4YY3I

30s ribosomal subunit- higb complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yy3I00
1K47A 2HHHE 2BV3A 4JI8I 1NZ0A 4DV6I 1HNWE 2HK3A 1H73A 2HFSA 4HACA 2WW4A 1ZM3A 1J5EE 1Z0EA 3T1HI 5FLXQ 1EI1A 4LF6E 4LF9E 1OJ4A 1Z0CA 4R1FA 4DR5I 5BR8I 5IWAE 3J7AG 4NXME 4JV5E 3J80C 5GMDA 3F0NA 1HNZI 4B3TI 3LTOA 1QZRA 4DV2E 5LMUI 4X62E 1BKNA 5FLXC 5L3JA 3ZKDA 4DR3E 1XMQE 3K17A 4JI5I 4JG4A 1IBLI 2BM1A 1N34I 3CWVA 2VQEI 1ZM4A 2HHHI 1IBME 2J7KA 4URLA 1HNWI 4DV7E 4DV5I 2UXDE 4DPTA 1J5EI 4JI2I 4DR6E 2DEIA 1N0UA 3B8HA 4YHHI 1XHKA 4LF6I 1Z0VA 4FWGA 4Z7YA 2F4VE 3K1JA 2A2DA 4HACB 5IWAI 2UXBE 4JI8E 4JV5I 1FJGI 1D6TA 4X65E 2XEXA 3Q1QA 4DUYI 4LF7E 2OI2A 1I94E 4LF8E 3JAMC 4DUZE 2UUCE 1H74A 4DR3I 3PYFA 4JI4I 5GMEA 4MYTA 1KTVA 1IBMI 4JI1E 1H7SA 1N36E 4M1KA 5LMUE 1IBKE 4WUBA 2UXDI 3ZZ0A 2V2ZA 4DR6I 4DU7A 1FWLA 4EMDA 4JI5E 4HXZA 5IT9C 1FNMA 2X7IA 3V2UC 4KHPI 4DPUA 4LF5E 1N34E 3B82A 2VQEE 1Z59A 3QT6A 2UXBI 4DR4I 4DPXA 1FKAE 4HYMA 4UT4A 4LF4E 1S4EA 4DV5E 4B3RE 4KQVA 1XNRE 4PRVA 1Z5CA 4X65I 4JI2E 2GS8A 2HKJA 4LF7I 1FWKA 4YHHE 1I94I 5A2QC 4LF8I 4JI6I 4USMA 1MG7A 4DUZI 2UUCI 1ZM2A 3PYGA 4DU8A 3QT5A 4JI3E 1FJGE 1NHHA 1MU5A 4YY3I 4WUDA 4DUYE 4JI1I 1N36I 3PYEA 2UU9E 1N32I 2VF3A 1IBKI 4WUCA 2EFGA 2NPFA 4LFBE 1Z0BA 4FW9A 1PVGA 4DR7I 3GONA 4DR2E 4JI4E 4Z7CA 2ZM6E 4DPWA 4LF5I 4FN5A 3V5RA 1Z5BA 1Z5AA 3H4LA 3QT7A 4LF4I 4ZVIA 4B3RI 1XNRI 4DV4E 2UUBE 4FWHA 4ED4A 4GKKE 4LFAE 4KHPE 1KKHA 2AJ4A 1EA6A 4DR4E 4NXNI 4JI3I 4FWDA 4X64E 2UU9I 4JI6E 1ZM9A 1MX0A 4LFBI 3J7AM 4I3HA 2BM0A 4B3ME 4K0KE 4DR2I 4YY3E 2ZM6I 1VISA 1B63A 2X36A 1N32E 2E1RA 4JI0I 4JI7I 2R42A 3ZM7A 4DV4I 3J81Q 2UUBI 2HKEA 4DR7E 4GKKI 1Z0GA 4LFAI 2V2VA 4DV0E 1B62A 2HFUA 1UEKA 2ZBKB 4X64I 4USKA 1N33E 4XTJA 2V34A 1XNQI 1XMOI 4PU9A 4DV3I 3B78A 4JYAI 1KVKA 3J80Q 4MYUA 1N0VC 3OTOE 2E5LE 2UUAE 4AQYE 4B3MI 4K0KI 4NXNE 4OX9E 3PYDA 5LMNE 4GKJE 1A6FA 1FI4A 3T1YE 4X66I 1HNXE 1HR0E 2VQFE 1ELOA 3QT8A 1ZXNA 4DPYA 1Z0TA 1H72C 4DV0I 1ZXMA 2A2CA 3HULA 4LFCE 1KIJA 4JI0E 4JI7E 4DV1E 2ZITA 4UTGA 4B3SE 2DEJA 1N33I 4DR1E 2V2QA 3WU5A 4PRXA 1NHJA 4P7AA 3OTOI 2E5LI 2UUAI 4AQYI 4OX9I 5LMNI 3LPSA 2R3VA 4RPFA 3WU3A 4GKJI 3JAMQ 1DARA 2UXCE 1NHIA 3T1YI 4LF9I 1XNQE 1XMOE 3ZZTA 4DV3E 4JYAE 1U2RA 1HNXI 1HR0I 2VQFI 4DV6E 4NXMI 3D4JA 4P52A 3T1HE 4DV2I 4LFCI 2LJPA 3WU6A 4X62I 2V8PA 1RREA 4DR5E 5BR8E 1Z0WA 4DV1I 4X66E 5IT9Q 1XMQI 4B3SI 5LL6R 4DR1I 1HNZE 4B3TE 4DXLA 2HK2A 4DV7I 1PKPA 3LNUA 1WUUA 1RR9A 5A2QQ 1H7UA 3ZKBA 3M6AA 3ZZUA 2UXCI 1PIEA 1IBLE 4HY1A 3J81C 1S16A 2F4VI 2Q2EB 2CZ9A 3WU4A
chains in the Genus database with same CATH superfamily
1K47A 2JE6A 2HHHE 2BV3A 4JI8I 1NZ0A 4DV6I 1HNWE 2HK3A 4OO1B 2BR2B 1H73A 2HFSA 4HACA 4LCHA 2WW4A 4FW4A 1ZM3A 1J5EE 2O1UA 3P3EA 1Z0EA 3T1HI 2GO4A 5FLXQ 1EI1A 4LF6E 4LF9E 1OJ4A 1Z0CA 2NN6A 4R1FA 4DR5I 5BR8I 4IZJB 2NN6D 2WNRB 5IWAE 3J7AG 4NXME 1YHCA 4JV5E 4QNKA 3J80C 5GMDA 2BA0D 3F0NA 4FW3A 1HNZI 5C0XB 4B3TI 2NN6C 3LTOA 1QZRA 4DV2E 4U3DA 2WP8A 5LMUI 4X62E 1BKNA 3NZKA 4J3DA 3P76A 1VI7A 5FLXC 5L3JA 3ZKDA 5JEAD 4DR3E 1XMQE 3K17A 4JI5I 4IFDA 5DNLA 4JG4A 1IBLI 2BM1A 4IFDD 3P3CA 1N34I 5EKWA 3CWVA 2VQEI 1ZM4A 2HHHI 1IBME 2J7KA 4URLA 1HNWI 4AIMA 4DV7E 3P06A 4DV5I 2UXDE 4IFDC 4DPTA 1J5EI 4JI2I 4DR6E 2DEIA 1N0UA 3B8HA 4YHHI 1XHKA 2JE6B 4LF6I 4Z7YA 1Z0VA 4FWGA 2C39A 2F4VE 4GQUA 3K1JA 2A2DA 3PS1A 4HACB 5IWAI 2UXBE 4JI8E 4U3BA 3L7ZA 4JV5I 1FJGI 2AE8A 1D6TA 2C38A 5K36A 4X65E 2XEXA 5DRPA 3Q1QA 4DUYI 4FW6A 4LF7E 2OI2A 1I94E 2F1DA 2CGEA 4OO1E 4LF8E 3JAMC 1RHYA 4DUZE 2UUCE 1H74A 1Y5YA 4DR3I 1P42A 3HKMA 4MU4A 2PO0A 2IESA 3PYFA 4JI4I 2WP8B 4FW7A 1UDQA 5GMEA 2PNMA 4MYTA 4AIDA 1KTVA 1IBMI 4JI1E 1H7SA 1N36E 4M1KA 5LMUE 4MU3A 2VESA 5K36F 1IBKE 5C0XE 4WUBA 5DNXA 2UXDI 2BA0G 3ZZ0A 2V2ZA 4DR6I 4DU7A 1FWLA 4EMDA 4JI5E 2PNLA 4HXZA 5IT9C 1FNMA 2BA1D 2X7IA 3M7ND 3V2UC 2JT2A 4KHPI 4DPUA 4LF5E 1N34E 3B82A 2O3ZA 2VQEE 1Z59A 3QT6A 2UXBI 4DR4I 4DPXA 1FKAE 4HYMA 4UT4A 4LF4E 1S4EA 4DV5E 4B3RE 4KQVA 1XNRE 2O1VA 1Z5CA 4PRVA 4X65I 4JI2E 2GS8A 2HKJA 2C39B 4LF7I 1FWKA 4YHHE 4MU1A 3GCMA 1I94I 5A2QC 4LCGA 3P3GA 4LF8I 4JI6I 3L7ZB 4USMA 1MG7A 2C38B 4DUZI 2UUCI 5K36B 1ZM2A 3PYGA 4IZKA 4DU8A 3QT5A 2Z5BA 4JI3E 1FJGE 1NHHA 1MU5A 4YY3I 4WUDA 4DUYE 4JI1I 1N36I 3PYEA 2UU9E 1N32I 2VF3A 5JEAA 2PNZB 2PO0B 1IBKI 4BA2A 2JEBA 2NN6E 4WUCA 5ELWA 2EFGA 2JEAA 2NPFA 4LFBE 1Z0BA 4FW9A 1PVGA 3CDIA 3GONA 4LPFA 2NN6F 4DR2E 4JI4E 4DR7I 4LOMA 4Z7CA 2ZM6E 4DPWA 4LF5I 4FN5A 3V5RA 1Z5BA 1Z5AA 3H4LA 3QT7A 5JEAC 1E3HA 5EL9A 4LF4I 4ZVIA 4B3RI 1XNRI 3KRNA 4DV4E 2CG9A 1OYPA 2PO2A 2UUBE 4FWHA 4ED4A 4GKKE 4IFDE 4LFAE 4MDTA 1USUA 1UDOA 4KHPE 2CVEA 3PRYA 1KKHA 2AJ4A 1E3PA 1EA6A 2O1TA 4DR4E 4IFDF 2IERA 1R6LA 4NXNI 3H1CA 4JI3I 4AM3A 4FWDA 2BA1G 3M7NG 2NN6B 4X64E 2IOQA 2BR2A 1Y4UA 2UU9I 4IZKB 2Z5BB 2CZ9A 4OO1D 4JI6E 1ZM9A 1MX0A 4LFBI 3J7AM 3Q6MA 4I3HA 3UHMA 2BM0A 4B3ME 4K0KE 4IZJA 4DR2I 4YY3E 4IS9A 4OO1C 2ZM6I 4IZJD 5K36E 1VISA 5JEAB 4BA2B 2JEBB 1B63A 2JEAB 2X36A 1N32E 2E1RA 4JI0I 5C0XA 4IFDB 4JI7I 2R42A 5C0XD 3ZM7A 4DV4I 3K85A 3J81Q 2UUBI 2HKEA 4DR7E 4GKKI 1Z0GA 2C37A 4LFAI 2V2VA 4DV0E 1Y60A 2IOPA 4N3OA 1B62A 5C0XC 3U1KA 1XXEA 4QNJA 2PO2B 2HFUA 1UEKA 2ZBKB 4X64I 2Z5CA 4USKA 2PO1A 1N33E 3GLLA 4XTJA 2V34A 1XNQI 3M85D 1XMOI 4PU9A 4DV3I 3B78A 2GQ0A 4JYAI 1KVKA 3J80Q 5DROA 4FW5A 4MYUA 1N0VC 3OTOE 2E5LE 2UUAE 4AQYE 2J65A 4B3MI 4NXNE 4NBQA 4K0KI 4OX9E 4MU0A 3PYDA 5LMNE 4GKJE 5FWKA 4LCFA 1A6FA 1R6MA 1FI4A 3T1YE 4X66I 1Y6ZA 1HNXE 1HR0E 2VQFE 1ELOA 3QT8A 1ZXNA 4DPYA 1Z0TA 1H72C 4DV0I 5DRQA 1ZXMA 2A2CA 3HULA 3PS2A 4LFCE 1OYSA 1KIJA 4JI0E 4MQYA 4JI7E 4DV1E 5JEAE 2C37B 2ZITA 4UTGA 4B3SE 2DEJA 1N33I 3B4TA 1HK7A 4DR1E 5JEAF 1YH8A 2V2QA 3WU5A 3U1YA 4PRXA 3PS3A 1NHJA 4P7AA 3OTOI 2E5LI 2UUAI 2Z5CB 4AQYI 1Y4SA 4OX9I 2PO1B 4BA1A 5LMNI 3LPSA 2R3VA 4RPFA 3WU3A 4GKJI 3CDJA 3JAMQ 1DARA 4OO1A 4ISAA 4OZEA 1NHIA 2UXCE 5DRRA 3T1YI 3DD6A 4LF9I 1XNQE 1XMOE 3ZZTA 4DV3E 4JYAE 1U2RA 1HNXI 1HR0I 2VQFI 4DV6E 4NXMI 3D4JA 4OKGA 2WNRA 4P52A 3M85G 5K36D 3T1HE 4DV2I 4LFCI 3Q6NA 1USVA 2LJPA 2GO3A 3WU6A 2V8PA 2O1WA 4X62I 1RREA 4DR5E 5BR8E 1Z0WA 4DV1I 4X66E 5IT9Q 1XMQI 4B3SI 5K36C 4OO1F 5LL6R 2PNZA 4DR1I 1OYRA 1HNZE 4B3TE 4DXLA 2HK2A 4DV7I 1PKPA 3LNUA 1UDSA 1UDNA 1WUUA 1RR9A 5A2QQ 2Z5EA 1H7UA 3ZKBA 3M6AA 3ZZUA 2UXCI 5C0XF 1PIEA 1IBLE 4HY1A 3J81C 1S16A 3HJCA 2F4VI 2Q2EB 3GMEA 3WU4A 4BA1B
chains in the Genus database with same CATH topology
1K47A 2HHHE 2BV3A 4JI8I 1NZ0A 4DV6I 1HNWE 2HK3A 1H73A 2HFSA 4HACA 2WW4A 1ZM3A 1J5EE 2O1UA 1Z0EA 3T1HI 5FLXQ 1EI1A 4LF6E 4LF9E 1OJ4A 1Z0CA 4R1FA 4DR5I 5BR8I 4IZJB 5IWAE 3J7AG 4NXME 4JV5E 3J80C 5GMDA 3F0NA 1HNZI 4B3TI 3LTOA 1QZRA 4DV2E 5LMUI 4X62E 1BKNA 5FLXC 5L3JA 3ZKDA 4DR3E 1XMQE 3K17A 4JI5I 4JG4A 1IBLI 2BM1A 1N34I 3CWVA 2VQEI 1ZM4A 2HHHI 1IBME 2J7KA 4URLA 1HNWI 4DV7E 3P06A 4DV5I 2UXDE 4DPTA 1J5EI 4JI2I 4DR6E 2DEIA 1N0UA 3B8HA 4YHHI 1XHKA 4LF6I 1Z0VA 4FWGA 4Z7YA 2F4VE 3K1JA 2A2DA 4HACB 5IWAI 2UXBE 4JI8E 4JV5I 1FJGI 1D6TA 4X65E 2XEXA 3Q1QA 4DUYI 4LF7E 2OI2A 1I94E 2CGEA 4LF8E 3JAMC 4DUZE 2UUCE 1H74A 4DR3I 3PYFA 4JI4I 5GMEA 2PNMA 4MYTA 1KTVA 1IBMI 4JI1E 1H7SA 1N36E 4M1KA 5LMUE 1IBKE 4WUBA 2UXDI 3ZZ0A 2V2ZA 4DR6I 4DU7A 1FWLA 4EMDA 4JI5E 2PNLA 4HXZA 5IT9C 1FNMA 2X7IA 3V2UC 4KHPI 4DPUA 4LF5E 1N34E 3B82A 2VQEE 1Z59A 3QT6A 2UXBI 4DR4I 4DPXA 1FKAE 4HYMA 4UT4A 4LF4E 1S4EA 4DV5E 4B3RE 4KQVA 1XNRE 2O1VA 1Z5CA 4PRVA 4X65I 4JI2E 2GS8A 2HKJA 4LF7I 1FWKA 4YHHE 1I94I 5A2QC 4LF8I 4JI6I 4USMA 1MG7A 4DUZI 2UUCI 1ZM2A 3PYGA 4IZKA 4DU8A 3QT5A 2Z5BA 4JI3E 1FJGE 1NHHA 1MU5A 4YY3I 4WUDA 4DUYE 4JI1I 1N36I 3PYEA 2UU9E 1N32I 2VF3A 1IBKI 4WUCA 2EFGA 2NPFA 4LFBE 1Z0BA 4FW9A 1PVGA 4DR7I 3GONA 4DR2E 4JI4E 4Z7CA 2ZM6E 4DPWA 4LF5I 4FN5A 3V5RA 1Z5BA 1Z5AA 3H4LA 3QT7A 4LF4I 4ZVIA 4B3RI 1XNRI 4DV4E 2CG9A 2UUBE 4FWHA 4ED4A 4GKKE 4LFAE 1USUA 4KHPE 3PRYA 1KKHA 2AJ4A 1EA6A 2O1TA 4DR4E 4NXNI 4JI3I 4FWDA 4X64E 2IOQA 1Y4UA 2UU9I 4IZKB 2Z5BB 4JI6E 1ZM9A 1MX0A 4LFBI 3J7AM 3Q6MA 4I3HA 2BM0A 4B3ME 4K0KE 4IZJA 4DR2I 4YY3E 2ZM6I 4IZJD 1VISA 1B63A 2X36A 1N32E 2E1RA 4JI0I 4JI7I 2R42A 3ZM7A 4DV4I 3K85A 3J81Q 2UUBI 2HKEA 4DR7E 4GKKI 1Z0GA 4LFAI 2V2VA 4DV0E 2IOPA 4N3OA 1B62A 2HFUA 1UEKA 2ZBKB 4X64I 2Z5CA 4USKA 1N33E 4XTJA 2V34A 1XNQI 1XMOI 4PU9A 4DV3I 3B78A 2GQ0A 4JYAI 1KVKA 3J80Q 4MYUA 1N0VC 3OTOE 2E5LE 2UUAE 4AQYE 4B3MI 4K0KI 4NXNE 4OX9E 3PYDA 5LMNE 4GKJE 5FWKA 1A6FA 1FI4A 3T1YE 4X66I 1Y6ZA 1HNXE 1HR0E 2VQFE 1ELOA 3QT8A 1ZXNA 4DPYA 1Z0TA 1H72C 4DV0I 1ZXMA 2A2CA 3HULA 4LFCE 1KIJA 4JI0E 4JI7E 4DV1E 2ZITA 4UTGA 4B3SE 2DEJA 1N33I 1HK7A 4DR1E 2V2QA 3WU5A 4PRXA 1NHJA 4P7AA 3OTOI 2E5LI 2UUAI 2Z5CB 4AQYI 1Y4SA 4OX9I 5LMNI 3LPSA 2R3VA 4RPFA 3WU3A 4GKJI 3JAMQ 1DARA 2UXCE 1NHIA 3T1YI 4LF9I 1XNQE 1XMOE 3ZZTA 4DV3E 4JYAE 1U2RA 1HNXI 1HR0I 2VQFI 4DV6E 4NXMI 3D4JA 4P52A 3T1HE 4DV2I 4LFCI 3Q6NA 1USVA 2LJPA 4X62I 3WU6A 2V8PA 2O1WA 1RREA 4DR5E 5BR8E 1Z0WA 4DV1I 4X66E 5IT9Q 1XMQI 4B3SI 5LL6R 4DR1I 1HNZE 4B3TE 4DXLA 2HK2A 4DV7I 1PKPA 3LNUA 1WUUA 1RR9A 5A2QQ 2Z5EA 1H7UA 3ZKBA 3M6AA 3ZZUA 2UXCI 1PIEA 1IBLE 4HY1A 3J81C 1S16A 3HJCA 2F4VI 2Q2EB 2CZ9A 3WU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K47 A;  2HHH E;  2BV3 A;  4JI8 I;  1NZ0 A;  4DV6 I;  1HNW E;  2HK3 A;  1H73 A;  2HFS A;  4HAC A;  2WW4 A;  1ZM3 A;  1J5E E;  1Z0E A;  3T1H I;  5FLX Q;  1EI1 A;  4LF6 E;  4LF9 E;  1OJ4 A;  1Z0C A;  4R1F A;  4DR5 I;  5BR8 I;  5IWA E;  3J7A G;  4NXM E;  4JV5 E;  3J80 C;  5GMD A;  3F0N A;  1HNZ I;  4B3T I;  3LTO A;  1QZR A;  4DV2 E;  5LMU I;  4X62 E;  1BKN A;  5FLX C;  5L3J A;  3ZKD A;  4DR3 E;  1XMQ E;  3K17 A;  4JI5 I;  4JG4 A;  1IBL I;  2BM1 A;  1N34 I;  3CWV A;  2VQE I;  1ZM4 A;  2HHH I;  1IBM E;  2J7K A;  4URL A;  1HNW I;  4DV7 E;  4DV5 I;  2UXD E;  4DPT A;  1J5E I;  4JI2 I;  4DR6 E;  2DEI A;  1N0U A;  3B8H A;  4YHH I;  1XHK A;  4LF6 I;  1Z0V A;  4FWG A;  4Z7Y A;  2F4V E;  3K1J A;  2A2D A;  4HAC B;  5IWA I;  2UXB E;  4JI8 E;  4JV5 I;  1FJG I;  1D6T A;  4X65 E;  2XEX A;  3Q1Q A;  4DUY I;  4LF7 E;  2OI2 A;  1I94 E;  4LF8 E;  3JAM C;  4DUZ E;  2UUC E;  1H74 A;  4DR3 I;  3PYF A;  4JI4 I;  5GME A;  4MYT A;  1KTV A;  1IBM I;  4JI1 E;  1H7S A;  1N36 E;  4M1K A;  5LMU E;  1IBK E;  4WUB A;  2UXD I;  3ZZ0 A;  2V2Z A;  4DR6 I;  4DU7 A;  1FWL A;  4EMD A;  4JI5 E;  4HXZ A;  5IT9 C;  1FNM A;  2X7I A;  3V2U C;  4KHP I;  4DPU A;  4LF5 E;  1N34 E;  3B82 A;  2VQE E;  1Z59 A;  3QT6 A;  2UXB I;  4DR4 I;  4DPX A;  1FKA E;  4HYM A;  4UT4 A;  4LF4 E;  1S4E A;  4DV5 E;  4B3R E;  4KQV A;  1XNR E;  4PRV A;  1Z5C A;  4X65 I;  4JI2 E;  2GS8 A;  2HKJ A;  4LF7 I;  1FWK A;  4YHH E;  1I94 I;  5A2Q C;  4LF8 I;  4JI6 I;  4USM A;  1MG7 A;  4DUZ I;  2UUC I;  1ZM2 A;  3PYG A;  4DU8 A;  3QT5 A;  4JI3 E;  1FJG E;  1NHH A;  1MU5 A;  4YY3 I;  4WUD A;  4DUY E;  4JI1 I;  1N36 I;  3PYE A;  2UU9 E;  1N32 I;  2VF3 A;  1IBK I;  4WUC A;  2EFG A;  2NPF A;  4LFB E;  1Z0B A;  4FW9 A;  1PVG A;  4DR7 I;  3GON A;  4DR2 E;  4JI4 E;  4Z7C A;  2ZM6 E;  4DPW A;  4LF5 I;  4FN5 A;  3V5R A;  1Z5B A;  1Z5A A;  3H4L A;  3QT7 A;  4LF4 I;  4ZVI A;  4B3R I;  1XNR I;  4DV4 E;  2UUB E;  4FWH A;  4ED4 A;  4GKK E;  4LFA E;  4KHP E;  1KKH A;  2AJ4 A;  1EA6 A;  4DR4 E;  4NXN I;  4JI3 I;  4FWD A;  4X64 E;  2UU9 I;  4JI6 E;  1ZM9 A;  1MX0 A;  4LFB I;  3J7A M;  4I3H A;  2BM0 A;  4B3M E;  4K0K E;  4DR2 I;  4YY3 E;  2ZM6 I;  1VIS A;  1B63 A;  2X36 A;  1N32 E;  2E1R A;  4JI0 I;  4JI7 I;  2R42 A;  3ZM7 A;  4DV4 I;  3J81 Q;  2UUB I;  2HKE A;  4DR7 E;  4GKK I;  1Z0G A;  4LFA I;  2V2V A;  4DV0 E;  1B62 A;  2HFU A;  1UEK A;  2ZBK B;  4X64 I;  4USK A;  1N33 E;  4XTJ A;  2V34 A;  1XNQ I;  1XMO I;  4PU9 A;  4DV3 I;  3B78 A;  4JYA I;  1KVK A;  3J80 Q;  4MYU A;  1N0V C;  3OTO E;  2E5L E;  2UUA E;  4AQY E;  4B3M I;  4K0K I;  4NXN E;  4OX9 E;  3PYD A;  5LMN E;  4GKJ E;  1A6F A;  1FI4 A;  3T1Y E;  4X66 I;  1HNX E;  1HR0 E;  2VQF E;  1ELO A;  3QT8 A;  1ZXN A;  4DPY A;  1Z0T A;  1H72 C;  4DV0 I;  1ZXM A;  2A2C A;  3HUL A;  4LFC E;  1KIJ A;  4JI0 E;  4JI7 E;  4DV1 E;  2ZIT A;  4UTG A;  4B3S E;  2DEJ A;  1N33 I;  4DR1 E;  2V2Q A;  3WU5 A;  4PRX A;  1NHJ A;  4P7A A;  3OTO I;  2E5L I;  2UUA I;  4AQY I;  4OX9 I;  5LMN I;  3LPS A;  2R3V A;  4RPF A;  3WU3 A;  4GKJ I;  3JAM Q;  1DAR A;  2UXC E;  1NHI A;  3T1Y I;  4LF9 I;  1XNQ E;  1XMO E;  3ZZT A;  4DV3 E;  4JYA E;  1U2R A;  1HNX I;  1HR0 I;  2VQF I;  4DV6 E;  4NXM I;  3D4J A;  4P52 A;  3T1H E;  4DV2 I;  4LFC I;  2LJP A;  3WU6 A;  4X62 I;  2V8P A;  1RRE A;  4DR5 E;  5BR8 E;  1Z0W A;  4DV1 I;  4X66 E;  5IT9 Q;  1XMQ I;  4B3S I;  5LL6 R;  4DR1 I;  1HNZ E;  4B3T E;  4DXL A;  2HK2 A;  4DV7 I;  1PKP A;  3LNU A;  1WUU A;  1RR9 A;  5A2Q Q;  1H7U A;  3ZKB A;  3M6A A;  3ZZU A;  2UXC I;  1PIE A;  1IBL E;  4HY1 A;  3J81 C;  1S16 A;  2F4V I;  2Q2E B;  2CZ9 A;  3WU4 A; 
#chains in the Genus database with same CATH topology
 1K47 A;  2JE6 A;  2HHH E;  2BV3 A;  4JI8 I;  1NZ0 A;  4DV6 I;  1HNW E;  2HK3 A;  4OO1 B;  2BR2 B;  1H73 A;  2HFS A;  4HAC A;  4LCH A;  2WW4 A;  4FW4 A;  1ZM3 A;  1J5E E;  2O1U A;  3P3E A;  1Z0E A;  3T1H I;  2GO4 A;  5FLX Q;  1EI1 A;  4LF6 E;  4LF9 E;  1OJ4 A;  1Z0C A;  2NN6 A;  4R1F A;  4DR5 I;  5BR8 I;  4IZJ B;  2NN6 D;  2WNR B;  5IWA E;  3J7A G;  4NXM E;  1YHC A;  4JV5 E;  4QNK A;  3J80 C;  5GMD A;  2BA0 D;  3F0N A;  4FW3 A;  1HNZ I;  5C0X B;  4B3T I;  2NN6 C;  3LTO A;  1QZR A;  4DV2 E;  4U3D A;  2WP8 A;  5LMU I;  4X62 E;  1BKN A;  3NZK A;  4J3D A;  3P76 A;  1VI7 A;  5FLX C;  5L3J A;  3ZKD A;  5JEA D;  4DR3 E;  1XMQ E;  3K17 A;  4JI5 I;  4IFD A;  5DNL A;  4JG4 A;  1IBL I;  2BM1 A;  4IFD D;  3P3C A;  1N34 I;  5EKW A;  3CWV A;  2VQE I;  1ZM4 A;  2HHH I;  1IBM E;  2J7K A;  4URL A;  1HNW I;  4AIM A;  4DV7 E;  3P06 A;  4DV5 I;  2UXD E;  4IFD C;  4DPT A;  1J5E I;  4JI2 I;  4DR6 E;  2DEI A;  1N0U A;  3B8H A;  4YHH I;  1XHK A;  2JE6 B;  4LF6 I;  4Z7Y A;  1Z0V A;  4FWG A;  2C39 A;  2F4V E;  4GQU A;  3K1J A;  2A2D A;  3PS1 A;  4HAC B;  5IWA I;  2UXB E;  4JI8 E;  4U3B A;  3L7Z A;  4JV5 I;  1FJG I;  2AE8 A;  1D6T A;  2C38 A;  5K36 A;  4X65 E;  2XEX A;  5DRP A;  3Q1Q A;  4DUY I;  4FW6 A;  4LF7 E;  2OI2 A;  1I94 E;  2F1D A;  2CGE A;  4OO1 E;  4LF8 E;  3JAM C;  1RHY A;  4DUZ E;  2UUC E;  1H74 A;  1Y5Y A;  4DR3 I;  1P42 A;  3HKM A;  4MU4 A;  2PO0 A;  2IES A;  3PYF A;  4JI4 I;  2WP8 B;  4FW7 A;  1UDQ A;  5GME A;  2PNM A;  4MYT A;  4AID A;  1KTV A;  1IBM I;  4JI1 E;  1H7S A;  1N36 E;  4M1K A;  5LMU E;  4MU3 A;  2VES A;  5K36 F;  1IBK E;  5C0X E;  4WUB A;  5DNX A;  2UXD I;  2BA0 G;  3ZZ0 A;  2V2Z A;  4DR6 I;  4DU7 A;  1FWL A;  4EMD A;  4JI5 E;  2PNL A;  4HXZ A;  5IT9 C;  1FNM A;  2BA1 D;  2X7I A;  3M7N D;  3V2U C;  2JT2 A;  4KHP I;  4DPU A;  4LF5 E;  1N34 E;  3B82 A;  2O3Z A;  2VQE E;  1Z59 A;  3QT6 A;  2UXB I;  4DR4 I;  4DPX A;  1FKA E;  4HYM A;  4UT4 A;  4LF4 E;  1S4E A;  4DV5 E;  4B3R E;  4KQV A;  1XNR E;  2O1V A;  1Z5C A;  4PRV A;  4X65 I;  4JI2 E;  2GS8 A;  2HKJ A;  2C39 B;  4LF7 I;  1FWK A;  4YHH E;  4MU1 A;  3GCM A;  1I94 I;  5A2Q C;  4LCG A;  3P3G A;  4LF8 I;  4JI6 I;  3L7Z B;  4USM A;  1MG7 A;  2C38 B;  4DUZ I;  2UUC I;  5K36 B;  1ZM2 A;  3PYG A;  4IZK A;  4DU8 A;  3QT5 A;  2Z5B A;  4JI3 E;  1FJG E;  1NHH A;  1MU5 A;  4YY3 I;  4WUD A;  4DUY E;  4JI1 I;  1N36 I;  3PYE A;  2UU9 E;  1N32 I;  2VF3 A;  5JEA A;  2PNZ B;  2PO0 B;  1IBK I;  4BA2 A;  2JEB A;  2NN6 E;  4WUC A;  5ELW A;  2EFG A;  2JEA A;  2NPF A;  4LFB E;  1Z0B A;  4FW9 A;  1PVG A;  3CDI A;  3GON A;  4LPF A;  2NN6 F;  4DR2 E;  4JI4 E;  4DR7 I;  4LOM A;  4Z7C A;  2ZM6 E;  4DPW A;  4LF5 I;  4FN5 A;  3V5R A;  1Z5B A;  1Z5A A;  3H4L A;  3QT7 A;  5JEA C;  1E3H A;  5EL9 A;  4LF4 I;  4ZVI A;  4B3R I;  1XNR I;  3KRN A;  4DV4 E;  2CG9 A;  1OYP A;  2PO2 A;  2UUB E;  4FWH A;  4ED4 A;  4GKK E;  4IFD E;  4LFA E;  4MDT A;  1USU A;  1UDO A;  4KHP E;  2CVE A;  3PRY A;  1KKH A;  2AJ4 A;  1E3P A;  1EA6 A;  2O1T A;  4DR4 E;  4IFD F;  2IER A;  1R6L A;  4NXN I;  3H1C A;  4JI3 I;  4AM3 A;  4FWD A;  2BA1 G;  3M7N G;  2NN6 B;  4X64 E;  2IOQ A;  2BR2 A;  1Y4U A;  2UU9 I;  4IZK B;  2Z5B B;  2CZ9 A;  4OO1 D;  4JI6 E;  1ZM9 A;  1MX0 A;  4LFB I;  3J7A M;  3Q6M A;  4I3H A;  3UHM A;  2BM0 A;  4B3M E;  4K0K E;  4IZJ A;  4DR2 I;  4YY3 E;  4IS9 A;  4OO1 C;  2ZM6 I;  4IZJ D;  5K36 E;  1VIS A;  5JEA B;  4BA2 B;  2JEB B;  1B63 A;  2JEA B;  2X36 A;  1N32 E;  2E1R A;  4JI0 I;  5C0X A;  4IFD B;  4JI7 I;  2R42 A;  5C0X D;  3ZM7 A;  4DV4 I;  3K85 A;  3J81 Q;  2UUB I;  2HKE A;  4DR7 E;  4GKK I;  1Z0G A;  2C37 A;  4LFA I;  2V2V A;  4DV0 E;  1Y60 A;  2IOP A;  4N3O A;  1B62 A;  5C0X C;  3U1K A;  1XXE A;  4QNJ A;  2PO2 B;  2HFU A;  1UEK A;  2ZBK B;  4X64 I;  2Z5C A;  4USK A;  2PO1 A;  1N33 E;  3GLL A;  4XTJ A;  2V34 A;  1XNQ I;  3M85 D;  1XMO I;  4PU9 A;  4DV3 I;  3B78 A;  2GQ0 A;  4JYA I;  1KVK A;  3J80 Q;  5DRO A;  4FW5 A;  4MYU A;  1N0V C;  3OTO E;  2E5L E;  2UUA E;  4AQY E;  2J65 A;  4B3M I;  4NXN E;  4NBQ A;  4K0K I;  4OX9 E;  4MU0 A;  3PYD A;  5LMN E;  4GKJ E;  5FWK A;  4LCF A;  1A6F A;  1R6M A;  1FI4 A;  3T1Y E;  4X66 I;  1Y6Z A;  1HNX E;  1HR0 E;  2VQF E;  1ELO A;  3QT8 A;  1ZXN A;  4DPY A;  1Z0T A;  1H72 C;  4DV0 I;  5DRQ A;  1ZXM A;  2A2C A;  3HUL A;  3PS2 A;  4LFC E;  1OYS A;  1KIJ A;  4JI0 E;  4MQY A;  4JI7 E;  4DV1 E;  5JEA E;  2C37 B;  2ZIT A;  4UTG A;  4B3S E;  2DEJ A;  1N33 I;  3B4T A;  1HK7 A;  4DR1 E;  5JEA F;  1YH8 A;  2V2Q A;  3WU5 A;  3U1Y A;  4PRX A;  3PS3 A;  1NHJ A;  4P7A A;  3OTO I;  2E5L I;  2UUA I;  2Z5C B;  4AQY I;  1Y4S A;  4OX9 I;  2PO1 B;  4BA1 A;  5LMN I;  3LPS A;  2R3V A;  4RPF A;  3WU3 A;  4GKJ I;  3CDJ A;  3JAM Q;  1DAR A;  4OO1 A;  4ISA A;  4OZE A;  1NHI A;  2UXC E;  5DRR A;  3T1Y I;  3DD6 A;  4LF9 I;  1XNQ E;  1XMO E;  3ZZT A;  4DV3 E;  4JYA E;  1U2R A;  1HNX I;  1HR0 I;  2VQF I;  4DV6 E;  4NXM I;  3D4J A;  4OKG A;  2WNR A;  4P52 A;  3M85 G;  5K36 D;  3T1H E;  4DV2 I;  4LFC I;  3Q6N A;  1USV A;  2LJP A;  2GO3 A;  3WU6 A;  2V8P A;  2O1W A;  4X62 I;  1RRE A;  4DR5 E;  5BR8 E;  1Z0W A;  4DV1 I;  4X66 E;  5IT9 Q;  1XMQ I;  4B3S I;  5K36 C;  4OO1 F;  5LL6 R;  2PNZ A;  4DR1 I;  1OYR A;  1HNZ E;  4B3T E;  4DXL A;  2HK2 A;  4DV7 I;  1PKP A;  3LNU A;  1UDS A;  1UDN A;  1WUU A;  1RR9 A;  5A2Q Q;  2Z5E A;  1H7U A;  3ZKB A;  3M6A A;  3ZZU A;  2UXC I;  5C0X F;  1PIE A;  1IBL E;  4HY1 A;  3J81 C;  1S16 A;  3HJC A;  2F4V I;  2Q2E B;  3GME A;  3WU4 A;  4BA1 B; 
#chains in the Genus database with same CATH homology
 1K47 A;  2HHH E;  2BV3 A;  4JI8 I;  1NZ0 A;  4DV6 I;  1HNW E;  2HK3 A;  1H73 A;  2HFS A;  4HAC A;  2WW4 A;  1ZM3 A;  1J5E E;  2O1U A;  1Z0E A;  3T1H I;  5FLX Q;  1EI1 A;  4LF6 E;  4LF9 E;  1OJ4 A;  1Z0C A;  4R1F A;  4DR5 I;  5BR8 I;  4IZJ B;  5IWA E;  3J7A G;  4NXM E;  4JV5 E;  3J80 C;  5GMD A;  3F0N A;  1HNZ I;  4B3T I;  3LTO A;  1QZR A;  4DV2 E;  5LMU I;  4X62 E;  1BKN A;  5FLX C;  5L3J A;  3ZKD A;  4DR3 E;  1XMQ E;  3K17 A;  4JI5 I;  4JG4 A;  1IBL I;  2BM1 A;  1N34 I;  3CWV A;  2VQE I;  1ZM4 A;  2HHH I;  1IBM E;  2J7K A;  4URL A;  1HNW I;  4DV7 E;  3P06 A;  4DV5 I;  2UXD E;  4DPT A;  1J5E I;  4JI2 I;  4DR6 E;  2DEI A;  1N0U A;  3B8H A;  4YHH I;  1XHK A;  4LF6 I;  1Z0V A;  4FWG A;  4Z7Y A;  2F4V E;  3K1J A;  2A2D A;  4HAC B;  5IWA I;  2UXB E;  4JI8 E;  4JV5 I;  1FJG I;  1D6T A;  4X65 E;  2XEX A;  3Q1Q A;  4DUY I;  4LF7 E;  2OI2 A;  1I94 E;  2CGE A;  4LF8 E;  3JAM C;  4DUZ E;  2UUC E;  1H74 A;  4DR3 I;  3PYF A;  4JI4 I;  5GME A;  2PNM A;  4MYT A;  1KTV A;  1IBM I;  4JI1 E;  1H7S A;  1N36 E;  4M1K A;  5LMU E;  1IBK E;  4WUB A;  2UXD I;  3ZZ0 A;  2V2Z A;  4DR6 I;  4DU7 A;  1FWL A;  4EMD A;  4JI5 E;  2PNL A;  4HXZ A;  5IT9 C;  1FNM A;  2X7I A;  3V2U C;  4KHP I;  4DPU A;  4LF5 E;  1N34 E;  3B82 A;  2VQE E;  1Z59 A;  3QT6 A;  2UXB I;  4DR4 I;  4DPX A;  1FKA E;  4HYM A;  4UT4 A;  4LF4 E;  1S4E A;  4DV5 E;  4B3R E;  4KQV A;  1XNR E;  2O1V A;  1Z5C A;  4PRV A;  4X65 I;  4JI2 E;  2GS8 A;  2HKJ A;  4LF7 I;  1FWK A;  4YHH E;  1I94 I;  5A2Q C;  4LF8 I;  4JI6 I;  4USM A;  1MG7 A;  4DUZ I;  2UUC I;  1ZM2 A;  3PYG A;  4IZK A;  4DU8 A;  3QT5 A;  2Z5B A;  4JI3 E;  1FJG E;  1NHH A;  1MU5 A;  4YY3 I;  4WUD A;  4DUY E;  4JI1 I;  1N36 I;  3PYE A;  2UU9 E;  1N32 I;  2VF3 A;  1IBK I;  4WUC A;  2EFG A;  2NPF A;  4LFB E;  1Z0B A;  4FW9 A;  1PVG A;  4DR7 I;  3GON A;  4DR2 E;  4JI4 E;  4Z7C A;  2ZM6 E;  4DPW A;  4LF5 I;  4FN5 A;  3V5R A;  1Z5B A;  1Z5A A;  3H4L A;  3QT7 A;  4LF4 I;  4ZVI A;  4B3R I;  1XNR I;  4DV4 E;  2CG9 A;  2UUB E;  4FWH A;  4ED4 A;  4GKK E;  4LFA E;  1USU A;  4KHP E;  3PRY A;  1KKH A;  2AJ4 A;  1EA6 A;  2O1T A;  4DR4 E;  4NXN I;  4JI3 I;  4FWD A;  4X64 E;  2IOQ A;  1Y4U A;  2UU9 I;  4IZK B;  2Z5B B;  4JI6 E;  1ZM9 A;  1MX0 A;  4LFB I;  3J7A M;  3Q6M A;  4I3H A;  2BM0 A;  4B3M E;  4K0K E;  4IZJ A;  4DR2 I;  4YY3 E;  2ZM6 I;  4IZJ D;  1VIS A;  1B63 A;  2X36 A;  1N32 E;  2E1R A;  4JI0 I;  4JI7 I;  2R42 A;  3ZM7 A;  4DV4 I;  3K85 A;  3J81 Q;  2UUB I;  2HKE A;  4DR7 E;  4GKK I;  1Z0G A;  4LFA I;  2V2V A;  4DV0 E;  2IOP A;  4N3O A;  1B62 A;  2HFU A;  1UEK A;  2ZBK B;  4X64 I;  2Z5C A;  4USK A;  1N33 E;  4XTJ A;  2V34 A;  1XNQ I;  1XMO I;  4PU9 A;  4DV3 I;  3B78 A;  2GQ0 A;  4JYA I;  1KVK A;  3J80 Q;  4MYU A;  1N0V C;  3OTO E;  2E5L E;  2UUA E;  4AQY E;  4B3M I;  4K0K I;  4NXN E;  4OX9 E;  3PYD A;  5LMN E;  4GKJ E;  5FWK A;  1A6F A;  1FI4 A;  3T1Y E;  4X66 I;  1Y6Z A;  1HNX E;  1HR0 E;  2VQF E;  1ELO A;  3QT8 A;  1ZXN A;  4DPY A;  1Z0T A;  1H72 C;  4DV0 I;  1ZXM A;  2A2C A;  3HUL A;  4LFC E;  1KIJ A;  4JI0 E;  4JI7 E;  4DV1 E;  2ZIT A;  4UTG A;  4B3S E;  2DEJ A;  1N33 I;  1HK7 A;  4DR1 E;  2V2Q A;  3WU5 A;  4PRX A;  1NHJ A;  4P7A A;  3OTO I;  2E5L I;  2UUA I;  2Z5C B;  4AQY I;  1Y4S A;  4OX9 I;  5LMN I;  3LPS A;  2R3V A;  4RPF A;  3WU3 A;  4GKJ I;  3JAM Q;  1DAR A;  2UXC E;  1NHI A;  3T1Y I;  4LF9 I;  1XNQ E;  1XMO E;  3ZZT A;  4DV3 E;  4JYA E;  1U2R A;  1HNX I;  1HR0 I;  2VQF I;  4DV6 E;  4NXM I;  3D4J A;  4P52 A;  3T1H E;  4DV2 I;  4LFC I;  3Q6N A;  1USV A;  2LJP A;  4X62 I;  3WU6 A;  2V8P A;  2O1W A;  1RRE A;  4DR5 E;  5BR8 E;  1Z0W A;  4DV1 I;  4X66 E;  5IT9 Q;  1XMQ I;  4B3S I;  5LL6 R;  4DR1 I;  1HNZ E;  4B3T E;  4DXL A;  2HK2 A;  4DV7 I;  1PKP A;  3LNU A;  1WUU A;  1RR9 A;  5A2Q Q;  2Z5E A;  1H7U A;  3ZKB A;  3M6A A;  3ZZU A;  2UXC I;  1PIE A;  1IBL E;  4HY1 A;  3J81 C;  1S16 A;  3HJC A;  2F4V I;  2Q2E B;  2CZ9 A;  3WU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...