;  3F0N A;  4R2P A;  1ZU1 A;  5LLQ A;  4X62 I;  4RPF A;  1S4E A;  2A25 A;  2EOO A;  2WBT A;  3ZOQ B;  5AAS A;  5FWK A;  1VIS A;  3H09 A;  2V2Q A;  5K36 F;  5C0X E;  4WXD A;  5TSE A;  2WCC 3;  4JI2 I;  1ZAA C;  2AE8 A;  3LTO A;  4B3R I;  1YSA C;  4JI1 E;  4JYA E;  2PNM A;  5A6J A;  2WBU A;  1DGC A;  2EOS A;  2JR1 A;  2E5L E;  2DMY A;  1Z0V A;  2UXC E;  1HNW I;  5DRP A;  2R1F A;  2DEJ A;  2O1T A;  1UBD C;  4IZJ A;  3BBG A;  3HXL A;  2L3J A;  2IOP A;  4IFD C;  1EI1 A;  2EN3 A;  1HR0 E;  2CT1 A;  2YU5 A;  4DUY E;  2ZIT A;  1T4N A;  2Q8U A;  1WUU A;  2DIX A;  3NZK A;  4URL A;  2LTR A;  3L7Z A;  4QNK A;  4KHP I;  3MSW A;  2FTX B;  3ZKB A;  3RMP A;  2N3G A;  3K6Q A;  2BM1 A;  4LFC I;  1XNQ I;  2EM8 A;  1UHZ A;  2GHF A;  1UDO A;  3LLH A;  4HYM A;  4Q35 B;  2Z5C B;  4JI8 E;  1Z5B A;  4USK A;  5DRQ A;  2LJU A;  4DR5 E;  4BA2 A;  1IQO A;  2EN6 A;  2VRD A;  2GQ0 A;  5JEA B;  1OYR A;  2L92 A;  2PO1 B;  2EL6 A;  3WU3 A;  4DR2 E;  2YTN A;  2LVH A;  4WFT A;  1A1L A;  2NA2 A;  1L4S A;  4IZK A;  4AQY I;  2L3C A;  2DMI A;  4DV0 E;  3HQ1 A;  1FWL A;  1MX0 A;  2UUC I;  4WSP A;  3DF6 A;  2LTS A;  4DV3 I;  1ELO A;  1RRE A;  4F2J C;  4FW3 A;  3J7A M;  4JI7 I;  4DR6 I;  2EMK A;  1WRJ A;  4TUG A;  2H36 X;  2BR2 A;  4NHR A;  2V2Z A;  3GME A;  1T38 A;  1ZBT A;  4LF9 I;  1X6E A;  5AC5 A;  4DR7 I;  1KVK A;  4DUZ I;  1UDN A;  2PNL A;  2DEI A;  1J26 A;  4DR4 I;  1T4L B;  2EMG A;  1ZR9 A;  4IFD D;  2EOQ A;  2V8Q B;  2HK3 A;  4JI0 I;  1A1H A;  2X7I A;  4MYT A;  2NN6 A;  4ZYE A;  4MLQ A;  5IT9 Q;  1KKH A;  4MU0 A;  5LL6 R;  1J5E I;  2BBG A;  5GMD A;  4DPU A;  4KZS A;  4O43 A;  4FK5 C;  5C0X F;  2EPR A;  2LJH A;  4FW6 A;  4B3T E;  4JI4 E;  4DV4 E;  4OO1 B;  3L7Z B;  4DV2 I;  3P76 A;  3U1K A;  4DV5 E;  2EOE A;  2JEA B;  4RHB B;  5JEA E;  1SR9 A;  4BHC A;  4JYA I;  3BF2 A;  3TQM A;  4X62 E;  3EQ1 A;  4DV7 E;  3ZZ0 A;  4Z7C A;  4FN5 A;  3OML A;  2WNR B;  2EPN A;  2YTP A;  2KOU A;  3VHT B;  4R2E A;  2ENA A;  1YUI A;  4LOM A;  4UT4 A;  4R03 A;  4M30 A;  4LU9 A;  1IQS A;  5LMU I;  2JY9 A;  2HKJ A;  2V85 A;  2EL4 A;  4B3R E;  4DUY I;  2FV4 B;  2M7Q A;  2L8T A;  2CG9 A;  2R3V A;  2XEX A;  2E1M A;  3EPK A;  2JEB B;  4IZK B;  2YTI A;  1NCS A;  2YTQ A;  1BBO A;  1PKP A;  4MU4 A;  3PYE A;  2C37 B;  1RHY A;  1N33 E;  2BV3 A;  1FWK A;  4JI8 I;  3LPS A;  2K7I A;  5EL9 A;  4KHP E;  4DV1 I;  3F6G A;  3DJW A;  2CTD A;  2C38 B;  1G2F C;  3J81 C;  1Z59 A;  3T1Y E;  2O1U A;  4IJD A;  4LFC E;  2YT4 A;  1XNQ E;  3P06 A;  4OO1 E;  1EKZ A;  3PS2 A;  4LF6 I;  1XMO I;  4PRX A;  4AM3 A;  3GCM A;  4DV0 I;  2ENH A;  4LF8 E;  3L00 A;  2EMW A;  5LMN I;  4ZYG A;  2CPN A;  5ADZ A;  4L5N C;  2YTD A;  2PNZ A;  4I3H A;  4HEI A;  3Q6N A;  2EM3 A;  4AQY E;  1GZ6 A;  4U3D A;  3QG5 C;  2HKE A;  2EM6 A;  2EMY A;  2Z5B A;  4IZJ D;  2UUC E;  5T6J A;  1NHH A;  4DV3 E;  2EOH A;  2MDG A;  4WYQ B;  2EMZ A;  4JI7 E;  3PYG A;  3K17 A;  3P1X A;  3IWD A;  2DRP A;  4LF9 E;  2NN6 C;  2KHX A;  2MDR A;  2HHH E;  1ZM4 A;  2E72 A;  1B62 A;  2EZ6 A;  2PO0 A;  3C4B A;  1QU6 A;  2PO2 A;  3J81 Q;  4LF4 I;  3OTO E;  4R2S A;  4DR4 E;  4JG4 A;  2JP9 A;  2LUQ A;  4F9A B;  4B3T I;  4BC9 A;  5JEA F;  3ZZU A;  1ZXM A;  2NAB A;  1BB8 A;  4DMI A;  4JI6 I;  4LCF A;  1X47 A;  3FIG A;  4DV7 I;  3JU0 A;  4IFD B;  1J5E E;  2EQ0 A;  2JXP A;  3M7N D;  5A6A A;  4OOG C;  3LML A;  3ADL A;  4NBQ A;  1ZM3 A;  1YYW A;  4GZN C;  4DV2 E;  2JWO A;  3ADJ A;  3JTZ A;  2NUE A;  4RH8 A;  1IMU A;  2UU9 E;  2CGE A;  4M0V A;  2R76 A;  1X49 A;  1X5W A;  1Y4S A;  3DD6 A;  1ZM2 A;  4K0K I;  1GTK A;  4BBY A;  4P7A A;  2YZT A;  2YRK A;  2EMC A;  4EMD A;  5AE1 A;  3GON A;  4ISA A;  2FGG A;  1HNX I;  2LRS A;  4O4K A;  2IES A;  2EM0 A;  2B7V A;  2YTG A;  1VI7 A;  1DQ3 A;  1RQ0 A;  4R2C A;  3CDJ A;  2EMA A;  4B3M E;  3F6H A;  4LFB I;  5LMU E;  2IHR 1;  1N33 I;  4Z7Y A;  3ADI A;  3THO B;  3ZZT A;  1FJG I;  1YUJ A;  5K36 A;  2HFU A;  2L33 A;  2WP8 A;  2NN6 D;  4IS9 A;  2EOX A;  4OO1 F;  1STU A;  2EOR A;  3T1Y I;  2EMB A;  4HTG A;  1XXE A;  2BA1 G;  4HAC A;  2CVE A;  5DNL A;  4NXM I;  3HPS A;  4X64 E;  4WUB A;  4BA1 A;  2V83 A;  4LF8 I;  4KWY A;  2PO2 B;  4DV1 E;  4IFD E;  5IT9 C;  4X9J A;  3PYD A;  1N0V C;  2C39 A;  3B4T A;  1UEK A;  1WHQ A; 
#chains in the Genus database with same CATH homology
 2UXB I;  4LF6 E;  1XMO E;  3Q6M A;  4LFA I;  3ADG A;  5FLX Q;  1XMQ E;  1H7S A;  5LMN E;  4F9B B;  2RTX A;  4M2Z A;  1MU5 A;  1IBL I;  4R1F A;  2HHH I;  3V2U C;  4X65 I;  3OTO I;  3KWR A;  2E1R A;  2V88 A;  2K4V A;  4B3S I;  1ZBQ A;  4PU9 A;  3B78 A;  4IZJ B;  2L2N A;  4LF4 E;  3WU4 A;  4WPY A;  2ODR C;  2UU9 I;  4JI6 E;  2EWL A;  4HY1 A;  3K1J A;  1NHI A;  1Z0E A;  2X36 A;  1USU A;  2JOX A;  3J80 Q;  4HAC B;  1QZR A;  1K47 A;  4B3M I;  1HNW E;  2B3T B;  4K0K E;  2WW4 A;  5GME A;  5F3W A;  1HNX E;  4WUC A;  1H72 C;  4BS9 A;  3J7Y p;  1Z0T A;  4LFB E;  1HK7 A;  5A2Q C;  3ZKD A;  4N3O A;  2UUA I;  1FJG E;  2HK2 A;  1D6T A;  4X64 I;  2LE2 A;  4LF5 I;  4JV5 E;  3QT8 A;  4FWD A;  1XNR I;  2ODR D;  2O1V A;  4NXM E;  4GKK I;  1XMQ I;  1PVG A;  2BM0 A;  2V2V A;  1RR9 A;  3QT5 A;  1HNZ I;  1Z0W A;  2UXB E;  1USV A;  2VQF E;  1MG7 A;  2VQE E;  5A2Q Q;  4LFA E;  4JI3 I;  1U2R A;  2V8P A;  3T1H I;  1T4O A;  1N34 I;  1IBL E;  1N36 E;  4FWH A;  2DSY A;  1ZM9 A;  4L8N A;  4X65 E;  3HUL A;  5BR8 I;  2F4V E;  4TUI A;  4B3S E;  2V86 A;  4WUD A;  4X8W A;  4XTJ A;  3VYY A;  1IBM E;  2LUP B;  3B8H A;  1FKA E;  1KTV A;  4I8O A;  4JI5 I;  2WZO A;  2NUF A;  1OJ4 A;  1Z0C A;  4P52 A;  1IBK I;  2ZM6 E;  5CFF E;  4J8Z A;  2ZBK B;  4PRV A;  3LNU A;  2CZ9 A;  2V34 A;  2RSM A;  1DAR A;  1YYO A;  1ZXN A;  4DR1 E;  2JOB A;  5FLX C;  2Q2E B;  2Z5E A;  1Z5A A;  4ED4 A;  3AV0 A;  1DI2 A;  1WXR A;  4DR3 E;  4P78 A;  2LBS B;  2L2M A;  2F8B A;  2Z5B B;  4JV5 I;  2VF3 A;  1EA6 A;  2M4I A;  2UUA E;  2LJP A;  2UUB E;  1Z0G A;  4LF5 E;  4DPX A;  4GKJ I;  4DV6 I;  4GEQ B;  5DNY A;  4DPW A;  1XNR E;  5L3J A;  3VK6 A;  2VQF I;  2A2D A;  2VQE I;  4GKK E;  2RS7 A;  1H73 A;  1I94 E;  3M6A A;  1FNM A;  1HNZ E;  2L6M A;  1N36 I;  1WHN A;  2AJ4 A;  4BC7 A;  3J80 C;  4DPY A;  4JI3 E;  4FWG A;  2F4V I;  2B9D A;  4DKK A;  2UXD I;  1Y4U A;  4YHH I;  3V5R A;  2MC5 A;  3T1H E;  1N34 E;  2M1S A;  5IWA E;  1IBM I;  1BKN A;  2A2C A;  3HJC A;  4MYU A;  4BMJ A;  3K85 A;  5BR8 E;  1S16 A;  2N3H A;  4F54 A;  5AE3 A;  3Q1Q A;  4YY3 E;  1H7U A;  4BCA A;  4LF7 I;  3PYF A;  4USM A;  3WU5 A;  4FW9 A;  2ZM6 I;  4P7D A;  3HPZ A;  1N32 E;  1Y6Z A;  2HFS A;  4NXN E;  1PIE A;  2LMZ A;  4JI5 E;  4X66 I;  3IWB A;  1B63 A;  2L2K B;  2KON A;  4UTG A;  4Q28 A;  1IBK E;  2V89 A;  4DR1 I;  3D4J A;  1FI4 A;  4DR3 I;  4OX9 E;  2V87 A;  4JI1 I;  1NHJ A;  2UUB I;  3VYX A;  4ZVI A;  2G7H A;  2E5L I;  4DU8 A;  2UXC I;  2MC6 A;  3C4T A;  4JI2 E;  1KIJ A;  2EFG A;  3WU6 A;  1HR0 I;  1YYK A;  4DU7 A;  3QT7 A;  1I94 I;  3AUZ A;  3QT6 A;  3ZM7 A;  1GQE A;  5AE2 A;  1H74 A;  4KQV A;  4GKJ E;  2GS8 A;  4DV6 E;  2O1W A;  2VF1 A;  3B82 A;  3PRY A;  1A6F A;  4DR5 I;  3HTX A;  2R42 A;  3IWC A;  3J7A G;  4DPT A;  2RS6 A;  4LTY A;  5IWA I;  4DXL A;  4DR2 I;  3JAM C;  1O0W A;  1RC7 A;  1YZ9 A;  4R8O A;  2IOQ A;  2UXD E;  1X48 A;  1N0U A;  4YHH E;  4YY3 I;  4F9C B;  1XHK A;  2NPF A;  2DB2 A;  2JVA A;  2VE7 C;  2B7T A;  4M1K A;  1N32 I;  4NXN I;  4DR6 E;  4LF7 E;  1Z0B A;  2Z5C A;  4HXZ A;  4DR7 E;  1UIL A;  1NZ0 A;  4DUZ E;  2OI2 A;  3JAM Q;  2J7K A;  4OX9 I;  4X66 E;  1Z5C A;  4JI4 I;  4DV4 I;  4JI0 E;  3CWV A;  4DV5 I;  3H4L A;  2NUG A;  3F0N A;  4X62 I;  4RPF A;  1S4E A;  5AAS A;  3ZOQ B;  5FWK A;  1VIS A;  3H09 A;  2V2Q A;  4JI2 I;  3LTO A;  4B3R I;  4JI1 E;  4JYA E;  2PNM A;  2JR1 A;  2E5L E;  2DMY A;  1Z0V A;  2UXC E;  2DEJ A;  4IZJ A;  2O1T A;  3HXL A;  2L3J A;  2IOP A;  1EI1 A;  1HR0 E;  2ZIT A;  4DUY E;  1T4N A;  1WUU A;  4URL A;  2DIX A;  2LTR A;  4KHP I;  3MSW A;  2FTX B;  3ZKB A;  3RMP A;  2N3G A;  3K6Q A;  2BM1 A;  4LFC I;  1XNQ I;  1UHZ A;  3LLH A;  4HYM A;  2Z5C B;  4JI8 E;  1Z5B A;  4USK A;  4DR5 E;  2GQ0 A;  2L92 A;  3WU3 A;  4DR2 E;  4WFT A;  2NA2 A;  4IZK A;  4AQY I;  2L3C A;  4DV0 E;  3HQ1 A;  1FWL A;  1MX0 A;  2UUC I;  4WSP A;  3DF6 A;  2LTS A;  4DV3 I;  1ELO A;  1RRE A;  4DR6 I;  3J7A M;  4JI7 I;  4TUG A;  2H36 X;  2V2Z A;  4LF9 I;  1ZBT A;  4DR7 I;  1KVK A;  4DUZ I;  2PNL A;  2DEI A;  1J26 A;  4DR4 I;  1T4L B;  2V8Q B;  2HK3 A;  4JI0 I;  2X7I A;  4MYT A;  5IT9 Q;  1KKH A;  5LL6 R;  1J5E I;  5GMD A;  4DPU A;  4KZS A;  2LJH A;  4B3T E;  4JI4 E;  4DV4 E;  4DV2 I;  4DV5 E;  1SR9 A;  4JYA I;  4X62 E;  3ZZ0 A;  4Z7C A;  4DV7 E;  4FN5 A;  3OML A;  2KOU A;  4UT4 A;  4R03 A;  4M30 A;  4LU9 A;  5LMU I;  2JY9 A;  2HKJ A;  2V85 A;  4B3R E;  4DUY I;  2FV4 B;  2M7Q A;  2L8T A;  2CG9 A;  2R3V A;  2XEX A;  2E1M A;  4IZK B;  1PKP A;  3PYE A;  1N33 E;  2BV3 A;  1FWK A;  4JI8 I;  3LPS A;  4KHP E;  4DV1 I;  3F6G A;  3DJW A;  3J81 C;  1Z59 A;  3T1Y E;  2O1U A;  4LFC E;  1XNQ E;  2YT4 A;  3P06 A;  1EKZ A;  4LF6 I;  1XMO I;  4PRX A;  4DV0 I;  4LF8 E;  5LMN I;  2CPN A;  5ADZ A;  4L5N C;  4I3H A;  3Q6N A;  4AQY E;  1GZ6 A;  2HKE A;  2Z5B A;  4IZJ D;  2UUC E;  5T6J A;  1NHH A;  4DV3 E;  4WYQ B;  4JI7 E;  3PYG A;  3K17 A;  3P1X A;  3IWD A;  4LF9 E;  2KHX A;  2MDR A;  2HHH E;  1ZM4 A;  3J81 Q;  1B62 A;  2EZ6 A;  3C4B A;  1QU6 A;  4LF4 I;  3OTO E;  4DR4 E;  4JG4 A;  2LUQ A;  4F9A B;  4B3T I;  4BC9 A;  3ZZU A;  1ZXM A;  4DMI A;  4JI6 I;  1X47 A;  3FIG A;  4DV7 I;  3JU0 A;  1J5E E;  4OOG C;  3LML A;  3ADL A;  1ZM3 A;  1YYW A;  4DV2 E;  2JWO A;  3ADJ A;  3JTZ A;  2NUE A;  2CGE A;  1HNW I;  2UU9 E;  4M0V A;  1Y4S A;  1X49 A;  4K0K I;  1ZM2 A;  4BBY A;  4P7A A;  2YZT A;  4EMD A;  5AE1 A;  3GON A;  2FGG A;  1HNX I;  2LRS A;  2B7V A;  1DQ3 A;  1RQ0 A;  4LFB I;  4B3M E;  3F6H A;  5LMU E;  2IHR 1;  1N33 I;  4Z7Y A;  3ADI A;  3ZZT A;  1FJG I;  2HFU A;  2L33 A;  1STU A;  3T1Y I;  4HAC A;  4NXM I;  3HPS A;  4X64 E;  4WUB A;  4LF8 I;  2V83 A;  4DV1 E;  5IT9 C;  3PYD A;  1N0V C;  1UEK A;  1WHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...