4JV5I

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jv5I00
4MYUA 1FKAE 4HY1A 4DV1I 4OX9E 4R1FA 1Z0BA 4JI4I 1OJ4A 3V2UC 1N36E 1HNZI 1Z59A 1N33E 1S4EA 2HFSA 1BKNA 2VQEE 3HULA 4DR1I 4JI3I 2UUCE 5IWAE 4JI8I 4JI2E 4URLA 5IT9C 4UTGA 4USMA 2V34A 2F4VE 1ELOA 5GMEA 4B3ME 1XMOE 1N36I 3B82A 1U2RA 4DV2I 1B63A 3QT6A 1XMOI 2X7IA 4DR1E 1IBLE 2ZITA 4LFAI 1H7UA 3T1HE 4LF9I 4GKJE 3J80C 5IWAI 2R42A 1PIEA 5GMDA 1NHIA 2VQFI 4NXME 4JI1I 3QT5A 4DV1E 4PRVA 3WU6A 2VQFE 3PYGA 4JI4E 2V2QA 4DR5E 1N33I 4DV5E 5A2QC 4LFCE 4DR5I 1IBMI 1Z0GA 4GKJI 1Z0TA 1RR9A 4B3TI 5LMNE 1IBME 4JI1E 1ZM9A 3K17A 1FWKA 4B3TE 2V2ZA 1FJGI 3CWVA 2V8PA 3QT8A 1Z5CA 1FWLA 4YY3E 3T1YE 4B3SE 2UUAI 3B78A 1K47A 4KHPI 4AQYI 1EA6A 4LFBE 3GONA 3QT7A 4DXLA 3WU5A 4DPUA 2A2CA 1XNQI 2UXBI 4JI7I 4Z7YA 1N32E 1Z0CA 2UUBI 1FNMA 5FLXQ 4PU9A 1I94E 1ZXNA 4MYTA 1H72C 3OTOI 4DUYE 1EI1A 2ZM6E 4X65I 3Q1QA 4DV3E 5LL6R 1B62A 1Z0EA 4DV4I 2J7KA 4B3RE 1D6TA 4YHHE 4DV7E 4FWGA 4X66E 2BM0A 2UU9I 4GKKI 2DEIA 2UXCI 1HNXI 3ZM7A 4JI5I 5LMNI 5BR8I 4LF7E 4EMDA 4NXNI 1H73A 4JYAE 2HHHI 2R3VA 3B8HA 1S16A 1J5EE 3LNUA 4YHHI 4USKA 1N34I 1J5EI 1Z0WA 2E5LI 4GKKE 1NHJA 4DR2E 1RREA 4DU8A 4DR2I 3LTOA 2GS8A 2V2VA 1IBKI 4B3MI 5LMUI 4JV5I 2CZ9A 4DR4I 2DEJA 2BV3A 2UUBE 3J7AG 2X36A 2ZBKB 4DR6E 4WUCA 1IBLI 1HNWE 4JI6I 3H4LA 2E5LE 1XMQE 4HACB 4DV6I 4X62E 2ZM6I 1MX0A 4JI2I 4LF7I 5BR8E 4DR7I 1KKHA 2UXDE 4RPFA 4JG4A 3ZZTA 4XTJA 5A2QQ 1KIJA 4FW9A 4LF5E 3M6AA 2HFUA 1H7SA 4X64I 1DARA 4NXNE 4FWHA 1QZRA 4DR3I 4DV2E 5LMUE 4JV5E 1WUUA 4DV0E 3ZKBA 1HNZE 2HKJA 4LF9E 3PYDA 4LFCI 1HR0I 4Z7CA 2UUCI 4NXMI 4KHPE 4WUBA 4HXZA 3OTOE 3WU4A 4UT4A 2LJPA 3WU3A 3JAMC 4FWDA 4DPYA 1Z5BA 2WW4A 4JI0I 2UXDI 3ZZ0A 4DR6I 4JI7E 3K1JA 4DV6E 2XEXA 4DPXA 4DPTA 3J81Q 1N0UA 4DV7I 4JI3E 4PRXA 1MG7A 4DV3I 4JI0E 2F4VI 4DR3E 4YY3I 2HKEA 4KQVA 4LF6I 2VQEI 2UXBE 4DV0I 3PYEA 3D4JA 2UUAE 1XHKA 4LF4E 3V5RA 4X64E 1KTVA 2UXCE 1NZ0A 4LF4I 1A6FA 4DU7A 1VISA 5L3JA 3ZZUA 3J81C 3LPSA 4DUZI 4AQYE 2Q2EB 4DV4E 4LF6E 1ZXMA 4WUDA 4DR4E 1N0VC 3T1HI 2UU9E 3PYFA 1HNWI 1ZM2A 4JI6E 4K0KE 3JAMQ 4X65E 4I3HA 4P52A 1NHHA 2A2DA 1I94I 1KVKA 4K0KI 2AJ4A 2HK3A 1Z0VA 4DR7E 1FI4A 1PVGA 3F0NA 4JI5E 1XMQI 4HACA 3ZKDA 4X62I 2E1RA 3T1YI 4B3SI 1PKPA 4JYAI 1Z5AA 4HYMA 4LF8E 2EFGA 4X66I 4P7AA 1XNRE 1HNXE 4LF8I 1FJGE 2OI2A 1IBKE 4DPWA 5FLXC 5IT9Q 1XNRI 2VF3A 1ZM4A 4B3RI 2NPFA 3J80Q 1XNQE 1ZM3A 1UEKA 3J7AM 4FN5A 1N34E 1MU5A 2BM1A 4LFBI 4DUZE 4OX9I 2HHHE 4ZVIA 2HK2A 1N32I 4LF5I 1H74A 1HR0E 4M1KA 4LFAE 4DV5I 4DUYI 4ED4A 4JI8E
chains in the Genus database with same CATH superfamily
4MYUA 2C38A 1FKAE 4HY1A 4DV1I 4OX9E 5K36B 1HK7A 4IZJD 4R1FA 1Z0BA 4JI4I 1OJ4A 3V2UC 1N36E 4FW4A 1HNZI 1Z59A 1N33E 1S4EA 1VI7A 2HFSA 1BKNA 2VQEE 3HULA 4LOMA 5JEAD 4DR1I 4JI3I 1YH8A 3P3GA 2UUCE 5DNXA 5IWAE 2PO1A 4JI8I 4JI2E 4URLA 5IT9C 2PO2B 4UTGA 4USMA 2V34A 2F4VE 1ELOA 5K36C 5GMEA 4B3ME 1XMOE 1N36I 3B82A 3KRNA 3M7NG 1U2RA 4DV2I 1B63A 4IZKB 3QT6A 1XMOI 2X7IA 4DR1E 1IBLE 2ZITA 4LFAI 3P06A 1H7UA 3T1HE 4LF9I 2PNLA 4GKJE 3J80C 5IWAI 2R42A 3UHMA 1PIEA 5GMDA 1NHIA 5K36F 2VQFI 4NXME 1Y6ZA 4JI1I 3QT5A 4DV1E 4PRVA 4AM3A 2NN6D 3WU6A 3PYGA 2VQFE 4OZEA 4JI4E 2V2QA 4DR5E 1N33I 4DV5E 5A2QC 5DROA 1USVA 1Y4UA 4LFCE 1YHCA 1R6MA 4DR5I 1IBMI 4IZJB 1Z0GA 4GKJI 4J3DA 1Z0TA 1RR9A 4B3TI 5LMNE 2BA0D 1IBME 2JEAB 4JI1E 1ZM9A 3K17A 2NN6C 1FWKA 4B3TE 2V2ZA 1FJGI 3CWVA 2V8PA 3QT8A 1Z5CA 3P76A 1FWLA 4YY3E 3T1YE 4B3SE 4IFDB 2UUAI 3B78A 1K47A 4KHPI 3PS2A 2GO4A 4AQYI 5FWKA 1EA6A 5JEAB 1E3PA 2BR2B 4AIMA 3HJCA 4LFBE 3GONA 3QT7A 4MU4A 4DXLA 3WU5A 4DPUA 2A2CA 1XNQI 2UXBI 2Z5CB 4JI7I 5C0XE 4Z7YA 1N32E 1R6LA 2PNZA 1Z0CA 2UUBI 2C39A 1FNMA 5FLXQ 2NN6A 4PU9A 4BA2A 2VESA 2JEBA 1ZXNA 4MYTA 1I94E 1H72C 3OTOI 4OO1B 4DUYE 1EI1A 2C37B 2ZM6E 4X65I 3Q1QA 2WNRB 4DV3E 5LL6R 1B62A 1Z0EA 5DRRA 4MU1A 1Y60A 2CGEA 4DV4I 2J7KA 4B3RE 5K36E 1D6TA 4YHHE 2JT2A 4DV7E 4FWGA 4X66E 2BM0A 2UU9I 4GKKI 2DEIA 2UXCI 4FW5A 1HNXI 3L7ZA 4GQUA 3ZM7A 5LMNI 5BR8I 4JI5I 4EMDA 4LF7E 3P3CA 4NXNI 1H73A 1OYSA 4JYAE 2R3VA 2HHHI 3B8HA 1P42A 1S16A 2BR2A 1J5EE 5C0XF 1UDOA 1UDQA 2O1VA 3LNUA 4YHHI 4MU0A 4USKA 2JE6A 2NN6E 1N34I 1J5EI 1Z0WA 2E5LI 4GKKE 1NHJA 4OO1E 4DR2E 2PO1B 1RREA 2NN6F 1Y5YA 2BA0G 4DU8A 4DR2I 3LTOA 3M85G 2GS8A 2V2VA 1IBKI 4B3MI 5LMUI 4JV5I 2CZ9A 4DR4I 2DEJA 2BV3A 2UUBE 3J7AG 2X36A 4IFDD 2ZBKB 3GCMA 4DR6E 4FW7A 4WUCA 2O3ZA 4MQYA 1IBLI 1HNWE 4JI6I 3H4LA 2E5LE 1XMQE 4HACB 4DV6I 4X62E 3M7ND 2ZM6I 1MX0A 4IFDE 4FW6A 4JI2I 5BR8E 4LF7I 4DR7I 2PO0B 1KKHA 2UXDE 2JEBB 4RPFA 3P3EA 4JG4A 5C0XB 3ZZTA 4XTJA 4OO1C 5DRPA 3CDJA 5A2QQ 1KIJA 4IZKA 5DNLA 4FW9A 4LF5E 5JEAF 3M6AA 2HFUA 2O1TA 4OO1D 1H7SA 2IOQA 5JEAE 4X64I 1DARA 4NXNE 1OYPA 2C39B 4FWHA 1QZRA 4AIDA 2O1UA 4DR3I 2IERA 4DV2E 5LMUE 4JV5E 1WUUA 4BA2B 4DV0E 4N3OA 3ZKBA 3B4TA 4U3BA 1HNZE 2WP8B 2HKJA 4IFDC 4LF9E 3PYDA 4LFCI 1HR0I 4Z7CA 2UUCI 4IFDA 4NXMI 4KHPE 1UDNA 4WUBA 2C38B 2JE6B 4HXZA 3OTOE 3WU4A 4UT4A 2LJPA 2WP8A 3WU3A 4FWDA 3L7ZB 3JAMC 4DPYA 1Z5BA 2WW4A 4JI0I 2UXDI 4LCFA 2Z5BA 3ZZ0A 3PRYA 4DR6I 4JI7E 4OO1F 3DD6A 2O1WA 3K1JA 2Z5BB 4DV6E 2XEXA 4IZJA 4DPXA 1E3HA 4DPTA 3J81Q 1N0UA 2BA1G 4DV7I 4JI3E 4PRXA 5C0XD 1MG7A 1Y4SA 3M85D 4OO1A 2PNMA 1OYRA 4DV3I 2CG9A 2AE8A 4JI0E 2F4VI 4DR3E 2IOPA 4YY3I 2HKEA 4KQVA 4LF6I 2VQEI 2UXBE 4DV0I 3PYEA 3D4JA 3CDIA 2UUAE 1XHKA 4LF4E 4BA1B 4MU3A 3V5RA 4X64E 4IFDF 1KTVA 2UXCE 1NZ0A 4QNJA 4LF4I 1A6FA 3PS1A 2PNZB 4DU7A 4ISAA 1VISA 5L3JA 3Q6MA 4BA1A 3NZKA 3ZZUA 3J81C 3LPSA 4DUZI 4AQYE 4IS9A 2Q2EB 2IESA 4DV4E 4LF6E 1ZXMA 4WUDA 4DR4E 1N0VC 5C0XA 3T1HI 2UU9E 2Z5CA 2PO2A 3PYFA 3GLLA 1HNWI 1ZM2A 4JI6E 4K0KE 3JAMQ 4X65E 4I3HA 4P52A 3U1YA 5C0XC 1NHHA 2GO3A 2A2DA 1I94I 1KVKA 4K0KI 1XXEA 2AJ4A 2HK3A 1Z0VA 4DR7E 5ELWA 2PO0A 1FI4A 5K36A 3GMEA 2F1DA 5DRQA 1USUA 4LPFA 1PVGA 3F0NA 4JI5E 1XMQI 4HACA 3ZKDA 4X62I 2E1RA 3T1YI 4B3SI 3K85A 1PKPA 4JYAI 1Z5AA 4HYMA 4LF8E 2EFGA 4X66I 4P7AA 2JEAA 1XNRE 1HNXE 2GQ0A 4LF8I 1FJGE 2OI2A 1IBKE 4DPWA 4FW3A 4MDTA 2BA1D 5JEAA 5FLXC 5IT9Q 4NBQA 1XNRI 2VF3A 1ZM4A 2WNRA 4B3RI 2NPFA 2Z5EA 3J80Q 1XNQE 3PS3A 1RHYA 1ZM3A 1UEKA 2NN6B 3J7AM 4FN5A 1N34E 5EL9A 1UDSA 1MU5A 4U3DA 3U1KA 4QNKA 5K36D 2BM1A 5JEAC 4LFBI 4DUZE 4OKGA 4LCHA 3HKMA 4OX9I 2HHHE 4ZVIA 2CVEA 2HK2A 1N32I 5EKWA 4LF5I 1H74A 1HR0E 4M1KA 3H1CA 4LFAE 4LCGA 2J65A 3Q6NA 4DV5I 2C37A 4DUYI 4ED4A 4JI8E
chains in the Genus database with same CATH topology
4MYUA 1FKAE 4HY1A 4DV1I 4OX9E 1HK7A 4IZJD 4R1FA 1Z0BA 4JI4I 1OJ4A 3V2UC 1N36E 1HNZI 1Z59A 1N33E 1S4EA 2HFSA 1BKNA 2VQEE 3HULA 4DR1I 4JI3I 2UUCE 5IWAE 4JI8I 4JI2E 4URLA 5IT9C 4UTGA 4USMA 2V34A 2F4VE 1ELOA 5GMEA 4B3ME 1XMOE 1N36I 3B82A 1U2RA 4DV2I 1B63A 4IZKB 3QT6A 1XMOI 2X7IA 4DR1E 1IBLE 2ZITA 4LFAI 3P06A 1H7UA 3T1HE 4LF9I 2PNLA 4GKJE 3J80C 5IWAI 2R42A 1PIEA 5GMDA 1NHIA 2VQFI 4NXME 1Y6ZA 4JI1I 3QT5A 4DV1E 4PRVA 3WU6A 2VQFE 3PYGA 4JI4E 2V2QA 4DR5E 1N33I 4DV5E 5A2QC 1USVA 1Y4UA 4LFCE 4DR5I 1IBMI 4IZJB 1Z0GA 4GKJI 1Z0TA 1RR9A 4B3TI 5LMNE 1IBME 4JI1E 1ZM9A 3K17A 1FWKA 4B3TE 2V2ZA 1FJGI 3CWVA 2V8PA 3QT8A 1Z5CA 1FWLA 4YY3E 4B3SE 3T1YE 2UUAI 3B78A 1K47A 4KHPI 4AQYI 5FWKA 1EA6A 3HJCA 4LFBE 3GONA 3QT7A 4DXLA 3WU5A 4DPUA 2A2CA 1XNQI 2UXBI 2Z5CB 4JI7I 4Z7YA 1N32E 1Z0CA 2UUBI 1FNMA 5FLXQ 4PU9A 1I94E 1ZXNA 4MYTA 1H72C 3OTOI 4DUYE 1EI1A 2ZM6E 4X65I 3Q1QA 4DV3E 5LL6R 1B62A 1Z0EA 2CGEA 4DV4I 2J7KA 4B3RE 1D6TA 4YHHE 4DV7E 4FWGA 4X66E 2BM0A 2UU9I 4GKKI 2DEIA 2UXCI 1HNXI 3ZM7A 4JI5I 5LMNI 5BR8I 4LF7E 4EMDA 4NXNI 1H73A 4JYAE 2HHHI 2R3VA 3B8HA 1S16A 1J5EE 2O1VA 3LNUA 4YHHI 4USKA 1N34I 1J5EI 1Z0WA 2E5LI 4GKKE 1NHJA 4DR2E 1RREA 4DU8A 4DR2I 3LTOA 2GS8A 2V2VA 1IBKI 4B3MI 5LMUI 4JV5I 2CZ9A 4DR4I 2DEJA 2BV3A 2UUBE 3J7AG 2X36A 2ZBKB 4DR6E 4WUCA 1IBLI 1HNWE 4JI6I 3H4LA 2E5LE 1XMQE 4HACB 4DV6I 4X62E 2ZM6I 1MX0A 4JI2I 5BR8E 4LF7I 4DR7I 1KKHA 2UXDE 4RPFA 4JG4A 3ZZTA 4XTJA 5A2QQ 1KIJA 4IZKA 4FW9A 4LF5E 3M6AA 2HFUA 2O1TA 1H7SA 2IOQA 4X64I 1DARA 4NXNE 4FWHA 1QZRA 2O1UA 4DR3I 4DV2E 5LMUE 4JV5E 1WUUA 4DV0E 4N3OA 3ZKBA 1HNZE 2HKJA 4LF9E 3PYDA 4LFCI 1HR0I 4Z7CA 2UUCI 4NXMI 4KHPE 4WUBA 4HXZA 3OTOE 3WU4A 4UT4A 2LJPA 3WU3A 3JAMC 4FWDA 4DPYA 1Z5BA 2WW4A 4JI0I 2UXDI 2Z5BA 3ZZ0A 3PRYA 4DR6I 4JI7E 2O1WA 3K1JA 2Z5BB 4DV6E 2XEXA 4IZJA 4DPXA 4DPTA 3J81Q 1N0UA 4DV7I 4JI3E 4PRXA 1MG7A 1Y4SA 2PNMA 4DV3I 2CG9A 4JI0E 2F4VI 4DR3E 2IOPA 4YY3I 2HKEA 4KQVA 4LF6I 2VQEI 2UXBE 4DV0I 3PYEA 3D4JA 2UUAE 1XHKA 4LF4E 3V5RA 4X64E 1KTVA 2UXCE 1NZ0A 4LF4I 1A6FA 4DU7A 1VISA 5L3JA 3Q6MA 3ZZUA 3J81C 3LPSA 4DUZI 4AQYE 2Q2EB 4DV4E 4LF6E 1ZXMA 4WUDA 4DR4E 1N0VC 3T1HI 2UU9E 2Z5CA 3PYFA 1HNWI 1ZM2A 4JI6E 4K0KE 3JAMQ 4X65E 4I3HA 4P52A 1NHHA 2A2DA 1I94I 1KVKA 4K0KI 2AJ4A 2HK3A 1Z0VA 4DR7E 1FI4A 1USUA 1PVGA 3F0NA 4JI5E 1XMQI 4HACA 3ZKDA 4X62I 2E1RA 3T1YI 4B3SI 3K85A 1PKPA 4JYAI 1Z5AA 4HYMA 4LF8E 2EFGA 4X66I 4P7AA 1XNRE 1HNXE 2GQ0A 4LF8I 1FJGE 2OI2A 1IBKE 4DPWA 5FLXC 5IT9Q 1XNRI 2VF3A 1ZM4A 4B3RI 2NPFA 2Z5EA 3J80Q 1XNQE 1ZM3A 1UEKA 3J7AM 4FN5A 1N34E 1MU5A 2BM1A 4LFBI 4DUZE 4OX9I 2HHHE 4ZVIA 2HK2A 1N32I 4LF5I 1H74A 1HR0E 4M1KA 4LFAE 3Q6NA 4DV5I 4DUYI 4ED4A 4JI8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MYU A;  1FKA E;  4HY1 A;  4DV1 I;  4OX9 E;  4R1F A;  1Z0B A;  4JI4 I;  1OJ4 A;  3V2U C;  1N36 E;  1HNZ I;  1Z59 A;  1N33 E;  1S4E A;  2HFS A;  1BKN A;  2VQE E;  3HUL A;  4DR1 I;  4JI3 I;  2UUC E;  5IWA E;  4JI8 I;  4JI2 E;  4URL A;  5IT9 C;  4UTG A;  4USM A;  2V34 A;  2F4V E;  1ELO A;  5GME A;  4B3M E;  1XMO E;  1N36 I;  3B82 A;  1U2R A;  4DV2 I;  1B63 A;  3QT6 A;  1XMO I;  2X7I A;  4DR1 E;  1IBL E;  2ZIT A;  4LFA I;  1H7U A;  3T1H E;  4LF9 I;  4GKJ E;  3J80 C;  5IWA I;  2R42 A;  1PIE A;  5GMD A;  1NHI A;  2VQF I;  4NXM E;  4JI1 I;  3QT5 A;  4DV1 E;  4PRV A;  3WU6 A;  2VQF E;  3PYG A;  4JI4 E;  2V2Q A;  4DR5 E;  1N33 I;  4DV5 E;  5A2Q C;  4LFC E;  4DR5 I;  1IBM I;  1Z0G A;  4GKJ I;  1Z0T A;  1RR9 A;  4B3T I;  5LMN E;  1IBM E;  4JI1 E;  1ZM9 A;  3K17 A;  1FWK A;  4B3T E;  2V2Z A;  1FJG I;  3CWV A;  2V8P A;  3QT8 A;  1Z5C A;  1FWL A;  4YY3 E;  3T1Y E;  4B3S E;  2UUA I;  3B78 A;  1K47 A;  4KHP I;  4AQY I;  1EA6 A;  4LFB E;  3GON A;  3QT7 A;  4DXL A;  3WU5 A;  4DPU A;  2A2C A;  1XNQ I;  2UXB I;  4JI7 I;  4Z7Y A;  1N32 E;  1Z0C A;  2UUB I;  1FNM A;  5FLX Q;  4PU9 A;  1I94 E;  1ZXN A;  4MYT A;  1H72 C;  3OTO I;  4DUY E;  1EI1 A;  2ZM6 E;  4X65 I;  3Q1Q A;  4DV3 E;  5LL6 R;  1B62 A;  1Z0E A;  4DV4 I;  2J7K A;  4B3R E;  1D6T A;  4YHH E;  4DV7 E;  4FWG A;  4X66 E;  2BM0 A;  2UU9 I;  4GKK I;  2DEI A;  2UXC I;  1HNX I;  3ZM7 A;  4JI5 I;  5LMN I;  5BR8 I;  4LF7 E;  4EMD A;  4NXN I;  1H73 A;  4JYA E;  2HHH I;  2R3V A;  3B8H A;  1S16 A;  1J5E E;  3LNU A;  4YHH I;  4USK A;  1N34 I;  1J5E I;  1Z0W A;  2E5L I;  4GKK E;  1NHJ A;  4DR2 E;  1RRE A;  4DU8 A;  4DR2 I;  3LTO A;  2GS8 A;  2V2V A;  1IBK I;  4B3M I;  5LMU I;  4JV5 I;  2CZ9 A;  4DR4 I;  2DEJ A;  2BV3 A;  2UUB E;  3J7A G;  2X36 A;  2ZBK B;  4DR6 E;  4WUC A;  1IBL I;  1HNW E;  4JI6 I;  3H4L A;  2E5L E;  1XMQ E;  4HAC B;  4DV6 I;  4X62 E;  2ZM6 I;  1MX0 A;  4JI2 I;  4LF7 I;  5BR8 E;  4DR7 I;  1KKH A;  2UXD E;  4RPF A;  4JG4 A;  3ZZT A;  4XTJ A;  5A2Q Q;  1KIJ A;  4FW9 A;  4LF5 E;  3M6A A;  2HFU A;  1H7S A;  4X64 I;  1DAR A;  4NXN E;  4FWH A;  1QZR A;  4DR3 I;  4DV2 E;  5LMU E;  4JV5 E;  1WUU A;  4DV0 E;  3ZKB A;  1HNZ E;  2HKJ A;  4LF9 E;  3PYD A;  4LFC I;  1HR0 I;  4Z7C A;  2UUC I;  4NXM I;  4KHP E;  4WUB A;  4HXZ A;  3OTO E;  3WU4 A;  4UT4 A;  2LJP A;  3WU3 A;  3JAM C;  4FWD A;  4DPY A;  1Z5B A;  2WW4 A;  4JI0 I;  2UXD I;  3ZZ0 A;  4DR6 I;  4JI7 E;  3K1J A;  4DV6 E;  2XEX A;  4DPX A;  4DPT A;  3J81 Q;  1N0U A;  4DV7 I;  4JI3 E;  4PRX A;  1MG7 A;  4DV3 I;  4JI0 E;  2F4V I;  4DR3 E;  4YY3 I;  2HKE A;  4KQV A;  4LF6 I;  2VQE I;  2UXB E;  4DV0 I;  3PYE A;  3D4J A;  2UUA E;  1XHK A;  4LF4 E;  3V5R A;  4X64 E;  1KTV A;  2UXC E;  1NZ0 A;  4LF4 I;  1A6F A;  4DU7 A;  1VIS A;  5L3J A;  3ZZU A;  3J81 C;  3LPS A;  4DUZ I;  4AQY E;  2Q2E B;  4DV4 E;  4LF6 E;  1ZXM A;  4WUD A;  4DR4 E;  1N0V C;  3T1H I;  2UU9 E;  3PYF A;  1HNW I;  1ZM2 A;  4JI6 E;  4K0K E;  3JAM Q;  4X65 E;  4I3H A;  4P52 A;  1NHH A;  2A2D A;  1I94 I;  1KVK A;  4K0K I;  2AJ4 A;  2HK3 A;  1Z0V A;  4DR7 E;  1FI4 A;  1PVG A;  3F0N A;  4JI5 E;  1XMQ I;  4HAC A;  3ZKD A;  4X62 I;  2E1R A;  3T1Y I;  4B3S I;  1PKP A;  4JYA I;  1Z5A A;  4HYM A;  4LF8 E;  2EFG A;  4X66 I;  4P7A A;  1XNR E;  1HNX E;  4LF8 I;  1FJG E;  2OI2 A;  1IBK E;  4DPW A;  5FLX C;  5IT9 Q;  1XNR I;  2VF3 A;  1ZM4 A;  4B3R I;  2NPF A;  3J80 Q;  1XNQ E;  1ZM3 A;  1UEK A;  3J7A M;  4FN5 A;  1N34 E;  1MU5 A;  2BM1 A;  4LFB I;  4DUZ E;  4OX9 I;  2HHH E;  4ZVI A;  2HK2 A;  1N32 I;  4LF5 I;  1H74 A;  1HR0 E;  4M1K A;  4LFA E;  4DV5 I;  4DUY I;  4ED4 A;  4JI8 E; 
#chains in the Genus database with same CATH topology
 4MYU A;  2C38 A;  1FKA E;  4HY1 A;  4DV1 I;  4OX9 E;  5K36 B;  1HK7 A;  4IZJ D;  4R1F A;  1Z0B A;  4JI4 I;  1OJ4 A;  3V2U C;  1N36 E;  4FW4 A;  1HNZ I;  1Z59 A;  1N33 E;  1S4E A;  1VI7 A;  2HFS A;  1BKN A;  2VQE E;  3HUL A;  4LOM A;  5JEA D;  4DR1 I;  4JI3 I;  1YH8 A;  3P3G A;  2UUC E;  5DNX A;  5IWA E;  2PO1 A;  4JI8 I;  4JI2 E;  4URL A;  5IT9 C;  2PO2 B;  4UTG A;  4USM A;  2V34 A;  2F4V E;  1ELO A;  5K36 C;  5GME A;  4B3M E;  1XMO E;  1N36 I;  3B82 A;  3KRN A;  3M7N G;  1U2R A;  4DV2 I;  1B63 A;  4IZK B;  3QT6 A;  1XMO I;  2X7I A;  4DR1 E;  1IBL E;  2ZIT A;  4LFA I;  3P06 A;  1H7U A;  3T1H E;  4LF9 I;  2PNL A;  4GKJ E;  3J80 C;  5IWA I;  2R42 A;  3UHM A;  1PIE A;  5GMD A;  1NHI A;  5K36 F;  2VQF I;  4NXM E;  1Y6Z A;  4JI1 I;  3QT5 A;  4DV1 E;  4PRV A;  4AM3 A;  2NN6 D;  3WU6 A;  3PYG A;  2VQF E;  4OZE A;  4JI4 E;  2V2Q A;  4DR5 E;  1N33 I;  4DV5 E;  5A2Q C;  5DRO A;  1USV A;  1Y4U A;  4LFC E;  1YHC A;  1R6M A;  4DR5 I;  1IBM I;  4IZJ B;  1Z0G A;  4GKJ I;  4J3D A;  1Z0T A;  1RR9 A;  4B3T I;  5LMN E;  2BA0 D;  1IBM E;  2JEA B;  4JI1 E;  1ZM9 A;  3K17 A;  2NN6 C;  1FWK A;  4B3T E;  2V2Z A;  1FJG I;  3CWV A;  2V8P A;  3QT8 A;  1Z5C A;  3P76 A;  1FWL A;  4YY3 E;  3T1Y E;  4B3S E;  4IFD B;  2UUA I;  3B78 A;  1K47 A;  4KHP I;  3PS2 A;  2GO4 A;  4AQY I;  5FWK A;  1EA6 A;  5JEA B;  1E3P A;  2BR2 B;  4AIM A;  3HJC A;  4LFB E;  3GON A;  3QT7 A;  4MU4 A;  4DXL A;  3WU5 A;  4DPU A;  2A2C A;  1XNQ I;  2UXB I;  2Z5C B;  4JI7 I;  5C0X E;  4Z7Y A;  1N32 E;  1R6L A;  2PNZ A;  1Z0C A;  2UUB I;  2C39 A;  1FNM A;  5FLX Q;  2NN6 A;  4PU9 A;  4BA2 A;  2VES A;  2JEB A;  1ZXN A;  4MYT A;  1I94 E;  1H72 C;  3OTO I;  4OO1 B;  4DUY E;  1EI1 A;  2C37 B;  2ZM6 E;  4X65 I;  3Q1Q A;  2WNR B;  4DV3 E;  5LL6 R;  1B62 A;  1Z0E A;  5DRR A;  4MU1 A;  1Y60 A;  2CGE A;  4DV4 I;  2J7K A;  4B3R E;  5K36 E;  1D6T A;  4YHH E;  2JT2 A;  4DV7 E;  4FWG A;  4X66 E;  2BM0 A;  2UU9 I;  4GKK I;  2DEI A;  2UXC I;  4FW5 A;  1HNX I;  3L7Z A;  4GQU A;  3ZM7 A;  5LMN I;  5BR8 I;  4JI5 I;  4EMD A;  4LF7 E;  3P3C A;  4NXN I;  1H73 A;  1OYS A;  4JYA E;  2R3V A;  2HHH I;  3B8H A;  1P42 A;  1S16 A;  2BR2 A;  1J5E E;  5C0X F;  1UDO A;  1UDQ A;  2O1V A;  3LNU A;  4YHH I;  4MU0 A;  4USK A;  2JE6 A;  2NN6 E;  1N34 I;  1J5E I;  1Z0W A;  2E5L I;  4GKK E;  1NHJ A;  4OO1 E;  4DR2 E;  2PO1 B;  1RRE A;  2NN6 F;  1Y5Y A;  2BA0 G;  4DU8 A;  4DR2 I;  3LTO A;  3M85 G;  2GS8 A;  2V2V A;  1IBK I;  4B3M I;  5LMU I;  4JV5 I;  2CZ9 A;  4DR4 I;  2DEJ A;  2BV3 A;  2UUB E;  3J7A G;  2X36 A;  4IFD D;  2ZBK B;  3GCM A;  4DR6 E;  4FW7 A;  4WUC A;  2O3Z A;  4MQY A;  1IBL I;  1HNW E;  4JI6 I;  3H4L A;  2E5L E;  1XMQ E;  4HAC B;  4DV6 I;  4X62 E;  3M7N D;  2ZM6 I;  1MX0 A;  4IFD E;  4FW6 A;  4JI2 I;  5BR8 E;  4LF7 I;  4DR7 I;  2PO0 B;  1KKH A;  2UXD E;  2JEB B;  4RPF A;  3P3E A;  4JG4 A;  5C0X B;  3ZZT A;  4XTJ A;  4OO1 C;  5DRP A;  3CDJ A;  5A2Q Q;  1KIJ A;  4IZK A;  5DNL A;  4FW9 A;  4LF5 E;  5JEA F;  3M6A A;  2HFU A;  2O1T A;  4OO1 D;  1H7S A;  2IOQ A;  5JEA E;  4X64 I;  1DAR A;  4NXN E;  1OYP A;  2C39 B;  4FWH A;  1QZR A;  4AID A;  2O1U A;  4DR3 I;  2IER A;  4DV2 E;  5LMU E;  4JV5 E;  1WUU A;  4BA2 B;  4DV0 E;  4N3O A;  3ZKB A;  3B4T A;  4U3B A;  1HNZ E;  2WP8 B;  2HKJ A;  4IFD C;  4LF9 E;  3PYD A;  4LFC I;  1HR0 I;  4Z7C A;  2UUC I;  4IFD A;  4NXM I;  4KHP E;  1UDN A;  4WUB A;  2C38 B;  2JE6 B;  4HXZ A;  3OTO E;  3WU4 A;  4UT4 A;  2LJP A;  2WP8 A;  3WU3 A;  4FWD A;  3L7Z B;  3JAM C;  4DPY A;  1Z5B A;  2WW4 A;  4JI0 I;  2UXD I;  4LCF A;  2Z5B A;  3ZZ0 A;  3PRY A;  4DR6 I;  4JI7 E;  4OO1 F;  3DD6 A;  2O1W A;  3K1J A;  2Z5B B;  4DV6 E;  2XEX A;  4IZJ A;  4DPX A;  1E3H A;  4DPT A;  3J81 Q;  1N0U A;  2BA1 G;  4DV7 I;  4JI3 E;  4PRX A;  5C0X D;  1MG7 A;  1Y4S A;  3M85 D;  4OO1 A;  2PNM A;  1OYR A;  4DV3 I;  2CG9 A;  2AE8 A;  4JI0 E;  2F4V I;  4DR3 E;  2IOP A;  4YY3 I;  2HKE A;  4KQV A;  4LF6 I;  2VQE I;  2UXB E;  4DV0 I;  3PYE A;  3D4J A;  3CDI A;  2UUA E;  1XHK A;  4LF4 E;  4BA1 B;  4MU3 A;  3V5R A;  4X64 E;  4IFD F;  1KTV A;  2UXC E;  1NZ0 A;  4QNJ A;  4LF4 I;  1A6F A;  3PS1 A;  2PNZ B;  4DU7 A;  4ISA A;  1VIS A;  5L3J A;  3Q6M A;  4BA1 A;  3NZK A;  3ZZU A;  3J81 C;  3LPS A;  4DUZ I;  4AQY E;  4IS9 A;  2Q2E B;  2IES A;  4DV4 E;  4LF6 E;  1ZXM A;  4WUD A;  4DR4 E;  1N0V C;  5C0X A;  3T1H I;  2UU9 E;  2Z5C A;  2PO2 A;  3PYF A;  3GLL A;  1HNW I;  1ZM2 A;  4JI6 E;  4K0K E;  3JAM Q;  4X65 E;  4I3H A;  4P52 A;  3U1Y A;  5C0X C;  1NHH A;  2GO3 A;  2A2D A;  1I94 I;  1KVK A;  4K0K I;  1XXE A;  2AJ4 A;  2HK3 A;  1Z0V A;  4DR7 E;  5ELW A;  2PO0 A;  1FI4 A;  5K36 A;  3GME A;  2F1D A;  5DRQ A;  1USU A;  4LPF A;  1PVG A;  3F0N A;  4JI5 E;  1XMQ I;  4HAC A;  3ZKD A;  4X62 I;  2E1R A;  3T1Y I;  4B3S I;  3K85 A;  1PKP A;  4JYA I;  1Z5A A;  4HYM A;  4LF8 E;  2EFG A;  4X66 I;  4P7A A;  2JEA A;  1XNR E;  1HNX E;  2GQ0 A;  4LF8 I;  1FJG E;  2OI2 A;  1IBK E;  4DPW A;  4FW3 A;  4MDT A;  2BA1 D;  5JEA A;  5FLX C;  5IT9 Q;  4NBQ A;  1XNR I;  2VF3 A;  1ZM4 A;  2WNR A;  4B3R I;  2NPF A;  2Z5E A;  3J80 Q;  1XNQ E;  3PS3 A;  1RHY A;  1ZM3 A;  1UEK A;  2NN6 B;  3J7A M;  4FN5 A;  1N34 E;  5EL9 A;  1UDS A;  1MU5 A;  4U3D A;  3U1K A;  4QNK A;  5K36 D;  2BM1 A;  5JEA C;  4LFB I;  4DUZ E;  4OKG A;  4LCH A;  3HKM A;  4OX9 I;  2HHH E;  4ZVI A;  2CVE A;  2HK2 A;  1N32 I;  5EKW A;  4LF5 I;  1H74 A;  1HR0 E;  4M1K A;  3H1C A;  4LFA E;  4LCG A;  2J65 A;  3Q6N A;  4DV5 I;  2C37 A;  4DUY I;  4ED4 A;  4JI8 E; 
#chains in the Genus database with same CATH homology
 4MYU A;  1FKA E;  4HY1 A;  4DV1 I;  4OX9 E;  1HK7 A;  4IZJ D;  4R1F A;  1Z0B A;  4JI4 I;  1OJ4 A;  3V2U C;  1N36 E;  1HNZ I;  1Z59 A;  1N33 E;  1S4E A;  2HFS A;  1BKN A;  2VQE E;  3HUL A;  4DR1 I;  4JI3 I;  2UUC E;  5IWA E;  4JI8 I;  4JI2 E;  4URL A;  5IT9 C;  4UTG A;  4USM A;  2V34 A;  2F4V E;  1ELO A;  5GME A;  4B3M E;  1XMO E;  1N36 I;  3B82 A;  1U2R A;  4DV2 I;  1B63 A;  4IZK B;  3QT6 A;  1XMO I;  2X7I A;  4DR1 E;  1IBL E;  2ZIT A;  4LFA I;  3P06 A;  1H7U A;  3T1H E;  4LF9 I;  2PNL A;  4GKJ E;  3J80 C;  5IWA I;  2R42 A;  1PIE A;  5GMD A;  1NHI A;  2VQF I;  4NXM E;  1Y6Z A;  4JI1 I;  3QT5 A;  4DV1 E;  4PRV A;  3WU6 A;  2VQF E;  3PYG A;  4JI4 E;  2V2Q A;  4DR5 E;  1N33 I;  4DV5 E;  5A2Q C;  1USV A;  1Y4U A;  4LFC E;  4DR5 I;  1IBM I;  4IZJ B;  1Z0G A;  4GKJ I;  1Z0T A;  1RR9 A;  4B3T I;  5LMN E;  1IBM E;  4JI1 E;  1ZM9 A;  3K17 A;  1FWK A;  4B3T E;  2V2Z A;  1FJG I;  3CWV A;  2V8P A;  3QT8 A;  1Z5C A;  1FWL A;  4YY3 E;  4B3S E;  3T1Y E;  2UUA I;  3B78 A;  1K47 A;  4KHP I;  4AQY I;  5FWK A;  1EA6 A;  3HJC A;  4LFB E;  3GON A;  3QT7 A;  4DXL A;  3WU5 A;  4DPU A;  2A2C A;  1XNQ I;  2UXB I;  2Z5C B;  4JI7 I;  4Z7Y A;  1N32 E;  1Z0C A;  2UUB I;  1FNM A;  5FLX Q;  4PU9 A;  1I94 E;  1ZXN A;  4MYT A;  1H72 C;  3OTO I;  4DUY E;  1EI1 A;  2ZM6 E;  4X65 I;  3Q1Q A;  4DV3 E;  5LL6 R;  1B62 A;  1Z0E A;  2CGE A;  4DV4 I;  2J7K A;  4B3R E;  1D6T A;  4YHH E;  4DV7 E;  4FWG A;  4X66 E;  2BM0 A;  2UU9 I;  4GKK I;  2DEI A;  2UXC I;  1HNX I;  3ZM7 A;  4JI5 I;  5LMN I;  5BR8 I;  4LF7 E;  4EMD A;  4NXN I;  1H73 A;  4JYA E;  2HHH I;  2R3V A;  3B8H A;  1S16 A;  1J5E E;  2O1V A;  3LNU A;  4YHH I;  4USK A;  1N34 I;  1J5E I;  1Z0W A;  2E5L I;  4GKK E;  1NHJ A;  4DR2 E;  1RRE A;  4DU8 A;  4DR2 I;  3LTO A;  2GS8 A;  2V2V A;  1IBK I;  4B3M I;  5LMU I;  4JV5 I;  2CZ9 A;  4DR4 I;  2DEJ A;  2BV3 A;  2UUB E;  3J7A G;  2X36 A;  2ZBK B;  4DR6 E;  4WUC A;  1IBL I;  1HNW E;  4JI6 I;  3H4L A;  2E5L E;  1XMQ E;  4HAC B;  4DV6 I;  4X62 E;  2ZM6 I;  1MX0 A;  4JI2 I;  5BR8 E;  4LF7 I;  4DR7 I;  1KKH A;  2UXD E;  4RPF A;  4JG4 A;  3ZZT A;  4XTJ A;  5A2Q Q;  1KIJ A;  4IZK A;  4FW9 A;  4LF5 E;  3M6A A;  2HFU A;  2O1T A;  1H7S A;  2IOQ A;  4X64 I;  1DAR A;  4NXN E;  4FWH A;  1QZR A;  2O1U A;  4DR3 I;  4DV2 E;  5LMU E;  4JV5 E;  1WUU A;  4DV0 E;  4N3O A;  3ZKB A;  1HNZ E;  2HKJ A;  4LF9 E;  3PYD A;  4LFC I;  1HR0 I;  4Z7C A;  2UUC I;  4NXM I;  4KHP E;  4WUB A;  4HXZ A;  3OTO E;  3WU4 A;  4UT4 A;  2LJP A;  3WU3 A;  3JAM C;  4FWD A;  4DPY A;  1Z5B A;  2WW4 A;  4JI0 I;  2UXD I;  2Z5B A;  3ZZ0 A;  3PRY A;  4DR6 I;  4JI7 E;  2O1W A;  3K1J A;  2Z5B B;  4DV6 E;  2XEX A;  4IZJ A;  4DPX A;  4DPT A;  3J81 Q;  1N0U A;  4DV7 I;  4JI3 E;  4PRX A;  1MG7 A;  1Y4S A;  2PNM A;  4DV3 I;  2CG9 A;  4JI0 E;  2F4V I;  4DR3 E;  2IOP A;  4YY3 I;  2HKE A;  4KQV A;  4LF6 I;  2VQE I;  2UXB E;  4DV0 I;  3PYE A;  3D4J A;  2UUA E;  1XHK A;  4LF4 E;  3V5R A;  4X64 E;  1KTV A;  2UXC E;  1NZ0 A;  4LF4 I;  1A6F A;  4DU7 A;  1VIS A;  5L3J A;  3Q6M A;  3ZZU A;  3J81 C;  3LPS A;  4DUZ I;  4AQY E;  2Q2E B;  4DV4 E;  4LF6 E;  1ZXM A;  4WUD A;  4DR4 E;  1N0V C;  3T1H I;  2UU9 E;  2Z5C A;  3PYF A;  1HNW I;  1ZM2 A;  4JI6 E;  4K0K E;  3JAM Q;  4X65 E;  4I3H A;  4P52 A;  1NHH A;  2A2D A;  1I94 I;  1KVK A;  4K0K I;  2AJ4 A;  2HK3 A;  1Z0V A;  4DR7 E;  1FI4 A;  1USU A;  1PVG A;  3F0N A;  4JI5 E;  1XMQ I;  4HAC A;  3ZKD A;  4X62 I;  2E1R A;  3T1Y I;  4B3S I;  3K85 A;  1PKP A;  4JYA I;  1Z5A A;  4HYM A;  4LF8 E;  2EFG A;  4X66 I;  4P7A A;  1XNR E;  1HNX E;  2GQ0 A;  4LF8 I;  1FJG E;  2OI2 A;  1IBK E;  4DPW A;  5FLX C;  5IT9 Q;  1XNR I;  2VF3 A;  1ZM4 A;  4B3R I;  2NPF A;  2Z5E A;  3J80 Q;  1XNQ E;  1ZM3 A;  1UEK A;  3J7A M;  4FN5 A;  1N34 E;  1MU5 A;  2BM1 A;  4LFB I;  4DUZ E;  4OX9 I;  2HHH E;  4ZVI A;  2HK2 A;  1N32 I;  4LF5 I;  1H74 A;  1HR0 E;  4M1K A;  4LFA E;  3Q6N A;  4DV5 I;  4DUY I;  4ED4 A;  4JI8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...