4YY3I

30s ribosomal subunit- higb complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yy3I00
4JV5E 2J7KA 2V2ZA 4DV3I 4NXNE 2CZ9A 1XNQE 1DARA 1N0VC 3PYDA 4LF5I 4FN5A 4JI1E 3T1YI 3J80C 3PYFA 4B3TE 3QT6A 4RPFA 4URLA 4DPTA 4DR4E 4DR6E 4GKKE 3V5RA 2VQFE 1NHIA 3ZZTA 1FI4A 4DV6E 3ZKBA 3J80Q 1NHJA 1Z0EA 4X65I 1ZXNA 4DR3I 1HNXI 4YY3E 1I94I 4LF8E 1QZRA 4MYTA 1N36E 4WUBA 4DU8A 4HACA 3QT5A 3LNUA 1ZM9A 5BR8I 5L3JA 2V2QA 4LF7I 4X66E 2HKEA 3WU5A 4FW9A 4JI8I 3PYEA 3J7AM 3K17A 4OX9E 4B3ME 5IWAE 2ZM6E 1H7SA 3QT7A 4DV5I 1N34E 4B3RE 1IBME 2UXCI 1PIEA 4DUYE 4DXLA 1H74A 1IBLE 3LPSA 4R1FA 1HR0E 4JI6I 3T1HI 3B8HA 2ZITA 4PU9A 2DEIA 4DV0E 1J5EI 2A2DA 4HY1A 4DV4I 2AJ4A 2UU9I 4DR2E 2HK2A 1N32E 5GMEA 1RREA 4GKJE 3ZZ0A 4Z7YA 2Q2EB 4LF6E 1N33I 1EI1A 2HHHE 2VF3A 3WU6A 4USMA 4YHHI 2UUCI 4DU7A 4UT4A 1ZXMA 2E5LE 4DUZE 3J7AG 4DR5I 1Z5CA 4JI3I 4JI4I 1Z59A 4ZVIA 2UUAE 3OTOE 4AQYI 4FWHA 4JI0E 2R3VA 4LFAI 2V2VA 4M1KA 2OI2A 2UXDI 4JI5E 3WU3A 1OJ4A 1EA6A 1XNRE 4LF8I 4NXME 1ZM2A 4X64I 5GMDA 1VISA 4K0KI 1FKAE 4KQVA 5LL6R 2V8PA 1IBKI 1U2RA 1Z0CA 4LF9I 2HFSA 2HK3A 4JI7I 3D4JA 5LMNE 4DV3E 1XMOI 4KHPI 1N34I 1A6FA 3B82A 3F0NA 4LF5E 4UTGA 3T1YE 4B3SE 1B62A 4LFCI 4DPYA 3QT8A 1MX0A 4WUDA 2A2CA 3PYGA 4X65E 4P52A 4DR3E 1HNXE 5LMUI 1ELOA 4LFBI 4HXZA 1I94E 1NHHA 4DV1I 2VQEI 5BR8E 3Q1QA 4LF7E 4USKA 1UEKA 1FJGI 2E1RA 1H7UA 4JI8E 3J81C 3B78A 3H4LA 4JI2I 2DEJA 1HNWI 3K1JA 1KTVA 4PRXA 4DR1I 1WUUA 4DV5E 4DPWA 1Z0VA 4MYUA 2UUBI 1D6TA 2F4VI 1ZM4A 1Z0WA 3J81Q 4DR7E 2UXCE 1XMQI 1MU5A 2LJPA 2XEXA 1HNZI 3T1HE 4DV7I 1H72C 4DUZI 1RR9A 2V34A 1FNMA 1N0UA 1J5EE 2BV3A 2UXBI 4X62I 4JV5I 2ZBKB 3LTOA 2X7IA 4WUCA 4NXNI 1XNQI 1FWKA 4DV4E 4JI1I 5IT9C 3ZM7A 4B3TI 4DR4I 4DR6I 4GKKI 2VQFI 2R42A 2X36A 1K47A 1Z5AA 1B63A 4DV6I 1N33E 4JYAE 4DPUA 4P7AA 5IT9Q 4YHHE 4DV2E 5A2QC 4LF4E 2UUCE 4YY3I 1N36I 3CWVA 4HYMA 3ZZUA 4ED4A 5LMNI 4DR5E 4DPXA 4X66I 4JI3E 4JI4E 5A2QQ 4B3SI 4OX9I 4B3MI 5IWAI 2BM1A 4FWDA 2ZM6I 1Z0TA 1Z5BA 4HACB 1KKHA 4AQYE 4B3RI 1IBMI 1BKNA 4DUYI 4LFAE 1IBLI 1HR0I 2UXDE 1Z0BA 4DV0I 4X64E 3GONA 4K0KE 2BM0A 2HFUA 3WU4A 1Z0GA 1IBKE 5FLXC 4LF9E 4JI7E 1XMOE 4PRVA 4KHPE 4DR2I 1XHKA 2EFGA 4DR7I 5FLXQ 1PKPA 4XTJA 3JAMC 1N32I 4LFCE 4JG4A 4GKJI 2HKJA 4LF6I 1KVKA 2HHHI 1H73A 3M6AA 3JAMQ 1S4EA 5LMUE 4JI6E 4LFBE 3V2UC 2E5LI 3HULA 4DV1E 2VQEE 1NZ0A 1S16A 1FJGE 1PVGA 2GS8A 4JI2E 1HNWE 2NPFA 2UUAI 3OTOI 1FWLA 4DR1E 4I3HA 2WW4A 2UU9E 4FWGA 1KIJA 4JYAI 4JI0I 2UUBE 2F4VE 1MG7A 4DV2I 3ZKDA 4LF4I 1XMQE 4JI5I 4EMDA 1HNZE 1XNRI 4Z7CA 4NXMI 4DV7E 1ZM3A 2UXBE 4X62E
chains in the Genus database with same CATH superfamily
4JV5E 2J7KA 2V2ZA 4DV3I 4NXNE 2CZ9A 1XNQE 1DARA 4LOMA 1N0VC 3PYDA 2PNMA 2O1VA 4LF5I 4FN5A 4JI1E 3T1YI 3J80C 2PNZB 2PO2B 2NN6E 3PYFA 4B3TE 3QT6A 4RPFA 2C38B 1UDQA 2BR2A 2WP8A 4DPTA 4URLA 4DR4E 4DR6E 3NZKA 4GKKE 3V5RA 2VQFE 1NHIA 4IFDD 3ZZTA 1FI4A 4DV6E 3ZKBA 3M7NG 3J80Q 3L7ZB 1NHJA 1Z0EA 5FWKA 4X65I 2O1WA 1ZXNA 4DR3I 1HNXI 4IS9A 4YY3E 2JEAA 1I94I 2F1DA 4LF8E 1QZRA 5K36C 1R6LA 4MYTA 1N36E 4WUBA 4DU8A 3U1KA 4HACA 3QT5A 3LNUA 1XXEA 1ZM9A 5BR8I 5L3JA 2V2QA 2C37B 4LF7I 4X66E 2HKEA 3WU5A 4FW9A 4LCFA 2AE8A 3PYEA 4JI8I 3J7AM 1Y4UA 3K17A 4OX9E 4B3ME 5IWAE 2ZM6E 1H7SA 2Z5BA 3QT7A 4DV5I 1N34E 4B3RE 2IESA 1IBME 2UXCI 2NN6C 1PIEA 4DUYE 4MU4A 4DXLA 1H74A 1IBLE 3H1CA 3LPSA 4R1FA 1HR0E 4JI6I 3T1HI 2PO1B 2O1TA 3B8HA 2PO0B 2JEBA 4IFDE 2ZITA 4PU9A 2DEIA 4IZJB 4DV0E 1J5EI 5EL9A 2NN6B 1HK7A 2JT2A 2A2DA 2GO3A 4HY1A 4DV4I 2AJ4A 2VESA 2UU9I 4DR2E 2HK2A 4LPFA 1N32E 5GMEA 1RREA 4GKJE 3ZZ0A 4Z7YA 2Q2EB 2JE6A 4LF6E 1N33I 1EI1A 2HHHE 2VF3A 3WU6A 5JEAF 4USMA 4YHHI 3CDJA 3GMEA 1E3HA 4OKGA 4OO1F 2UUCI 4DU7A 4UT4A 1ZXMA 2E5LE 4DUZE 3J7AG 4IFDC 5ELWA 4DR5I 1Z5CA 5DRRA 2GO4A 5JEAA 3P76A 4JI3I 4JI4I 4OO1A 1Z59A 4ZVIA 3M85D 2IOPA 4IZKB 4IFDB 2UUAE 5C0XE 3PS2A 3OTOE 4AQYI 5DRQA 2Z5CA 5DROA 4FWHA 4JI0E 2R3VA 4LFAI 2V2VA 5JEAD 4M1KA 2OI2A 4MQYA 2UXDI 4JI5E 4OO1D 3WU3A 2WP8B 1OJ4A 1EA6A 2BR2B 1XNRE 4LF8I 4NXME 1USUA 1ZM2A 4X64I 5GMDA 1VISA 4K0KI 4BA1B 1YHCA 1FKAE 4KQVA 5LL6R 2V8PA 1IBKI 1U2RA 1Z0CA 4LF9I 2HFSA 2HK3A 4JI7I 2IOQA 3D4JA 5LMNE 4DV3E 1XMOI 4KHPI 4N3OA 1N34I 2O1UA 1A6FA 3B82A 3F0NA 4LF5E 2O3ZA 4UTGA 4U3DA 3T1YE 4B3SE 5DNLA 1B62A 4LFCI 2C39A 4FW4A 4DPYA 1USVA 5K36F 5C0XC 3B4TA 2BA0D 2CGEA 2Z5BB 2C37A 3QT8A 1MX0A 4WUDA 2A2CA 2BA1D 3PYGA 5JEAE 4X65E 4P52A 4DR3E 1HNXE 5LMUI 1ELOA 4MU0A 4LFBI 4FW7A 5K36A 4HXZA 1I94E 4AIMA 3PS1A 5C0XB 1NHHA 3HKMA 4DV1I 2VQEI 5BR8E 3Q1QA 4LF7E 4USKA 3M85G 1UEKA 1FJGI 1VI7A 2E1RA 1H7UA 3PRYA 4JI8E 3J81C 3B78A 3H4LA 4JI2I 2DEJA 4BA2A 3K1JA 1HNWI 2PO1A 4QNKA 1KTVA 4PRXA 4DR1I 3P06A 3P3GA 5K36D 1WUUA 4DV5E 4DPWA 1Z0VA 4ISAA 4MYUA 2UUBI 1D6TA 2NN6A 1P42A 2F4VI 1ZM4A 1Z0WA 3J81Q 4DR7E 2UXCE 1XMQI 3Q6NA 1MU5A 2LJPA 2XEXA 1HNZI 3T1HE 4DV7I 1H72C 4DUZI 3HJCA 1RR9A 1R6MA 2J65A 3KRNA 2JE6B 4FW3A 2V34A 1FNMA 1N0UA 1J5EE 2BV3A 5JEAC 2UXBI 4X62I 4JV5I 2ZBKB 3LTOA 2WNRB 2X7IA 4WUCA 4NXNI 1XNQI 1FWKA 4FW6A 4DV4E 4JI1I 5IT9C 3ZM7A 5JEAB 2CG9A 4MU1A 4B3TI 3P3CA 4DR4I 4DR6I 4GKKI 4LCGA 2BA0G 2VQFI 3DD6A 2R42A 2X36A 1K47A 1Z5AA 1B63A 4DV6I 1N33E 4JYAE 2BA1G 4DPUA 3UHMA 4P7AA 5IT9Q 4YHHE 4DV2E 5A2QC 4LF4E 2UUCE 4YY3I 4IZKA 1N36I 4IFDA 3CWVA 3K85A 4HYMA 2PNLA 3ZZUA 4ED4A 5LMNI 4DR5E 4DPXA 1Y6ZA 4X66I 4QNJA 2PNZA 2PO2A 4JI3E 4JI4E 2C38A 5A2QQ 4B3SI 4OX9I 4B3MI 5IWAI 2BM1A 4FWDA 2JEAB 2ZM6I 1Z0TA 3Q6MA 1Z5BA 3GCMA 4HACB 2GQ0A 1KKHA 4AQYE 4B3RI 1IBMI 4BA1A 1UDNA 3L7ZA 1BKNA 4DUYI 4LFAE 1IBLI 3GLLA 1HR0I 2UXDE 1Z0BA 2C39B 1Y5YA 1OYPA 4MDTA 4X64E 4DV0I 1YH8A 3GONA 4K0KE 2IERA 2BM0A 2HFUA 3WU4A 1Z0GA 1IBKE 4OO1E 5FLXC 4LF9E 4OZEA 2CVEA 4MU3A 5K36B 4JI7E 5C0XF 2JEBB 1XMOE 4PRVA 4KHPE 4DR2I 1XHKA 2NN6F 2EFGA 4DR7I 5FLXQ 1PKPA 4XTJA 4AIDA 3JAMC 1N32I 4LFCE 2PO0A 4JG4A 4GKJI 5C0XA 4BA2B 2HKJA 4GQUA 4LF6I 4IZJA 5EKWA 1KVKA 2HHHI 1H73A 4NBQA 1UDSA 3M7ND 3M6AA 3PS3A 3JAMQ 1S4EA 5LMUE 4JI6E 4LFBE 3U1YA 3V2UC 2Z5EA 2E5LI 1OYSA 3HULA 4DV1E 2VQEE 5C0XD 1NZ0A 1S16A 1FJGE 4IZJD 3CDIA 1PVGA 1UDOA 1E3PA 4OO1C 2GS8A 4LCHA 2NN6D 3P3EA 4JI2E 4FW5A 1HNWE 2NPFA 2UUAI 3OTOI 1FWLA 4DR1E 4I3HA 1Y60A 2WW4A 2UU9E 4FWGA 1KIJA 1RHYA 1Y4SA 4JYAI 4JI0I 2UUBE 2F4VE 4OO1B 1MG7A 4DV2I 3ZKDA 4LF4I 1XMQE 4JI5I 4EMDA 2WNRA 1HNZE 1XNRI 4Z7CA 4IFDF 5K36E 4NXMI 1OYRA 5DNXA 4DV7E 4AM3A 2Z5CB 4J3DA 5DRPA 1ZM3A 4U3BA 2UXBE 4X62E
chains in the Genus database with same CATH topology
4JV5E 2J7KA 2V2ZA 4DV3I 4NXNE 2CZ9A 1XNQE 1DARA 1N0VC 3PYDA 2PNMA 2O1VA 4LF5I 4FN5A 4JI1E 3T1YI 3J80C 3PYFA 4B3TE 3QT6A 4RPFA 4URLA 4DPTA 4DR4E 4DR6E 4GKKE 3V5RA 2VQFE 1NHIA 3ZZTA 1FI4A 4DV6E 3ZKBA 3J80Q 1NHJA 1Z0EA 5FWKA 4X65I 2O1WA 1ZXNA 4DR3I 1HNXI 4YY3E 1I94I 4LF8E 1QZRA 4MYTA 1N36E 4WUBA 4DU8A 4HACA 3QT5A 3LNUA 1ZM9A 5BR8I 5L3JA 2V2QA 4LF7I 4X66E 2HKEA 3WU5A 4FW9A 4JI8I 3PYEA 3J7AM 1Y4UA 3K17A 4OX9E 4B3ME 5IWAE 2ZM6E 1H7SA 2Z5BA 3QT7A 4DV5I 1N34E 4B3RE 1IBME 2UXCI 1PIEA 4DUYE 4DXLA 1H74A 1IBLE 3LPSA 4R1FA 1HR0E 4JI6I 3T1HI 2O1TA 3B8HA 2ZITA 4PU9A 2DEIA 4IZJB 4DV0E 1J5EI 1HK7A 2A2DA 4HY1A 4DV4I 2AJ4A 2UU9I 4DR2E 2HK2A 1N32E 5GMEA 1RREA 4GKJE 3ZZ0A 4Z7YA 2Q2EB 4LF6E 1N33I 1EI1A 2HHHE 2VF3A 3WU6A 4USMA 4YHHI 2UUCI 4DU7A 4UT4A 1ZXMA 2E5LE 4DUZE 3J7AG 4DR5I 1Z5CA 4JI3I 4JI4I 1Z59A 4ZVIA 2IOPA 4IZKB 2UUAE 3OTOE 4AQYI 2Z5CA 4FWHA 4JI0E 2R3VA 4LFAI 2V2VA 4M1KA 2OI2A 2UXDI 4JI5E 3WU3A 1OJ4A 1EA6A 1XNRE 4LF8I 4NXME 1USUA 1ZM2A 4X64I 5GMDA 1VISA 4K0KI 1FKAE 4KQVA 5LL6R 2V8PA 1IBKI 1U2RA 1Z0CA 4LF9I 2HFSA 2HK3A 4JI7I 2IOQA 3D4JA 5LMNE 4DV3E 1XMOI 4KHPI 4N3OA 1N34I 2O1UA 1A6FA 3B82A 3F0NA 4LF5E 4UTGA 3T1YE 4B3SE 1B62A 4LFCI 4DPYA 1USVA 2CGEA 2Z5BB 3QT8A 1MX0A 4WUDA 2A2CA 3PYGA 4X65E 4P52A 4DR3E 1HNXE 5LMUI 1ELOA 4LFBI 4HXZA 1I94E 1NHHA 4DV1I 2VQEI 5BR8E 3Q1QA 4LF7E 4USKA 1UEKA 1FJGI 2E1RA 1H7UA 3PRYA 4JI8E 3J81C 3B78A 3H4LA 4JI2I 2DEJA 1HNWI 3K1JA 1KTVA 4PRXA 4DR1I 3P06A 1WUUA 4DV5E 4DPWA 1Z0VA 4MYUA 2UUBI 1D6TA 2F4VI 1ZM4A 1Z0WA 3J81Q 4DR7E 2UXCE 1XMQI 3Q6NA 1MU5A 2LJPA 2XEXA 1HNZI 3T1HE 4DV7I 1H72C 4DUZI 3HJCA 1RR9A 2V34A 1FNMA 1N0UA 1J5EE 2BV3A 2UXBI 4X62I 4JV5I 2ZBKB 3LTOA 2X7IA 4WUCA 4NXNI 1XNQI 1FWKA 4DV4E 4JI1I 5IT9C 3ZM7A 2CG9A 4B3TI 4DR4I 4DR6I 4GKKI 2VQFI 2R42A 2X36A 1K47A 1Z5AA 1B63A 4DV6I 1N33E 4JYAE 4DPUA 4P7AA 5IT9Q 4YHHE 4DV2E 5A2QC 4LF4E 2UUCE 4YY3I 4IZKA 1N36I 3CWVA 3K85A 4HYMA 5LMNI 2PNLA 3ZZUA 4ED4A 4DR5E 4DPXA 1Y6ZA 4X66I 4JI3E 4JI4E 5A2QQ 4B3SI 4OX9I 4B3MI 5IWAI 2BM1A 4FWDA 2ZM6I 1Z0TA 3Q6MA 1Z5BA 4HACB 2GQ0A 1KKHA 4AQYE 4B3RI 1IBMI 1BKNA 4DUYI 4LFAE 1IBLI 1HR0I 2UXDE 1Z0BA 4DV0I 4X64E 3GONA 4K0KE 2BM0A 2HFUA 3WU4A 1Z0GA 1IBKE 5FLXC 4LF9E 4JI7E 1XMOE 4PRVA 4KHPE 4DR2I 1XHKA 2EFGA 4DR7I 5FLXQ 1PKPA 4XTJA 3JAMC 1N32I 4LFCE 4JG4A 4GKJI 2HKJA 4LF6I 4IZJA 1KVKA 2HHHI 1H73A 3M6AA 3JAMQ 1S4EA 5LMUE 4JI6E 4LFBE 3V2UC 2Z5EA 2E5LI 3HULA 4DV1E 2VQEE 1NZ0A 1S16A 1FJGE 4IZJD 1PVGA 2GS8A 4JI2E 1HNWE 2NPFA 2UUAI 3OTOI 1FWLA 4DR1E 4I3HA 2WW4A 2UU9E 4FWGA 1KIJA 1Y4SA 4JYAI 4JI0I 2UUBE 2F4VE 1MG7A 4DV2I 3ZKDA 4LF4I 1XMQE 4JI5I 4EMDA 1HNZE 1XNRI 4Z7CA 4NXMI 4DV7E 2Z5CB 1ZM3A 2UXBE 4X62E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 E;  2J7K A;  2V2Z A;  4DV3 I;  4NXN E;  2CZ9 A;  1XNQ E;  1DAR A;  1N0V C;  3PYD A;  4LF5 I;  4FN5 A;  4JI1 E;  3T1Y I;  3J80 C;  3PYF A;  4B3T E;  3QT6 A;  4RPF A;  4URL A;  4DPT A;  4DR4 E;  4DR6 E;  4GKK E;  3V5R A;  2VQF E;  1NHI A;  3ZZT A;  1FI4 A;  4DV6 E;  3ZKB A;  3J80 Q;  1NHJ A;  1Z0E A;  4X65 I;  1ZXN A;  4DR3 I;  1HNX I;  4YY3 E;  1I94 I;  4LF8 E;  1QZR A;  4MYT A;  1N36 E;  4WUB A;  4DU8 A;  4HAC A;  3QT5 A;  3LNU A;  1ZM9 A;  5BR8 I;  5L3J A;  2V2Q A;  4LF7 I;  4X66 E;  2HKE A;  3WU5 A;  4FW9 A;  4JI8 I;  3PYE A;  3J7A M;  3K17 A;  4OX9 E;  4B3M E;  5IWA E;  2ZM6 E;  1H7S A;  3QT7 A;  4DV5 I;  1N34 E;  4B3R E;  1IBM E;  2UXC I;  1PIE A;  4DUY E;  4DXL A;  1H74 A;  1IBL E;  3LPS A;  4R1F A;  1HR0 E;  4JI6 I;  3T1H I;  3B8H A;  2ZIT A;  4PU9 A;  2DEI A;  4DV0 E;  1J5E I;  2A2D A;  4HY1 A;  4DV4 I;  2AJ4 A;  2UU9 I;  4DR2 E;  2HK2 A;  1N32 E;  5GME A;  1RRE A;  4GKJ E;  3ZZ0 A;  4Z7Y A;  2Q2E B;  4LF6 E;  1N33 I;  1EI1 A;  2HHH E;  2VF3 A;  3WU6 A;  4USM A;  4YHH I;  2UUC I;  4DU7 A;  4UT4 A;  1ZXM A;  2E5L E;  4DUZ E;  3J7A G;  4DR5 I;  1Z5C A;  4JI3 I;  4JI4 I;  1Z59 A;  4ZVI A;  2UUA E;  3OTO E;  4AQY I;  4FWH A;  4JI0 E;  2R3V A;  4LFA I;  2V2V A;  4M1K A;  2OI2 A;  2UXD I;  4JI5 E;  3WU3 A;  1OJ4 A;  1EA6 A;  1XNR E;  4LF8 I;  4NXM E;  1ZM2 A;  4X64 I;  5GMD A;  1VIS A;  4K0K I;  1FKA E;  4KQV A;  5LL6 R;  2V8P A;  1IBK I;  1U2R A;  1Z0C A;  4LF9 I;  2HFS A;  2HK3 A;  4JI7 I;  3D4J A;  5LMN E;  4DV3 E;  1XMO I;  4KHP I;  1N34 I;  1A6F A;  3B82 A;  3F0N A;  4LF5 E;  4UTG A;  3T1Y E;  4B3S E;  1B62 A;  4LFC I;  4DPY A;  3QT8 A;  1MX0 A;  4WUD A;  2A2C A;  3PYG A;  4X65 E;  4P52 A;  4DR3 E;  1HNX E;  5LMU I;  1ELO A;  4LFB I;  4HXZ A;  1I94 E;  1NHH A;  4DV1 I;  2VQE I;  5BR8 E;  3Q1Q A;  4LF7 E;  4USK A;  1UEK A;  1FJG I;  2E1R A;  1H7U A;  4JI8 E;  3J81 C;  3B78 A;  3H4L A;  4JI2 I;  2DEJ A;  1HNW I;  3K1J A;  1KTV A;  4PRX A;  4DR1 I;  1WUU A;  4DV5 E;  4DPW A;  1Z0V A;  4MYU A;  2UUB I;  1D6T A;  2F4V I;  1ZM4 A;  1Z0W A;  3J81 Q;  4DR7 E;  2UXC E;  1XMQ I;  1MU5 A;  2LJP A;  2XEX A;  1HNZ I;  3T1H E;  4DV7 I;  1H72 C;  4DUZ I;  1RR9 A;  2V34 A;  1FNM A;  1N0U A;  1J5E E;  2BV3 A;  2UXB I;  4X62 I;  4JV5 I;  2ZBK B;  3LTO A;  2X7I A;  4WUC A;  4NXN I;  1XNQ I;  1FWK A;  4DV4 E;  4JI1 I;  5IT9 C;  3ZM7 A;  4B3T I;  4DR4 I;  4DR6 I;  4GKK I;  2VQF I;  2R42 A;  2X36 A;  1K47 A;  1Z5A A;  1B63 A;  4DV6 I;  1N33 E;  4JYA E;  4DPU A;  4P7A A;  5IT9 Q;  4YHH E;  4DV2 E;  5A2Q C;  4LF4 E;  2UUC E;  4YY3 I;  1N36 I;  3CWV A;  4HYM A;  3ZZU A;  4ED4 A;  5LMN I;  4DR5 E;  4DPX A;  4X66 I;  4JI3 E;  4JI4 E;  5A2Q Q;  4B3S I;  4OX9 I;  4B3M I;  5IWA I;  2BM1 A;  4FWD A;  2ZM6 I;  1Z0T A;  1Z5B A;  4HAC B;  1KKH A;  4AQY E;  4B3R I;  1IBM I;  1BKN A;  4DUY I;  4LFA E;  1IBL I;  1HR0 I;  2UXD E;  1Z0B A;  4DV0 I;  4X64 E;  3GON A;  4K0K E;  2BM0 A;  2HFU A;  3WU4 A;  1Z0G A;  1IBK E;  5FLX C;  4LF9 E;  4JI7 E;  1XMO E;  4PRV A;  4KHP E;  4DR2 I;  1XHK A;  2EFG A;  4DR7 I;  5FLX Q;  1PKP A;  4XTJ A;  3JAM C;  1N32 I;  4LFC E;  4JG4 A;  4GKJ I;  2HKJ A;  4LF6 I;  1KVK A;  2HHH I;  1H73 A;  3M6A A;  3JAM Q;  1S4E A;  5LMU E;  4JI6 E;  4LFB E;  3V2U C;  2E5L I;  3HUL A;  4DV1 E;  2VQE E;  1NZ0 A;  1S16 A;  1FJG E;  1PVG A;  2GS8 A;  4JI2 E;  1HNW E;  2NPF A;  2UUA I;  3OTO I;  1FWL A;  4DR1 E;  4I3H A;  2WW4 A;  2UU9 E;  4FWG A;  1KIJ A;  4JYA I;  4JI0 I;  2UUB E;  2F4V E;  1MG7 A;  4DV2 I;  3ZKD A;  4LF4 I;  1XMQ E;  4JI5 I;  4EMD A;  1HNZ E;  1XNR I;  4Z7C A;  4NXM I;  4DV7 E;  1ZM3 A;  2UXB E;  4X62 E; 
#chains in the Genus database with same CATH topology
 4JV5 E;  2J7K A;  2V2Z A;  4DV3 I;  4NXN E;  2CZ9 A;  1XNQ E;  1DAR A;  4LOM A;  1N0V C;  3PYD A;  2PNM A;  2O1V A;  4LF5 I;  4FN5 A;  4JI1 E;  3T1Y I;  3J80 C;  2PNZ B;  2PO2 B;  2NN6 E;  3PYF A;  4B3T E;  3QT6 A;  4RPF A;  2C38 B;  1UDQ A;  2BR2 A;  2WP8 A;  4DPT A;  4URL A;  4DR4 E;  4DR6 E;  3NZK A;  4GKK E;  3V5R A;  2VQF E;  1NHI A;  4IFD D;  3ZZT A;  1FI4 A;  4DV6 E;  3ZKB A;  3M7N G;  3J80 Q;  3L7Z B;  1NHJ A;  1Z0E A;  5FWK A;  4X65 I;  2O1W A;  1ZXN A;  4DR3 I;  1HNX I;  4IS9 A;  4YY3 E;  2JEA A;  1I94 I;  2F1D A;  4LF8 E;  1QZR A;  5K36 C;  1R6L A;  4MYT A;  1N36 E;  4WUB A;  4DU8 A;  3U1K A;  4HAC A;  3QT5 A;  3LNU A;  1XXE A;  1ZM9 A;  5BR8 I;  5L3J A;  2V2Q A;  2C37 B;  4LF7 I;  4X66 E;  2HKE A;  3WU5 A;  4FW9 A;  4LCF A;  2AE8 A;  3PYE A;  4JI8 I;  3J7A M;  1Y4U A;  3K17 A;  4OX9 E;  4B3M E;  5IWA E;  2ZM6 E;  1H7S A;  2Z5B A;  3QT7 A;  4DV5 I;  1N34 E;  4B3R E;  2IES A;  1IBM E;  2UXC I;  2NN6 C;  1PIE A;  4DUY E;  4MU4 A;  4DXL A;  1H74 A;  1IBL E;  3H1C A;  3LPS A;  4R1F A;  1HR0 E;  4JI6 I;  3T1H I;  2PO1 B;  2O1T A;  3B8H A;  2PO0 B;  2JEB A;  4IFD E;  2ZIT A;  4PU9 A;  2DEI A;  4IZJ B;  4DV0 E;  1J5E I;  5EL9 A;  2NN6 B;  1HK7 A;  2JT2 A;  2A2D A;  2GO3 A;  4HY1 A;  4DV4 I;  2AJ4 A;  2VES A;  2UU9 I;  4DR2 E;  2HK2 A;  4LPF A;  1N32 E;  5GME A;  1RRE A;  4GKJ E;  3ZZ0 A;  4Z7Y A;  2Q2E B;  2JE6 A;  4LF6 E;  1N33 I;  1EI1 A;  2HHH E;  2VF3 A;  3WU6 A;  5JEA F;  4USM A;  4YHH I;  3CDJ A;  3GME A;  1E3H A;  4OKG A;  4OO1 F;  2UUC I;  4DU7 A;  4UT4 A;  1ZXM A;  2E5L E;  4DUZ E;  3J7A G;  4IFD C;  5ELW A;  4DR5 I;  1Z5C A;  5DRR A;  2GO4 A;  5JEA A;  3P76 A;  4JI3 I;  4JI4 I;  4OO1 A;  1Z59 A;  4ZVI A;  3M85 D;  2IOP A;  4IZK B;  4IFD B;  2UUA E;  5C0X E;  3PS2 A;  3OTO E;  4AQY I;  5DRQ A;  2Z5C A;  5DRO A;  4FWH A;  4JI0 E;  2R3V A;  4LFA I;  2V2V A;  5JEA D;  4M1K A;  2OI2 A;  4MQY A;  2UXD I;  4JI5 E;  4OO1 D;  3WU3 A;  2WP8 B;  1OJ4 A;  1EA6 A;  2BR2 B;  1XNR E;  4LF8 I;  4NXM E;  1USU A;  1ZM2 A;  4X64 I;  5GMD A;  1VIS A;  4K0K I;  4BA1 B;  1YHC A;  1FKA E;  4KQV A;  5LL6 R;  2V8P A;  1IBK I;  1U2R A;  1Z0C A;  4LF9 I;  2HFS A;  2HK3 A;  4JI7 I;  2IOQ A;  3D4J A;  5LMN E;  4DV3 E;  1XMO I;  4KHP I;  4N3O A;  1N34 I;  2O1U A;  1A6F A;  3B82 A;  3F0N A;  4LF5 E;  2O3Z A;  4UTG A;  4U3D A;  3T1Y E;  4B3S E;  5DNL A;  1B62 A;  4LFC I;  2C39 A;  4FW4 A;  4DPY A;  1USV A;  5K36 F;  5C0X C;  3B4T A;  2BA0 D;  2CGE A;  2Z5B B;  2C37 A;  3QT8 A;  1MX0 A;  4WUD A;  2A2C A;  2BA1 D;  3PYG A;  5JEA E;  4X65 E;  4P52 A;  4DR3 E;  1HNX E;  5LMU I;  1ELO A;  4MU0 A;  4LFB I;  4FW7 A;  5K36 A;  4HXZ A;  1I94 E;  4AIM A;  3PS1 A;  5C0X B;  1NHH A;  3HKM A;  4DV1 I;  2VQE I;  5BR8 E;  3Q1Q A;  4LF7 E;  4USK A;  3M85 G;  1UEK A;  1FJG I;  1VI7 A;  2E1R A;  1H7U A;  3PRY A;  4JI8 E;  3J81 C;  3B78 A;  3H4L A;  4JI2 I;  2DEJ A;  4BA2 A;  3K1J A;  1HNW I;  2PO1 A;  4QNK A;  1KTV A;  4PRX A;  4DR1 I;  3P06 A;  3P3G A;  5K36 D;  1WUU A;  4DV5 E;  4DPW A;  1Z0V A;  4ISA A;  4MYU A;  2UUB I;  1D6T A;  2NN6 A;  1P42 A;  2F4V I;  1ZM4 A;  1Z0W A;  3J81 Q;  4DR7 E;  2UXC E;  1XMQ I;  3Q6N A;  1MU5 A;  2LJP A;  2XEX A;  1HNZ I;  3T1H E;  4DV7 I;  1H72 C;  4DUZ I;  3HJC A;  1RR9 A;  1R6M A;  2J65 A;  3KRN A;  2JE6 B;  4FW3 A;  2V34 A;  1FNM A;  1N0U A;  1J5E E;  2BV3 A;  5JEA C;  2UXB I;  4X62 I;  4JV5 I;  2ZBK B;  3LTO A;  2WNR B;  2X7I A;  4WUC A;  4NXN I;  1XNQ I;  1FWK A;  4FW6 A;  4DV4 E;  4JI1 I;  5IT9 C;  3ZM7 A;  5JEA B;  2CG9 A;  4MU1 A;  4B3T I;  3P3C A;  4DR4 I;  4DR6 I;  4GKK I;  4LCG A;  2BA0 G;  2VQF I;  3DD6 A;  2R42 A;  2X36 A;  1K47 A;  1Z5A A;  1B63 A;  4DV6 I;  1N33 E;  4JYA E;  2BA1 G;  4DPU A;  3UHM A;  4P7A A;  5IT9 Q;  4YHH E;  4DV2 E;  5A2Q C;  4LF4 E;  2UUC E;  4YY3 I;  4IZK A;  1N36 I;  4IFD A;  3CWV A;  3K85 A;  4HYM A;  2PNL A;  3ZZU A;  4ED4 A;  5LMN I;  4DR5 E;  4DPX A;  1Y6Z A;  4X66 I;  4QNJ A;  2PNZ A;  2PO2 A;  4JI3 E;  4JI4 E;  2C38 A;  5A2Q Q;  4B3S I;  4OX9 I;  4B3M I;  5IWA I;  2BM1 A;  4FWD A;  2JEA B;  2ZM6 I;  1Z0T A;  3Q6M A;  1Z5B A;  3GCM A;  4HAC B;  2GQ0 A;  1KKH A;  4AQY E;  4B3R I;  1IBM I;  4BA1 A;  1UDN A;  3L7Z A;  1BKN A;  4DUY I;  4LFA E;  1IBL I;  3GLL A;  1HR0 I;  2UXD E;  1Z0B A;  2C39 B;  1Y5Y A;  1OYP A;  4MDT A;  4X64 E;  4DV0 I;  1YH8 A;  3GON A;  4K0K E;  2IER A;  2BM0 A;  2HFU A;  3WU4 A;  1Z0G A;  1IBK E;  4OO1 E;  5FLX C;  4LF9 E;  4OZE A;  2CVE A;  4MU3 A;  5K36 B;  4JI7 E;  5C0X F;  2JEB B;  1XMO E;  4PRV A;  4KHP E;  4DR2 I;  1XHK A;  2NN6 F;  2EFG A;  4DR7 I;  5FLX Q;  1PKP A;  4XTJ A;  4AID A;  3JAM C;  1N32 I;  4LFC E;  2PO0 A;  4JG4 A;  4GKJ I;  5C0X A;  4BA2 B;  2HKJ A;  4GQU A;  4LF6 I;  4IZJ A;  5EKW A;  1KVK A;  2HHH I;  1H73 A;  4NBQ A;  1UDS A;  3M7N D;  3M6A A;  3PS3 A;  3JAM Q;  1S4E A;  5LMU E;  4JI6 E;  4LFB E;  3U1Y A;  3V2U C;  2Z5E A;  2E5L I;  1OYS A;  3HUL A;  4DV1 E;  2VQE E;  5C0X D;  1NZ0 A;  1S16 A;  1FJG E;  4IZJ D;  3CDI A;  1PVG A;  1UDO A;  1E3P A;  4OO1 C;  2GS8 A;  4LCH A;  2NN6 D;  3P3E A;  4JI2 E;  4FW5 A;  1HNW E;  2NPF A;  2UUA I;  3OTO I;  1FWL A;  4DR1 E;  4I3H A;  1Y60 A;  2WW4 A;  2UU9 E;  4FWG A;  1KIJ A;  1RHY A;  1Y4S A;  4JYA I;  4JI0 I;  2UUB E;  2F4V E;  4OO1 B;  1MG7 A;  4DV2 I;  3ZKD A;  4LF4 I;  1XMQ E;  4JI5 I;  4EMD A;  2WNR A;  1HNZ E;  1XNR I;  4Z7C A;  4IFD F;  5K36 E;  4NXM I;  1OYR A;  5DNX A;  4DV7 E;  4AM3 A;  2Z5C B;  4J3D A;  5DRP A;  1ZM3 A;  4U3B A;  2UXB E;  4X62 E; 
#chains in the Genus database with same CATH homology
 4JV5 E;  2J7K A;  2V2Z A;  4DV3 I;  4NXN E;  2CZ9 A;  1XNQ E;  1DAR A;  1N0V C;  3PYD A;  2PNM A;  2O1V A;  4LF5 I;  4FN5 A;  4JI1 E;  3T1Y I;  3J80 C;  3PYF A;  4B3T E;  3QT6 A;  4RPF A;  4URL A;  4DPT A;  4DR4 E;  4DR6 E;  4GKK E;  3V5R A;  2VQF E;  1NHI A;  3ZZT A;  1FI4 A;  4DV6 E;  3ZKB A;  3J80 Q;  1NHJ A;  1Z0E A;  5FWK A;  4X65 I;  2O1W A;  1ZXN A;  4DR3 I;  1HNX I;  4YY3 E;  1I94 I;  4LF8 E;  1QZR A;  4MYT A;  1N36 E;  4WUB A;  4DU8 A;  4HAC A;  3QT5 A;  3LNU A;  1ZM9 A;  5BR8 I;  5L3J A;  2V2Q A;  4LF7 I;  4X66 E;  2HKE A;  3WU5 A;  4FW9 A;  4JI8 I;  3PYE A;  3J7A M;  1Y4U A;  3K17 A;  4OX9 E;  4B3M E;  5IWA E;  2ZM6 E;  1H7S A;  2Z5B A;  3QT7 A;  4DV5 I;  1N34 E;  4B3R E;  1IBM E;  2UXC I;  1PIE A;  4DUY E;  4DXL A;  1H74 A;  1IBL E;  3LPS A;  4R1F A;  1HR0 E;  4JI6 I;  3T1H I;  2O1T A;  3B8H A;  2ZIT A;  4PU9 A;  2DEI A;  4IZJ B;  4DV0 E;  1J5E I;  1HK7 A;  2A2D A;  4HY1 A;  4DV4 I;  2AJ4 A;  2UU9 I;  4DR2 E;  2HK2 A;  1N32 E;  5GME A;  1RRE A;  4GKJ E;  3ZZ0 A;  4Z7Y A;  2Q2E B;  4LF6 E;  1N33 I;  1EI1 A;  2HHH E;  2VF3 A;  3WU6 A;  4USM A;  4YHH I;  2UUC I;  4DU7 A;  4UT4 A;  1ZXM A;  2E5L E;  4DUZ E;  3J7A G;  4DR5 I;  1Z5C A;  4JI3 I;  4JI4 I;  1Z59 A;  4ZVI A;  2IOP A;  4IZK B;  2UUA E;  3OTO E;  4AQY I;  2Z5C A;  4FWH A;  4JI0 E;  2R3V A;  4LFA I;  2V2V A;  4M1K A;  2OI2 A;  2UXD I;  4JI5 E;  3WU3 A;  1OJ4 A;  1EA6 A;  1XNR E;  4LF8 I;  4NXM E;  1USU A;  1ZM2 A;  4X64 I;  5GMD A;  1VIS A;  4K0K I;  1FKA E;  4KQV A;  5LL6 R;  2V8P A;  1IBK I;  1U2R A;  1Z0C A;  4LF9 I;  2HFS A;  2HK3 A;  4JI7 I;  2IOQ A;  3D4J A;  5LMN E;  4DV3 E;  1XMO I;  4KHP I;  4N3O A;  1N34 I;  2O1U A;  1A6F A;  3B82 A;  3F0N A;  4LF5 E;  4UTG A;  3T1Y E;  4B3S E;  1B62 A;  4LFC I;  4DPY A;  1USV A;  2CGE A;  2Z5B B;  3QT8 A;  1MX0 A;  4WUD A;  2A2C A;  3PYG A;  4X65 E;  4P52 A;  4DR3 E;  1HNX E;  5LMU I;  1ELO A;  4LFB I;  4HXZ A;  1I94 E;  1NHH A;  4DV1 I;  2VQE I;  5BR8 E;  3Q1Q A;  4LF7 E;  4USK A;  1UEK A;  1FJG I;  2E1R A;  1H7U A;  3PRY A;  4JI8 E;  3J81 C;  3B78 A;  3H4L A;  4JI2 I;  2DEJ A;  1HNW I;  3K1J A;  1KTV A;  4PRX A;  4DR1 I;  3P06 A;  1WUU A;  4DV5 E;  4DPW A;  1Z0V A;  4MYU A;  2UUB I;  1D6T A;  2F4V I;  1ZM4 A;  1Z0W A;  3J81 Q;  4DR7 E;  2UXC E;  1XMQ I;  3Q6N A;  1MU5 A;  2LJP A;  2XEX A;  1HNZ I;  3T1H E;  4DV7 I;  1H72 C;  4DUZ I;  3HJC A;  1RR9 A;  2V34 A;  1FNM A;  1N0U A;  1J5E E;  2BV3 A;  2UXB I;  4X62 I;  4JV5 I;  2ZBK B;  3LTO A;  2X7I A;  4WUC A;  4NXN I;  1XNQ I;  1FWK A;  4DV4 E;  4JI1 I;  5IT9 C;  3ZM7 A;  2CG9 A;  4B3T I;  4DR4 I;  4DR6 I;  4GKK I;  2VQF I;  2R42 A;  2X36 A;  1K47 A;  1Z5A A;  1B63 A;  4DV6 I;  1N33 E;  4JYA E;  4DPU A;  4P7A A;  5IT9 Q;  4YHH E;  4DV2 E;  5A2Q C;  4LF4 E;  2UUC E;  4YY3 I;  4IZK A;  1N36 I;  3CWV A;  3K85 A;  4HYM A;  5LMN I;  2PNL A;  3ZZU A;  4ED4 A;  4DR5 E;  4DPX A;  1Y6Z A;  4X66 I;  4JI3 E;  4JI4 E;  5A2Q Q;  4B3S I;  4OX9 I;  4B3M I;  5IWA I;  2BM1 A;  4FWD A;  2ZM6 I;  1Z0T A;  3Q6M A;  1Z5B A;  4HAC B;  2GQ0 A;  1KKH A;  4AQY E;  4B3R I;  1IBM I;  1BKN A;  4DUY I;  4LFA E;  1IBL I;  1HR0 I;  2UXD E;  1Z0B A;  4DV0 I;  4X64 E;  3GON A;  4K0K E;  2BM0 A;  2HFU A;  3WU4 A;  1Z0G A;  1IBK E;  5FLX C;  4LF9 E;  4JI7 E;  1XMO E;  4PRV A;  4KHP E;  4DR2 I;  1XHK A;  2EFG A;  4DR7 I;  5FLX Q;  1PKP A;  4XTJ A;  3JAM C;  1N32 I;  4LFC E;  4JG4 A;  4GKJ I;  2HKJ A;  4LF6 I;  4IZJ A;  1KVK A;  2HHH I;  1H73 A;  3M6A A;  3JAM Q;  1S4E A;  5LMU E;  4JI6 E;  4LFB E;  3V2U C;  2Z5E A;  2E5L I;  3HUL A;  4DV1 E;  2VQE E;  1NZ0 A;  1S16 A;  1FJG E;  4IZJ D;  1PVG A;  2GS8 A;  4JI2 E;  1HNW E;  2NPF A;  2UUA I;  3OTO I;  1FWL A;  4DR1 E;  4I3H A;  2WW4 A;  2UU9 E;  4FWG A;  1KIJ A;  1Y4S A;  4JYA I;  4JI0 I;  2UUB E;  2F4V E;  1MG7 A;  4DV2 I;  3ZKD A;  4LF4 I;  1XMQ E;  4JI5 I;  4EMD A;  1HNZ E;  1XNR I;  4Z7C A;  4NXM I;  4DV7 E;  2Z5C B;  1ZM3 A;  2UXB E;  4X62 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...