4YY3I

30s ribosomal subunit- higb complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yy3I00
4JI4E 3PYGA 3WU5A 2WW4A 4LFAE 4X65E 1FI4A 4EMDA 2F4VI 1Z0TA 4B3MI 4B3SE 3H4LA 1ZM9A 4DV4I 4DV2E 2GS8A 4DR5E 1I94I 4DV1E 4LF5E 3T1HE 3T1YE 2HK3A 4YY3E 1N36E 4LF7E 4LFCE 4NXMI 1Z0CA 3CWVA 4DPUA 1HR0E 1Z5BA 1NHHA 4FWDA 4LF6I 4DR3E 1HNZI 4KHPE 2E1RA 4LFBI 2UU9E 2V2QA 1IBME 1FKAE 5A2QQ 3K1JA 4JI2I 2R3VA 5IWAE 4MYUA 3JAMC 2AJ4A 1Z0GA 5LMNE 2E5LE 1FWLA 1NHJA 4GKKI 4NXNE 4DR7I 1QZRA 4B3RE 3J81C 4WUBA 1RR9A 1OJ4A 4DR6E 4JI7I 4HY1A 3ZZTA 1J5EI 2VQEE 2HHHE 3GONA 5BR8E 1EA6A 5LMUE 2UUAI 1HNWE 1H73A 4DR4E 1PKPA 3F0NA 1UEKA 4DPYA 4P7AA 1EI1A 4JI4I 2EFGA 2UXCE 3WU6A 4LFAI 4PRXA 4X65I 4DPWA 1HNXE 3ZKBA 4B3SI 2DEJA 4AQYE 3V5RA 4DV2I 1U2RA 4DR5I 1Z0WA 4JI5E 3J81Q 4DV1I 4LF5I 3T1HI 3WU3A 3T1YI 1PVGA 3B78A 4YY3I 4JV5E 4RPFA 2BV3A 1XHKA 1IBKE 1ZM3A 5IT9Q 2VQFE 4LFCI 1N36I 2HKJA 4LF7I 2V34A 4DV0E 1XNRE 1S4EA 1N0UA 4JI8E 1HR0I 4DR3I 4KHPI 2UU9I 4YHHE 1IBMI 1N33E 3J80Q 5A2QC 1FNMA 4KQVA 4R1FA 1PIEA 4PU9A 4DV5E 4K0KE 5IWAI 3OTOE 5LMNI 4HYMA 2E5LI 1MG7A 1H7SA 4NXNI 4HXZA 4B3RI 1XNQE 4DR6I 4PRVA 4JI3E 4Z7CA 2VQEI 2UXDE 2BM0A 3QT7A 2HHHI 4JI0E 1MU5A 5BR8I 4HACB 4DPTA 5LMUI 4JI6E 3D4JA 4GKJE 4DR4I 1HNWI 5GMEA 4WUCA 1RREA 1IBLE 4DR1E 2UXCI 1Z0EA 1HNXI 4X64E 1ZM4A 2DEIA 4M1KA 4AQYI 1KIJA 1H74A 3ZZ0A 2R42A 4JI5I 1NHIA 1N0VC 5IT9C 4JYAE 4JV5I 1IBKI 2VQFI 1N34E 1FWKA 4DV0I 1XNRI 1KVKA 3J7AG 4MYTA 1MX0A 4JI8I 3J80C 5FLXQ 2UUCE 4YHHI 2CZ9A 1B63A 2Q2EB 3QT5A 3QT6A 4X66E 2X7IA 4DV5I 4K0KI 3OTOI 4UT4A 2V8PA 4WUDA 4DV7E 3WU4A 4DV6E 4B3TE 5L3JA 1B62A 2ZITA 1XNQI 1FJGE 2A2DA 1ELOA 4JI3I 2VF3A 2UXDI 3PYDA 4JI1E 4OX9E 3LTOA 4JI0I 4LF9E 4DUZE 2XEXA 1ZM2A 2NPFA 4JI6I 4JG4A 4DV3E 4FW9A 3B82A 4UTGA 4DU8A 1IBLI 4DR1I 4LF4E 1WUUA 4USKA 2ZM6E 3ZZUA 4X64I 1S16A 1N32E 4DU7A 4Z7YA 1XMQE 1Z0BA 1Z0VA 3V2UC 2UXBE 4JYAI 1XMOE 3PYFA 4USMA 1N34I 4DUYE 1KTVA 2J7KA 1VISA 5FLXC 3HULA 1BKNA 4DR2E 2UUCI 2HFUA 1DARA 4X62E 4X66I 4HACA 3ZKDA 3LPSA 4LF8E 2V2VA 1A6FA 2HKEA 4FWHA 4ED4A 5LL6R 2V2ZA 1ZXMA 2UUBE 4DV7I 2ZBKB 4DV6I 4B3TI 2A2CA 1H72C 2F4VE 3LNUA 1FJGI 1H7UA 1D6TA 4B3ME 2OI2A 1NZ0A 4DV4E 4URLA 4ZVIA 1I94E 1Z5CA 2HK2A 4JI1I 4OX9I 4LF9I 1Z5AA 4I3HA 4DUZI 3M6AA 4XTJA 2X36A 3QT8A 4FWGA 1N33I 2HFSA 3K17A 3B8HA 4DV3I 4NXME 1K47A 4LF6E 1HNZE 4LFBE 4LF4I 1Z59A 2ZM6I 4DPXA 1N32I 1XMQI 4JI2E 4P52A 2UXBI 1XMOI 1KKHA 3JAMQ 4GKKE 4DR7E 1ZXNA 4DUYI 4DR2I 4JI7E 5GMDA 3J7AM 4GKJI 4FN5A 1J5EE 3PYEA 4X62I 4LF8I 2LJPA 4DXLA 2UUAE 2BM1A 2UUBI 3Q1QA 3ZM7A
chains in the Genus database with same CATH superfamily
2BA0D 4JI4E 4IFDC 3PYGA 1UDQA 5JEAC 3WU5A 1E3HA 2WW4A 4LFAE 4X65E 1FI4A 4OKGA 4EMDA 2F4VI 1Z0TA 4FW7A 4B3MI 4B3SE 3H4LA 1ZM9A 4DV4I 2BA0G 4DV2E 2GS8A 4DR5E 1I94I 1XXEA 4DV1E 4LF5E 3T1HE 5C0XD 2NN6D 2CVEA 3T1YE 2HK3A 4YY3E 3GMEA 1UDSA 2PNZB 1N36E 4LF7E 4LFCE 2GO3A 1Y4SA 4NXMI 1Z0CA 2PO1B 3CWVA 4DPUA 1Z5BA 1NHHA 4FWDA 1HR0E 4LF6I 4DR3E 1HNZI 4KHPE 2CGEA 3U1YA 2E1RA 4LFBI 2UU9E 2PNZA 2V2QA 4LPFA 1IBME 1FKAE 2CG9A 5A2QQ 3K1JA 4JI2I 5K36D 2R3VA 4IZKB 5IWAE 4MYUA 3JAMC 2AJ4A 1Z0GA 5LMNE 2E5LE 1FWLA 1NHJA 2Z5BB 4GKKI 4NXNE 4DR7I 1QZRA 3DD6A 4B3RE 3J81C 4WUBA 1RR9A 1OJ4A 4DR6E 1OYRA 2WP8A 4JI7I 1USVA 4HY1A 4LCHA 3ZZTA 1J5EI 2VQEE 2JE6B 3B4TA 5C0XA 2HHHE 2NN6A 3GONA 4IFDD 5BR8E 5JEAD 1EA6A 2IERA 5LMUE 2UUAI 4NBQA 1HNWE 1H73A 4DR4E 1PKPA 3F0NA 1UEKA 4DPYA 4P7AA 1EI1A 4IS9A 4JI4I 2EFGA 2UXCE 3WU6A 4LFAI 4PRXA 4X65I 4DPWA 1HNXE 2JEAA 3ZKBA 3L7ZA 4B3SI 2DEJA 4AQYE 3V5RA 5K36A 4DV2I 1U2RA 4DR5I 1Z0WA 4JI5E 4LOMA 4MDTA 3J81Q 5EL9A 4DV1I 5DNLA 4LF5I 3T1HI 3WU3A 1PVGA 3T1YI 3B78A 4FW4A 4YY3I 4OZEA 4JV5E 4RPFA 2BV3A 1XHKA 1IBKE 1ZM3A 5IT9Q 2VQFE 5DRPA 4LFCI 1N36I 2HKJA 4LF7I 1VI7A 2V34A 5EKWA 4DV0E 1XNRE 4MU0A 1S4EA 1N0UA 4JI8E 2GQ0A 1HR0I 4DR3I 4KHPI 2PO0A 2UU9I 1Y4UA 4YHHE 1IBMI 1N33E 3J80Q 5A2QC 1FNMA 1R6LA 2C37B 4BA2B 4IFDA 1Y60A 4KQVA 4R1FA 5JEAA 3PS2A 1PIEA 4PU9A 2C38B 1UDOA 4DV5E 4K0KE 4IZJD 2O1TA 5IWAI 3OTOE 3CDIA 3GCMA 4HYMA 3GLLA 5LMNI 2E5LI 4OO1F 1MG7A 1H7SA 4NXNI 2VESA 4HXZA 4B3RI 5FWKA 4OO1E 1XNQE 1Y5YA 4DR6I 4PRVA 2BA1D 4JI3E 4Z7CA 1OYPA 2O1VA 3Q6MA 2F1DA 2VQEI 2UXDE 2BM0A 3QT7A 2HHHI 4JI0E 1HK7A 1MU5A 5BR8I 4HACB 4DPTA 5LMUI 4JI6E 3D4JA 4GKJE 4DR4I 2PO1A 1HNWI 5GMEA 4WUCA 1RREA 3CDJA 4FW5A 1IBLE 4IZJB 4DR1E 2UXCI 3HKMA 1Z0EA 1HNXI 3M7ND 4X64E 2JT2A 1ZM4A 3PS1A 2DEIA 4M1KA 4AQYI 1KIJA 4IZKA 1H74A 3ZZ0A 4MQYA 4IZJA 4BA1B 2R42A 4JI5I 1NHIA 1UDNA 5ELWA 1N0VC 5IT9C 2Z5BA 4JYAE 3M7NG 4JV5I 1IBKI 2VQFI 2O1UA 1N34E 1FWKA 1R6MA 4DV0I 1XNRI 1KVKA 4QNJA 3J7AG 1USUA 4MYTA 1MX0A 4JI8I 2IESA 4OO1D 3J80C 5FLXQ 2UUCE 3PRYA 2JE6A 4YHHI 2CZ9A 1B63A 2Q2EB 3QT5A 3QT6A 4X66E 2X7IA 4DV5I 2PO2B 4K0KI 3OTOI 4UT4A 2V8PA 4WUDA 5C0XF 4DV7E 2NN6F 3WU4A 3Q6NA 3P06A 4DV6E 4B3TE 4J3DA 5L3JA 2PNMA 1B62A 2PO2A 2ZITA 3P76A 5C0XE 1XNQI 2NN6E 1FJGE 4AIDA 2A2DA 1ELOA 4JI3I 2BR2B 2VF3A 4AIMA 4N3OA 2UXDI 3PYDA 4JI1E 4OX9E 3LTOA 4JI0I 1YH8A 4LF9E 4OO1B 4DUZE 2XEXA 1ZM2A 5K36F 2NPFA 5DROA 4JI6I 4JG4A 4DV3E 4MU3A 4FW9A 4OO1C 2WNRB 3B82A 4UTGA 3P3CA 5K36E 4DU8A 1IBLI 4DR1I 4LF4E 1WUUA 2PNLA 4USKA 2ZM6E 2C37A 1YHCA 3ZZUA 4BA2A 1Y6ZA 4X64I 1S16A 1N32E 2JEBB 2C38A 4DU7A 4Z7YA 1XMQE 1Z0BA 4LCFA 1Z0VA 3V2UC 3P3EA 2UXBE 4JYAI 1XMOE 2JEBA 4IFDF 3PYFA 4USMA 5JEAF 2IOQA 1N34I 4DUYE 1KTVA 2J7KA 1VISA 3M85D 2BA1G 5FLXC 3HULA 4IFDE 1BKNA 4DR2E 5JEAE 2UUCI 2HFUA 1E3PA 1DARA 2IOPA 3M85G 1RHYA 4X62E 4QNKA 4X66I 3PS3A 4HACA 3ZKDA 3LPSA 1P42A 4LF8E 2V2VA 1A6FA 2HKEA 4FWHA 4ED4A 5LL6R 2AE8A 2V2ZA 1ZXMA 2UUBE 4DV7I 3P3GA 2C39B 4FW3A 3UHMA 2ZBKB 4DV6I 4B3TI 4ISAA 2A2CA 1H72C 2O1WA 3KRNA 3LNUA 2F4VE 1H7UA 1FJGI 1D6TA 4B3ME 2OI2A 1NZ0A 2C39A 5DRQA 4DV4E 4BA1A 4URLA 2Z5CB 2WP8B 4ZVIA 1I94E 4AM3A 1Z5CA 2HK2A 4JI1I 3U1KA 4OX9I 4MU1A 3NZKA 4LF9I 1Z5AA 4I3HA 5C0XB 4DUZI 3M6AA 2NN6B 4GQUA 4XTJA 2X36A 3QT8A 4FWGA 1N33I 2HFSA 2Z5CA 3K17A 3B8HA 4MU4A 4DV3I 4NXME 1K47A 4LF6E 5C0XC 2NN6C 1HNZE 4LFBE 4LF4I 1Z59A 2ZM6I 4DPXA 2GO4A 2JEAB 1N32I 1XMQI 3L7ZB 4JI2E 4FW6A 4P52A 5DRRA 5K36B 2UXBI 5DNXA 1XMOI 1KKHA 3JAMQ 4GKKE 4DR7E 4U3BA 1ZXNA 4DUYI 5K36C 3K85A 2BR2A 3HJCA 4DR2I 4JI7E 5GMDA 3J7AM 4GKJI 4FN5A 1J5EE 3PYEA 2PO0B 4OO1A 2Z5EA 4X62I 4IFDB 4LF8I 5JEAB 1OYSA 2LJPA 4DXLA 2UUAE 2BM1A 2O3ZA 2UUBI 2J65A 4U3DA 2WNRA 4LCGA 3Q1QA 3H1CA 3ZM7A
chains in the Genus database with same CATH topology
4JI4E 3PYGA 3WU5A 2WW4A 4LFAE 4X65E 1FI4A 4EMDA 2F4VI 1Z0TA 4B3MI 4B3SE 3H4LA 1ZM9A 4DV4I 4DV2E 2GS8A 4DR5E 1I94I 4DV1E 4LF5E 3T1HE 3T1YE 2HK3A 4YY3E 1N36E 4LF7E 4LFCE 1Y4SA 4NXMI 1Z0CA 3CWVA 4DPUA 1Z5BA 1NHHA 4FWDA 1HR0E 4LF6I 4DR3E 1HNZI 4KHPE 2CGEA 2E1RA 4LFBI 2UU9E 2V2QA 1IBME 1FKAE 2CG9A 5A2QQ 3K1JA 4JI2I 2R3VA 4IZKB 5IWAE 4MYUA 3JAMC 2AJ4A 1Z0GA 5LMNE 2E5LE 1FWLA 1NHJA 2Z5BB 4GKKI 4NXNE 4DR7I 1QZRA 4B3RE 3J81C 4WUBA 1RR9A 1OJ4A 4DR6E 4JI7I 1USVA 4HY1A 3ZZTA 1J5EI 2VQEE 2HHHE 3GONA 5BR8E 1EA6A 5LMUE 2UUAI 1HNWE 1H73A 4DR4E 1PKPA 3F0NA 1UEKA 4DPYA 4P7AA 1EI1A 4JI4I 2EFGA 2UXCE 3WU6A 4LFAI 4PRXA 4X65I 4DPWA 1HNXE 3ZKBA 4B3SI 2DEJA 4AQYE 3V5RA 4DV2I 1U2RA 4DR5I 1Z0WA 4JI5E 3J81Q 4DV1I 4LF5I 3T1HI 3WU3A 3T1YI 1PVGA 3B78A 4YY3I 4JV5E 4RPFA 2BV3A 1XHKA 1IBKE 1ZM3A 5IT9Q 2VQFE 4LFCI 1N36I 2HKJA 4LF7I 2V34A 4DV0E 1XNRE 1S4EA 1N0UA 4JI8E 2GQ0A 1HR0I 4DR3I 4KHPI 2UU9I 1Y4UA 4YHHE 1IBMI 1N33E 3J80Q 5A2QC 1FNMA 4KQVA 4R1FA 1PIEA 4PU9A 4DV5E 4K0KE 4IZJD 2O1TA 5IWAI 3OTOE 5LMNI 4HYMA 2E5LI 1MG7A 1H7SA 4NXNI 4HXZA 4B3RI 5FWKA 1XNQE 4DR6I 4PRVA 4JI3E 4Z7CA 2O1VA 3Q6MA 2VQEI 2UXDE 2BM0A 3QT7A 2HHHI 4JI0E 1HK7A 1MU5A 5BR8I 4HACB 4DPTA 5LMUI 4JI6E 3D4JA 4GKJE 4DR4I 1HNWI 5GMEA 4WUCA 1RREA 1IBLE 4IZJB 4DR1E 2UXCI 1Z0EA 1HNXI 4X64E 1ZM4A 2DEIA 4M1KA 4AQYI 1KIJA 4IZKA 1H74A 3ZZ0A 4IZJA 2R42A 4JI5I 1NHIA 1N0VC 5IT9C 2Z5BA 4JYAE 4JV5I 1IBKI 2VQFI 2O1UA 1N34E 1FWKA 4DV0I 1XNRI 1KVKA 3J7AG 1USUA 4MYTA 1MX0A 4JI8I 3J80C 5FLXQ 2UUCE 3PRYA 4YHHI 2CZ9A 1B63A 2Q2EB 3QT5A 3QT6A 4X66E 2X7IA 4DV5I 4K0KI 3OTOI 4UT4A 2V8PA 4WUDA 4DV7E 3WU4A 3Q6NA 3P06A 4DV6E 4B3TE 5L3JA 2PNMA 1B62A 2ZITA 1XNQI 1FJGE 2A2DA 1ELOA 4JI3I 2VF3A 4N3OA 2UXDI 3PYDA 4JI1E 4OX9E 3LTOA 4JI0I 4LF9E 4DUZE 2XEXA 1ZM2A 2NPFA 4JI6I 4JG4A 4DV3E 4FW9A 3B82A 4UTGA 4DU8A 1IBLI 4DR1I 4LF4E 1WUUA 2PNLA 4USKA 2ZM6E 3ZZUA 1Y6ZA 4X64I 1S16A 1N32E 4DU7A 4Z7YA 1XMQE 1Z0BA 1Z0VA 3V2UC 2UXBE 4JYAI 1XMOE 3PYFA 4USMA 2IOQA 1N34I 4DUYE 1KTVA 2J7KA 1VISA 5FLXC 3HULA 1BKNA 4DR2E 2UUCI 2HFUA 1DARA 2IOPA 4X62E 4X66I 4HACA 3ZKDA 3LPSA 4LF8E 2V2VA 1A6FA 2HKEA 4FWHA 4ED4A 5LL6R 2V2ZA 1ZXMA 2UUBE 4DV7I 2ZBKB 4DV6I 4B3TI 2A2CA 1H72C 2O1WA 2F4VE 3LNUA 1FJGI 1H7UA 1D6TA 4B3ME 2OI2A 1NZ0A 4DV4E 4URLA 2Z5CB 4ZVIA 1I94E 1Z5CA 2HK2A 4JI1I 4OX9I 4LF9I 1Z5AA 4I3HA 4DUZI 3M6AA 4XTJA 2X36A 3QT8A 4FWGA 1N33I 2HFSA 2Z5CA 3K17A 3B8HA 4DV3I 4NXME 1K47A 4LF6E 1HNZE 4LFBE 4LF4I 1Z59A 2ZM6I 4DPXA 1N32I 1XMQI 4JI2E 4P52A 2UXBI 1XMOI 1KKHA 3JAMQ 4GKKE 4DR7E 1ZXNA 4DUYI 3K85A 3HJCA 4DR2I 4JI7E 5GMDA 3J7AM 4GKJI 4FN5A 1J5EE 3PYEA 2Z5EA 4X62I 4LF8I 2LJPA 4DXLA 2UUAE 2BM1A 2UUBI 3Q1QA 3ZM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 E;  3PYG A;  3WU5 A;  2WW4 A;  4LFA E;  4X65 E;  1FI4 A;  4EMD A;  2F4V I;  1Z0T A;  4B3M I;  4B3S E;  3H4L A;  1ZM9 A;  4DV4 I;  4DV2 E;  2GS8 A;  4DR5 E;  1I94 I;  4DV1 E;  4LF5 E;  3T1H E;  3T1Y E;  2HK3 A;  4YY3 E;  1N36 E;  4LF7 E;  4LFC E;  4NXM I;  1Z0C A;  3CWV A;  4DPU A;  1HR0 E;  1Z5B A;  1NHH A;  4FWD A;  4LF6 I;  4DR3 E;  1HNZ I;  4KHP E;  2E1R A;  4LFB I;  2UU9 E;  2V2Q A;  1IBM E;  1FKA E;  5A2Q Q;  3K1J A;  4JI2 I;  2R3V A;  5IWA E;  4MYU A;  3JAM C;  2AJ4 A;  1Z0G A;  5LMN E;  2E5L E;  1FWL A;  1NHJ A;  4GKK I;  4NXN E;  4DR7 I;  1QZR A;  4B3R E;  3J81 C;  4WUB A;  1RR9 A;  1OJ4 A;  4DR6 E;  4JI7 I;  4HY1 A;  3ZZT A;  1J5E I;  2VQE E;  2HHH E;  3GON A;  5BR8 E;  1EA6 A;  5LMU E;  2UUA I;  1HNW E;  1H73 A;  4DR4 E;  1PKP A;  3F0N A;  1UEK A;  4DPY A;  4P7A A;  1EI1 A;  4JI4 I;  2EFG A;  2UXC E;  3WU6 A;  4LFA I;  4PRX A;  4X65 I;  4DPW A;  1HNX E;  3ZKB A;  4B3S I;  2DEJ A;  4AQY E;  3V5R A;  4DV2 I;  1U2R A;  4DR5 I;  1Z0W A;  4JI5 E;  3J81 Q;  4DV1 I;  4LF5 I;  3T1H I;  3WU3 A;  3T1Y I;  1PVG A;  3B78 A;  4YY3 I;  4JV5 E;  4RPF A;  2BV3 A;  1XHK A;  1IBK E;  1ZM3 A;  5IT9 Q;  2VQF E;  4LFC I;  1N36 I;  2HKJ A;  4LF7 I;  2V34 A;  4DV0 E;  1XNR E;  1S4E A;  1N0U A;  4JI8 E;  1HR0 I;  4DR3 I;  4KHP I;  2UU9 I;  4YHH E;  1IBM I;  1N33 E;  3J80 Q;  5A2Q C;  1FNM A;  4KQV A;  4R1F A;  1PIE A;  4PU9 A;  4DV5 E;  4K0K E;  5IWA I;  3OTO E;  5LMN I;  4HYM A;  2E5L I;  1MG7 A;  1H7S A;  4NXN I;  4HXZ A;  4B3R I;  1XNQ E;  4DR6 I;  4PRV A;  4JI3 E;  4Z7C A;  2VQE I;  2UXD E;  2BM0 A;  3QT7 A;  2HHH I;  4JI0 E;  1MU5 A;  5BR8 I;  4HAC B;  4DPT A;  5LMU I;  4JI6 E;  3D4J A;  4GKJ E;  4DR4 I;  1HNW I;  5GME A;  4WUC A;  1RRE A;  1IBL E;  4DR1 E;  2UXC I;  1Z0E A;  1HNX I;  4X64 E;  1ZM4 A;  2DEI A;  4M1K A;  4AQY I;  1KIJ A;  1H74 A;  3ZZ0 A;  2R42 A;  4JI5 I;  1NHI A;  1N0V C;  5IT9 C;  4JYA E;  4JV5 I;  1IBK I;  2VQF I;  1N34 E;  1FWK A;  4DV0 I;  1XNR I;  1KVK A;  3J7A G;  4MYT A;  1MX0 A;  4JI8 I;  3J80 C;  5FLX Q;  2UUC E;  4YHH I;  2CZ9 A;  1B63 A;  2Q2E B;  3QT5 A;  3QT6 A;  4X66 E;  2X7I A;  4DV5 I;  4K0K I;  3OTO I;  4UT4 A;  2V8P A;  4WUD A;  4DV7 E;  3WU4 A;  4DV6 E;  4B3T E;  5L3J A;  1B62 A;  2ZIT A;  1XNQ I;  1FJG E;  2A2D A;  1ELO A;  4JI3 I;  2VF3 A;  2UXD I;  3PYD A;  4JI1 E;  4OX9 E;  3LTO A;  4JI0 I;  4LF9 E;  4DUZ E;  2XEX A;  1ZM2 A;  2NPF A;  4JI6 I;  4JG4 A;  4DV3 E;  4FW9 A;  3B82 A;  4UTG A;  4DU8 A;  1IBL I;  4DR1 I;  4LF4 E;  1WUU A;  4USK A;  2ZM6 E;  3ZZU A;  4X64 I;  1S16 A;  1N32 E;  4DU7 A;  4Z7Y A;  1XMQ E;  1Z0B A;  1Z0V A;  3V2U C;  2UXB E;  4JYA I;  1XMO E;  3PYF A;  4USM A;  1N34 I;  4DUY E;  1KTV A;  2J7K A;  1VIS A;  5FLX C;  3HUL A;  1BKN A;  4DR2 E;  2UUC I;  2HFU A;  1DAR A;  4X62 E;  4X66 I;  4HAC A;  3ZKD A;  3LPS A;  4LF8 E;  2V2V A;  1A6F A;  2HKE A;  4FWH A;  4ED4 A;  5LL6 R;  2V2Z A;  1ZXM A;  2UUB E;  4DV7 I;  2ZBK B;  4DV6 I;  4B3T I;  2A2C A;  1H72 C;  2F4V E;  3LNU A;  1FJG I;  1H7U A;  1D6T A;  4B3M E;  2OI2 A;  1NZ0 A;  4DV4 E;  4URL A;  4ZVI A;  1I94 E;  1Z5C A;  2HK2 A;  4JI1 I;  4OX9 I;  4LF9 I;  1Z5A A;  4I3H A;  4DUZ I;  3M6A A;  4XTJ A;  2X36 A;  3QT8 A;  4FWG A;  1N33 I;  2HFS A;  3K17 A;  3B8H A;  4DV3 I;  4NXM E;  1K47 A;  4LF6 E;  1HNZ E;  4LFB E;  4LF4 I;  1Z59 A;  2ZM6 I;  4DPX A;  1N32 I;  1XMQ I;  4JI2 E;  4P52 A;  2UXB I;  1XMO I;  1KKH A;  3JAM Q;  4GKK E;  4DR7 E;  1ZXN A;  4DUY I;  4DR2 I;  4JI7 E;  5GMD A;  3J7A M;  4GKJ I;  4FN5 A;  1J5E E;  3PYE A;  4X62 I;  4LF8 I;  2LJP A;  4DXL A;  2UUA E;  2BM1 A;  2UUB I;  3Q1Q A;  3ZM7 A; 
#chains in the Genus database with same CATH topology
 2BA0 D;  4JI4 E;  4IFD C;  3PYG A;  1UDQ A;  5JEA C;  3WU5 A;  1E3H A;  2WW4 A;  4LFA E;  4X65 E;  1FI4 A;  4OKG A;  4EMD A;  2F4V I;  1Z0T A;  4FW7 A;  4B3M I;  4B3S E;  3H4L A;  1ZM9 A;  4DV4 I;  2BA0 G;  4DV2 E;  2GS8 A;  4DR5 E;  1I94 I;  1XXE A;  4DV1 E;  4LF5 E;  3T1H E;  5C0X D;  2NN6 D;  2CVE A;  3T1Y E;  2HK3 A;  4YY3 E;  3GME A;  1UDS A;  2PNZ B;  1N36 E;  4LF7 E;  4LFC E;  2GO3 A;  1Y4S A;  4NXM I;  1Z0C A;  2PO1 B;  3CWV A;  4DPU A;  1Z5B A;  1NHH A;  4FWD A;  1HR0 E;  4LF6 I;  4DR3 E;  1HNZ I;  4KHP E;  2CGE A;  3U1Y A;  2E1R A;  4LFB I;  2UU9 E;  2PNZ A;  2V2Q A;  4LPF A;  1IBM E;  1FKA E;  2CG9 A;  5A2Q Q;  3K1J A;  4JI2 I;  5K36 D;  2R3V A;  4IZK B;  5IWA E;  4MYU A;  3JAM C;  2AJ4 A;  1Z0G A;  5LMN E;  2E5L E;  1FWL A;  1NHJ A;  2Z5B B;  4GKK I;  4NXN E;  4DR7 I;  1QZR A;  3DD6 A;  4B3R E;  3J81 C;  4WUB A;  1RR9 A;  1OJ4 A;  4DR6 E;  1OYR A;  2WP8 A;  4JI7 I;  1USV A;  4HY1 A;  4LCH A;  3ZZT A;  1J5E I;  2VQE E;  2JE6 B;  3B4T A;  5C0X A;  2HHH E;  2NN6 A;  3GON A;  4IFD D;  5BR8 E;  5JEA D;  1EA6 A;  2IER A;  5LMU E;  2UUA I;  4NBQ A;  1HNW E;  1H73 A;  4DR4 E;  1PKP A;  3F0N A;  1UEK A;  4DPY A;  4P7A A;  1EI1 A;  4IS9 A;  4JI4 I;  2EFG A;  2UXC E;  3WU6 A;  4LFA I;  4PRX A;  4X65 I;  4DPW A;  1HNX E;  2JEA A;  3ZKB A;  3L7Z A;  4B3S I;  2DEJ A;  4AQY E;  3V5R A;  5K36 A;  4DV2 I;  1U2R A;  4DR5 I;  1Z0W A;  4JI5 E;  4LOM A;  4MDT A;  3J81 Q;  5EL9 A;  4DV1 I;  5DNL A;  4LF5 I;  3T1H I;  3WU3 A;  1PVG A;  3T1Y I;  3B78 A;  4FW4 A;  4YY3 I;  4OZE A;  4JV5 E;  4RPF A;  2BV3 A;  1XHK A;  1IBK E;  1ZM3 A;  5IT9 Q;  2VQF E;  5DRP A;  4LFC I;  1N36 I;  2HKJ A;  4LF7 I;  1VI7 A;  2V34 A;  5EKW A;  4DV0 E;  1XNR E;  4MU0 A;  1S4E A;  1N0U A;  4JI8 E;  2GQ0 A;  1HR0 I;  4DR3 I;  4KHP I;  2PO0 A;  2UU9 I;  1Y4U A;  4YHH E;  1IBM I;  1N33 E;  3J80 Q;  5A2Q C;  1FNM A;  1R6L A;  2C37 B;  4BA2 B;  4IFD A;  1Y60 A;  4KQV A;  4R1F A;  5JEA A;  3PS2 A;  1PIE A;  4PU9 A;  2C38 B;  1UDO A;  4DV5 E;  4K0K E;  4IZJ D;  2O1T A;  5IWA I;  3OTO E;  3CDI A;  3GCM A;  4HYM A;  3GLL A;  5LMN I;  2E5L I;  4OO1 F;  1MG7 A;  1H7S A;  4NXN I;  2VES A;  4HXZ A;  4B3R I;  5FWK A;  4OO1 E;  1XNQ E;  1Y5Y A;  4DR6 I;  4PRV A;  2BA1 D;  4JI3 E;  4Z7C A;  1OYP A;  2O1V A;  3Q6M A;  2F1D A;  2VQE I;  2UXD E;  2BM0 A;  3QT7 A;  2HHH I;  4JI0 E;  1HK7 A;  1MU5 A;  5BR8 I;  4HAC B;  4DPT A;  5LMU I;  4JI6 E;  3D4J A;  4GKJ E;  4DR4 I;  2PO1 A;  1HNW I;  5GME A;  4WUC A;  1RRE A;  3CDJ A;  4FW5 A;  1IBL E;  4IZJ B;  4DR1 E;  2UXC I;  3HKM A;  1Z0E A;  1HNX I;  3M7N D;  4X64 E;  2JT2 A;  1ZM4 A;  3PS1 A;  2DEI A;  4M1K A;  4AQY I;  1KIJ A;  4IZK A;  1H74 A;  3ZZ0 A;  4MQY A;  4IZJ A;  4BA1 B;  2R42 A;  4JI5 I;  1NHI A;  1UDN A;  5ELW A;  1N0V C;  5IT9 C;  2Z5B A;  4JYA E;  3M7N G;  4JV5 I;  1IBK I;  2VQF I;  2O1U A;  1N34 E;  1FWK A;  1R6M A;  4DV0 I;  1XNR I;  1KVK A;  4QNJ A;  3J7A G;  1USU A;  4MYT A;  1MX0 A;  4JI8 I;  2IES A;  4OO1 D;  3J80 C;  5FLX Q;  2UUC E;  3PRY A;  2JE6 A;  4YHH I;  2CZ9 A;  1B63 A;  2Q2E B;  3QT5 A;  3QT6 A;  4X66 E;  2X7I A;  4DV5 I;  2PO2 B;  4K0K I;  3OTO I;  4UT4 A;  2V8P A;  4WUD A;  5C0X F;  4DV7 E;  2NN6 F;  3WU4 A;  3Q6N A;  3P06 A;  4DV6 E;  4B3T E;  4J3D A;  5L3J A;  2PNM A;  1B62 A;  2PO2 A;  2ZIT A;  3P76 A;  5C0X E;  1XNQ I;  2NN6 E;  1FJG E;  4AID A;  2A2D A;  1ELO A;  4JI3 I;  2BR2 B;  2VF3 A;  4AIM A;  4N3O A;  2UXD I;  3PYD A;  4JI1 E;  4OX9 E;  3LTO A;  4JI0 I;  1YH8 A;  4LF9 E;  4OO1 B;  4DUZ E;  2XEX A;  1ZM2 A;  5K36 F;  2NPF A;  5DRO A;  4JI6 I;  4JG4 A;  4DV3 E;  4MU3 A;  4FW9 A;  4OO1 C;  2WNR B;  3B82 A;  4UTG A;  3P3C A;  5K36 E;  4DU8 A;  1IBL I;  4DR1 I;  4LF4 E;  1WUU A;  2PNL A;  4USK A;  2ZM6 E;  2C37 A;  1YHC A;  3ZZU A;  4BA2 A;  1Y6Z A;  4X64 I;  1S16 A;  1N32 E;  2JEB B;  2C38 A;  4DU7 A;  4Z7Y A;  1XMQ E;  1Z0B A;  4LCF A;  1Z0V A;  3V2U C;  3P3E A;  2UXB E;  4JYA I;  1XMO E;  2JEB A;  4IFD F;  3PYF A;  4USM A;  5JEA F;  2IOQ A;  1N34 I;  4DUY E;  1KTV A;  2J7K A;  1VIS A;  3M85 D;  2BA1 G;  5FLX C;  3HUL A;  4IFD E;  1BKN A;  4DR2 E;  5JEA E;  2UUC I;  2HFU A;  1E3P A;  1DAR A;  2IOP A;  3M85 G;  1RHY A;  4X62 E;  4QNK A;  4X66 I;  3PS3 A;  4HAC A;  3ZKD A;  3LPS A;  1P42 A;  4LF8 E;  2V2V A;  1A6F A;  2HKE A;  4FWH A;  4ED4 A;  5LL6 R;  2AE8 A;  2V2Z A;  1ZXM A;  2UUB E;  4DV7 I;  3P3G A;  2C39 B;  4FW3 A;  3UHM A;  2ZBK B;  4DV6 I;  4B3T I;  4ISA A;  2A2C A;  1H72 C;  2O1W A;  3KRN A;  3LNU A;  2F4V E;  1H7U A;  1FJG I;  1D6T A;  4B3M E;  2OI2 A;  1NZ0 A;  2C39 A;  5DRQ A;  4DV4 E;  4BA1 A;  4URL A;  2Z5C B;  2WP8 B;  4ZVI A;  1I94 E;  4AM3 A;  1Z5C A;  2HK2 A;  4JI1 I;  3U1K A;  4OX9 I;  4MU1 A;  3NZK A;  4LF9 I;  1Z5A A;  4I3H A;  5C0X B;  4DUZ I;  3M6A A;  2NN6 B;  4GQU A;  4XTJ A;  2X36 A;  3QT8 A;  4FWG A;  1N33 I;  2HFS A;  2Z5C A;  3K17 A;  3B8H A;  4MU4 A;  4DV3 I;  4NXM E;  1K47 A;  4LF6 E;  5C0X C;  2NN6 C;  1HNZ E;  4LFB E;  4LF4 I;  1Z59 A;  2ZM6 I;  4DPX A;  2GO4 A;  2JEA B;  1N32 I;  1XMQ I;  3L7Z B;  4JI2 E;  4FW6 A;  4P52 A;  5DRR A;  5K36 B;  2UXB I;  5DNX A;  1XMO I;  1KKH A;  3JAM Q;  4GKK E;  4DR7 E;  4U3B A;  1ZXN A;  4DUY I;  5K36 C;  3K85 A;  2BR2 A;  3HJC A;  4DR2 I;  4JI7 E;  5GMD A;  3J7A M;  4GKJ I;  4FN5 A;  1J5E E;  3PYE A;  2PO0 B;  4OO1 A;  2Z5E A;  4X62 I;  4IFD B;  4LF8 I;  5JEA B;  1OYS A;  2LJP A;  4DXL A;  2UUA E;  2BM1 A;  2O3Z A;  2UUB I;  2J65 A;  4U3D A;  2WNR A;  4LCG A;  3Q1Q A;  3H1C A;  3ZM7 A; 
#chains in the Genus database with same CATH homology
 4JI4 E;  3PYG A;  3WU5 A;  2WW4 A;  4LFA E;  4X65 E;  1FI4 A;  4EMD A;  2F4V I;  1Z0T A;  4B3M I;  4B3S E;  3H4L A;  1ZM9 A;  4DV4 I;  4DV2 E;  2GS8 A;  4DR5 E;  1I94 I;  4DV1 E;  4LF5 E;  3T1H E;  3T1Y E;  2HK3 A;  4YY3 E;  1N36 E;  4LF7 E;  4LFC E;  1Y4S A;  4NXM I;  1Z0C A;  3CWV A;  4DPU A;  1Z5B A;  1NHH A;  4FWD A;  1HR0 E;  4LF6 I;  4DR3 E;  1HNZ I;  4KHP E;  2CGE A;  2E1R A;  4LFB I;  2UU9 E;  2V2Q A;  1IBM E;  1FKA E;  2CG9 A;  5A2Q Q;  3K1J A;  4JI2 I;  2R3V A;  4IZK B;  5IWA E;  4MYU A;  3JAM C;  2AJ4 A;  1Z0G A;  5LMN E;  2E5L E;  1FWL A;  1NHJ A;  2Z5B B;  4GKK I;  4NXN E;  4DR7 I;  1QZR A;  4B3R E;  3J81 C;  4WUB A;  1RR9 A;  1OJ4 A;  4DR6 E;  4JI7 I;  1USV A;  4HY1 A;  3ZZT A;  1J5E I;  2VQE E;  2HHH E;  3GON A;  5BR8 E;  1EA6 A;  5LMU E;  2UUA I;  1HNW E;  1H73 A;  4DR4 E;  1PKP A;  3F0N A;  1UEK A;  4DPY A;  4P7A A;  1EI1 A;  4JI4 I;  2EFG A;  2UXC E;  3WU6 A;  4LFA I;  4PRX A;  4X65 I;  4DPW A;  1HNX E;  3ZKB A;  4B3S I;  2DEJ A;  4AQY E;  3V5R A;  4DV2 I;  1U2R A;  4DR5 I;  1Z0W A;  4JI5 E;  3J81 Q;  4DV1 I;  4LF5 I;  3T1H I;  3WU3 A;  3T1Y I;  1PVG A;  3B78 A;  4YY3 I;  4JV5 E;  4RPF A;  2BV3 A;  1XHK A;  1IBK E;  1ZM3 A;  5IT9 Q;  2VQF E;  4LFC I;  1N36 I;  2HKJ A;  4LF7 I;  2V34 A;  4DV0 E;  1XNR E;  1S4E A;  1N0U A;  4JI8 E;  2GQ0 A;  1HR0 I;  4DR3 I;  4KHP I;  2UU9 I;  1Y4U A;  4YHH E;  1IBM I;  1N33 E;  3J80 Q;  5A2Q C;  1FNM A;  4KQV A;  4R1F A;  1PIE A;  4PU9 A;  4DV5 E;  4K0K E;  4IZJ D;  2O1T A;  5IWA I;  3OTO E;  5LMN I;  4HYM A;  2E5L I;  1MG7 A;  1H7S A;  4NXN I;  4HXZ A;  4B3R I;  5FWK A;  1XNQ E;  4DR6 I;  4PRV A;  4JI3 E;  4Z7C A;  2O1V A;  3Q6M A;  2VQE I;  2UXD E;  2BM0 A;  3QT7 A;  2HHH I;  4JI0 E;  1HK7 A;  1MU5 A;  5BR8 I;  4HAC B;  4DPT A;  5LMU I;  4JI6 E;  3D4J A;  4GKJ E;  4DR4 I;  1HNW I;  5GME A;  4WUC A;  1RRE A;  1IBL E;  4IZJ B;  4DR1 E;  2UXC I;  1Z0E A;  1HNX I;  4X64 E;  1ZM4 A;  2DEI A;  4M1K A;  4AQY I;  1KIJ A;  4IZK A;  1H74 A;  3ZZ0 A;  4IZJ A;  2R42 A;  4JI5 I;  1NHI A;  1N0V C;  5IT9 C;  2Z5B A;  4JYA E;  4JV5 I;  1IBK I;  2VQF I;  2O1U A;  1N34 E;  1FWK A;  4DV0 I;  1XNR I;  1KVK A;  3J7A G;  1USU A;  4MYT A;  1MX0 A;  4JI8 I;  3J80 C;  5FLX Q;  2UUC E;  3PRY A;  4YHH I;  2CZ9 A;  1B63 A;  2Q2E B;  3QT5 A;  3QT6 A;  4X66 E;  2X7I A;  4DV5 I;  4K0K I;  3OTO I;  4UT4 A;  2V8P A;  4WUD A;  4DV7 E;  3WU4 A;  3Q6N A;  3P06 A;  4DV6 E;  4B3T E;  5L3J A;  2PNM A;  1B62 A;  2ZIT A;  1XNQ I;  1FJG E;  2A2D A;  1ELO A;  4JI3 I;  2VF3 A;  4N3O A;  2UXD I;  3PYD A;  4JI1 E;  4OX9 E;  3LTO A;  4JI0 I;  4LF9 E;  4DUZ E;  2XEX A;  1ZM2 A;  2NPF A;  4JI6 I;  4JG4 A;  4DV3 E;  4FW9 A;  3B82 A;  4UTG A;  4DU8 A;  1IBL I;  4DR1 I;  4LF4 E;  1WUU A;  2PNL A;  4USK A;  2ZM6 E;  3ZZU A;  1Y6Z A;  4X64 I;  1S16 A;  1N32 E;  4DU7 A;  4Z7Y A;  1XMQ E;  1Z0B A;  1Z0V A;  3V2U C;  2UXB E;  4JYA I;  1XMO E;  3PYF A;  4USM A;  2IOQ A;  1N34 I;  4DUY E;  1KTV A;  2J7K A;  1VIS A;  5FLX C;  3HUL A;  1BKN A;  4DR2 E;  2UUC I;  2HFU A;  1DAR A;  2IOP A;  4X62 E;  4X66 I;  4HAC A;  3ZKD A;  3LPS A;  4LF8 E;  2V2V A;  1A6F A;  2HKE A;  4FWH A;  4ED4 A;  5LL6 R;  2V2Z A;  1ZXM A;  2UUB E;  4DV7 I;  2ZBK B;  4DV6 I;  4B3T I;  2A2C A;  1H72 C;  2O1W A;  2F4V E;  3LNU A;  1FJG I;  1H7U A;  1D6T A;  4B3M E;  2OI2 A;  1NZ0 A;  4DV4 E;  4URL A;  2Z5C B;  4ZVI A;  1I94 E;  1Z5C A;  2HK2 A;  4JI1 I;  4OX9 I;  4LF9 I;  1Z5A A;  4I3H A;  4DUZ I;  3M6A A;  4XTJ A;  2X36 A;  3QT8 A;  4FWG A;  1N33 I;  2HFS A;  2Z5C A;  3K17 A;  3B8H A;  4DV3 I;  4NXM E;  1K47 A;  4LF6 E;  1HNZ E;  4LFB E;  4LF4 I;  1Z59 A;  2ZM6 I;  4DPX A;  1N32 I;  1XMQ I;  4JI2 E;  4P52 A;  2UXB I;  1XMO I;  1KKH A;  3JAM Q;  4GKK E;  4DR7 E;  1ZXN A;  4DUY I;  3K85 A;  3HJC A;  4DR2 I;  4JI7 E;  5GMD A;  3J7A M;  4GKJ I;  4FN5 A;  1J5E E;  3PYE A;  2Z5E A;  4X62 I;  4LF8 I;  2LJP A;  4DXL A;  2UUA E;  2BM1 A;  2UUB I;  3Q1Q A;  3ZM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...