4JV5I

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jv5I00
4KQVA 4DV6E 4B3RE 4USKA 5A2QQ 3ZKBA 2UXDI 2X36A 4NXNI 4YHHI 2AJ4A 2UXBI 4HACA 1MU5A 4DV7I 1NZ0A 1Z5BA 4DR2E 1Z0TA 3WU3A 4JI0I 1WUUA 4FWHA 2V2VA 2A2CA 4DV3I 4JI2E 3Q1QA 2V2QA 3B78A 1XMOE 1HNXI 2UXCE 1S4EA 1N33E 2E5LI 1IBKE 1Z0VA 1N34I 1KTVA 4DU8A 1KIJA 1HNXE 1XNQE 3K1JA 1H74A 1FJGI 2WW4A 4ZVIA 1N36E 2UUAI 1S16A 5GMDA 4MYTA 4DR5E 4DV2E 1H73A 4DUZE 2VQFI 4PRVA 5IWAI 5A2QC 4LF4I 4R1FA 2Q2EB 4HY1A 5IWAE 4LF8I 4GKJI 3PYFA 4LFBE 2J7KA 4X64E 4FW9A 1N32I 4LF8E 4B3ME 5LMNE 2UU9I 1Z0CA 3J80Q 1IBME 2OI2A 1HNZE 1BKNA 4AQYI 1ZM4A 4B3TI 3T1HI 4I3HA 1IBLE 4X62I 3QT7A 2BM0A 4B3TE 2UUBE 4OX9E 3J81Q 4DV1I 1HNWI 2HK3A 4GKKI 4JI8I 4JI5E 4LF7I 2ZBKB 1HR0I 4JV5I 4JI4E 4DR7I 2HHHI 4JI8E 4PU9A 4B3SE 5LL6R 4DR1E 4DV4I 2DEIA 1J5EE 4DR3I 1N0VC 4DV0I 4DPWA 3B82A 4JYAI 2DEJA 1U2RA 3QT8A 1PKPA 4JI1I 3WU5A 2EFGA 2UXDE 4NXNE 4YHHE 2UXBE 1KVKA 3ZKDA 1ZM3A 4DV7E 4MYUA 3V2UC 4DPUA 4DPTA 4WUCA 4RPFA 2HFSA 1N0UA 3J80C 1ZXNA 1KKHA 1PVGA 3PYEA 4WUDA 1UEKA 4DR6I 4JI0E 4DR4I 5IT9Q 4DV3E 3H4LA 3HULA 1Z5AA 4XTJA 2XEXA 3OTOI 4LFAI 4DR6E 1Z0BA 1EA6A 2HFUA 1FWKA 4M1KA 3J81C 5BR8I 1H7UA 3B8HA 2R3VA 2E5LE 4LFAE 4DV5I 4X66I 1N34E 3ZZTA 3K17A 4X65I 4KHPI 1FJGE 3WU4A 2LJPA 5L3JA 4X66E 3LTOA 4FN5A 1FKAE 2UUAE 2ZITA 1ZM9A 1XNRI 4P7AA 4UT4A 4UTGA 2UUCI 1OJ4A 2VQFE 1XHKA 3PYDA 3V5RA 5LMUI 4LF4E 4WUBA 2UUCE 2HKJA 3ZZUA 4LFCI 4EMDA 4GKJE 1I94I 1N32E 3D4JA 3F0NA 1Z0EA 1FWLA 2UU9E 3GONA 3PYGA 2A2DA 4Z7YA 4AQYE 5IT9C 1NHJA 3T1HE 2HK2A 1Z0GA 4X62E 4LF9I 4JI3I 4JI7I 1A6FA 4DV1E 3T1YI 1XMQI 1B63A 2E1RA 4LF5I 4JI6I 2VQEI 1NHHA 2F4VI 4LF6I 1HNWE 3WU6A 1D6TA 1MG7A 4GKKE 4YY3I 1XMQE 4LF7E 1HR0E 4PRXA 4JV5E 1ZXMA 4DR7E 4DUYI 2CZ9A 2HHHE 1MX0A 1PIEA 4DV6I 1DARA 4DV4E 4B3RI 3ZM7A 1Z5CA 4DPYA 4DR3E 3QT6A 3LNUA 3M6AA 4DV0E 4JYAE 3JAMQ 2NPFA 4JI1E 1ELOA 3J7AM 4DR2I 4HYMA 2BM1A 4HACB 4USMA 1Z0WA 2BV3A 4JI2I 1FI4A 4DR4E 2VF3A 1FNMA 3OTOE 2HKEA 1XMOI 2UXCI 2X7IA 1N33I 1IBKI 5FLXQ 5BR8E 4HXZA 4JG4A 1XNQI 3ZZ0A 4ED4A 4DV5E 4NXMI 4X65E 4KHPE 1N36I 1QZRA 4DR5I 4DV2I 4NXME 4Z7CA 4DUZI 1XNRE 1VISA 3CWVA 1K47A 1ZM2A 5LMUE 3LPSA 3JAMC 4P52A 4LFCE 4LFBI 4X64I 4B3MI 1I94E 1EI1A 5LMNI 4URLA 1IBMI 1HNZI 2V2ZA 3J7AG 2ZM6I 4FWGA 4DU7A 1IBLI 1NHIA 1RR9A 3QT5A 1H7SA 2UUBI 4LF9E 2ZM6E 4OX9I 1RREA 4JI7E 4JI3E 1Z59A 4FWDA 5FLXC 2V34A 3T1YE 4LF5E 4JI6E 2VQEE 2F4VE 4LF6E 4JI5I 1H72C 2V8PA 1B62A 4YY3E 2R42A 4K0KI 4JI4I 4DPXA 5GMEA 4B3SI 2GS8A 4DR1I 4DUYE 4K0KE 1J5EI 4DXLA
chains in the Genus database with same CATH superfamily
4KQVA 4DV6E 4B3RE 4USKA 5A2QQ 5C0XD 4IS9A 3ZKBA 2UXDI 2X36A 4NXNI 4YHHI 2AJ4A 2UXBI 2PNLA 4HACA 4QNKA 5DNLA 4OZEA 1MU5A 1YH8A 4DV7I 1NZ0A 1Z5BA 4DR2E 4NBQA 3H1CA 2C37B 4OKGA 1Z0TA 3WU3A 3GMEA 4JI0I 1WUUA 4FWHA 2V2VA 2A2CA 4DV3I 4JI2E 3DD6A 4DXLA 3Q1QA 2V2QA 3B78A 1XMOE 1HNXI 3UHMA 3PS3A 1P42A 2UXCE 1S4EA 1N33E 2E5LI 1IBKE 1R6LA 1Z0VA 1N34I 1KTVA 4DU8A 3L7ZB 1KIJA 1HNXE 1XNQE 3K1JA 4OO1B 1H74A 1FJGI 2WP8B 3Q6MA 2O1UA 2WW4A 4ZVIA 1N36E 2UUAI 1S16A 2NN6B 5GMDA 4MYTA 4DR5E 4DV2E 1H73A 4DUZE 2VQFI 4PRVA 5IWAI 5JEAA 3B4TA 5A2QC 4LF4I 4R1FA 2Q2EB 4HY1A 5IWAE 4LF8I 3CDJA 4AM3A 4GKJI 3CDIA 3PYFA 4LFBE 2J7KA 2JT2A 4X64E 4FW9A 1N32I 5JEAC 4LF8E 4B3ME 5LMNE 2UU9I 1Z0CA 3J80Q 1IBME 2OI2A 3HJCA 1HNZE 1BKNA 4AQYI 1ZM4A 2WNRA 4B3TI 5C0XB 3T1HI 2PO1B 4I3HA 3P76A 4BA1A 1IBLE 2PO2A 4X62I 3QT7A 2BM0A 2BA1G 4B3TE 2UUBE 4OX9E 2Z5EA 3J81Q 2C39B 4DV1I 5DNXA 4MDTA 1HNWI 2Z5CA 2HK3A 4GKKI 3U1KA 4JI8I 4JI5E 4LF7I 2ZBKB 1HR0I 5K36A 4JV5I 4AIDA 4JI4E 4DR7I 2HHHI 4JI8E 4BA2B 4PU9A 2CG9A 4B3SE 5LL6R 4DR1E 4DV4I 2DEIA 4FW3A 1J5EE 1Y60A 4DR3I 1UDNA 1N0VC 4DV0I 4DPWA 3B82A 4JYAI 2VESA 2DEJA 5K36C 1U2RA 3QT8A 1PKPA 4JI1I 3WU5A 2EFGA 2UXDE 4NXNE 4YHHE 2UXBE 1XXEA 2J65A 1KVKA 3ZKDA 1ZM3A 2C37A 4DV7E 4MYUA 3V2UC 4DPUA 4DPTA 4WUCA 4RPFA 2F1DA 2HFSA 1Y5YA 1N0UA 4QNJA 3J80C 1ZXNA 1KKHA 1PVGA 3PYEA 4WUDA 1UEKA 4DR6I 4JI0E 4GQUA 4DR4I 5IT9Q 4LPFA 4DV3E 3H4LA 3HULA 1Z5AA 4XTJA 2XEXA 3OTOI 4LFAI 4DR6E 1Z0BA 2C38B 4LCGA 1UDQA 1EA6A 1FWKA 2HFUA 4M1KA 3J81C 3L7ZA 3NZKA 3PRYA 4OO1A 3U1YA 5BR8I 1H7UA 3B8HA 2R3VA 2E5LE 4LFAE 1E3HA 1Y4UA 2WP8A 3HKMA 4DV5I 4X66I 1N34E 3ZZTA 1OYSA 2JE6B 4IZJB 4X65I 4KHPI 2NN6A 1FJGE 5JEAE 3WU4A 2LJPA 5L3JA 4X66E 3LTOA 4FN5A 3M85G 1FKAE 2UUAE 2ZITA 4OO1C 1ZM9A 1XNRI 4P7AA 4IZKB 4IZKA 4UT4A 2PO0B 4UTGA 2UUCI 1OJ4A 2VQFE 1XHKA 3PYDA 4IFDB 2NN6C 4LCHA 3V5RA 5LMUI 4LF4E 5ELWA 4LOMA 2BR2B 4WUBA 2UUCE 2HKJA 5JEAF 3ZZUA 4LFCI 3KRNA 4EMDA 3Q6NA 2JEAB 2GO3A 2JEAA 4GKJE 4FW4A 1I94I 1Y6ZA 1N32E 3D4JA 3GCMA 3F0NA 3P3CA 1Z0EA 4IFDC 1FWLA 5C0XA 2UU9E 2PO1A 3GONA 3PYGA 2A2DA 4Z7YA 4AQYE 5IT9C 4FW5A 1NHJA 3T1HE 2HK2A 1Z0GA 4X62E 4LF9I 2C39A 4JI3I 4JI7I 1A6FA 5C0XC 2BA0G 4DV1E 3T1YI 5K36E 1XMQI 5EL9A 1B63A 2E1RA 4LF5I 4JI6I 2VQEI 1NHHA 2F4VI 5JEAD 4LF6I 1HNWE 3WU6A 1RHYA 1D6TA 1MG7A 3PS2A 4GKKE 4YY3I 1XMQE 4LF7E 4BA2A 1Y4SA 1HR0E 4PRXA 4JV5E 2PNMA 1ZXMA 4DR7E 4DUYI 2O1VA 2CZ9A 2O3ZA 2HHHE 4MU4A 1MX0A 1PIEA 4FW7A 2Z5BB 4DV6I 5K36F 4U3DA 1HK7A 1DARA 4DV4E 4B3RI 1E3PA 3ZM7A 1Z5CA 4DPYA 4DR3E 3QT6A 3LNUA 3M6AA 4DV0E 3M85D 4JYAE 3JAMQ 2NPFA 5DRPA 4JI1E 2GQ0A 1ELOA 3J7AM 5DROA 2PNZB 2PNZA 4DR2I 4HYMA 2BM1A 4HACB 3P06A 2IOQA 4USMA 3P3EA 1Z0WA 2BV3A 1UDOA 4FW6A 4J3DA 4JI2I 1FI4A 4DR4E 4OO1E 2C38A 2VF3A 1FNMA 4ISAA 5DRQA 4U3BA 5K36D 3OTOE 3M7NG 2HKEA 1XMOI 2UXCI 2X7IA 3GLLA 2NN6E 1N33I 2IOPA 1IBKI 5FLXQ 4MU3A 5EKWA 5BR8E 2JE6A 2BA1D 4IZJA 4HXZA 4JG4A 1XNQI 3ZZ0A 1USUA 4ED4A 3K85A 4DV5E 5FWKA 4OO1F 4NXMI 4X65E 4KHPE 1N36I 3P3GA 2BA0D 1OYRA 1QZRA 2PO0A 4IFDE 1USVA 4DR5I 4DV2I 2IESA 2NN6F 4Z7CA 2JEBB 4NXME 4DUZI 2JEBA 1XNRE 1VISA 4IFDA 3CWVA 1K47A 2BR2A 1ZM2A 1VI7A 5JEAB 5LMUE 3LPSA 3JAMC 4P52A 5C0XE 4LFCE 4LFBI 4IFDF 4AIMA 2IERA 4X64I 5DRRA 4B3MI 1UDSA 1I94E 1EI1A 5LMNI 4URLA 1IBMI 3PS1A 1HNZI 2CVEA 4OO1D 2V2ZA 4MU0A 1OYPA 3J7AG 2ZM6I 4FWGA 4MU1A 4DU7A 1IBLI 5C0XF 4N3OA 1NHIA 2NN6D 2WNRB 4IZJD 1RR9A 3QT5A 1H7SA 1YHCA 2UUBI 4LF9E 2ZM6E 4OX9I 4BA1B 2PO2B 1RREA 4JI7E 4JI3E 2O1TA 1Z59A 4FWDA 5FLXC 2V34A 3T1YE 4MQYA 4LF5E 4JI6E 2VQEE 2F4VE 4LF6E 4LCFA 4JI5I 1H72C 2Z5CB 4IFDD 3M7ND 2AE8A 2CGEA 2GO4A 2V8PA 1B62A 1R6MA 2R42A 4YY3E 4K0KI 4JI4I 2O1WA 4DPXA 5GMEA 2Z5BA 4B3SI 2GS8A 5K36B 4DR1I 4DUYE 4K0KE 1J5EI 3K17A
chains in the Genus database with same CATH topology
4KQVA 4DV6E 4B3RE 4USKA 5A2QQ 3ZKBA 2UXDI 2X36A 4NXNI 4YHHI 2AJ4A 2UXBI 2PNLA 4HACA 1MU5A 4DV7I 1Z5BA 1NZ0A 4DR2E 1Z0TA 3WU3A 4JI0I 1WUUA 4FWHA 2V2VA 2A2CA 4DV3I 4JI2E 3Q1QA 2V2QA 3B78A 1XMOE 1HNXI 2UXCE 1S4EA 1N33E 2E5LI 1IBKE 1Z0VA 1N34I 1KTVA 4DU8A 1KIJA 1HNXE 1XNQE 3K1JA 1H74A 1FJGI 3Q6MA 2O1UA 2WW4A 4ZVIA 1N36E 2UUAI 1S16A 5GMDA 4MYTA 4DR5E 4DV2E 1H73A 4DUZE 2VQFI 4PRVA 5IWAI 5A2QC 4LF4I 4R1FA 2Q2EB 4HY1A 5IWAE 4LF8I 4GKJI 3PYFA 4LFBE 2J7KA 4X64E 4FW9A 1N32I 4LF8E 4B3ME 5LMNE 2UU9I 1Z0CA 3J80Q 1IBME 2OI2A 3HJCA 1HNZE 1BKNA 4AQYI 1ZM4A 4B3TI 3T1HI 4I3HA 1IBLE 4X62I 3QT7A 2BM0A 4B3TE 2UUBE 4OX9E 2Z5EA 3J81Q 4DV1I 1HNWI 2Z5CA 2HK3A 4GKKI 4JI8I 4JI5E 4LF7I 2ZBKB 1HR0I 4JV5I 4JI4E 4DR7I 2HHHI 4JI8E 4PU9A 2CG9A 4B3SE 5LL6R 4DR1E 4DV4I 2DEIA 1J5EE 4DR3I 1N0VC 4DV0I 4DPWA 3B82A 4JYAI 2DEJA 1U2RA 3QT8A 1PKPA 4JI1I 3WU5A 2EFGA 2UXDE 4NXNE 4YHHE 2UXBE 1KVKA 3ZKDA 1ZM3A 4DV7E 4MYUA 3V2UC 4DPUA 4DPTA 4WUCA 4RPFA 2HFSA 1N0UA 3J80C 1ZXNA 1KKHA 1PVGA 3PYEA 4WUDA 1UEKA 4DR6I 4JI0E 4DR4I 5IT9Q 4DV3E 3H4LA 3HULA 1Z5AA 4XTJA 2XEXA 3OTOI 4LFAI 4DR6E 1Z0BA 1EA6A 1FWKA 2HFUA 4M1KA 3J81C 5BR8I 3PRYA 1H7UA 3B8HA 2R3VA 2E5LE 4LFAE 1Y4UA 4DV5I 4X66I 1N34E 3ZZTA 4IZJB 3K17A 4X65I 4KHPI 1FJGE 3WU4A 2LJPA 5L3JA 4X66E 3LTOA 4FN5A 1FKAE 2UUAE 2ZITA 1ZM9A 1XNRI 4P7AA 4IZKB 4IZKA 4UT4A 4UTGA 2UUCI 1OJ4A 2VQFE 1XHKA 3PYDA 3V5RA 5LMUI 4LF4E 4WUBA 2UUCE 2HKJA 3ZZUA 4LFCI 4EMDA 3Q6NA 4GKJE 1I94I 1Y6ZA 1N32E 3D4JA 3F0NA 1Z0EA 1FWLA 2UU9E 3GONA 3PYGA 2A2DA 4Z7YA 4AQYE 5IT9C 1NHJA 3T1HE 2HK2A 1Z0GA 4X62E 4LF9I 4JI3I 4JI7I 1A6FA 4DV1E 3T1YI 1XMQI 1B63A 2E1RA 4LF5I 4JI6I 2VQEI 1NHHA 2F4VI 4LF6I 1HNWE 3WU6A 1D6TA 1MG7A 4GKKE 4YY3I 1XMQE 4LF7E 1Y4SA 1HR0E 4PRXA 4JV5E 2PNMA 1ZXMA 4DR7E 4DUYI 2O1VA 2CZ9A 2HHHE 1MX0A 1PIEA 2Z5BB 4DV6I 1HK7A 1DARA 4DV4E 4B3RI 3ZM7A 1Z5CA 4DPYA 4DR3E 3QT6A 3LNUA 3M6AA 4DV0E 4JYAE 3JAMQ 2NPFA 4JI1E 2GQ0A 1ELOA 3J7AM 4DR2I 4HYMA 2BM1A 4HACB 3P06A 2IOQA 4USMA 1Z0WA 2BV3A 4JI2I 1FI4A 4DR4E 2VF3A 1FNMA 3OTOE 2HKEA 1XMOI 2UXCI 2X7IA 1N33I 2IOPA 1IBKI 5FLXQ 5BR8E 4IZJA 4HXZA 4JG4A 1XNQI 3ZZ0A 1USUA 4ED4A 3K85A 4DV5E 5FWKA 4NXMI 4X65E 4KHPE 1N36I 1QZRA 1USVA 4DR5I 4DV2I 4NXME 4Z7CA 4DUZI 1XNRE 1VISA 3CWVA 1K47A 1ZM2A 5LMUE 3LPSA 3JAMC 4P52A 4LFCE 4LFBI 4X64I 4B3MI 1I94E 1EI1A 5LMNI 4URLA 1IBMI 1HNZI 2V2ZA 3J7AG 2ZM6I 4FWGA 4DU7A 1IBLI 4N3OA 1NHIA 4IZJD 1RR9A 3QT5A 1H7SA 2UUBI 4LF9E 2ZM6E 4OX9I 1RREA 4JI7E 4JI3E 2O1TA 1Z59A 4FWDA 5FLXC 2V34A 3T1YE 4LF5E 4JI6E 2VQEE 2F4VE 4LF6E 4JI5I 1H72C 2Z5CB 2CGEA 2V8PA 1B62A 4YY3E 2R42A 4K0KI 4JI4I 2O1WA 4DPXA 5GMEA 2Z5BA 4B3SI 2GS8A 4DR1I 4DUYE 4K0KE 1J5EI 4DXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQV A;  4DV6 E;  4B3R E;  4USK A;  5A2Q Q;  3ZKB A;  2UXD I;  2X36 A;  4NXN I;  4YHH I;  2AJ4 A;  2UXB I;  4HAC A;  1MU5 A;  4DV7 I;  1NZ0 A;  1Z5B A;  4DR2 E;  1Z0T A;  3WU3 A;  4JI0 I;  1WUU A;  4FWH A;  2V2V A;  2A2C A;  4DV3 I;  4JI2 E;  3Q1Q A;  2V2Q A;  3B78 A;  1XMO E;  1HNX I;  2UXC E;  1S4E A;  1N33 E;  2E5L I;  1IBK E;  1Z0V A;  1N34 I;  1KTV A;  4DU8 A;  1KIJ A;  1HNX E;  1XNQ E;  3K1J A;  1H74 A;  1FJG I;  2WW4 A;  4ZVI A;  1N36 E;  2UUA I;  1S16 A;  5GMD A;  4MYT A;  4DR5 E;  4DV2 E;  1H73 A;  4DUZ E;  2VQF I;  4PRV A;  5IWA I;  5A2Q C;  4LF4 I;  4R1F A;  2Q2E B;  4HY1 A;  5IWA E;  4LF8 I;  4GKJ I;  3PYF A;  4LFB E;  2J7K A;  4X64 E;  4FW9 A;  1N32 I;  4LF8 E;  4B3M E;  5LMN E;  2UU9 I;  1Z0C A;  3J80 Q;  1IBM E;  2OI2 A;  1HNZ E;  1BKN A;  4AQY I;  1ZM4 A;  4B3T I;  3T1H I;  4I3H A;  1IBL E;  4X62 I;  3QT7 A;  2BM0 A;  4B3T E;  2UUB E;  4OX9 E;  3J81 Q;  4DV1 I;  1HNW I;  2HK3 A;  4GKK I;  4JI8 I;  4JI5 E;  4LF7 I;  2ZBK B;  1HR0 I;  4JV5 I;  4JI4 E;  4DR7 I;  2HHH I;  4JI8 E;  4PU9 A;  4B3S E;  5LL6 R;  4DR1 E;  4DV4 I;  2DEI A;  1J5E E;  4DR3 I;  1N0V C;  4DV0 I;  4DPW A;  3B82 A;  4JYA I;  2DEJ A;  1U2R A;  3QT8 A;  1PKP A;  4JI1 I;  3WU5 A;  2EFG A;  2UXD E;  4NXN E;  4YHH E;  2UXB E;  1KVK A;  3ZKD A;  1ZM3 A;  4DV7 E;  4MYU A;  3V2U C;  4DPU A;  4DPT A;  4WUC A;  4RPF A;  2HFS A;  1N0U A;  3J80 C;  1ZXN A;  1KKH A;  1PVG A;  3PYE A;  4WUD A;  1UEK A;  4DR6 I;  4JI0 E;  4DR4 I;  5IT9 Q;  4DV3 E;  3H4L A;  3HUL A;  1Z5A A;  4XTJ A;  2XEX A;  3OTO I;  4LFA I;  4DR6 E;  1Z0B A;  1EA6 A;  2HFU A;  1FWK A;  4M1K A;  3J81 C;  5BR8 I;  1H7U A;  3B8H A;  2R3V A;  2E5L E;  4LFA E;  4DV5 I;  4X66 I;  1N34 E;  3ZZT A;  3K17 A;  4X65 I;  4KHP I;  1FJG E;  3WU4 A;  2LJP A;  5L3J A;  4X66 E;  3LTO A;  4FN5 A;  1FKA E;  2UUA E;  2ZIT A;  1ZM9 A;  1XNR I;  4P7A A;  4UT4 A;  4UTG A;  2UUC I;  1OJ4 A;  2VQF E;  1XHK A;  3PYD A;  3V5R A;  5LMU I;  4LF4 E;  4WUB A;  2UUC E;  2HKJ A;  3ZZU A;  4LFC I;  4EMD A;  4GKJ E;  1I94 I;  1N32 E;  3D4J A;  3F0N A;  1Z0E A;  1FWL A;  2UU9 E;  3GON A;  3PYG A;  2A2D A;  4Z7Y A;  4AQY E;  5IT9 C;  1NHJ A;  3T1H E;  2HK2 A;  1Z0G A;  4X62 E;  4LF9 I;  4JI3 I;  4JI7 I;  1A6F A;  4DV1 E;  3T1Y I;  1XMQ I;  1B63 A;  2E1R A;  4LF5 I;  4JI6 I;  2VQE I;  1NHH A;  2F4V I;  4LF6 I;  1HNW E;  3WU6 A;  1D6T A;  1MG7 A;  4GKK E;  4YY3 I;  1XMQ E;  4LF7 E;  1HR0 E;  4PRX A;  4JV5 E;  1ZXM A;  4DR7 E;  4DUY I;  2CZ9 A;  2HHH E;  1MX0 A;  1PIE A;  4DV6 I;  1DAR A;  4DV4 E;  4B3R I;  3ZM7 A;  1Z5C A;  4DPY A;  4DR3 E;  3QT6 A;  3LNU A;  3M6A A;  4DV0 E;  4JYA E;  3JAM Q;  2NPF A;  4JI1 E;  1ELO A;  3J7A M;  4DR2 I;  4HYM A;  2BM1 A;  4HAC B;  4USM A;  1Z0W A;  2BV3 A;  4JI2 I;  1FI4 A;  4DR4 E;  2VF3 A;  1FNM A;  3OTO E;  2HKE A;  1XMO I;  2UXC I;  2X7I A;  1N33 I;  1IBK I;  5FLX Q;  5BR8 E;  4HXZ A;  4JG4 A;  1XNQ I;  3ZZ0 A;  4ED4 A;  4DV5 E;  4NXM I;  4X65 E;  4KHP E;  1N36 I;  1QZR A;  4DR5 I;  4DV2 I;  4NXM E;  4Z7C A;  4DUZ I;  1XNR E;  1VIS A;  3CWV A;  1K47 A;  1ZM2 A;  5LMU E;  3LPS A;  3JAM C;  4P52 A;  4LFC E;  4LFB I;  4X64 I;  4B3M I;  1I94 E;  1EI1 A;  5LMN I;  4URL A;  1IBM I;  1HNZ I;  2V2Z A;  3J7A G;  2ZM6 I;  4FWG A;  4DU7 A;  1IBL I;  1NHI A;  1RR9 A;  3QT5 A;  1H7S A;  2UUB I;  4LF9 E;  2ZM6 E;  4OX9 I;  1RRE A;  4JI7 E;  4JI3 E;  1Z59 A;  4FWD A;  5FLX C;  2V34 A;  3T1Y E;  4LF5 E;  4JI6 E;  2VQE E;  2F4V E;  4LF6 E;  4JI5 I;  1H72 C;  2V8P A;  1B62 A;  4YY3 E;  2R42 A;  4K0K I;  4JI4 I;  4DPX A;  5GME A;  4B3S I;  2GS8 A;  4DR1 I;  4DUY E;  4K0K E;  1J5E I;  4DXL A; 
#chains in the Genus database with same CATH topology
 4KQV A;  4DV6 E;  4B3R E;  4USK A;  5A2Q Q;  5C0X D;  4IS9 A;  3ZKB A;  2UXD I;  2X36 A;  4NXN I;  4YHH I;  2AJ4 A;  2UXB I;  2PNL A;  4HAC A;  4QNK A;  5DNL A;  4OZE A;  1MU5 A;  1YH8 A;  4DV7 I;  1NZ0 A;  1Z5B A;  4DR2 E;  4NBQ A;  3H1C A;  2C37 B;  4OKG A;  1Z0T A;  3WU3 A;  3GME A;  4JI0 I;  1WUU A;  4FWH A;  2V2V A;  2A2C A;  4DV3 I;  4JI2 E;  3DD6 A;  4DXL A;  3Q1Q A;  2V2Q A;  3B78 A;  1XMO E;  1HNX I;  3UHM A;  3PS3 A;  1P42 A;  2UXC E;  1S4E A;  1N33 E;  2E5L I;  1IBK E;  1R6L A;  1Z0V A;  1N34 I;  1KTV A;  4DU8 A;  3L7Z B;  1KIJ A;  1HNX E;  1XNQ E;  3K1J A;  4OO1 B;  1H74 A;  1FJG I;  2WP8 B;  3Q6M A;  2O1U A;  2WW4 A;  4ZVI A;  1N36 E;  2UUA I;  1S16 A;  2NN6 B;  5GMD A;  4MYT A;  4DR5 E;  4DV2 E;  1H73 A;  4DUZ E;  2VQF I;  4PRV A;  5IWA I;  5JEA A;  3B4T A;  5A2Q C;  4LF4 I;  4R1F A;  2Q2E B;  4HY1 A;  5IWA E;  4LF8 I;  3CDJ A;  4AM3 A;  4GKJ I;  3CDI A;  3PYF A;  4LFB E;  2J7K A;  2JT2 A;  4X64 E;  4FW9 A;  1N32 I;  5JEA C;  4LF8 E;  4B3M E;  5LMN E;  2UU9 I;  1Z0C A;  3J80 Q;  1IBM E;  2OI2 A;  3HJC A;  1HNZ E;  1BKN A;  4AQY I;  1ZM4 A;  2WNR A;  4B3T I;  5C0X B;  3T1H I;  2PO1 B;  4I3H A;  3P76 A;  4BA1 A;  1IBL E;  2PO2 A;  4X62 I;  3QT7 A;  2BM0 A;  2BA1 G;  4B3T E;  2UUB E;  4OX9 E;  2Z5E A;  3J81 Q;  2C39 B;  4DV1 I;  5DNX A;  4MDT A;  1HNW I;  2Z5C A;  2HK3 A;  4GKK I;  3U1K A;  4JI8 I;  4JI5 E;  4LF7 I;  2ZBK B;  1HR0 I;  5K36 A;  4JV5 I;  4AID A;  4JI4 E;  4DR7 I;  2HHH I;  4JI8 E;  4BA2 B;  4PU9 A;  2CG9 A;  4B3S E;  5LL6 R;  4DR1 E;  4DV4 I;  2DEI A;  4FW3 A;  1J5E E;  1Y60 A;  4DR3 I;  1UDN A;  1N0V C;  4DV0 I;  4DPW A;  3B82 A;  4JYA I;  2VES A;  2DEJ A;  5K36 C;  1U2R A;  3QT8 A;  1PKP A;  4JI1 I;  3WU5 A;  2EFG A;  2UXD E;  4NXN E;  4YHH E;  2UXB E;  1XXE A;  2J65 A;  1KVK A;  3ZKD A;  1ZM3 A;  2C37 A;  4DV7 E;  4MYU A;  3V2U C;  4DPU A;  4DPT A;  4WUC A;  4RPF A;  2F1D A;  2HFS A;  1Y5Y A;  1N0U A;  4QNJ A;  3J80 C;  1ZXN A;  1KKH A;  1PVG A;  3PYE A;  4WUD A;  1UEK A;  4DR6 I;  4JI0 E;  4GQU A;  4DR4 I;  5IT9 Q;  4LPF A;  4DV3 E;  3H4L A;  3HUL A;  1Z5A A;  4XTJ A;  2XEX A;  3OTO I;  4LFA I;  4DR6 E;  1Z0B A;  2C38 B;  4LCG A;  1UDQ A;  1EA6 A;  1FWK A;  2HFU A;  4M1K A;  3J81 C;  3L7Z A;  3NZK A;  3PRY A;  4OO1 A;  3U1Y A;  5BR8 I;  1H7U A;  3B8H A;  2R3V A;  2E5L E;  4LFA E;  1E3H A;  1Y4U A;  2WP8 A;  3HKM A;  4DV5 I;  4X66 I;  1N34 E;  3ZZT A;  1OYS A;  2JE6 B;  4IZJ B;  4X65 I;  4KHP I;  2NN6 A;  1FJG E;  5JEA E;  3WU4 A;  2LJP A;  5L3J A;  4X66 E;  3LTO A;  4FN5 A;  3M85 G;  1FKA E;  2UUA E;  2ZIT A;  4OO1 C;  1ZM9 A;  1XNR I;  4P7A A;  4IZK B;  4IZK A;  4UT4 A;  2PO0 B;  4UTG A;  2UUC I;  1OJ4 A;  2VQF E;  1XHK A;  3PYD A;  4IFD B;  2NN6 C;  4LCH A;  3V5R A;  5LMU I;  4LF4 E;  5ELW A;  4LOM A;  2BR2 B;  4WUB A;  2UUC E;  2HKJ A;  5JEA F;  3ZZU A;  4LFC I;  3KRN A;  4EMD A;  3Q6N A;  2JEA B;  2GO3 A;  2JEA A;  4GKJ E;  4FW4 A;  1I94 I;  1Y6Z A;  1N32 E;  3D4J A;  3GCM A;  3F0N A;  3P3C A;  1Z0E A;  4IFD C;  1FWL A;  5C0X A;  2UU9 E;  2PO1 A;  3GON A;  3PYG A;  2A2D A;  4Z7Y A;  4AQY E;  5IT9 C;  4FW5 A;  1NHJ A;  3T1H E;  2HK2 A;  1Z0G A;  4X62 E;  4LF9 I;  2C39 A;  4JI3 I;  4JI7 I;  1A6F A;  5C0X C;  2BA0 G;  4DV1 E;  3T1Y I;  5K36 E;  1XMQ I;  5EL9 A;  1B63 A;  2E1R A;  4LF5 I;  4JI6 I;  2VQE I;  1NHH A;  2F4V I;  5JEA D;  4LF6 I;  1HNW E;  3WU6 A;  1RHY A;  1D6T A;  1MG7 A;  3PS2 A;  4GKK E;  4YY3 I;  1XMQ E;  4LF7 E;  4BA2 A;  1Y4S A;  1HR0 E;  4PRX A;  4JV5 E;  2PNM A;  1ZXM A;  4DR7 E;  4DUY I;  2O1V A;  2CZ9 A;  2O3Z A;  2HHH E;  4MU4 A;  1MX0 A;  1PIE A;  4FW7 A;  2Z5B B;  4DV6 I;  5K36 F;  4U3D A;  1HK7 A;  1DAR A;  4DV4 E;  4B3R I;  1E3P A;  3ZM7 A;  1Z5C A;  4DPY A;  4DR3 E;  3QT6 A;  3LNU A;  3M6A A;  4DV0 E;  3M85 D;  4JYA E;  3JAM Q;  2NPF A;  5DRP A;  4JI1 E;  2GQ0 A;  1ELO A;  3J7A M;  5DRO A;  2PNZ B;  2PNZ A;  4DR2 I;  4HYM A;  2BM1 A;  4HAC B;  3P06 A;  2IOQ A;  4USM A;  3P3E A;  1Z0W A;  2BV3 A;  1UDO A;  4FW6 A;  4J3D A;  4JI2 I;  1FI4 A;  4DR4 E;  4OO1 E;  2C38 A;  2VF3 A;  1FNM A;  4ISA A;  5DRQ A;  4U3B A;  5K36 D;  3OTO E;  3M7N G;  2HKE A;  1XMO I;  2UXC I;  2X7I A;  3GLL A;  2NN6 E;  1N33 I;  2IOP A;  1IBK I;  5FLX Q;  4MU3 A;  5EKW A;  5BR8 E;  2JE6 A;  2BA1 D;  4IZJ A;  4HXZ A;  4JG4 A;  1XNQ I;  3ZZ0 A;  1USU A;  4ED4 A;  3K85 A;  4DV5 E;  5FWK A;  4OO1 F;  4NXM I;  4X65 E;  4KHP E;  1N36 I;  3P3G A;  2BA0 D;  1OYR A;  1QZR A;  2PO0 A;  4IFD E;  1USV A;  4DR5 I;  4DV2 I;  2IES A;  2NN6 F;  4Z7C A;  2JEB B;  4NXM E;  4DUZ I;  2JEB A;  1XNR E;  1VIS A;  4IFD A;  3CWV A;  1K47 A;  2BR2 A;  1ZM2 A;  1VI7 A;  5JEA B;  5LMU E;  3LPS A;  3JAM C;  4P52 A;  5C0X E;  4LFC E;  4LFB I;  4IFD F;  4AIM A;  2IER A;  4X64 I;  5DRR A;  4B3M I;  1UDS A;  1I94 E;  1EI1 A;  5LMN I;  4URL A;  1IBM I;  3PS1 A;  1HNZ I;  2CVE A;  4OO1 D;  2V2Z A;  4MU0 A;  1OYP A;  3J7A G;  2ZM6 I;  4FWG A;  4MU1 A;  4DU7 A;  1IBL I;  5C0X F;  4N3O A;  1NHI A;  2NN6 D;  2WNR B;  4IZJ D;  1RR9 A;  3QT5 A;  1H7S A;  1YHC A;  2UUB I;  4LF9 E;  2ZM6 E;  4OX9 I;  4BA1 B;  2PO2 B;  1RRE A;  4JI7 E;  4JI3 E;  2O1T A;  1Z59 A;  4FWD A;  5FLX C;  2V34 A;  3T1Y E;  4MQY A;  4LF5 E;  4JI6 E;  2VQE E;  2F4V E;  4LF6 E;  4LCF A;  4JI5 I;  1H72 C;  2Z5C B;  4IFD D;  3M7N D;  2AE8 A;  2CGE A;  2GO4 A;  2V8P A;  1B62 A;  1R6M A;  2R42 A;  4YY3 E;  4K0K I;  4JI4 I;  2O1W A;  4DPX A;  5GME A;  2Z5B A;  4B3S I;  2GS8 A;  5K36 B;  4DR1 I;  4DUY E;  4K0K E;  1J5E I;  3K17 A; 
#chains in the Genus database with same CATH homology
 4KQV A;  4DV6 E;  4B3R E;  4USK A;  5A2Q Q;  3ZKB A;  2UXD I;  2X36 A;  4NXN I;  4YHH I;  2AJ4 A;  2UXB I;  2PNL A;  4HAC A;  1MU5 A;  4DV7 I;  1Z5B A;  1NZ0 A;  4DR2 E;  1Z0T A;  3WU3 A;  4JI0 I;  1WUU A;  4FWH A;  2V2V A;  2A2C A;  4DV3 I;  4JI2 E;  3Q1Q A;  2V2Q A;  3B78 A;  1XMO E;  1HNX I;  2UXC E;  1S4E A;  1N33 E;  2E5L I;  1IBK E;  1Z0V A;  1N34 I;  1KTV A;  4DU8 A;  1KIJ A;  1HNX E;  1XNQ E;  3K1J A;  1H74 A;  1FJG I;  3Q6M A;  2O1U A;  2WW4 A;  4ZVI A;  1N36 E;  2UUA I;  1S16 A;  5GMD A;  4MYT A;  4DR5 E;  4DV2 E;  1H73 A;  4DUZ E;  2VQF I;  4PRV A;  5IWA I;  5A2Q C;  4LF4 I;  4R1F A;  2Q2E B;  4HY1 A;  5IWA E;  4LF8 I;  4GKJ I;  3PYF A;  4LFB E;  2J7K A;  4X64 E;  4FW9 A;  1N32 I;  4LF8 E;  4B3M E;  5LMN E;  2UU9 I;  1Z0C A;  3J80 Q;  1IBM E;  2OI2 A;  3HJC A;  1HNZ E;  1BKN A;  4AQY I;  1ZM4 A;  4B3T I;  3T1H I;  4I3H A;  1IBL E;  4X62 I;  3QT7 A;  2BM0 A;  4B3T E;  2UUB E;  4OX9 E;  2Z5E A;  3J81 Q;  4DV1 I;  1HNW I;  2Z5C A;  2HK3 A;  4GKK I;  4JI8 I;  4JI5 E;  4LF7 I;  2ZBK B;  1HR0 I;  4JV5 I;  4JI4 E;  4DR7 I;  2HHH I;  4JI8 E;  4PU9 A;  2CG9 A;  4B3S E;  5LL6 R;  4DR1 E;  4DV4 I;  2DEI A;  1J5E E;  4DR3 I;  1N0V C;  4DV0 I;  4DPW A;  3B82 A;  4JYA I;  2DEJ A;  1U2R A;  3QT8 A;  1PKP A;  4JI1 I;  3WU5 A;  2EFG A;  2UXD E;  4NXN E;  4YHH E;  2UXB E;  1KVK A;  3ZKD A;  1ZM3 A;  4DV7 E;  4MYU A;  3V2U C;  4DPU A;  4DPT A;  4WUC A;  4RPF A;  2HFS A;  1N0U A;  3J80 C;  1ZXN A;  1KKH A;  1PVG A;  3PYE A;  4WUD A;  1UEK A;  4DR6 I;  4JI0 E;  4DR4 I;  5IT9 Q;  4DV3 E;  3H4L A;  3HUL A;  1Z5A A;  4XTJ A;  2XEX A;  3OTO I;  4LFA I;  4DR6 E;  1Z0B A;  1EA6 A;  1FWK A;  2HFU A;  4M1K A;  3J81 C;  5BR8 I;  3PRY A;  1H7U A;  3B8H A;  2R3V A;  2E5L E;  4LFA E;  1Y4U A;  4DV5 I;  4X66 I;  1N34 E;  3ZZT A;  4IZJ B;  3K17 A;  4X65 I;  4KHP I;  1FJG E;  3WU4 A;  2LJP A;  5L3J A;  4X66 E;  3LTO A;  4FN5 A;  1FKA E;  2UUA E;  2ZIT A;  1ZM9 A;  1XNR I;  4P7A A;  4IZK B;  4IZK A;  4UT4 A;  4UTG A;  2UUC I;  1OJ4 A;  2VQF E;  1XHK A;  3PYD A;  3V5R A;  5LMU I;  4LF4 E;  4WUB A;  2UUC E;  2HKJ A;  3ZZU A;  4LFC I;  4EMD A;  3Q6N A;  4GKJ E;  1I94 I;  1Y6Z A;  1N32 E;  3D4J A;  3F0N A;  1Z0E A;  1FWL A;  2UU9 E;  3GON A;  3PYG A;  2A2D A;  4Z7Y A;  4AQY E;  5IT9 C;  1NHJ A;  3T1H E;  2HK2 A;  1Z0G A;  4X62 E;  4LF9 I;  4JI3 I;  4JI7 I;  1A6F A;  4DV1 E;  3T1Y I;  1XMQ I;  1B63 A;  2E1R A;  4LF5 I;  4JI6 I;  2VQE I;  1NHH A;  2F4V I;  4LF6 I;  1HNW E;  3WU6 A;  1D6T A;  1MG7 A;  4GKK E;  4YY3 I;  1XMQ E;  4LF7 E;  1Y4S A;  1HR0 E;  4PRX A;  4JV5 E;  2PNM A;  1ZXM A;  4DR7 E;  4DUY I;  2O1V A;  2CZ9 A;  2HHH E;  1MX0 A;  1PIE A;  2Z5B B;  4DV6 I;  1HK7 A;  1DAR A;  4DV4 E;  4B3R I;  3ZM7 A;  1Z5C A;  4DPY A;  4DR3 E;  3QT6 A;  3LNU A;  3M6A A;  4DV0 E;  4JYA E;  3JAM Q;  2NPF A;  4JI1 E;  2GQ0 A;  1ELO A;  3J7A M;  4DR2 I;  4HYM A;  2BM1 A;  4HAC B;  3P06 A;  2IOQ A;  4USM A;  1Z0W A;  2BV3 A;  4JI2 I;  1FI4 A;  4DR4 E;  2VF3 A;  1FNM A;  3OTO E;  2HKE A;  1XMO I;  2UXC I;  2X7I A;  1N33 I;  2IOP A;  1IBK I;  5FLX Q;  5BR8 E;  4IZJ A;  4HXZ A;  4JG4 A;  1XNQ I;  3ZZ0 A;  1USU A;  4ED4 A;  3K85 A;  4DV5 E;  5FWK A;  4NXM I;  4X65 E;  4KHP E;  1N36 I;  1QZR A;  1USV A;  4DR5 I;  4DV2 I;  4NXM E;  4Z7C A;  4DUZ I;  1XNR E;  1VIS A;  3CWV A;  1K47 A;  1ZM2 A;  5LMU E;  3LPS A;  3JAM C;  4P52 A;  4LFC E;  4LFB I;  4X64 I;  4B3M I;  1I94 E;  1EI1 A;  5LMN I;  4URL A;  1IBM I;  1HNZ I;  2V2Z A;  3J7A G;  2ZM6 I;  4FWG A;  4DU7 A;  1IBL I;  4N3O A;  1NHI A;  4IZJ D;  1RR9 A;  3QT5 A;  1H7S A;  2UUB I;  4LF9 E;  2ZM6 E;  4OX9 I;  1RRE A;  4JI7 E;  4JI3 E;  2O1T A;  1Z59 A;  4FWD A;  5FLX C;  2V34 A;  3T1Y E;  4LF5 E;  4JI6 E;  2VQE E;  2F4V E;  4LF6 E;  4JI5 I;  1H72 C;  2Z5C B;  2CGE A;  2V8P A;  1B62 A;  4YY3 E;  2R42 A;  4K0K I;  4JI4 I;  2O1W A;  4DPX A;  5GME A;  2Z5B A;  4B3S I;  2GS8 A;  4DR1 I;  4DUY E;  4K0K E;  1J5E I;  4DXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...