1K47A

Crystal structure of the streptococcus pneumoniae phosphomevalonate kinase (pmk)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
322
Chain Sequence
HMMIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQSFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphomevalonate kinase
publication title Crystal structure of the Streptococcus pneumoniae phosphomevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Streptococcus pneumoniae r6
molecule tags Transferase
total genus 102
structure length 322
sequence length 331
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2001-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1k47A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1k47A01
4LF8I 2E5LI 1FI4A 1ELOA 5FLXQ 3WU3A 4DR5E 4X65I 4YY3E 1HNZE 4DPTA 2A2DA 4DR2E 3M6AA 2WW4A 2HK3A 5BR8E 4X66E 4OX9E 1XMQI 2X7IA 4DU8A 1ZM3A 1MU5A 3K1JA 1ZXNA 4LF4E 1H72C 3PYDA 4DV2I 1IBMI 4ED4A 4NXNI 4NXME 3PYEA 4KHPE 1HNXI 4LFCI 4I3HA 2HK2A 4WUDA 4DR3I 3B8HA 4M1KA 2LJPA 4PRXA 5IWAI 2HHHI 4K0KE 4LF6E 4HACB 4JI1I 3ZKDA 4DV1I 4DV3E 1HR0E 2BM1A 4JI2E 4LFBE 3LTOA 4JI3I 4R1FA 1NZ0A 4DUZI 1IBKI 4B3TI 5LMNI 4GKKE 3J80Q 4X62I 4DPWA 3HULA 4LF9I 3JAMQ 2Q2EB 4USMA 2UXCI 1EA6A 2VQEI 3T1HI 2V2VA 4JI6I 4B3RE 4WUCA 1FWKA 2VF3A 2UXDE 1N36I 2DEJA 1ZM2A 4HACA 1I94E 3LPSA 4JV5E 4DR7I 4GKJE 3OTOI 4B3MI 4X64I 1Z0VA 5GMEA 1Z0CA 2BM0A 4JI5I 2ZITA 4DUYI 4JI8E 4DR5I 2R3VA 1XNQE 1OJ4A 4JYAE 4DR2I 3H4LA 2VQFE 4Z7CA 5BR8I 4OX9I 1H7SA 4JI4E 3J81C 4LF4I 4B3SE 1NHHA 1KVKA 4JI0E 4NXMI 1WUUA 4DR6I 3LNUA 2F4VE 1N0UA 4LF6I 3V2UC 4P7AA 1Z5AA 4DV3I 1FWLA 1EI1A 4DR1E 4LFBI 5A2QQ 1PIEA 3T1YI 1S4EA 2UU9E 4DV4E 4DPXA 1XHKA 1Z0WA 4JG4A 5FLXC 1K47A 1Z59A 4DV6I 4LF7I 4LF5E 4LFAE 2ZM6E 1PKPA 4ZVIA 4AQYE 4B3RI 2OI2A 1N33I 1IBLE 1HNWE 4HY1A 4LF8E 1ZM9A 4DV5I 4FWHA 4GKJI 1XMOE 4DR4E 1KIJA 4PRVA 1XMQE 3QT5A 4DXLA 2UXBE 4DPYA 4HXZA 4JYAI 1QZRA 4FWDA 1N32I 4DV7E 2X36A 1MX0A 1FJGI 5LMUE 4DV2E 4RPFA 3K17A 4NXNE 3J7AG 4JI7I 1D6TA 3ZZTA 4LFCE 2UUAI 1B63A 2V2ZA 4JI0I 2UUCE 1XNRE 2GS8A 3J80C 2F4VI 4YY3I 4DV1E 1Z0TA 1Z5CA 2EFGA 4DV0E 1HNZI 5IT9Q 1H74A 1KTVA 3J81Q 1DARA 4DUZE 2E1RA 1IBKE 4X66I 1B62A 3ZZ0A 4DR1I 3WU4A 3J7AM 1N0VC 4LF9E 2UXCE 2AJ4A 4KHPI 4XTJA 2VQEE 5GMDA 4JI6E 3QT8A 1A6FA 3QT6A 2HKEA 1FNMA 4K0KI 2ZM6I 4FW9A 3B82A 4AQYI 2J7KA 4FWGA 3ZM7A 1UEKA 3OTOE 4HYMA 4B3ME 1HR0I 1IBLI 1H7UA 1N34E 4JI2I 4X64E 4MYUA 4JI5E 4DUYE 1XMOI 4KQVA 4GKKI 1J5EE 4DR4I 1Z0GA 1Z0EA 2UUBE 4YHHE 2A2CA 2UXBI 1RREA 1H73A 4DV7I 2R42A 1FKAE 4DPUA 2HKJA 1RR9A 2XEXA 5LMUI 2UXDI 2E5LE 1I94I 4JV5I 4X65E 4DR6E 3V5RA 5A2QC 4UT4A 2UUCI 3WU6A 1XNRI 3QT7A 4JI8I 1NHJA 2V34A 4DV0I 1XNQI 1VISA 1BKNA 1KKHA 3WU5A 4USKA 2VQFI 2V8PA 2CZ9A 3T1YE 1IBME 4JI4I 3F0NA 4UTGA 1NHIA 1HNXE 4B3SI 4DR3E 1MG7A 4DV6E 4P52A 3ZZUA 5IWAE 4LF7E 2HHHE 1PVGA 4JI1E 2HFSA 3D4JA 1N33E 4MYTA 3PYGA 3JAMC 1S16A 3GONA 4DV5E 2HFUA 4JI3E 4DU7A 4URLA 1N34I 4B3TE 5LMNE 2BV3A 3CWVA 4X62E 5LL6R 4EMDA 4FN5A 1Z5BA 3Q1QA 1N32E 1J5EI 4Z7YA 3ZKBA 2UU9I 4DV4I 2UUBI 4YHHI 3T1HE 4PU9A 2DEIA 3B78A 1Z0BA 1FJGE 1N36E 1U2RA 5IT9C 4LF5I 4LFAI 4WUBA 2NPFA 1ZXMA 4JI7E 1ZM4A 2V2QA 4DR7E 5L3JA 2UUAE 2ZBKB 3PYFA 1HNWI
chains in the Genus database with same CATH superfamily
3JSBA 4DR5E 2KKHA 1L3TA 3QAEA 5IV3A 4O44A 1C2PA 3IR7B 5CYJA 2LMIA 1RGVA 1H72C 4HTIA 3UE2A 4K5RA 4C48A 4QWAA 1SKWA 3TWZA 2QC3A 1N5SA 1HNXI 3AFGA 4I3HA 2HK2A 2YKNB 1S1WB 2JE6B 6FD1A 2R8GA 4DL7A 3F41A 2HS0A 1RCOB 3M05A 1KLMA 2ADCA 4DR6J 3M2RB 1X0PA 3DU6A 5I42B 2GCFA 3UCGA 1U45A 3AJ1A 4DV3J 3SV4A 4B3RF 3K5PA 2GQ0A 1X4HA 2QEXS 2CDQA 1LWCB 2BJDA 2ASLA 5BYSA 3MAQA 1S9EA 5D4LA 2NREA 2A6MA 4WP3A 2MYFA 2R8KA 4H4MB 3L7ZB 1N5TA 2GA7A 3D3CJ 4JYAF 4U6PA 5F3TA 8RUCA 2CXEA 1QLNA 1REVB 4NLQA 3GJTB 1U4BA 1FKOB 4IOCQ 3QIPA 4HDGA 3BGUA 3MGJA 5ETSA 2P6SA 4JI0F 5KG0A 3OL6A 5DS7A 3TO8A 5LSRA 1XR5A 3QFWA 4NXMI 3SBMA 1KOOA 2F4VE 2C2MB 5JEAE 2WRMA 4NRTA 3O44A 4IKAA 3V2UC 1O6XA 5GAHI 3JYTB 2GVZA 3M32B 3IFEA 1FWLA 1RADB 2XMJA 1HHSA 4L6V3 5A6PA 3LAKA 1OS5A 4LF1A 5KFSA 3KLFA 5I3QA 1RDRA 1WF1A 4ID5B 3R2CJ 4YS2A 4OI6A 4MDTA 4OZLA 4WFYA 4B08A 2ZJQQ 3CJKB 1AXQA 5J1EA 1NKCA 2EG2A 2IDEA 4OX6A 1VBYA 1HD0A 1KR4A 4I0WA 4PAAA 4USHA 1VBKA 2ZD1B 3P45B 5LJ3Y 2YX4A 2NUHA 4C8LA 3QT5A 3TW0A 2NCKL 5JEAC 1PGZA 3I6PA 4Y6IA 3CPWR 4PG6A 5DZ6A 4UZCA 2BX6A 4J9PA 4DV2E 5KT6A 4LQ3A 2HMIA 5EL9A 5KG6A 1UJ4A 3NCPA 4ER8A 3MR6A 4NLPA 2OLWA 3N6NA 4U3DA 1N5YB 4TLQA 4A8OA 1HNZI 5IT9Q 2HIYA 3TEGA 4DBQA 2ZBCA 1NK9A 1KTQA 4TY9A 1RTIB 1YTYA 3PDNA 3MEDA 4USIA 3ITHA 3Q86A 2A3JA 1VQ5S 1FT8A 4DF8A 4CLKA 1IM6A 2XS5A 4CLFA 1JXEA 2HLTA 4CO1A 2C1EB 1Y5LB 3VV2B 1PAEX 4FKXA 3ISNC 1IBLI 1TP7A 1CJKB 4FYWB 1XBWA 1XMOI 3FBEA 5AJ3F 3PNIA 1Q5YA 4GKKI 4B17A 2QMUB 1FRXA 3VAIA 1RT6A 2R7UA 4NI2A 3BBCA 1RTDB 1EB0A 5ADZA 2RIJA 1R6LA 1RR9A 4BLGA 2NN6F 4Q7AA 4DV4J 4KGVB 1VDHA 2PNLA 3D6FB 5A2QY 3HLUA 1HQUA 3TA1A 2VL1A 2VICA 4F8RA 1QAXA 1QY7A 5D77A 2XYGB 2UVWA 3T1YE 2PGCA 2V4JA 3QPIA 2QZ8A 2HHHF 3H2VE 4QOTA 3KHRA 2B5JA 2G1HA 2KU7A 2R7XA 3VAHA 3D4JA 3P76A 1VOMA 2H4YB 3JXOA 3MMJA 3MFHA 3UO0A 3Q8VA 3JSMA 4JI3E 1OYRA 2N7YA 4R5PA 1A9NB 4ECVA 3R3TA 1WDTA 1JIHA 4DV1J 1Y4SA 5FDLA 2Y0SD 1Q7YT 2PFDA 3AXMA 2V0NA 5IT9C 3BDEA 1RKIA 1ZXMA 1MMDA 4DR5F 2OTJS 1USVA 2WSCC 2Z0GA 4U8VA 4YY3E 5FLXU 3RBZA 4IZKB 2ZHBA 3AA9A 3UR3C 2C3MA 5HROB 4M5NA 4W92B 1CVJA 3NY0A 1OYEA 1RT4A 5B09A 1PJ7A 3H2LA 1RWXB 3RRGA 5C7PA 3D68A 1S6PA 4KKOB 2AX1A 3PG9A 1QJHA 5DQHA 4QWDA 3B8HA 1VQYA 2GQCA 1EHWA 2DNQA 3BREA 2M4MA 2XNRA 5F9LA 1SC3B 1KBRA 3DXBA 3IO1A 4MU3A 2MZJA 4GRSA 3K5LA 5KFHA 2ZH8A 4B3TI 4X4UA 1ZTWA 1S59A 3UCUP 4RNFA 5B0DA 5CCMA 1Q95G 1UMJA 2V2VA 2CQ4A 4FW3A 4XIUA 3M7ND 2BE7D 4HH0A 1CS4B 3UDVA 4V1Ak 1Q81T 4ZP9A 4O44B 4CLSA 4QIWD 3NGUA 3MTKA 1FRMA 4IG3B 3VGSA 2DK2A 4JI7F 3M7VA 5SUHA 4MK7A 2RKIB 1UJ6A 2EXUA 4CDIA 3TUJC 2F4VF 3FCWA 4FXWA 3OLBA 2AJQA 4DR6I 1UPMB 5JEAB 1VQSA 1D1UA 3AD7C 4P6QA 1Z5AA 2ZZTA 2L48A 4DV3I 3T19A 2RVJA 4HT5A 1YZ7A 4E8UA 1KP6A 1VLOA 4NCGA 2WONA 1X4GA 1FA0A 1GQEA 1UFWA 2X1AA 4GC6A 4K0KF 1BWEA 4AIMA 2ZOMA 4RNOA 1Z0WA 5FLXY 2LEPA 1SPBP 1Z59A 4B9LA 2KFYA 3JQJA 5LL6d 4LF5E 2IPOB 3IM8A 3FBBA 4AQYE 1T05B 2AYEA 2UZAA 1R8BA 5K5MA 2XWYA 3S6EA 3DNCA 4OHZA 4RWXA 1ZAXA 1UVKA 2ZOFA 3LOUA 4LR7A 2ABYA 1HR0J 4JI2J 2VG6B 2ASYA 4PYDA 4FWDA 5HANA 3DC2A 2DCUB 5C25B 1TL7B 2OSQA 4JI8F 2K1RA 4LSNA 1SJ4P 3N5FA 2DJWA 3US5A 1S1XA 4R8UA 4DN0A 4CO0A 3DLGA 3BDPA 3W2WA 3DOMA 1K1QA 2MKCA 4KSEB 3BJYA 3ZZ0A 1HI8A 3FNNA 3K8WA 2B4PA 3EDRB 3CDUA 4KFBA 1VBXA 2W1BA 1IBKJ 3TZXA 2G0JA 3AOBA 1LWEA 1TFYA 5THWA 2ZH9A 1S0OA 2VHGA 2XG8A 3UDLA 3SI8A 2LA6A 1FNOA 5F0UA 2OEMA 5DGBA 4DUYE 3FFIB 2JWNA 5K8MA 1YJVA 3TR5A 5E3QA 1L5UA 4CP5A 3H5UA 3MCOA 2IC3B 2AF6A 3LGHA 1M1KT 4QR1A 4LQ9A 4XK8C 2FLOA 1IJFB 4DS4A 2AYMA 4Z2XA 3K59A 2GV1A 2DY1A 5DRRA 4W90B 2XY7A 2QMXA 3DYAB 1EP4B 3HFKA 4OZNA 1NHJA 4F3OA 3MEDB 3CT9A 1SQEA 2JEFA 3T1YF 3ITHB 1KKHA 4X65J 5HVFA 1F9EB 3DKDA 2WOMA 3MOZA 2CG9A 4K4UA 1IWGA 2CIMA 5E3PA 4F50A 1H38A 3J7AN 1U24A 4DX7A 2PA3A 2OD6A 1KFDA 4BCAA 5T7LB 4JI3F 3MAHA 3KG4A 2NXEA 3MI7X 1WHVA 1UEVA 1Z4UA 5HMWA 5L39A 4PWDA 4WPAA 2B0GA 4J37A 1M5HA 4DU7A 3KLGB 1SIZA 3CWVA 2OEKA 2GJFA 3HHEA 1RT6B 2HHTA 2AD9A 3GWCA 1Z5BA 3EUNA 4DV4I 2VOPA 3Q8RB 3T1HE 4ECTA 4PU9A 1N36E 5LMNJ 2JDJA 4H4OB 2W7OA 4L3KA 1ZM4A 2QTWA 1T03A 3BSAA 1U09A 4DR7E 3CB4A 4HKQA 1YJTA 4LF8I 2DNGA 4RUBA 3P4UB 1BXNA 1ELOA 3PHTA 5C24B 1D0EA 1RKJA 3EMTA 2DHAA 4DZDA 2HAFA 2XYHB 2Z5EA 4Q2MA 2BRKA 3EXYA 3GE9A 4JV2A 4HTJA 1FKAF 2WW8A 3UNYA 5HJXA 4I6WA 1LW2A 3MAAA 1YBTA 2Q66A 1U1KA 3PYDA 4F4ZA 1NKBA 1C1BA 1CULB 2B5JB 2H9ZA 5CZVA 1GFWB 4CLTA 4ZCKA 3RB0A 1RWUA 1F3FA 5JMNA 3KNAA 2PO2B 1WDDA 4WTOB 4ZHRA 4A46A 2ZFHA 2CJQA 4RO0A 1G3OA 4DV1I 4DL5A 3QGHA 5DRKA 3BSOA 4F04B 4R1FA 2D3UA 5K20B 5FDLB 1RAIB 2CVEA 3C16B 3POTB 3LW5C 3J80Q 2GHWA 4GVBA 1S77D 3HHLA 1OY6A 4WUCA 1E3HA 3T6JA 1YLXA 2GIFA 4F2RA 1VYAA 1NKEA 4GKJE 3JQMA 2MMYA 4OI3A 3WBZA 1N33J 3PEJA 3CWJA 4DCJB 2VBYA 1HHQA 3NNHA 3P06A 1TKZA 3OLAA 1BQNA 2DRDA 1H7WA 4A8MP 2XMWA 2VA3A 4BWJA 2P9GA 1SIWB 1HNVB 3TYTA 2L3MA 2FGCA 2J7UA 4BC7A 1WUUA 2J6UA 4LRDA 1SQGA 4K4TA 4X66F 1Z2LA 4ZPBA 2ACYA 3G6VA 3K5OA 2J7WA 3DRSB 2QSFA 3M6VA 1NH7A 4G1IA 3GFXA 4UQGA 2ZH3A 4WJBA 3NL0A 2X1BA 1FFSB 1KLNA 2FQQB 4WXOA 2UVVA 1YHCA 5J1PA 4I64A 1SL1A 2VIHA 3FEYB 1RWPB 3I5BA 4JV0A 2C28A 1M5VC 3MM6B 4AQYF 2UUWA 3BSCA 2Y1JA 3R5DA 2L9WA 3BQ1A 1YRTA 2JLFA 3U7JA 3KLEB 2VPZB 2M5YA 3A3NB 3RB4A 2PO1A 2YNIB 4OYPA 2EFQA 2QYGA 4PQAA 4C7QA 1M5KC 4PZVA 5EWGA 1P42A 2KM8C 2LU1A 4DPYA 3VALA 1QZRA 3KYLA 3OTEA 2HBQB 5GAGU 3DGPA 2XSJA 2M52A 1NPKA 5AXKA 3V6KA 2DRAA 2UXBJ 1QAIA 4DV7J 4G1PA 4TY8A 1FRLA 3DU5A 3J80C 3P3CA 3PHEA 3CCMS 5F8IA 5GAHU 5ETLA 3GR0A 3TJ8A 5ETTA 2XMVA 2YNHA 2JC1A 1H2UX 2EK6A 4RW6B 2WTFA 2M8HA 4PXDA 3A8EA 4FYVB 2PD1A 3VWSA 3EYZA 3BQ2A 5I4MA 2Z5BA 4J9VA 2IYGA 1U6BA 3EWGA 1DJ0A 4ALZA 1JLGB 4RL1A 2ZWPA 2HKEA 2MSSA 5JUMA 2AX0A 3FKBA 1X8DA 4EYIB 2G9OA 1HR0I 2KXFA 4H4KA 2BR0A 1Q82T 4JI2I 4F4YA 3VGTA 3D1HA 5ETMA 2XY5A 2HNYA 1SCJB 4IR1A 1IJEB 4KQVA 2V4QA 1PAUB 3OUYB 4LFAF 2OPRA 4M63A 2A2CA 1S6QA 1LK5A 1NZAA 4OI4A 1J5EJ 3OR2B 4LSNB 1DTQB 4YHHJ 2XI3A 2FHKA 3MM8B 3H25A 2Q43A 1S1XB 2AEJA 5CYQB 3SXLA 2DPJA 1UWBA 2B6AA 3I5CA 3JTPA 5CCLA 4FPRA 3CD7A 4G65A 3I82A 1R7IA 4LBPA 3MUVP 2RD5C 1N6QB 3RW7A 1IQTA 4O3QA 2JLEA 3HSZA 4A8WA 3F0NA 4KFBB 3PO5A 2QLFB 1HQ2A 3W61A 1LWEB 5IWAE 3CD0A 1OPZA 3OTCA 3RBXA 2P8IA 4DV2J 3VAMA 4F4XA 3PYGA 5AT1B 1S16A 4J9LA 3LP2B 1UJ5A 4TU8A 2UV8G 4DV5E 3M85D 4DR3J 1Q79A 2HGNA 1WF2A 4ZPAA 3CJ3A 4OV1A 1UFLA 1YITS 2VQEF 2KT2A 3T1HF 1RWNB 1N36F 3MUMP 5A0YA 4WK3A 2OAUA 1O0PA 4DR7F 5DRPA 2VPXB 3DLEB 1WC5A 2ROGA 3HVTB 2V2QA 5KFUA 1KVIA 3PYFA 1UVLA 2HBZB 3R6GB 4YDXA 4X65I 2FHMA 3PR4A 1EQ0A 2JZ5A 4Q43A 2EG1A 2R7VA 2A2DA 1BGXT 3KK3B 2QA1A 5F8JA 4OX9E 3G4SS 4R0JA 2FIUA 5HLFA 2MLYA 5LSOA 4CLPA 4MFBB 3BZQA 1N48A 1IR0A 1X4CA 1RXOB 2CNOB 2FZKB 1AROP 2XQCA 1M1GA 4CNZA 4PRXA 1NK0A 4PWDB 1SJRA 3I56S 5B0CA 1S1VA 4CT8A 4NLXA 3IM9A 4ZVPB 4PEOA 2M7SA 1U25A 3H40A 3T9NA 3VAGA 4ZVQB 1S97A 4B9NA 4LF6J 2WVEA 4F67A 5LMNI 2RQKA 1KS2A 2DXDA 3OSNA 3HULA 3K5NA 1T9XA 4OIXA 3OVBA 1U0HA 5L1JA 2CPIA 1T03B 1REGX 4QJVA 2BYCA 4GKJF 2XLJA 2EW9A 2QIFA 3D66A 2Y1LB 4HACA 1VJWA 4FNIA 4L75A 3D28A 1R8HA 2CWXA 4KIAA 3QJJA 4JP8A 1C0TB 1WI6A 5ETQA 2XLIA 2WVFA 3A3PB 4I6YA 5KAKA 1WJ9A 5CD4A 2C2RA 1NK6A 1RT5A 4ZVTB 2BXJA 1LW2B 2VQFE 3GJRB 2DBBA 3QAUA 2CQCA 3W60A 2B43A 3NCQA 3J81C 2VA2A 3MM5A 5J2PA 3KUHA 2KM8B 4LMZA 3LNUA 4GC7A 1N0UA 2LKZA 2K8GA 5U47A 3GZ7A 1OYDA 3BO2A 3BS9A 3KTQA 1VMBA 4JUZA 4NASA 1FVQA 1DFDA 2LDIA 2M3DA 4DR1E 3CO9A 4EZ9A 4YY3J 1WEXA 2KYXA 3DLLQ 4GVBB 2FVQA 3W3SA 3EZUA 1JLQA 4ES1A 4Q0BA 5E5NA 4JG4A 1WOPA 1NRKA 1S9GB 1SL2A 2O1WA 1YG0A 1N33I 1C0UA 1ULRA 1NO8A 2UVRA 1DLOB 1B7YB 2Z58B 1BUXA 2BE9B 4O3OA 2HWIA 1PYSB 2F7VA 2ZM6J 2JOQA 1TKZB 1FJCA 5D3GA 2ZC4A 1R0CB 1OWXA 4ED8A 1KHVA 3X3UA 5L1KA 2E7XA 3OV7A 4J9OA 4DR4J 2DR8A 2BA0G 3P8BB 4DFPA 2CPZA 4WE1A 1KRPA 2A10A 1XNQF 1TKXB 2COLA 1HPZA 1YQHA 3PM9A 1FDDA 2LFVA 1Y0HA 2IERA 2AWZA 2AZ3A 3DD6A 3KJVB 2AU0A 1LNQA 4P2SA 2UUCJ 2YKPA 4CYUB 1I51B 4ES2A 2SXLA 3CC7S 4IRKA 4B9VA 1OQ6A 3QQCD 4F2SA 2UXCE 2QLXA 2Z57B 1GK8A 2DNNA 2AJ4A 4XTJA 1U2FA 4MKYA 3D1OA 1X5SA 1X4AA 4TLRA 2CJXB 3U1NA 3MEEB 1YHQS 4IO9Q 2D7SA 3OTOE 2PO1B 1WG5A 3BR9A 2Z4PA 1RU2A 2JC0A 2WP8A 4O3RA 3LA0A 4B9TA 1WF0A 1B4SA 2AMCB 3QRPA 1IKXB 4ISAA 1QDUB 1Z0GA 1VRUB 4MTPA 2XS7A 4C8NA 1Q8LA 1JK9B 3SCLE 2ZZNA 2KRRA 2UXBI 1BQMB 4DV7I 5C42A 4LT6A 5G0RB 2G2ZA 1RI7A 3M1VA 4CTAB 2HWTA 4ZMMA 4C11A 2PMWA 4NYZA 4TY8B 2QL7B 2B8PA 3V5RA 2F9DA 4LF5J 2MQNA 4UOFA 1AW0A 3GMGA 2E5LJ 2MXYA 2EI5A 1BD6A 1JLEA 2KZMA 2KB2A 2L9NA 2YQ1A 2GNKA 2Z5BB 2AJ2A 5HI7A 2FHJD 5IWAF 3S8SA 4DV6E 1TU0B 2DGWA 3VAFA 1NU4A 3MPUB 3GYNA 3LQVA 5KG3A 4U96A 1IBMJ 2IHR1 3L3CA 3HSJA 1GT8A 3QBCA 2J9DA 2LQ5A 3FBCA 3GFHA 5KFEA 2FLPA 4BHQA 4NCBA 5CYMB 4ZLNA 2OPRB 2B9WA 1JLCB 4JI6F 1N8RT 3ZZOA 1GMWA 1J5EI 3CDWA 1HWLA 4YHHI 2LYVA 3I87A 4L76A 4FXDA 4KGXB 1FRJA 1TL1A 2CQIA 2HQIA 3OFFA 3UI3A 2BW2A 3KMSA 1HFEL 3W5YA 4JI5F 3VGVA 3LF0A 3HVAA 2IMOA 2VV5A 5FJ4A 2M88A 1HBMA 4C0BA 2B6AB 3QSIA 1RWMB 3PXGa 3T41A 4OX9F 1F0XA 1RHUB 3CCJS 2KJWA 2NXNA 1SQFA 2QYCA 5BR8E 2O3DA 1E6VA 2R4FA 2M70A 1ZM3A 4DUYJ 3OJSA 2FVSA 2VBXA 3HSGA 2YY3A 5J2QB 4DV2I 4WP8A 5FD1A 5KFRA 2I38A 3PACA 2OSRA 4O4GB 4DR3I 3BSNA 2UP1A 1YBUA 3MM9A 3N0VA 4KH0B 4HT7A 3DRRA 1CJUA 4PPZA 2BZ2A 2O5DA 1AUDA 4ZIWA 3LP1B 3T5JA 1RB0A 1U1QA 2C2KB 2XULA 3N4WA 1ZETA 2QJ3A 5T41A 2C37B 4FVMA 4WFZA 2JL9A 3ENVA 2DNPA 3GCXP 4ECUA 3JAMU 4ECZA 1EA6A 1V3ZA 4Y2CA 2AYGA 1WHXA 2IY5B 2XCAA 3NGTA 2CPJA 5H9EK 4OO1D 2QA4S 4S0MA 2JEBA 2CRLA 1Y5IB 2ZH6A 3MCNA 3HT0A 1HBOB 3HHDA 2DH7A 4WFAQ 3V6JA 1FJGF 4P73A 3BR8A 2EBEA 2JEJA 3TP2A 4OZ5A 4BA2A 5JJBA 4JI4E 2UUAF 4FW6A 2RQCA 1UWAA 1RT3B 7AT1B 4WBFA 3GLLA 3IN5A 2E66A 2GMHA 4PXCA 2B51A 1AB8A 3Q24A 1Q16B 4BC9A 2W9CA 2ZKUA 4DR1F 4LF6I 4X4TA 4FW7A 1Q8IA 1R89A 2IOPA 1SUQB 2BJEA 2KXNB 3BO4A 3IS9B 3G6ES 3T1YI 5DG9A 4PG5A 1S4EA 4WFBQ 2UU9E 3PV8A 1TKDA 2IAJA 1CC8A 3PIOQ 3NBPB 3PRYA 3EE3A 2BEFA 4FF3A 3NAHA 2QL9B 2JEAA 1JXVA 2ALZA 1UL3A 4LSLB 1U0SA 3HDSA 5K14A 1SB6A 4B3OA 3AD8C 3M9OB 3MWBA 4DLGA 3BGFA 3CJ0A 3W65A 2RJZA 3P6YC 4JV5F 3IG1A 2D69A 2HNZA 4DSIA 1X7VA 1MU2A 1PC4A 5J2PB 3J7AG 3CJTA 3TZYA 1H7XA 4IG0B 2V2ZA 3D5MA 3OD2A 4IH7A 2DNKA 4ZJLA 2XMTA 3QYYA 4IDKA 4YY3I 1Z5CA 4HHUA 4DV0E 2NS1B 3UD3P 4YN3B 2YX7A 3M8SA 2E1RA 4B3SF 2NXJA 4ZVGA 3R7BB 3WU4A 2JSXA 4U7UK 2WSEC 4KHRA 4LF9E 2V6AA 4K59A 3N79A 4C8YA 2YPZA 2C3YA 3UVJB 1XWLA 4OYXA 1GMUA 3W63A 3CJ2A 4HDHA 1RTJB 4DPOA 2AEMA 2ZM6I 4J9KA 5I3UA 3GG1A 4DLEA 1BC6A 4B3ME 1EAYC 5BXIA 4DX5A 1VQ4S 2DO4A 5D3GB 3CC4S 3HKWA 1UP1A 4KAIA 2BJ9A 2KT3A 1FKPA 1BLUA 4DR4I 2XGQA 1LXNA 4KQZA 2N4CA 5KG7A 5HVHA 1HNWF 1RT1A 2OJ3A 1QM9A 1Z1ZA 4NLUA 2OPPA 2HBRB 2KHDA 3C14A 3KK1A 1TKTB 2I6WA 2GVDA 3DM2A 5A8RB 2UUCI 2BKNA 1CEZA 2HZCA 1U2CA 2DR5A 4IZJD 4I4BA 2J5AA 1ROFA 1S79A 2V8PA 3GB0A 1UCNA 5IC4B 4DV6F 4QYZK 3OSPA 2DVIA 2ERRA 3NNCA 3E01A 3EGWB 4JI1E 3L7OA 3VAJA 3Q8PB 4MYTA 3MTJA 2FDNA 3CC2S 1FX2A 1XXEA 3RG6A 1IN0A 2CPYA 2WP8B 2CPXA 4DG1B 4M5DB 1LFWA 1QE1A 1K1SA 2P6TA 5LJ5Y 3AOCA 1XEZA 2XMKA 1N32E 2CPDA 4OO1E 1N56A 4X62J 1U2RA 4LF5I 2XZTB 3LUYA 2NPFA 5KFDA 4X64F 3OXFA 2RSQA 1R6VA 3GP9A 2E5LI 4P72A 4NLWA 4ECRA 3H0PA 1CQNA 2ROEA 2WBMA 4UF4A 4WWSA 2ZH7A 4QWEA 3R5AA 2E44A 3PKMA 3BGLA 5BR8F 4ED1A 4DR2E 2KJVA 3Q8QB 1P27B 2HHWA 2WW4A 3MMBB 3HD1A 2FJWA 1URNA 2YNFA 2GZOA 5BJRA 3I9V9 3K0JA 1IBMI 2W7AA 3ZTOA 1JXLA 5DG8A 4KHPE 2ROPA 1FTCA 3NOGA 4AD6A 2RRAA 3BF4A 2IBOA 4OO1C 3HZEA 5L46A 2IIHA 4N8NA 1ZS6A 4KO0A 2X3DA 4FF4A 3I96A 1K0TA 1U8WA 4IOAQ 4I67A 4ZN1A 4YDDB 3HO1A 2V8VA 2YKAA 3AODA 5A8WB 1GXLA 1Y60A 3BB5A 3IRXA 2E1CA 4OZ0A 3TEHB 4A8KA 1NLKL 2RNEA 3F44A 3FSYA 1Z0VA 4C8KA 3KLHB 3UFCX 2KH9A 4DUYI 2VASA 4TYBA 3PS2A 5A8KA 3GSDA 1Y6ZA 1T9TA 4OJGA 3HSDA 4DV5J 4JI4F 2FHOB 4ZA1A 5E3AA 1LW0B 5HN0A 2RRBA 1S1TA 3N28A 2CYYA 4DS5A 3OTDA 1QUVA 3PZPA 5GADI 3RBEA 2NYHA 2DR7A 5CA5A 3VHQA 1RWKB 3DRXA 4F25A 2PN6A 1F1BB 2VDIA 5L1LA 1RA7A 3EGNA 2BW7A 4PYAA 4LVOP 5KFKA 1D09B 4O23A 5H9FJ 2JEBB 4MMOA 1WC3A 2X3GA 3N6MA 1VCTA 2BOAA 3GLJA 4DL3A 1APSA 3D7SB 2FJBB 3AD9C 1S57A 5C0XA 3CDIA 2J8SA 3HCXA 3GIIA 2UXDF 4OL8A 3LAMA 2YKMA 1VHIA 4ERDA 1UVJA 3GSIA 2YWWA 4C6AA 2KFZA 2BDPA 4LFCE 2AJ1A 5L8RC 5E3RA 4DV0F 2ZWOA 4ZIVA 1G6BA 2E5GA 5LMUJ 3I0SA 1Y4UA 3J7YI 1QSLA 4F26A 5DO2A 4WIQA 3IGVA 1NK5A 1DARA 4DUZE 4CH1A 2J6TA 1XNRJ 4LF9F 2D41A 4PXEA 3MM7B 1U49A 4OI0A 3IGNA 2VQFJ 1KN6A 2XBPA 4B3MF 3RRHA 2EBGA 1S9FA 2C3UA 2DKOB 4IFYB 3JS9A 3IMQJ 3FEXB 2BJ8A 5K14B 3QJLA 1FXRA 1N52B 2HGMA 3TVKA 5C0XE 1RLDA 2NN6D 2MB0B 1EETA 2AGOA 2UUBE 4OLPA 2HFVA 1V3SA 2Q79A 4X4SA 3OVAA 1WKKA 4FF1A 2PC6A 2PO0B 1GX5A 2E5JA 4JBCA 2LU2A 1D8ZA 3DMJB 3M6WA 3ZNJ1 1TAUA 2GO4A 3R5GA 3HFVA 3H20A 5GAEI 3ZTSA 3ZFVA 3HKZD 1XMQF 2PNZB 4WCEQ 3W9IA 2RB7A 2EC0A 2CPFA 1FRHA 1NAQA 4CCHA 2L41A 3LH2S 1X9MA 3I9ZA 3BEGB 2CZ9A 5LSLA 1HNXE 4K50A 4JI1F 5H9EJ 2MKJA 5EDWA 4TQSA 3I0RA 3IWLA 1PVGA 2JNJA 1MWYA 4Y0FA 2WVDA 1AFJA 2MQQA 2XNQA 5MAOA 2CKWA 1UDQA 3CCUS 4CT9A 2HYIB 1N32F 1B0VA 3FRZA 3NOCA 4CQ1A 3J81j 2BA1G 4FVCA 3L7UA 4NLSA 4OO1B 2HVDA 5F8GA 3T5KA 4A47A 5DDOC 2FLNA 4ZPDA 3DXSX 4TQRA 4IR9A 2UXCJ 2ZOGA 3JTNA 3CD6S 3J7Z5 1EARA 4DR2F 2IM0A 4CH7A 2CNLB 3DRPA 2XHCA 3OTOJ 3GIMA 4NCAA 3TUIC 5GMKa 1P1LA 3P3DA 1HYSA 3MEGB 1HD1A 1HNZJ 3W2VA 4P71A 1TUWA 4NXME 2E9ZA 3T6BA 2WNRB 4N41A 2ZVIA 1HI0P 4NX9A 3ZTRA 1UKUA 4AE5A 3VVUA 3V6HA 1QE1B 2OPQA 4DI6A 4J91A 4ICLB 1RHQB 4MIBA 2DB1A 4DFMA 4ETZA 4X62I 3G96A 2DYAA 1GNKA 1SKUB 4C4WA 1TUVA 4YR0A 1FXDA 1S1UB 2HFNA 3LPSA 4AFFA 1V9OA 1YH8A 3W1YC 4DV6J 3HKMA 2VUGA 4A4JA 3PTWA 1Z0CA 5HP1A 1LOUA 2GJ2A 9RUBA 3TA0A 3RU0A 1CLFA 2KRBA 4IFDA 3L4BC 2DO0A 2C39A 4DOZA 3KHHA 2GO9A 1R8CA 5HJYA 4AYBD 3TA2A 4CNYA 1SJ3P 3UWTA 1HMVA 2AV5A 2J9EA 1WEZA 1KVJA 1JJ4A 2DNLA 1NSPA 2IDLA 2ZC3A 4ILMA 3BYPA 3MMCB 2BR2B 3NRBA 3FSIA 1PYOB 4QIVA 3D2WA 1S0VA 3AB4B 3ELHA 4DCPB 1RA6A 4UOGA 1JLBB 1UVMA 4DJBA 3V6DB 1D8YA 4M5JA 1T95A 1IBLE 5AE1A 1MROA 2F8HA 2R7TA 4DV5I 4AL5A 1F5BA 4FWHA 2NN6E 1XMOE 2YQ0A 3UD5A 4KPCA 2DR6A 4LPFA 4I7FA 5IC6B 3KOAA 5KTQA 2ZE2B 2VU5A 1UAWA 3JTOA 1SKSA 4V19X 1LWFA 1S7IA 2C2OB 5E0OA 2VG5B 2GW8A 4DZ6A 4IZJB 2A1BA 4FF2A 1AYEA 5HL7Q 1EZZB 4XPCA 4QR0A 2B3TB 3HD2A 4TU7A 3OL8A 1QSYA 1SL0A 4KV8B 3CCTA 3U1MA 3GCMA 5CABA 3ILLA 1I6JA 3TX8A 4DMZA 1H0HB 3MD3A 4K4VA 4KRWA 4PG8A 2NN6C 3M2UB 1T9WA 3CUNA 2W25A 4R0EA 5GMDA 1TVRA 2H5JB 1RWWB 1F60B 2X51A 3GR1A 3OFEA 1UEKA 4NL5A 2PNMA 3DI6B 3FZBA 5D6GA 5C0XF 4WIIA 3R8YA 3KK2A 2UUBF 1KHWA 3CDAA 3PIPQ 2Y3YA 1DTTA 2PA8D 1XTZA 3C46A 4DQRA 3FQLA 1T3OA 4QBUA 2ZH5A 1URRA 2KT5A 4IFVB 1TL5A 2MZSA 5LMUI 3OBIA 2UU9J 4MKAA 3HFZB 1Y10A 2JJ4D 2GGPA 5I3PA 3HT3A 1I1GA 1T11A 2F65A 1XNRI 2WVCA 1QUPA 3NWGA 4IH5A 4I2PA 1ZZNA 3DLHA 2NYIA 3WIUA 4USKA 4I6AA 2VQFI 1Y5NB 1HIYA 2E29A 1HNXF 4ELUA 2Z2YB 2HHXA 1RT7B 2H5EA 2XM3A 4YUDA 2LXFA 3PW2A 1MG7A 3MEKA 4LF7E 2HFOA 2EEYA 2GX8A 2RT3A 3Q2SC 2HFSA 5DJBA 5DRQA 4ANEA 1XERA 4LR8A 4B3TE 2WSFC 3W8GA 2PI4A 3NMAA 3EVMA 4KHMA 2B4UA 2NSBA 1HQEB 4ZVHA 2LQ8A 3VF0B 1UEUA 4F7VA 3DN9A 3QLHA 1WTFA 2FGOA 1Z0BA 3D54A 5A6WA 3FQKA 5IT9Y 2CPHA 4JI7E 4URQU 1CJVA 4LF9J 3DOKA 1NJIT 1JJ2R 4NMLA 4U3BA 4ZVFA 5DGAA 3QO9B 5DM6Q 4L72B 3VQTA 4FS2A 3FGVA 3TAMB 4ZS6A 2QE5A 4J9QA 5D0GA 4NXMF 3R5CA 2GJIA 5A2QU 1YVFA 4OYBA 4ANDA 3PYEA 2AE8A 3TX0A 5EWFA 2QFIA 3W8PA 2VG7B 4EO8A 4Q8EA 3RJMB 4LF4J 4K0KE 2AIRB 3H4DA 5IFMA 1GXTA 4QWCA 3GTYX 5M2PA 4DV3E 5IM0B 1NMEB 3PX0A 3BBBA 1EQMA 4QPXA 4N5SA 2QFJA 3CXCR 1NXIA 3HVRA 2H3EB 4LR9A 3DRYA 1B3TA 3ENAA 1CG2A 4Y28C 1F9FA 5KOXA 3AJDA 4LFBJ 2UXCI 3BBFA 4FW5A 3K89A 4FS1A 2L9DA 3UW1A 3SCJE 1NBEB 4EU0A 2CQ3A 3CCZA 2VESA 2XO6A 3ZZPA 3OTOI 3NNAA 1H2VZ 2YNGA 4Y34A 2VC0A 4JI8E 5DDPC 4EWTA 3UN5A 4LUBA 4DN9A 2CNNB 3BM7A 4TYAA 1RBLA 2QRRA 4ED7A 1WEYA 2C38B 3ET6A 3GFZA 3M9NB 5HATA 4A8FA 4ZCLA 1TUGB 2W9BB 2AZ1A 2BJ7A 3PW0A 2OPQB 3O5TB 4J9RA 1RU1A 4NRUA 5MLCV 3MR7A 2MEWA 4W98A 2BANA 2W4CA 2YX1A 1RHKB 3T1AA 2ZDOA 3KLIA 2PEHA 4DV6I 1IBLF 1RCXB 1FERA 2DGXA 4QIEA 3IR5B 2YH1A 3GFYA 1Y5YA 4RNHA 1VQNS 1XMOF 4KHPJ 3BV8A 1RBOB 2NN6B 4GKKF 1WHYA 2OUGA 2QL5B 3VR1A 4IFDF 1RTHB 1O51A 3Q0AA 1U6FA 5ETVA 1PKUA 4LF8J 4KH1B 4DQPA 4MU4A 1S0NA 2E9RX 5KFBA 2CQDA 4NLTA 2HZAA 3MURP 3IAS9 2HPUA 3PO4A 1D6TA 1IKVA 2CJBA 5IZHA 4LBHA 5J2NA 4RU2A 3PW5A 1SV5A 4WU2A 2DNRA 3L9ZA 5ETNA 2AHOB 3K5MA 5J2MB 2UV8A 2M9KA 4RZRA 1RHJB 3H5YA 2BE2A 1KQSR 3ILIA 1IKWB 4N56A 1WKLA 4OHYA 3NEKA 2K2PA 4NZ7A 4FDFA 3QT6A 2JX2A 4RW7B 2P9CA 4UOCA 3D1QA 2LDYA 1J5OB 3O6QA 2J65A 1Y9OA 3A13A 3FRYA 1DBDA 4MYUA 5DROA 5KFMA 2RHQB 5KT5A 4M5IA 4OV6A 1R0AA 2H4WB 1CBKA 1Q86T 1VQ8S 1IVZA 4G1QB 2XMMA 5KG5A 3UPFA 1N34J 3PW4A 1X60A 1ZPVA 3OL9A 1FKAE 4DPUA 4KGKA 2IYIA 1P8GA 3AJ2A 3M8PB 2B4OA 2JVOA 2O1UA 1GTHA 2H54B 1HARA 4UT4A 1T8EA 3WU6A 2LP4A 3QT7A 2MKYA 3SDEB 1CJTA 3WC0A 2Y8WA 2Q3PA 4PUOA 1GEHA 1FWPA 2QLBB 3DLBA 4JI4I 4CLLA 4CWBA 3ZXWA 1K9MT 4LF7F 2B9XA 3WZ0A 3CJQA 2VD3A 1D9FA 4WZMA 3PRVA 2Z2MA 1NPRA 1L3VA 2D3O1 1WNEA 3K7RA 2VJUA 3JAMC 1KONA 2J0SD 4HL9A 4AXIA 3VVTA 2R2TA 4B3TF 4LFCJ 1C1CA 2E7VA 2MQPA 2DIUA 4Y00A 3GV7B 1OQ3A 2RF2A 3DDKA 1XC9A 4ZCIA 3HPOA 1YRUA 4J9NA 2W9AA 2G0IA 4WYLA 2IOQA 2V69A 1U1RA 2IESA 2UU9I 1UA0A 3CIMA 4DUZJ 5HQMA 1FTRA 2Q6CA 4ETXA 4ED3A 3UQSA 5FWKA 1LEOA 1CC7A 2H1YA 3CULA 1FK9A 4MK9A 5K8OA 4LRCA 2VDHA 1OIAA 4DSKA 1VFJA 3BGRA 5GAEU 4LOMA 4IS9A 2RDIA 1PYTA 3AXKA 1R6YA 4L3NA 2I5JA 2EKNA 4NE9C 1KLMB 4F4AA 3PR5B 5KFOA 4X66E 5KFGA 3M85G 5DDRC 2FYXA 2VOOA 3VQSA 2DD8S 2QGFB 1Q5VA 4L74A 2DGUA 4DR6F 3MECA 3GJSB 4ED4A 3OR1A 1JNRB 4YR3A 3FUYA 2BMBA 1TMMA 1DQ8A 3E51A 3NWRA 4M1KA 4DV3F 3JQKA 1S9EB 2Z2LA 4USJC 3ZKDA 3M4XA 5KG1A 3D0GE 5JVGQ 1YIJS 1RAHB 4M5GA 1ITPA 4DDFA 2DH8A 1MMLA 5KFVA 3PJ9A 1YWXA 2RE1A 4WFXA 4YMEA 4IUFA 4HR2A 3P96A 4X4PA 3J80U 2Y8YA 4XO0A 4LF9I 1XQIA 2XMUA 3QIPB 3A4TA 5E2QA 2Z30B 3E2EA 2HVHA 2HHPA 1QVGR 2APOA 1FESA 2YKNA 1S1WA 1AT1B 1RAJA 3L95X 2DGQA 3KHGA 3ISZA 4TXSA 4B3MI 5KG4A 4QW8A 4ELTA 4Y2KA 4O3PA 4K8RA 4B3RJ 9ATCB 2GVZB 5I42A 2OPSA 4KGZB 1HW9A 3TJ9A 4XAKA 3BQ0A 3KLFB 1XR7A 5T14A 1SC4B 3GCWP 4MJKA 4LF4I 1XJWB 1LFPA 1LWCA 4LCGA 1KVKA 4JYAJ 3FDSA 1XMBA 1X9WA 5F3ZA 4C8OA 4RNMA 3U1LA 1NHVA 1NJYA 5J1EB 1Y11A 3HHLD 3KDNA 3L7ZA 2XCPA 2KFNA 3W5ZA 3DHWC 4DUTA 3GJQB 4JI0J 1REVA 4QU6A 4LFBI 2BRLA 7FD1A 2WVBA 4OX8A 1FKOA 2V50A 3HVWA 4Y3CA 1B99A 4QNKA 1F3VA 2Y9HA 1H98A 2AGQA 2MSTA 3D3BJ 2HMIB 4LFAE 4LF2A 3F56A 4FNHA 2R7SA 3QNWB 2YNGB 1I3OB 3KXDA 3JYTA 3M32A 4OYMA 3WQPA 1VQMS 1FEEA 1S72S 1R3NA 2OTLS 5EX3A 4RWWA 2N3OA 3R7SB 1TZ0A 4ED2A 1N32I 1L3KA 3OQ2A 2X36A 3V4IA 3CCQS 4EBDA 1YJRA 3K17A 4NXNE 4M8LA 5L9XA 1JLAA 3CJKA 2XC9A 2K7KA 3ULHA 3J80Y 1O8BA 4DL6A 5IQ6A 2Z56B 1H74A 2D9PA 4NLGA 1IBKE 2HHVA 3C15A 1N54B 2X1GA 3EX7B 1N0VC 2A18A 4OJ1A 5D4PA 1FE4A 4N3OA 4NI2B 3CJ4A 4KHPI 2VQEE 1R6MA 2XLKA 3QT8A 2LLZA 4OHVA 2BJ1A 3H5SA 5KFNA 3R7NB 3NXZA 1N5YA 4LIWA 3HF5A 5K9FA 3B4DA 1ICEB 3UR0A 1H7UA 1RTIA 1AUSL 1HQUB 4DV4F 2RU9A 2Y1RI 2FUG9 4LVNP 1VLYA 4AL6A 3EDQB 2VH7A 3D0HE 4FW4A 2F1DA 4HI1A 2V4JB 4ED5A 3NS6A 4OZEA 4C2MA 3THTA 2MKHA 1NJZA 3HJVA 2XMAA 5AJ3J 2B7CB 4X65E 4NBQA 3MZIA 2O67A 1NZ8A 1CJKA 2KXHA 3PW7A 1RAGB 3KNGA 1SJFA 1WD6A 3JSMB 4ZN3A 4R5PB 1VISA 4PQUA 4NMXA 4C0OC 1X5OA 1RTDA 3CCES 4UY8T 2BVZA 1HWUA 4DV1F 4P52A 3G8TA 1KEKA 5K36A 4URSA 2JVRA 2DNHA 2V67A 1EJ7L 3A8IA 2F5GA 3RB6A 3JSYA 5AXMA 1A6LA 3C2PA 2HHHJ 1N34I 2CUYA 1R0AB 5LMNE 3TZZA 4CO2A 3LWLA 1VHFA 1RT4B 1S6OA 4Z7YA 3RAQA 4PKDB 1DY3A 3RW6A 1T9UA 2WZ1A 1S6PB 1JB0C 4FXVA 2IVFB 3NZKA 1IBCB 3P5BP 3R2DJ 3IAM9 1DAXA 5IT0A 5D4OA 2XHWA 4LJMA 3BPSP 2C2ZB 3EM1A 2HEKA 2YWFA 2HG4A 2MQOA 4DR5J 5D78A 1GAOA 4A8YA 3B6BA 3DCAA 3G6YA 4MT1A 3QZ7A 2HQCA 1NK4A 3G2XA 5K36E 5B08A 4LFCI 2YVSA 2P5VA 2LJPA 3NGSA 4ANCA 2MZRA 2MKSA 2WB4A 5LXYA 1WWHA 5KFLA 2VJVA 3OT9A 2LCWA 3RGIA 1RTZA 1LV5A 1GXUA 2CZ4A 4IZKA 2RF2B 5KFQA 3DFEA 5HROA 3RR7A 4J3DA 3H4BA 2WK4A 4DUZI 3FCVA 1OSDA 3SQGA 5CAAA 3V81A 2EFNA 2PDAA 1G2EA 4USMA 1IWAA 2ZUGA 4KKOA 3PFEA 4DX6A 4F0MA 3BGRB 1IXKA 2DEJA 2BUNA 3SFUA 1F6TA 1PG5B 4UUWA 4LREA 3HHLC 5K36C 5B0GA 1RWVB 1XNQE 1FCAA 4YP3A 1NB7A 4QIGA 2BJ3A 4P2FA 4B9SA 4NCGB 1TELA 2HVIA 3ILOA 1X4EA 2WONB 4O0IA 2XB2D 3J81Y 1Q78A 5B0FA 1NHHA 3U02A 2HBYB 4QPTA 5E3CA 1CS4A 1WG4A 4FYYB 4JI7J 2ZH4A 2R7RA 1X5TA 2E9TA 4P7AA 2HW3A 2OFHX 3SCIE 4IG3A 4YB7A 2F4VJ 4EBCA 3O2IA 2JH3A 3PJXA 2RKIA 4KPYA 1NHUA 3CDEA 1K47A 4P9SA 4ATNA 1UW4A 1HR0F 1T3NA 4JI2F 2EKYA 2GAGC 1Y3KA 4B3RI 5JEAA 1X31C 2K1RB 1LWXA 1VGYA 3G9CA 2NUUG 2HQFA 4KGMA 2CQ0A 3R6LB 4K0KJ 3MMAA 4R8UB 3BKUA 2OPSB 3DLGB 5AXNA 4IYQA 5CHCB 3W2WB 3DOMB 4OHWA 3KRNA 2QG9B 1ZAVA 2UXBE 4ZVUB 4JYAI 4FKYA 4DV7E 3HHNB 4NXNF 1MX0A 2NLWA 4IQMA 1X0FA 3AY0A 3PS3A 1U6ZA 2IVMA 3TUZC 1T05A 4WFNQ 4K2XA 2HFZA 2K3KA 3Q2TC 4JI0I 2C2NA 1MWZA 5EX0A 1IBKF 3J81Q 4OX7A 4GVLA 4IO1A 2MLZA 2W7PA 2VG6A 2KZZA 3W62A 2CVIA 4CM2A 4PWUA 2FJXA 4JI8J 4KBIA 5GAGI 4FYXB 1YK9A 3N5BA 5C25A 5C2GA 4YR2A 2W4PA 1VIXA 1TL7A 3VTIA 4JI6E 2ATCB 2HHQA 3CW2C 1R8AA 1RQ0A 2LVWA 3B82A 3CCLS 3VCDA 1S6UA 1W26A 4ECXA 4JI5E 4JB8B 3RBDA 3TVYA 1GH8A 3KJQB 1ZZFA 1J5EE 3EGZA 4YHHE 2KDOA 2YQ3A 3D0IE 4K4XA 3V4IB 1NM2A 2A0FB 2D1CA 3KG1A 2WOMB 1YBAA 3LGMA 4HLBA 1RREA 1H73A 2MZTA 3Q22A 1JLAB 4H4KC 3EVOA 1RYSA 4X65F 2ZKTA 2Z2ZA 1RHRB 4Y2MA 2C42A 1AZSA 1ZTTA 3U27A 4J7CA 4RBTA 4XDDA 3FFIA 2XSFA 1SH0A 4CO3A 3C15B 4NWBA 2IC3A 2VFRA 4P7VA 3C3LA 1TQLA 1BWVA 2MY7A 5D15A 4ZITA 3SEOA 1WELA 4DR3E 3ZZUA 3TANA 2IA6A 2MHNA 2BQ3A 2YXLA 4KE5A 4M5HA 3F73A 3T1YJ 3DYAA 3W64A 4CH0S 3G8QA 1EP4A 1K0VA 4M5KA 3IXQA 5LMNF 3LANA 4LRBA 4DF4A 4PABA 1RHYA 2IM1A 5M2RA 4EYHB 3W9JA 4A48A 3CSKA 4JI3J 3MAAB 1FJGE 1G7CB 3I32A 1C1BB 4OZJA 4I1TA 2MKKA 5T7LA 2UUAE 2FC8A 4F36A 4ZHRB 4DWIA 3WU3A 5ELWA 3MCSA 3KLGA 1RUSA 4PQUB 3M6AA 2HK3A 1UETA 4WXWA 2C2EA 4W4MA 5K36F 4H4OA 3AAWB 1NDCA 3HHLB 1OYPA 3WDOA 5K36B 2YKQA 2PFFB 1S0MA 2R2RA 4UUXA 4YQWA 1GMWD 2HHHI 4CIOA 3PVXA 4LF6E 2BA1D 1Q8KA 3GV8B 1VJQA 2D3OR 5C24A 2FVRA 1ZH5A 1RACB 2BM1A 1GTEA 1YKWA 5E7OB 3HM9A 1Y00A 4USUA 2DHXA 1JX4A 4WZQA 1NNDA 3MF5A 2HRUA 3M8WA 4NLYA 1BQNB 4X4VA 2H65B 4ES3A 1N33F 1T02A 1CULA 1YJWS 4CO4A 2V4RA 1FWKA 2PO2A 5KFYA 3HHKA 2WHOA 2MY8A 1ZM2A 3RB3A 4JV5E 3R5BA 2OMOA 2ZH2A 4QNJA 4DR5I 3Q6MA 4DSLA 4AM3A 1MLAA 3ICLA 3C16A 3POTA 5DLFA 2K06A 3SSSA 2R2SA 2KN4A 1FFGB 3DGVA 4RKUC 2J8AA 5DM7Q 2OP5A 2D9OA 4B3SE 1E3PA 4NEZA 1NSQA 4FBTA 2FB0A 4DL2A 2GIRA 2M2BA 2M8DB 3IC1A 3ZTQA 4GO5X 2DGTA 3SQGB 1W25A 1JKHA 3V81B 1PJ6A 5A2QQ 5EGYA 3KJNB 4DEZA 3RTVA 1LQ9A 3K8VA 4DPXA 4X66J 1RJJA 1HNVA 2Z8QA 3T5HA 3DGPB 4LF7I 2XSJB 2ZM6E 4FBUA 4N7TA 2Z5CA 1UDSA 4XTTA 4RX6A 3TZWA 3LO3A 4ZPVR 2KL8A 4ENOA 1HNWE 4HY1A 4LSZB 3DRSA 5H9FK 3AQOA 5F0WA 2G2OA 2UXBF 4AQYJ 2YNHB 4DR4E 2CWKA 4DV7F 2KTQA 1KIJA 1Y3JA 2IRXA 1YGYA 4PRVA 2EFVA 2J9CA 4NLRA 5SZTA 4P74A 3EVWA 4C3MA 1CPZA 4BBYA 3MM6A 4BS2A 4RPFA 3UD4P 5EKWA 4I68A 4NA1A 4OQJA 5ETKA 5D0HA 3TNVA 1FJ7A 4JI7I 3AOAA 3ZZTA 3KMQA 2DNOA 1SJQA 2UUCE 2PIIA 3KLEA 3IWXA 2GS8A 3KG0A 1R43A 2F4VI 2YNIA 5HO4A 1PSDA 3SSRA 3TARA 4WKYA 2BQUA 1FDNA 2JEGA 1VRQC 4Y2AA 2HNYB 3KUEA 1PC5A 1SKRA 1S6QB 5JEAF 2G1DA 1A6FA 3EPIA 1K73T 1X4DA 4ID8A 4K0KI 2PE8A 3T9ZA 1RP5A 2DIVA 4FWGA 2P9EA 1SBRA 4HYMA 4O4RA 4MU1A 3MMAB 1SXLA 3X1LB 4X64E 1UWBB 4CZCA 2QX0A 1J5EF 3UHMA 4YHHF 4RW6A 1E6YA 1F5AA 5LXRA 4OYWA 1JMTA 8AT1B 4P7TA 1UZHA 5F8HA 2D74B 1WTBA 4XPEA 1YRXA 2R42A 1JLGA 3A8KA 5J1NA 3B4MA 4WK1A 2LA4A 2MJUA 2IRUA 1JNZB 1C4CA 4WU3A 2R8JA 1KWMA 2E5LE 5M2UA 2DRBA 2EFPA 3Q8YA 5A2QC 2DXEA 4LFAJ 2FY1A 1M90T 1WHWA 5HMYA 1FEHA 2J9DE 2W2PP 4JI8I 2G13A 3ZZYA 3SIPB 3MR5A 3GPAA 4P2MA 2V94A 1BKNA 4DV2F 2F63A 1RT2A 3IA0A 3OUYA 2FVPA 4EO6A 2JEIA 3DDNA 3G87A 1IBME 2JFKA 2VPWB 4DR3F 3BH6B 3PX4A 1W2BR 5A0YB 4NA3A 4OFZA 3OFHA 3OR2A 2HS3A 1DTQA 4CLZA 2O1PA 3HJFA 1WACA 5D4NA 3MM8A 4MKBA 1FVSA 4NXNJ 1LXJA 2JT2A 1NDPA 5CYQA 3RAXA 4ZVRB 3G82A 3ZNUA 2HFUA 5E33A 6FDRA 4CRJA 2B56A 5KFCA 1JJCB 1N6QA 1KNZA 4F02A 1M0SA 1RAEB 3AA8A 4DHVA 3TRGA 5HLFB 2J6SA 2XGPA 1Y7PA 1EIYB 4B02A 2CQ2A 3IRWP 3C66A 2E7WA 3ZO7A 4RBVA 3ZC4A 4DSEA 1MW7A 1R8PA 1QTNB 4QW9A 1IUJA 4JOUA 1AZSB 2DNZA 3LP2A 2VQEJ 3T1HJ 5FLXQ 1S1VB 1N36J 2GAHC 5KFIA 2R9LA 4O3NA 4DR7J 3BPDA 3RR8A 1P9YA 2KG0A 5KT2A 1ZXNA 3M8ZA 2VFVA 1HI1A 5C2CA 3DLEA 2LEBA 3KUGA 1SC6A 1U0HB 3K57A 2H5IB 3HVTA 4LF6F 1HBNA 4M94A 2ZBIA 4HACB 3A1YG 2A6OA 2NZCA 2VFTA 1ZA2B 3FMWA 5HMXA 2RHSB 4KY3A 3KK3A 5ITHA 2G2YA 4JI3I 1NZ0A 1F2GA 1QVFR 4KJIA 3FVYA 1PCAA 1RT5B 1WOSA 3GILA 4MFBA 2Q1LA 2EC2A 3R1HA 3ZZZA 5RUBA 2YTCA 1VQ6S 4GMKA 4QR2A 5CH7B 3QSYB 2UXDE 5IQQA 1TK5A 3MM5B 5JXSA 1I94E 2IM3A 3CMQA 3FEZA 2V8DA 2E1AA 2ZBQA 5GMEA 3NKYA 2OD4A 3IBFB 4DL4A 4GKJJ 1JLQB 2QT7A 4Q0BB 2AW0A 5F8MA 2EPIA 4YY3F 4ZKAA 4LRFA 2AJFE 1C0UB 1C0TA 5KT4A 2QO3A 2ZNYA 1NPPA 1RISA 1JWWA 1K44A 2XZDB 3IWNC 1S48A 4ZPCA 3AH6A 2CFXA 3L7PA 2R8HA 1PILA 4OYOA 2ZH1A 3R27A 4YB1P 2ZM6F 4C8ZA 1NUEA 5FLXC 3OL7A 1D9DA 3BYRA 4ZVIA 2ACMA 1VQ9S 4U67Q 4WE1B 2C2DA 2W2OP 4UZBA 7FDRA 2JHEA 1HPZB 4DR4F 5F41A 1A7GE 1HWKA 4K2JA 4LCFA 4RW9A 1XMQE 4E2FB 1X4FA 1QSSA 2VKRA 4NZ0A 5L9NA 4OZ1A 2C3PA 1CSJA 3GIJA 4YB5A 2AKWB 3M8RA 5EN1A 1S9GA 4UW2A 3K85A 2DNMA 3AHPA 3MHYA 2UUCF 3DLKA 2OHDA 1DLOA 2O1VA 2LQJA 5HSPA 2EFGA 4WYWA 2PEBA 1JKHB 3K58A 4X66I 2DY9A 2HQ3A 2PO4A 4ITSA 3J7AM 2V68A 3IP0A 1XNQJ 4PPDA 3GMEA 2CQ1A 5C42B 3M1VB 2Z5CB 2CPEA 1M5OC 3EPGA 5C0XD 1YX2A 4C11B 1HWJA 1FRIA 1VQ7S 1T0TV 1TKXA 3IR6B 3QIDA 4AQYI 2ILZA 4ECSA 2DHSA 3H90A 1MSWD 3T3FA 3A12A 3KJVA 3Q23A 1VQLS 4CYUA 3NGRA 5KFXA 4LF5F 5AXLA 4A8QA 4FP9A 3DDIA 4CLWA 1JLEB 1L3UA 2FJEB 3VZIA 2E5LF 1V6HA 4P2XA 2XY6A 4RBUA 3PFOA 3OPKA 6AT1B 3MEEA 3ETOA 3M6UA 2K7JA 1HL6A 4RNNA 3HZGA 2V34A 3PY8A 2I8EA 2DCLA 2DHHA 1VQKS 3ZZRA 1IKXA 1IBMF 2GQ2A 1VRUA 3S1TA 4PCQA 1U1LA 1BQMA 5G0RA 4CTAA 2U2FA 2O1TA 1RE1B 1K8AT 1TL1B 3PKYA 1BHNA 2EFOA 2E5IA 1HBMB 4ZP8A 2RMLA 2MQLA 2F4FA 4WKRA 1DQ9A 5IWAJ 1E6YB 4F3MA 3ADAC 2BACA 2F8EX 2HZVA 4AXJA 4X62E 2W8KA 1EKRA 3UN3A 3HJCA 3QZ8A 1E6VB 4FN5A 3H42A 2AYBA 3AQPA 3CD5A 3ZKBA 2ZNZA 2MLXA 5CXTA 4MQYA 3SV3A 4LFAI 3EJMA 2IRYA 4DX8H 4K4WA 3MPWA 1G1XA 4BWMA 4DUYF 3Q6NA 5L3JA 3EGVA 2ZBKB 1UW9A 5IS2A 2CAJA 3IBWA 4JI6J 3LPEA 3MM9B 3JB9k 4OZ3A 3TQ1A 2ASJA 1EKSA 3DRRB 1CJUB 2AJ0A 1RT2B 2U1AA 5CYMA 3J7A1 1BQXA 1JLCA 3NCRA 4P10A 2KHCA 4JI5J 3NLCA 1SH3A 1S4FA 2FY8A 3RYLA 5BYRA 5KFAA 4NXNI 2RS2A 1RYRA 1TL3A 3G8SA 4OX9J 5CD4H 3QGGA 1FNXH 2G4BA 3E8OA 3W66A 4KR0B 3Q89A 2OELA 3G82B 4K4YA 2MQ8A 1W2IA 3CMAS 2ZUAA 4E0DA 5D0EA 1NEEA 3OW2R 4ZLLA 1IBKI 2CZVC 3QRQA 3M30A 1WC4A 5B0BA 3Q8SB 5J2QA 4BA2B 2BKPA 1RZMA 2HVEA 3D6MB 4ECQA 2VQEI 2OGUA 1I94F 3T1HI 5ETRA 4O4GA 1N36I 1B0PA 3WIVA 2MGZA 3OFGA 4J9MA 4O0NA 4DR7I 2E1PA 2HGLA 5DLGA 2OIHA 3LP1A 2W9CB 4OZ2A 1S12A 4CLYA 1ACMB 2DGVA 1V3RA 2R3VA 2C37A 3H4LA 1TV6A 4ZVOB 4ELVA 3G71S 1HW8A 4DSFA 3Q83A 1FX4A 4TVAB 5KFZA 4KTQA 1ZBTA 2QMWA 2IAJB 3QWUA 3IBCB 1HBNB 1FJGJ 2NQPA 4WF9Q 2JEAB 4ZDNA 2UUAJ 1HBOA 2JFDA 2W2QP 1EI1A 1T9YA 4H54A 1DURA 4B3OB 2ZJPQ 1RT3A 2XS2A 2VFUA 3IG1B 4DR1J 4C97A 2HNZB 4IFDD 1MU2B 3CJ8A 1S99A 2CDRB 4NYOA 2OI2A 3CCWA 1MMNA 3SMZA 3L09A 4MIWA 5HBMA 5HQ8A 5KT7A 3OHBA 1FJEB 4IDKB 4GKJI 4U7UD 2GHPA 1SUQA 3IS9A 1VBZA 1X9SA 3N6LA 3BKTA 2XO7A 4EK2A 2B4VA 2V5HG 1KOHA 1UFKA 5LMUE 3MD1A 3OTBA 3HX9A 3NBPA 3W5XA 3FBFA 3NMRA 1XNRE 5C0XC 2FZCB 5CQGA 5I3UB 2RU3A 3WHIA 4YEAA 3DHXA 2V2KA 4LSLA 2KVQE 4J90A 1KTVA 4JV5J 1WG1A 4ECYA 2EVZA 4I69A 1VQOS 1FKPB 3RUBL 5F8LA 4NLOA 4RW8A 1FO1A 2MTLA 1RT1B 3CJRA 4IG0A 2FVCA 1P6TA 4PR6A 1QAYA 2KVIA 3QGPA 2OPPB 4B3SJ 2MQMA 2NR0A 3BH7B 3C14B 4F0HA 3UN2A 3KK1B 2GVDB 3DM2B 1HHTP 1QD1A 2WB1D 1H3DA 4RW9B 2FJAB 3ONQA 3CDBA 1C4AA 2V9KA 2W8LA 1YJ7A 1KQGB 3HMJG 4F4WA 2POKA 4ZVEA 4C0HA 3DLKB 3UVJA 1RTJA 2IFXA 3E01B 3CNQP 2C3OA 1B64A 1OMSA 4IOBA 4RJVA 3CVKA 3ENWA 3LP0A 1OY8A 3I4HX 4A8XA 1P9QC 5DNXA 2NXUA 1XK8A 3NAIA 1HNWJ 2J0QD 3P3EA 1GMVA 2Q6BA 1XNQI 1VR6A 4IQXA 3PEHA 3I55S 3CMES 1VK8A 3VAKA 4CI0B 2GMLA 3P3GA 5F9NA 3D6TB 4D3HA 4YFUA 3LPYA 2LECA 1U47A 2IMWP 3GIKA 3EZ5A 3R5JB 1UDNA 1NJXA 4CLUA 3UNGC 1NSKL 3CTRA 4AUKA 2LQBA 1TKTA 4ZOSA 2HRYA 5A8RA 4I2QA 1LK7A 4X62F 2HAIA 1WOOA 2CNKB 4PG7A 3GQCA 5H1SV 2YNFB 3H1CA 1OY9A 3CE8A 3U1KA 2XWXA 2R7QA 2PI5A 1U8SA 4Y2IA 5FIIA 4X4RA 2OFGX 3C8YA 2EWHA 1QAJA 1TK8A 1PJ5A 2OEJA 1FI4A 1FD2A 1SC1B 1JLFA 3UDEA 2GMJA 4FZVA 2VKZG 4N8OA 1BY9A 1YSJA 4DG1A 4M5DA 2YWKA 2DGOA 2HIQA 5E41A 1HNZE 2XZWA 3M7NG 2XTJP 3V4MA 2X7IA 4ZLJA 4X64J 1Q0NA 4KO0B 4DU8A 1MU5A 2MPUA 1VK3A 1WORA 2AEFA 4RLEA 3I31A 5BR8J 2B7BB 2CG8A 3IRXB 5IWAI 1VC0A 2VODA 4RUHA 2ZJRQ 3HK2A 4Z37A 3MMBA 1VC5A 5A8KB 4GKKE 5CZXA 4IFDE 1DRZA 1S1TB 1RWOB 4JI6I 3R1LA 4DV5F 3B4TA 2YWHA 3MCMA 2HHSA 2HWHA 3BGOP 4EI2A 4M95A 2RH3A 4ZVSB 4EUVA 1VRTA 1D3WA 4JI5I 2BM0A 2ZITA 2YWEA 5EHHA 3LGNA 4MK8A 1N88A 5K8NA 5IT9U 1HBUA 2AT1B 4Z7CA 3CCSS 2BQRA 4OX9I 1L3SA 5KT3A 2RILA 4OI1A 2FPHX 3PJWA 1TL3B 5A8WA 3FSXA 4Q45A 2CA9A 3MR2A 3O8WA 1NCLA 4HHHA 2BABA 3M2VA 3M8YA 4JI4J 2CG4A 4AIDA 4IFDC 5AE3A 1LKZA 3NS5A 3KLHA 1UZDA 3NGKA 2GO8A 3PS1A 3TAPA 3M30B 3NP5A 4LRAA 4MIAA 2F3JA 5KG2A 1HLWA 2HHUA 1LW0A 4M5MA 1VS3A 5C0XB 1PIEA 1FXLA 4F3QA 5L1IA 2YKMB 1XHKA 3SYZA 2PT0A 4EGLA 1WC0A 5ETOA 3RRKA 1RSCA 2MGZB 2J0WA 2QLWA 5KFJA 3M8QA 4HI2A 1M5PC 4C3KA 1RBAA 5A76A 5IT4A 4HHJA 4F0KA 3I0SB 1B70B 3B54A 2R8IA 1NDLA 1TV6B 1YZ6A 5LMUF 1MN7A 1JQGA 3LWMA 4X2BA 2QV6A 2ILYA 1FJGI 3TOQA 5B7WA 3OJUA 2F1FA 1XNRF 2UUAI 2N3LA 4URGA 2O01C 2VQFF 2UXDJ 1Z0TA 4RUAA 1I94J 1NSAA 2W2NP 3CDJA 1SI9A 4DR1I 4USWA 1H6KX 1EETB 4NYPA 4X4OA 4DV0J 3P49B 2NSCA 2ZBRA 2AGPA 3KHLA 5GVQA 2UUTA 3RZAA 4DFJA 2I0XA 1PBUA 1HK7A 1N5QA 4L73A 1FFWB 4PWWA 5HBMB 4QWBA 2PMHA 2DXFA 2K3IA 4IRDA 2FHJA 1EX8A 2B9YA 2JRSA 2HNDA 1ZA1B 4HH1A 3HI9A 3MM7A 2KO1A 1YJUA 1S7HA 4B3MJ 3GU0A 3FCHA 1TMJA 3MOJB 4ZPWR 1QTMA 2CQPA 2FTRA 4OYAA 2XEXA 4TU9A 3JSRA 3I0RB 4N76A 4JV5I 2V9WA 4DR6E 4IFYA 1H2TZ 1Q53A 4X84A 2W4DA 3PRDA 2ADBA 5IV4A 1TR0A 2B9EA 5EWEA 1XN9A 4ECWA 4HYKA 2RDDA 3WU5A 1U26A 4RW8B 1FHTA 4U95A 1S5ZA 1FRKA 2PO0A 1KQFB 3NG8A 2BKOA 1XMQJ 4B3SI 4MAKA 3DMJA 3E3XA 3ETMA 4WP9A 5L38A 1S76D 1U48A 1IR2A 1CQMA 4EFAC 4USTA 4YOEA 4IH6A 3JAMY 5HK4A 2PNZA 3GONA 2GHVC 4ZJQA 4E98A 4N47A 4JI1J 2UXCF 2RQ4A 3DRPB 4RW4A 1IM4A 2UVUA 5LL6R 3CF5Q 4G6VB 3Q1QA 5DZ7A 2RS8A 1HYSB 2P2CB 3P5TL 4RUCA 2DEIA 3B78A 1ZPWX 2F40A 1R27B 3OTOF 3W2VB 2ZZMA 3M9MB 2IJNA 1YDLA 4C98A 3VZHA 3FC9A 3G6XA 3LP0B 3OXGA 1N32J 2HS4A 1HNWI 1HNIA 3WC2A 5LT5A 1HNZF 4X4NA 2VONA 1S10A 3A8JA 3DOLA 5G4DA 4CO5A 2HRTA 2M0GB 1OO0B 4ILRA 2ZHOA 2YBVA 2CGEA 2O66A 4OO1A 4LF4E 4NA2A 1UPPA 3CJ5A 3FMBA 3OVSA 4DR2J 4ZP7A 4DL0C 3C6TA 1KD1T 4Q2LA 4QIFA 1G4CA 1OPIA 4KB7A 4I2QB 2QN6B 3H8YA 2IJRA 3O3LA 3SQOP 4LFBE 4BA1A 5HP1B 2R7OA 1WKJA 4LIRA 3MEGA 4IFDB 4DPWA 3T5LA 1V5VA 2W2MP 2C39B 3WX4A 3JAMQ 1VQPS 4HEA9 1XR6A 4K4SA 2WNRA 4KYZA 2QSWA 3QFHA 1IR1A 1HMVB 2X1FA 2HQDA 1JLFB 1V5IB 2RUSA 3ZTPA 5GADU 3CIZA 2XI2A 4X64I 3MDFA 8ATCB 5KFWA 1UVNA 2HVZA 4ICLA 3C6UA 3DLJA 1OJ4A 1IKYA 2W24A 5BR8I 5KOWA 4G3IA 1RLCL 4DFKA 1S1UA 2KI2A 3KDOA 1NDKA 4ED0A 1U7LA 1T7PA 4WTYA 1TFWA 4YB6A 2DITA 1WSVA 2MKIA 4O3SA 1T94A 1MROB 2J76E 2EK1A 3NS7B 1Q7LB 4F4KA 1WC1A 3MFIA 4AT1B 1NK8A 2GIQA 1MWQA 2BA0D 4I7FB 1USUA 1O5JA 2RQMA 4DV4E 2WCXA 2FD2A 3U1YA 2NXCA 2PSZA 1LWFB 1UTAA 3BN4A 3GIRA 5IOLA 5ETPA 1B7FA 5D8HB 1VRTB 4LF8E 4LBIA 3PCOB 3O1LA 4UOHA 1ZM9A 5HVGA 3SFGA 2OMLA 3MMCA 2BR2A 2IVYA 1NJWA 4Q44A 1WI8A 2FLLA 4AL7A 3J7YU 2VFSA 1HBUB 2DGSA 1B0TA 4I56A 3G86A 2CJAA 3FJ2A 4QQBA 2VPYB 1I5OB 3QMQA 1F9HA 1JLBA 4DQIA 3FK4A 4USVA 3V6DA 2ZBPA 2J0XA 4ZJOA 1VIOA 5KFTA 3THVA 4TN2A 2DT9A 3QGIA 4NLDA 3M2VB 1TVRB 2F8MA 2WBRA 2CADA 3EXCX 3KJFB 3D9BA 2BA9A 2BOPA 3GG0A 4DV1E 3TI0A 1Q1KA 4DQSA 5HAOA 4D3GA 3CGIA 1X4BA 3GV5B 4ILLA 3R9LA 3C19A 1NH8A 3KK2B 2NPIA 4M5LA 1B62A 2ZE2A 1DTTB 4TKTA 3M6XA 3LALA 2NZ4A 2CJYB 3KKFA 1HKAA 2VG5A 1KQKA 4IZJA 3M8QB 4NLVA 3D67A 4NZ6A 1UA1A 4NOHA 4FW9A 4NEYA 2J7KA 4EEYA 2GGPB 3PX6A 2ZDPA 3WX8A 1N34E 2L08A 1ZAWA 5F8NA 2UU9F 4KV8A 1BE4A 2MZQA 4I2PB 4QYRA 2XYPB 4PRFA 1Z0EA 2FZGB 4MH8A 3M2UA 5DETA 4OJHA 4K4ZA 2UXDI 4MKVA 5HMZA 2V8HA 4A8SA 2UUBJ 1I94I 2CJKA 3KFWX 2HSEB 3I5AA 1KDNA 2N82B 2ZEJA 4K5SA 1JJHA 2QLJB 3DI6A 1N5VA 2VC1A 2DISA 3A3OB 1RAAB 3GYGA 4DV0I 5C5JA 2CJ9A 3MPDA 2MJNA 1FDBA 4IFVA 4BDPA 1F2HA 4UTGA 1NHIA 5KFPA 3QLHB 3MR3A 4LCHA 4PXBA 1CJVB 3DOKB 3PRBA 2JE6A 1UVIA 3EICA 2QA2A 1HNXJ 3VGUA 3QWPA 2HNDB 3UCZP 1Y4ZB 4URLA 4U9RA 2BV3A 1MNEA 3M2RA 1IQZA 2I9SA 2DTJA 1YJ9S 4EMDA 1RT7A 4OI2A 4CM0A 2YPYA 4B9UA 2ZHAA 1J2VA 1WSRA 4DCOB 2MHEA 2R2UA 2IM2A 2V63A 3CJSA 4DSJA 5KFFA 3N9UC 4ZPTR 1SJ1A 4H4MA 4DPTA 1DZ5A 5K36D 2O3ZA 4U7CA 4GO7X 3OHAA 4TNOA 5HQLA 2I2YA 2GFFA 5D0RA 4LF4F 1HA1A 1XMQI 4OJ3A 5DG7A 1HQEA 4ZP6A 3K1JA 4B9MA 2GO3A 4OYIA 4J9SA 4C9DA 2RAQA 2OO4A 1TAQA 4MU0A 2IBKA 5K8PA 4WUDA 2CQGA 3QO9A 3NGDA 2DNYA 4JI1I 4LFBF 2CQHA 4KT0C 4NXMJ 3MUTP 1HR0E 3QATA 4JI2E 3LTOA 4RW4B 2VB6A 2OKQA 1W7WA 2LQ9A 3HXMA 3TAMA 2RUGA 2V8GA 1GX6A 2W01A 4HVZA 2AP6A 1BMQB 2Q2EB 2YKOA 2DH9A 1NB2A 2DR9A 4ID5A 3AB2B 4B3RE 4UY85 3SCKE 2IA0A 2VG7A 2VF3A 4FPIA 1U1MA 4P75A 1RK8A 3UDCA 4ZLPA 1PBAA 1PO6A 1HNIB 4IRCA 3ET6B 4X4QA 4C8MA 5AE2A 3MPVA 2R7WA 5JVHQ 5IM0A 3DOLB 2VBWA 1Z2ZA 1TTHB 1NK7A 4OO1F 1KFSA 4JYAE 4DR2I 4Y65A 4OHXA 2ATLA 2ZD1A 2BANB 4ZK7M 3GYXB 1H7SA 2LXIA 3FZ2A 2N7CA 2Y0BB 1U02A 1OSCA 3C6TB 2N4DA 3KLIB 4KC5A 4Q8FA 4U8YA 1VC6A 1KC8T 4JI0E 2GQQA 1N4LA 3ILJA 2CQBA 4K7QA 4C3LA 3MPYA 5IXUA 5EUHA 2YH0A 2HLUA 2VZ9A 3S01A 1FD8A 4BA1B 3RAMA 3CO0P 5B0AA 2E1MC 5LOQA 1F5CA 2PMZD 5DQIA 4KHPF 1VI7A 1RAFB 1SVDA 2KG1A 1UDOA 1A0OB 4OKGA 2C38A 2ASDA 1TK0A 3CCVS 4NPOA 1PKPA 4LF8F 3BN7A 5B0EA 3TAQA 1IKVB 1DHMA 3H59A 1M1HA 2W9BA 1YJNS 2MDAA 5J2NB 1X5PA 4V19J 2YWGA 1SV5B 1FF2A 3C6UB 2RDJA 3SZ2A 2H51B 1YI2S 1IKYB 4PG4A 1XIQA 1DQAA 2IJFA 1IBLJ 4DXLA 3QJPA 4QZVB 4HXZA 3H7HB 3H5XA 2FJDB 3TVZA 3OXLA 1XMOJ 3TUPA 2C22A 2BE2B 4GKKJ 1FDAA 1RAOA 1MN9A 4N77A 4OMFG 1WC6A 1B63A 1U1PA 2NN6A 3HP6A 4J9UE 1RTHA 1SH2A 1T9VA 3J81U 4JV1A 5JEAD 3CEDA 2RRNA 4QCLA 1KSPA 1ZYQA 5LM7E 3R97A 1M5SA 1HWIA 2LXUA 4FYDA 5DNLA 1Q8BA 1Q4RA 1TL4A 3TJAA 1FNMA 1P1TA 3J7ZT 1N34F 1ZOTA 5BYQA 3ZM7A 3W7BA 1R31A 2Y1IA 1U1NA 2FC9A 1U1OA 1D9AA 1AA1B 1CJTB 2G0CA 5J2MA 2OH2A 3MXHP 2WAQD 2DPIA 4OLOA 4PUOB 3Q8UA 4ED6A 2H48B 1IKWA 3TQEA 3AT1B 2F9JA 3KLVA 3BKFA 3W9HA 2HKJA 4RW7A 2D3ZA 3H98A 3BO3A 3ISND 3EZOA 2QA4G 1J5OA 4OYZA 3D6HB 2ALYB 2GC8A 2HURA 3CCRS 1C1CB 3H2UB 2FJVA 1R0BG 3QRRA 4QYZJ 1RHMB 2JLGA 4G1QA 3ENQA 2MZ1A 4ZCMA 4LFCF 3THPA 4R25A 2HQGA 2AQ4A 2B8QA 4UQTA 5DQGA 4Q5VA 2VBZA 2ZVSA 3I4PA 4DQQA 3M8PA 1S49A 2HHHE 3SSQA 1FK9B 1AFIA 1N33E 4RR5A 2BBEA 4EZ6A 4DUZF 4RU9A 4EBEA 4GQUA 3SDEA 4LF7J 2I5JB 1J27A 4J5OA 3N01A 3S7RA 5DDQC 1NHKL 4QU7A 2UUBI 1RABB 2LEAA 4B3TJ 3MECB 3OR1B 1FE0A 4WUBA 3KWMA 2I1RA 4XDCA 1OYSA 2KYZA 3K2YA 2DHGA 2E5HA
chains in the Genus database with same CATH topology
4LF8I 2E5LI 1FI4A 1ELOA 5FLXQ 3WU3A 4DR5E 4X65I 4YY3E 1HNZE 4IZKB 4DPTA 2Z5EA 2A2DA 4DR2E 3M6AA 2WW4A 2HK3A 5BR8E 4X66E 4OX9E 1XMQI 2X7IA 4DU8A 1ZM3A 1MU5A 2CGEA 3K1JA 1ZXNA 4LF4E 1H72C 3PYDA 4DV2I 1IBMI 4ED4A 4NXNI 4NXME 3PYEA 4KHPE 1HNXI 4LFCI 4I3HA 2HK2A 4WUDA 4DR3I 3B8HA 4M1KA 2LJPA 4PRXA 5IWAI 2HHHI 4K0KE 4LF6E 4HACB 4JI1I 3ZKDA 4DV1I 4DV3E 1HR0E 2BM1A 4IZKA 4JI2E 4LFBE 3LTOA 4JI3I 4R1FA 1NZ0A 4DUZI 1IBKI 4B3TI 5LMNI 4GKKE 3J80Q 4X62I 4DPWA 3HULA 4LF9I 3JAMQ 2Q2EB 4USMA 2UXCI 1EA6A 2GQ0A 2VQEI 3T1HI 2V2VA 4JI6I 4B3RE 4WUCA 1FWKA 2VF3A 2UXDE 1N36I 2DEJA 1ZM2A 4HACA 1I94E 3LPSA 4JV5E 4DR7I 4GKJE 3OTOI 4B3MI 4X64I 1Z0VA 5GMEA 1Z0CA 2BM0A 4JI5I 2ZITA 4DUYI 4JI8E 4DR5I 3Q6MA 1Y6ZA 3P06A 2R3VA 1XNQE 1OJ4A 4JYAE 4DR2I 3H4LA 2VQFE 4Z7CA 5BR8I 4OX9I 1H7SA 4JI4E 3J81C 4LF4I 4B3SE 1NHHA 1KVKA 4JI0E 4NXMI 1WUUA 4DR6I 3LNUA 2F4VE 1N0UA 4LF6I 3V2UC 4P7AA 1Z5AA 4DV3I 1FWLA 1EI1A 4DR1E 4LFBI 2IOPA 5A2QQ 1PIEA 3T1YI 1USUA 1S4EA 2UU9E 4DV4E 4DPXA 1XHKA 1Z0WA 4JG4A 5FLXC 1K47A 1Z59A 4DV6I 4LF7I 4LF5E 4LFAE 2ZM6E 2O1WA 1PKPA 2Z5CA 4ZVIA 4AQYE 4B3RI 2OI2A 1N33I 3PRYA 1IBLE 1HNWE 4HY1A 4LF8E 1ZM9A 4DV5I 4FWHA 4GKJI 1XMOE 4DR4E 1KIJA 4PRVA 1XMQE 3QT5A 4DXLA 2UXBE 4DPYA 4HXZA 4JYAI 1QZRA 4FWDA 1N32I 4DV7E 2X36A 1MX0A 1FJGI 5LMUE 4DV2E 4RPFA 3K17A 3K85A 4NXNE 3J7AG 4JI7I 1D6TA 3ZZTA 4LFCE 2UUAI 1B63A 2O1VA 2V2ZA 4IZJB 4JI0I 2UUCE 1XNRE 2GS8A 3J80C 2F4VI 4YY3I 4DV1E 1Z0TA 1Z5CA 2EFGA 4DV0E 1Y4UA 1HNZI 5IT9Q 1H74A 1KTVA 3J81Q 1DARA 4DUZE 2E1RA 1IBKE 4X66I 1B62A 3ZZ0A 4DR1I 3WU4A 3J7AM 1N0VC 4LF9E 4N3OA 2UXCE 2Z5BA 2AJ4A 4KHPI 4XTJA 2VQEE 5GMDA 2Z5CB 4JI6E 3QT8A 1A6FA 3QT6A 2HKEA 4IZJA 1FNMA 1HK7A 4K0KI 2ZM6I 4FW9A 3B82A 4AQYI 2J7KA 4FWGA 3ZM7A 1UEKA 3OTOE 4HYMA 4B3ME 1HR0I 1IBLI 1H7UA 2PNMA 1N34E 4JI2I 4X64E 4MYUA 4JI5E 4DUYE 1XMOI 4KQVA 4GKKI 1J5EE 4DR4I 1Z0GA 1Z0EA 2UUBE 4YHHE 2A2CA 2UXBI 1RREA 1H73A 4DV7I 2R42A 1FKAE 4DPUA 2HKJA 1RR9A 2XEXA 5LMUI 2UXDI 2E5LE 2O1UA 1I94I 2PNLA 4JV5I 4X65E 4DR6E 3V5RA 5A2QC 4UT4A 2UUCI 3WU6A 1XNRI 3QT7A 4JI8I 1NHJA 2V34A 4IZJD 4DV0I 1XNQI 1VISA 1BKNA 1KKHA 3WU5A 4USKA 2VQFI 2V8PA 2CZ9A 3T1YE 1IBME 4JI4I 2CG9A 2Z5BB 3F0NA 4UTGA 1NHIA 1HNXE 4B3SI 2O1TA 4DR3E 1MG7A 4DV6E 4P52A 3ZZUA 5IWAE 4LF7E 2HHHE 1PVGA 4JI1E 2HFSA 3D4JA 1N33E 4MYTA 3PYGA 3JAMC 1S16A 3GONA 4DV5E 2HFUA 4JI3E 4DU7A 4URLA 1N34I 4B3TE 5LMNE 2BV3A 3CWVA 4X62E 1Y4SA 3HJCA 5LL6R 4EMDA 2IOQA 4FN5A 1Z5BA 3Q1QA 1N32E 1J5EI 4Z7YA 3ZKBA 2UU9I 4DV4I 2UUBI 4YHHI 3T1HE 4PU9A 2DEIA 5FWKA 3B78A 1Z0BA 1FJGE 1N36E 1U2RA 5IT9C 4LF5I 4LFAI 4WUBA 2NPFA 1ZXMA 4JI7E 1ZM4A 2V2QA 4DR7E 3Q6NA 5L3JA 2UUAE 1USVA 2ZBKB 3PYFA 1HNWI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 I;  2E5L I;  1FI4 A;  1ELO A;  5FLX Q;  3WU3 A;  4DR5 E;  4X65 I;  4YY3 E;  1HNZ E;  4DPT A;  2A2D A;  4DR2 E;  3M6A A;  2WW4 A;  2HK3 A;  5BR8 E;  4X66 E;  4OX9 E;  1XMQ I;  2X7I A;  4DU8 A;  1ZM3 A;  1MU5 A;  3K1J A;  1ZXN A;  4LF4 E;  1H72 C;  3PYD A;  4DV2 I;  1IBM I;  4ED4 A;  4NXN I;  4NXM E;  3PYE A;  4KHP E;  1HNX I;  4LFC I;  4I3H A;  2HK2 A;  4WUD A;  4DR3 I;  3B8H A;  4M1K A;  2LJP A;  4PRX A;  5IWA I;  2HHH I;  4K0K E;  4LF6 E;  4HAC B;  4JI1 I;  3ZKD A;  4DV1 I;  4DV3 E;  1HR0 E;  2BM1 A;  4JI2 E;  4LFB E;  3LTO A;  4JI3 I;  4R1F A;  1NZ0 A;  4DUZ I;  1IBK I;  4B3T I;  5LMN I;  4GKK E;  3J80 Q;  4X62 I;  4DPW A;  3HUL A;  4LF9 I;  3JAM Q;  2Q2E B;  4USM A;  2UXC I;  1EA6 A;  2VQE I;  3T1H I;  2V2V A;  4JI6 I;  4B3R E;  4WUC A;  1FWK A;  2VF3 A;  2UXD E;  1N36 I;  2DEJ A;  1ZM2 A;  4HAC A;  1I94 E;  3LPS A;  4JV5 E;  4DR7 I;  4GKJ E;  3OTO I;  4B3M I;  4X64 I;  1Z0V A;  5GME A;  1Z0C A;  2BM0 A;  4JI5 I;  2ZIT A;  4DUY I;  4JI8 E;  4DR5 I;  2R3V A;  1XNQ E;  1OJ4 A;  4JYA E;  4DR2 I;  3H4L A;  2VQF E;  4Z7C A;  5BR8 I;  4OX9 I;  1H7S A;  4JI4 E;  3J81 C;  4LF4 I;  4B3S E;  1NHH A;  1KVK A;  4JI0 E;  4NXM I;  1WUU A;  4DR6 I;  3LNU A;  2F4V E;  1N0U A;  4LF6 I;  3V2U C;  4P7A A;  1Z5A A;  4DV3 I;  1FWL A;  1EI1 A;  4DR1 E;  4LFB I;  5A2Q Q;  1PIE A;  3T1Y I;  1S4E A;  2UU9 E;  4DV4 E;  4DPX A;  1XHK A;  1Z0W A;  4JG4 A;  5FLX C;  1K47 A;  1Z59 A;  4DV6 I;  4LF7 I;  4LF5 E;  4LFA E;  2ZM6 E;  1PKP A;  4ZVI A;  4AQY E;  4B3R I;  2OI2 A;  1N33 I;  1IBL E;  1HNW E;  4HY1 A;  4LF8 E;  1ZM9 A;  4DV5 I;  4FWH A;  4GKJ I;  1XMO E;  4DR4 E;  1KIJ A;  4PRV A;  1XMQ E;  3QT5 A;  4DXL A;  2UXB E;  4DPY A;  4HXZ A;  4JYA I;  1QZR A;  4FWD A;  1N32 I;  4DV7 E;  2X36 A;  1MX0 A;  1FJG I;  5LMU E;  4DV2 E;  4RPF A;  3K17 A;  4NXN E;  3J7A G;  4JI7 I;  1D6T A;  3ZZT A;  4LFC E;  2UUA I;  1B63 A;  2V2Z A;  4JI0 I;  2UUC E;  1XNR E;  2GS8 A;  3J80 C;  2F4V I;  4YY3 I;  4DV1 E;  1Z0T A;  1Z5C A;  2EFG A;  4DV0 E;  1HNZ I;  5IT9 Q;  1H74 A;  1KTV A;  3J81 Q;  1DAR A;  4DUZ E;  2E1R A;  1IBK E;  4X66 I;  1B62 A;  3ZZ0 A;  4DR1 I;  3WU4 A;  3J7A M;  1N0V C;  4LF9 E;  2UXC E;  2AJ4 A;  4KHP I;  4XTJ A;  2VQE E;  5GMD A;  4JI6 E;  3QT8 A;  1A6F A;  3QT6 A;  2HKE A;  1FNM A;  4K0K I;  2ZM6 I;  4FW9 A;  3B82 A;  4AQY I;  2J7K A;  4FWG A;  3ZM7 A;  1UEK A;  3OTO E;  4HYM A;  4B3M E;  1HR0 I;  1IBL I;  1H7U A;  1N34 E;  4JI2 I;  4X64 E;  4MYU A;  4JI5 E;  4DUY E;  1XMO I;  4KQV A;  4GKK I;  1J5E E;  4DR4 I;  1Z0G A;  1Z0E A;  2UUB E;  4YHH E;  2A2C A;  2UXB I;  1RRE A;  1H73 A;  4DV7 I;  2R42 A;  1FKA E;  4DPU A;  2HKJ A;  1RR9 A;  2XEX A;  5LMU I;  2UXD I;  2E5L E;  1I94 I;  4JV5 I;  4X65 E;  4DR6 E;  3V5R A;  5A2Q C;  4UT4 A;  2UUC I;  3WU6 A;  1XNR I;  3QT7 A;  4JI8 I;  1NHJ A;  2V34 A;  4DV0 I;  1XNQ I;  1VIS A;  1BKN A;  1KKH A;  3WU5 A;  4USK A;  2VQF I;  2V8P A;  2CZ9 A;  3T1Y E;  1IBM E;  4JI4 I;  3F0N A;  4UTG A;  1NHI A;  1HNX E;  4B3S I;  4DR3 E;  1MG7 A;  4DV6 E;  4P52 A;  3ZZU A;  5IWA E;  4LF7 E;  2HHH E;  1PVG A;  4JI1 E;  2HFS A;  3D4J A;  1N33 E;  4MYT A;  3PYG A;  3JAM C;  1S16 A;  3GON A;  4DV5 E;  2HFU A;  4JI3 E;  4DU7 A;  4URL A;  1N34 I;  4B3T E;  5LMN E;  2BV3 A;  3CWV A;  4X62 E;  5LL6 R;  4EMD A;  4FN5 A;  1Z5B A;  3Q1Q A;  1N32 E;  1J5E I;  4Z7Y A;  3ZKB A;  2UU9 I;  4DV4 I;  2UUB I;  4YHH I;  3T1H E;  4PU9 A;  2DEI A;  3B78 A;  1Z0B A;  1FJG E;  1N36 E;  1U2R A;  5IT9 C;  4LF5 I;  4LFA I;  4WUB A;  2NPF A;  1ZXM A;  4JI7 E;  1ZM4 A;  2V2Q A;  4DR7 E;  5L3J A;  2UUA E;  2ZBK B;  3PYF A;  1HNW I; 
#chains in the Genus database with same CATH topology
 3JSB A;  4DR5 E;  2KKH A;  1L3T A;  3QAE A;  5IV3 A;  4O44 A;  1C2P A;  3IR7 B;  5CYJ A;  2LMI A;  1RGV A;  1H72 C;  4HTI A;  3UE2 A;  4K5R A;  4C48 A;  4QWA A;  1SKW A;  3TWZ A;  2QC3 A;  1N5S A;  1HNX I;  3AFG A;  4I3H A;  2HK2 A;  2YKN B;  1S1W B;  2JE6 B;  6FD1 A;  2R8G A;  4DL7 A;  3F41 A;  2HS0 A;  1RCO B;  3M05 A;  1KLM A;  2ADC A;  4DR6 J;  3M2R B;  1X0P A;  3DU6 A;  5I42 B;  2GCF A;  3UCG A;  1U45 A;  3AJ1 A;  4DV3 J;  3SV4 A;  4B3R F;  3K5P A;  2GQ0 A;  1X4H A;  2QEX S;  2CDQ A;  1LWC B;  2BJD A;  2ASL A;  5BYS A;  3MAQ A;  1S9E A;  5D4L A;  2NRE A;  2A6M A;  4WP3 A;  2MYF A;  2R8K A;  4H4M B;  3L7Z B;  1N5T A;  2GA7 A;  3D3C J;  4JYA F;  4U6P A;  5F3T A;  8RUC A;  2CXE A;  1QLN A;  1REV B;  4NLQ A;  3GJT B;  1U4B A;  1FKO B;  4IOC Q;  3QIP A;  4HDG A;  3BGU A;  3MGJ A;  5ETS A;  2P6S A;  4JI0 F;  5KG0 A;  3OL6 A;  5DS7 A;  3TO8 A;  5LSR A;  1XR5 A;  3QFW A;  4NXM I;  3SBM A;  1KOO A;  2F4V E;  2C2M B;  5JEA E;  2WRM A;  4NRT A;  3O44 A;  4IKA A;  3V2U C;  1O6X A;  5GAH I;  3JYT B;  2GVZ A;  3M32 B;  3IFE A;  1FWL A;  1RAD B;  2XMJ A;  1HHS A;  4L6V 3;  5A6P A;  3LAK A;  1OS5 A;  4LF1 A;  5KFS A;  3KLF A;  5I3Q A;  1RDR A;  1WF1 A;  4ID5 B;  3R2C J;  4YS2 A;  4OI6 A;  4MDT A;  4OZL A;  4WFY A;  4B08 A;  2ZJQ Q;  3CJK B;  1AXQ A;  5J1E A;  1NKC A;  2EG2 A;  2IDE A;  4OX6 A;  1VBY A;  1HD0 A;  1KR4 A;  4I0W A;  4PAA A;  4USH A;  1VBK A;  2ZD1 B;  3P45 B;  5LJ3 Y;  2YX4 A;  2NUH A;  4C8L A;  3QT5 A;  3TW0 A;  2NCK L;  5JEA C;  1PGZ A;  3I6P A;  4Y6I A;  3CPW R;  4PG6 A;  5DZ6 A;  4UZC A;  2BX6 A;  4J9P A;  4DV2 E;  5KT6 A;  4LQ3 A;  2HMI A;  5EL9 A;  5KG6 A;  1UJ4 A;  3NCP A;  4ER8 A;  3MR6 A;  4NLP A;  2OLW A;  3N6N A;  4U3D A;  1N5Y B;  4TLQ A;  4A8O A;  1HNZ I;  5IT9 Q;  2HIY A;  3TEG A;  4DBQ A;  2ZBC A;  1NK9 A;  1KTQ A;  4TY9 A;  1RTI B;  1YTY A;  3PDN A;  3MED A;  4USI A;  3ITH A;  3Q86 A;  2A3J A;  1VQ5 S;  1FT8 A;  4DF8 A;  4CLK A;  1IM6 A;  2XS5 A;  4CLF A;  1JXE A;  2HLT A;  4CO1 A;  2C1E B;  1Y5L B;  3VV2 B;  1PAE X;  4FKX A;  3ISN C;  1IBL I;  1TP7 A;  1CJK B;  4FYW B;  1XBW A;  1XMO I;  3FBE A;  5AJ3 F;  3PNI A;  1Q5Y A;  4GKK I;  4B17 A;  2QMU B;  1FRX A;  3VAI A;  1RT6 A;  2R7U A;  4NI2 A;  3BBC A;  1RTD B;  1EB0 A;  5ADZ A;  2RIJ A;  1R6L A;  1RR9 A;  4BLG A;  2NN6 F;  4Q7A A;  4DV4 J;  4KGV B;  1VDH A;  2PNL A;  3D6F B;  5A2Q Y;  3HLU A;  1HQU A;  3TA1 A;  2VL1 A;  2VIC A;  4F8R A;  1QAX A;  1QY7 A;  5D77 A;  2XYG B;  2UVW A;  3T1Y E;  2PGC A;  2V4J A;  3QPI A;  2QZ8 A;  2HHH F;  3H2V E;  4QOT A;  3KHR A;  2B5J A;  2G1H A;  2KU7 A;  2R7X A;  3VAH A;  3D4J A;  3P76 A;  1VOM A;  2H4Y B;  3JXO A;  3MMJ A;  3MFH A;  3UO0 A;  3Q8V A;  3JSM A;  4JI3 E;  1OYR A;  2N7Y A;  4R5P A;  1A9N B;  4ECV A;  3R3T A;  1WDT A;  1JIH A;  4DV1 J;  1Y4S A;  5FDL A;  2Y0S D;  1Q7Y T;  2PFD A;  3AXM A;  2V0N A;  5IT9 C;  3BDE A;  1RKI A;  1ZXM A;  1MMD A;  4DR5 F;  2OTJ S;  1USV A;  2WSC C;  2Z0G A;  4U8V A;  4YY3 E;  5FLX U;  3RBZ A;  4IZK B;  2ZHB A;  3AA9 A;  3UR3 C;  2C3M A;  5HRO B;  4M5N A;  4W92 B;  1CVJ A;  3NY0 A;  1OYE A;  1RT4 A;  5B09 A;  1PJ7 A;  3H2L A;  1RWX B;  3RRG A;  5C7P A;  3D68 A;  1S6P A;  4KKO B;  2AX1 A;  3PG9 A;  1QJH A;  5DQH A;  4QWD A;  3B8H A;  1VQY A;  2GQC A;  1EHW A;  2DNQ A;  3BRE A;  2M4M A;  2XNR A;  5F9L A;  1SC3 B;  1KBR A;  3DXB A;  3IO1 A;  4MU3 A;  2MZJ A;  4GRS A;  3K5L A;  5KFH A;  2ZH8 A;  4B3T I;  4X4U A;  1ZTW A;  1S59 A;  3UCU P;  4RNF A;  5B0D A;  5CCM A;  1Q95 G;  1UMJ A;  2V2V A;  2CQ4 A;  4FW3 A;  4XIU A;  3M7N D;  2BE7 D;  4HH0 A;  1CS4 B;  3UDV A;  4V1A k;  1Q81 T;  4ZP9 A;  4O44 B;  4CLS A;  4QIW D;  3NGU A;  3MTK A;  1FRM A;  4IG3 B;  3VGS A;  2DK2 A;  4JI7 F;  3M7V A;  5SUH A;  4MK7 A;  2RKI B;  1UJ6 A;  2EXU A;  4CDI A;  3TUJ C;  2F4V F;  3FCW A;  4FXW A;  3OLB A;  2AJQ A;  4DR6 I;  1UPM B;  5JEA B;  1VQS A;  1D1U A;  3AD7 C;  4P6Q A;  1Z5A A;  2ZZT A;  2L48 A;  4DV3 I;  3T19 A;  2RVJ A;  4HT5 A;  1YZ7 A;  4E8U A;  1KP6 A;  1VLO A;  4NCG A;  2WON A;  1X4G A;  1FA0 A;  1GQE A;  1UFW A;  2X1A A;  4GC6 A;  4K0K F;  1BWE A;  4AIM A;  2ZOM A;  4RNO A;  1Z0W A;  5FLX Y;  2LEP A;  1SPB P;  1Z59 A;  4B9L A;  2KFY A;  3JQJ A;  5LL6 d;  4LF5 E;  2IPO B;  3IM8 A;  3FBB A;  4AQY E;  1T05 B;  2AYE A;  2UZA A;  1R8B A;  5K5M A;  2XWY A;  3S6E A;  3DNC A;  4OHZ A;  4RWX A;  1ZAX A;  1UVK A;  2ZOF A;  3LOU A;  4LR7 A;  2ABY A;  1HR0 J;  4JI2 J;  2VG6 B;  2ASY A;  4PYD A;  4FWD A;  5HAN A;  3DC2 A;  2DCU B;  5C25 B;  1TL7 B;  2OSQ A;  4JI8 F;  2K1R A;  4LSN A;  1SJ4 P;  3N5F A;  2DJW A;  3US5 A;  1S1X A;  4R8U A;  4DN0 A;  4CO0 A;  3DLG A;  3BDP A;  3W2W A;  3DOM A;  1K1Q A;  2MKC A;  4KSE B;  3BJY A;  3ZZ0 A;  1HI8 A;  3FNN A;  3K8W A;  2B4P A;  3EDR B;  3CDU A;  4KFB A;  1VBX A;  2W1B A;  1IBK J;  3TZX A;  2G0J A;  3AOB A;  1LWE A;  1TFY A;  5THW A;  2ZH9 A;  1S0O A;  2VHG A;  2XG8 A;  3UDL A;  3SI8 A;  2LA6 A;  1FNO A;  5F0U A;  2OEM A;  5DGB A;  4DUY E;  3FFI B;  2JWN A;  5K8M A;  1YJV A;  3TR5 A;  5E3Q A;  1L5U A;  4CP5 A;  3H5U A;  3MCO A;  2IC3 B;  2AF6 A;  3LGH A;  1M1K T;  4QR1 A;  4LQ9 A;  4XK8 C;  2FLO A;  1IJF B;  4DS4 A;  2AYM A;  4Z2X A;  3K59 A;  2GV1 A;  2DY1 A;  5DRR A;  4W90 B;  2XY7 A;  2QMX A;  3DYA B;  1EP4 B;  3HFK A;  4OZN A;  1NHJ A;  4F3O A;  3MED B;  3CT9 A;  1SQE A;  2JEF A;  3T1Y F;  3ITH B;  1KKH A;  4X65 J;  5HVF A;  1F9E B;  3DKD A;  2WOM A;  3MOZ A;  2CG9 A;  4K4U A;  1IWG A;  2CIM A;  5E3P A;  4F50 A;  1H38 A;  3J7A N;  1U24 A;  4DX7 A;  2PA3 A;  2OD6 A;  1KFD A;  4BCA A;  5T7L B;  4JI3 F;  3MAH A;  3KG4 A;  2NXE A;  3MI7 X;  1WHV A;  1UEV A;  1Z4U A;  5HMW A;  5L39 A;  4PWD A;  4WPA A;  2B0G A;  4J37 A;  1M5H A;  4DU7 A;  3KLG B;  1SIZ A;  3CWV A;  2OEK A;  2GJF A;  3HHE A;  1RT6 B;  2HHT A;  2AD9 A;  3GWC A;  1Z5B A;  3EUN A;  4DV4 I;  2VOP A;  3Q8R B;  3T1H E;  4ECT A;  4PU9 A;  1N36 E;  5LMN J;  2JDJ A;  4H4O B;  2W7O A;  4L3K A;  1ZM4 A;  2QTW A;  1T03 A;  3BSA A;  1U09 A;  4DR7 E;  3CB4 A;  4HKQ A;  1YJT A;  4LF8 I;  2DNG A;  4RUB A;  3P4U B;  1BXN A;  1ELO A;  3PHT A;  5C24 B;  1D0E A;  1RKJ A;  3EMT A;  2DHA A;  4DZD A;  2HAF A;  2XYH B;  2Z5E A;  4Q2M A;  2BRK A;  3EXY A;  3GE9 A;  4JV2 A;  4HTJ A;  1FKA F;  2WW8 A;  3UNY A;  5HJX A;  4I6W A;  1LW2 A;  3MAA A;  1YBT A;  2Q66 A;  1U1K A;  3PYD A;  4F4Z A;  1NKB A;  1C1B A;  1CUL B;  2B5J B;  2H9Z A;  5CZV A;  1GFW B;  4CLT A;  4ZCK A;  3RB0 A;  1RWU A;  1F3F A;  5JMN A;  3KNA A;  2PO2 B;  1WDD A;  4WTO B;  4ZHR A;  4A46 A;  2ZFH A;  2CJQ A;  4RO0 A;  1G3O A;  4DV1 I;  4DL5 A;  3QGH A;  5DRK A;  3BSO A;  4F04 B;  4R1F A;  2D3U A;  5K20 B;  5FDL B;  1RAI B;  2CVE A;  3C16 B;  3POT B;  3LW5 C;  3J80 Q;  2GHW A;  4GVB A;  1S77 D;  3HHL A;  1OY6 A;  4WUC A;  1E3H A;  3T6J A;  1YLX A;  2GIF A;  4F2R A;  1VYA A;  1NKE A;  4GKJ E;  3JQM A;  2MMY A;  4OI3 A;  3WBZ A;  1N33 J;  3PEJ A;  3CWJ A;  4DCJ B;  2VBY A;  1HHQ A;  3NNH A;  3P06 A;  1TKZ A;  3OLA A;  1BQN A;  2DRD A;  1H7W A;  4A8M P;  2XMW A;  2VA3 A;  4BWJ A;  2P9G A;  1SIW B;  1HNV B;  3TYT A;  2L3M A;  2FGC A;  2J7U A;  4BC7 A;  1WUU A;  2J6U A;  4LRD A;  1SQG A;  4K4T A;  4X66 F;  1Z2L A;  4ZPB A;  2ACY A;  3G6V A;  3K5O A;  2J7W A;  3DRS B;  2QSF A;  3M6V A;  1NH7 A;  4G1I A;  3GFX A;  4UQG A;  2ZH3 A;  4WJB A;  3NL0 A;  2X1B A;  1FFS B;  1KLN A;  2FQQ B;  4WXO A;  2UVV A;  1YHC A;  5J1P A;  4I64 A;  1SL1 A;  2VIH A;  3FEY B;  1RWP B;  3I5B A;  4JV0 A;  2C28 A;  1M5V C;  3MM6 B;  4AQY F;  2UUW A;  3BSC A;  2Y1J A;  3R5D A;  2L9W A;  3BQ1 A;  1YRT A;  2JLF A;  3U7J A;  3KLE B;  2VPZ B;  2M5Y A;  3A3N B;  3RB4 A;  2PO1 A;  2YNI B;  4OYP A;  2EFQ A;  2QYG A;  4PQA A;  4C7Q A;  1M5K C;  4PZV A;  5EWG A;  1P42 A;  2KM8 C;  2LU1 A;  4DPY A;  3VAL A;  1QZR A;  3KYL A;  3OTE A;  2HBQ B;  5GAG U;  3DGP A;  2XSJ A;  2M52 A;  1NPK A;  5AXK A;  3V6K A;  2DRA A;  2UXB J;  1QAI A;  4DV7 J;  4G1P A;  4TY8 A;  1FRL A;  3DU5 A;  3J80 C;  3P3C A;  3PHE A;  3CCM S;  5F8I A;  5GAH U;  5ETL A;  3GR0 A;  3TJ8 A;  5ETT A;  2XMV A;  2YNH A;  2JC1 A;  1H2U X;  2EK6 A;  4RW6 B;  2WTF A;  2M8H A;  4PXD A;  3A8E A;  4FYV B;  2PD1 A;  3VWS A;  3EYZ A;  3BQ2 A;  5I4M A;  2Z5B A;  4J9V A;  2IYG A;  1U6B A;  3EWG A;  1DJ0 A;  4ALZ A;  1JLG B;  4RL1 A;  2ZWP A;  2HKE A;  2MSS A;  5JUM A;  2AX0 A;  3FKB A;  1X8D A;  4EYI B;  2G9O A;  1HR0 I;  2KXF A;  4H4K A;  2BR0 A;  1Q82 T;  4JI2 I;  4F4Y A;  3VGT A;  3D1H A;  5ETM A;  2XY5 A;  2HNY A;  1SCJ B;  4IR1 A;  1IJE B;  4KQV A;  2V4Q A;  1PAU B;  3OUY B;  4LFA F;  2OPR A;  4M63 A;  2A2C A;  1S6Q A;  1LK5 A;  1NZA A;  4OI4 A;  1J5E J;  3OR2 B;  4LSN B;  1DTQ B;  4YHH J;  2XI3 A;  2FHK A;  3MM8 B;  3H25 A;  2Q43 A;  1S1X B;  2AEJ A;  5CYQ B;  3SXL A;  2DPJ A;  1UWB A;  2B6A A;  3I5C A;  3JTP A;  5CCL A;  4FPR A;  3CD7 A;  4G65 A;  3I82 A;  1R7I A;  4LBP A;  3MUV P;  2RD5 C;  1N6Q B;  3RW7 A;  1IQT A;  4O3Q A;  2JLE A;  3HSZ A;  4A8W A;  3F0N A;  4KFB B;  3PO5 A;  2QLF B;  1HQ2 A;  3W61 A;  1LWE B;  5IWA E;  3CD0 A;  1OPZ A;  3OTC A;  3RBX A;  2P8I A;  4DV2 J;  3VAM A;  4F4X A;  3PYG A;  5AT1 B;  1S16 A;  4J9L A;  3LP2 B;  1UJ5 A;  4TU8 A;  2UV8 G;  4DV5 E;  3M85 D;  4DR3 J;  1Q79 A;  2HGN A;  1WF2 A;  4ZPA A;  3CJ3 A;  4OV1 A;  1UFL A;  1YIT S;  2VQE F;  2KT2 A;  3T1H F;  1RWN B;  1N36 F;  3MUM P;  5A0Y A;  4WK3 A;  2OAU A;  1O0P A;  4DR7 F;  5DRP A;  2VPX B;  3DLE B;  1WC5 A;  2ROG A;  3HVT B;  2V2Q A;  5KFU A;  1KVI A;  3PYF A;  1UVL A;  2HBZ B;  3R6G B;  4YDX A;  4X65 I;  2