1K47A

Crystal structure of the streptococcus pneumoniae phosphomevalonate kinase (pmk)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
322
Chain Sequence
b'HMMIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQSFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphomevalonate kinase
publication title Crystal structure of the Streptococcus pneumoniae phosphomevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Streptococcus pneumoniae r6
molecule tags Transferase
total genus 102
structure length 322
sequence length 331
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2001-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1k47A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1k47A01
4ZVIA 5LL6R 4X62I 4JYAE 4DV1E 4USMA 5GMDA 3JAMC 4JI6I 1J5EE 2R42A 2UXCE 1FWLA 4DPYA 4LFBI 4JI1E 4B3TI 1HNWE 1A6FA 3JAMQ 1XNRI 4DV5E 4JI8I 4B3RI 4ED4A 4YHHI 3ZZTA 4LF6I 1I94I 4LF8E 3J81C 5A2QC 1H72C 1HNZI 2V8PA 1ZM4A 4URLA 4LFAI 1IBME 4DU8A 4NXNE 1Z0EA 1Z0VA 3J81Q 5A2QQ 4JI0I 1RREA 3V5RA 3F0NA 3LPSA 4UT4A 4LFCE 1Z0CA 4DU7A 2HFSA 4MYTA 1KTVA 1IBLI 4YY3E 4FWHA 1N32E 4AQYI 1Z0TA 4B3MI 4DV2E 4K0KE 2BM1A 2Q2EB 4DV4E 4FWGA 4DR2I 3D4JA 1MG7A 4RPFA 4LF9I 2V34A 1N33E 4DV3I 1EI1A 3QT7A 1NHIA 1MU5A 4X65I 1FJGE 4JI5I 3PYDA 2VQFI 2CZ9A 3T1YI 4DR3E 1H7UA 2NPFA 2HHHI 2UU9I 1H74A 2OI2A 3B78A 3T1HI 1QZRA 4X64E 3B8HA 2ZM6I 4DPWA 4GKKI 1ZXNA 2V2VA 1ZM2A 3OTOI 1N36I 4DV1I 2WW4A 1HR0E 2AJ4A 4DR1E 1VISA 4DUZE 4FW9A 3ZM7A 5BR8E 2R3VA 4DV0E 1U2RA 1XMQE 2UXDE 1Z5BA 3CWVA 5GMEA 4DUYE 1DARA 4USKA 2J7KA 3J7AM 4JI7E 1H73A 4JI4E 2UUBE 4R1FA 2X36A 4OX9E 2HKJA 2DEJA 2F4VE 2VQEE 4LF4E 4YY3I 2V2ZA 3K1JA 3WU3A 4Z7CA 1EA6A 1NZ0A 4DV4I 5IT9C 3Q1QA 3PYFA 1XNQE 3ZZUA 4GKJE 4JI3I 2ZBKB 4DR4E 5IT9Q 2BV3A 1XMOI 4X66E 4DV6E 1MX0A 4PRVA 1KKHA 4X62E 4JI6E 2HKEA 4B3SI 2UUAE 4DR7I 4HACB 4NXMI 4LFBE 2V2QA 4B3TE 2UXBI 3ZKDA 5IWAI 3GONA 1XNRE 4XTJA 4EMDA 1NHHA 1Z5CA 3V2UC 4B3RE 1N34E 4LF6E 4DR6I 5LMUI 3K17A 1I94E 1HNZE 4P7AA 4LFAE 1IBKI 4DR5I 4P52A 2A2CA 4PU9A 4DPUA 4DR1I 4PRXA 1FWKA 1N0UA 1IBLE 4AQYE 4DV7I 5FLXC 4B3ME 1KIJA 4JI2I 1S4EA 1PKPA 4KHPI 3PYGA 2E5LE 4DR2E 2GS8A 1B63A 4JYAI 3LNUA 4LF5E 1NHJA 1J5EI 4LF9E 1UEKA 2UXCI 1ZM9A 4HY1A 4JI1I 1HNWI 4DV3E 1ZXMA 2HK3A 1Z0WA 2LJPA 2VQEI 4DV5I 4LF4I 1D6TA 4WUDA 4X65E 1XHKA 3WU5A 4LF8I 4Z7YA 1RR9A 4JI5E 4JV5E 4FN5A 2VQFE 1Z5AA 3T1YE 1IBMI 4NXNI 4LF7E 2HHHE 2UU9E 1B62A 3T1HE 3J80C 2ZM6E 4LFCI 3LTOA 1HNXE 4GKKE 1N32I 2VF3A 3J80Q 3OTOE 4DV2I 1KVKA 1N36E 1PVGA 4K0KI 2UUAI 4JG4A 2A2DA 2EFGA 3ZKBA 5LMNE 2DEIA 1BKNA 2UUCE 1N33I 1N34I 4DXLA 1Z0GA 4MYUA 2XEXA 2HFUA 3QT6A 3WU6A 4I3HA 3J7AG 1FNMA 1FJGI 4UTGA 2X7IA 4DR3I 3PYEA 4KQVA 4DPXA 4JI8E 4YHHE 4X64I 3QT5A 1ELOA 3H4LA 4DPTA 4WUCA 2E5LI 1ZM3A 3QT8A 4JI0E 1HR0I 4DUZI 4LF5I 4WUBA 1FKAE 4JI3E 5BR8I 5L3JA 1XMOE 4DV0I 1XMQI 3B82A 2UXDI 1FI4A 4HYMA 1K47A 4B3SE 4DUYI 4DR7E 4NXME 4JV5I 4HACA 4M1KA 5FLXQ 2UXBE 3HULA 1WUUA 5IWAE 4JI7I 4LF7I 4JI4I 2UUBI 2E1RA 2ZITA 3WU4A 3M6AA 4DR6E 5LMUE 4OX9I 1OJ4A 2F4VI 1HNXI 1IBKE 1Z0BA 1PIEA 2BM0A 4HXZA 4DR5E 1N0VC 1XNQI 5LMNI 3ZZ0A 4GKJI 2UUCI 4DV7E 1S16A 4DR4I 1Z59A 4JI2E 4KHPE 1H7SA 4X66I 4DV6I 4FWDA 2HK2A
chains in the Genus database with same CATH superfamily
1HW9A 3JSMA 2GNKA 3LALA 4LIWA 1URNA 4RWXA 1FWLA 2EFPA 5HJXA 4PXDA 1VRTB 2ADBA 4BBYA 1W2BR 4DL6A 1RWNB 4TNOA 1CBKA 3HKZD 1SL1A 2F1DA 4LFAI 3OUYB 4P2SA 1LWXA 3HM9A 2ZHBA 4K4SA 4I0WA 3V5RA 4HHJA 5B09A 1RUSA 2Q3PA 4DUYJ 5A6WA 1YGYA 2BW2A 4B9VA 5EX0A 1RT3A 2QLBB 4ZJQA 1A9NB 3NOGA 2EK6A 4CT8A 1NJZA 3MAHA 2ZM6J 4I2QA 2FHJA 2R7UA 4J5OA 4KTQA 1U0HB 4DQPA 4ES1A 3K2YA 3A3PB 2IESA 4AIMA 1YRXA 3DKDA 3VALA 1FDBA 1FJGE 3PYDA 2FJXA 5HATA 4RX6A 4KGZB 4OZJA 3EGNA 2FGCA 3DLGB 2GVZB 4M5KA 4QIGA 4GRSA 1RTZA 3NBPB 3OTOI 4NYOA 4U9RA 2DXEA 4Y2MA 1VISA 4NLYA 4FYWB 1HI0P 2NXEA 3I32A 3IGNA 2DHSA 3W7BA 2NZCA 1WC1A 3OL6A 2MYFA 3CJ8A 2PO0A 5AXKA 4USKA 4AE5A 1D3WA 1ZH5A 3VCDA 3J7AM 3BM7A 2GQCA 3LPEA 2BBEA 2X36A 1IR0A 1OIAA 2DEJA 2RUSA 3W3SA 2CQPA 1YITS 3K1JA 2YPYA 5C24A 4AD6A 5G0RA 1W2IA 5KFHA 5IWAJ 4IR9A 3RUBL 1MN9A 2PNLA 3D0IE 4DV3J 3N5BA 4IO1A 5CD4A 5JUMA 4HEA9 4ED0A 5A0YA 2RD5C 3M6XA 2DGXA 3CD0A 2UU9J 4DV6F 4PUOB 1SUQA 4CYUA 2GVDB 3UCGA 1U26A 3SZ2A 4I67A 3DDKA 4A46A 4MH8A 3KLEB 3C16A 1LOUA 2MZRA 2JEAB 2CJKA 2D7SA 1IBKI 3QLHA 4KT0C 2C2NA 1D9DA 1F9EB 3M6VA 4I64A 2QLFB 3BS9A 2G9OA 5DROA 2DH7A 2GO3A 1TL3B 2HWTA 2CGEA 2RKIA 4OX6A 5FLXC 3PYGA 1DLOA 1RWXB 3AJ1A 1UDSA 2E5LE 4CLYA 5LSOA 2GS8A 2C2KB 5ETVA 2EFQA 4HT5A 5B0DA 3BEGB 3O44A 2JLEA 2R2UA 1ZTTA 4CDIA 5D4PA 4DV4J 1H38A 1N5QA 2ZJPQ 1FO1A 4CTAB 1VC5A 5F8JA 3HT3A 2K3KA 4A4JA 2VQFE 3OQ2A 1Y4UA 3EPIA 2YX4A 4Z2XA 5D6GA 2LKZA 3UNYA 2DCUB 3H4BA 4DS4A 2AKWB 2UVRA 1VRUB 3SV3A 1JWWA 4TY9A 1KVKA 3N5FA 2ZM6F 2KYZA 2XGQA 4DX7A 2JC1A 3K59A 2DJWA 1HWIA 8RUCA 3MHYA 5GADU 1HD0A 1EB0A 3E8OA 4N8NA 1IKXA 3J7AG 1FJGI 2EPIA 1EQMA 1FXLA 3NL0A 5HAOA 2UUTA 1HNIA 1MWZA 4EZ9A 2DYAA 5K9FA 3CC7S 1X5OA 1MROB 2AJ0A 1XR5A 3M85G 2E1AA 3CJ5A 4IFDE 2AV5A 5J2PA 1F5AA 2NREA 2V68A 2JJ4D 3I0SA 3ZXWA 2YWHA 2M8DB 4BWJA 4MU0A 2BANA 4PCQA 3KLHB 4ZN1A 4E2FB 4LOMA 2C22A 1X7VA 1WHWA 2BQUA 1AUSL 4ILLA 2IYIA 2ZITA 4K4TA 5IWAF 2OTJS 2C3YA 4DR6E 1BQXA 2NN6D 1W25A 4C0OC 1YX2A 2R7QA 3M8PB 3P3CA 3I9V9 3WBZA 1VQNS 1UAWA 2BJ7A 2JX2A 3PEJA 4DQRA 3QQCD 2B9XA 2RJZA 4DFPA 5H9EJ 4QYZJ 3ULHA 2BA0G 4IFDA 2AIRB 2ZOMA 4O0IA 3GU0A 3Q0AA 2MSSA 2XULA 2R7WA 1KQSR 4N7TA 2DRAA 4BS2A 1P27B 3HVWA 3TUPA 5GMDA 4CRJA 1S59A 3GIKA 1R0CB 5EKWA 4DPYA 1FE4A 4QR2A 2DT9A 1X60A 3GYXB 4ZP7A 4IDKB 2F9JA 5JJBA 1P42A 2YKAA 3QJLA 1USUA 2OEMA 5A2QQ 1RKIA 4YQWA 2JRSA 4IRCA 4PYDA 2BVZA 2FVPA 1OYPA 2BA1D 3T1YJ 3DLHA 1T9UA 1UCNA 4WBFA 5CYQB 4LF7J 2MZTA 5KFTA 5L38A 3H5UA 2CVEA 3MEKA 1RADB 2J6SA 2P6TA 3M6WA 5IZHA 4DV4F 4TY8A 2I0XA 3SQGB 2HS4A 3AOAA 5DQIA 5JEAE 4J9PA 2FJAB 3TAPA 5K36B 1JB0C 2Z5BB 4DSFA 3WZ0A 1RKJA 2VQFI 4F0KA 4FW5A 2XB2D 2UUWA 3TEHB 1S1UB 2AGQA 2IDLA 2RQKA 5HI7A 1RU2A 4QU7A 2BJ8A 4PYAA 5KFCA 1M5HA 4NOHA 4DUTA 4FW4A 3OVAA 3NXZA 2G0CA 5D0GA 3N6NA 3PX0A 3DRSA 1T05A 2GGPB 3KNAA 4DR1E 3JAMU 1UVJA 4DUZE 4JI8J 4FW9A 3PNIA 3DRYA 3BO4A 2V8GA 2VA3A 1GTEA 4UOCA 1S1XA 2E9ZA 1NHUA 3F44A 4LT6A 1U1NA 1RBOB 3IFEA 3VZHA 1RISA 1SH3A 4CM0A 4OI4A 2UVWA 4RU9A 1RAJA 2UUBF 2MPUA 4LF4E 1P8GA 1X9SA 3P5BP 3M1VB 5D4LA 1SIWB 3D5MA 4RNOA 3GV7B 2ZUGA 4BWMA 3IWNC 1YG0A 4CM2A 5E2QA 2POKA 2PO1B 2L9WA 4X66E 2VBYA 1Y5IB 1NKCA 2PMZD 1S6UA 2GV1A 5JXSA 2YNIA 1N5TA 2RU3A 4V1Ak 4EK2A 2ZVSA 3W5YA 4DR6I 4DV1J 4FYDA 3FVYA 3JXOA 2YTCA 1ZZFA 5KG6A 2QIFA 4DJBA 4USUA 1WACA 1ZBTA 3LP2A 2J76E 3R6GB 4G6VB 4P73A 4QCLA 4QYZK 3KKFA 2XS7A 4KO0B 4MK9A 1W26A 3AOBA 4AFFA 5HROA 4P2XA 4PXBA 3N9UC 2V94A 4HYKA 3LNUA 3G8SA 2A10A 3G2XA 5I3QA 3TX8A 3H42A 4ED2A 2CQBA 1NK9A 3AA8A 4HY1A 4NE9C 2HQIA 1S9EB 3IGVA 4LF9F 3TA2A 4B9SA 3AXKA 5KFSA 4IUFA 1TFYA 3TARA 3W8PA 4J9VA 5ETRA 2AU0A 3C3LA 2U2FA 2ZE2B 4ZHRA 2HVZA 1Y5LB 1X4CA 1XEZA 1Q8IA 3T1YF 2IJNA 4WP9A 1F60B 4LF7F 3IA0A 3U1YA 3T6BA 1SQFA 1ZOTA 1SC3B 3G82B 1R7IA 2AE8A 3B4DA 4LSLB 3L7UA 2W2OP 3QAUA 1LNQA 2RNEA 5LMNE 2DISA 1C0TB 3VVTA 2EK1A 1FXRA 1M1GA 4DXLA 2D3UA 2PN6A 3OPKA 1AUDA 3PRVA 4JUZA 7FDRA 3SI8A 1O51A 2DGQA 4XPCA 2E1CA 5CD4H 3EZOA 2C38A 1W7WA 4A47A 5KG7A 3CXCR 1M1HA 2CQ1A 2FUG9 3PYEA 2BE2B 3EDQB 4FXWA 4USVA 4YHHE 4EO8A 2CPYA 5CYJA 4GVBB 3HHLB 4JI8F 2HRTA 4O3QA 2X51A 1N6QA 1BMQB 1ZA2B 3FRZA 1VQSA 3QT8A 4DUZI 4K7QA 4DQIA 1Y5YA 2ZH6A 4EU0A 1RT1A 1XMOE 3ZTSA 4FKXA 2GMHA 3A8KA 3H5YA 2RU9A 4LBIA 4PRFA 4QIVA 2HBQB 2YQ3A 3K5MA 2HYIB 3A3OB 2WTFA 2D1CA 5E0OA 3B54A 5AXNA 4OLOA 2DPIA 1FT8A 4X62J 1LQ9A 4JI6J 5KT3A 3M2UA 1TL1B 4ED3A 1YK9A 2RB7A 3MXHP 3RBEA 2VUGA 2VG7A 3R7NB 4I1TA 1E6VB 4C8KA 4NLOA 1FNXH 3GIIA 1K9MT 2CJYB 3DLBA 4X66I 1WD6A 1VFJA 2DNQA 1U2FA 1ITPA 5CYMB 2FJWA 2NS1B 1ZAVA 2R42A 2N3LA 1Z4UA 1S48A 1XQIA 3BV8A 4DV1F 2ZC3A 4WKYA 1A6FA 2J8SA 5ETSA 3C6UB 1Q1KA 2CQCA 3CEDA 4EBEA 3V81A 1UFLA 5H1SV 1MWYA 1SBRA 1R8HA 1Z0VA 4YB5A 5DZ6A 1T0TV 3HSZA 4TQSA 4F50A 1UDOA 4K8RA 5CAAA 1PJ6A 2P2CB 3MM5B 1UA0A 3CTRA 1DFDA 3T1HJ 2BM1A 2HQDA 1PJ5A 3MEDA 1MG7A 1LWCB 5A8RB 2PO2B 5H9FJ 5ADZA 5K36F 2FB0A 1N36J 4RW9B 2W2MP 2AW0A 2X3GA 3LP1A 5KOWA 1Y5NB 1X5TA 4MFBB 3BGUA 3BREA 3GE9A 3OR2A 2J9EA 2DO0A 1S6QA 3R27A 1HMVB 2OI2A 4ANCA 3OXLA 5F3ZA 3HDSA 5DLGA 4FW7A 5C0XC 3M6UA 2R8HA 5HBMA 3AD7C 3KK3A 1FKOB 1DZ5A 2C3PA 3IS9B 1K0TA 1FKPB 2YX1A 4OI1A 3RU0A 4HDGA 2OPQB 4DV0E 4EEYA 2GC8A 1PYOB 4ZIWA 2CJBA 1CS4A 2LQ8A 4JI0J 2XY5A 1K44A 1FRHA 1S0OA 4AL5A 1FRKA 4X4QA 2C2ZB 4FYXB 3L4BC 2W9BA 5C2GA 5HLFB 5LM7E 3ILJA 3ZZOA 2ZDPA 5FDLA 3H2LA 1UVMA 1Y6ZA 3ENAA 1VI7A 3DRRA 4LR8A 4QZVB 2IVFB 1F5CA 2PA3A 1T03B 3AQPA 1T7PA 2DNMA 2AT1B 2ASDA 2ROPA 2VJVA 1UVNA 1GK8A 1YZ6A 4FNIA 4NRUA 4DL2A 1P9QC 1XMOI 2E44A 3IXQA 2CNNB 1NXIA 4RBVA 2NCKL 2QSWA 3QMQA 2DR6A 4X62F 1HA1A 2PNZA 4JI6F 4YFUA 3IO1A 2CPIA 3M8ZA 3G6ES 3UFCX 4QYRA 1UWBB 2ILYA 2QLXA 4R0EA 1D09B 1KEKA 3M8QB 4JYAJ 2DGTA 3PM9A 3UW1A 1XWLA 1IKYB 3KLGA 3M85D 1HNZE 2CQ0A 4DQQA 5E3QA 5FIIA 2WONB 3BO2A 4KH1B 4CH7A 4UZCA 3FQKA 4FS1A 3PJWA 3N01A 4E98A 4WFZA 2RILA 4UUWA 2ZH5A 4F3QA 2WBMA 3QO9B 2FJBB 4I69A 2KXHA 3IBFB 4ZP9A 1UZHA 5IOLA 1RT2B 2CPJA 1HBUA 1WG4A 5IXUA 3TP2A 2IM2A 1S0VA 2H3EB 2M8HA 3FK4A 3D7SB 4FN5A 3SXLA 1Z5AA 4V19X 2W7OA 1RWUA 3E3XA 1R6YA 5KFPA 3EZ5A 1FXDA 3TANA 1KS2A 3MMCA 2FQQB 3T1HF 3D0HE 5E33A 4FF3A 2PGCA 5K8NA 3LW5C 2KN4A 3J80Q 1FJEB 2HBZB 2HHXA 3DOMB 2MZJA 4H4KC 1H3DA 2BZ2A 1N36F 3QIPA 4AXJA 1C1CA 1WORA 2E5JA 1IKWA 2N7CA 4LRFA 4O4GB 4QIFA 4K4ZA 3WU6A 5BR8J 4ID8A 3CCQS 2Y3YA 1UWAA 3Q8QB 3HKWA 1S7IA 1CSJA 3ENWA 5FLXY 1XC9A 4K4VA 1X8DA 3KG4A 5HMXA 3EX7B 1FFGB 1S5ZA 2FJEB 2HBYB 3EVWA 4EWTA 2AJ1A 2C2OB 3HCXA 2VQEJ 1CJTB 3CD7A 5L1IA 2K3IA 2Y8WA 5A8KB 4JI0F 3IM8A 2VOOA 4DV0I 3WX4A 3GTYX 1UEUA 1U1KA 4B3SE 1YVFA 3ELHA 3LGHA 1UFWA 5DDPC 3IG1A 5IC6B 1SB6A 5ETKA 2ZHOA 5FLXQ 3P4UB 2L9NA 3ITHA 1WDDA 2X3DA 4ZVEA 1EIYB 1H6KX 1X4DA 2MHNA 4RW7A 3VGTA 1OQ6A 4ISAA 4RJVA 1N5YA 1BLUA 4P6QA 4WFXA 3P45B 1AFIA 2CJXB 1BY9A 3WHIA 2ZBRA 1ZETA 2IIHA 2HS0A 4LFAJ 4C8LA 3D6TB 3L9ZA 1JXLA 1H7SA 4NLRA 2HK2A 4HHHA 1RT3B 2VZ9A 3W60A 2Z56B 2AEMA 4OX7A 4JYAF 4JI1E 2JEJA 5C0XA 5FWKA 3NKYA 3TUIC 4LRBA 2PSZA 2Z5EA 1JLQB 4Q44A 4ED4A 4R25A 2CDQA 1S57A 4LF8E 2W4CA 1HNZI 3UQSA 3PRBA 3BO3A 1OY8A 2CKWA 4X2BA 3BKUA 4RUCA 4IZKA 3DLKA 4ZCIA 2K2PA 4CLPA 1LKZA 3HMJG 1KLNA 3KJQB 1JIHA 1G2EA 2DKOB 3QZ7A 4AXIA 1S7HA 1CJUA 1RTHA 4PXEA 4EFAC 3LPYA 1ICEB 3K5NA 3OTOJ 1VQKS 2HAIA 3CDJA 1M5KC 2WZ1A 1K1SA 2JVOA 3HHKA 3W2WB 4F8RA 2KZMA 4TQRA 3PW5A 2PO0B 3BYRA 3DGVA 2PFDA 1WC4A 2CJQA 3OL8A 4PG7A 5HMWA 2WAQD 3W8GA 1OPIA 1MMDA 3B78A 4DOZA 1QZRA 4NLSA 2CZ4A 4NWBA 1FHTA 4O3RA 1ZXNA 5CCMA 5E3PA 4IO9Q 3FUYA 3QJPA 2RS8A 3QFHA 3DOLA 2YWWA 4C8OA 3V6HA 2DNHA 3UVJB 2V5HG 1HR0F 2R3VA 3L3CA 1S99A 3J81j 5BR8F 1X4GA 1TKXB 4DUYE 1NH7A 1B3TA 3GR1A 2HHSA 4OI3A 3MF5A 4A8SA 4NEYA 4R1FA 4FW3A 5I3UA 4ES3A 3CJ4A 2W9CA 4Q0BA 1VBKA 2ZH2A 2YWKA 3FMBA 4Z7CA 1YRUA 2VQEF 5T7LB 4DSLA 1Y9OA 3QLHB 1NSKL 3TUJC 1UJ4A 1B70B 1PGZA 3AOCA 4KV8A 2QGFB 3PJ9A 4RW4B 1IBKJ 2IBOA 4XK8C 1HQEA 3THTA 4PRVA 3U27A 1S1WA 2ZBPA 3CMQA 1DLOB 4WK3A 4B3SI 1KRPA 3BH7B 3S7RA 3T5HA 5AE3A 2W4PA 5M2PA 4FXVA 3FNNA 3NGDA 3CMAS 5LL6d 4TU7A 4WU2A 2YNHB 4NZ6A 4USIA 3OLAA 3PR4A 2HNZA 4QOTA 2Z0GA 1QE1B 1UVKA 2XLKA 4PRXA 4JP8A 4LFAF 2MKJA 2JDJA 2C3OA 2XSJB 5DRKA 1S6PA 5BYRA 1LXNA 3HSDA 4XDCA 1PKPA 5ETMA 2KZZA 1T9XA 2H5EA 4ZLLA 3PS3A 3I4HX 3LGMA 4FYYB 2C2RA 4F67A 2M5YA 2E7WA 4ECWA 2GMJA 2BJDA 5DDQC 3EPGA 1NJIT 4NLXA 4JI1I 3NGRA 4DV3E 4X4TA 3OV7A 2WP8A 3R5BA 2QRRA 5KFFA 3HLUA 1BXNA 2RT3A 1PO6A 4WUDA 4LF1A 2Y0BB 4LF8I 3DMJB 2R8KA 3TYTA 2UU9E 1Q95G 4C8MA 3AT1B 4IKAA 2K7KA 2UV8G 5CABA 1FJGJ 2XO7A 4NXMJ 4EBDA 2DHHA 4ITSA 4F3OA 1PVGA 6FD1A 2MDAA 5KFZA 2ZNYA 4JG4A 3OTOF 2KXNB 3P06A 4C3MA 3ILOA 3QRQA 5HMZA 5RUBA 1NK8A 2AZ1A 3DI6B 3P5TL 1LK7A 4FBUA 1Y00A 3MDFA 5EUHA 2BJEA 4XAKA 2D3O1 4K2XA 3KJVA 2IA6A 1I5OB 3JQMA 3CSKA 2Y1IA 4HKQA 2R7TA 3FEYB 4F04B 4DPTA 2I9SA 4WUCA 3JTNA 4A8WA 3N79A 4WE1A 2QLJB 2J5AA 1TMJA 2G2ZA 4QW9A 3GLLA 3TNVA 3MAAA 1BQMB 4NZ0A 3MR2A 1NMEB 1D8YA 3K57A 2CPFA 2GIQA 4IFDB 3EVMA 1IBMJ 4IH5A 2B56A 1N5VA 4G1PA 4DUYI 3TZYA 4DR7E 4ETXA 4DZDA 4HR2A 2Y1RI 1WUUA 3KOAA 2ILZA 3AA9A 4S0MA 1JLAA 1IJEB 2OKQA 1AZSB 2MQLA 1U8SA 3ZZYA 4B17A 3NGSA 1RA6A 1IBKF 2CNKB 4I6AA 1RHRB 2PI4A 1M90T 4JI2E 1EHWA 4ZVIA 4M5JA 3M2RA 1Q53A 3M30B 3PTWA 1XJWB 2VICA 2DB1A 1SKRA 2E9TA 1OY6A 4M8LA 1HHSA 1JLFA 2W8LA 1I3OB 2V4RA 2E5LJ 2PD1A 4N3OA 2C42A 3CCES 3MEEB 1FDDA 1OS5A 3PX6A 1RACB 4RZRA 2H48B 1NKEA 2HFNA 2UXDJ 2R8JA 2GHWA 1QY7A 1IN0A 1VQPS 2NN6C 1VHIA 2B6AA 3LP0A 3Q83A 3NG8A 4YY3E 2X1GA 2VQFJ 2GIRA 2KT2A 3M9OB 3RZAA 3C46A 2BE7D 4OO1B 1TZ0A 2X1BA 4KBIA 4OLPA 3JB9k 4KKOA 3MEGA 4OYBA 2XG8A 2O1VA 4CI0B 3P96A 2ACYA 1GXUA 4UOFA 2FY1A 4DV3I 1RA7A 3T1AA 1IM6A 3U1LA 5KFKA 4LVOP 2XMMA 1D9FA 1ZPWX 1EJ7L 3VGVA 2CWKA 3MM7A 2IBKA 3NNAA 4ZLNA 1RAFB 3E51A 2XTJP 1H7UA 1FJGF 2UU9I 5JEAB 1SH0A 2Y8YA 2XS2A 3ICLA 2E66A 1EX8A 1LWFB 2AJ4A 4YP3A 2MMYA 8AT1B 4PG5A 3HHLD 2DTJA 1Y60A 4GC6A 3R8YA 4MK7A 1PJ7A 1V9OA 4OJ1A 2XNQA 4FF4A 4WKRA 3ZFVA 2ZKUA 1VLOA 3G6XA 4IZJB 3L09A 1JNRB 2DHGA 1U48A 3IC1A 2BA9A 5A2QU 3GYNA 4KGMA 1C2PA 3EYZA 1S9GA 3MM6B 4ICLA 2GO8A 2EKNA 1KLMA 5ETOA 2BABA 3WIVA 2F4VE 2JZ5A 1UJ5A 1LK5A 4MJKA 2PEBA 1X5PA 2Q6BA 4DV4I 2BXJA 3Q1QA 5GVQA 4DBQA 4BC7A 5B0EA 5KT2A 4M5DA 4UW2A 1FD8A 1OYRA 2YQ1A 3MI7X 3QYYA 1XTZA 3JSRA 3NWGA 4GC7A 1RTJB 2VBZA 1R0BG 3P3GA 5HROB 4DR7I 4UQGA 2OEKA 2B8QA 1U6BA 2Y9HA 4QR1A 1IR2A 1N34E 4LF6E 3FRYA 3UE2A 2KM8C 4CO1A 1U09A 1CULA 4NA2A 5EDWA 5BYQA 4JV2A 3MOZA 3NOCA 1HWKA 2M4MA 2VPYB 2NZ4A 1UPMB 3THPA 2OMOA 1HFEL 5LJ5Y 3ZNUA 4JI2I 1R89A 4P2MA 1N5SA 3TEGA 4U8VA 5KT5A 4DR2E 2P9GA 2OPRA 1IWGA 1X9MA 1NHJA 2E5LF 2C2EA 2COLA 2XO6A 1D6TA 3Q24A 2BKNA 1XHKA 3WU5A 4JI5E 2DH8A 4JV5E 1U47A 1NRKA 1S1VA 2VQFF 3CW2C 2XMAA 1QAIA 2FVQA 2JL9A 2MLYA 3RB6A 4J90A 1A7GE 4ECSA 2BE9B 2NPIA 1DTTB 2EFGA 3C14A 1YKWA 5C7PA 2NN6E 3C6TB 2VH7A 1L3KA 2GJFA 5F8HA 2CADA 4DR1J 4DUZJ 2FZGB 1S1TA 2JEGA 3Q8UA 3BGRB 1BHNA 1Z1ZA 3D1OA 4IG3B 4UTGA 2X7IA 3GJSB 4KHRA 3MGJA 5C25A 2VG5A 3TVYA 4ZCMA 5L8RC 5MAOA 5KFVA 1NDCA 3NAIA 3JYTB 1WI6A 3MMJA 2E5GA 2W2NP 2DRDA 5F8GA 5KFXA 3AHPA 2DPJA 1LW2A 4IFDF 4C4WA 4LF4J 4DPOA 2DNNA 1QTNB 5L3JA 4X4VA 2XMUA 4ELUA 1RTIB 1JLEA 4I56A 3CO9A 1WKLA 3EZUA 2NN6A 1JJ4A 3HULA 2J6TA 2YPZA 4LF7I 1TV6B 1FERA 2Z5CB 3WU4A 1VOMA 2O1UA 4DG1B 2J6UA 2F4VI 1RBAA 2NYIA 1VRQC 2FLPA 2KB2A 1SQGA 3SDEB 5L1JA 3CO0P 1Q8KA 3FQLA 4B3OA 2CA9A 3MD1A 1X4BA 1FEHA 3CJQA 1S16A 1RT7B 3NWRA 5KFGA 1RAOA 3H2VE 4FWDA 4PQUA 1FK9A 3OW2R 5EGYA 2A6OA 2GQQA 4USMA 3JAMC 3FFIA 1TELA 2UXCE 3MEDB 2K7JA 4G1QA 2YH0A 1WOSA 2F1FA 2MKHA 3MECA 1B0PA 2Z2LA 4ZIVA 3MPUB 4JI8I 3SEOA 2O67A 1RLDA 4LF6I 1CPZA 1FA0A 4CLZA 3GWCA 3NNCA 1HI8A 3OR2B 3J81Q 4QR0A 2HNYA 4O23A 5GAEI 2IM3A 1Z0CA 2FC9A 1VQMS 3IR5B 1FFWB 3CVKA 3FJ2A 3KK3B 4DR2I 3AY0A 4UY85 1U6FA 4HLBA 3IM9A 1QVGR 3MAQA 2KL8A 4DL4A 3PHTA 4DCOB 2VFSA 2C2DA 3BYPA 1CS4B 1U8WA 3PR5B 5LMNJ 2VKRA 5JEAF 2OO4A 2FVRA 4JI5I 3TJ8A 3VAFA 2Q6CA 4OI6A 3RYLA 1FJCA 2KDOA 3OHAA 2MQOA 3J7YU 2O5DA 5HO4A 2YH1A 2ZBQA 3A4TA 3FBCA 4DV1I 2DITA 1SJ3P 2J9DE 1AXQA 3DRRB 4YHHJ 4B08A 3WX8A 4DR1F 1GX5A 4DUZF 1U2RA 1XMQE 3C15A 2ABYA 3JTPA 3DDNA 1UDNA 2R8GA 1WJ9A 4ZVQB 3NRBA 9ATCB 4KQZA 2ZH1A 1WC0A 2IDEA 2EXUA 1XMOJ 1EP4A 2W2QP 1GAOA 3DCAA 1BQNA 3QAEA 3OLBA 4PWUA 3R3TA 2A18A 4FKYA 4LF4F 4QU6A 2ZC4A 2PO4A 3CNQP 2JEIA 2NXUA 3CJKA 4IFYB 4J3DA 1VBXA 2FVCA 2DGUA 5IT9Q 2KG1A 2HZAA 3FCWA 2J9DA 2QT7A 4X66F 1RXOB 2OSRA 1SKSA 3R5CA 2ALYB 3R7BB 2VODA 4HACB 4PG4A 4MDTA 2VG6A 4A8FA 4F2SA 4EMDA 2MZQA 1YTYA 1SV5B 3UNGC 1HBUB 1H2TZ 4ZPBA 1HBOB 4BC9A 1C0UB 3M32B 3SCIE 1C4CA 4J37A 1AYEA 2VDIA 1CJKA 2ZH4A 1VMBA 4BA1A 1HLWA 3BBFA 1IM4A 3RGIA 4RBTA 3C66A 3TWZA 3D2WA 2DVIA 4N47A 4FVMA 2QL9B 2HAFA 1LXJA 3QZ8A 4LF5E 4C11A 1HWJA 2UXCI 1ZM9A 2JFKA 4QPXA 5E7OB 4ZVUB 3CCUS 2JEBA 2ROEA 4Z7YA 1B0VA 2FHOB 2B4OA 3CDIA 1CJVA 2KG0A 4DL3A 2IVMA 3U1NA 4OI0A 2HHHE 4ZVTB 2R7SA 1B62A 3G6VA 2VBWA 3C2PA 4QWAA 5DNLA 4Y65A 4YN3B 2OGUA 5GADI 2DNKA 3NEKA 3LF0A 2Z2MA 3KHHA 2IM1A 3M05A 4YMEA 4ID5B 2OPPB 2N82B 3QGGA 4LSNA 4FNHA 4HVZA 4ANEA 1NH8A 2EEYA 5EWEA 5A76A 4DSEA 5FD1A 5LMNF 2C37A 3TAMB 1TUGB 2K1RB 3H2UB 4J9KA 4I3HA 1RT4A 3K85A 3IG1B 1FNMA 4DV0J 2OFGX 5C42A 4DPXA 2FZKB 1UMJA 2M0GB 4ZLJA 2L08A 2OSQA 1WOOA 3D67A 4YHHF 3U1MA 3GV8B 3BGLA 3K8VA 3KG0A 2RDIA 1CEZA 2CG8A 1KVIA 3OFEA 1JX4A 1XMQI 1XMOF 4W98A 5J1EA 6AT1B 1HIYA 4DLGA 3VQTA 2FHMA 2MZSA 1IXKA 1UL3A 3J80U 3CCMS 1RT6A 2GJ2A 3M9MB 5DZ7A 4AYBD 4P7VA 1HBNA 1HBMA 5LSRA 3RW7A 1HNZJ 2VONA 3HJFA 1REGX 4IZKB 4RW6B 2OAUA 3HSJA 3IRXA 3GPAA 3H20A 3KK1A 2HZCA 1AROP 3OR1A 3M8YA 3EWGA 1RCXB 3LA0A 1HNWE 1RTDB 5HP1B 4OZEA 5L1LA 4J9NA 1UP1A 1HYSB 4LUBA 2AYGA 4ZVHA 2YQ0A 1Q0NA 4JI0I 4Y0FA 2GMLA 3RRHA 3VAIA 3MM9A 2OPSB 2V4JB 1T9WA 1Q7LB 4OZLA 2LXUA 4C3KA 2PDAA 2KRRA 5GAGI 3KYLA 3PJXA 4CLSA 1OSDA 1N33E 3GSIA 2AJQA 2QZ8A 5KFNA 4KPYA 2CRLA 4OZ5A 4F4XA 1N4LA 2F8EX 4LCFA 2HHTA 1MU2B 3SV4A 4L76A 3FKBA 2HHHI 1J5OA 3ISND 4I68A 2WB1D 2W9CB 4Q0BB 3IAM9 4I6YA 3KK2B 1HWLA 3OFGA 1FF2A 5EHHA 1YIJS 3SIPB 2MJNA 4DFJA 3HHEA 4ANDA 2ZOFA 4XDDA 2OHDA 1H98A 3FBFA 4IS9A 4KV8B 3GIMA 4M63A 3QIDA 2AGPA 2WNRA 2WSCC 2HGLA 2H9ZA 1N54B 2E5HA 4DN0A 4DV0F 1HQEB 2F5GA 4LCGA 1S1WB 2YNGB 4P7TA 2CXEA 2FZCB 1L3UA 4NYZA 2F8HA 1TP7A 4MTPA 2ZJQQ 2IRXA 4NA3A 1PYTA 4I7FA 3HD2A 4O44A 3M8RA 4OYAA 4B3SJ 4RL1A 4OX9E 3HPOA 3KDOA 2WOMB 2HIQA 1TKTB 3OBIA 4A8MP 3KJNB 1XNQE 3ZZUA 2J65A 3G71S 5K14B 4GKJE 1QAJA 2ZWOA 2P9CA 2ACMA 5J1NA 3BH6B 1S6PB 2VBXA 3VGSA 1MX0A 3CCSS 1M5VC 1EAYC 3R97A 1UFKA 2FLLA 2I5JB 5KOXA 1VRTA 4W90B 4GKKJ 4ZOSA 4CNZA 4B3RE 1NK4A 4F4YA 3NCPA 2UZAA 4JI1J 4F4WA 1E6YB 1E3PA 1TAUA 2CJAA 1HNZF 3OUYA 5HVFA 4BHQA 3H5XA 2QA2A 3IRWP 4LF8J 1IBLE 3RR7A 4FPRA 4ECVA 4C8ZA 1HNVB 1YQHA 4JV0A 1AT1B 1O0PA 3NAHA 4KFBA 3CCZA 2AJFE 2HPUA 2WW8A 5C5JA 2O1PA 3CCRS 1UEKA 3UI3A 1V3RA 1HNWI 3TQ1A 1RP5A 3HZEA 4OO1D 2O3ZA 2E7XA 2VQEI 1RHQB 3KHRA 2HQFA 5J2NB 4W4MA 4U7CA 1QM9A 3AQOA 3IR7B 1Z2ZA 1KOOA 1HQUB 2LU1A 5KFBA 3BKFA 5CZXA 3DN9A 2MGZB 2CFXA 4Y34A 3OL9A 3DLGA 3KLIB 1JLGB 3HK2A 4NI2B 4WE1B 4LCHA 4NLGA 3E2EA 3QGHA 1N33I 2X1FA 3R1HA 4MYUA 1DQ9A 3CULA 3MPDA 4PG8A 5F8MA 4IZJD 4OJ3A 4IRDA 3DXBA 2QL7B 2IMOA 2YKNB 4HH1A 1JLAB 4WPAA 2CPHA 2HW3A 4P9SA 2IHR1 4RNMA 1Y3KA 2DNYA 2Y0SD 4ZN3A 4UZBA 1U49A 3Q6MA 2KXFA 5B0BA 4NCGB 3PCOB 3GIJA 4ES2A 5K36C 4DV5J 1R0AB 2RRBA 3KMSA 3ADAC 4IG0A 1TL7A 4FP9A 4ZCKA 3B82A 4HYMA 1OQ3A 3Q6NA 1GX6A 3M2RB 4PUOA 4NXME 2GVDA 2E9RX 5DRRA 4B3SF 2MQPA 4LR7A 2YKMB 2D41A 1P6TA 1N8RT 1JLFB 1YZ7A 2CWXA 3NGTA 1WHVA 3KLEA 2A3JA 4OX9I 5KG0A 1TL5A 3TX0A 2JEAA 4ZVFA 3PIOQ 3I31A 3NS5A 2BM0A 3CD5A 2BW7A 2PE8A 2V0NA 2YWGA 3PFOA 4NMXA 1DQAA 3M8SA 1XNQI 4GKJI 4L6V3 2XS5A 1TL3A 2W4DA 2BUNA 1TUWA 3TAQA 1WC6A 3WQPA 5KFIA 1Y4SA 4DL7A 3I56S 4GO7X 1TR0A 2P8IA 1VQ9S 4ZPTR 4MQYA 3H59A 4GVLA 4P75A 2XLJA 4NZ7A 3QSIA 4B3RI 1TVRB 4JI1F 4K5SA 2JEFA 1NHKL 2OLWA 1DURA 1NK5A 4FBTA 3GFHA 3MCNA 4K5RA 4ED7A 3MMAB 1IBME 4LF8F 2HZVA 4JB8B 3HJCA 5EN1A 3O1LA 2G0JA 4LFCE 1IBLI 4FWHA 1VRUA 4NMLA 4EUVA 4OJHA 2EG1A 3KUEA 2HS3A 1SL2A 3H25A 2V6AA 3Q23A 2YXLA 2E5IA 3IWXA 1TL4A 4ZPWR 4XTTA 1CQNA 4OZ2A 2YWEA 3QT7A 1VBZA 4DL0C 1OYEA 3VF0B 3T5LA 5F8LA 2ZZNA 3MTKA 2GO4A 3X1LB 4OKGA 4X4OA 1NPPA 1NK6A 3I55S 2O01C 4NCBA 1S9GB 5KAKA 4ZCLA 4CLLA 4LPFA 4PG6A 4X64E 1MROA 4KYZA 3B8HA 2C39B 2B5JA 3JAMY 1ZM2A 2XCAA 2JE6B 2BJ9A 1GXTA 2W7PA 3ZM7A 2RF2B 2VFRA 5HK4A 4ZLPA 3D6MB 2C1EB 2GJIA 5J2MA 4WTOB 2UXDE 1MMNA 5DGBA 1I1GA 3Q86A 3KLHA 2IY5B 1S77D 2V8HA 2MQNA 5GAHI 4DUYF 3PW4A 2PC6A 3BF4A 5IC4B 4JI4E 5DM7Q 2KT5A 4UOHA 2DNGA 2QYCA 4KGVB 2HKJA 4DR7J 3M8PA 4F2RA 1SKUB 2MQMA 5F8NA 4NASA 1NZ0A 1VJQA 5I42B 1N48A 3UHMA 3GQCA 4N56A 4ECZA 2ZBKB 1ZA1B 1VQ8S 2WBRA 1Q79A 1KKHA 2EBEA 3KUGA 2UUAE 4AUKA 3DXSX 4NXMI 3HHLC 3K89A 4WP3A 4JI2J 1QAXA 3RRKA 3I6PA 3QGIA 4M5LA 2LQ5A 1FD2A 4IDKA 4CP5A 2YWFA 4NBQA 3O5TB 1NUEA 4C6AA 1P9YA 1SJRA 2J9CA 1X9WA 3DYAB 2R9LA 4CO0A 2J8AA 2B7BB 1HPZB 1S4EA 5CYQA 2JVRA 1TK8A 1KR4A 3HX9A 2XHCA 4YY3J 3C14B 5IM0B 4PWWA 3SQGA 3MR7A 4R8UB 4OYZA 1ZXMA 5CZVA 5JVHQ 2R7XA 1Q16B 3MCMA 4LR9A 4DV3F 3TJAA 1S1TB 3MOJB 1YDLA 1KQFB 2MLZA 2NSBA 1BD6A 1IBMI 2Z5BA 2AMCB 2AD9A 2DNZA 1EQ0A 4YOEA 1L5UA 4HH0A 3EGWB 1CVJA 2UU9F 2VG5B 4LFCI 2QMWA 3BSAA 2UXBJ 1MMLA 3L7ZB 2GGPA 5KFRA 5E3AA 3ILIA 1VHFA 1LW2B 3ZKBA 2P5VA 2CYYA 4WZMA 2DK2A 4EO6A 3PX4A 4OI2A 3PKMA 4ZJOA 1LW0B 3QATA 1YH8A 3RRGA 1Y7PA 4V19J 2ZHAA 4F36A 3I96A 4C97A 2UP1A 4QWEA 3HJVA 3I87A 4OYIA 4X64I 1U25A 3PW2A 3MUTP 3M1VA 3QT5A 3D68A 3IN5A 1PBUA 2E5LI 2ZDOA 3MR5A 5I3PA 3CDBA 2F4VJ 3RB0A 3H90A 2PO1A 4L3NA 1IQZA 2UXDI 3FEXB 4KPCA 5A6PA 2NYHA 2VASA 5KTQA 2AF6A 3D0GE 2BR0A 4UQTA 4DR7F 4JI4I 4FYVB 3V4IB 3ZTOA 3QRPA 3HFKA 3CJ3A 2Q1LA 1GTHA 2B4UA 4Y28C 1TKDA 2RDDA 3GV5B 2KFNA 2DHXA 2ZD1A 1B7FA 3QNWB 2LP4A 1NK0A 2KFZA 4A48A 1N34J 4LF6J 2WHOA 1N0VC 2XM3A 2HNYB 4KIAA 3CWJA 2HIYA 4PEOA 4CH0S 5HQLA 4KO0A 4OZ3A 3PVXA 2H65B 4JI2F 3GZ7A 1DJ0A 3EUNA 4HTJA 3Q2SC 5B08A 3Q89A 4X4NA 3PRDA 4NYPA 1TFWA 1S9EA 1BWVA 5D0EA 3FDSA 5JMNA 2HNDB 4DR2J 1GNKA 5A2QC 3PFEA 1MLAA 1KHVA 2ZE2A 2ZZMA 3THVA 1RREA 2BKOA 3EVOA 5U47A 2G0IA 2QG9B 1NPRA 3MPWA 2OUGA 3LPSA 4EGLA 4X4RA 5HMYA 4JI5J 4JV5J 3KNGA 4A8YA 3R1LA 2UVVA 4K0KE 4YY3F 3DLLQ 4ED8A 2FC8A 4FWGA 3D4JA 4RPFA 1NJWA 2CPXA 2MQQA 3RB3A 1C0TA 4M5GA 3B6BA 3GIRA 5AE1A 1FRIA 3I0RB 3H7HB 3FZ2A 1EI1A 2Z8QA 4UOGA 4PR6A 2AX0A 2GQ2A 4FVCA 2I8EA 4ZVOB 3AB4B 2NXJA 1UTAA 1F5BA 1Q82T 4G3IA 2KI2A 2C3MA 2I2YA 4OIXA 4WFBQ 3KLFB 1KBRA 1O8BA 2H5IB 4TYBA 4GVBA 3HHLA 2M2BA 1DBDA 3FCHA 3IP0A 1ZAWA 3IWLA 4F4ZA 3GG0A 5KG2A 2VKZG 3H8YA 1SQEA 1X4EA 2VD3A 3RW6A 3RG6A 3S6EA 4ZPCA 2CJ9A 3HFZB 1DARA 3U1KA 1S9FA 3J81U 3CC2S 1NAQA 2MSTA 1H73A 1A0OB 1RDRA 2DGOA 3GMEA 4H4OA 5G4DA 2DR8A 3WU3A 2W8KA 3SBMA 2BR2B 3MUMP 2F4VF 4MKBA 1TL1A 4J9SA 1Y11A 4PXCA 3MMBB 1CC7A 4WFYA 1DTQB 4N77A 3BSOA 1NDLA 3B4TA 4MAKA 1GMWD 2DR9A 3F73A 1E6VA 3BJYA 3JTOA 4URGA 4K4UA 3CPWR 1KSPA 2OP5A 5CYMA 4LFBE 4XO0A 3EM1A 1U1MA 4N41A 1U2CA 3GJTB 2GAGC 1O5JA 3SFUA 2UXCJ 1REVB 1N34F 4ZMMA 4LF6F 2HGMA 3UR0A 3DC2A 4P52A 3T9NA 3AD8C 4DR1I 4BA2B 1SJ1A 1DY3A 3LQVA 4IOAQ 4MT1A 2HMIB 1RWWB 3UDCA 3TZZA 2C3UA 2WRMA 1PAEX 2BQ3A 2KKHA 4PWDA 1B7YB 4QJVA 5KG1A 3OXGA 5HQMA 1LWCA 5A8RA 4TU8A 2PO2A 4DR2F 1RWKB 3EMTA 2FYXA 4RW9A 4LF4I 2FHKA 1DHMA 2W7AA 1RT4B 2CVIA 1FESA 4JI5F 4JV5F 1HMVA 3QGPA 5C42B 1NDKA 3D66A 1EETA 4MKVA 2F8MA 4Y2KA 1HNXE 2MKYA 1I6JA 3HVAA 2AQ4A 4K0KI 2H5JB 4ETZA 1FKPA 1U24A 4F26A 2UUCE 1C1BA 2OPQA 2D9PA 2XZTB 2V63A 2NN6F 3EGZA 1Y10A 1Q4RA 3SQOP 2XEXA 2BA1G 5THWA 2KYXA 3G87A 2R7VA 4G1IA 1XMQJ 3LO3A 4I2PB 3J7A1 2NSCA 5CCLA 5HLFA 2H54B 3T5JA 2BOAA 3PO5A 4OL8A 1SJFA 4ATNA 3T6JA 3H0PA 2H4YB 1T03A 3IAS9 1HBMB 3RTVA 4BLGA 2B0GA 2DR5A 5K8PA 2HWIA 1RWOB 1K47A 2AYBA 3BKTA 2JOQA 3KK1B 3KDNA 3OR1B 2IERA 2Q43A 3OD2A 2I6WA 4RW8B 1GH8A 2MHEA 3BBBA 3W61A 3BSNA 4QWBA 2L3MA 1UWBA 4XPEA 5LMUE 3M8QA 1IKYA 4DEZA 2VFUA 2VPXB 4Y6IA 4FW6A 2WONA 1FCAA 3WIUA 1S76D 5LMNI 3BPSP 3MM9B 3P76A 2KTQA 4DV7E 2RUGA 2WB4A 4IYQA 2IA0A 3SSSA 1D9AA 3N6LA 3UPFA 3HVTB 3J7Z5 3AODA 1NO8A 4CLFA 3S1TA 2L9DA 3DLEB 2FLOA 3TUZC 4LFBI 3KXDA 2YNFB 1KWMA 1UETA 3BB5A 2UXCF 4L3KA 4OQJA 1RT2A 1VQYA 4YHHI 3ZZTA 1QSSA 3R2DJ 1QVFR 4ZK7M 2LA4A 4LF5J 1JLCB 3MCSA 2IJFA 2KO1A 3KHGA 1VR6A 5IT0A 3ZZZA 1RWMB 4UT4A 3KG1A 4DU7A 1BE4A 4DV2E 2HHHJ 1NB7A 2Q2EB 3DOMA 1AB8A 3CJSA 1R8AA 5D4OA 4QNKA 1V5IB 1HARA 2D3OR 2M9KA 4O4GA 2XCPA 3KLVA 4KH0B 3VAJA 4YR0A 4FF1A 3RBDA 2W24A 2VC0A 4DV6J 1YJRA 3CC4S 2HHWA 1EARA 1WSRA 3D6FB 5HN0A 2ZJRQ 3V6DB 3GFZA 4Q45A 5ELWA 1S0MA 4HTIA 1OY9A 3VAKA 2B4PA 2HEKA 3ZNJ1 2W25A 3W1YC 3D1QA 4USTA 4USHA 3X3UA 1N52B 1CJTA 4C8NA 5A8KA 4WK1A 2ALZA 4J9OA 1XMQF 2UV8A 2HBRB 1WKKA 2W01A 3HD1A 1RT5B 4JI7E 1UJ6A 2BA0D 4WIQA 2ASLA 4CZCA 1TAQA 4ED6A 1KN6A 3DOKB 4USJC 2H4WB 2JSXA 2N4DA 3D3CJ 4WP8A 1D8ZA 4RUAA 1MWQA 2GIFA 4FS2A 2MY7A 1EA6A 3OJUA 2LDIA 1XXEA 5DETA 3W9IA 1WDTA 2OIHA 4LRDA 4IRKA 2G2YA 1NSPA 3PACA 4D3HA 3ISNC 3M2VB 4QIEA 4DR4E 4OJGA 3I9ZA 4U8YA 3A8EA 3LWMA 5T41A 4L72B 2OH2A 4KFBB 2WK4A 2YX7A 4F0HA 2GQ0A 2ZH9A 4OZ0A 4BCAA 1Q8BA 2CDRB 4Q7AA 1XNRE 4C8YA 4WXWA 1JLQA 4LVNP 5GAEU 5LMUI 1U1LA 4K50A 4P7AA 1HNWJ 4Y3CA 3ET6B 4IFDC 1PG5B 2CPZA 5AT1B 3BR8A 1LV5A 2M52A 2WVDA 3DM2B 1TKZB 2ZFHA 4AQYE 4JBCA 5C0XE 1NZ8A 1R3NA 2X1AA 4DV7I 4M5HA 5ETTA 2DIVA 3JSMB 4KHMA 2G2OA 3UD3P 1FFSB 3CGIA 4IOBA 2JLGA 4LF5F 1NDPA 2RQ4A 4F02A 1Y0HA 3W2WA 1X4AA 1BGXT 3TRGA 1N33J 3SSQA 5GMKa 1RAHB 1NJYA 3P49B 4ZVGA 3SMZA 3D9BA 3JQJA 4M95A 4F4KA 3J80C 2HHHF 3OJSA 4C3LA 4U6PA 4GKKE 2LXIA 1KHWA 4DV2I 4KRWA 5CA5A 1SL0A 3GSDA 3UDLA 4NLUA 2PMHA 1XERA 1RWPB 4WTYA 4I2QB 1U02A 3UVJA 4IG0B 1X4FA 1TL7B 4CT9A 1TKXA 1H7XA 1RYSA 1YBAA 2V9WA 3Q22A 2KJVA 2CG4A 1J2VA 2DCLA 3DD6A 3M7NG 1DAXA 1QAYA 4OO1C 2DR7A 1JLBA 1GT8A 2IM0A 1PAUB 4CH1A 5B0CA 3WC2A 5T7LA 1PKUA 2BQRA 1ZM3A 1B4SA 1E3HA 4OX9J 1FWPA 4RUHA 4RW4A 5AXMA 1T95A 2D69A 2MY8A 3TJ9A 3NLCA 3HO1A 3HFVA 3HI9A 5JEAC 2RMLA 1XNQJ 3TZWA 2VIHA 1CQMA 4GKJJ 3IBWA 4TXSA 4M1KA 4C98A 1U0SA 4JI7I 5KFEA 4TKTA 1U1OA 4ZS6A 2QA4S 2YNHA 4DZ6A 5C24B 2OELA 5G0RB 3DLJA 1Z0BA 2ERRA 1IKVA 1RHMB 4J9LA 1QE1A 1ZS6A 2EBGA 4B3RJ 2QE5A 2V2KA 1KQKA 4CNYA 4PAAA 4EYIB 5K20B 2XSJA 2HG4A 1NEEA 5D3GA 4DR4I 2KFYA 4KHPE 4PZVA 3D6HB 5A0YB 1HWUA 3HP6A 3POTA 1SUQB 2V8DA 1YLXA 4CYUB 1C4AA 1RHJB 1FTRA 1IBLJ 4DN9A 2MKCA 4KE5A 1OPZA 2CNOB 3BQ2A 1XNRI 1UKUA 4DV5E 1HNWF 3C16B 4C2MA 1VCTA 1R43A 1QSLA 1VQ7S 2P9EA 2VFTA 4J91A 3DMJA 3GB0A 3W9HA 1QD1A 4EZ6A 2VOPA 3BGOP 2RKIB 4MYTA 4DSIA 4NLQA 4AQYI 4UY8T 2B5JB 4WIIA 1M5PC 1RSCA 2UUBJ 3M4XA 3HHNB 1V3ZA 4L73A 4FDFA 1WC3A 2V34A 4F0MA 4M5IA 3HZGA 2MZ1A 3KFWX 3LANA 5J2MB 3DI6A 1Q8LA 4H4KA 1N33F 3G8QA 1HW8A 3TOQA 1WF2A 3J7YI 5AJ3J 3QSYB 4RNFA 3EICA 1BUXA 2CUYA 2MLXA 3BN4A 1KFSA 4KB7A 1S0NA 4ED5A 1NLKL 4O0NA 3TW0A 1HHQA 4P72A 4GKKI 4DSKA 3M8WA 1Q5YA 2CZVC 1BWEA 4A8OA 3AD9C 4TN2A 1BQMA 1NPKA 1YRTA 1G3OA 3LWLA 2NXCA 1UVLA 2EVZA 2VFVA 5A2QY 1WEZA 1Q7YT 4MKYA 1YJWS 4CLTA 2QX0A 1IKXB 3CJ2A 3Q8VA 2NUUG 5A8WA 1AW0A 2VPZB 1WG5A 5K36D 3A1YG 1NCLA 1HNIB 1M0SA 1NU4A 4B9UA 1AZSA 2HRYA 2E29A 4OX9F 4LF9J 5J2PB 2VHGA 4AT1B 2J0XA 4CLUA 2KHCA 3I0SB 3IR6B 3O6QA 4OO1E 4WYWA 1RK8A 1XNQF 3TA1A 4GKJF 5ITHA 2BANB 3MPVA 2DXFA 4GMKA 2NR0A 5HVGA 3M30A 3CB4A 2O1TA 4B3TE 2WVEA 1JKHA 4TU9A 1RU1A 3R5JB 2ATCB 1QDUB 4MU4A 3EXCX 1JXEA 1I94E 4B3RF 1ZPVA 3MEEA 1LWEA 1JJHA 1F3FA 5LOQA 3HKMA 4F3MA 2QMUB 3CCVS 4LRCA 5GAGU 1VQ6S 2B8PA 4RLEA 5SZTA 1KIJA 4TVAB 4KHPI 4Q8EA 1IBLF 1FRLA 1LFWA 2AP6A 1H7WA 3GCMA 2GFFA 4OO1A 1J27A 4LFCJ 4ECQA 5HL7Q 2RVJA 4ZVRB 2RSQA 4O3PA 1HHTP 2ASJA 1YI2S 1OSCA 4DV5I 2IRYA 2ZZTA 3OVSA 2ZH8A 3NS7B 4X65E 1JK9B 5J1PA 2ZKTA 1B0TA 3LAMA 1RGVA 1G7CB 2OTLS 5JEAA 3CDWA 3N0VA 1F3VA 3N4WA 4YS2A 3MZIA 3QFWA 2YKOA 3VHQA 1LWFA 4QNJA 4RWWA 1HI1A 2V9KA 4N8OA 4X64J 5SUHA 1WTFA 1YJTA 3IMQJ 4Q2LA 2R4FA 3QWPA 4OYOA 3PY8A 2DNOA 2WSEC 4TY8B 1S72S 4MIAA 4P10A 5AJ3F 3FEZA 2QA4G 4IZJA 1D0EA 3ENQA 2HFUA 3QT6A 1T3NA 3MM6A 2RE1A 2F63A 1WEYA 3I82A 5D77A 4WF9Q 1S79A 3Q8SB 5L1KA 2IOQA 4JI4J 2IC3A 3A8JA 2PEHA 3DRSB 1T05B 2ZD1B 1KONA 5H9EK 2QEXS 2ZWPA 4USWA 2EG2A 1IR1A 2N4CA 4MKAA 1S1XB 5KG4A 3CJ0A 1RTJA 9RUBA 3W66A 4CCHA 1K8AT 3PW0A 1RAIB 3RB4A 2IOPA 2UXBE 3QPIA 5IV3A 4NXMF 3QJJA 2DNPA 1LFPA 4X4PA 1NM2A 2EFOA 2UUAJ 5BYSA 1R8BA 1UEVA 4P2FA 4ZPDA 4LQ3A 3MD3A 2QJ3A 3PG9A 4OYXA 3US5A 5LXYA 1OYSA 1YHCA 4FF2A 3CUNA 1K1QA 2DO4A 3OTCA 4B9TA 4RBUA 3DHWC 2Y1JA 1J5EE 2YNIB 4B3TI 3BDPA 2LVWA 2VC1A 2KVQE 4CO2A 3RJMB 1HKAA 1I94I 3ZTPA 1H72C 2BMBA 1X0PA 1PILA 2V8PA 3LP2B 4NXNE 1Z0EA 4DFMA 4HL9A 4CO5A 3E01A 4YB6A 3PW7A 1IBMF 2ZBCA 5DNXA 3F0NA 5DRPA 1T9TA 4OFZA 3HSGA 2LXFA 1N32E 2QFIA 1Z0TA 4ZA1A 4J7CA 4LFCF 1DTTA 1WSVA 3NNHA 4UUXA 3UO0A 5KFQA 4HT7A 3BDEA 3C6TA 3G96A 5HJYA 2SXLA 3BGRA 4X65I 1LEOA 2VU5A 3CJTA 2EWHA 4ZHRB 4IG3A 1KOHA 2RS2A 4DR3E 4HI2A 4H4OB 3DGPA 3UD5A 2QYGA 3JYTA 1TK5A 4X64F 5ETNA 1VK8A 1RAGB 3J7AN 1EKSA 4MU1A 2WW4A 4OHZA 1UW4A 3M9NB 3NS6A 4LREA 3G9CA 4MIBA 1RTIA 1Z5BA 3NGUA 3CWVA 4O3NA 4DFKA 1FE0A 1OYDA 4DI6A 4X4SA 1VQOS 2DGSA 1U45A 2HWHA 3ZZRA 2UXDF 2XNRA 4FXDA 1SC4B 2LQBA 2C38B 1TV6A 3RAMA 4OHWA 4NLTA 1RHYA 2Z5CA 3NCQA 4ER8A 3Q8RB 4JI4F 4L74A 4DG1A 4YY3I 3MPYA 4R5PA 1S12A 1N6QB 2LLZA 3SDEA 2DNLA 4LBHA 1NK7A 3CIMA 1RT1B 1T02A 3SFGA 1RT7A 3T3FA 3ZZPA 2AYEA 4ERDA 3CCLS 1F2HA 4LBPA 5E5NA 1NSQA 1U1RA 4PWDB 3K8WA 3GLJA 4K4WA 2HFZA 2IVYA 4O4RA 3M7ND 2V2QA 2UXBI 1TUVA 3VR1A 2BDPA 4ZDNA 3I5CA 2UUAF 3GR0A 1Z5CA 5KFDA 1F0XA 2IAJA 5C2CA 1R8CA 3M2UB 3KMQA 1A6LA 7AT1B 3OTEA 4WYLA 3L95X 2ASYA 3N6MA 3MUVP 3UD4P 1RHUB 2VG7B 3HHDA 1EETB 2F40A 3TA0A 4B3ME 1FVQA 4IH6A 3KHLA 1SI9A 3K5OA 4YB7A 3VV2B 3KJFB 4G65A 1B63A 2PI5A 4DL5A 2LEPA 4J9QA 1J5EI 6FDRA 3EXYA 1H0HB 1IVZA 4ZITA 1B99A 1C1BB 1ACMB 2RH3A 4K0KJ 2XLIA 2R8IA 3PS2A 2GX8A 3V81B 2V8VA 3KWMA 3SYZA 4CO3A 1HQ2A 1SH2A 2PA8D 2QFJA 4NXNI 2LECA 1XK8A 3LOUA 3P6YC 1UPPA 2C28A 1SJQA 1N32I 2CNLB 5DS7A 4TLQA 3GMGA 3RAXA 1RJJA 1RABB 3HF5A 2JFDA 5GAHU 4EYHB 4LMZA 2DEIA 2XWYA 1N88A 1T11A 1N34I 4IFVA 3W63A 3LP1B 2GO9A 4MK8A 3A12A 3CF5Q 3GG1A 2E1MC 4ZP6A 3RR8A 1MW7A 3ETOA 3CD6S 3ZTRA 1S6QB 4UF4A 4DR3I 2L41A 1ZAXA 5J2QA 3FZBA 2XSFA 2LA6A 5HBMB 3FGVA 1JJ2R 2CG9A 2QN6B 2YVSA 3BSCA 5T14A 1S4FA 3HT0A 4WUBA 4IFYA 3UWTA 1FKAE 4JI3E 2RHSB 3PRYA 5E3RA 1FEEA 4QW8A 1FVSA 3DRPA 1SIZA 2W1BA 4U96A 4JV5I 4HACA 2KJWA 3JSBA 3G4SS 3J80Y 1FJ7A 2RQMA 2HQGA 5KFWA 2W9BB 4I6WA 2QL5B 1SV5A 4X84A 1HBOA 4URQU 4LFBJ 5FDLB 1C0UA 2EFNA 2JH3A 1PIEA 3FSXA 3M32A 1F9HA 4DR5E 3OXFA 1VK3A 2IYGA 2M88A 2XMWA 3VTIA 1NNDA 4DCPB 2B4VA 2NLWA 2QTWA 1VQ4S 5EL9A 3K7RA 1FNOA 1M1KT 4DHVA 3T41A 2B43A 2PNZB 4TYAA 5H9FK 3HVRA 2R7OA 2D9OA 2EI5A 1WKJA 3KLGB 3OTBA 1V5VA 1HR0J 3J81C 4U3DA 2N3OA 3LUYA 1ZM4A 3O2IA 4YB1P 4URLA 4J9RA 5KT7A 1R6VA 3JQKA 2R2SA 3VAGA 2XMJA 3U7JA 3UN5A 3H4DA 5AE2A 1OWXA 4B3MI 1QTMA 4ID5A 2OPPA 1WC5A 3K5PA 4K0KF 1P1LA 3VWSA 1HNXJ 3UR3C 3I5AA 3TAMA 2VL1A 5KT4A 2OJ3A 2K1RA 4NLVA 2FHJD 2VB6A 2UUCJ 5F8IA 3W64A 2BACA 3AFGA 1H74A 3GFYA 3MMCB 2UVUA 4YEAA 4ILMA 1IJFB 1SPBP 3RAQA 2RQCA 1XR7A 3VGUA 3QIPB 1FDAA 1C1CB 2DRBA 5LT5A 3H1CA 4ELVA 2VJUA 1IKWB 3SCJE 4U7UD 5GMEA 1RWVB 1VS3A 1IWAA 5D0HA 2J7KA 3UCUP 2CPEA 3UN3A 4Y00A 2HSEB 2RIJA 2LYVA 3AB2B 4O3SA 5D8HB 1KFDA 2M70A 4F7VA 5F41A 4QIWD 2BJ3A 3ZTQA 4KC5A 2CIMA 3C8YA 3DU5A 4W92B 4NEZA 1KQGB 4QWDA 1GMWA 1V3SA 2XYHB 5IT9C 3FMWA 3WDOA 5LMUJ 2HRUA 2WSFC 1WF0A 3MM8A 2FGOA 4RR5A 2BX6A 4JI3I 3GILA 4RW6A 2RDJA 3G86A 4DV6E 4BDPA 4ALZA 3PV8A 1YBTA 3OVBA 5DRQA 1V6HA 1F9FA 3R7SB 1T94A 4DV7J 2PT0A 3ITHB 3ZKDA 2OMLA 2IFXA 4M5MA 4N76A 3EJMA 1RTDA 4XTJA 4LFBF 2MXYA 5HP1A 1GQEA 4RW7B 4Q2MA 1HYSA 1N5YB 4LIRA 3W65A 1MSWD 4DR5I 1WNEA 1QJHA 1YJ7A 3NZKA 3H98A 2OPSA 1FRMA 2V4JA 2HVIA 2EFVA 2FJDB 4CQ1A 4H4MA 1VGYA 1YBUA 5L46A 2PNMA 4F25A 3BQ1A 3CMES 5C0XB 4DV2J 1VJWA 2F4FA 2U1AA 2LJPA 5E41A 1H2VZ 5F0UA 1MU2A 1HL6A 5DG9A 1RR9A 2LDYA 1VDHA 1TU0B 4ILRA 4PKDB 3DLKB 2I1RA 3OT9A 1JLBB 4QWCA 2ZM6E 4HI1A 3BBCA 1JXVA 3KK2A 1JJCB 2VF3A 4U67Q 1HNXF 2XI2A 1OMSA 1Y3JA 5KFJA 1CJUB 1RTHB 2ZUAA 3P3DA 2AZ3A 1O6XA 2V69A 2FPHX 1ZYQA 3K5LA 4U95A 2UUCF 5DDRC 1WHXA 4C9DA 3S8SA 3MR6A 2YNGA 4ZPAA 4IH7A 5B0FA 3V6KA 1JNZB 2R2TA 3A8IA 2MQ8A 2LCWA 4KQVA 2ZBIA 4OYPA 4ZP8A 3OSNA 2QC3A 5FLXU 1X5SA 4JI7J 3H4LA 2KVIA 2ZH3A 2O1WA 1IKVB 2WOMA 1TKTA 3DOLB 1U4BA 5M2RA 3S01A 4LF5I 2GA7A 5K14A 3G6YA 1F2GA 5D3GB 1ULRA 2F7VA 1YJ9S 4R0JA 1Q86T 2MKSA 1PC4A 1TK0A 4DMZA 2CAJA 3POTB 5DO2A 4DR4J 5IWAE 1T3OA 2I5JA 2GHVC 2E1RA 4YDDB 5I3UB 1SJ4P 4NA1A 4ZPVR 1EZZB 2Z4PA 2AEJA 3W2VA 5LMUF 3ZC4A 1E6YA 5MLCV 1XNRJ 3U02A 5K8OA 3LGNA 1T8EA 2PFFB 2XWXA 4CWBA 2V50A 3ZZ0A 2Q66A 2Z30B 1P1TA 2DGVA 3N28A 4DV6I 1HNVA 4DV7F 5LL6R 1RLCL 4YR2A 1K73T 4IFDD 4AQYJ 2VPWB 2DHAA 4J9MA 3T5KA 1NSAA 4XIUA 2J0QD 5J2NA 3GP9A 3L7PA 4WXOA 2HNZB 2YY3A 4DU8A 1L3TA 2XQCA 1HQUA 1VBYA 2CQ2A 1RBLA 5EWGA 4DS5A 4OZ1A 2MGZA 2DH9A 4LRAA 3KLIA 1KTVA 1UZDA 2FVSA 1JLGA 1RCOB 2HFOA 4NI2A 5IFMA 4ECTA 2ATLA 4DV2F 4DV4E 1XMBA 1XN9A 1UDQA 5F0WA 1QUVA 4RNNA 3VZIA 2WP8B 5BXIA 1CLFA 3QBCA 1GXLA 3PO4A 1NHIA 1GEHA 3GCXP 2NQPA 1G4CA 2LQJA 5A8WB 1VC6A 4Q5VA 4NLPA 2YKPA 3SCLE 3TR5A 1WWHA 1B64A 2P6SA 3R9LA 2YKNA 1QLNA 2B9WA 1PYSB 2ZM6I 1WELA 2V2VA 2AYMA 1KTQA 2NXNA 4NCGA 2MKKA 4DF4A 1S49A 4CLWA 1R0AA 2OEJA 1U0HA 5L9NA 5CXTA 4YUDA 4OZNA 1CG2A 4PPZA 1RHKB 4OYMA 2D74B 1PC5A 2AWZA 3KJVB 2ROGA 2DY1A 2UUBE 3MCOA 1JKHB 2H51B 2YKMA 4JI7F 4A8QA 5B0GA 2GVZA 4ECXA 2EC2A 2V2ZA 1VIXA 5JEAD 3NBPA 1LWEB 3MFIA 3ONQA 3PYFA 1RYRA 1VQLS 3MAAB 3UDVA 1USVA 2BV3A 4AM3A 4WU3A 4OYWA 4DR4F 2VA2A 2GAHC 4C48A 1OO0B 2N7YA 2HKEA 2FIUA 3AXMA 5DJBA 5CQGA 4B02A 4IQMA 4Q8FA 2CQ3A 3Q8YA 2K06A 4U7UK 5IWAI 2EW9A 4KHPJ 4OV6A 1ZZNA 1RB0A 1SKWA 1TVRA 3TO8A 1R6MA 1XNRF 1RAAB 2G1HA 4NCAA 2NUHA 3O3LA 3MMAA 2A2CA 5F9LA 1Q81T 1FWKA 1X4HA 1Q78A 4Z37A 1N0UA 3LAKA 3VAMA 4Y2IA 2CQGA 4DF8A 4AQYF 2PMWA 5C0XF 2V67A 3GFXA 1RAEB 1WI8A 4LF9E 4DLEA 5JVGQ 3GJRB 3R6LB 3TZXA 2B9EA 2G13A 2KU7A 4ENOA 3JS9A 3SCKE 1URRA 1G1XA 4IQXA 1U1PA 2G4BA 2KHDA 1VIOA 1KC8T 3MR3A 3T1YE 4LF7E 2OD6A 1NHVA 5KFUA 3Q8PB 1IBCB 4B9NA 4B9LA 3CCWA 3MTJA 2B6AB 3LP0B 1X0FA 1NB2A 2C39A 2XMTA 3UN2A 3BR9A 4NPOA 3CDUA 5AXLA 4GKKF 2IC3B 2JE6A 4DR6J 4KKOB 3MEGB 2RF2A 4DCJB 2HHUA 2OD4A 3FSIA 1EKRA 2CPDA 3R5GA 2AGOA 2F3JA 4CTAA 2Z2ZA 2WCXA 2A0FB 2H1YA 3MM7B 3ETMA 4JV1A 5EX3A 5LXRA 1XIQA 4JI8E 3MFHA 3SSRA 4P71A 5KG5A 4RU2A 2QO3A 2DXDA 3PDNA 1G6BA 4KR0B 5I42A 3RBZA 4YDXA 3RBXA 2XYGB 5LJ3Y 3TVZA 3MURP 5ETQA 4WWSA 2JNJA 3DDIA 1UW9A 2W9AA 1Y4ZB 3CE8A 4ICLB 2QA1A 4N5SA 2UUBI 4KJIA 1KLMB 3M6AA 3H5SA 3F56A 3ILLA 2HLUA 2M3DA 1WOPA 3I5BA 4CIOA 2IPOB 1RI7A 1R6LA 1K0VA 2G1DA 4B9MA 4B3TJ 4E8UA 3R5DA 4ZKAA 3PS1A 2VV5A 2HVDA 2Y1LB 1NZAA 2FY8A 3HXMA 2BKPA 1I94J 3E01B 2HHQA 4M5DB 3DYAA 3J7ZT 1FDNA 4Y2AA 5B7WA 1Z59A 1HPZA 5IQQA 5DLFA 2XHWA 3D28A 2JLFA 4KHPF 4DV1E 3F41A 1XBWA 3A3NB 2RRNA 4QQBA 3TVKA 5IM0A 1I51B 4OMFG 3JAMQ 4R8UA 5DDOC 2XI3A 5IQ6A 1U6ZA 1YJNS 4DV5F 3OFHA 2F65A 3NGKA 3C19A 1CULB 1S6OA 4QBUA 3JSYA 3UDEA 2DIUA 4X65J 2XMKA 2BYCA 2QV6A 2FD2A 3DGPB 4C0BA 3OTDA 3BQ0A 2AHOB 2KRBA 4GQUA 3EDRB 3IBCB 3L7ZA 2OPRB 3TQEA 3A13A 2B9YA 5K36E 2A1BA 3OHBA 1S97A 4LF9I 3KTQA 2XY7A 3R5AA 4MU3A 2JT2A 4DX5A 1LW0A 2ZEJA 2VDHA 1TQLA 2CZ9A 3T1YI 3CCTA 1S1VB 1T9VA 2NPFA 4X66J 2CQDA 3DNCA 4DPWA 4DR6F 4R5PB 3LH2S 1SVDA 1UVIA 3PEHA 4C7QA 4RO0A 1PCAA 4ZJLA 4Q43A 3J81Y 5K8MA 4RNHA 4OV1A 5K36A 4ECYA 3B4MA 2JWNA 3ENVA 4U3BA 1S1UA 2FLNA 3V4IA 1DRZA 3P3EA 2AJ2A 1ZTWA 1XR6A 5C25B 2XC9A 2DY9A 3DFEA 2IAJB 5HANA 2GHPA 2J7UA 2BRKA 2OFHX 5M2UA 3EGVA 4A8KA 2APOA 1HD1A 2EC0A 1JLEB 4OO1F 2RAQA 4X62E 3OFFA 4JI6E 1GFWB 2VESA 1TTHB 2NN6B 3NMAA 1SC6A 1FRJA 4WFAQ 3V2UC 4B3TF 2HNDA 3FSYA 1J5EJ 5DGAA 1I94F 4D3GA 3QRRA 4OHVA 2HQCA 2YKQA 4B3OB 2LU2A 8ATCB 3CDAA 3MWBA 3W5ZA 1M5SA 3T19A 4ED1A 2ZOGA 4NXNJ 4PQUB 1FK9B 1QUPA 2BOPA 2CQ4A 5E3CA 3FFIB 4ECRA 4G1QB 2EKYA 1N32J 3MECB 2O3DA 2GZOA 3I0RA 2FTRA 3KUHA 4CLKA 4RUBA 2MJUA 1Z0WA 4ZVSB 2QLWA 4IFVB 3DU6A 5IT9Y 2HHPA 4WJBA 4X65F 2DD8S 3T1HE 2XZWA 2DGWA 5DG8A 2GW8A 2WVBA 5J2QB 3KLFA 2LEAA 3W62A 3DRXA 2B51A 1N36E 4DR3J 2UUAI 1IQTA 2A2DA 2M7SA 4I4BA 1BKNA 1M5OC 1WG1A 2AEFA 3CDEA 2Z2YB 3NMRA 3DRPB 4JOUA 1QSYA 2WVCA 2B7CB 3K0JA 1FX2A 3L7OA 1FTCA 3PZPA 3FC9A 3AJDA 1JQGA 1RZMA 2KH9A 4KAIA 3G82A 1YHQS 2FDNA 2MEWA 5DQHA 4LSLA 1ELOA 2BR2A 4PQAA 3MMBA 4EBCA 3QWUA 4E0DA 1DTQA 4JI0E 1PSDA 1SXLA 2LMIA 2IMWP 3M7VA 3C15B 2KM8B 4PABA 2A6MA 4A8XA 3PIPQ 1RQ0A 3AAWB 2MB0B 4KGXB 4NRTA 5HQ8A 1GMUA 4OHXA 3ISZA 1EP4B 2XY6A 5KFLA 5KFAA 3BZQA 2UXBF 2BE2A 1BQNB 5KFOA 1YWXA 1JMTA 3VQSA 2XMVA 1REVA 1D1UA 1DQ8A 5B0AA 3BGFA 1BC6A 4DX6A 4DQSA 1YJVA 5L39A 3I4PA 1NKBA 2IJRA 2WVFA 4BA2A 1FRXA 3AJ2A 3CJKB 2HMIA 1AFJA 1VYAA 5KG3A 3W9JA 1SC1B 3CT9A 3GCWP 4IOCQ 3P8BB 4X62I 4JYAE 3R2CJ 4JI6I 1X31C 2XBPA 5HSPA 4MIWA 4B3MJ 2QSFA 2VG6B 5F3TA 1J5EF 5KFMA 1L3SA 2HVHA 5C0XD 2O66A 1F1BB 1WTBA 5HVHA 1KNZA 4URSA 1FX4A 1CJKB 3BPDA 4BA1B 5IT4A 3KRNA 1KP6A 4NXNF 5D15A 5DM6Q 5ETLA 3V4MA 2XYPB 5EWFA 3GYGA 2HFSA 4LF2A 1N32F 2HHVA 1APSA 3V6JA 3FCVA 3TI0A 4J9UE 4C11B 2E1PA 3C6UA 4KSEB 2Q79A 3AH6A 3CCJS 4GO5X 2JEBB 2BRLA 1MU5A 1CJVB 3OSPA 2DBBA 3T9ZA 4DX8H 4I2PA 2K8GA 1RE1B 4CO4A 3T1HI 2HFVA 4DR3F 2B3TB 5IS2A 3MM5A 1ROFA 1NJXA 4P74A 4KY3A 1N36I 4K59A 1L3VA 1HR0E 5DQGA 4LSNB 3PXGa 2LFVA 5BR8E 2HGNA 3MM8B 2IRUA 5F9NA 1KD1T 2C37B 2L48A 4K4YA 2D3ZA 4YR3A 4DDFA 3NCRA 4MFBA 3W5XA 3GJQB 4JI3J 2HVEA 4EI2A 4RW8A 5IT9U 1NBEB 4OHYA 2HLTA 3PKYA 5KT6A 4AIDA 3CJRA 2DNRA 4Y2CA 2VQEE 2J7WA 5DG7A 2AX1A 2Z58B 1CC8A 3FBBA 5D0RA 1N56A 1FKOA 2LEBA 1KVJA 3IS9A 2JHEA 2YBVA 1H2UX 7FD1A 2KT3A 3OL7A 1GMVA 2PIIA 4NLWA 2MTLA 2LQ9A 4DR5J 5KFYA 5CHCB 5J1EB 3HVTA 3DLEA 1R27B 4H4MB 3GONA 2YNFA 2J0WA 2QMXA 1NHHA 4HHUA 2XZDB 3K17A 3Q2TC 1RT6B 1JLCA 1VC0A 4LFAE 4K2JA 4X4UA 4LQ9A 2FJVA 1HBNB 3WC0A 3VAHA 3D1HA 2MKIA 4ELTA 4PU9A 1WEXA 4DPUA 1VQ5S 3H40A 2XGPA 1S10A 4LSZB 3IRXB 4QPTA 4RKUC 3UCZP 5FJ4A 4B3MF 4TLRA 3BN7A 5K5MA 4DSJA 4JYAI 1R8PA 4H54A 3VVUA 2E7VA 2HK3A 4ECUA 1U7LA 3O8WA 2HURA 2W2PP 2I38A 2ZH7A 4IR1A 2BEFA 2Z57B 3V6DA 1VLYA 3LTOA 1YSJA 3NY0A 3QO9A 4LJMA 3OTOE 2RHQB 3ZO7A 1Z2LA 2CQHA 1U1QA 4KGKA 4NX9A 3D3BJ 3FBEA 5IV4A 4FPIA 4NLDA 1R31A 3PHEA 1MNEA 3D54A 1Z0GA 1MN7A 1AA1B 2F9DA 1F6TA 5CH7B 3K58A 4M5NA 1WF1A 2ZVIA 2HQ3A 4OX8A 1RT5A 4MMOA 5LSLA 3DHXA 5ETPA 2JC0A 4WCEQ 1PBAA 2R7RA 2ADCA 4DWIA 2GCFA 1TMMA 1J5OB 1Q5VA 1WHYA 3DOKA 2CQIA 1IUJA 1UA1A 4HDHA 3W2VB 4ZVPB 4M94A 4C0HA 4PPDA 1HR0I 4AL7A 2BJ1A 2V4QA 3G8TA 3M2VA 2ZNZA 5BR8I 2WNRB 4WFNQ 5L9XA 1FKAF 4JI3F 4L75A 1FI4A 2J0SD 4O3OA 4AL6A 5BJRA 5D78A 4WZQA 4I7FB 2RRAA 2C2MB 4O44B 1SCJB 4FZVA 3NP5A 1OJ4A 1KDNA 1HNXI 5I4MA 1IBKE 4HXZA 5D4NA 3ET6A 4F4AA 1T9YA 3EE3A 4DR5F 3CIZA 1HK7A 4NL5A 4K4XA 3DM2A 1TKZA 2UUCI 1YJUA 2R2RA
chains in the Genus database with same CATH topology
4ZVIA 1Y4SA 5LL6R 4X62I 4JYAE 4DV1E 4USMA 5GMDA 3JAMC 4JI6I 1J5EE 2R42A 2UXCE 1FWLA 4DPYA 4LFBI 4JI1E 4B3TI 1HNWE 5FWKA 1A6FA 3JAMQ 1XNRI 2Z5EA 4DV5E 4JI8I 4B3RI 4ED4A 4YHHI 3ZZTA 4LF6I 4N3OA 1I94I 4LF8E 3J81C 5A2QC 1H72C 1HNZI 2V8PA 1ZM4A 4URLA 4LFAI 1IBME 4DU8A 4NXNE 1Z0EA 1Z0VA 3J81Q 1USUA 5A2QQ 4JI0I 1RREA 3V5RA 4IZKA 3F0NA 3HJCA 3LPSA 4UT4A 4LFCE 1Z0CA 4DU7A 2HFSA 4MYTA 1KTVA 1IBLI 4YY3E 4FWHA 1N32E 4AQYI 1Z0TA 4B3MI 4DV2E 4K0KE 2BM1A 2Q2EB 4DV4E 4FWGA 4DR2I 3D4JA 1MG7A 4RPFA 4LF9I 2V34A 1N33E 2O1VA 4DV3I 1EI1A 3QT7A 1NHIA 1MU5A 4X65I 1FJGE 4JI5I 2Z5BB 3PYDA 2VQFI 2CZ9A 3T1YI 4DR3E 1H7UA 2NPFA 2HHHI 2UU9I 1H74A 2OI2A 3B78A 3T1HI 1QZRA 4X64E 3B8HA 2ZM6I 4DPWA 4GKKI 1ZXNA 2V2VA 1ZM2A 3OTOI 1N36I 4DV1I 2WW4A 1HR0E 2AJ4A 4DR1E 1VISA 4DUZE 4FW9A 3ZM7A 5BR8E 2R3VA 4DV0E 1U2RA 1XMQE 2UXDE 1Z5BA 3CWVA 4IZJB 5GMEA 4DUYE 1DARA 4USKA 2J7KA 3J7AM 4JI7E 1H73A 4JI4E 2UUBE 2Z5CA 4R1FA 2X36A 4OX9E 2HKJA 2DEJA 2F4VE 2VQEE 4LF4E 4YY3I 2V2ZA 3K1JA 3WU3A 1Y6ZA 4Z7CA 1EA6A 2PNLA 1NZ0A 4DV4I 5IT9C 3Q1QA 3PYFA 1XNQE 3ZZUA 4GKJE 4JI3I 2ZBKB 1USVA 4DR4E 5IT9Q 2BV3A 1XMOI 4X66E 4DV6E 1MX0A 4PRVA 1KKHA 4X62E 4JI6E 2HKEA 4B3SI 2UUAE 4DR7I 4HACB 4NXMI 4LFBE 2GQ0A 2O1TA 2V2QA 4B3TE 2UXBI 3ZKDA 5IWAI 3GONA 1XNRE 4XTJA 4EMDA 1NHHA 1Z5CA 3V2UC 4B3RE 1N34E 4LF6E 4DR6I 5LMUI 3K17A 1I94E 1HNZE 4P7AA 4LFAE 1IBKI 4DR5I 4P52A 2A2CA 4PU9A 4DPUA 4DR1I 4PRXA 1FWKA 1N0UA 1IBLE 2CGEA 4AQYE 4DV7I 5FLXC 4B3ME 1KIJA 4JI2I 1S4EA 1PKPA 4KHPI 3PYGA 2E5LE 4DR2E 2GS8A 1B63A 4JYAI 3LNUA 4LF5E 1NHJA 1J5EI 4LF9E 1UEKA 2UXCI 1ZM9A 2PNMA 4HY1A 4JI1I 1HNWI 4DV3E 1ZXMA 2HK3A 1Z0WA 2LJPA 2VQEI 4DV5I 4LF4I 1D6TA 4WUDA 4X65E 1XHKA 3WU5A 4LF8I 4Z7YA 1RR9A 4JI5E 4JV5E 4FN5A 2VQFE 1Z5AA 3T1YE 1IBMI 2Z5BA 1Y4UA 4NXNI 4LF7E 2HHHE 2UU9E 1B62A 3T1HE 3J80C 2ZM6E 4LFCI 3LTOA 1HNXE 4GKKE 1N32I 2VF3A 3J80Q 3OTOE 4DV2I 1KVKA 1N36E 1PVGA 4K0KI 2UUAI 4JG4A 2A2DA 2EFGA 3ZKBA 5LMNE 2DEIA 1BKNA 3P06A 2UUCE 1N33I 1N34I 4IZJA 4DXLA 1Z0GA 4MYUA 2XEXA 2HFUA 3QT6A 3WU6A 4I3HA 3K85A 3J7AG 4IZJD 1FNMA 1FJGI 4UTGA 2X7IA 4DR3I 3PYEA 4KQVA 4DPXA 4JI8E 4YHHE 4X64I 3QT5A 1ELOA 2IOQA 4DPTA 3H4LA 4WUCA 2CG9A 2O1WA 3Q6MA 2E5LI 1ZM3A 3QT8A 4JI0E 1HR0I 4DUZI 4LF5I 4WUBA 1FKAE 4JI3E 3PRYA 5BR8I 5L3JA 1XMOE 4DV0I 1XMQI 3B82A 2UXDI 1FI4A 4HYMA 1K47A 3Q6NA 4B3SE 4DUYI 4DR7E 4NXME 2IOPA 4JV5I 4HACA 4M1KA 5FLXQ 2UXBE 3HULA 1WUUA 5IWAE 4JI7I 4LF7I 4JI4I 2Z5CB 2UUBI 2E1RA 2ZITA 3WU4A 3M6AA 4DR6E 5LMUE 2O1UA 4OX9I 1OJ4A 2F4VI 1HNXI 1IBKE 1Z0BA 1PIEA 2BM0A 4HXZA 4DR5E 1N0VC 1HK7A 1XNQI 5LMNI 3ZZ0A 4GKJI 4IZKB 2UUCI 4DV7E 1S16A 4DR4I 1Z59A 4JI2E 4KHPE 1H7SA 4X66I 4DV6I 4FWDA 2HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVI A;  5LL6 R;  4X62 I;  4JYA E;  4DV1 E;  4USM A;  5GMD A;  3JAM C;  4JI6 I;  1J5E E;  2R42 A;  2UXC E;  1FWL A;  4DPY A;  4LFB I;  4JI1 E;  4B3T I;  1HNW E;  1A6F A;  3JAM Q;  1XNR I;  4DV5 E;  4JI8 I;  4B3R I;  4ED4 A;  4YHH I;  3ZZT A;  4LF6 I;  1I94 I;  4LF8 E;  3J81 C;  5A2Q C;  1H72 C;  1HNZ I;  2V8P A;  1ZM4 A;  4URL A;  4LFA I;  1IBM E;  4DU8 A;  4NXN E;  1Z0E A;  1Z0V A;  3J81 Q;  5A2Q Q;  4JI0 I;  1RRE A;  3V5R A;  3F0N A;  3LPS A;  4UT4 A;  4LFC E;  1Z0C A;  4DU7 A;  2HFS A;  4MYT A;  1KTV A;  1IBL I;  4YY3 E;  4FWH A;  1N32 E;  4AQY I;  1Z0T A;  4B3M I;  4DV2 E;  4K0K E;  2BM1 A;  2Q2E B;  4DV4 E;  4FWG A;  4DR2 I;  3D4J A;  1MG7 A;  4RPF A;  4LF9 I;  2V34 A;  1N33 E;  4DV3 I;  1EI1 A;  3QT7 A;  1NHI A;  1MU5 A;  4X65 I;  1FJG E;  4JI5 I;  3PYD A;  2VQF I;  2CZ9 A;  3T1Y I;  4DR3 E;  1H7U A;  2NPF A;  2HHH I;  2UU9 I;  1H74 A;  2OI2 A;  3B78 A;  3T1H I;  1QZR A;  4X64 E;  3B8H A;  2ZM6 I;  4DPW A;  4GKK I;  1ZXN A;  2V2V A;  1ZM2 A;  3OTO I;  1N36 I;  4DV1 I;  2WW4 A;  1HR0 E;  2AJ4 A;  4DR1 E;  1VIS A;  4DUZ E;  4FW9 A;  3ZM7 A;  5BR8 E;  2R3V A;  4DV0 E;  1U2R A;  1XMQ E;  2UXD E;  1Z5B A;  3CWV A;  5GME A;  4DUY E;  1DAR A;  4USK A;  2J7K A;  3J7A M;  4JI7 E;  1H73 A;  4JI4 E;  2UUB E;  4R1F A;  2X36 A;  4OX9 E;  2HKJ A;  2DEJ A;  2F4V E;  2VQE E;  4LF4 E;  4YY3 I;  2V2Z A;  3K1J A;  3WU3 A;  4Z7C A;  1EA6 A;  1NZ0 A;  4DV4 I;  5IT9 C;  3Q1Q A;  3PYF A;  1XNQ E;  3ZZU A;  4GKJ E;  4JI3 I;  2ZBK B;  4DR4 E;  5IT9 Q;  2BV3 A;  1XMO I;  4X66 E;  4DV6 E;  1MX0 A;  4PRV A;  1KKH A;  4X62 E;  4JI6 E;  2HKE A;  4B3S I;  2UUA E;  4DR7 I;  4HAC B;  4NXM I;  4LFB E;  2V2Q A;  4B3T E;  2UXB I;  3ZKD A;  5IWA I;  3GON A;  1XNR E;  4XTJ A;  4EMD A;  1NHH A;  1Z5C A;  3V2U C;  4B3R E;  1N34 E;  4LF6 E;  4DR6 I;  5LMU I;  3K17 A;  1I94 E;  1HNZ E;  4P7A A;  4LFA E;  1IBK I;  4DR5 I;  4P52 A;  2A2C A;  4PU9 A;  4DPU A;  4DR1 I;  4PRX A;  1FWK A;  1N0U A;  1IBL E;  4AQY E;  4DV7 I;  5FLX C;  4B3M E;  1KIJ A;  4JI2 I;  1S4E A;  1PKP A;  4KHP I;  3PYG A;  2E5L E;  4DR2 E;  2GS8 A;  1B63 A;  4JYA I;  3LNU A;  4LF5 E;  1NHJ A;  1J5E I;  4LF9 E;  1UEK A;  2UXC I;  1ZM9 A;  4HY1 A;  4JI1 I;  1HNW I;  4DV3 E;  1ZXM A;  2HK3 A;  1Z0W A;  2LJP A;  2VQE I;  4DV5 I;  4LF4 I;  1D6T A;  4WUD A;  4X65 E;  1XHK A;  3WU5 A;  4LF8 I;  4Z7Y A;  1RR9 A;  4JI5 E;  4JV5 E;  4FN5 A;  2VQF E;  1Z5A A;  3T1Y E;  1IBM I;  4NXN I;  4LF7 E;  2HHH E;  2UU9 E;  1B62 A;  3T1H E;  3J80 C;  2ZM6 E;  4LFC I;  3LTO A;  1HNX E;  4GKK E;  1N32 I;  2VF3 A;  3J80 Q;  3OTO E;  4DV2 I;  1KVK A;  1N36 E;  1PVG A;  4K0K I;  2UUA I;  4JG4 A;  2A2D A;  2EFG A;  3ZKB A;  5LMN E;  2DEI A;  1BKN A;  2UUC E;  1N33 I;  1N34 I;  4DXL A;  1Z0G A;  4MYU A;  2XEX A;  2HFU A;  3QT6 A;  3WU6 A;  4I3H A;  3J7A G;  1FNM A;  1FJG I;  4UTG A;  2X7I A;  4DR3 I;  3PYE A;  4KQV A;  4DPX A;  4JI8 E;  4YHH E;  4X64 I;  3QT5 A;  1ELO A;  3H4L A;  4DPT A;  4WUC A;  2E5L I;  1ZM3 A;  3QT8 A;  4JI0 E;  1HR0 I;  4DUZ I;  4LF5 I;  4WUB A;  1FKA E;  4JI3 E;  5BR8 I;  5L3J A;  1XMO E;  4DV0 I;  1XMQ I;  3B82 A;  2UXD I;  1FI4 A;  4HYM A;  1K47 A;  4B3S E;  4DUY I;  4DR7 E;  4NXM E;  4JV5 I;  4HAC A;  4M1K A;  5FLX Q;  2UXB E;  3HUL A;  1WUU A;  5IWA E;  4JI7 I;  4LF7 I;  4JI4 I;  2UUB I;  2E1R A;  2ZIT A;  3WU4 A;  3M6A A;  4DR6 E;  5LMU E;  4OX9 I;  1OJ4 A;  2F4V I;  1HNX I;  1IBK E;  1Z0B A;  1PIE A;  2BM0 A;  4HXZ A;  4DR5 E;  1N0V C;  1XNQ I;  5LMN I;  3ZZ0 A;  4GKJ I;  2UUC I;  4DV7 E;  1S16 A;  4DR4 I;  1Z59 A;  4JI2 E;  4KHP E;  1H7S A;  4X66 I;  4DV6 I;  4FWD A;  2HK2 A; 
#chains in the Genus database with same CATH topology
 1HW9 A;  3JSM A;  2GNK A;  3LAL A;  4LIW A;  1URN A;  4RWX A;  1FWL A;  2EFP A;  5HJX A;  4PXD A;  1VRT B;  2ADB A;  4BBY A;  1W2B R;  4DL6 A;  1RWN B;  4TNO A;  1CBK A;  3HKZ D;  1SL1 A;  2F1D A;  4LFA I;  3OUY B;  4P2S A;  1LWX A;  3HM9 A;  2ZHB A;  4K4S A;  4I0W A;  3V5R A;  4HHJ A;  5B09 A;  1RUS A;  2Q3P A;  4DUY J;  5A6W A;  1YGY A;  2BW2 A;  4B9V A;  5EX0 A;  1RT3 A;  2QLB B;  4ZJQ A;  1A9N B;  3NOG A;  2EK6 A;  4CT8 A;  1NJZ A;  3MAH A;  2ZM6 J;  4I2Q A;  2FHJ A;  2R7U A;  4J5O A;  4KTQ A;  1U0H B;  4DQP A;  4ES1 A;  3K2Y A;  3A3P B;  2IES A;  4AIM A;  1YRX A;  3DKD A;  3VAL A;  1FDB A;  1FJG E;  3PYD A;  2FJX A;  5HAT A;  4RX6 A;  4KGZ B;  4OZJ A;  3EGN A;  2FGC A;  3DLG B;  2GVZ B;  4M5K A;  4QIG A;  4GRS A;  1RTZ A;  3NBP B;  3OTO I;  4NYO A;  4U9R A;  2DXE A;  4Y2M A;  1VIS A;  4NLY A;  4FYW B;  1HI0 P;  2NXE A;  3I32 A;  3IGN A;  2DHS A;  3W7B A;  2NZC A;  1WC1 A;  3OL6 A;  2MYF A;  3CJ8 A;  2PO0 A;  5AXK A;  4USK A;  4AE5 A;  1D3W A;  1ZH5 A;  3VCD A;  3J7A M;  3BM7 A;  2GQC A;  3LPE A;  2BBE A;  2X36 A;  1IR0 A;  1OIA A;  2DEJ A;  2RUS A;  3W3S A;  2CQP A;  1YIT S;  3K1J A;  2YPY A;  5C24 A;  4AD6 A;  5G0R A;  1W2I A;  5KFH A;  5IWA J;  4IR9 A;  3RUB L;  1MN9 A;  2PNL A;  3D0I E;  4DV3 J;  3N5B A;  4IO1 A;  5CD4 A;  5JUM A;  4HEA 9;  4ED0 A;  5A0Y A;  2RD5 C;  3M6X A;  2DGX A;  3CD0 A;  2UU9 J;  4DV6 F;  4PUO B;  1SUQ A;  4CYU A;  2GVD B;  3UCG A;  1U26 A;  3SZ2 A;  4I67 A;  3DDK A;  4A46 A;  4MH8 A;  3KLE B;  3C16 A;  1LOU A;  2MZR A;  2JEA B;  2CJK A;  2D7S A;  1IBK I;  3QLH A;  4KT0 C;  2C2N A;  1D9D A;  1F9E B;  3M6V A;  4I64 A;  2QLF B;  3BS9 A;  2G9O A;  5DRO A;  2DH7 A;  2GO3 A;  1TL3 B;  2HWT A;  2CGE A;  2RKI A;  4OX6 A;  5FLX C;  3PYG A;  1DLO A;  1RWX B;  3AJ1 A;  1UDS A;  2E5L E;  4CLY A;  5LSO A;  2GS8 A;  2C2K B;  5ETV A;  2EFQ A;  4HT5 A;  5B0D A;  3BEG B;  3O44 A;  2JLE A;  2R2U A;  1ZTT A;  4CDI A;  5D4P A;  4DV4 J;  1H38 A;  1N5Q A;  2ZJP Q;  1FO1 A;  4CTA B;  1VC5 A;  5F8J A;  3HT3 A;  2K3K A;  4A4J A;  2VQF E;  3OQ2 A;  1Y4U A;  3EPI A;  2YX4 A;  4Z2X A;  5D6G A;  2LKZ A;  3UNY A;  2DCU B;  3H4B A;  4DS4 A;  2AKW B;  2UVR A;  1VRU B;  3SV3 A;  1JWW A;  4TY9 A;  1KVK A;  3N5F A;  2ZM6 F;  2KYZ A;  2XGQ A;  4DX7 A;  2JC1 A;  3K59 A;  2DJW A;  1HWI A;  8RUC A;  3MHY A;  5GAD U;  1HD0 A;  1EB0 A;  3E8O A;  4N8N A;  1IKX A;  3J7A G;  1FJG I;  2EPI A;  1EQM A;  1FXL A;  3NL0 A;  5HAO A;  2UUT A;  1HNI A;  1MWZ A;  4EZ9 A;  2DYA A;  5K9F A;  3CC7 S;  1X5O A;  1MRO B;  2AJ0 A;  1XR5 A;  3M85 G;  2E1A A;  3CJ5 A;  4IFD E;  2AV5 A;  5J2P A;  1F5A A;  2NRE A;  2V68 A;  2JJ4 D;  3I0S A;  3ZXW A;  2YWH A;  2M8D B;  4BWJ A;  4MU0 A;  2BAN A;  4PCQ A;  3KLH B;  4ZN1 A;  4E2F B;  4LOM A;  2C22 A;  1X7V A;  1WHW A;  2BQU A;  1AUS L;  4ILL A;  2IYI A;  2ZIT A;  4K4T A;  5IWA F;  2OTJ S;  2C3Y A;  4DR6 E;  1BQX A;  2NN6 D;  1W25 A;  4C0O C;  1YX2 A;  2R7Q A;  3M8P B;  3P3C A;  3I9V 9;  3WBZ A;  1VQN S;  1UAW A;  2BJ7 A;  2JX2 A;  3PEJ A;  4DQR A;  3QQC D;  2B9X A;  2RJZ A;  4DFP A;  5H9E J;  4QYZ J;  3ULH A;  2BA0 G;  4IFD A;  2AIR B;  2ZOM A;  4O0I A;  3GU0 A;  3Q0A A;  2MSS A;  2XUL A;  2R7W A;  1KQS R;  4N7T A;  2DRA A;  4BS2 A;  1P27 B;  3HVW A;  3TUP A;  5GMD A;  4CRJ A;  1S59 A;  3GIK A;  1R0C B;  5EKW A;  4DPY A;  1FE4 A;  4QR2 A;  2DT9 A;  1X60 A;  3GYX B;  4ZP7 A;  4IDK B;  2F9J A;  5JJB A;  1P42 A;  2YKA A;  3QJL A;  1USU A;  2OEM A;  5A2Q Q;  1RKI A;  4YQW A;  2JRS A;  4IRC A;  4PYD A;  2BVZ A;  2FVP A;  1OYP A;  2BA1 D;  3T1Y J;  3DLH A;  1T9U A;  1UCN A;  4WBF A;  5CYQ B;  4LF7 J;  2MZT A;  5KFT A;  5L38 A;  3H5U A;  2CVE A;  3MEK A;  1RAD B;  2J6S A;  2P6T A;  3M6W A;  5IZH A;  4DV4 F;  4TY8 A;  2I0X A;  3SQG B;  2HS4 A;  3AOA A;  5DQI A;  5JEA E;  4J9P A;  2FJA B;  3TAP A;  5K36 B;  1JB0 C;  2Z5B B;  4DSF A;  3WZ0 A;  1RKJ A;  2VQF I;  4F0K A;  4FW5 A;  2XB2 D;  2UUW A;  3TEH B;  1S1U B;  2AGQ A;  2IDL A;  2RQK A;  5HI7 A;  1RU2 A;  4QU7 A;  2BJ8 A;  4PYA A;  5KFC A;  1M5H A;  4NOH A;  4DUT A;  4FW4 A;  3OVA A;  3NXZ A;  2G0C A;  5D0G A;  3N6N A;  3PX0 A;  3DRS A;  1T05 A;  2GGP B;  3KNA A;  4DR1 E;  3JAM U;  1UVJ A;  4DUZ E;  4JI8 J;  4FW9 A;  3PNI A;  3DRY A;  3BO4 A;  2V8G A;  2VA3 A;  1GTE A;  4UOC A;  1S1X A;  2E9Z A;  1NHU A;  3F44 A;  4LT6 A;  1U1N A;  1RBO B;  3IFE A;  3VZH A;  1RIS A;  1SH3 A;  4CM0 A;  4OI4 A;  2UVW A;  4RU9 A;  1RAJ A;  2UUB F;  2MPU A;  4LF4 E;  1P8G A;  1X9S A;  3P5B P;  3M1V B;  5D4L A;  1SIW B;  3D5M A;  4RNO A;  3GV7 B;  2ZUG A;  4BWM A;  3IWN C;  1YG0 A;  4CM2 A;  5E2Q A;  2POK A;  2PO1 B;  2L9W A;  4X66 E;  2VBY A;  1Y5I B;  1NKC A;  2PMZ D;  1S6U A;  2GV1 A;  5JXS A;  2YNI A;  1N5T A;  2RU3 A;  4V1A k;  4EK2 A;  2ZVS A;  3W5Y A;  4DR6 I;  4DV1 J;  4FYD A;  3FVY A;  3JXO A;  2YTC A;  1ZZF A;  5KG6 A;  2QIF A;  4DJB A;  4USU A;  1WAC A;  1ZBT A;  3LP2 A;  2J76 E;  3R6G B;  4G6V B;  4P73 A;  4QCL A;  4QYZ K;  3KKF A;  2XS7 A;  4KO0 B;  4MK9 A;  1W26 A;  3AOB A;  4AFF A;  5HRO A;  4P2X A;  4PXB A;  3N9U C;  2V94 A;  4HYK A;  3LNU A;  3G8S A;  2A10 A;  3G2X A;  5I3Q A;  3TX8 A;  3H42 A;  4ED2 A;  2CQB A;  1NK9 A;  3AA8 A;  4HY1 A;  4NE9 C;  2HQI A;  1S9E B;  3IGV A;  4LF9 F;  3TA2 A;  4B9S A;  3AXK A;  5KFS A;  4IUF A;  1TFY A;  3TAR A;  3W8P A;  4J9V A;  5ETR A;  2AU0 A;  3C3L A;  2U2F A;  2ZE2 B;  4ZHR A;  2HVZ A;  1Y5L B;  1X4C A;  1XEZ A;  1Q8I A;  3T1Y F;  2IJN A;  4WP9 A;  1F60 B;  4LF7 F;  3IA0 A;  3U1Y A;  3T6B A;  1SQF A;  1ZOT A;  1SC3 B;  3G82 B;  1R7I A;  2AE8 A;  3B4D A;  4LSL B;  3L7U A;  2W2O P;  3QAU A;  1LNQ A;  2RNE A;  5LMN E;  2DIS A;  1C0T B;  3VVT A;  2EK1 A;  1FXR A;  1M1G A;  4DXL A;  2D3U A;  2PN6 A;  3OPK A;  1AUD A;  3PRV A;  4JUZ A;  7FDR A;  3SI8 A;  1O51 A;  2DGQ A;  4XPC A;  2E1C A;  5CD4 H;  3EZO A;  2C38 A;  1W7W A;  4A47 A;  5KG7 A;  3CXC R;  1M1H A;  2CQ1 A;  2FUG 9;  3PYE A;  2BE2 B;  3EDQ B;  4FXW A;  4USV A;  4YHH E;  4EO8 A;  2CPY A;  5CYJ A;  4GVB B;  3HHL B;  4JI8 F;  2HRT A;  4O3Q A;  2X51 A;  1N6Q A;  1BMQ B;  1ZA2 B;  3FRZ A;  1VQS A;  3QT8 A;  4DUZ I;  4K7Q A;  4DQI A;  1Y5Y A;  2ZH6 A;  4EU0 A;  1RT1 A;  1XMO E;  3ZTS A;  4FKX A;  2GMH A;  3A8K A;  3H5Y A;  2RU9 A;  4LBI A;  4PRF A;  4QIV A;  2HBQ B;  2YQ3 A;  3K5M A;  2HYI B;  3A3O B;  2WTF A;  2D1C A;  5E0O A;  3B54 A;  5AXN A;  4OLO A;  2DPI A;  1FT8 A;  4X62 J;  1LQ9 A;  4JI6 J;  5KT3 A;  3M2U A;  1TL1 B;  4ED3 A;  1YK9 A;  2RB7 A;  3MXH P;  3RBE A;  2VUG A;  2VG7 A;  3R7N B;  4I1T A;  1E6V B;  4C8K A;  4NLO A;  1FNX H;  3GII A;  1K9M T;  2CJY B;  3DLB A;  4X66 I;  1WD6 A;  1VFJ A;  2DNQ A;  1U2F A;  1ITP A;  5CYM B;  2FJW A;  2NS1 B;  1ZAV A;  2R42 A;  2N3L A;  1Z4U A;  1S48 A;  1XQI A;  3BV8 A;  4DV1 F;  2ZC3 A;  4WKY A;  1A6F A;  2J8S A;  5ETS A;  3C6U B;  1Q1K A;  2CQC A;  3CED A;  4EBE A;  3V81 A;  1UFL A;  5H1S V;  1MWY A;  1SBR A;  1R8H A;  1Z0V A;  4YB5 A;  5DZ6 A;  1T0T V;  3HSZ A;  4TQS A;  4F50 A;  1UDO A;  4K8R A;  5CAA A;  1PJ6 A;  2P2C B;  3MM5 B;  1UA0 A;  3CTR A;  1DFD A;  3T1H J;  2BM1 A;  2HQD A;  1PJ5 A;  3MED A;  1MG7 A;  1LWC B;  5A8R B;  2PO2 B;  5H9F J;  5ADZ A;  5K36 F;  2FB0 A;  1N36 J;  4RW9 B;  2W2M P;  2AW0 A;  2X3G A;  3LP1 A;  5KOW A;  1Y5N B;  1X5T A;  4MFB B;  3BGU A;  3BRE A;  3GE9 A;  3OR2 A;  2J9E A;  2DO0 A;  1S6Q A;  3R27 A;  1HMV B;  2OI2 A;  4ANC A;  3OXL A;  5F3Z A;  3HDS A;  5DLG A;  4FW7 A;  5C0X C;  3M6U A;  2R8H A;  5HBM A;  3AD7 C;  3KK3 A;  1FKO B;  1DZ5 A;  2C3P A;  3IS9 B;  1K0T A;  1FKP B;  2YX1 A;  4OI1 A;  3RU0 A;  4HDG A;  2OPQ B;  4DV0 E;  4EEY A;  2GC8 A;  1PYO B;  4ZIW A;  2CJB A;  1CS4 A;  2LQ8 A;  4JI0 J;  2XY5 A;  1K44 A;  1FRH A;  1S0O A;  4AL5 A;  1FRK A;  4X4Q A;  2C2Z B;  4FYX B;  3L4B C;  2W9B A;  5C2G A;  5HLF B;  5LM7 E;  3ILJ A;  3ZZO A;  2ZDP A;  5FDL A;  3H2L A;  1UVM A;  1Y6Z A;  3ENA A;  1VI7 A;  3DRR A;  4LR8 A;  4QZV B;  2IVF B;  1F5C A;  2PA3 A;  1T03 B;  3AQP A;  1T7P A;  2DNM A;  2AT1 B;  2ASD A;  2ROP A;  2VJV A;  1UVN A;  1GK8 A;  1YZ6 A;  4FNI A;  4NRU A;  4DL2 A;  1P9Q C;  1XMO I;  2E44 A;  3IXQ A;  2CNN B;  1NXI A;  4RBV A;  2NCK L;  2QSW A;  3QMQ A;  2DR6 A;  4X62 F;  1HA1 A;  2PNZ A;  4JI6 F;  4YFU A;  3IO1 A;  2CPI A;  3M8Z A;  3G6E S;  3UFC X;  4QYR A;  1UWB B;  2ILY A;  2QLX A;  4R0E A;  1D09 B;  1KEK A;  3M8Q B;  4JYA J;  2DGT A;  3PM9 A;  3UW1 A;  1XWL A;  1IKY B;  3KLG A;  3M85 D;  1HNZ E;  2CQ0 A;  4DQQ A;  5E3Q A;  5FII A;  2WON B;  3BO2 A;  4KH1 B;  4CH7 A;  4UZC A;  3FQK A;  4FS1 A;  3PJW A;  3N01 A;  4E98 A;  4WFZ A;  2RIL A;  4UUW A;  2ZH5 A;  4F3Q A;  2WBM A;  3QO9 B;  2FJB B;  4I69 A;  2KXH A;  3IBF B;  4ZP9 A;  1UZH A;  5IOL A;  1RT2 B;  2CPJ A;  1HBU A;  1WG4 A;  5IXU A;  3TP2 A;  2IM2 A;  1S0V A;  2H3E B;  2M8H A;  3FK4 A;  3D7S B;  4FN5 A;  3SXL A;  1Z5A A;  4V19 X;  2W7O A;  1RWU A;  3E3X A;  1R6Y A;  5KFP A;  3EZ5 A;  1FXD A;  3TAN A;  1KS2 A;  3MMC A;  2FQQ B;  3T1H F;  3D0H E;  5E33 A;  4FF3 A;  2PGC A;  5K8N A;  3LW5 C;  2KN4 A;  3J80 Q;  1FJE B;  2HBZ B;  2HHX A;  3DOM B;  2MZJ A;  4H4K C;  1H3D A;  2BZ2 A;  1N36 F;  3QIP A;  4AXJ A;  1C1C A;  1WOR A;  2E5J A;  1IKW A;  2N7C A;  4LRF A;  4O4G B;  4QIF A;  4K4Z A;  3WU6 A;  5BR8 J;  4ID8 A;  3CCQ S;  2Y3Y A;  1UWA A;  3Q8Q B;  3HKW A;  1S7I A;  1CSJ A;  3ENW A;  5FLX Y;  1XC9 A;  4K4V A;  1X8D A;  3KG4 A;  5HMX A;  3EX7 B;  1FFG B;  1S5Z A;  2FJE B;  2HBY B;  3EVW A;  4EWT A;  2AJ1 A;  2C2O B;  3HCX A;  2VQE J;  1CJT B;  3CD7 A;  5L1I A;  2K3I A;