4JV5I

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jv5I00
2BM1A 4X65I 1PKPA 4R1FA 4X62I 1N33I 4B3RI 4LFBE 1K47A 4DUYI 4X65E 4KHPI 1XMQI 4B3RE 1UEKA 1HNXI 2UU9I 4DUYE 4KHPE 1XMQE 3F0NA 3LTOA 2GS8A 1ZM4A 1HNXE 2UU9E 1Z0TA 4FWGA 3K1JA 4LF5I 2VQFI 4GKKI 4FWHA 1NHIA 4B3TI 3Q1QA 2NPFA 4DR6I 4JG4A 4LF5E 2VQFE 1NZ0A 4B3TE 4UT4A 3QT8A 4DR6E 4DR7I 4K0KI 5IT9C 1KTVA 1MU5A 4K0KE 1A6FA 2BV3A 4PU9A 1S4EA 5LMUI 5IWAI 4LF9I 5FLXC 4X64I 2UXBI 4DXLA 4RPFA 1KVKA 3D4JA 5LMUE 5IWAE 1DARA 1H7SA 4X64E 4DR1I 2UXBE 1H74A 1IBMI 4HACA 4DR1E 1N0VC 1B63A 4DV4I 2HK3A 1NHJA 3CWVA 1XNRE 2UXCI 1QZRA 4DV4E 1J5EI 3HULA 2V2ZA 1Z59A 4B3MI 3ZKBA 3WU5A 1J5EE 2AJ4A 4OX9I 2V2QA 4DV5E 1EA6A 3T1YE 1EI1A 4JV5I 3QT6A 4JI5E 1ZM3A 4JV5E 3B8HA 4WUDA 4JI1I 4Z7CA 1FWLA 2V8PA 1ELOA 1VISA 4JI1E 5IT9Q 3PYFA 4LFCI 2V2VA 1MX0A 2UUCE 1Z0WA 1ZM9A 4Z7YA 3ZKDA 4LFCE 2R42A 1N36I 3H4LA 2ZM6E 5FLXQ 4FWDA 1XNQE 1N36E 1HNZE 1RREA 3ZZUA 1MG7A 4LF4I 4X66I 1U2RA 1PVGA 4HXZA 4LFAE 2CZ9A 2UUAI 4DPUA 4LF4E 4X66E 3PYDA 2ZBKB 1FI4A 4I3HA 4USMA 2UUAE 1IBLE 1Z0VA 4WUBA 3V5RA 1XHKA 1HNWI 4FN5A 3WU4A 4KQVA 5LL6R 4JI7I 5BR8I 4WUCA 1HNWE 2HKEA 3QT7A 4JI7E 5BR8E 1XNRI 2R3VA 5L3JA 3OTOI 1N34I 4DR5E 2J7KA 1Z5BA 4JI2E 1B62A 3OTOE 1N34E 4YY3I 1FJGE 1H7UA 5LMNI 4DV5I 3WU3A 4YY3E 3J80Q 1WUUA 3T1YI 4JI5I 3M6AA 4DU7A 2V34A 5LMNE 2X7IA 1ZXMA 4NXNI 4ZVIA 2VF3A 4LF8I 2LJPA 4DV3I 4DV6I 2HHHE 4DU8A 4NXNE 3ZZ0A 2UUBE 1I94I 4LF8E 1HR0E 2F4VI 4GKJI 2E1RA 4DV3E 3J7AG 4DV6E 1KIJA 4JYAI 4UTGA 1OJ4A 1I94E 2F4VE 4GKJE 1Z0CA 5GMDA 3LNUA 4JYAE 4PRVA 2A2DA 4DV7E 2UUCI 4DR3E 3WU6A 1Z0GA 4DR2I 4DV2E 3J80C 3T1HI 2DEIA 5A2QC 2BM0A 1ZXNA 4AQYI 4DR2E 1D6TA 2ZM6I 1XNQI 3T1HE 1H73A 1RR9A 4MYUA 1HNZI 4AQYE 4FW9A 2HFSA 3J81C 2X36A 1H72C 4XTJA 1Z5AA 3JAMQ 4X62E 4JI6I 4YHHI 1N33E 3ZM7A 1Z5CA 4LFAI 4LF7I 1PIEA 3LPSA 2DEJA 4JI6E 4YHHE 1FKAE 2UXDI 1FWKA 3QT5A 4DV1I 4USKA 4LF7E 3V2UC 3B82A 1S16A 1IBLI 1N32I 3GONA 2UXDE 4DV1E 2E5LI 3PYEA 4MYTA 4JI8I 4DPYA 4GKKE 1N32E 4PRXA 2E5LE 4JI8E 2HKJA 2A2CA 4DR4I 4DR7E 3JAMC 3B78A 2XEXA 4DUZI 4M1KA 4ED4A 4DR5I 2HFUA 2OI2A 4DR4E 4JI2I 4DUZE 1XMOI 1IBKI 1FJGI 2WW4A 1BKNA 2ZITA 1XMOE 4LF9E 1IBKE 4EMDA 2VQEI 4JI4I 4HY1A 3K17A 3J7AM 4DPXA 4DV0I 4HACB 2VQEE 4JI4E 5A2QQ 1IBME 1Z0BA 2HHHI 1Z0EA 4DV0E 2HK2A 2UUBI 4LF6I 1HR0I 4URLA 4JI3I 2Q2EB 5GMEA 4NXMI 4JI0I 4LF6E 2UXCE 1ZM2A 4JI3E 3J81Q 4DPWA 4DV7I 4NXME 4JI0E 4DR3I 4P52A 4HYMA 1KKHA 4B3ME 2EFGA 4DV2I 3ZZTA 1FNMA 4OX9E 3PYGA 4P7AA 4DPTA 1N0UA 4B3SI 1NHHA 4LFBI 4B3SE
chains in the Genus database with same CATH superfamily
5JEAD 2BM1A 2CG9A 4BA2A 3HKMA 3P76A 4QNJA 4X65I 1PKPA 4R1FA 5ELWA 4X62I 4FW3A 4B3RI 4IZJB 4LFBE 1N33I 1K47A 3GMEA 3P3GA 4DUYI 4X65E 4KHPI 1XMQI 4B3RE 1UEKA 3P3CA 1HNXI 2UU9I 4DUYE 4KHPE 1XMQE 3F0NA 3LTOA 2GS8A 1ZM4A 1HNXE 2UU9E 1Z0TA 4FWGA 3K1JA 4LF5I 2VQFI 4GKKI 5K36D 2JE6B 4FWHA 1NHIA 4B3TI 3Q1QA 2NPFA 4DR6I 4JG4A 2AE8A 3U1YA 4LF5E 2VQFE 5JEAF 1NZ0A 4B3TE 4UT4A 3QT8A 4DR6E 4DR7I 4K0KI 5IT9C 1KTVA 1Y60A 1MU5A 4K0KE 5C0XB 1A6FA 1USVA 2BV3A 4FW7A 4MU4A 5JEAA 2IERA 4PU9A 1R6MA 1S4EA 5LMUI 5IWAI 4LF9I 5FLXC 4X64I 2UXBI 4DXLA 5K36F 1Y5YA 4RPFA 1KVKA 3D4JA 2O1TA 5LMUE 5IWAE 1DARA 1H7SA 4X64E 4OZEA 4DR1I 2UXBE 4IZKB 1H74A 2GO4A 1YHCA 4MU3A 1IBMI 4HACA 4DR1E 5DNXA 2PO0B 1N0VC 3P06A 4IZJD 1B63A 5K36A 2BA1D 4DV4I 2HK3A 2C37A 1NHJA 3CWVA 1XNRE 2UXCI 1QZRA 4DV4E 1J5EI 2JEBB 3P3EA 3HULA 1OYRA 4BA1A 2NN6D 2V2ZA 1Z59A 2IESA 4B3MI 2O1WA 4IS9A 3ZKBA 3WU5A 3NZKA 1J5EE 3GLLA 2AJ4A 2C38B 4OX9I 2V2QA 4DV5E 1EA6A 3T1YE 1EI1A 4JV5I 3QT6A 4JI5E 1ZM3A 4OO1B 2IOQA 4OO1C 4JV5E 3U1KA 3B8HA 4WUDA 3M7ND 4JI1I 4Z7CA 2NN6E 1FWLA 2BR2B 2V8PA 1ELOA 4LCFA 1VISA 2NN6F 3DD6A 4JI1E 4MU1A 2PNMA 5IT9Q 2WNRB 4IZJA 3PYFA 4FW5A 4IFDD 4LFCI 2V2VA 1MX0A 2PO2A 2UUCE 1Z0WA 1ZM9A 2GQ0A 4Z7YA 3ZKDA 4LFCE 2R42A 2C39B 1N36I 2NN6A 2O3ZA 4QNKA 3H4LA 5DRQA 2ZM6E 4BA2B 5FLXQ 4FWDA 2BA0G 1XNQE 1N36E 3M85G 1HNZE 1OYSA 2WP8A 5JEAE 1RREA 3ZZUA 5C0XF 1MG7A 4IFDE 3L7ZA 4IFDF 4LF4I 4OKGA 1U2RA 1PVGA 4HXZA 4X66I 4LFAE 2PO1A 3PS1A 3CDJA 4MU0A 2CZ9A 2Z5BA 2UUAI 4DPUA 4LF4E 1VI7A 4X66E 3PYDA 2ZBKB 1FI4A 3B4TA 4I3HA 4USMA 2UUAE 1IBLE 5K36E 4IFDA 1Z0VA 2CGEA 1UDQA 4WUBA 4AIMA 1HK7A 1R6LA 3V5RA 1XHKA 1HNWI 4FN5A 3UHMA 3WU4A 2JEAA 4KQVA 2CVEA 5LL6R 4AM3A 5EL9A 5BR8I 4JI7I 5DRRA 4IZKA 4WUCA 2O1VA 4AIDA 5JEAB 1HNWE 2HKEA 5JEAC 3H1CA 3QT7A 4MDTA 4JI7E 5BR8E 1XNRI 2R3VA 5L3JA 3OTOI 1N34I 4FW4A 4DR5E 2J7KA 1Z5BA 1OYPA 4JI2E 1B62A 3OTOE 1N34E 4YY3I 2Z5CA 3PS2A 1FJGE 1H7UA 1P42A 5LMNI 4DV5I 3WU3A 4YY3E 3J80Q 1WUUA 3T1YI 3M85D 4JI5I 3M6AA 4DU7A 5K36B 1USUA 2V34A 5LMNE 2X7IA 1UDOA 2PNLA 3PRYA 2C37B 1ZXMA 5K36C 4NXNI 4ZVIA 2VF3A 4LF8I 2LJPA 4DV3I 4DV6I 4LCGA 2HHHE 4DU8A 4NXNE 3ZZ0A 4BA1B 1I94I 2UUBE 1HR0E 4LF8E 2F4VI 4GKJI 2E1RA 4DV3E 3J7AG 4DV6E 1KIJA 4JYAI 2PNZB 2IOPA 4UTGA 1OJ4A 1I94E 2F4VE 5C0XD 4GKJE 1Z0CA 5GMDA 3LNUA 4JYAE 4ISAA 4PRVA 2A2DA 4DV7E 1YH8A 2UUCI 4DR3E 2WNRA 3WU6A 1Z0GA 4LCHA 2JT2A 4DR2I 1E3HA 4DV2E 3J80C 3T1HI 4N3OA 4MQYA 2DEIA 5A2QC 2BM0A 2Z5EA 1ZXNA 4AQYI 4U3BA 4DR2E 1XXEA 2ZM6I 1D6TA 1XNQI 3T1HE 1H73A 1RR9A 4MYUA 1HNZI 4AQYE 2GO3A 4FW9A 2HFSA 1UDNA 3J81C 5C0XE 2X36A 2JE6A 1H72C 2BA1G 4XTJA 1Y4UA 1Z5AA 2PO2B 3JAMQ 5DRPA 4X62E 4JI6I 3PS3A 4YHHI 3ZM7A 1N33E 1Z5CA 4LFAI 4LF7I 1PIEA 1Y4SA 3LPSA 2NN6B 2DEJA 4JI6E 4YHHE 1FKAE 1UDSA 1Y6ZA 2UXDI 1FWKA 3QT5A 4DV1I 2NN6C 4USKA 5FWKA 4LF7E 3V2UC 3B82A 5C0XA 1S16A 1IBLI 1N32I 3GONA 2UXDE 4DV1E 2E5LI 2WP8B 3PYEA 4MYTA 4FW6A 4JI8I 4DPYA 2F1DA 4NBQA 4GKKE 4OO1D 3Q6MA 2J65A 1N32E 4PRXA 2E5LE 2VESA 2O1UA 3L7ZB 4JI8E 2HKJA 2A2CA 2PO1B 4DR4I 4DR7E 3JAMC 2Z5BB 3B78A 3M7NG 2XEXA 4DUZI 1E3PA 4M1KA 3CDIA 5DROA 4ED4A 5C0XC 4DR5I 2HFUA 2OI2A 3KRNA 4DR4E 4JI2I 2PO0A 4DUZE 1XMOI 4IFDB 1IBKI 1FJGI 4IFDC 2WW4A 1BKNA 2ZITA 1XMOE 4OO1E 4LF9E 1IBKE 2JEBA 4EMDA 2JEAB 2VQEI 4JI4I 4OO1F 4HY1A 3K17A 3J7AM 2BA0D 4DPXA 4DV0I 4HACB 2VQEE 2C38A 4JI4E 5A2QQ 1IBME 1Z0BA 2HHHI 1Z0EA 4DV0E 2HK2A 4J3DA 5EKWA 2UUBI 4LF6I 3K85A 1HR0I 4URLA 4JI3I 2Q2EB 4OO1A 2Z5CB 5GMEA 4NXMI 4JI0I 4LF6E 2UXCE 1ZM2A 4JI3E 3J81Q 2PNZA 4DPWA 4DV7I 4NXME 4JI0E 4DR3I 4P52A 2BR2A 1KKHA 4HYMA 4B3ME 4GQUA 2EFGA 4DV2I 3Q6NA 3ZZTA 1FNMA 3GCMA 4LPFA 4LOMA 4OX9E 3PYGA 4P7AA 3HJCA 4U3DA 4DPTA 1N0UA 4B3SI 5DNLA 1RHYA 1NHHA 2C39A 4LFBI 4B3SE
chains in the Genus database with same CATH topology
2BM1A 2CG9A 4X65I 1PKPA 4R1FA 4X62I 1N33I 4B3RI 4LFBE 4IZJB 1K47A 4DUYI 4X65E 4KHPI 1XMQI 4B3RE 1UEKA 1HNXI 2UU9I 4DUYE 4KHPE 1XMQE 3F0NA 3LTOA 2GS8A 1ZM4A 1HNXE 2UU9E 1Z0TA 4FWGA 3K1JA 4LF5I 2VQFI 4GKKI 4FWHA 1NHIA 4B3TI 3Q1QA 2NPFA 4DR6I 4JG4A 4LF5E 2VQFE 1NZ0A 4B3TE 4UT4A 3QT8A 4DR6E 4DR7I 4K0KI 5IT9C 1KTVA 1MU5A 4K0KE 1A6FA 1USVA 2BV3A 4PU9A 1S4EA 5LMUI 5IWAI 4LF9I 5FLXC 4X64I 2UXBI 4DXLA 4RPFA 1KVKA 3D4JA 2O1TA 5LMUE 5IWAE 1DARA 1H7SA 4X64E 4DR1I 2UXBE 4IZKB 1H74A 1IBMI 4HACA 4DR1E 1N0VC 3P06A 4IZJD 1B63A 4DV4I 2HK3A 1NHJA 3CWVA 1XNRE 2UXCI 1QZRA 4DV4E 1J5EI 3HULA 2V2ZA 1Z59A 4B3MI 2O1WA 3ZKBA 3WU5A 1J5EE 2AJ4A 4OX9I 2V2QA 4DV5E 1EA6A 3T1YE 1EI1A 4JV5I 3QT6A 4JI5E 1ZM3A 2IOQA 4JV5E 3B8HA 4WUDA 4JI1I 4Z7CA 1FWLA 2V8PA 1ELOA 1VISA 4JI1E 2PNMA 5IT9Q 4IZJA 3PYFA 4LFCI 2V2VA 1MX0A 2UUCE 1Z0WA 1ZM9A 2GQ0A 4Z7YA 3ZKDA 4LFCE 2R42A 1N36I 3H4LA 2ZM6E 5FLXQ 4FWDA 1XNQE 1N36E 1HNZE 1RREA 3ZZUA 1MG7A 4LF4I 4X66I 1U2RA 1PVGA 4HXZA 4LFAE 2CZ9A 2Z5BA 2UUAI 4DPUA 4LF4E 4X66E 3PYDA 2ZBKB 1FI4A 4I3HA 4USMA 2UUAE 1IBLE 1Z0VA 2CGEA 4WUBA 1HK7A 3V5RA 1XHKA 1HNWI 4FN5A 3WU4A 4KQVA 5LL6R 4JI7I 5BR8I 4IZKA 4WUCA 2O1VA 1HNWE 2HKEA 3QT7A 4JI7E 5BR8E 1XNRI 2R3VA 5L3JA 3OTOI 1N34I 4DR5E 2J7KA 1Z5BA 4JI2E 1B62A 3OTOE 1N34E 4YY3I 2Z5CA 1FJGE 1H7UA 5LMNI 4DV5I 3WU3A 4YY3E 3J80Q 1WUUA 3T1YI 4JI5I 3M6AA 4DU7A 1USUA 2V34A 5LMNE 2X7IA 2PNLA 3PRYA 1ZXMA 4NXNI 4ZVIA 2VF3A 4LF8I 2LJPA 4DV3I 4DV6I 2HHHE 4DU8A 4NXNE 3ZZ0A 2UUBE 1I94I 4LF8E 1HR0E 2F4VI 4GKJI 2E1RA 4DV3E 3J7AG 4DV6E 1KIJA 4JYAI 2IOPA 4UTGA 1OJ4A 1I94E 2F4VE 4GKJE 1Z0CA 5GMDA 3LNUA 4JYAE 4PRVA 2A2DA 4DV7E 2UUCI 4DR3E 3WU6A 1Z0GA 4DR2I 4DV2E 3J80C 3T1HI 4N3OA 2DEIA 5A2QC 2BM0A 2Z5EA 1ZXNA 4AQYI 4DR2E 1D6TA 2ZM6I 1XNQI 3T1HE 1H73A 1RR9A 4MYUA 1HNZI 4AQYE 4FW9A 2HFSA 3J81C 2X36A 1H72C 1Y4UA 4XTJA 1Z5AA 3JAMQ 4X62E 4JI6I 4YHHI 1N33E 3ZM7A 1Z5CA 4LFAI 4LF7I 1PIEA 1Y4SA 3LPSA 2DEJA 4JI6E 4YHHE 1FKAE 1Y6ZA 2UXDI 1FWKA 3QT5A 4DV1I 4USKA 5FWKA 4LF7E 3V2UC 3B82A 1S16A 1IBLI 1N32I 3GONA 2UXDE 4DV1E 2E5LI 3PYEA 4MYTA 4JI8I 4DPYA 4GKKE 3Q6MA 1N32E 4PRXA 2E5LE 2O1UA 4JI8E 2HKJA 2A2CA 4DR4I 4DR7E 3JAMC 2Z5BB 3B78A 2XEXA 4DUZI 4M1KA 4ED4A 4DR5I 2HFUA 2OI2A 4DR4E 4JI2I 4DUZE 1XMOI 1IBKI 1FJGI 2WW4A 1BKNA 2ZITA 1XMOE 4LF9E 1IBKE 4EMDA 2VQEI 4JI4I 4HY1A 3K17A 3J7AM 4DPXA 4DV0I 4HACB 2VQEE 4JI4E 5A2QQ 1IBME 1Z0BA 2HHHI 1Z0EA 4DV0E 2HK2A 2UUBI 4LF6I 3K85A 1HR0I 4URLA 4JI3I 2Q2EB 2Z5CB 5GMEA 4NXMI 4JI0I 4LF6E 2UXCE 1ZM2A 4JI3E 3J81Q 4DPWA 4DV7I 4NXME 4JI0E 4DR3I 4P52A 4HYMA 1KKHA 4B3ME 2EFGA 4DV2I 3Q6NA 3ZZTA 1FNMA 4OX9E 3PYGA 4P7AA 3HJCA 4DPTA 1N0UA 4B3SI 1NHHA 4LFBI 4B3SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM1 A;  4X65 I;  1PKP A;  4R1F A;  4X62 I;  1N33 I;  4B3R I;  4LFB E;  1K47 A;  4DUY I;  4X65 E;  4KHP I;  1XMQ I;  4B3R E;  1UEK A;  1HNX I;  2UU9 I;  4DUY E;  4KHP E;  1XMQ E;  3F0N A;  3LTO A;  2GS8 A;  1ZM4 A;  1HNX E;  2UU9 E;  1Z0T A;  4FWG A;  3K1J A;  4LF5 I;  2VQF I;  4GKK I;  4FWH A;  1NHI A;  4B3T I;  3Q1Q A;  2NPF A;  4DR6 I;  4JG4 A;  4LF5 E;  2VQF E;  1NZ0 A;  4B3T E;  4UT4 A;  3QT8 A;  4DR6 E;  4DR7 I;  4K0K I;  5IT9 C;  1KTV A;  1MU5 A;  4K0K E;  1A6F A;  2BV3 A;  4PU9 A;  1S4E A;  5LMU I;  5IWA I;  4LF9 I;  5FLX C;  4X64 I;  2UXB I;  4DXL A;  4RPF A;  1KVK A;  3D4J A;  5LMU E;  5IWA E;  1DAR A;  1H7S A;  4X64 E;  4DR1 I;  2UXB E;  1H74 A;  1IBM I;  4HAC A;  4DR1 E;  1N0V C;  1B63 A;  4DV4 I;  2HK3 A;  1NHJ A;  3CWV A;  1XNR E;  2UXC I;  1QZR A;  4DV4 E;  1J5E I;  3HUL A;  2V2Z A;  1Z59 A;  4B3M I;  3ZKB A;  3WU5 A;  1J5E E;  2AJ4 A;  4OX9 I;  2V2Q A;  4DV5 E;  1EA6 A;  3T1Y E;  1EI1 A;  4JV5 I;  3QT6 A;  4JI5 E;  1ZM3 A;  4JV5 E;  3B8H A;  4WUD A;  4JI1 I;  4Z7C A;  1FWL A;  2V8P A;  1ELO A;  1VIS A;  4JI1 E;  5IT9 Q;  3PYF A;  4LFC I;  2V2V A;  1MX0 A;  2UUC E;  1Z0W A;  1ZM9 A;  4Z7Y A;  3ZKD A;  4LFC E;  2R42 A;  1N36 I;  3H4L A;  2ZM6 E;  5FLX Q;  4FWD A;  1XNQ E;  1N36 E;  1HNZ E;  1RRE A;  3ZZU A;  1MG7 A;  4LF4 I;  4X66 I;  1U2R A;  1PVG A;  4HXZ A;  4LFA E;  2CZ9 A;  2UUA I;  4DPU A;  4LF4 E;  4X66 E;  3PYD A;  2ZBK B;  1FI4 A;  4I3H A;  4USM A;  2UUA E;  1IBL E;  1Z0V A;  4WUB A;  3V5R A;  1XHK A;  1HNW I;  4FN5 A;  3WU4 A;  4KQV A;  5LL6 R;  4JI7 I;  5BR8 I;  4WUC A;  1HNW E;  2HKE A;  3QT7 A;  4JI7 E;  5BR8 E;  1XNR I;  2R3V A;  5L3J A;  3OTO I;  1N34 I;  4DR5 E;  2J7K A;  1Z5B A;  4JI2 E;  1B62 A;  3OTO E;  1N34 E;  4YY3 I;  1FJG E;  1H7U A;  5LMN I;  4DV5 I;  3WU3 A;  4YY3 E;  3J80 Q;  1WUU A;  3T1Y I;  4JI5 I;  3M6A A;  4DU7 A;  2V34 A;  5LMN E;  2X7I A;  1ZXM A;  4NXN I;  4ZVI A;  2VF3 A;  4LF8 I;  2LJP A;  4DV3 I;  4DV6 I;  2HHH E;  4DU8 A;  4NXN E;  3ZZ0 A;  2UUB E;  1I94 I;  4LF8 E;  1HR0 E;  2F4V I;  4GKJ I;  2E1R A;  4DV3 E;  3J7A G;  4DV6 E;  1KIJ A;  4JYA I;  4UTG A;  1OJ4 A;  1I94 E;  2F4V E;  4GKJ E;  1Z0C A;  5GMD A;  3LNU A;  4JYA E;  4PRV A;  2A2D A;  4DV7 E;  2UUC I;  4DR3 E;  3WU6 A;  1Z0G A;  4DR2 I;  4DV2 E;  3J80 C;  3T1H I;  2DEI A;  5A2Q C;  2BM0 A;  1ZXN A;  4AQY I;  4DR2 E;  1D6T A;  2ZM6 I;  1XNQ I;  3T1H E;  1H73 A;  1RR9 A;  4MYU A;  1HNZ I;  4AQY E;  4FW9 A;  2HFS A;  3J81 C;  2X36 A;  1H72 C;  4XTJ A;  1Z5A A;  3JAM Q;  4X62 E;  4JI6 I;  4YHH I;  1N33 E;  3ZM7 A;  1Z5C A;  4LFA I;  4LF7 I;  1PIE A;  3LPS A;  2DEJ A;  4JI6 E;  4YHH E;  1FKA E;  2UXD I;  1FWK A;  3QT5 A;  4DV1 I;  4USK A;  4LF7 E;  3V2U C;  3B82 A;  1S16 A;  1IBL I;  1N32 I;  3GON A;  2UXD E;  4DV1 E;  2E5L I;  3PYE A;  4MYT A;  4JI8 I;  4DPY A;  4GKK E;  1N32 E;  4PRX A;  2E5L E;  4JI8 E;  2HKJ A;  2A2C A;  4DR4 I;  4DR7 E;  3JAM C;  3B78 A;  2XEX A;  4DUZ I;  4M1K A;  4ED4 A;  4DR5 I;  2HFU A;  2OI2 A;  4DR4 E;  4JI2 I;  4DUZ E;  1XMO I;  1IBK I;  1FJG I;  2WW4 A;  1BKN A;  2ZIT A;  1XMO E;  4LF9 E;  1IBK E;  4EMD A;  2VQE I;  4JI4 I;  4HY1 A;  3K17 A;  3J7A M;  4DPX A;  4DV0 I;  4HAC B;  2VQE E;  4JI4 E;  5A2Q Q;  1IBM E;  1Z0B A;  2HHH I;  1Z0E A;  4DV0 E;  2HK2 A;  2UUB I;  4LF6 I;  1HR0 I;  4URL A;  4JI3 I;  2Q2E B;  5GME A;  4NXM I;  4JI0 I;  4LF6 E;  2UXC E;  1ZM2 A;  4JI3 E;  3J81 Q;  4DPW A;  4DV7 I;  4NXM E;  4JI0 E;  4DR3 I;  4P52 A;  4HYM A;  1KKH A;  4B3M E;  2EFG A;  4DV2 I;  3ZZT A;  1FNM A;  4OX9 E;  3PYG A;  4P7A A;  4DPT A;  1N0U A;  4B3S I;  1NHH A;  4LFB I;  4B3S E; 
#chains in the Genus database with same CATH topology
 5JEA D;  2BM1 A;  2CG9 A;  4BA2 A;  3HKM A;  3P76 A;  4QNJ A;  4X65 I;  1PKP A;  4R1F A;  5ELW A;  4X62 I;  4FW3 A;  4B3R I;  4IZJ B;  4LFB E;  1N33 I;  1K47 A;  3GME A;  3P3G A;  4DUY I;  4X65 E;  4KHP I;  1XMQ I;  4B3R E;  1UEK A;  3P3C A;  1HNX I;  2UU9 I;  4DUY E;  4KHP E;  1XMQ E;  3F0N A;  3LTO A;  2GS8 A;  1ZM4 A;  1HNX E;  2UU9 E;  1Z0T A;  4FWG A;  3K1J A;  4LF5 I;  2VQF I;  4GKK I;  5K36 D;  2JE6 B;  4FWH A;  1NHI A;  4B3T I;  3Q1Q A;  2NPF A;  4DR6 I;  4JG4 A;  2AE8 A;  3U1Y A;  4LF5 E;  2VQF E;  5JEA F;  1NZ0 A;  4B3T E;  4UT4 A;  3QT8 A;  4DR6 E;  4DR7 I;  4K0K I;  5IT9 C;  1KTV A;  1Y60 A;  1MU5 A;  4K0K E;  5C0X B;  1A6F A;  1USV A;  2BV3 A;  4FW7 A;  4MU4 A;  5JEA A;  2IER A;  4PU9 A;  1R6M A;  1S4E A;  5LMU I;  5IWA I;  4LF9 I;  5FLX C;  4X64 I;  2UXB I;  4DXL A;  5K36 F;  1Y5Y A;  4RPF A;  1KVK A;  3D4J A;  2O1T A;  5LMU E;  5IWA E;  1DAR A;  1H7S A;  4X64 E;  4OZE A;  4DR1 I;  2UXB E;  4IZK B;  1H74 A;  2GO4 A;  1YHC A;  4MU3 A;  1IBM I;  4HAC A;  4DR1 E;  5DNX A;  2PO0 B;  1N0V C;  3P06 A;  4IZJ D;  1B63 A;  5K36 A;  2BA1 D;  4DV4 I;  2HK3 A;  2C37 A;  1NHJ A;  3CWV A;  1XNR E;  2UXC I;  1QZR A;  4DV4 E;  1J5E I;  2JEB B;  3P3E A;  3HUL A;  1OYR A;  4BA1 A;  2NN6 D;  2V2Z A;  1Z59 A;  2IES A;  4B3M I;  2O1W A;  4IS9 A;  3ZKB A;  3WU5 A;  3NZK A;  1J5E E;  3GLL A;  2AJ4 A;  2C38 B;  4OX9 I;  2V2Q A;  4DV5 E;  1EA6 A;  3T1Y E;  1EI1 A;  4JV5 I;  3QT6 A;  4JI5 E;  1ZM3 A;  4OO1 B;  2IOQ A;  4OO1 C;  4JV5 E;  3U1K A;  3B8H A;  4WUD A;  3M7N D;  4JI1 I;  4Z7C A;  2NN6 E;  1FWL A;  2BR2 B;  2V8P A;  1ELO A;  4LCF A;  1VIS A;  2NN6 F;  3DD6 A;  4JI1 E;  4MU1 A;  2PNM A;  5IT9 Q;  2WNR B;  4IZJ A;  3PYF A;  4FW5 A;  4IFD D;  4LFC I;  2V2V A;  1MX0 A;  2PO2 A;  2UUC E;  1Z0W A;  1ZM9 A;  2GQ0 A;  4Z7Y A;  3ZKD A;  4LFC E;  2R42 A;  2C39 B;  1N36 I;  2NN6 A;  2O3Z A;  4QNK A;  3H4L A;  5DRQ A;  2ZM6 E;  4BA2 B;  5FLX Q;  4FWD A;  2BA0 G;  1XNQ E;  1N36 E;  3M85 G;  1HNZ E;  1OYS A;  2WP8 A;  5JEA E;  1RRE A;  3ZZU A;  5C0X F;  1MG7 A;  4IFD E;  3L7Z A;  4IFD F;  4LF4 I;  4OKG A;  1U2R A;  1PVG A;  4HXZ A;  4X66 I;  4LFA E;  2PO1 A;  3PS1 A;  3CDJ A;  4MU0 A;  2CZ9 A;  2Z5B A;  2UUA I;  4DPU A;  4LF4 E;  1VI7 A;  4X66 E;  3PYD A;  2ZBK B;  1FI4 A;  3B4T A;  4I3H A;  4USM A;  2UUA E;  1IBL E;  5K36 E;  4IFD A;  1Z0V A;  2CGE A;  1UDQ A;  4WUB A;  4AIM A;  1HK7 A;  1R6L A;  3V5R A;  1XHK A;  1HNW I;  4FN5 A;  3UHM A;  3WU4 A;  2JEA A;  4KQV A;  2CVE A;  5LL6 R;  4AM3 A;  5EL9 A;  5BR8 I;  4JI7 I;  5DRR A;  4IZK A;  4WUC A;  2O1V A;  4AID A;  5JEA B;  1HNW E;  2HKE A;  5JEA C;  3H1C A;  3QT7 A;  4MDT A;  4JI7 E;  5BR8 E;  1XNR I;  2R3V A;  5L3J A;  3OTO I;  1N34 I;  4FW4 A;  4DR5 E;  2J7K A;  1Z5B A;  1OYP A;  4JI2 E;  1B62 A;  3OTO E;  1N34 E;  4YY3 I;  2Z5C A;  3PS2 A;  1FJG E;  1H7U A;  1P42 A;  5LMN I;  4DV5 I;  3WU3 A;  4YY3 E;  3J80 Q;  1WUU A;  3T1Y I;  3M85 D;  4JI5 I;  3M6A A;  4DU7 A;  5K36 B;  1USU A;  2V34 A;  5LMN E;  2X7I A;  1UDO A;  2PNL A;  3PRY A;  2C37 B;  1ZXM A;  5K36 C;  4NXN I;  4ZVI A;  2VF3 A;  4LF8 I;  2LJP A;  4DV3 I;  4DV6 I;  4LCG A;  2HHH E;  4DU8 A;  4NXN E;  3ZZ0 A;  4BA1 B;  1I94 I;  2UUB E;  1HR0 E;  4LF8 E;  2F4V I;  4GKJ I;  2E1R A;  4DV3 E;  3J7A G;  4DV6 E;  1KIJ A;  4JYA I;  2PNZ B;  2IOP A;  4UTG A;  1OJ4 A;  1I94 E;  2F4V E;  5C0X D;  4GKJ E;  1Z0C A;  5GMD A;  3LNU A;  4JYA E;  4ISA A;  4PRV A;  2A2D A;  4DV7 E;  1YH8 A;  2UUC I;  4DR3 E;  2WNR A;  3WU6 A;  1Z0G A;  4LCH A;  2JT2 A;  4DR2 I;  1E3H A;  4DV2 E;  3J80 C;  3T1H I;  4N3O A;  4MQY A;  2DEI A;  5A2Q C;  2BM0 A;  2Z5E A;  1ZXN A;  4AQY I;  4U3B A;  4DR2 E;  1XXE A;  2ZM6 I;  1D6T A;  1XNQ I;  3T1H E;  1H73 A;  1RR9 A;  4MYU A;  1HNZ I;  4AQY E;  2GO3 A;  4FW9 A;  2HFS A;  1UDN A;  3J81 C;  5C0X E;  2X36 A;  2JE6 A;  1H72 C;  2BA1 G;  4XTJ A;  1Y4U A;  1Z5A A;  2PO2 B;  3JAM Q;  5DRP A;  4X62 E;  4JI6 I;  3PS3 A;  4YHH I;  3ZM7 A;  1N33 E;  1Z5C A;  4LFA I;  4LF7 I;  1PIE A;  1Y4S A;  3LPS A;  2NN6 B;  2DEJ A;  4JI6 E;  4YHH E;  1FKA E;  1UDS A;  1Y6Z A;  2UXD I;  1FWK A;  3QT5 A;  4DV1 I;  2NN6 C;  4USK A;  5FWK A;  4LF7 E;  3V2U C;  3B82 A;  5C0X A;  1S16 A;  1IBL I;  1N32 I;  3GON A;  2UXD E;  4DV1 E;  2E5L I;  2WP8 B;  3PYE A;  4MYT A;  4FW6 A;  4JI8 I;  4DPY A;  2F1D A;  4NBQ A;  4GKK E;  4OO1 D;  3Q6M A;  2J65 A;  1N32 E;  4PRX A;  2E5L E;  2VES A;  2O1U A;  3L7Z B;  4JI8 E;  2HKJ A;  2A2C A;  2PO1 B;  4DR4 I;  4DR7 E;  3JAM C;  2Z5B B;  3B78 A;  3M7N G;  2XEX A;  4DUZ I;  1E3P A;  4M1K A;  3CDI A;  5DRO A;  4ED4 A;  5C0X C;  4DR5 I;  2HFU A;  2OI2 A;  3KRN A;  4DR4 E;  4JI2 I;  2PO0 A;  4DUZ E;  1XMO I;  4IFD B;  1IBK I;  1FJG I;  4IFD C;  2WW4 A;  1BKN A;  2ZIT A;  1XMO E;  4OO1 E;  4LF9 E;  1IBK E;  2JEB A;  4EMD A;  2JEA B;  2VQE I;  4JI4 I;  4OO1 F;  4HY1 A;  3K17 A;  3J7A M;  2BA0 D;  4DPX A;  4DV0 I;  4HAC B;  2VQE E;  2C38 A;  4JI4 E;  5A2Q Q;  1IBM E;  1Z0B A;  2HHH I;  1Z0E A;  4DV0 E;  2HK2 A;  4J3D A;  5EKW A;  2UUB I;  4LF6 I;  3K85 A;  1HR0 I;  4URL A;  4JI3 I;  2Q2E B;  4OO1 A;  2Z5C B;  5GME A;  4NXM I;  4JI0 I;  4LF6 E;  2UXC E;  1ZM2 A;  4JI3 E;  3J81 Q;  2PNZ A;  4DPW A;  4DV7 I;  4NXM E;  4JI0 E;  4DR3 I;  4P52 A;  2BR2 A;  1KKH A;  4HYM A;  4B3M E;  4GQU A;  2EFG A;  4DV2 I;  3Q6N A;  3ZZT A;  1FNM A;  3GCM A;  4LPF A;  4LOM A;  4OX9 E;  3PYG A;  4P7A A;  3HJC A;  4U3D A;  4DPT A;  1N0U A;  4B3S I;  5DNL A;  1RHY A;  1NHH A;  2C39 A;  4LFB I;  4B3S E; 
#chains in the Genus database with same CATH homology
 2BM1 A;  2CG9 A;  4X65 I;  1PKP A;  4R1F A;  4X62 I;  1N33 I;  4B3R I;  4LFB E;  4IZJ B;  1K47 A;  4DUY I;  4X65 E;  4KHP I;  1XMQ I;  4B3R E;  1UEK A;  1HNX I;  2UU9 I;  4DUY E;  4KHP E;  1XMQ E;  3F0N A;  3LTO A;  2GS8 A;  1ZM4 A;  1HNX E;  2UU9 E;  1Z0T A;  4FWG A;  3K1J A;  4LF5 I;  2VQF I;  4GKK I;  4FWH A;  1NHI A;  4B3T I;  3Q1Q A;  2NPF A;  4DR6 I;  4JG4 A;  4LF5 E;  2VQF E;  1NZ0 A;  4B3T E;  4UT4 A;  3QT8 A;  4DR6 E;  4DR7 I;  4K0K I;  5IT9 C;  1KTV A;  1MU5 A;  4K0K E;  1A6F A;  1USV A;  2BV3 A;  4PU9 A;  1S4E A;  5LMU I;  5IWA I;  4LF9 I;  5FLX C;  4X64 I;  2UXB I;  4DXL A;  4RPF A;  1KVK A;  3D4J A;  2O1T A;  5LMU E;  5IWA E;  1DAR A;  1H7S A;  4X64 E;  4DR1 I;  2UXB E;  4IZK B;  1H74 A;  1IBM I;  4HAC A;  4DR1 E;  1N0V C;  3P06 A;  4IZJ D;  1B63 A;  4DV4 I;  2HK3 A;  1NHJ A;  3CWV A;  1XNR E;  2UXC I;  1QZR A;  4DV4 E;  1J5E I;  3HUL A;  2V2Z A;  1Z59 A;  4B3M I;  2O1W A;  3ZKB A;  3WU5 A;  1J5E E;  2AJ4 A;  4OX9 I;  2V2Q A;  4DV5 E;  1EA6 A;  3T1Y E;  1EI1 A;  4JV5 I;  3QT6 A;  4JI5 E;  1ZM3 A;  2IOQ A;  4JV5 E;  3B8H A;  4WUD A;  4JI1 I;  4Z7C A;  1FWL A;  2V8P A;  1ELO A;  1VIS A;  4JI1 E;  2PNM A;  5IT9 Q;  4IZJ A;  3PYF A;  4LFC I;  2V2V A;  1MX0 A;  2UUC E;  1Z0W A;  1ZM9 A;  2GQ0 A;  4Z7Y A;  3ZKD A;  4LFC E;  2R42 A;  1N36 I;  3H4L A;  2ZM6 E;  5FLX Q;  4FWD A;  1XNQ E;  1N36 E;  1HNZ E;  1RRE A;  3ZZU A;  1MG7 A;  4LF4 I;  4X66 I;  1U2R A;  1PVG A;  4HXZ A;  4LFA E;  2CZ9 A;  2Z5B A;  2UUA I;  4DPU A;  4LF4 E;  4X66 E;  3PYD A;  2ZBK B;  1FI4 A;  4I3H A;  4USM A;  2UUA E;  1IBL E;  1Z0V A;  2CGE A;  4WUB A;  1HK7 A;  3V5R A;  1XHK A;  1HNW I;  4FN5 A;  3WU4 A;  4KQV A;  5LL6 R;  4JI7 I;  5BR8 I;  4IZK A;  4WUC A;  2O1V A;  1HNW E;  2HKE A;  3QT7 A;  4JI7 E;  5BR8 E;  1XNR I;  2R3V A;  5L3J A;  3OTO I;  1N34 I;  4DR5 E;  2J7K A;  1Z5B A;  4JI2 E;  1B62 A;  3OTO E;  1N34 E;  4YY3 I;  2Z5C A;  1FJG E;  1H7U A;  5LMN I;  4DV5 I;  3WU3 A;  4YY3 E;  3J80 Q;  1WUU A;  3T1Y I;  4JI5 I;  3M6A A;  4DU7 A;  1USU A;  2V34 A;  5LMN E;  2X7I A;  2PNL A;  3PRY A;  1ZXM A;  4NXN I;  4ZVI A;  2VF3 A;  4LF8 I;  2LJP A;  4DV3 I;  4DV6 I;  2HHH E;  4DU8 A;  4NXN E;  3ZZ0 A;  2UUB E;  1I94 I;  4LF8 E;  1HR0 E;  2F4V I;  4GKJ I;  2E1R A;  4DV3 E;  3J7A G;  4DV6 E;  1KIJ A;  4JYA I;  2IOP A;  4UTG A;  1OJ4 A;  1I94 E;  2F4V E;  4GKJ E;  1Z0C A;  5GMD A;  3LNU A;  4JYA E;  4PRV A;  2A2D A;  4DV7 E;  2UUC I;  4DR3 E;  3WU6 A;  1Z0G A;  4DR2 I;  4DV2 E;  3J80 C;  3T1H I;  4N3O A;  2DEI A;  5A2Q C;  2BM0 A;  2Z5E A;  1ZXN A;  4AQY I;  4DR2 E;  1D6T A;  2ZM6 I;  1XNQ I;  3T1H E;  1H73 A;  1RR9 A;  4MYU A;  1HNZ I;  4AQY E;  4FW9 A;  2HFS A;  3J81 C;  2X36 A;  1H72 C;  1Y4U A;  4XTJ A;  1Z5A A;  3JAM Q;  4X62 E;  4JI6 I;  4YHH I;  1N33 E;  3ZM7 A;  1Z5C A;  4LFA I;  4LF7 I;  1PIE A;  1Y4S A;  3LPS A;  2DEJ A;  4JI6 E;  4YHH E;  1FKA E;  1Y6Z A;  2UXD I;  1FWK A;  3QT5 A;  4DV1 I;  4USK A;  5FWK A;  4LF7 E;  3V2U C;  3B82 A;  1S16 A;  1IBL I;  1N32 I;  3GON A;  2UXD E;  4DV1 E;  2E5L I;  3PYE A;  4MYT A;  4JI8 I;  4DPY A;  4GKK E;  3Q6M A;  1N32 E;  4PRX A;  2E5L E;  2O1U A;  4JI8 E;  2HKJ A;  2A2C A;  4DR4 I;  4DR7 E;  3JAM C;  2Z5B B;  3B78 A;  2XEX A;  4DUZ I;  4M1K A;  4ED4 A;  4DR5 I;  2HFU A;  2OI2 A;  4DR4 E;  4JI2 I;  4DUZ E;  1XMO I;  1IBK I;  1FJG I;  2WW4 A;  1BKN A;  2ZIT A;  1XMO E;  4LF9 E;  1IBK E;  4EMD A;  2VQE I;  4JI4 I;  4HY1 A;  3K17 A;  3J7A M;  4DPX A;  4DV0 I;  4HAC B;  2VQE E;  4JI4 E;  5A2Q Q;  1IBM E;  1Z0B A;  2HHH I;  1Z0E A;  4DV0 E;  2HK2 A;  2UUB I;  4LF6 I;  3K85 A;  1HR0 I;  4URL A;  4JI3 I;  2Q2E B;  2Z5C B;  5GME A;  4NXM I;  4JI0 I;  4LF6 E;  2UXC E;  1ZM2 A;  4JI3 E;  3J81 Q;  4DPW A;  4DV7 I;  4NXM E;  4JI0 E;  4DR3 I;  4P52 A;  4HYM A;  1KKH A;  4B3M E;  2EFG A;  4DV2 I;  3Q6N A;  3ZZT A;  1FNM A;  4OX9 E;  3PYG A;  4P7A A;  3HJC A;  4DPT A;  1N0U A;  4B3S I;  1NHH A;  4LFB I;  4B3S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...