4NXNE

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4nxnE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4nxnE02
2ZM6E 1HNXI 4JI8E 1N34E 2UUAI 2BV3A 4JYAE 1J5EI 1KVKA 4LF4I 1Z0VA 2HHHI 4DV7E 4LF9I 4FWHA 4DUZE 1IBLE 1A6FA 3LLHA 3VYXA 2E1RA 3HULA 1FNMA 1FJGE 3JAMQ 1QZRA 3PYDA 4P7AA 4WYQB 2UXDE 4ZVIA 1Z0BA 2X7IA 1IBKI 2VQFE 2V2ZA 2MDRA 4X62E 4DUYI 1N36E 1KTVA 4LFCE 3J7AM 3J7AG 4DR3I 1Z0TA 1OJ4A 3GONA 1BKNA 1X48A 2VQEI 1RC7A 3J7Yp 1HNXE 2UUAE 3K1JA 2RTXA 1YYWA 4NXNI 1J5EE 1XMQI 2JVAA 3ADLA 4LF4E 2HHHE 4LF9E 2DB2A 4JI3I 3ADGA 2LTRA 3WU5A 2WW4A 3D4JA 1ZM4A 3B8HA 4FWGA 4ED4A 1H7SA 3QT5A 4HACB 4LF6I 1S4EA 4HACA 1IBKE 2NUFA 2NPFA 4AQYI 4DUYE 2UU9I 1YZ9A 4EMDA 4DR3E 4USMA 1N0VC 2DEIA 4HY1A 1T4NA 2VQEE 2N3GA 5LMNI 4NXNE 1ELOA 4USKA 1PIEA 1XMQE 1RQ0A 4K0KI 4JI3E 3ZZTA 4UT4A 2A2CA 3LTOA 1XNQI 1H73A 3QT8A 4LF6E 4OOGC 1XNRI 1UILA 1DARA 4AQYE 5IT9C 4LF8I 2UU9E 1I94I 2NUEA 4JI2I 3T1HI 1WHQA 5LL6R 1Z59A 4JI6I 1HNWI 3V5RA 1WHNA 4OX9I 4FWDA 5LMNE 3ZKDA 2F4VI 3J81C 2NUGA 4DR1I 4X66I 4K0KE 1Z0WA 4DV3I 4JI0I 1NHIA 4DPXA 4FW9A 2JY9A 5IT9Q 1XNQE 4X64I 1ZBTA 1N32I 4DR2I 1H74A 1XNRE 1ZXNA 4LF8E 4HXZA 4Z7CA 1I94E 4JI2E 4DPUA 1EKZA 4KQVA 1FI4A 3T1HE 2B7VA 1YYOA 1NZ0A 2L3JA 4JI6E 3J81Q 1HNWE 4OX9E 4LF5I 3Q1QA 2F4VE 3T1YI 4DR1E 1XMOI 4B3MI 4X66E 4LF7I 2LRSA 1RREA 1T4OA 4DV3E 1H72C 2DEJA 2ZITA 4JI0E 1K47A 3CWVA 4X64E 1N32E 4DR2E 3P1XA 3C4TA 4JI7I 1NHHA 3C4BA 4GKKI 5BR8I 1QU6A 4P52A 4WUCA 4B3TI 5GMDA 4DPYA 1YYKA 4B3SI 3F0NA 4URLA 2L2NA 1HNZI 4LF5E 1PKPA 1N0UA 5A2QQ 3T1YE 1XMOE 4B3ME 4LF7E 3ZKBA 1U2RA 4B3RI 4DPWA 2AJ4A 4DXLA 1B63A 2VF3A 1MU5A 4MYUA 3ADJA 5LMUI 4YY3I 3WU4A 1KIJA 1Z0CA 4JI7E 4DV5I 2RSMA 4GKKE 1B62A 3V2UC 5BR8E 5IWAI 2V34A 4B3TE 4M1KA 5L3JA 2DMYA 2EZ6A 3VYYA 3PYEA 4B3SE 3HTXA 1HNZE 3M6AA 3B78A 2UXBI 1Z0GA 3OTOI 1N33I 2LJHA 2LTSA 1S16A 4LFBI 4B3RE 4DV0I 1Z5AA 2CPNA 2BM1A 4WFTA 4DPTA 3ZZUA 2R42A 1ZM2A 4PRVA 3QT7A 4DV6I 1X49A 4JV5I 4DR7I 4JG4A 2LUQA 5LMUE 4YY3E 1EI1A 3PYFA 4DV5E 1Z0EA 4DR6I 4DU7A 2X36A 2L2MA 4RPFA 4YHHI 2IHR1 2NA2A 4DV2I 4WUDA 4KHPI 5IWAE 4Z7YA 3H4LA 2HFUA 4DV1I 4M2ZA 1FWLA 2Q2EB 2UUBI 1ZM9A 1UHZA 4UTGA 1PVGA 4DR5I 2LUPB 2UXBE 1NHJA 1RR9A 4MYTA 3OTOE 1N33E 1Z5BA 2UUCI 1KKHA 2J7KA 4LFBE 1GQEA 3ZM7A 4DV0E 4DU8A 3LPSA 2HKJA 1Z5CA 2HKEA 5A2QC 3WU6A 2R3VA 2DIXA 4DV6E 3ADIA 4DR7E 4JV5E 4JI1I 4NXMI 1XHKA 1HR0I 1H7UA 4HYMA 4X65I 1X47A 2B7TA 2V2VA 2E5LI 4DR6E 1MG7A 1IBMI 4LFAI 2HK3A 2KHXA 3LNUA 4YHHE 4JI4I 3B82A 2A2DA 4DV2E 4KHPE 4DV1E 2RS7A 2L3CA 2ZBKB 2UUBE 4DR5E 2UXCI 2HK2A 2L33A 4X8WA 3QT6A 4DR4I 4DV4I 2UUCE 1FWKA 1D6TA 4DKKA 2CZ9A 3J80C 1MX0A 4PU9A 5CFFE 1FKAE 4GKJI 4M30A 2N3HA 2BM0A 4NXME 1O0WA 4JI1E 4FN5A 2XEXA 1HR0E 3ZZ0A 4X65E 2V2QA 5FLXC 1ZM3A 2E5LE 4XTJA 4JI5I 1IBME 4LFAE 2LJPA 4JI4E 4WUBA 4R1FA 2B3TB 1STUA 2ZM6I 4JI8I 1N34I 4JYAI 3PYGA 3J80Q 2UXCE 4DV7I 4DUZI 1IBLI 1T4LB 2L2KB 4DR4E 4DV4E 1UEKA 2YT4A 1FJGI 1J26A 2UXDI 2GS8A 5FLXQ 4GKJE 3WU3A 2RS6A 5GMEA 3K17A 1EA6A 4PRXA 1WUUA 1DI2A 2VQFI 2LBSB 4X62I 3JAMC 2HFSA 1ZXMA 1N36I 4LFCI 2OI2A 1VISA 2EFGA 2V8PA 4I3HA 4JI5E
chains in the Genus database with same CATH superfamily
5C0XE 2BB8A 2ZM6E 2IOQA 1HNXI 4MU4A 4JI8E 2EJ4A 1N34E 2UUAI 2EN2A 2BV3A 4JYAE 2YTFA 5DROA 4O4KA 1LLMC 2YRHA 1USUA 3P06A 4O24A 1J5EI 5AE3A 4WPYA 2EPRA 3F6GA 1KVKA 2BA0G 4ZYHA 4LF4I 1Z0VA 2HHHI 2YTJA 4DV7E 4LF9I 1A1GA 4FWHA 2EPNA 4DUZE 2EMGA 5LLQA 3LLHA 1IBLE 3VYXA 5KL5A 1A6FA 4AIDA 3IWDA 2E1RA 3HULA 3HKMA 1FNMA 1FJGE 4R2AA 3JAMQ 1QZRA 3PYDA 4P7AA 1ZBQA 4WYQB 2LO3A 2UXDE 4ZVIA 4TUGA 2C38A 4R2CA 1Z0BA 4WSPA 2LE2A 2X7IA 1IBKI 2VQFE 2V2ZA 2MDRA 4L8NA 4X62E 4DUYI 2EORA 1N36E 4LFCE 3J7AG 1KTVA 3J7AM 4DR3I 4IJDA 1Z0TA 1OJ4A 2CGEA 2VESA 2FTXB 3GONA 1BKNA 1X48A 2VQEI 1RC7A 2B9DA 3J7Yp 1HNXE 4BBYA 1R6MA 2UUAE 5IV8B 3K1JA 2RTXA 2EMCA 3THOB 1YYWA 4X9JA 2EMAA 4KZSA 4NXNI 3HPZA 1J5EE 2IOPA 2PNMA 2PNLA 1GZ6A 1XMQI 2JVAA 2LV2A 3RMPA 3ADLA 1PJTA 4LF4E 2HHHE 3FIGA 2J7JA 4LTYA 4LF9E 2EM8A 4R2DA 1P42A 4F9BB 1JK2A 2DB2A 4JI3I 3ADGA 4FW3A 3P3CA 2LTRA 4R03A 5DRPA 2JYAA 3WU5A 2WW4A 2CTDA 1SR9A 3D4JA 1ZM4A 5K36A 4MDTA 3B8HA 4FWGA 1Y4SA 4ED4A 1H7SA 3QT5A 4HACB 4LF6I 1S4EA 4ZYEA 2KONA 3ZOQB 4DMIA 4HACA 5DNLA 5GMEA 3L00A 1YPNA 4WXCA 2EN8A 1IBKE 2NUFA 4FW5A 2NPFA 3P3GA 4AQYI 2YRMA 2Z5BB 4DUYE 2UU9I 4DR6I 2I13A 1YZ9A 4EMDA 4DR3E 4USMA 2Z5BA 3L7ZB 1N0VC 3PS1A 2DEIA 4HY1A 1T4NA 3C6KA 4HTGA 2O1TA 2EQ3A 2VQEE 1TF3A 2N3GA 4F9AB 2ELZA 2C39A 1YUIA 3NZKA 2F8BA 3VK6A 1F2IG 2EP3A 3H1CA 2EMXA 4NXNE 1MGTA 2ELYA 1ELOA 4USKA 5LMNI 2O1UA 5A6JA 1PIEA 2EMHA 1YSAC 1XMQE 4IS1C 4MU1A 3M99B 4LU9A 4AM3A 5AE2A 2Z5CA 5KL7A 1RQ0A 4K0KI 4BCAA 4JI3E 2V8QB 4R8OA 3ZZTA 4U3DA 1A1HA 3PS2A 2YSOA 3KWRA 1UDOA 4IS9A 2A2CA 3LTOA 4UT4A 1IBMI 1XNQI 2GHFA 2GPIA 1KJKA 1G2DC 1H73A 5AE1A 1SFEA 4LF6E 1PJSA 1WJPA 4OOGC 3K85A 4HEIA 3HJCA 1XNRI 1KYQA 1UILA 3JTZA 1DARA 4AQYE 2WBUA 5IT9C 4LF8I 2UU9E 2WCC3 1I94I 2NUEA 4JI2I 2WZOA 1ZU1A 1GTKA 3T1HI 1WHQA 2JE6B 2YTOA 5LL6R 1Z59A 4JI6I 2I9IA 4F9CB 2O3ZA 2EPMX 2JP9A 1HNWI 2LJUA 4GZNC 2E1MA 1UN6B 2EM5A 1WHNA 2Z5EA 3V5RA 4OX9I 2EPAA 2EMKA 4FWDA 2DMIA 1ZAAC 4MQYA 3EQ1A 4MLQA 5LMNE 5DNXA 1RHYA 1PJQA 3ZKDA 1UDQA 4M9VC 2F4VI 1A1KA 3J81C 3OMLA 1MEYC 2NUGA 4DR1I 3Q6MA 3Q6NA 2EM7A 4X66I 4R2SA 4MU3A 3THNA 2MDGA 4WX9A 3GCMA 4K0KE 2EN7A 5KL6A 3EPJA 2EOOA 2EMBA 4U3BA 1Z0WA 4DV3I 5A6KA 4JI0I 1NHIA 4ZYGA 4FW9A 4DPXA 2JY9A 2WNRA 5IT9Q 1YH8A 1XNQE 4X64I 1ZBTA 3GMEA 1N32I 4DR2I 1H74A 2K7IA 1XNRE 1ZXNA 5A6BD 5K36F 2C38B 3DJWA 4Q35B 2M4IA 4P78A 4LF8E 5A6BA 4HXZA 4Z7CA 1I94E 4JI2E 4DPUA 2EOEA 2EN4A 2ODRC 1EKZA 2CSHA 1FI4A 4KQVA 2ODRD 3T1HE 2B7VA 1YYOA 4LCHA 1RMDA 1NZ0A 4GEQB 2L3JA 2YZTA 4JI6E 2HGHA 3J81Q 4LPFA 1HNWE 2DGCA 2L6MA 2EOQA 4OX9E 2YTQA 2JWOA 2BA1D 4LF5I 2WP8B 4MLVA 4TUIA 5K36E 1DQ3A 3Q1QA 2O1WA 2F4VE 1UDNA 2O1VA 2WP8A 2V85A 2EPOA 3T1YI 4DR1E 2K4VA 4R2RA 1L4SA 1XMOI 4B3MI 4X66E 1DGCA 4LF7I 1OYSA 2LRSA 1RREA 4OO1A 1NEIA 2E72A 1T4OA 1X5WA 1B69A 2JEAA 5A6AA 4DV3E 1H72C 2DEJA 2RQLA 4JI0E 2ZITA 4FW7A 5K36C 3BIDA 5AASA 1A1IA 5K36D 1K47A 3CWVA 5K36B 4X64E 1N32E 4DR2E 2F1DA 3HXLA 4F6NA 3P1XA 3M7ND 5KL2A 2KOUA 3C4TA 1T38A 2JEBB 2JR1A 2PNZA 4JI7I 2ENCA 4BHBA 1NHHA 3C4BA 2JEBA 4GKKI 2HJJA 3KZYA 4FK5C 4BA2B 5BR8I 1BB8A 1QU6A 4P52A 4WUCA 4B3TI 2YTIA 2YWQA 5GMDA 4DPYA 5JEAF 4BA2A 1YYKA 2GQ0A 4GQUA 1IQOA 4B3SI 3PS3A 3F0NA 3UHMA 4BMJA 2L2NA 4URLA 1TF6A 1HNZI 4I8OA 2C39B 2V83A 4LF5E 4AIMA 2WBSA 2YU8A 1Y5YA 1PKPA 1N0UA 2GO4A 5A2QQ 3T1YE 2JXPA 3AUZA 4LCFA 1XMOE 4B3ME 2MKDA 4KWYA 2JPAA 4LF7E 3ZKBA 1U2RA 4FW6A 4B3RI 2Z5CB 3JU0A 3MHSC 4DPWA 2AJ4A 5JEAE 4LOMA 2M9AA 4DXLA 5KL4A 2EM9A 2RPCA 2EOSA 1B63A 3H09A 2VF3A 1MU5A 1Y6ZA 4MU0A 4MYUA 3ADJA 2EMFA 2RSIA 4F2JC 2R1FA 4YY3I 3WU4A 2CT1A 5LMUI 2BR2A 2LCEA 2DLKA 1PDAA 1KIJA 2NN6A 1EH6A 2NABA 4NHRA 1Z0CA 4JI7E 1OYRA 5JEAC 4DV5I 3M85D 2RSMA 3IWBA 4RHBB 1EH7A 5JEAD 2PO2A 3C6MA 4GKKE 5EL9A 5JEAB 2PO1B 1B62A 3V2UC 5BR8E 1EH8A 2N8XA 5EKWA 1X3CA 2V34A 5JEAA 2EOXA 4B3TE 4M1KA 5L3JA 5IWAI 2DMYA 3MHHC 2EZ6A 2EOFA 3VYYA 3PYEA 4B3SE 4QNJA 2FV4B 3HTXA 2MC6A 1HNZE 1VI7A 3M6AA 3B78A 1YUJA 2V87A 5DNYA 4WSGA 2EOIA 2UXBI 5TSEA 3TQMA 1USVA 1Z0GA 3OTOI 1N33I 4IFDF 2LJHA 2LTSA 1S16A 2DLQA 4LFBI 4B3RE 2DRPA 4BC9A 4BHCA 2IERA 2LVHA 4P7DA 4OZEA 5C0XF 4DV0I 1BBOA 1Z5AA 2CPNA 2BM1A 4WFTA 4DPTA 2V89A 2VRDA 2V86A 3ZZUA 2R42A 2YTEA 4OO1F 3B4TA 2YTPA 1ZM2A 4IZJD 3QT7A 4PRVA 2WNRB 4J8ZA 4DV6I 1X49A 2C37A 4DR7I 4JV5I 4IZJA 4JG4A 2EM2A 5AC4A 4R2PA 2LUQA 2EN6A 5LMUE 4YY3E 2EQ0A 2ENAA 1EI1A 2PO0B 4BA1A 3PYFA 2EMYA 2LMZA 4DV5E 1Z0EA 2BA1G 2PO0A 1ZR9A 2L2MA 1T39A 2EE8A 2X36A 4RPFA 4DU7A 4YHHI 2CVEA 3MSWA 2IHR1 2NA2A 1TN9A 3ECRA 4DV2I 2L8TA 4WUDA 4KHPI 5IWAE 2WBTA 4M0VA 3EPHA 5ADZA 2EMZA 2HFUA 2HC5A 3H4LA 4Z7YA 4DV1I 2EOMA 4M2ZA 1FWLA 2Q2EB 2PO1A 3CDIA 2UUBI 2GLIA 2GO3A 1ZM9A 1UHZA 4RH8A 1PVGA 4UTGA 4IFDC 4DR5I 2LUPB 4IFDD 2YSPA 4WXDA 5KL3A 4IFDB 2UXBE 1NHJA 2EN3A 5C0XC 2EOZA 2EMLA 2YTGA 1RR9A 4IFDA 5C0XD 3PRYA 4MYTA 1OYPA 3OTOE 5C0XB 1N33E 2JOBA 1Z5BA 2UUCI 2V88A 1KKHA 2J7KA 4LFBE 1GQEA 5C0XA 4OO1C 3BBGA 3ZM7A 2EPZA 4DV0E 1E3HA 4OO1D 4OO1B 2ADRA 4DU8A 2YTNA 2BA0D 3M7NG 1WXRA 3LPSA 4N4RB 2HKJA 1Z5CA 2AE8A 2HKEA 4R2EA 2EL5A 2JEAB 5A2QC 3WU6A 3HQ1A 5A69A 2R3VA 2DIXA 4DV6E 1N3GA 5ELWA 3ADIA 4DR7E 4JV5E 4JI1I 4IZKB 4NXMI 1XHKA 1HR0I 1XXEA 1H7UA 4HYMA 2M7QA 4X65I 4IZKA 1X47A 2B7TA 4O43A 2V2VA 4OKGA 2YU5A 3BF2A 2EPUA 2E5LI 3CDJA 4DR6E 1MG7A 4FW4A 1A1LA 2HK3A 2EOHA 2ENHA 1QNTA 2KHXA 4YHHE 3LNUA 2PNZB 3B82A 3U1KA 3BGHA 5FWKA 2A2DA 4JI4I 4DV2E 3IWCA 2NN6F 4KHPE 2EPKX 4DV1E 1YHCA 1X6HA 4OO1E 4Q28A 2RS7A 2YPNA 3EPKA 1X6EA 2EOYA 2LT7A 2L3CA 2ZBKB 1G2FC 2UUBE 2EPXA 3DD6A 2R76A 1X6FA 4DR5E 1Y4UA 2HK2A 2UXCI 3F6HA 2L33A 2H36X 2L92A 1IMUA 4LCGA 4X8WA 3P3EA 3QT6A 4DR4I 3HPSA 2UUCE 4DV4I 2FGGA 1HK7A 2EL6A 4ISAA 1FWKA 2NN6E 4DKKA 2CZ9A 5DRQA 1D6TA 3KZZA 3J80C 2EQ1A 1MX0A 3K6QA 1P47A 4PU9A 5F3WA 4F54A 5CFFE 4NBQA 2IESA 2A25A 4J3DA 1FKAE 3M85G 4GKJI 4M30A 2DSYA 4F6MA 2N3HA 2MKNA 2BM0A 3DF6A 1O0WA 2MC5A 4JI1E 4NXME 4FN5A 2JOXA 4O5GA 1HR0E 2XEXA 3QT8A 3ZZ0A 2CG9A 2EM0A 3L7ZA 4ZYDA 4X65E 2EM6A 2JT2A 2V2QA 2NN6C 1UDSA 5FLXC 2BR2B 1ZM3A 1E3PA 2NN6D 2NN6B 2E5LE 4BC7A 4XTJA 4QNKA 1IBME 4LFAE 4JI5I 2LJPA 1NCSA 2VE7C 1UBDC 4JI4E 4WUBA 3KRNA 2EWLA 4R1FA 2B3TB 2PO2B 1STUA 2EL4A 2Q8UA 3QG5C 2ZM6I 2EPCA 4JI8I 1N34I 3UK3C 4JYAI 2YTDA 4LFAI 1WRJA 3VHTB 3EPLA 1JK1A 1IQSA 3PYGA 1AAYA 3J80Q 1Z1BA 1AH5A 2UXCE 2EMIA 2EPLX 2EOJA 4DV7I 3P76A 3AV0A 4DUZI 1IBLI 1T4LB 2L2KB 4DR4E 4DV4E 4N3OA 2G7HA 1UEKA 1BBGA 2YT4A 3U1YA 2EMWA 4L5NC 1FJGI 2VF1A 5DRRA 2YRKA 2J65A 1J26A 2UXDI 2GS8A 5FLXQ 4GKJE 3WU3A 1A1JA 2RS6A 2EPPA 5T6JA 5IXMB 1YFHA 4NZVA 1EA6A 3GLLA 1WUUA 3K17A 4BS9A 1A1FA 1DI2A 4PRXA 2VQFI 5AC5A 2LBSB 4X62I 2C37B 3JAMC 1R6LA 2HFSA 4IZJB 3LMLA 1ZXMA 4LFCI 1N36I 2D9HA 2JE6A 2OI2A 1VISA 2EFGA 2V8PA 4R2QA 2EM3A 2EM4A 4I3HA 4JI5E 4BA1B 4IFDE 2EN1A 2BBGA 2PRTA 1Y60A 2M1SA
chains in the Genus database with same CATH topology
2ZM6E 2IOQA 1HNXI 4JI8E 1N34E 2UUAI 2BV3A 4JYAE 3P06A 1USUA 1J5EI 5AE3A 4WPYA 3F6GA 1KVKA 4LF4I 1Z0VA 2HHHI 4DV7E 4LF9I 4FWHA 4DUZE 1IBLE 1A6FA 3LLHA 3VYXA 3IWDA 2E1RA 3HULA 1FNMA 1FJGE 3JAMQ 1QZRA 3PYDA 4P7AA 1ZBQA 4WYQB 2UXDE 4ZVIA 4TUGA 1Z0BA 4WSPA 2LE2A 2X7IA 1IBKI 2VQFE 2V2ZA 2MDRA 4L8NA 4X62E 4DUYI 1N36E 3J7AG 4LFCE 1KTVA 3J7AM 4DR3I 1Z0TA 1OJ4A 2CGEA 2FTXB 3GONA 1BKNA 1X48A 2VQEI 1RC7A 2B9DA 3J7Yp 1HNXE 4BBYA 2UUAE 3K1JA 2RTXA 1YYWA 4KZSA 4NXNI 3HPZA 1J5EE 2IOPA 2PNMA 2PNLA 1GZ6A 1XMQI 2JVAA 3RMPA 3ADLA 4LF4E 2HHHE 3FIGA 4LTYA 4LF9E 4F9BB 2DB2A 4JI3I 3ADGA 2LTRA 4R03A 3WU5A 2WW4A 1SR9A 3D4JA 1ZM4A 3B8HA 4FWGA 1Y4SA 4ED4A 1H7SA 3QT5A 4HACB 4LF6I 1S4EA 2KONA 3ZOQB 4DMIA 4HACA 1IBKE 2NUFA 2NPFA 4AQYI 2Z5BB 4DUYE 2UU9I 1YZ9A 4EMDA 4DR3E 4USMA 2Z5BA 1N0VC 2DEIA 4HY1A 1T4NA 2O1TA 2VQEE 2N3GA 4F9AB 2F8BA 3VK6A 5LMNI 4NXNE 1ELOA 4USKA 2O1UA 1PIEA 1XMQE 4LU9A 5AE2A 2Z5CA 1RQ0A 4K0KI 4BCAA 4JI3E 2V8QB 4R8OA 3ZZTA 3KWRA 4UT4A 2A2CA 3LTOA 1XNQI 1H73A 3QT8A 5AE1A 3K85A 4LF6E 4OOGC 1XNRI 3HJCA 1UILA 3JTZA 1DARA 4AQYE 5IT9C 4LF8I 2UU9E 1I94I 2NUEA 4JI2I 2WZOA 3T1HI 1WHQA 5LL6R 1Z59A 4JI6I 4F9CB 1HNWI 2E1MA 2Z5EA 3V5RA 1WHNA 4OX9I 4FWDA 5LMNE 3ZKDA 2F4VI 3J81C 3OMLA 2NUGA 4DR1I 3Q6MA 3Q6NA 4X66I 4K0KE 1Z0WA 4DV3I 4JI0I 1NHIA 4DPXA 4FW9A 2JY9A 5IT9Q 1XNQE 4X64I 1ZBTA 1N32I 4DR2I 1H74A 1XNRE 1ZXNA 3DJWA 2M4IA 4P78A 4LF8E 4HXZA 4Z7CA 1I94E 4JI2E 4DPUA 2ODRC 1EKZA 4KQVA 1FI4A 2ODRD 3T1HE 2B7VA 1YYOA 1NZ0A 4GEQB 2L3JA 2YZTA 4JI6E 3J81Q 1HNWE 2L6MA 4OX9E 2JWOA 4LF5I 4TUIA 1DQ3A 3Q1QA 2O1WA 2F4VE 2O1VA 2V85A 3T1YI 4DR1E 2K4VA 1XMOI 4B3MI 4X66E 4LF7I 2LRSA 1RREA 1T4OA 4DV3E 1H72C 2DEJA 2ZITA 4JI0E 5AASA 1K47A 3CWVA 4X64E 1N32E 4DR2E 3HXLA 3P1XA 2KOUA 3C4TA 2JR1A 4JI7I 1NHHA 3C4BA 4GKKI 5BR8I 1QU6A 4P52A 4WUCA 4B3TI 5GMDA 4DPYA 1YYKA 2GQ0A 4B3SI 3F0NA 4BMJA 2L2NA 4URLA 1HNZI 4I8OA 2V83A 4LF5E 1PKPA 1N0UA 5A2QQ 3T1YE 3AUZA 1XMOE 4B3ME 4LF7E 3ZKBA 1U2RA 4B3RI 2Z5CB 3JU0A 4DPWA 2AJ4A 4DXLA 1B63A 3H09A 2VF3A 1MU5A 1Y6ZA 4MYUA 3ADJA 5LMUI 4YY3I 3WU4A 1KIJA 1Z0CA 4JI7E 4DV5I 2RSMA 3IWBA 4GKKE 1B62A 3V2UC 5BR8E 5IWAI 2V34A 4B3TE 4M1KA 5L3JA 2DMYA 2EZ6A 3VYYA 3PYEA 4B3SE 2FV4B 3HTXA 2MC6A 1HNZE 3M6AA 3B78A 2V87A 5DNYA 2UXBI 1USVA 1Z0GA 3OTOI 1N33I 2LJHA 2LTSA 1S16A 4LFBI 4B3RE 4BC9A 4P7DA 4DV0I 1Z5AA 2CPNA 2BM1A 4WFTA 4DPTA 2V89A 3ZZUA 2V86A 2R42A 1ZM2A 4IZJD 3QT7A 4PRVA 4J8ZA 4DV6I 1X49A 4JV5I 4DR7I 4IZJA 4JG4A 2LUQA 5LMUE 4YY3E 1EI1A 3PYFA 2LMZA 4DV5E 1Z0EA 4DU7A 4DR6I 2X36A 2L2MA 4RPFA 4YHHI 3MSWA 2IHR1 2NA2A 4DV2I 2L8TA 4WUDA 4KHPI 5IWAE 4M0VA 4Z7YA 5ADZA 2HFUA 3H4LA 4DV1I 4M2ZA 1FWLA 2Q2EB 2UUBI 1ZM9A 1UHZA 4UTGA 1PVGA 4DR5I 2LUPB 2UXBE 1NHJA 1RR9A 3PRYA 4MYTA 3OTOE 1N33E 2JOBA 1Z5BA 2UUCI 2V88A 1KKHA 2J7KA 4LFBE 1GQEA 3ZM7A 4DV0E 4DU8A 1WXRA 3LPSA 2HKJA 1Z5CA 2HKEA 5A2QC 3WU6A 3HQ1A 2R3VA 2DIXA 4DV6E 3ADIA 4DR7E 4JV5E 4JI1I 4IZKB 4NXMI 1XHKA 1HR0I 1H7UA 4HYMA 2M7QA 4X65I 4IZKA 1X47A 2B7TA 2V2VA 2E5LI 4DR6E 1MG7A 1IBMI 4LFAI 2HK3A 2KHXA 3LNUA 4YHHE 5FWKA 4JI4I 3B82A 2A2DA 4DV2E 3IWCA 4KHPE 4DV1E 4Q28A 2RS7A 2L3CA 2ZBKB 2UUBE 4DR5E 1Y4UA 2HK2A 2UXCI 2L33A 2H36X 2L92A 3F6HA 4X8WA 3QT6A 4DR4I 3HPSA 2UUCE 4DV4I 2FGGA 1HK7A 1FWKA 1D6TA 4DKKA 2CZ9A 3J80C 1MX0A 3K6QA 4PU9A 5F3WA 4F54A 5CFFE 1FKAE 4GKJI 4M30A 2DSYA 2N3HA 2BM0A 3DF6A 1O0WA 2MC5A 4JI1E 4NXME 4FN5A 2JOXA 2XEXA 1HR0E 3ZZ0A 2CG9A 4X65E 2V2QA 5FLXC 1ZM3A 2E5LE 4BC7A 4XTJA 4JI5I 1IBME 4LFAE 2LJPA 2VE7C 4JI4E 4WUBA 2EWLA 4R1FA 2B3TB 1STUA 2ZM6I 4JI8I 1N34I 4JYAI 3PYGA 3J80Q 2UXCE 4DV7I 3AV0A 4DUZI 1IBLI 1T4LB 2L2KB 4DR4E 4DV4E 4N3OA 2G7HA 1UEKA 2YT4A 4L5NC 1FJGI 2VF1A 1J26A 2UXDI 2GS8A 5FLXQ 4GKJE 3WU3A 2RS6A 5GMEA 5T6JA 1EA6A 3K17A 4PRXA 1WUUA 4BS9A 1DI2A 2VQFI 2LBSB 4X62I 3JAMC 2HFSA 4IZJB 3LMLA 1ZXMA 4LFCI 1N36I 2OI2A 1VISA 2EFGA 2V8PA 4I3HA 4JI5E 2M1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 E;  1HNX I;  4JI8 E;  1N34 E;  2UUA I;  2BV3 A;  4JYA E;  1J5E I;  1KVK A;  4LF4 I;  1Z0V A;  2HHH I;  4DV7 E;  4LF9 I;  4FWH A;  4DUZ E;  1IBL E;  1A6F A;  3LLH A;  3VYX A;  2E1R A;  3HUL A;  1FNM A;  1FJG E;  3JAM Q;  1QZR A;  3PYD A;  4P7A A;  4WYQ B;  2UXD E;  4ZVI A;  1Z0B A;  2X7I A;  1IBK I;  2VQF E;  2V2Z A;  2MDR A;  4X62 E;  4DUY I;  1N36 E;  1KTV A;  4LFC E;  3J7A M;  3J7A G;  4DR3 I;  1Z0T A;  1OJ4 A;  3GON A;  1BKN A;  1X48 A;  2VQE I;  1RC7 A;  3J7Y p;  1HNX E;  2UUA E;  3K1J A;  2RTX A;  1YYW A;  4NXN I;  1J5E E;  1XMQ I;  2JVA A;  3ADL A;  4LF4 E;  2HHH E;  4LF9 E;  2DB2 A;  4JI3 I;  3ADG A;  2LTR A;  3WU5 A;  2WW4 A;  3D4J A;  1ZM4 A;  3B8H A;  4FWG A;  4ED4 A;  1H7S A;  3QT5 A;  4HAC B;  4LF6 I;  1S4E A;  4HAC A;  1IBK E;  2NUF A;  2NPF A;  4AQY I;  4DUY E;  2UU9 I;  1YZ9 A;  4EMD A;  4DR3 E;  4USM A;  1N0V C;  2DEI A;  4HY1 A;  1T4N A;  2VQE E;  2N3G A;  5LMN I;  4NXN E;  1ELO A;  4USK A;  1PIE A;  1XMQ E;  1RQ0 A;  4K0K I;  4JI3 E;  3ZZT A;  4UT4 A;  2A2C A;  3LTO A;  1XNQ I;  1H73 A;  3QT8 A;  4LF6 E;  4OOG C;  1XNR I;  1UIL A;  1DAR A;  4AQY E;  5IT9 C;  4LF8 I;  2UU9 E;  1I94 I;  2NUE A;  4JI2 I;  3T1H I;  1WHQ A;  5LL6 R;  1Z59 A;  4JI6 I;  1HNW I;  3V5R A;  1WHN A;  4OX9 I;  4FWD A;  5LMN E;  3ZKD A;  2F4V I;  3J81 C;  2NUG A;  4DR1 I;  4X66 I;  4K0K E;  1Z0W A;  4DV3 I;  4JI0 I;  1NHI A;  4DPX A;  4FW9 A;  2JY9 A;  5IT9 Q;  1XNQ E;  4X64 I;  1ZBT A;  1N32 I;  4DR2 I;  1H74 A;  1XNR E;  1ZXN A;  4LF8 E;  4HXZ A;  4Z7C A;  1I94 E;  4JI2 E;  4DPU A;  1EKZ A;  4KQV A;  1FI4 A;  3T1H E;  2B7V A;  1YYO A;  1NZ0 A;  2L3J A;  4JI6 E;  3J81 Q;  1HNW E;  4OX9 E;  4LF5 I;  3Q1Q A;  2F4V E;  3T1Y I;  4DR1 E;  1XMO I;  4B3M I;  4X66 E;  4LF7 I;  2LRS A;  1RRE A;  1T4O A;  4DV3 E;  1H72 C;  2DEJ A;  2ZIT A;  4JI0 E;  1K47 A;  3CWV A;  4X64 E;  1N32 E;  4DR2 E;  3P1X A;  3C4T A;  4JI7 I;  1NHH A;  3C4B A;  4GKK I;  5BR8 I;  1QU6 A;  4P52 A;  4WUC A;  4B3T I;  5GMD A;  4DPY A;  1YYK A;  4B3S I;  3F0N A;  4URL A;  2L2N A;  1HNZ I;  4LF5 E;  1PKP A;  1N0U A;  5A2Q Q;  3T1Y E;  1XMO E;  4B3M E;  4LF7 E;  3ZKB A;  1U2R A;  4B3R I;  4DPW A;  2AJ4 A;  4DXL A;  1B63 A;  2VF3 A;  1MU5 A;  4MYU A;  3ADJ A;  5LMU I;  4YY3 I;  3WU4 A;  1KIJ A;  1Z0C A;  4JI7 E;  4DV5 I;  2RSM A;  4GKK E;  1B62 A;  3V2U C;  5BR8 E;  5IWA I;  2V34 A;  4B3T E;  4M1K A;  5L3J A;  2DMY A;  2EZ6 A;  3VYY A;  3PYE A;  4B3S E;  3HTX A;  1HNZ E;  3M6A A;  3B78 A;  2UXB I;  1Z0G A;  3OTO I;  1N33 I;  2LJH A;  2LTS A;  1S16 A;  4LFB I;  4B3R E;  4DV0 I;  1Z5A A;  2CPN A;  2BM1 A;  4WFT A;  4DPT A;  3ZZU A;  2R42 A;  1ZM2 A;  4PRV A;  3QT7 A;  4DV6 I;  1X49 A;  4JV5 I;  4DR7 I;  4JG4 A;  2LUQ A;  5LMU E;  4YY3 E;  1EI1 A;  3PYF A;  4DV5 E;  1Z0E A;  4DR6 I;  4DU7 A;  2X36 A;  2L2M A;  4RPF A;  4YHH I;  2IHR 1;  2NA2 A;  4DV2 I;  4WUD A;  4KHP I;  5IWA E;  4Z7Y A;  3H4L A;  2HFU A;  4DV1 I;  4M2Z A;  1FWL A;  2Q2E B;  2UUB I;  1ZM9 A;  1UHZ A;  4UTG A;  1PVG A;  4DR5 I;  2LUP B;  2UXB E;  1NHJ A;  1RR9 A;  4MYT A;  3OTO E;  1N33 E;  1Z5B A;  2UUC I;  1KKH A;  2J7K A;  4LFB E;  1GQE A;  3ZM7 A;  4DV0 E;  4DU8 A;  3LPS A;  2HKJ A;  1Z5C A;  2HKE A;  5A2Q C;  3WU6 A;  2R3V A;  2DIX A;  4DV6 E;  3ADI A;  4DR7 E;  4JV5 E;  4JI1 I;  4NXM I;  1XHK A;  1HR0 I;  1H7U A;  4HYM A;  4X65 I;  1X47 A;  2B7T A;  2V2V A;  2E5L I;  4DR6 E;  1MG7 A;  1IBM I;  4LFA I;  2HK3 A;  2KHX A;  3LNU A;  4YHH E;  4JI4 I;  3B82 A;  2A2D A;  4DV2 E;  4KHP E;  4DV1 E;  2RS7 A;  2L3C A;  2ZBK B;  2UUB E;  4DR5 E;  2UXC I;  2HK2 A;  2L33 A;  4X8W A;  3QT6 A;  4DR4 I;  4DV4 I;  2UUC E;  1FWK A;  1D6T A;  4DKK A;  2CZ9 A;  3J80 C;  1MX0 A;  4PU9 A;  5CFF E;  1FKA E;  4GKJ I;  4M30 A;  2N3H A;  2BM0 A;  4NXM E;  1O0W A;  4JI1 E;  4FN5 A;  2XEX A;  1HR0 E;  3ZZ0 A;  4X65 E;  2V2Q A;  5FLX C;  1ZM3 A;  2E5L E;  4XTJ A;  4JI5 I;  1IBM E;  4LFA E;  2LJP A;  4JI4 E;  4WUB A;  4R1F A;  2B3T B;  1STU A;  2ZM6 I;  4JI8 I;  1N34 I;  4JYA I;  3PYG A;  3J80 Q;  2UXC E;  4DV7 I;  4DUZ I;  1IBL I;  1T4L B;  2L2K B;  4DR4 E;  4DV4 E;  1UEK A;  2YT4 A;  1FJG I;  1J26 A;  2UXD I;  2GS8 A;  5FLX Q;  4GKJ E;  3WU3 A;  2RS6 A;  5GME A;  3K17 A;  1EA6 A;  4PRX A;  1WUU A;  1DI2 A;  2VQF I;  2LBS B;  4X62 I;  3JAM C;  2HFS A;  1ZXM A;  1N36 I;  4LFC I;  2OI2 A;  1VIS A;  2EFG A;  2V8P A;  4I3H A;  4JI5 E; 
#chains in the Genus database with same CATH topology
 5C0X E;  2BB8 A;  2ZM6 E;  2IOQ A;  1HNX I;  4MU4 A;  4JI8 E;  2EJ4 A;  1N34 E;  2UUA I;  2EN2 A;  2BV3 A;  4JYA E;  2YTF A;  5DRO A;  4O4K A;  1LLM C;  2YRH A;  1USU A;  3P06 A;  4O24 A;  1J5E I;  5AE3 A;  4WPY A;  2EPR A;  3F6G A;  1KVK A;  2BA0 G;  4ZYH A;  4LF4 I;  1Z0V A;  2HHH I;  2YTJ A;  4DV7 E;  4LF9 I;  1A1G A;  4FWH A;  2EPN A;  4DUZ E;  2EMG A;  5LLQ A;  3LLH A;  1IBL E;  3VYX A;  5KL5 A;  1A6F A;  4AID A;  3IWD A;  2E1R A;  3HUL A;  3HKM A;  1FNM A;  1FJG E;  4R2A A;  3JAM Q;  1QZR A;  3PYD A;  4P7A A;  1ZBQ A;  4WYQ B;  2LO3 A;  2UXD E;  4ZVI A;  4TUG A;  2C38 A;  4R2C A;  1Z0B A;  4WSP A;  2LE2 A;  2X7I A;  1IBK I;  2VQF E;  2V2Z A;  2MDR A;  4L8N A;  4X62 E;  4DUY I;  2EOR A;  1N36 E;  4LFC E;  3J7A G;  1KTV A;  3J7A M;  4DR3 I;  4IJD A;  1Z0T A;  1OJ4 A;  2CGE A;  2VES A;  2FTX B;  3GON A;  1BKN A;  1X48 A;  2VQE I;  1RC7 A;  2B9D A;  3J7Y p;  1HNX E;  4BBY A;  1R6M A;  2UUA E;  5IV8 B;  3K1J A;  2RTX A;  2EMC A;  3THO B;  1YYW A;  4X9J A;  2EMA A;  4KZS A;  4NXN I;  3HPZ A;  1J5E E;  2IOP A;  2PNM A;  2PNL A;  1GZ6 A;  1XMQ I;  2JVA A;  2LV2 A;  3RMP A;  3ADL A;  1PJT A;  4LF4 E;  2HHH E;  3FIG A;  2J7J A;  4LTY A;  4LF9 E;  2EM8 A;  4R2D A;  1P42 A;  4F9B B;  1JK2 A;  2DB2 A;  4JI3 I;  3ADG A;  4FW3 A;  3P3C A;  2LTR A;  4R03 A;  5DRP A;  2JYA A;  3WU5 A;  2WW4 A;  2CTD A;  1SR9 A;  3D4J A;  1ZM4 A;  5K36 A;  4MDT A;  3B8H A;  4FWG A;  1Y4S A;  4ED4 A;  1H7S A;  3QT5 A;  4HAC B;  4LF6 I;  1S4E A;  4ZYE A;  2KON A;  3ZOQ B;  4DMI A;  4HAC A;  5DNL A;  5GME A;  3L00 A;  1YPN A;  4WXC A;  2EN8 A;  1IBK E;  2NUF A;  4FW5 A;  2NPF A;  3P3G A;  4AQY I;  2YRM A;  2Z5B B;  4DUY E;  2UU9 I;  4DR6 I;  2I13 A;  1YZ9 A;  4EMD A;  4DR3 E;  4USM A;  2Z5B A;  3L7Z B;  1N0V C;  3PS1 A;  2DEI A;  4HY1 A;  1T4N A;  3C6K A;  4HTG A;  2O1T A;  2EQ3 A;  2VQE E;  1TF3 A;  2N3G A;  4F9A B;  2ELZ A;  2C39 A;  1YUI A;  3NZK A;  2F8B A;  3VK6 A;  1F2I G;  2EP3 A;  3H1C A;  2EMX A;  4NXN E;  1MGT A;  2ELY A;  1ELO A;  4USK A;  5LMN I;  2O1U A;  5A6J A;  1PIE A;  2EMH A;  1YSA C;  1XMQ E;  4IS1 C;  4MU1 A;  3M99 B;  4LU9 A;  4AM3 A;  5AE2 A;  2Z5C A;  5KL7 A;  1RQ0 A;  4K0K I;  4BCA A;  4JI3 E;  2V8Q B;  4R8O A;  3ZZT A;  4U3D A;  1A1H A;  3PS2 A;  2YSO A;  3KWR A;  1UDO A;  4IS9 A;  2A2C A;  3LTO A;  4UT4 A;  1IBM I;  1XNQ I;  2GHF A;  2GPI A;  1KJK A;  1G2D C;  1H73 A;  5AE1 A;  1SFE A;  4LF6 E;  1PJS A;  1WJP A;  4OOG C;  3K85 A;  4HEI A;  3HJC A;  1XNR I;  1KYQ A;  1UIL A;  3JTZ A;  1DAR A;  4AQY E;  2WBU A;  5IT9 C;  4LF8 I;  2UU9 E;  2WCC 3;  1I94 I;  2NUE A;  4JI2 I;  2WZO A;  1ZU1 A;  1GTK A;  3T1H I;  1WHQ A;  2JE6 B;  2YTO A;  5LL6 R;  1Z59 A;  4JI6 I;  2I9I A;  4F9C B;  2O3Z A;  2EPM X;  2JP9 A;  1HNW I;  2LJU A;  4GZN C;  2E1M A;  1UN6 B;  2EM5 A;  1WHN A;  2Z5E A;  3V5R A;  4OX9 I;  2EPA A;  2EMK A;  4FWD A;  2DMI A;  1ZAA C;  4MQY A;  3EQ1 A;  4MLQ A;  5LMN E;  5DNX A;  1RHY A;  1PJQ A;  3ZKD A;  1UDQ A;  4M9V C;  2F4V I;  1A1K A;  3J81 C;  3OML A;  1MEY C;  2NUG A;  4DR1 I;  3Q6M A;  3Q6N A;  2EM7 A;  4X66 I;  4R2S A;  4MU3 A;  3THN A;  2MDG A;  4WX9 A;  3GCM A;  4K0K E;  2EN7 A;  5KL6 A;  3EPJ A;  2EOO A;  2EMB A;  4U3B A;  1Z0W A;  4DV3 I;  5A6K A;  4JI0 I;  1NHI A;  4ZYG A;  4FW9 A;  4DPX A;  2JY9 A;  2WNR A;  5IT9 Q;  1YH8 A;  1XNQ E;  4X64 I;  1ZBT A;  3GME A;  1N32 I;  4DR2 I;  1H74 A;  2K7I A;  1XNR E;  1ZXN A;  5A6B D;  5K36 F;  2C38 B;  3DJW A;  4Q35 B;  2M4I A;  4P78 A;  4LF8 E;  5A6B A;  4HXZ A;  4Z7C A;  1I94 E;  4JI2 E;  4DPU A;  2EOE A;  2EN4 A;  2ODR C;  1EKZ A;  2CSH A;  1FI4 A;  4KQV A;  2ODR D;  3T1H E;  2B7V A;  1YYO A;  4LCH A;  1RMD A;  1NZ0 A;  4GEQ B;  2L3J A;  2YZT A;  4JI6 E;  2HGH A;  3J81 Q;  4LPF A;  1HNW E;  2DGC A;  2L6M A;  2EOQ A;  4OX9 E;  2YTQ A;  2JWO A;  2BA1 D;  4LF5 I;  2WP8 B;  4MLV A;  4TUI A;  5K36 E;  1DQ3 A;  3Q1Q A;  2O1W A;  2F4V E;  1UDN A;  2O1V A;  2WP8 A;  2V85 A;  2EPO A;  3T1Y I;  4DR1 E;  2K4V A;  4R2R A;  1L4S A;  1XMO I;  4B3M I;  4X66 E;  1DGC A;  4LF7 I;  1OYS A;  2LRS A;  1RRE A;  4OO1 A;  1NEI A;  2E72 A;  1T4O A;  1X5W A;  1B69 A;  2JEA A;  5A6A A;  4DV3 E;  1H72 C;  2DEJ A;  2RQL A;  4JI0 E;  2ZIT A;  4FW7 A;  5K36 C;  3BID A;  5AAS A;  1A1I A;  5K36 D;  1K47 A;  3CWV A;  5K36 B;  4X64 E;  1N32 E;  4DR2 E;  2F1D A;  3HXL A;  4F6N A;  3P1X A;  3M7N D;  5KL2 A;  2KOU A;  3C4T A;  1T38 A;  2JEB B;  2JR1 A;  2PNZ A;  4JI7 I;  2ENC A;  4BHB A;  1NHH A;  3C4B A;  2JEB A;  4GKK I;  2HJJ A;  3KZY A;  4FK5 C;  4BA2 B;  5BR8 I;  1BB8 A;  1QU6 A;  4P52 A;  4WUC A;  4B3T I;  2YTI A;  2YWQ A;  5GMD A;  4DPY A;  5JEA F;  4BA2 A;  1YYK A;  2GQ0 A;  4GQU A;  1IQO A;  4B3S I;  3PS3 A;  3F0N A;  3UHM A;  4BMJ A;  2L2N A;  4URL A;  1TF6 A;  1HNZ I;  4I8O A;  2C39 B;  2V83 A;  4LF5 E;  4AIM A;  2WBS A;  2YU8 A;  1Y5Y A;  1PKP A;  1N0U A;  2GO4 A;  5A2Q Q;  3T1Y E;  2JXP A;  3AUZ A;  4LCF A;  1XMO E;  4B3M E;  2MKD A;  4KWY A;  2JPA A;  4LF7 E;  3ZKB A;  1U2R A;  4FW6 A;  4B3R I;  2Z5C B;  3JU0 A;  3MHS C;  4DPW A;  2AJ4 A;  5JEA E;  4LOM A;  2M9A A;  4DXL A;  5KL4 A;  2EM9 A;  2RPC A;  2EOS A;  1B63 A;  3H09 A;  2VF3 A;  1MU5 A;  1Y6Z A;  4MU0 A;  4MYU A;  3ADJ A;  2EMF A;  2RSI A;  4F2J C;  2R1F A;  4YY3 I;  3WU4 A;  2CT1 A;  5LMU I;  2BR2 A;  2LCE A;  2DLK A;  1PDA A;  1KIJ A;  2NN6 A;  1EH6 A;  2NAB A;  4NHR A;  1Z0C A;  4JI7 E;  1OYR A;  5JEA C;  4DV5 I;  3M85 D;  2RSM A;  3IWB A;  4RHB B;  1EH7 A;  5JEA D;  2PO2 A;  3C6M A;  4GKK E;  5EL9 A;  5JEA B;  2PO1 B;  1B62 A;  3V2U C;  5BR8 E;  1EH8 A;  2N8X A;  5EKW A;  1X3C A;  2V34 A;  5JEA A;  2EOX A;  4B3T E;  4M1K A;  5L3J A;  5IWA I;  2DMY A;  3MHH C;  2EZ6 A;  2EOF A;  3VYY A;  3PYE A;  4B3S E;  4QNJ A;  2FV4 B;  3HTX A;  2MC6 A;  1HNZ E;  1VI7 A;  3M6A A;  3B78 A;  1YUJ A;  2V87 A;  5DNY A;  4WSG A;  2EOI A;  2UXB I;  5TSE A;  3TQM A;  1USV A;  1Z0G A;  3OTO I;  1N33 I;  4IFD F;  2LJH A;  2LTS A;  1S16 A;  2DLQ A;  4LFB I;  4B3R E;  2DRP A;  4BC9 A;  4BHC A;  2IER A;  2LVH A;  4P7D A;  4OZE A;  5C0X F;  4DV0 I;  1BBO A;  1Z5A A;  2CPN A;  2BM1 A;  4WFT A;  4DPT A;  2V89 A;  2VRD A;  2V86 A;  3ZZU A;  2R42 A;  2YTE A;  4OO1 F;  3B4T A;  2YTP A;  1ZM2 A;  4IZJ D;  3QT7 A;  4PRV A;  2WNR B;  4J8Z A;  4DV6 I;  1X49 A;  2C37 A;  4DR7 I;  4JV5 I;  4IZJ A;  4JG4 A;  2EM2 A;  5AC4 A;  4R2P A;  2LUQ A;  2EN6 A;  5LMU E;  4YY3 E;  2EQ0 A;  2ENA A;  1EI1 A;  2PO0 B;  4BA1 A;  3PYF A;  2EMY A;  2LMZ A;  4DV5 E;  1Z0E A;  2BA1 G;  2PO0 A;  1ZR9 A;  2L2M A;  1T39 A;  2EE8 A;  2X36 A;  4RPF A;  4DU7 A;  4YHH I;  2CVE A;  3MSW A;  2IHR 1;  2NA2 A;  1TN9 A;  3ECR A;  4DV2 I;  2L8T A;  4WUD A;  4KHP I;  5IWA E;  2WBT A;  4M0V A;  3EPH A;  5ADZ A;  2EMZ A;  2HFU A;  2HC5 A;  3H4L A;  4Z7Y A;  4DV1 I;  2EOM A;  4M2Z A;  1FWL A;  2Q2E B;  2PO1 A;  3CDI A;  2UUB I;  2GLI A;  2GO3 A;  1ZM9 A;  1UHZ A;  4RH8 A;  1PVG A;  4UTG A;  4IFD C;  4DR5 I;  2LUP B;  4IFD D;  2YSP A;  4WXD A;  5KL3 A;  4IFD B;  2UXB E;  1NHJ A;  2EN3 A;  5C0X C;  2EOZ A;  2EML A;  2YTG A;  1RR9 A;  4IFD A;  5C0X D;  3PRY A;  4MYT A;  1OYP A;  3OTO E;  5C0X B;  1N33 E;  2JOB A;  1Z5B A;  2UUC I;  2V88 A;  1KKH A;  2J7K A;  4LFB E;  1GQE A;  5C0X A;  4OO1 C;  3BBG A;  3ZM7 A;  2EPZ A;  4DV0 E;  1E3H A;  4OO1 D;  4OO1 B;  2ADR A;  4DU8 A;  2YTN A;  2BA0 D;  3M7N G;  1WXR A;  3LPS A;  4N4R B;  2HKJ A;  1Z5C A;  2AE8 A;  2HKE A;  4R2E A;  2EL5 A;  2JEA B;  5A2Q C;  3WU6 A;  3HQ1 A;  5A69 A;  2R3V A;  2DIX A;  4DV6 E;  1N3G A;  5ELW A;  3ADI A;  4DR7 E;  4JV5 E;  4JI1 I;  4IZK B;  4NXM I;  1XHK A;  1HR0 I;  1XXE A;  1H7U A;  4HYM A;  2M7Q A;  4X65 I;  4IZK A;  1X47 A;  2B7T A;  4O43 A;  2V2V A;  4OKG A;  2YU5 A;  3BF2 A;  2EPU A;  2E5L I;  3CDJ A;  4DR6 E;  1MG7 A;  4FW4 A;  1A1L A;  2HK3 A;  2EOH A;  2ENH A;  1QNT A;  2KHX A;  4YHH E;  3LNU A;  2PNZ B;  3B82 A;  3U1K A;  3BGH A;  5FWK A;  2A2D A;  4JI4 I;  4DV2 E;  3IWC A;  2NN6 F;  4KHP E;  2EPK X;  4DV1 E;  1YHC A;  1X6H A;  4OO1 E;  4Q28 A;  2RS7 A;  2YPN A;  3EPK A;  1X6E A;  2EOY A;  2LT7 A;  2L3C A;  2ZBK B;  1G2F C;  2UUB E;  2EPX A;  3DD6 A;  2R76 A;  1X6F A;  4DR5 E;  1Y4U A;  2HK2 A;  2UXC I;  3F6H A;  2L33 A;  2H36 X;  2L92 A;  1IMU A;  4LCG A;  4X8W A;  3P3E A;  3QT6 A;  4DR4 I;  3HPS A;  2UUC E;  4DV4 I;  2FGG A;  1HK7 A;  2EL6 A;  4ISA A;  1FWK A;  2NN6 E;  4DKK A;  2CZ9 A;  5DRQ A;  1D6T A;  3KZZ A;  3J80 C;  2EQ1 A;  1MX0 A;  3K6Q A;  1P47 A;  4PU9 A;  5F3W A;  4F54 A;  5CFF E;  4NBQ A;  2IES A;  2A25 A;  4J3D A;  1FKA E;  3M85 G;  4GKJ I;  4M30 A;  2DSY A;  4F6M A;  2N3H A;  2MKN A;  2BM0 A;  3DF6 A;  1O0W A;  2MC5 A;  4JI1 E;  4NXM E;  4FN5 A;  2JOX A;  4O5G A;  1HR0 E;  2XEX A;  3QT8 A;  3ZZ0 A;  2CG9 A;  2EM0 A;  3L7Z A;  4ZYD A;  4X65 E;  2EM6 A;  2JT2 A;  2V2Q A;  2NN6 C;  1UDS A;  5FLX C;  2BR2 B;  1ZM3 A;  1E3P A;  2NN6 D;  2NN6 B;  2E5L E;  4BC7 A;  4XTJ A;  4QNK A;  1IBM E;  4LFA E;  4JI5 I;  2LJP A;  1NCS A;  2VE7 C;  1UBD C;  4JI4 E;  4WUB A;  3KRN A;  2EWL A;  4R1F A;  2B3T B;  2PO2 B;  1STU A;  2EL4 A;  2Q8U A;  3QG5 C;  2ZM6 I;  2EPC A;  4JI8 I;  1N34 I;  3UK3 C;  4JYA I;  2YTD A;  4LFA I;  1WRJ A;  3VHT B;  3EPL A;  1JK1 A;  1IQS A;  3PYG A;  1AAY A;  3J80 Q;  1Z1B A;  1AH5 A;  2UXC E;  2EMI A;  2EPL X;  2EOJ A;  4DV7 I;  3P76 A;  3AV0 A;  4DUZ I;  1IBL I;  1T4L B;  2L2K B;  4DR4 E;  4DV4 E;  4N3O A;  2G7H A;  1UEK A;  1BBG A;  2YT4 A;  3U1Y A;  2EMW A;  4L5N C;  1FJG I;  2VF1 A;  5DRR A;  2YRK A;  2J65 A;  1J26 A;  2UXD I;  2GS8 A;  5FLX Q;  4GKJ E;  3WU3 A;  1A1J A;  2RS6 A;  2EPP A;  5T6J A;  5IXM B;  1YFH A;  4NZV A;  1EA6 A;  3GLL A;  1WUU A;  3K17 A;  4BS9 A;  1A1F A;  1DI2 A;  4PRX A;  2VQF I;  5AC5 A;  2LBS B;  4X62 I;  2C37 B;  3JAM C;  1R6L A;  2HFS A;  4IZJ B;  3LML A;  1ZXM A;  4LFC I;  1N36 I;  2D9H A;  2JE6 A;  2OI2 A;  1VIS A;  2EFG A;  2V8P A;  4R2Q A;  2EM3 A;  2EM4 A;  4I3H A;  4JI5 E;  4BA1 B;  4IFD E;  2EN1 A;  2BBG A;  2PRT A;  1Y60 A;  2M1S A; 
#chains in the Genus database with same CATH homology
 2ZM6 E;  2IOQ A;  1HNX I;  4JI8 E;  1N34 E;  2UUA I;  2BV3 A;  4JYA E;  3P06 A;  1USU A;  1J5E I;  5AE3 A;  4WPY A;  3F6G A;  1KVK A;  4LF4 I;  1Z0V A;  2HHH I;  4DV7 E;  4LF9 I;  4FWH A;  4DUZ E;  1IBL E;  1A6F A;  3LLH A;  3VYX A;  3IWD A;  2E1R A;  3HUL A;  1FNM A;  1FJG E;  3JAM Q;  1QZR A;  3PYD A;  4P7A A;  1ZBQ A;  4WYQ B;  2UXD E;  4ZVI A;  4TUG A;  1Z0B A;  4WSP A;  2LE2 A;  2X7I A;  1IBK I;  2VQF E;  2V2Z A;  2MDR A;  4L8N A;  4X62 E;  4DUY I;  1N36 E;  3J7A G;  4LFC E;  1KTV A;  3J7A M;  4DR3 I;  1Z0T A;  1OJ4 A;  2CGE A;  2FTX B;  3GON A;  1BKN A;  1X48 A;  2VQE I;  1RC7 A;  2B9D A;  3J7Y p;  1HNX E;  4BBY A;  2UUA E;  3K1J A;  2RTX A;  1YYW A;  4KZS A;  4NXN I;  3HPZ A;  1J5E E;  2IOP A;  2PNM A;  2PNL A;  1GZ6 A;  1XMQ I;  2JVA A;  3RMP A;  3ADL A;  4LF4 E;  2HHH E;  3FIG A;  4LTY A;  4LF9 E;  4F9B B;  2DB2 A;  4JI3 I;  3ADG A;  2LTR A;  4R03 A;  3WU5 A;  2WW4 A;  1SR9 A;  3D4J A;  1ZM4 A;  3B8H A;  4FWG A;  1Y4S A;  4ED4 A;  1H7S A;  3QT5 A;  4HAC B;  4LF6 I;  1S4E A;  2KON A;  3ZOQ B;  4DMI A;  4HAC A;  1IBK E;  2NUF A;  2NPF A;  4AQY I;  2Z5B B;  4DUY E;  2UU9 I;  1YZ9 A;  4EMD A;  4DR3 E;  4USM A;  2Z5B A;  1N0V C;  2DEI A;  4HY1 A;  1T4N A;  2O1T A;  2VQE E;  2N3G A;  4F9A B;  2F8B A;  3VK6 A;  5LMN I;  4NXN E;  1ELO A;  4USK A;  2O1U A;  1PIE A;  1XMQ E;  4LU9 A;  5AE2 A;  2Z5C A;  1RQ0 A;  4K0K I;  4BCA A;  4JI3 E;  2V8Q B;  4R8O A;  3ZZT A;  3KWR A;  4UT4 A;  2A2C A;  3LTO A;  1XNQ I;  1H73 A;  3QT8 A;  5AE1 A;  3K85 A;  4LF6 E;  4OOG C;  1XNR I;  3HJC A;  1UIL A;  3JTZ A;  1DAR A;  4AQY E;  5IT9 C;  4LF8 I;  2UU9 E;  1I94 I;  2NUE A;  4JI2 I;  2WZO A;  3T1H I;  1WHQ A;  5LL6 R;  1Z59 A;  4JI6 I;  4F9C B;  1HNW I;  2E1M A;  2Z5E A;  3V5R A;  1WHN A;  4OX9 I;  4FWD A;  5LMN E;  3ZKD A;  2F4V I;  3J81 C;  3OML A;  2NUG A;  4DR1 I;  3Q6M A;  3Q6N A;  4X66 I;  4K0K E;  1Z0W A;  4DV3 I;  4JI0 I;  1NHI A;  4DPX A;  4FW9 A;  2JY9 A;  5IT9 Q;  1XNQ E;  4X64 I;  1ZBT A;  1N32 I;  4DR2 I;  1H74 A;  1XNR E;  1ZXN A;  3DJW A;  2M4I A;  4P78 A;  4LF8 E;  4HXZ A;  4Z7C A;  1I94 E;  4JI2 E;  4DPU A;  2ODR C;  1EKZ A;  4KQV A;  1FI4 A;  2ODR D;  3T1H E;  2B7V A;  1YYO A;  1NZ0 A;  4GEQ B;  2L3J A;  2YZT A;  4JI6 E;  3J81 Q;  1HNW E;  2L6M A;  4OX9 E;  2JWO A;  4LF5 I;  4TUI A;  1DQ3 A;  3Q1Q A;  2O1W A;  2F4V E;  2O1V A;  2V85 A;  3T1Y I;  4DR1 E;  2K4V A;  1XMO I;  4B3M I;  4X66 E;  4LF7 I;  2LRS A;  1RRE A;  1T4O A;  4DV3 E;  1H72 C;  2DEJ A;  2ZIT A;  4JI0 E;  5AAS A;  1K47 A;  3CWV A;  4X64 E;  1N32 E;  4DR2 E;  3HXL A;  3P1X A;  2KOU A;  3C4T A;  2JR1 A;  4JI7 I;  1NHH A;  3C4B A;  4GKK I;  5BR8 I;  1QU6 A;  4P52 A;  4WUC A;  4B3T I;  5GMD A;  4DPY A;  1YYK A;  2GQ0 A;  4B3S I;  3F0N A;  4BMJ A;  2L2N A;  4URL A;  1HNZ I;  4I8O A;  2V83 A;  4LF5 E;  1PKP A;  1N0U A;  5A2Q Q;  3T1Y E;  3AUZ A;  1XMO E;  4B3M E;  4LF7 E;  3ZKB A;  1U2R A;  4B3R I;  2Z5C B;  3JU0 A;  4DPW A;  2AJ4 A;  4DXL A;  1B63 A;  3H09 A;  2VF3 A;  1MU5 A;  1Y6Z A;  4MYU A;  3ADJ A;  5LMU I;  4YY3 I;  3WU4 A;  1KIJ A;  1Z0C A;  4JI7 E;  4DV5 I;  2RSM A;  3IWB A;  4GKK E;  1B62 A;  3V2U C;  5BR8 E;  5IWA I;  2V34 A;  4B3T E;  4M1K A;  5L3J A;  2DMY A;  2EZ6 A;  3VYY A;  3PYE A;  4B3S E;  2FV4 B;  3HTX A;  2MC6 A;  1HNZ E;  3M6A A;  3B78 A;  2V87 A;  5DNY A;  2UXB I;  1USV A;  1Z0G A;  3OTO I;  1N33 I;  2LJH A;  2LTS A;  1S16 A;  4LFB I;  4B3R E;  4BC9 A;  4P7D A;  4DV0 I;  1Z5A A;  2CPN A;  2BM1 A;  4WFT A;  4DPT A;  2V89 A;  3ZZU A;  2V86 A;  2R42 A;  1ZM2 A;  4IZJ D;  3QT7 A;  4PRV A;  4J8Z A;  4DV6 I;  1X49 A;  4JV5 I;  4DR7 I;  4IZJ A;  4JG4 A;  2LUQ A;  5LMU E;  4YY3 E;  1EI1 A;  3PYF A;  2LMZ A;  4DV5 E;  1Z0E A;  4DU7 A;  4DR6 I;  2X36 A;  2L2M A;  4RPF A;  4YHH I;  3MSW A;  2IHR 1;  2NA2 A;  4DV2 I;  2L8T A;  4WUD A;  4KHP I;  5IWA E;  4M0V A;  4Z7Y A;  5ADZ A;  2HFU A;  3H4L A;  4DV1 I;  4M2Z A;  1FWL A;  2Q2E B;  2UUB I;  1ZM9 A;  1UHZ A;  4UTG A;  1PVG A;  4DR5 I;  2LUP B;  2UXB E;  1NHJ A;  1RR9 A;  3PRY A;  4MYT A;  3OTO E;  1N33 E;  2JOB A;  1Z5B A;  2UUC I;  2V88 A;  1KKH A;  2J7K A;  4LFB E;  1GQE A;  3ZM7 A;  4DV0 E;  4DU8 A;  1WXR A;  3LPS A;  2HKJ A;  1Z5C A;  2HKE A;  5A2Q C;  3WU6 A;  3HQ1 A;  2R3V A;  2DIX A;  4DV6 E;  3ADI A;  4DR7 E;  4JV5 E;  4JI1 I;  4IZK B;  4NXM I;  1XHK A;  1HR0 I;  1H7U A;  4HYM A;  2M7Q A;  4X65 I;  4IZK A;  1X47 A;  2B7T A;  2V2V A;  2E5L I;  4DR6 E;  1MG7 A;  1IBM I;  4LFA I;  2HK3 A;  2KHX A;  3LNU A;  4YHH E;  5FWK A;  4JI4 I;  3B82 A;  2A2D A;  4DV2 E;  3IWC A;  4KHP E;  4DV1 E;  4Q28 A;  2RS7 A;  2L3C A;  2ZBK B;  2UUB E;  4DR5 E;  1Y4U A;  2HK2 A;  2UXC I;  2L33 A;  2H36 X;  2L92 A;  3F6H A;  4X8W A;  3QT6 A;  4DR4 I;  3HPS A;  2UUC E;  4DV4 I;  2FGG A;  1HK7 A;  1FWK A;  1D6T A;  4DKK A;  2CZ9 A;  3J80 C;  1MX0 A;  3K6Q A;  4PU9 A;  5F3W A;  4F54 A;  5CFF E;  1FKA E;  4GKJ I;  4M30 A;  2DSY A;  2N3H A;  2BM0 A;  3DF6 A;  1O0W A;  2MC5 A;  4JI1 E;  4NXM E;  4FN5 A;  2JOX A;  2XEX A;  1HR0 E;  3ZZ0 A;  2CG9 A;  4X65 E;  2V2Q A;  5FLX C;  1ZM3 A;  2E5L E;  4BC7 A;  4XTJ A;  4JI5 I;  1IBM E;  4LFA E;  2LJP A;  2VE7 C;  4JI4 E;  4WUB A;  2EWL A;  4R1F A;  2B3T B;  1STU A;  2ZM6 I;  4JI8 I;  1N34 I;  4JYA I;  3PYG A;  3J80 Q;  2UXC E;  4DV7 I;  3AV0 A;  4DUZ I;  1IBL I;  1T4L B;  2L2K B;  4DR4 E;  4DV4 E;  4N3O A;  2G7H A;  1UEK A;  2YT4 A;  4L5N C;  1FJG I;  2VF1 A;  1J26 A;  2UXD I;  2GS8 A;  5FLX Q;  4GKJ E;  3WU3 A;  2RS6 A;  5GME A;  5T6J A;  1EA6 A;  3K17 A;  4PRX A;  1WUU A;  4BS9 A;  1DI2 A;  2VQF I;  2LBS B;  4X62 I;  3JAM C;  2HFS A;  4IZJ B;  3LML A;  1ZXM A;  4LFC I;  1N36 I;  2OI2 A;  1VIS A;  2EFG A;  2V8P A;  4I3H A;  4JI5 E;  2M1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...