1K47A

Crystal structure of the streptococcus pneumoniae phosphomevalonate kinase (pmk)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
322
Chain Sequence
HMMIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQSFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Streptococcus pneumoniae phosphomevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Streptococcus pneumoniae r6
molecule tags Transferase
molecule keywords phosphomevalonate kinase
total genus 102
structure length 322
sequence length 331
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2001-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1k47A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1k47A01
1IBLE 3M6AA 4FN5A 1N32E 4YHHI 4M1KA 4DV7I 4PRXA 3J81Q 4DR6I 4JI2E 3J7AG 4FWGA 2V2ZA 4HACB 2VF3A 3ZZUA 4JYAI 1MX0A 4YY3I 4DUZE 1XMQE 3J7AM 1RR9A 4JV5E 4JI1I 3WU3A 2DEJA 2WW4A 3Q1QA 4LFCE 4LF9I 4JI3E 1IBKE 3D4JA 4JI3I 4WUBA 2Q2EB 4HYMA 3WU6A 1NZ0A 1HNXE 2VQEE 1PVGA 4DV0E 1EA6A 4HXZA 2E1RA 4DV4E 1HNWI 3QT6A 1FNMA 2UU9E 3ZZTA 2A2CA 4JI0I 2UUBI 4LFAE 3QT8A 1IBMI 2ZBKB 1XHKA 1XNRI 1XMOE 4JG4A 4DR1I 4P52A 4X64E 3WU4A 4B3RI 3HULA 1N36E 1ZM9A 2UXCI 3PYFA 4DV6E 4DR5E 1XNQE 1FI4A 2E5LE 5GMEA 1Z0EA 4LF7I 1HNWE 1Z59A 1ZXNA 4DPTA 2UUCE 1A6FA 1PIEA 4JI0E 1Z0TA 2UUBE 4LFBE 4KHPI 4DV3I 4NXNE 1ELOA 1XNRE 1HNZI 1FWLA 1MU5A 5GMDA 2BM0A 4MYTA 2UUAE 1I94I 1NHJA 1Z5BA 2F4VE 4B3TE 5BR8E 4RPFA 5IWAE 2UU9I 2E5LI 5IT9Q 4DR7E 1N33I 2LJPA 1Z0WA 2X7IA 3OTOI 4DR4E 1J5EI 4B3ME 4OX9E 3T1HE 4B3MI 4FWDA 2V8PA 4FW9A 4DR2I 1KTVA 3JAMQ 2UXDE 2HFSA 4UT4A 2UXDI 4P7AA 4GKJE 1H72C 1B63A 4JI5I 2R42A 2BM1A 4PU9A 4GKKE 2HHHE 3LPSA 1Z0GA 4DPUA 2OI2A 4HACA 5FLXQ 4Z7YA 4K0KE 3LNUA 4JI2I 3V2UC 4ED4A 2R3VA 1Z0VA 4DR6E 2J7KA 2UXBE 4YY3E 4ZVIA 1I94E 1N34I 1OJ4A 2NPFA 1PKPA 2UXCE 4DV6I 1WUUA 3ZKDA 4DR5I 1XNQI 4JI4I 2XEXA 3ZM7A 4X62I 4X62E 4LF4E 4AQYI 4K0KI 5LMNE 1DARA 4DR3I 4DUYE 3PYDA 2VQFI 4GKKI 4NXMI 1KKHA 4B3TI 3ZZ0A 2ZM6E 3B8HA 1H74A 3LTOA 4X66E 2GS8A 4LFAI 5L3JA 1Z0CA 2DEIA 1N0UA 4B3SE 3J80C 4USMA 1MG7A 1N36I 4LF6I 4JI6E 4LF6E 4DR3E 4JI6I 5IT9C 4JV5I 3F0NA 4DV4I 4LFCI 2HK2A 4X65E 2HHHI 4KHPE 4LF9E 4LFBI 2BV3A 4USKA 4Z7CA 1U2RA 1HNXI 4DPXA 4YHHE 4NXNI 4DV7E 4DV3E 1NHIA 4JI7I 1HNZE 4B3SI 2X36A 1HR0E 2UUAI 4JYAE 3T1YE 2ZITA 3T1YI 1RREA 1FJGE 1S4EA 4LF7E 4DUZI 1N33E 1VISA 4EMDA 4LF8I 3OTOE 4DR4I 4JI1E 4DR1E 1BKNA 1NHHA 3K17A 4UTGA 3V5RA 2HKEA 3J80Q 2UUCI 4WUCA 3PYGA 5LMNI 1B62A 1ZXMA 4DV2I 1HR0I 2V2QA 4DV1I 1N0VC 2CZ9A 2EFGA 2HKJA 5A2QQ 3CWVA 5A2QC 2AJ4A 1FWKA 2HFUA 1Z5CA 4HY1A 4MYUA 4DV5E 3H4LA 4DPWA 2UXBI 4JI7E 4OX9I 1IBME 1FKAE 1J5EE 4X64I 4WUDA 3J81C 1N34E 1XMQI 1UEKA 5IWAI 4DXLA 1H73A 3QT5A 4DR7I 3GONA 1Z5AA 4JI5E 1K47A 1H7UA 1S16A 1EI1A 3QT7A 2A2DA 1ZM4A 4X65I 1IBKI 1KIJA 3T1HI 2HK3A 3B82A 1N32I 4DR2E 4DV5I 4DV0I 4KQVA 4GKJI 1ZM2A 2VQFE 4FWHA 1H7SA 4DV2E 5FLXC 4DV1E 1Z0BA 2F4VI 4NXME 2ZM6I 4JI4E 4DU8A 4X66I 1FJGI 1IBLI 5BR8I 1XMOI 4R1FA 4LF8E 1KVKA 3JAMC 3WU5A 4B3RE 4JI8E 4I3HA 4DU7A 1QZRA 4JI8I 4AQYE 4LF4I 3K1JA 3PYEA 2VQEI 4URLA 4DUYI 2V34A 4PRVA 4LF5I 2V2VA 1ZM3A 4LF5E 5LMUI 1D6TA 5LMUE 5LL6R 3ZKBA 3B78A 4DPYA 4XTJA
chains in the Genus database with same CATH superfamily
4TLQA 5KFSA 3M2RB 1T02A 2IA0A 1T9XA 2X1GA 4KQZA 1NUEA 2JVRA 4UOHA 1YJRA 1JKHB 1WG4A 3WQPA 3NKYA 1W7WA 2QMWA 4DI6A 3KLIA 3FUYA 4FN5A 3BQ2A 1N32E 1JXVA 4KKOB 4P7TA 2PI5A 3U27A 1RHYA 1RA7A 5IQ6A 2K8GA 2L48A 2DK2A 2IAJA 3PJ9A 2I1RA 4O4RA 3SQOP 4DR3J 3R2CJ 4JI2E 3J7AG 2DCUB 3IXQA 1LWXA 1XXEA 4HACB 1JLFB 4UQGA 5LM7E 2VF3A 2DIUA 1JLCA 4HI1A 4JYAI 3RG6A 4CIOA 1MX0A 1I6JA 8AT1B 1RDRA 2GIFA 5L8RC 2R9LA 2C37A 2OP5A 3PS1A 5IM0A 2EPIA 2ILZA 3H90A 3IM9A 2RRBA 2OSRA 4AFFA 3CJTA 2UXBJ 1GTHA 3R5DA 1DBDA 3LQVA 4FXWA 4WU2A 3BS9A 3J80U 1CBKA 5CQGA 5CXTA 4E0DA 2VONA 2ILYA 2RSQA 1FTRA 3CD5A 3FZBA 4TN2A 1O0PA 1SJ3P 2DEJA 2GNKA 2WW4A 3W2VA 3T9ZA 5ETLA 2IFXA 1N8RT 4DV3F 4AL5A 1Z2LA 1DLOA 2W24A 3DRYA 1WC4A 2GO9A 1C4AA 2NXCA 2R8HA 1REGX 2DNMA 3OXFA 1WF0A 3ENWA 3QZ8A 4FF2A 3I9V9 5HLFA 2DR5A 4WKRA 1YQHA 1HD1A 4UZCA 3P5TL 5JEAF 3TJAA 4DR5I 2CVIA 2P9GA 3FC9A 1KHWA 5ADZA 1RTIA 1HFEL 2MEWA 2VQEE 3OFGA 4Y2AA 3P76A 2OTJS 1GAOA 1S6PB 3IM8A 2E5LF 2V6AA 2MKKA 5C24A 2WONA 2PO0A 4IFYB 4WU3A 4F4XA 3KNGA 1EETA 3K5PA 1QVGR 3KK1A 1BQXA 1VK3A 3I5CA 3TUIC 1U0HA 1YVFA 3T6JA 3EPGA 4B9TA 3L7ZB 4C8MA 4HXZA 1VI7A 2EI5A 1C1BB 1F2HA 1X31C 3LUYA 1Y5NB 2UUTA 3QT6A 3FEXB 5AXNA 4DV5J 4CO4A 4BA2B 1BXNA 1N36J 4LBPA 1FKPB 3JSRA 4K2XA 3DM2B 4I6YA 3LF0A 4MDTA 1DTQA 2A10A 3OXGA 2FD2A 4F4WA 5CCLA 2IERA 2A2CA 1RE1B 5KFZA 1DTTB 4ZPCA 3OLBA 1IBMI 1Q8BA 5JEAA 1RWPB 2ZBKB 3OSPA 1XHKA 1VRUB 1XN9A 3HF5A 4FP9A 2BDPA 2XNRA 1G2EA 1XMOE 2YXLA 3A8IA 5J2MA 3CD6S 2BANB 2QT7A 3NAHA 3TUPA 3OVBA 4FW7A 5IT9Q 4ZVEA 5ETQA 1GMWD 4IH6A 3IWLA 4P52A 3PW2A 3NXZA 1YSJA 4J9UE 2WRMA 4TU8A 4ZKAA 3T3FA 4X64E 3DDNA 2KHCA 4GKJJ 1TKXB 4USWA 1L3VA 5K8MA 1E3PA 1N36E 1D09B 1HWIA 2V8VA 4KGMA 4RNMA 4CLZA 2PGCA 3FSIA 1CJVB 2YKPA 4ECZA 3LP2A 2FJWA 3C16A 2CPZA 5HI7A 1I3OB 1D9FA 2BKOA 3ZZYA 2ZH7A 3T1YJ 4NCBA 1LWEA 2IM1A 4ECTA 4IG3A 1U49A 1TVRA 2KG1A 3BGRA 1SJRA 3O1LA 4YQWA 2ALZA 2DTJA 1T9YA 1TZ0A 1V3ZA 1JJ4A 1SI9A 3M85G 2V8DA 2OH2A 2KU7A 1FERA 2JWNA 4DLGA 3OFHA 5CA5A 2JJ4D 3A1YG 1AZSA 2OEJA 2HWIA 3QAEA 2M8HA 3TEHB 4QW9A 2VFTA 4QZVB 3U1MA 1HI1A 3MM5B 1E6VB 2BR0A 4TYBA 4DQQA 4X2BA 4L76A 2GMHA 3R1LA 2E9ZA 3DN9A 3UVJA 3K7RA 1PIEA 5FJ4A 3V6DB 4NYPA 2RAQA 1Z0TA 2DIVA 5T7LA 7FDRA 3RBZA 3M1VB 2HHXA 3M30A 3MMAB 4J9QA 3QIDA 2LMIA 2NYIA 4LUBA 1ELOA 3S1TA 2D3O1 1XNRE 1NJZA 3BKUA 2E5LJ 3TX0A 4AL7A 1FA0A 4Q44A 1HW8A 1VQMS 4DR5F 1XNQF 3DYAA 3B4DA 3G8QA 2I5JA 2Z5CA 5EX3A 3AA8A 3PRDA 4XK8C 4PCQA 2FHMA 3NAIA 4JB8B 4NLVA 1G7CB 1UPPA 4A8MP 2KG0A 2DY1A 3U1YA 2ZH2A 3D28A 2ZH9A 1VRTA 4NI2B 2AGQA 3W61A 2FJBB 1NHJA 4CRJA 4O3RA 1R27B 4M5DB 4DX8H 3MF5A 3RJMB 1VQNS 2F4VE 1S6QA 4OI2A 5KFIA 5H9EK 1NK6A 5KT2A 2HVHA 2GC8A 3NL0A 2NREA 2UU9I 4ECVA 2DITA 4DCOB 3W9JA 2RQKA 2ZFHA 1R0AB 1NHUA 2BR2A 2PIIA 1TTHB 3MCSA 1P9QC 4YN3B 1HL6A 2A0FB 2QGFB 3J7YI 3KJVB 1FJEB 1HR0F 4C48A 2XG8A 1NSKL 3CDAA 5AXKA 4DR4E 3ZC4A 5K14B 5HN0A 1YHCA 1M5SA 4WFZA 4B3ME 4OX9E 4XTTA 4C2MA 3T1HE 4JV1A 1NDPA 3DM2A 4CLLA 4ZITA 3OFEA 1X7VA 1KLMB 3TA2A 2VPZB 3SCIE 3TARA 3T9NA 5A6PA 3OW2R 4JI0F 2UUBF 4BS2A 2HW3A 2YKAA 4QNJA 4TNOA 1FJGJ 4DR2I 3CW2C 3FFIA 3JAMQ 4I7FA 3NBPA 3GCXP 3M05A 3RW7A 2GQ0A 4N7TA 2I38A 2QO3A 4P7AA 2AE8A 3JQKA 3QBCA 3KK2B 5KFUA 4W98A 3JSMB 1K9MT 3KLGA 4B9SA 3PVXA 2DHSA 3A13A 4LVNP 4DV6J 3PO4A 1KTQA 1MU2B 2IY5B 4B9NA 5SZTA 5EDWA 1RAGB 3ISNC 4LOMA 3GIJA 1RT2A 2RT3A 2J6SA 2HHHE 4IFDE 1JIHA 3LP0A 1HNZJ 2V4JA 1Z0GA 2FLLA 1RTZA 1R31A 3KDOA 2OI2A 2P2CB 2VFRA 2SXLA 1T11A 4DL4A 5LL6d 4Z7YA 4J9SA 2EFVA 4LF6F 3BYRA 3C2PA 1SB6A 2EKYA 4K0KE 5C0XA 3C66A 2VJUA 3LNUA 3DXBA 2CAJA 4X4PA 4ED4A 2FHKA 2R3VA 4G1IA 4OYBA 1FEHA 2DRDA 2KB2A 2NN6B 4DR6E 3WBZA 5A2QY 4NPOA 3GIIA 1R6VA 2K3KA 1NPPA 3MM8B 3MECA 1CJTB 2H4YB 1U2CA 1ZPVA 2RS8A 3O8WA 3DMJA 1T7PA 1QD1A 2VUGA 4JYAJ 1N34I 4LPFA 2J9DE 2VASA 2GVDA 4OMFG 1AROP 1HBOB 1YKWA 4X4RA 2Z5EA 3OHBA 3CULA 3H25A 1O6XA 2W8LA 4K4XA 4DV1J 4DV6I 1WUUA 2HBYB 5C42A 5AE1A 3J80Y 3SZ2A 2ROEA 2D74B 4YHHF 5DG7A 4AT1B 4FF1A 1U8SA 4DV7F 2QIFA 3Q83A 2GX8A 4O44A 2F40A 3NMRA 3MCNA 1IQTA 4WFXA 1SH3A 1FXRA 3GP9A 4BC9A 5DDPC 2XMKA 4AM3A 2MPUA 2WHOA 4X62E 3AD8C 3IRXA 4XDCA 3C3LA 3ISZA 3T1AA 3D68A 1Y5IB 1OYEA 4ANDA 3HVWA 4YY3F 1RTDB 3ILOA 1S7IA 2Z56B 3BSNA 2RKIB 1FEEA 2CQPA 2YWKA 2CZVC 4NYZA 4C98A 1FJGF 2VPWB 1ZETA 5DS7A 3MDFA 1Q95G 3I32A 3H42A 5U47A 4ZIVA 1WACA 2FDNA 2GFFA 3DRXA 3PNIA 5GAHI 1UVIA 3EZUA 3FCHA 3ILLA 4OI4A 2CUYA 2QL7B 1RU1A 4M5JA 4DR4F 1U1LA 1D9AA 2DNNA 3K8WA 1UVJA 1UMJA 1H7WA 2QLWA 3I4PA 3IR7B 4ZP9A 4MU1A 3HZEA 4ZN3A 1J2VA 4GKKI 2HWHA 1F9HA 1YG0A 2QFJA 1XEZA 4O0IA 1R8BA 3CMQA 4Y34A 4C3LA 2ZDPA 4AE5A 2RH3A 3SQGA 1JX4A 1EI1A 1R89A 3KJNB 3OLAA 2NUUG 3B8HA 1H74A 4B3TI 4A4JA 1DQ8A 2LVWA 4HHUA 5C5JA 1R0AA 3EDQB 1K44A 1CLFA 2R4FA 3RRHA 1SPBP 2XMJA 1Z0CA 1HI8A 1U6FA 1VQOS 1JLBA 3R7NB 4U9RA 3CF5Q 2CJ9A 5D0RA 4FYYB 5HP1B 1FVQA 4B3SE 5RUBA 1E6YB 4OHVA 3ZO7A 3OJSA 2MHEA 1VHIA 3GJRB 2DXDA 3PEHA 1F1BB 1QE1B 1QE1A 1S57A 2B9EA 2EFNA 2XHCA 4YDDB 2Z57B 4ED1A 1UA1A 4C4WA 1DJ0A 3RGIA 3T5LA 3R1HA 4ITSA 1S99A 1FWPA 2UXCJ 2LU2A 2DGSA 2ZBPA 3D6TB 4LF6E 3RUBL 2KVIA 3UD4P 1RAFB 4C8OA 1JLEA 2EC0A 4KTQA 2JLGA 2UXDJ 4JV5I 2B8PA 4QNKA 2Z2MA 3NOCA 1JJCB 1IR0A 4Y2KA 3SBMA 4HY1A 2ZOGA 5B08A 2W9CB 3VAKA 4OJHA 3TWZA 2C2DA 1XNRF 4DV4I 2LKZA 1R6YA 2UVRA 3BYPA 1WC0A 2DGTA 2HK2A 3I5BA 2E5IA 1YITS 4HDHA 2AYGA 3C6UB 4B17A 2Z0GA 1U1OA 1USVA 5F3ZA 2YNFA 2DR7A 1XMOJ 3EE3A 2EFQA 3NS5A 4QWBA 3G96A 1EIYB 3DOLB 5MLCV 3ZTQA 2HGNA 2BV3A 2KDOA 1YRTA 3QFWA 3GJSB 1RWKB 1U2RA 4I2QA 4P75A 4USKA 1F6TA 1GQEA 1UFWA 2VBXA 3OD2A 3M8RA 1AW0A 1Q8IA 2FVCA 1RADB 2VBZA 3FBFA 1Y6ZA 1NXIA 4NXMJ 4DV3E 4DV7E 4E98A 5IWAF 1FRMA 5F0WA 4IZKB 1VQLS 2CDRB 1L3TA 1TELA 5JXSA 1KFSA 2X36A 2AZ1A 2XWXA 4FF3A 1APSA 5CYJA 3FJ2A 5CZVA 3BO4A 1HR0E 3T1YE 5GADU 4UOCA 3NS7B 2C2ZB 2WBRA 2OTLS 2D3ZA 4FNIA 3BH7B 2PA8D 3DKDA 1HWJA 3CVKA 5D4LA 1ZYQA 1WHVA 2DNOA 4G6VB 1UETA 1A6LA 2HQFA 3DMJB 3IRXB 4RBTA 2C2OB 3NEKA 5EWFA 1FJGE 1S6OA 4QIVA 1KC8T 4DV3J 3DLGB 3EPIA 4DJBA 2K7KA 4OZLA 1RU2A 4K7QA 2F8EX 2HIYA 4FPRA 5FDLA 3WDOA 1MWYA 4FNHA 4DV5F 1M90T 4JI1E 1VQSA 2DNKA 4KT0C 4RKUC 1V9OA 1IVZA 1RHKB 3AOBA 4MKBA 3UO0A 1IKVA 4DFKA 1B4SA 1FDAA 5LSOA 2EBEA 1PBUA 1I94F 4JV5J 1BKNA 2IM3A 4EYIB 1NHHA 2DR8A 2KM8C 3Q89A 3AJ2A 2XY7A 1RB0A 1ZA1B 1JK9B 2PT0A 1YX2A 2Y1LB 2C22A 3OL9A 2HS0A 2YWWA 2EKNA 1SC6A 1C0TB 4H4MB 2ZH5A 3HK2A 4OZNA 3TX8A 2Q3PA 3E2EA 2BE9B 2RJZA 3I0RB 2VICA 2CQCA 3GV5B 2FVPA 3GLLA 3CJ8A 1GFWB 1F9FA 3B54A 3D0GE 1N32J 4PQUA 2EFGA 1O5JA 3M7VA 2ZZMA 5KG7A 2XMTA 3H8YA 1N36F 4B3RF 5A2QQ 4RO0A 3CWVA 2F5GA 2QX0A 4F0KA 4TXSA 1RABB 2EG2A 2ASLA 4B3MF 2HFUA 5KFFA 3ZNJ1 3K57A 1NEEA 3CCTA 5HJYA 3IG1A 1Z5CA 1YK9A 3EGWB 3QSIA 4MYUA 1R0CB 4Y2IA 4J9RA 1CJKB 2NLWA 1RAOA 5L38A 1F9EB 4CM0A 3TA0A 1X0PA 3KK2A 3H4LA 2R8IA 2UXBI 4KHPJ 4MU0A 4R5PA 4ED6A 1WOSA 1KS2A 3CE8A 3NBPB 1FDDA 5E0OA 3OR1B 3JS9A 4RLEA 2HS3A 2KKHA 5LMUF 4JI5F 2CG9A 3GJQB 2CPFA 3TAMA 2HVEA 3C19A 5IC4B 2G13A 4RU9A 1M5PC 2R2UA 4WUDA 4YR0A 1NSQA 3MR5A 4CI0B 2DNQA 4WYLA 2XS2A 4IFVA 2FJVA 4WUCA 3DU6A 4DXLA 1KP6A 1AT1B 2IC3A 2M7SA 1V5VA 3QT5A 2BQ3A 2J0SD 1MNEA 4NLYA 3M8QA 1FXLA 3RBXA 2Z5CB 5EKWA 1E6YA 4JI5E 1HQEA 2HFVA 1AXQA 5AJ3F 1RHMB 4LF4J 2H5IB 2V63A 2M5YA 5A8RB 1DAXA 3I56S 5DQIA 4ISAA 4I1TA 3C46A 2PEHA 2ZHOA 3QT7A 1SV5B 3DLBA 1ZM4A 1B70B 1JLQA 4X65I 1BGXT 3Q8RB 2R7XA 1KIJA 3HHLA 4LQ3A 5B0DA 2A6MA 1Q0NA 2FZCB 4DN0A 2HK3A 4NRTA 1E6VA 2KJWA 4IR9A 2FJEB 5DDOC 4NMXA 1J5OA 2VG5B 3CDUA 1N32I 3NRBA 3VAHA 3N28A 4C8KA 4M63A 2I5JB 1S4FA 3KFWX 1YRUA 3Q8QB 1TL3B 2XWYA 2ZH1A 1M5VC 2WVDA 4B3OB 2LYVA 2IOQA 2HBRB 2VIHA 2WP8A 1Z1ZA 1WKLA 5HVGA 2CDQA 4NMLA 4C11A 5I3PA 4JBCA 1Q7LB 4IG3B 3KLVA 4DV2E 1IQZA 4ZVPB 2ACMA 2IHR1 2VJVA 5FLXC 5C7PA 3V81A 1CJVA 2G9OA 4O4GB 1Z4UA 3BQ1A 1HK7A 2D7SA 3FCVA 3RZAA 3KDNA 2HHUA 3Q8YA 3EVMA 3L7UA 1GXLA 4IG0B 4AQYF 3R7BB 4JI4E 3UI3A 2CWKA 5A8RA 2MY8A 5IV3A 4X4UA 2AJ1A 4E2FB 4YB7A 4ETXA 4DR3F 2PC6A 3ENVA 4LFAJ 4NLXA 2CADA 3FEZA 2E44A 2A1BA 5JVGQ 4DV1F 2R8JA 3KMQA 2JEAB 2AWZA 1LWFA 1ZBTA 4J7CA 4ELTA 1WEZA 2BACA 5LMUJ 3NGKA 2YQ0A 1RT7B 1RT6A 3JTOA 2ABYA 3VGVA 5DQGA 3P4UB 3CT9A 3A4TA 2YPYA 2OFGX 1N5QA 2MQMA 3H2LA 4PXCA 4ANCA 1OO0B 4DU7A 2DPIA 3AQOA 1DQ9A 4ZVGA 4OJGA 1Y4ZB 3UR3C 4LF7J 4LMZA 3MTKA 1A9NB 3VGUA 3S01A 1KDNA 2MLYA 2W4PA 3T5JA 3L3CA 1SKWA 2VA3A 2DNZA 2VQEI 3VGSA 4DUYI 2HZAA 4NLUA 4YY3J 4IO9Q 1RZMA 1S1VA 2BANA 3PFEA 4OZ5A 3GV7B 1VC6A 5GAHU 4O3SA 3QWUA 2WVFA 4IFYA 4EYHB 5HQMA 4LFAF 1NPRA 4LF1A 3DGVA 1Y5YA 4LF5I 4OO1E 1VJQA 2JX2A 4EO6A 2MJNA 4C3MA 1Y11A 3HSZA 1H98A 3IA0A 3BN7A 2MHNA 2X51A 3JAMU 2CG8A 1OYPA 2LXIA 2DB1A 2DHGA 1H2UX 3B78A 2HG4A 2KZZA 4QOTA 2ROGA 4OYAA 3IRWP 5DNLA 4BA1B 1C1CB 2QLJB 3THVA 2CGEA 2EK1A 2F8MA 4DX5A 3RB6A 4M5GA 5E3AA 3D1QA 3EGVA 2H51B 3ONQA 4JI6F 4K4TA 4YR3A 1URNA 2ACYA 3N0VA 5ETOA 4LIRA 4LRCA 2H48B 1JXEA 4PUOA 1K1QA 4QW8A 4JI1J 3PY8A 1VJWA 2BRKA 1R8PA 2EFPA 4U7CA 5J2PA 1FFGB 4GC7A 2A3JA 2WSCC 4J9KA 5JEAE 1RGVA 1RTIB 1LKZA 2I0XA 2UUAJ 4WF9Q 2RQMA 2JEIA 2AQ4A 4WFBQ 1XWLA 4JUZA 4KH0B 4PYDA 3KLHB 5IM0B 4AXJA 2JNJA 5K9FA 4U3BA 5HANA 2DBBA 1OPZA 3A3OB 1YJ9S 4RNHA 2JEBB 2OJ3A 1QDUB 2HHVA 4F25A 2QC3A 3VR1A 1RR9A 1Q53A 1U2FA 4JV5E 3DGPA 3L95X 1KRPA 3DOKA 1R6LA 4ZCKA 4MKYA 4JI7F 1Q4RA 1QUPA 5KFGA 1WKKA 1IR2A 3G87A 1X0FA 2RIJA 1YH8A 5C0XF 1RT5A 1OIAA 2BUNA 2J9DA 2PO4A 3CB4A 4GVBB 3KLIB 1U1QA 1RP5A 4LF9I 1UTAA 2YX4A 2UUAF 1D8ZA 5E3RA 1NU4A 2ZD1B 2ASJA 1Q81T 3D4JA 3HD2A 1FNXH 2Y9HA 1IBKE 4B3RE 1B99A 3QMQA 3C15B 2UUCJ 1JMTA 5HQLA 5F8JA 4DUZJ 4N3OA 2ZH6A 2W9BA 3JYTB 1XMOF 4IOAQ 2HRTA 2N3LA 2VKRA 4FW6A 5K36A 1WJ9A 5DJBA 4GKJF 4NA3A 2HMIB 2F7VA 2BOAA 2C2NA 1FT8A 3MEEB 2KXHA 3R5JB 4I2QB 4L73A 3MI7X 3WZ0A 1EA6A 1KQSR 3CJRA 2E1RA 2OEKA 3QATA 2JFDA 2FHJD 2KT5A 5K5MA 4LRDA 4DN9A 4QPXA 2AYMA 4HYKA 5L39A 3LO3A 3UVJB 4USHA 1FNMA 4IYQA 4USUA 2ZWOA 4ED3A 5K36E 2IESA 4KGZB 3M8ZA 4HEA9 3GMEA 4MQYA 2UU9E 4R0EA 3ZTPA 1JLQB 5IZHA 3MM5A 3CCZA 3J7YU 4RR5A 1Q1KA 3EDRB 3NGDA 4J9LA 3QT8A 4LIWA 4Z2XA 3BGLA 1TAUA 2YY3A 4A48A 2OAUA 9RUBA 2XCPA 2ZZTA 4C97A 1X4DA 4P2XA 4IZJA 1WD6A 2RDJA 1RT1A 1NZ8A 1RWOB 2J9EA 3BKTA 4OHZA 4A8KA 2FC8A 2FVRA 2J6UA 4A8FA 5LT5A 1LW2B 4IRDA 1HNWJ 5K36F 2KM8B 3UR0A 2HHHF 1FJCA 4LR8A 2XZWA 5D8HB 2GIRA 2PEBA 1ZM9A 2OPRA 4LR9A 1KOOA 1OY6A 2B5JA 3FRYA 5HBMA 4EBEA 3C15A 2QG9B 3T5HA 1YTYA 5E2QA 1IKWB 1T05A 4FW4A 2HVIA 4M5LA 4FS1A 4DR5E 1XNQE 3MR2A 1BWVA 1PYOB 1TKTB 1Y3JA 3CDWA 4W4MA 1RHQB 3FNNA 5GMEA 3PW5A 4CLFA 4Q0BA 2UP1A 4DL7A 2OPSB 3A8EA 4LF7I 3CO9A 4JI8E 4XPCA 1VRUA 2B51A 3ZZOA 2NQPA 1PJ6A 3K1JA 3HLUA 4ECSA 1LFPA 2EBGA 1VQ5S 4W90B 1SC3B 3D1HA 1TKDA 4ED2A 2EW9A 5KFVA 2LEAA 1TL5A 3TP2A 1N54B 4YMEA 1NH8A 3OL7A 4NLWA 3OBIA 3R5CA 3A8KA 3RU0A 5IWAJ 2ZJQQ 1IKYA 1ZTWA 2YKMB 4BA2A 1YBTA 4LFBE 3IO1A 2MB0B 4OYXA 2CNKB 4EBDA 4NXNE 4BHQA 3KRNA 1HPZA 1K8AT 1HNZI 1LXJA 5IT9U 2LA4A 5ETNA 2DT9A 4USVA 2O3ZA 4RW9B 1SJQA 3DLKA 1WF2A 5GMDA 2WONB 4DQRA 3Q24A 2W25A 2E5GA 3EVWA 2BM0A 2AYBA 4ES3A 1ZZFA 4O3OA 4H4MA 4YS2A 4UUXA 1X5TA 2L08A 3L9ZA 3CCSS 1R43A 1G3OA 5FLXY 1RTDA 3V4MA 4DBQA 3CNQP 1TL7A 4DG1A 3GILA 4O3PA 1NMEB 3TUZC 5K8NA 2OMLA 2FLNA 3CC7S 3HPOA 4AL6A 1YGYA 2PE8A 2QRRA 1SVDA 3TAPA 4BA1A 3UNYA 2R8KA 5CD4A 1U47A 2NSCA 4ZHRA 2D69A 3AT1B 3QLHB 4RUHA 4K4WA 4DR7E 1UJ4A 2Y0SD 1Z0WA 2RHQB 3ET6B 4ZVOB 4MKAA 2PSZA 2LJPA 3WU3A 3L09A 2RDDA 4KV8B 4RW4B 5B7WA 4KYZA 4LSLB 1VS3A 3SV3A 1HW9A 1GX5A 2AGOA 3RAXA 3QPIA 3J7A1 3W2VB 1HNWF 4NLGA 4K4VA 4FBTA 2VD3A 2WVBA 5F8MA 2CQDA 2NYHA 1IR1A 3QIPA 2Y1RI 3GFYA 3DRPB 4MIBA 1C0UA 4O3QA 4QQBA 4CH0S 4KPCA 3JAMY 2HHTA 4NZ7A 2JE6B 3EGZA 3DD6A 4NYOA 2VZ9A 2DVIA 4GKKF 3KLFB 2B9YA 5BR8J 3P3EA 1KVJA 2E7VA 2MGZA 4FW9A 1KTVA 3CCLS 1YJTA 2V0NA 4UT4A 4N56A 1VQ9S 2D3OR 3GWCA 2CNNB 4QIEA 2JEFA 2UXDI 5LXRA 1X4BA 2FB0A 3TW0A 1RWVB 2GAGC 4AYBD 2XO6A 1CG2A 2OUGA 2HWTA 3RB3A 4K4YA 3H5UA 2F9DA 4C8NA 5ETRA 2Z4PA 3W60A 1AFIA 1B63A 1FTCA 1U1MA 1P6TA 2R42A 5CYQB 2XC9A 1RJJA 3O44A 4X64F 4JI3F 2RRNA 3MEGB 5K8PA 4OX9J 4GKKE 2WZ1A 2LDYA 3P8BB 3W9HA 1TP7A 2L3MA 4ZDNA 4M95A 4LT6A 2UXCF 3MPYA 3N6MA 3AD7C 4KIAA 1B7YB 2PNZA 4DPUA 2VFUA 4XIUA 2HIQA 4DPWA 4M5NA 4V19J 5FLXQ 2V5HG 2PMZD 1RT3B 3W62A 1VYAA 3UN2A 2O1PA 3MPDA 5EX0A 2N4DA 4PUOB 3PEJA 2HZCA 3HHKA 1PO6A 3N9UC 4B08A 1QJHA 1KONA 4QWDA 3TOQA 4OZ0A 5HVHA 2XMVA 2JEJA 2QMUB 3FMWA 1SL2A 4YY3E 1PSDA 2XSJA 4B02A 1D9DA 1SC1B 1XJWB 1TL3A 3GLJA 3WX4A 3Q86A 3EMTA 3E51A 3T1HF 1RWNB 3PIOQ 3ICLA 4IKAA 4CQ1A 4KPYA 2JL9A 1SIWB 1PG5B 1REVA 3D66A 1F0XA 3SDEB 4MMOA 3HJVA 1FXDA 1CS4B 2DR9A 5IT4A 1SBRA 2UXCE 2VL1A 1C2PA 1P8GA 2ZEJA 3FGVA 3SFUA 4DV0J 1J5EJ 4PWWA 2CNLB 1JQGA 1WG1A 2B6AB 4N41A 4ERDA 4OHXA 2CQ1A 3C14A 4ICLA 4IDKA 4PXBA 2IBOA 2RF2A 5E3CA 3AD9C 2JVOA 5HK4A 3X1LB 4OHYA 3HT0A 1ZAWA 1QTNB 3CSKA 4TLRA 1KQFB 3LP1A 1UL3A 3EICA 4G1QB 4M5DA 1XIQA 1LWCB 4OV6A 3W2WA 2FIUA 1M5KC 2AT1B 4FXVA 2WB4A 4TY8A 2CQGA 3M8PA 3AA9A 2NN6C 1GX6A 1SXLA 2NPIA 3I4HX 3Q23A 4K0KI 1BWEA 1DARA 1FRJA 3DRSA 3OFFA 4PG8A 4JI4J 3CMAS 3G9CA 2FVQA 2ALYB 1SIZA 1U26A 4I0WA 1YIJS 2J0XA 2B7BB 2XSFA 1RCXB 4F4YA 1X4EA 3M30B 3MMAA 4ZVHA 5GADI 2Y1JA 1XMQJ 3AHPA 2H1YA 3IAM9 1HMVA 4HTJA 2G2OA 1BE4A 2DNRA 1UAWA 2C1EB 2N7YA 3HHDA 3NY0A 4LBIA 2ZJRQ 4ECQA 1QLNA 1OYSA 2JC0A 2XI3A 4OI0A 1HR0J 2N4CA 2OPPA 5CYMA 2VDIA 3H2VE 4OI6A 3V81B 1Y9OA 5KG4A 3TUJC 2VH7A 1Y60A 1PGZA 3K8VA 1KKHA 5KFRA 4PRFA 5B0EA 3SSRA 2BE2B 3PXGa 3TJ9A 3GV8B 5LMNJ 3DHWC 4EBCA 2VOOA 4B9MA 1YZ6A 4L3NA 2DYAA 3GG1A 3M6VA 5BXIA 5IT0A 2J65A 2QJ3A 2MKCA 4F3MA 1N48A 4OZEA 4GRSA 4IFDC 4WP3A 3I0RA 3M6XA 2FJDB 3J80C 1T9VA 4C6AA 3ZFVA 2IVFB 1F2GA 2QMXA 4YP3A 4OYZA 2IMWP 3G82B 4OHWA 1N36I 2RMLA 1EB0A 5KG3A 2PNLA 3HI9A 1Z2ZA 1NRKA 2G1HA 2Q6CA 4QCLA 1C0UB 2EEYA 3DRPA 4NLTA 3G6VA 2HBZB 4URQU 2JDJA 1NPKA 3PDNA 3RRKA 2CJKA 1B64A 3GIRA 2MLXA 3VAIA 3ENAA 4ILRA 1R8HA 2ZNZA 3SFGA 1SCJB 2OPQA 2HAIA 3NGRA 1H38A 3QJJA 4DR6F 2PNMA 1NJXA 1U09A 1GXTA 1HHSA 3KG1A 4J9MA 4CT9A 2E1AA 4ED5A 4LFCI 2YQ3A 3JQMA 4WE1A 2UXBF 1TUGB 3QLHA 4M5KA 5CHCB 5FDLB 5HMZA 4NBQA 5J1EB 3RRGA 1SH2A 3O5TB 2F3JA 1FRXA 4DL6A 5H1SV 1OYDA 3VV2B 4KHPE 4DFPA 3GPAA 4RUCA 2N7CA 3HO1A 4MIWA 5D6GA 4F2SA 4Z7CA 3CCJS 3DLEB 4KR0B 3UD3P 2BA1D 1NHKL 3IN5A 4NASA 3W8PA 4DPXA 4FS2A 4JI1F 4JI4F 4YHHE 3Q8SB 2PO1B 2XNQA 1TR0A 3AY0A 1EJ7L 3I96A 2IRXA 5E3PA 4ZVIA 3QJLA 2R7UA 3HKZD 3BO3A 2KFNA 2R7QA 4WIQA 4B3SI 3KXDA 1AB8A 1A0OB 5KFDA 4K4SA 3KWMA 5E41A 2NZCA 2ZITA 2QA4S 4K59A 5G0RA 1NCLA 2LXFA 2FUG9 1S1XB 1URRA 2FTRA 4EU0A 4JI2J 1RHUB 3DRRB 4LR7A 4HT5A 2HRUA 2B8QA 4MK7A 4NRUA 2VODA 3SSQA 2IRUA 4H4KC 3Q8UA 2IIHA 3MAAA 1BD6A 1HNIB 3GCWP 2CJXB 1S4EA 4DX7A 1JNRB 1ACMB 4K2JA 2ZBRA 5FWKA 3OTOE 4OZ1A 1LV5A 3DDIA 1VBYA 3BSCA 4K5SA 2W9CA 4LFBJ 5B0FA 2E7XA 2HGLA 2VQFF 2ZBIA 1TKZA 1QSYA 4DR1E 3TVKA 5JVHQ 2DY9A 2ZDOA 1KVIA 3NMAA 2V50A 3MHYA 4UTGA 3V5RA 4ZLPA 3CGIA 3HMJG 3FVYA 1S6QB 4F0MA 5HMYA 1U1PA 3P3GA 1WC5A 2OPRB 4LSZB 1YDLA 4YB6A 1T0TV 1QSLA 1S0NA 2AKWB 4M94A 4U67Q 4FYVB 2QE5A 4WIIA 3DCAA 5LMNI 2F63A 1UWBA 3D6FB 3IR6B 4ZP6A 1E3HA 3E01A 2MQPA 1B62A 3KK3A 3CEDA 3TEGA 4AD6A 1BLUA 3BPSP 4ZS6A 2XI2A 2M9KA 4DV2I 3BM7A 1RISA 3LANA 1HR0I 1TK5A 1K0VA 2W2MP 2R7OA 3W65A 3MCMA 3M1VA 1NSAA 1UKUA 3VF0B 3OTOF 1JLGA 4G1PA 4RW8B 4MH8A 4K0KJ 2ASDA 3NLCA 5J2QA 2MKSA 1D3WA 4I64A 1HIYA 3BGOP 3VQTA 4PWDB 3M85D 4C0OC 3W9IA 1RSCA 3LGNA 1FWKA 2YPZA 2AD9A 1G1XA 2C3PA 1SQGA 2LLZA 2X3GA 1RAIB 1GMUA 3PRBA 4ZP8A 1AZSB 2O66A 1FHTA 4IQXA 2Y8WA 4DV4E 1VOMA 2KRRA 1UJ5A 2NCKL 3FMBA 1TL1A 4I68A 4DUYF 4C8LA 5KOXA 2KFYA 2HQGA 2I9SA 2M2BA 3TZWA 1FD2A 3FCWA 3HFKA 1N56A 3CMES 4DSKA 4OX9I 2MSTA 1IBME 1X4CA 2LU1A 2IBKA 3BKFA 3FBBA 4K8RA 4RNOA 3G8SA 1ITPA 4A8WA 3HHEA 2IJFA 2ZM6J 3JYTA 3CUNA 1HI0P 2O1VA 3TJ8A 3RBEA 2H4WB 3DFEA 3R5GA 5F0UA 2YQ1A 3J81C 1N34E 2MY7A 3PX4A 1TKXA 3BB5A 3OTCA 4CZCA 2XTJP 4EZ6A 2C38B 3H98A 3U7JA 2Z5BA 4MFBB 3FK4A 2QA4G 3CJKA 2DNGA 3GONA 4U6PA 4NXNJ 2NR0A 1S10A 1K47A 1Y5LB 1Q16B 5KFNA 3VTIA 3K5LA 5F8LA 4ENOA 3W5XA 1FDNA 3NCQA 2VHGA 1WI8A 3LWLA 1H7XA 2BW7A 2RS2A 3T1YF 2XS7A 2A2DA 4K4UA 4QYZJ 2AX0A 3DOMA 1U48A 4N5SA 1B7FA 4ECRA 4DZDA 4NOHA 3J81j 3MUMP 4ZMMA 2LEPA 1AA1B 4ZVUB 2PD1A 4C0HA 3I6PA 1ROFA 1KQGB 3B82A 3FQKA 1XBWA 3LP1B 4IZJB 2UU9F 4U3DA 1YWXA 3AOAA 1OY8A 1JLBB 2O01C 3OPKA 4RUBA 2E1MC 1HYSA 3M7ND 1CJTA 3IC1A 3MFIA 1M5HA 1RWXB 2B56A 3KK1B 3SEOA 2F4FA 4EO8A 2DNLA 4KQVA 3JTPA 2HLUA 3W1YC 4GKJI 1EARA 4Q7AA 3P6YC 4IFDB 2HHQA 4USTA 1KN6A 4HTIA 3I0SA 1C4CA 1H7SA 2VQFE 5DQHA 1CS4A 1H0HB 3B6BA 4JP8A 4DV1E 4C3KA 2UUCF 2RVJA 1JB0C 3CD0A 1W2BR 4O23A 4USIA 3H0PA 4DSLA 2PN6A 3MM9B 3ZZPA 3AXMA 5EWGA 4M5IA 2XM3A 1HHQA 4KFBA 2L9NA 4B3SJ 3MXHP 2W4DA 5GAGI 4DU8A 1HQUB 3OVSA 4F2RA 2YX1A 1IBLI 1VGYA 4ECWA 3UWTA 2KL8A 3LOUA 5A0YB 1MU2A 4LCFA 1XMOI 1Z5BA 1VBKA 2BW2A 4FYXB 4IO1A 1IBMJ 4LF8E 3GG0A 3KLGB 5D0HA 3G2XA 1KVKA 3LW5C 3HT3A 2RKIA 3OTBA 4HI2A 4LVOP 3BF4A 3M8YA 1R3NA 3T5KA 1GMVA 3ITHA 4GKKJ 4JI8I 3X3UA 3FFIB 3HHLD 1VHFA 3G8TA 3KG4A 5BYSA 1Y10A 1L3UA 4ECUA 4GVBA 3ETMA 4PYAA 1XTZA 2W4CA 2YNGB 1VQ8S 1KLMA 1CJUA 3B4MA 3ILIA 3OQ2A 4B3TJ 3W5YA 2HEKA 1UVLA 1KLNA 1JLFA 2QSWA 2V8GA 3DOKB 1NKCA 2E1CA 3MM7B 3PRYA 2XGPA 4Y3CA 5L1IA 4M5MA 2XLKA 3E3XA 4LF9J 1T9TA 6AT1B 2JEBA 5GAGU 3OHAA 1D6TA 3HVTA 3QGPA 1CJUB 2BE7D 5LMUE 1ULRA 2X3DA 2CA9A 3GR1A 4ZA1A 3KLHA 2B0GA 4NLOA 4NZ6A 4WJBA 2MKIA 1XMQF 4MJKA 3PR4A 4P2FA 2VG6B 4H4OA 4PZVA 4DPYA 4DOZA 2VKZG 5HQ8A 2JE6A 3M2RA 1U1RA 1WEYA 1VDHA 1QAXA 2WSFC 5DDQC 4PXDA 4RW6B 1Y7PA 3CCWA 4NI2A 3THTA 4DV6F 2NN6A 3M6AA 2V69A 3QGIA 4KB7A 1V3SA 4LSLA 4M1KA 5I4MA 3K5NA 4DSIA 4PRXA 2XCAA 4DV7I 2P8IA 1CQNA 1FX4A 1DY3A 1Q8LA 2QL5B 1S77D 2CJQA 5CZXA 3HSJA 5LMUI 3QNWB 1IBKF 4LRBA 3OR2A 4LCGA 1WC6A 3DLJA 3NCPA 3QRRA 1SUQB 5E33A 2IM0A 3CTRA 1NJWA 1J5OB 4MK8A 2ATCB 5C0XE 2AJ2A 2BVZA 3RW6A 2BBEA 3GE9A 2GQQA 3Q6NA 3AFGA 3MMCB 4KGKA 3S6EA 4DV0F 4DUZE 1XMQE 4L75A 3PW0A 1TK8A 4UW2A 4B3MJ 1WWHA 1IXKA 2CZ4A 2IDEA 3DLKB 3JSMA 2OELA 2QA1A 2XYPB 2A18A 4I6AA 1IBCB 1JNZB 3CXCR 3TYTA 1VBXA 3OL8A 3R9LA 3ZXWA 2OLWA 5KT6A 4I7FB 2ZKUA 1JLAA 1T94A 2KYXA 2ZKTA 4RW7A 5KAKA 4LFCE 5F8GA 3J7ZT 1PCAA 2LQ5A 4LF5F 2OD6A 3BDPA 1ZAVA 3A12A 2R2RA 3NNHA 1EP4A 1PYTA 1WI6A 5KFKA 3SIPB 4DL3A 4WUBA 1UWAA 4OO1B 1YJNS 3C16B 2HNZB 3UCGA 4X66F 4TY8B 2C28A 4B3TF 2UV8G 4HYMA 3WU6A 2JEAA 1NZ0A 4ED0A 5B0GA 5K20B 2ZC3A 3V6JA 1NKEA 5JEAD 1HNXE 3CJ0A 1N33J 2VC0A 2IVMA 2OPSA 3OR1A 3R6GB 4BLGA 4Q43A 4DUZF 1S9FA 4DV0E 3MPVA 4R5PB 4MFBA 3UCZP 4LF8F 1IUJA 4RU2A 2L41A 2C38A 2F1FA 4U7UK 2GJ2A 4UF4A 5FLXU 1LW0B 3GYNA 1S1TB 4QU7A 4CYUB 2IM2A 5DLFA 3FKBA 1HNWI 2DO0A 1Y0HA 1P42A 1EP4B 1S1WB 1NKBA 2HAFA 3CWJA 1IBLJ 1I51B 3DI6B 4DR4J 4JI6E 2AV5A 3PJXA 3PTWA 4QR0A 1CPZA 5D4PA 2QV6A 3ZZTA 5A8KA 3TANA 3HCXA 4RW7B 3CCES 2EG1A 4JI0I 1K0TA 2UUBI 1HNVB 4LFAE 3N5FA 1QAIA 1YJWS 2RD5C 4OI1A 3IS9A 3PIPQ 1EETB 2VG5A 3FEYB 2FY8A 2G0IA 2V9KA 4DR1I 1M0SA 5ITHA 1SKRA 4Z37A 2GO4A 4WFNQ 2JH3A 1B0PA 3Q8VA 2OD4A 2YVSA 4ZP7A 4B3RI 2I2YA 3H5SA 3HULA 1F5CA 4LFBF 2ZH3A 1VQYA 2VG6A 4H4OB 1WG5A 4J90A 2XBPA 4LSNB 1EX8A 5E7OB 5IC6B 2CPXA 2IDLA 3UDVA 2PNZB 4NLQA 4CCHA 4L6V3 4DV6E 1LK7A 3OR2B 3MEEA 1S76D 3M32A 1P1TA 2JC1A 4IQMA 4CO5A 1CEZA 3HVTB 2GO3A 5HLFB 1U25A 4AQYJ 1UVMA 2E5LE 2GIQA 1N6QA 2ZUGA 1UPMB 1T3OA 1ICEB 5FD1A 5B0AA 1VLYA 1MWZA 1UW4A 3MM7A 2KT3A 4ZPWR 4USJC 1H3DA 1S49A 4DLEA 1R6MA 3P06A 1N5VA 3DLGA 2VBWA 4CO3A 1HBNB 5AE2A 3TAMB 2PMHA 1T9WA 2XMAA 3PACA 2GQ2A 3OXLA 5T41A 4YFUA 2ZD1A 3OTOJ 5HL7Q 2VFVA 1U4BA 1A6FA 2COLA 4QR2A 1N34F 3HP6A 2JT2A 3FBEA 1RT5B 4ID5B 1OSCA 2BJDA 4KH1B 3HVAA 2KN4A 4EWTA 5KT4A 2DRAA 1PYSB 4M5HA 4WK1A 4NCGB 5F3TA 3Q0AA 1FWLA 3P3DA 1DTTA 1EAYC 1LXNA 1RTHB 1F60B 2E66A 5E3QA 4ES2A 3VWSA 3PV8A 1IJEB 1TMMA 1BHNA 4HT7A 1BQNB 1SJ4P 2HYIB 4MYTA 1ZH5A 1RWWB 1FKPA 2FLOA 2MMYA 1D0EA 2C3MA 1I1GA 2EK6A 1NBEB 2XYGB 4FKYA 4NEYA 1RBAA 3UQSA 5LSLA 2ZWPA 1X9WA 4FPIA 2HZVA 4DWIA 1R8CA 1X5PA 4I2PA 4BCAA 2N82B 2MJUA 1VQ6S 2C2RA 3Q2TC 2KZMA 1USUA 4GQUA 2V67A 4B3TE 5BR8E 4RUAA 1U0SA 3MTJA 5J1NA 2HLTA 3GYGA 2ADCA 1PJ5A 1N32F 4K0KF 1N33I 1OQ6A 4ZCIA 4B3RJ 1S7HA 1C0TA 4U96A 3BBFA 2ASYA 3PJWA 3J81U 1JJ2R 4DSEA 1VFJA 2U2FA 3DLLQ 2GV1A 3WIVA 2QN6B 2XLJA 2RQCA 2BRLA 1MN9A 3MEKA 1OY9A 1X5OA 2FZKB 2HRYA 4RWWA 4XO0A 4RNNA 1J5EI 2VDHA 3VVTA 4CLKA 2XMWA 3UDEA 4B3MI 3NOGA 3C6TB 1WOPA 5CD4H 2YNHA 5JUMA 1HARA 2XYHB 2P6SA 3POTA 3HVRA 2V8PA 2YBVA 4X4NA 2KHDA 4ELVA 5F8NA 4F50A 4LF6J 3JXOA 2HFSA 2FPHX 1PC5A 2FGCA 3NWRA 4GO7X 4LF2A 5HVFA 1FRKA 4F67A 5D15A 5KFQA 3OUYA 3MR3A 3KJFB 4BDPA 4GKJE 3PO5A 3I55S 4U95A 4ZVFA 2MQQA 3MPWA 1EQMA 4UY85 1O8BA 3MGJA 1CQMA 4FVMA 1NSPA 1KWMA 2JZ5A 3UDCA 4BBYA 3V4IA 4QYZK 3GZ7A 4ATNA 4LF8J 3BREA 4F3OA 5DG8A 2X1BA 2H3EB 2V94A 2XMMA 2UUBJ 4JI0J 4HACA 4LF4F 3QRQA 2BYCA 4OO1A 2W1BA 1ZA2B 2VQEF 2QLXA 3ZZZA 1X8DA 2LA6A 1TK0A 5K36D 1GT8A 4AQYE 3LALA 2HGMA 1SH0A 4QWEA 4JI2I 5EN1A 1SC4B 1S6UA 1XERA 2APOA 2AW0A 2E5JA 3V2UC 3KUGA 1JLAB 1SL1A 4JV5F 1Z0VA 1TL1B 3US5A 3UFCX 2RRAA 2J9CA 2VU5A 4IG0A 3NZKA 3ELHA 2UXBE 2CG4A 3W5ZA 4OLPA 3ZTOA 4DV4F 5J2MB 2AJFE 3MAQA 4FVCA 1QTMA 4B9LA 3K0JA 1MROA 1I94E 4A8SA 4WTYA 3MWBA 5D4OA 2CVEA 1OJ4A 2W7OA 2XY6A 1O51A 1TU0B 3HJFA 4KHPF 4PWDA 1MSWD 1PKPA 2I6WA 5DM6Q 4NLPA 1AYEA 1HNXJ 4WK3A 1U8WA 1WC1A 1UCNA 2J8AA 2MYFA 2NXNA 2POKA 3P45B 4DS4A 4PXEA 2YKOA 5I3UA 3ZKDA 3H7HB 1NO8A 5KOWA 1S79A 3IBWA 2XEXA 1M1GA 1PKUA 5C0XD 3UHMA 3K2YA 2W01A 3NNCA 3ZM7A 3J81Y 1CSJA 2WSEC 1FRLA 5HROA 2KFZA 4X62I 3CCVS 4R25A 3IWNC 5C42B 2LFVA 2MKJA 2BJ9A 3HSGA 5I3QA 5HAOA 3N6LA 4DR2E 4Y6IA 3H2UB 1LWCA 4KE5A 1FRHA 5D0EA 3W2WB 4JYAF 4MU4A 1N5TA 3HHLB 5JEAC 3CJ4A 1JLGB 2GMJA 2NS1B 4RW8A 2DH8A 4A46A 3RR8A 3QRPA 4LRFA 3MM8A 3M2UB 3M2VA 1FCAA 3NWGA 2AEJA 4PG6A 1KNZA 4DR3I 1FFWB 2CQ3A 1XR7A 4IH5A 4KSEB 2G0CA 2B43A 2CPJA 3LAMA 4M8LA 1QUVA 3OUYB 2YNIB 3VVUA 3A8JA 3EXYA 2IC3B 2HHWA 4IS9A 3H1CA 4QJVA 1I5OB 1HNIA 3POTB 3G6YA 4I3HA 3OTDA 3NP5A 5GAEU 3PYDA 1W25A 3LWMA 2YNHB 1RCOB 3DNCA 4J5OA 1WDTA 4D3GA 2GVZB 2MDAA 1FJ7A 2AYEA 3NS6A 1KQKA 5DETA 1ZTTA 4NXMI 5ETVA 4QWAA 4J3DA 3BDEA 1TAQA 1S59A 1YZ7A 1RKJA 2WTFA 4KBIA 1XC9A 5B0CA 1GNKA 2ZM6E 3LTOA 4X66E 1FDBA 4ZVQB 5EWEA 3B4TA 2ATLA 2PO2A 5L3JA 2AZ3A 2DEIA 2R2SA 4KJIA 1S0OA 4N77A 4A8XA 1DZ5A 4RBUA 3H40A 1S0VA 1WHWA 2JOQA 2IVYA 2DCLA 1YBUA 3DLEA 2NXEA 4DV4J 1YHQS 2O1WA 4RX6A 3UNGC 4JV0A 4DR5J 2BJEA 1XNQJ 2J76E 5D77A 5B09A 2GO8A 5KFYA 4LF6I 4URSA 2EC2A 1QY7A 5GAEI 4ZLLA 2IMOA 4JI6I 1TQLA 5KG2A 1DURA 2UXCI 2CQHA 2C2EA 5H9FK 2Z30B 3F0NA 2QYCA 3BH6B 5IOLA 1FKOB 2VG7A 2BJ7A 2OPQB 3VHQA 5KFWA 1MWQA 1CC8A 2WCXA 1N88A 2UVUA 1HBOA 3PG9A 2B7CB 4TQRA 4X65E 3ADAC 4N47A 2A6OA 2NZ4A 2J7UA 4OZ2A 3WU5A 3HDSA 3N01A 2HHHI 4CWBA 3MZIA 4R8UB 3TVYA 5C2CA 3D5MA 2GVZA 1TFWA 5DO2A 2HVDA 4IRCA 3THPA 2N3OA 2EWHA 1MMDA 4OJ3A 3CD7A 3WC0A 1NJYA 4ZPBA 1HWKA 2NXUA 2EFOA 4GC6A 2ZBCA 5KT3A 4NXNI 1LWFB 1HNZE 2HVZA 2PI4A 4QYRA 4CO0A 3QFHA 3OT9A 2DGXA 2Z58B 5DG9A 4FKXA 3BO2A 2AF6A 2HNYA 2VQEJ 1UDNA 2UUAI 3CDJA 2CNOB 4JYAE 2CJAA 3D9BA 1TL7B 1I94J 5JJBA 4WKYA 3T1YI 2DO4A 2GAHC 1WDDA 3IP0A 1RREA 2AJQA 3MEDA 2DNHA 2CQ2A 3BV8A 3GJTB 5KFHA 4WZQA 1S9EB 2IPOB 1UP1A 4LF7E 3QO9B 3N5BA 1NJIT 4ETZA 2NSBA 4EMDA 4IZKA 4X4TA 1HBMB 2OSQA 4NZ0A 1T03A 4DR4I 1ZAXA 3RR7A 2H65B 2W2PP 2YKMA 3ILJA 4OZJA 2K06A 2NN6F 4IOBA 3HKMA 1YJVA 1RTJA 3MAHA 2HQIA 1U7LA 1S1WA 2D41A 5D4NA 1LWEB 3UPFA 3PKMA 4WCEQ 3QO9A 1X4FA 1TMJA 3M8PB 3CJ2A 5GVQA 3J7AN 2F4VJ 2DKOB 3BQ0A 3SCJE 1HKAA 1NAQA 4CYUA 1AUSL 3M9OB 1CC7A 3PW7A 3J80Q 5LOQA 4K50A 5M2PA 1GEHA 3KUEA 3M6WA 3GSDA 3PKYA 5EUHA 3VCDA 4ZPVR 1S1UB 2U1AA 1X60A 4GVLA 3NGSA 4L74A 1UZHA 2RF2B 5BYQA 3W8GA 1IBMF 3MFHA 1N34J 4N76A 4P2MA 3PS2A 4F3QA 3AJDA 2W7AA 1VQPS 4DQIA 4DEZA 1Q82T 4OFZA 3R5AA 4LF5J 2OO4A 2PA3A 3F41A 5LSRA 5KFJA 2V2QA 1ZXMA 4DV1I 2X1FA 1VCTA 3OV7A 5H9FJ 1BUXA 1UWBB 4CM2A 3MUTP 2HKJA 1FNOA 2XQCA 5A2QC 1REVB 4ZJLA 4L3KA 2AJ4A 3C6TA 3D67A 3HFVA 4DX6A 3TR5A 2MZSA 1T9UA 3JTNA 1TFYA 3ULHA 5KG1A 2XGQA 4LJMA 4NWBA 2WNRA 3MR6A 1W26A 2FC9A 1U0HB 2RUSA 1IKXB 1SJ1A 2QYGA 3AQPA 4PPDA 4DL0C 5LJ5Y 4C8YA 4DV5E 2UUWA 2YWFA 4TY9A 1MW7A 3R27A 2B9WA 4WPAA 1F3FA 2OKQA 2XZDB 5ETPA 3UE2A 3UDLA 4CNYA 5T14A 1L5UA 4JI7E 3TO8A 1RAHB 3EYZA 2LP4A 2VV5A 4I69A 1FKOA 2Y3YA 3R2DJ 4EUVA 2O1TA 1R0BG 1J5EE 4X64I 3MAAB 3K5MA 4JV2A 3SDEA 2CPYA 1JWWA 4P6QA 2FJAB 4QR1A 3VAJA 4KHMA 1GK8A 2HQDA 2ZE2A 5EL9A 4P73A 1MMNA 2QLBB 2GW8A 2JSXA 1NDLA 2CJBA 1HWUA 4H4KA 4XPEA 4DHVA 4ER8A 4KY3A 4IUFA 4FF4A 5IWAI 4R0JA 3MOZA 2XY5A 3OTEA 3HD1A 5DDRC 1HNZF 1Z5AA 1ZS6A 3GIKA 3PFOA 2MQLA 4HHJA 3IFEA 1G4CA 3LPYA 5SUHA 3WIUA 2M8DB 2JRSA 2R7SA 1UDSA 3U1NA 3H5XA 1H7UA 1S16A 2MZ1A 1XNQI 4O3NA 1XMBA 5KT5A 5D3GA 1IBKI 3WC2A 2CKWA 4UUWA 3OVAA 5J2NB 4OYPA 3ZTRA 1M1HA 2DGWA 3KHLA 4E8UA 4OX8A 1S72S 1LOUA 1R7IA 1NLKL 4FYWB 4IH7A 3H4DA 2BABA 3VAFA 2Q79A 1FKAF 4CLYA 1U6ZA 1WEXA 2W2QP 4CH7A 3LA0A 5CYQA 1YLXA 3M8WA 3GR0A 4HH1A 4NLDA 1NNDA 1UFKA 3PW4A 1BQNA 1IKVB 3PRVA 4O44B 4CLSA 4WE1B 3AXKA 4RWXA 4WP9A 3R3TA 4P71A 1ZM2A 3TA1A 2CPDA 3FRZA 4NCGA 2VBYA 1N6QB 5DGAA 3L4BC 3GCMA 1N52B 2MGZB 3W64A 1N5SA 3O2IA 2O5DA 1GMWA 4P7VA 3KLFA 1TUWA 2LEBA 1DRZA 2JLFA 4DV7J 1OS5A 3LGMA 1XNRJ 4LF9F 3MMJA 1Z0BA 2F4VI 3ISND 4DG1B 3W3SA 3UD5A 4DR7I 5C24B 2PO0B 4DR2J 2BKNA 1X4GA 1FJGI 1S6PA 3JB9k 3SCLE 1WTBA 1VBZA 5A0YA 1IBKJ 3SV4A 4R1FA 2HFOA 1PJ7A 2B4OA 4RNFA 3ET6A 4ZVRB 2ADBA 1UVNA 1S9GA 3A3PB 3MD1A 5ETKA 3UN5A 2HBQB 3CDIA 3GYXB 5AT1B 3RAQA 3JAMC 3BR9A 2Z8QA 2YWEA 3UW1A 2RE1A 1BMQB 1GTEA 3DI6A 5BYRA 5I3UB 1LK5A 2Z2YB 2C3YA 2V4JB 2G2ZA 3DOLA 5IFMA 1LNQA 1RT2B 2G1DA 2ZOFA 1NDCA 2P9CA 3IWXA 3PYEA 1MLAA 3C8YA 4KGVB 2OPPB 2QLFB 3C6UA 3D6HB 4QIWD 1FRIA 4QPTA 4WXWA 4CLTA 4ZJQA 2V34A 3GQCA 4FBUA 2WNRB 4PRVA 1MMLA 5M2RA 4DDFA 3TZYA 4ELUA 4DSFA 4W92B 3HX9A 3MD3A 1ZM3A 5DRKA 4J9PA 5ELWA 4LF5E 5K36C 2XLIA 2G2YA 1F5AA 2CFXA 3EGNA 3I82A 3P96A 5A8KB 5HJXA 1U02A 5LL6R 3ZKBA 3DRSB 4HH0A 4WFAQ 3M9NB 2Q43A 2R7WA 2YWGA 3BN4A 3M8SA 2ZVSA 3Q22A 1GH8A 2MTLA 1KR4A 2AJ0A 3MPUB 5EGYA 2QL9B 3K58A 1RLCL 2MKHA 1R8AA 4PG4A 1Y4UA 2BX6A 4WYWA 1S1TA 1IBLE 3EWGA 4DR7J 1RWUA 4ZN1A 4G1QA 2KI2A 2WOMA 4YHHI 2RNEA 4KKOA 2WB1D 2C3UA 4OZ3A 2F65A 2D9PA 1QAJA 1MN7A 3J81Q 1TV6A 3BBCA 2CYYA 4P72A 5DZ7A 4ICLB 4IDKB 3T6BA 1TKTA 1N4LA 4CLWA 4DR6I 5L9NA 4FWGA 3HM9A 2V2ZA 5IS2A 4B9VA 3ZZUA 2JEGA 2E1PA 2MQNA 8ATCB 4IZJD 1FVSA 2HNZA 2KVQE 1D1UA 1NB7A 4IR1A 3N79A 2Q66A 4YY3I 1WSRA 1WORA 4NA2A 1LQ9A 5IT9Y 2ROPA 3EZOA 3QSYB 1VK8A 3JQJA 2OGUA 4TU9A 2V4QA 1YBAA 3AB2B 3DYAB 4O0NA 4DR1J 1T03B 3IGVA 3M6UA 2F9JA 1Q79A 2VESA 4JI1I 5KFPA 4B3OA 1S48A 3PR5B 4Q8FA 1QSSA 4OO1F 2QZ8A 2V8HA 4LRAA 3EX7B 4F7VA 1U6BA 3QYYA 4HHHA 5KFCA 2W7PA 2QA2A 3Q1QA 3U1KA 3KHGA 2FHJA 2IJRA 5T7LB 3CJ3A 8RUCA 4NX9A 2YH1A 4WFYA 2V2KA 1RUSA 2AHOB 2WW8A 2HNDB 4CTAA 2M88A 3IBFB 1RT3A 3MURP 2DPJA 1OSDA 4OYIA 3R7SB 4F4ZA 1KHVA 4JI3I 2PFFB 4HR2A 3VZHA 1IWGA 2ZM6F 4YUDA 4EZ9A 4JI5J 2Q2EB 4FW3A 2YH0A 5BR8F 2MLZA 5I42B 4OO1D 4F02A 2C3OA 1P9YA 2C2KB 2YKNA 3VQSA 2ERRA 3JSBA 4IOCQ 1PVGA 2BJ3A 2QTWA 2B4PA 2HMIA 4P10A 3UN3A 5F8HA 1J27A 3BGFA 2GCFA 4IFVB 3SCKE 4DV2J 5D0GA 2ZC4A 2W9BB 2DGUA 3CCMS 4ES1A 4Q2MA 5KG6A 2XO7A 4Y65A 4RW6A 1V6HA 4PEOA 1H6KX 1OQ3A 1B3TA 1RT4B 2YNGA 4R8UA 1UFLA 2H54B 2KO1A 2W2NP 2GJIA 3W66A 4DCPB 3DLHA 1NK4A 1OYRA 4NEZA 1TKZB 4LREA 3AB4B 2BQRA 5J2NA 3ITHB 1U45A 2C39A 5D3GB 4F4KA 2IYIA 1P27B 2W8KA 1UVKA 2W9AA 1HBNA 1FO1A 3EM1A 4F8RA 4NCAA 2VG7B 3BJYA 2VOPA 4JOUA 2PFDA 4YB5A 5KFBA 2UUAE 4GO5X 1XNRI 1K1SA 4WTOB 3DGPB 4JG4A 4LFCF 3W7BA 3KHRA 3J7AM 1DTQB 2XHWA 2FY1A 3LH2S 2WK4A 4MK9A 2FJXA 1L3KA 4OYOA 4CDIA 3JSYA 1WTFA 2GA7A 2J8SA 3M32B 1S1XA 1V3RA 2RU9A 3F73A 2R2TA 1CVJA 3WU4A 2ZE2B 5A76A 4F04B 3LAKA 1C1BA 2GGPB 4I6WA 3PM9A 4LSNA 4OLOA 2DH9A 5EHHA 3PYFA 5KFMA 4N8NA 5DGBA 1HD0A 1YI2S 3L7ZA 1PAUB 3K59A 4RZRA 1RLDA 4OV1A 3TAQA 1RAJA 3GFXA 5J2PB 6FDRA 2IJNA 1FI4A 2DH7A 4J37A 5IQQA 5KFOA 3G4SS 1Z0EA 2PO2B 2V9WA 4G65A 3H5YA 4RW9A 4JI2F 4C7QA 4DF4A 1IWAA 1U1KA 3IS9B 1UZDA 1IKXA 3AODA 5C25A 1RI7A 1X4AA 2HHPA 4PAAA 3D7SB 1CULA 2LQ9A 1XR5A 3KLEA 4DV5I 1HNWE 4X62J 1FX2A 4QIFA 3G71S 1Z59A 2ZZNA 2O3DA 4ALZA 1ZXNA 1SKUB 1NH7A 5A6WA 3VZIA 4DPTA 4Q5VA 1G6BA 4C0BA 1DQAA 1KBRA 4ED8A 2UUCE 5A2QU 4EI2A 3UCUP 1RXOB 4TQSA 3BBBA 2UUBE 4JI0E 4KHPI 3CIMA 2CPIA 2KT2A 1FD8A 5L1JA 2DNPA 2M0GB 2YNIA 5HATA 1DLOB 2HQCA 3CCUS 1RYRA 4DV3I 1LW0A 4IFDA 4MTPA 2OHDA 4OQJA 3U02A 5THWA 4YB1P 3BSOA 3KTQA 1MU5A 2BR2B 1S0MA 1HA1A 3CJSA 3FSYA 3KG0A 3EJMA 4FZVA 3CJKB 1S1UA 1I94I 2Y0BB 1T3NA 2MQ8A 5DRRA 4YEAA 1HBUB 5KFLA 3R97A 4BC7A 6FD1A 5F9NA 4X62F 2H9ZA 5F41A 3QWPA 1IM6A 5AJ3J 1RT4A 1EZZB 1L3SA 1JLCB 5CH7B 1RT6B 1RT7A 3MMBA 4RPFA 3R5BA 5LMNF 1WHXA 5IWAE 3CC4S 2AU0A 2E5LI 2IAJB 1HWLA 1DHMA 1RTJB 4MKVA 1LW2A 2DHXA 2AIRB 1KOHA 2CRLA 2JLEA 5DM7Q 2F1DA 2GZOA 3TRGA 2RB7A 3GU0A 2G0JA 2R7RA 4ILLA 2WP8B 1HBMA 3IBCB 2W2OP 2C42A 5ETSA 1RK8A 3SSSA 1X9SA 3PS3A 4IFDD 1NZAA 2K1RB 2X7IA 2CWXA 3SYZA 2AGPA 1T8EA 4JI3J 2XB2D 2Z5BB 3TQEA 3OTOI 2UUCI 1S9EA 3I5AA 2DNYA 3LGHA 5KTQA 3PX6A 2PDAA 1Y3KA 2RILA 2BJ1A 2KRBA 4O4GA 4UOGA 1SQEA 4EK2A 1WELA 4CTAB 2HNDA 2XZTB 3TZXA 3MOJB 4FWDA 1YRXA 2AEMA 1FK9A 1VQ4S 3MR7A 4NXMF 4WZMA 4ZPTR 4LCHA 1SUQA 2FQQB 2HNYB 3DHXA 3HFZB 3V6KA 4V19X 1PBAA 4OKGA 1IBLF 4ECYA 1FE4A 2QSFA 4WBFA 1XR6A 1JLEB 2UVVA 1WC3A 5K8OA 2CQ4A 3D0IE 2RU3A 4ILMA 1AFJA 5AXLA 1H72C 1S9GB 4F36A 3Q8PB 1A7GE 4NLRA 4JI5I 4OJ1A 2BM1A 2DXEA 2JFKA 3GSIA 3VALA 1HHTP 4PU9A 3H59A 3LPSA 5J1PA 5F9LA 2E9RX 3LP2B 1LFWA 4JI8F 2MZRA 3VAMA 3CJQA 2CIMA 1WHYA 4EFAC 2OIHA 5DNXA 1U24A 1N5YA 1RAEB 1ZPWX 1S5ZA 2RQ4A 1K73T 4NLSA 1SV5A 2P5VA 3F44A 1QVFR 4DR7F 2B6AA 3FBCA 1UEUA 1TV6B 4LF7F 2BJ8A 3RTVA 4KO0B 3A3NB 3F56A 3KK3B 3M8QB 1GXUA 2CXEA 4X4OA 2J7KA 5JEAB 5D78A 4UQTA 3HHLC 4PQAA 4UOFA 4X65F 3M7NG 1NB2A 2UU9J 3H20A 3AOCA 3CO0P 5KFTA 4DFMA 2B3TB 2LECA 2HHHJ 4DUYJ 2GHVC 4B9UA 5A8WB 4K5RA 4QBUA 2NPFA 3NGUA 2E29A 3Q6MA 2FYXA 2DR6A 4ZVTB 3OJUA 1UA0A 2BA9A 3TZZA 4N8OA 4MAKA 5DLGA 1OMSA 4PQUB 4S0MA 1Q5YA 2GHPA 2HFNA 3Q2SC 3LPEA 2AMCB 3OSNA 3TNVA 2V4RA 3MCOA 1RYSA 2CPHA 1HNXF 1QAYA 4RJVA 4JI4I 4DQPA 2CQIA 4U7UD 4Y28C 2MZTA 4PG5A 1UDQA 4ZCMA 1RQ0A 3GTYX 2RHSB 4ZPDA 4J9OA 1NK9A 4J9NA 2DHHA 3IG1B 3T1HJ 1JXLA 1AUDA 4B3SF 1B0TA 1X5SA 5KG0A 3QZ7A 2KJVA 4Y2CA 4ECXA 2BA1G 4ZIWA 2NXJA 3DRRA 1OWXA 3GB0A 3FDSA 4HL9A 4LF4E 4KAIA 3KOAA 1C1CA 1EHWA 1T95A 5G0RB 5A8WA 1PC4A 2VPXB 4AQYI 5J1EA 4RBVA 4CNZA 2CJYB 3IMQJ 4DZ6A 5LMNE 3QAUA 1XQIA 2AX1A 4F0HA 1EQ0A 1RTHA 2HFZA 1NK8A 3L7OA 4DQSA 1Y00A 2DGQA 2UVWA 2P9EA 1P1LA 3DDKA 2J0QD 5DROA 3ZZRA 1YJ7A 3CDEA 3G6XA 1RKIA 3WHIA 2ZVIA 3MUVP 1WF1A 4DS5A 4DUYE 3GMGA 1WNEA 4KO0A 2ZJPQ 3CJ5A 1PAEX 1SKSA 3TI0A 2O67A 2GVDB 1VRQC 3J7Z5 4C8ZA 2R7VA 1HLWA 5DRPA 1S1VB 2D9OA 4TYAA 4F4AA 4AUKA 3T19A 1UEVA 2QFIA 4ID8A 3HZGA 5HSPA 1HYSB 2VQFI 2HSEB 4JI7J 2DGVA 1RA6A 3MECB 3SI8A 1FE0A 2ZH8A 2IA6A 2E9TA 4K4ZA 4DR2F 2DD8S 4I67A 1RHJB 3ZZ0A 2IRYA 3AJ1A 3DC2A 5CCMA 3U1LA 3RBDA 5HO4A 2M4MA 5HROB 2GS8A 2BZ2A 2J7WA 3DOMB 4KC5A 1OPIA 2KYZA 4Y0FA 3OL6A 3KMSA 1N0UA 2HQ3A 3CDBA 3TQ1A 4OYWA 4ZHRB 1XK8A 3R8YA 4YDXA 5G4DA 4DL2A 2GQCA 4GMKA 4KRWA 3O6QA 2K2PA 4NE9C 4PG7A 1Y4SA 2LDIA 3D0HE 4P74A 4QIGA 4USMA 5L1KA 4I56A 2Z2LA 1NM2A 4CO2A 2K3IA 3P5BP 1MG7A 4PPZA 1WKJA 3G82A 4A8YA 1Q7YT 2VC1A 3M9MB 2K7JA 2ZHAA 3S8SA 2VFSA 2HPUA 4DR3E 2VPYB 2OFHX 5AE3A 1M1KT 5FIIA 5IT9C 4ANEA 4QU6A 4AXIA 3KHHA 2K1RA 4IRKA 2YTCA 2X1AA 2YKQA 3CIZA 4C9DA 3NG8A 1S97A 5C0XC 1IKYB 4ZCLA 1H2TZ 5DRQA 5DZ6A 4JI3E 2ZH4A 4UY8T 2E5HA 4DR1F 4OX9F 4X64J 2DXFA 3P3CA 1LEOA 3MMBB 4I4BA 1JJHA 2YNFB 3BR8A 1NHVA 3KKFA 1FF2A 4P9SA 4LF9E 4LFBI 5CYMB 1KFDA 4OL8A 3V4IB 2D1CA 4Q8EA 4XDDA 3CCRS 1TL4A 2ZUAA 5H9EJ 1WOOA 5J2QB 4BWJA 1HMVB 5C25B 4Q0BB 3I9ZA 1NHIA 4JI7I 3D6MB 3RAMA 4U8YA 4HLBA 1IKWA 3K5OA 3R6LB 5ETMA 4FYDA 5MAOA 1HQEB 4V1Ak 3E01B 1W2IA 3N6NA 3ETOA 7AT1B 5LJ3Y 1YJUA 1VRTB 3QQCD 4A8OA 2BOPA 1F3VA 4NA1A 4X84A 2AP6A 2DGOA 2G4BA 2NN6E 4CO1A 3N4WA 5C2GA 3NCRA 3S7RA 1RBOB 9ATCB 4AIDA 1Q5VA 4FXDA 4BWMA 3KJQB 4TU7A 1CULB 3KLEB 5HP1A 4QWCA 1SJFA 4DUZI 1N33E 4LQ9A 1VISA 4LF8I 2GJFA 1TUVA 3ENQA 4ZPAA 2KXNB 2MZJA 5L1LA 4L72B 1NK5A 1BY9A 4ZLNA 3P49B 2VB6A 2HURA 3EUNA 3MM6A 1RAAB 2Z2ZA 5E5NA 4UZBA 3BSAA 1CJKA 3MMCA 1BQMB 2DRBA 1VQKS 1VIOA 2M52A 2FLPA 3FZ2A 4KHRA 3K17A 3PCOB 2DJWA 1HNXI 2OEMA 2HKEA 2FGOA 4ZJOA 3WX8A 2GGPA 5F8IA 2HS4A 2LQ8A 2MSSA 4I2PB 3ZNUA 4LFCJ 3PYGA 4RL1A 4U8VA 2WVCA 3EVOA 2F4VF 2XSJB 3HKWA 3I87A 4NXNF 3FSXA 3SMZA 1Q86T 1EKSA 4ED7A 2FVSA 2FZGB 4CP5A 3BGRB 4MIAA 3QJPA 2IOPA 3I31A 4CH1A 1IN0A 4OX7A 5K36B 3HHNB 3RB0A 4KGXB 3AAWB 4TKTA 2XS5A 2VQFJ 4EEYA 1N0VC 2XMUA 2CZ9A 2ZBQA 1X9MA 1VC5A 3MEDB 4ID5A 1VMBA 5M2UA 2C39B 2PO1A 1HBUA 2WAQD 4DMZA 2YWHA 5IV4A 1D8YA 3GIMA 2R7TA 2LQJA 4DUTA 3MEGA 3QIPB 2ZOMA 5HMXA 5KT7A 2BMBA 5KFXA 3W63A 3D2WA 5CABA 3E8OA 4ZLJA 2GMLA 2UXDF 2JHEA 2KXFA 1NDKA 4X4SA 2KH9A 3HSDA 4KV8A 1RHRB 3VGTA 5GMKa 2L9WA 5BJRA 4ZOSA 2MXYA 2OMOA 3D3CJ 4J9VA 4A47A 3TVZA 4FDFA 4X66J 4OO1C 2H5JB 2BA0D 3QGGA 1FKAE 2YKNB 1U1NA 2I8EA 2BA0G 2VA2A 4MT1A 4JI6J 4YOEA 4DPOA 1XMQI 3D1OA 2C2MB 4DL5A 1UEKA 5L46A 4WWSA 3BZQA 4Y2MA 4NL5A 5L9XA 2ZHBA 4OIXA 4J91A 4HVZA 1H73A 3V6HA 4OI3A 1M5OC 4YR2A 4G3IA 2L9DA 2KTQA 1KSPA 4RW4A 2BXJA 4URGA 1VIXA 1KEKA 4DR6J 1HPZB 1HQUA 4WP8A 4D3HA 2WBMA 2XULA 4DF8A 1HNVA 3PZPA 5C0XB 4KFBB 1UDOA 2UZAA 5JMNA 2UXDE 1NK0A 5KG5A 1IJFB 3HJCA 2YX7A 3MM9A 4OX6A 4FW5A 3T1HI 3DU5A 4CLPA 3IGNA 2BE2A 2GHWA 3VAGA 5B0BA 4AIMA 3LP0B 4F26A 4H54A 4TVAB 4PABA 4PR6A 2BQUA 1RWMB 2BEFA 1IM4A 1SQFA 1ZOTA 2ZNYA 5KFEA 2B4UA 1H2VZ 1Q78A 2WVEA 4Q2LA 3I0SB 2D3UA 1WSVA 2Q6BA 5K14A 2MKYA 1ZZNA 1MROB 3KUHA 1VQ7S 3KNAA 1N33F 3PHTA 3RB4A 4DV0I 1BQMA 1UW9A 2PMWA 3H4BA 2IYGA 5HMWA 1EKRA 3MM6B 1PILA 4DFJA 3G6ES 1KD1T 4HKQA 2NN6D 1HQ2A 1Q8KA 2O1UA 1S12A 4FWHA 4P2SA 4X4VA 2WOMB 1J5EF 2DISA 1T05B 2R8GA 2C37B 1QM9A 1FFSB 2CQ0A 1BC6A 3GFHA 4YHHJ 1VC0A 2LCWA 3G86A 4X4QA 4NXME 3BPDA 2M70A 4PKDB 3CPWR 5AXMA 2EXUA 2LQBA 3CCQS 3ZTSA 2ZM6I 3M4XA 3D3BJ 2CQBA 3D54A 3KJVA 4X66I 3GFZA 4LBHA 5BR8I 1RT1B 2QEXS 4DV2F 3DXSX 4OYMA 3RYLA 2J0WA 3K89A 4ZK7M 4DCJB 1VR6A 1V5IB 1SL0A 2AEFA 4XAKA 3EXCX 3C14B 3M2VB 3M2UA 4A8QA 4Q45A 5I42A 1F5BA 1B0VA 1JKHA 2J6TA 4MU3A 4CLUA 4IFDF 2H5EA 2B9XA 2RUGA 3BGUA 3PHEA 3V6DA 2M3DA 4Y00A 5KFAA 1N5YB 2B5JB 5HBMB 2E7WA 5LXYA 1QZRA 1RBLA 1RACB 4CT8A 1X4HA 3IR5B 3HXMA 3SQGB 4LF4I 2EVZA 1NK7A 4PWUA 3QGHA 5ETTA 3CC2S 4LFAI 3NGTA 5CAAA 5IXUA 4X65J 2LXUA 4URLA 2F8HA 4C11B 2MZQA 2Y1IA 2B4VA 3KYLA 2J5AA 2P6TA 3FQLA 3T41A 2Q1LA 2UV8A 2V2VA 1FESA 1VLOA 3EZ5A 3NNAA 4ZVSB 2MQOA 1UJ6A 2HHSA 1TVRB 2BKPA 4HDGA 4WXOA 4EGLA 2CPEA 2Y8YA 3K85A 2V68A 3AH6A 4JI8J 1FK9B 2DHAA 3L7PA 1DFDA 3BEGB 2NUHA 3SXLA 7FD1A 3PX0A 3O3LA 4DSJA 3IAS9 2FHOB 4XTJA 2RDIA
chains in the Genus database with same CATH topology
2CGEA 1Y4UA 1IBLE 3M6AA 4FN5A 1N32E 4YHHI 4M1KA 4DV7I 4PRXA 3J81Q 4DR6I 4JI2E 3J7AG 4FWGA 2V2ZA 4HACB 2VF3A 3ZZUA 4JYAI 4IZJD 1MX0A 4YY3I 3Q6NA 4DUZE 1XMQE 3J7AM 1RR9A 4JV5E 4JI1I 3WU3A 2DEJA 2WW4A 3Q1QA 4LFCE 4LF9I 4JI3E 1IBKE 3D4JA 4JI3I 4WUBA 2Q2EB 4HYMA 3WU6A 4N3OA 1NZ0A 1HNXE 2VQEE 1PVGA 4DV0E 1EA6A 4HXZA 2E1RA 4DV4E 1HNWI 3QT6A 1FNMA 2UU9E 3ZZTA 2A2CA 4JI0I 2UUBI 4LFAE 3QT8A 1IBMI 2ZBKB 1XHKA 1XNRI 1XMOE 4JG4A 4IZJA 4DR1I 4P52A 4X64E 3WU4A 4B3RI 3HULA 1N36E 1ZM9A 2UXCI 3PYFA 4DV6E 4DR5E 1XNQE 1FI4A 2E5LE 5GMEA 1Z0EA 4LF7I 3P06A 1HNWE 1Z59A 1ZXNA 4DPTA 2UUCE 1A6FA 1PIEA 1Z0TA 2UUBE 4JI0E 4LFBE 4KHPI 4DV3I 4NXNE 1ELOA 1XNRE 1HNZI 1FWLA 1MU5A 5GMDA 2Z5CA 2BM0A 4MYTA 2UUAE 1I94I 1NHJA 1Z5BA 2F4VE 4B3TE 1USUA 5BR8E 4RPFA 5IWAE 2UU9I 2E5LI 5IT9Q 4DR7E 1N33I 2LJPA 1Z0WA 2X7IA 3OTOI 2Z5BB 4DR4E 1J5EI 4B3ME 4OX9E 2Z5EA 3T1HE 4B3MI 4FWDA 2V8PA 4FW9A 4DR2I 1KTVA 3JAMQ 2UXDE 2HFSA 4UT4A 2GQ0A 2UXDI 4P7AA 4GKJE 1H72C 1B63A 4JI5I 2R42A 2BM1A 4PU9A 4GKKE 2HHHE 3LPSA 1Z0GA 4DPUA 2OI2A 4HACA 5FLXQ 4Z7YA 4K0KE 3LNUA 4JI2I 3V2UC 4ED4A 2R3VA 1Z0VA 4DR6E 2J7KA 2UXBE 4YY3E 4ZVIA 1I94E 1N34I 1OJ4A 3Q6MA 2NPFA 1PKPA 2UXCE 4DV6I 1WUUA 3ZKDA 4DR5I 1XNQI 4JI4I 2XEXA 3ZM7A 4X62I 4X62E 4LF4E 4AQYI 4K0KI 5LMNE 1DARA 4DR3I 4DUYE 3PYDA 2VQFI 4GKKI 4NXMI 1KKHA 4B3TI 3ZZ0A 2ZM6E 3B8HA 1H74A 3LTOA 4X66E 2GS8A 4LFAI 5L3JA 1Z0CA 2DEIA 1N0UA 1Y4SA 4B3SE 2O1WA 3J80C 4USMA 1MG7A 1N36I 2PNLA 4LF6I 4JI6E 4LF6E 4DR3E 4JI6I 5IT9C 4JV5I 3F0NA 2PNMA 4DV4I 4LFCI 2HK2A 4X65E 1USVA 2HHHI 4KHPE 4LF9E 4LFBI 2BV3A 4USKA 4Z7CA 1U2RA 1HNXI 4DPXA 4YHHE 4NXNI 4DV7E 4DV3E 1NHIA 4JI7I 4IZKB 1HNZE 4B3SI 2X36A 1HR0E 2UUAI 4JYAE 3T1YE 2ZITA 3T1YI 1RREA 1FJGE 1S4EA 4LF7E 4DUZI 1N33E 1VISA 4EMDA 4IZKA 4LF8I 3OTOE 4DR4I 4JI1E 4DR1E 1BKNA 1NHHA 3K17A 4UTGA 3V5RA 2HKEA 3J80Q 2UUCI 4WUCA 3PYGA 5LMNI 1B62A 2IOPA 1ZXMA 4DV2I 1HR0I 2V2QA 4DV1I 1N0VC 2CZ9A 2EFGA 2HKJA 5A2QQ 3CWVA 5A2QC 2AJ4A 1FWKA 2HFUA 1Z5CA 4HY1A 4MYUA 4DV5E 3H4LA 4DPWA 2UXBI 4JI7E 4OX9I 1IBME 2CG9A 2O1TA 1FKAE 1J5EE 4X64I 2O1VA 4WUDA 3J81C 1N34E 1XMQI 1UEKA 5IWAI 4DXLA 2Z5BA 1H73A 3QT5A 2Z5CB 3GONA 4DR7I 1Z5AA 4JI5E 1K47A 1H7UA 1S16A 1EI1A 3QT7A 2A2DA 1ZM4A 4X65I 3HJCA 1IBKI 1KIJA 3K85A 3T1HI 2HK3A 3B82A 4IZJB 1N32I 4DR2E 4DV5I 4DV0I 5FWKA 2IOQA 4KQVA 4GKJI 1ZM2A 2O1UA 2VQFE 4FWHA 1H7SA 4DV2E 5FLXC 4DV1E 1Z0BA 2F4VI 1HK7A 4NXME 2ZM6I 4JI4E 4DU8A 4X66I 1FJGI 1IBLI 5BR8I 1XMOI 4R1FA 4LF8E 1KVKA 3JAMC 3WU5A 4B3RE 4JI8E 1Y6ZA 4I3HA 4DU7A 1QZRA 4JI8I 4AQYE 4LF4I 3K1JA 3PYEA 2VQEI 4URLA 4DUYI 2V34A 4PRVA 3PRYA 4LF5I 2V2VA 1ZM3A 4LF5E 5LMUI 1D6TA 5LMUE 5LL6R 3ZKBA 3B78A 4DPYA 4XTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL E;  3M6A A;  4FN5 A;  1N32 E;  4YHH I;  4M1K A;  4DV7 I;  4PRX A;  3J81 Q;  4DR6 I;  4JI2 E;  3J7A G;  4FWG A;  2V2Z A;  4HAC B;  2VF3 A;  3ZZU A;  4JYA I;  1MX0 A;  4YY3 I;  4DUZ E;  1XMQ E;  3J7A M;  1RR9 A;  4JV5 E;  4JI1 I;  3WU3 A;  2DEJ A;  2WW4 A;  3Q1Q A;  4LFC E;  4LF9 I;  4JI3 E;  1IBK E;  3D4J A;  4JI3 I;  4WUB A;  2Q2E B;  4HYM A;  3WU6 A;  1NZ0 A;  1HNX E;  2VQE E;  1PVG A;  4DV0 E;  1EA6 A;  4HXZ A;  2E1R A;  4DV4 E;  1HNW I;  3QT6 A;  1FNM A;  2UU9 E;  3ZZT A;  2A2C A;  4JI0 I;  2UUB I;  4LFA E;  3QT8 A;  1IBM I;  2ZBK B;  1XHK A;  1XNR I;  1XMO E;  4JG4 A;  4DR1 I;  4P52 A;  4X64 E;  3WU4 A;  4B3R I;  3HUL A;  1N36 E;  1ZM9 A;  2UXC I;  3PYF A;  4DV6 E;  4DR5 E;  1XNQ E;  1FI4 A;  2E5L E;  5GME A;  1Z0E A;  4LF7 I;  1HNW E;  1Z59 A;  1ZXN A;  4DPT A;  2UUC E;  1A6F A;  1PIE A;  4JI0 E;  1Z0T A;  2UUB E;  4LFB E;  4KHP I;  4DV3 I;  4NXN E;  1ELO A;  1XNR E;  1HNZ I;  1FWL A;  1MU5 A;  5GMD A;  2BM0 A;  4MYT A;  2UUA E;  1I94 I;  1NHJ A;  1Z5B A;  2F4V E;  4B3T E;  5BR8 E;  4RPF A;  5IWA E;  2UU9 I;  2E5L I;  5IT9 Q;  4DR7 E;  1N33 I;  2LJP A;  1Z0W A;  2X7I A;  3OTO I;  4DR4 E;  1J5E I;  4B3M E;  4OX9 E;  3T1H E;  4B3M I;  4FWD A;  2V8P A;  4FW9 A;  4DR2 I;  1KTV A;  3JAM Q;  2UXD E;  2HFS A;  4UT4 A;  2UXD I;  4P7A A;  4GKJ E;  1H72 C;  1B63 A;  4JI5 I;  2R42 A;  2BM1 A;  4PU9 A;  4GKK E;  2HHH E;  3LPS A;  1Z0G A;  4DPU A;  2OI2 A;  4HAC A;  5FLX Q;  4Z7Y A;  4K0K E;  3LNU A;  4JI2 I;  3V2U C;  4ED4 A;  2R3V A;  1Z0V A;  4DR6 E;  2J7K A;  2UXB E;  4YY3 E;  4ZVI A;  1I94 E;  1N34 I;  1OJ4 A;  2NPF A;  1PKP A;  2UXC E;  4DV6 I;  1WUU A;  3ZKD A;  4DR5 I;  1XNQ I;  4JI4 I;  2XEX A;  3ZM7 A;  4X62 I;  4X62 E;  4LF4 E;  4AQY I;  4K0K I;  5LMN E;  1DAR A;  4DR3 I;  4DUY E;  3PYD A;  2VQF I;  4GKK I;  4NXM I;  1KKH A;  4B3T I;  3ZZ0 A;  2ZM6 E;  3B8H A;  1H74 A;  3LTO A;  4X66 E;  2GS8 A;  4LFA I;  5L3J A;  1Z0C A;  2DEI A;  1N0U A;  4B3S E;  3J80 C;  4USM A;  1MG7 A;  1N36 I;  4LF6 I;  4JI6 E;  4LF6 E;  4DR3 E;  4JI6 I;  5IT9 C;  4JV5 I;  3F0N A;  4DV4 I;  4LFC I;  2HK2 A;  4X65 E;  2HHH I;  4KHP E;  4LF9 E;  4LFB I;  2BV3 A;  4USK A;  4Z7C A;  1U2R A;  1HNX I;  4DPX A;  4YHH E;  4NXN I;  4DV7 E;  4DV3 E;  1NHI A;  4JI7 I;  1HNZ E;  4B3S I;  2X36 A;  1HR0 E;  2UUA I;  4JYA E;  3T1Y E;  2ZIT A;  3T1Y I;  1RRE A;  1FJG E;  1S4E A;  4LF7 E;  4DUZ I;  1N33 E;  1VIS A;  4EMD A;  4LF8 I;  3OTO E;  4DR4 I;  4JI1 E;  4DR1 E;  1BKN A;  1NHH A;  3K17 A;  4UTG A;  3V5R A;  2HKE A;  3J80 Q;  2UUC I;  4WUC A;  3PYG A;  5LMN I;  1B62 A;  1ZXM A;  4DV2 I;  1HR0 I;  2V2Q A;  4DV1 I;  1N0V C;  2CZ9 A;  2EFG A;  2HKJ A;  5A2Q Q;  3CWV A;  5A2Q C;  2AJ4 A;  1FWK A;  2HFU A;  1Z5C A;  4HY1 A;  4MYU A;  4DV5 E;  3H4L A;  4DPW A;  2UXB I;  4JI7 E;  4OX9 I;  1IBM E;  1FKA E;  1J5E E;  4X64 I;  4WUD A;  3J81 C;  1N34 E;  1XMQ I;  1UEK A;  5IWA I;  4DXL A;  1H73 A;  3QT5 A;  4DR7 I;  3GON A;  1Z5A A;  4JI5 E;  1K47 A;  1H7U A;  1S16 A;  1EI1 A;  3QT7 A;  2A2D A;  1ZM4 A;  4X65 I;  1IBK I;  1KIJ A;  3T1H I;  2HK3 A;  3B82 A;  1N32 I;  4DR2 E;  4DV5 I;  4DV0 I;  4KQV A;  4GKJ I;  1ZM2 A;  2VQF E;  4FWH A;  1H7S A;  4DV2 E;  5FLX C;  4DV1 E;  1Z0B A;  2F4V I;  4NXM E;  2ZM6 I;  4JI4 E;  4DU8 A;  4X66 I;  1FJG I;  1IBL I;  5BR8 I;  1XMO I;  4R1F A;  4LF8 E;  1KVK A;  3JAM C;  3WU5 A;  4B3R E;  4JI8 E;  4I3H A;  4DU7 A;  1QZR A;  4JI8 I;  4AQY E;  4LF4 I;  3K1J A;  3PYE A;  2VQE I;  4URL A;  4DUY I;  2V34 A;  4PRV A;  4LF5 I;  2V2V A;  1ZM3 A;  4LF5 E;  5LMU I;  1D6T A;  5LMU E;  5LL6 R;  3ZKB A;  3B78 A;  4DPY A;  4XTJ A; 
#chains in the Genus database with same CATH topology
 4TLQ A;  5KFS A;  3M2R B;  1T02 A;  2IA0 A;  1T9X A;  2X1G A;  4KQZ A;  1NUE A;  2JVR A;  4UOH A;  1YJR A;  1JKH B;  1WG4 A;  3WQP A;  3NKY A;  1W7W A;  2QMW A;  4DI6 A;  3KLI A;  3FUY A;  4FN5 A;  3BQ2 A;  1N32 E;  1JXV A;  4KKO B;  4P7T A;  2PI5 A;  3U27 A;  1RHY A;  1RA7 A;  5IQ6 A;  2K8G A;  2L48 A;  2DK2 A;  2IAJ A;  3PJ9 A;  2I1R A;  4O4R A;  3SQO P;  4DR3 J;  3R2C J;  4JI2 E;  3J7A G;  2DCU B;  3IXQ A;  1LWX A;  1XXE A;  4HAC B;  1JLF B;  4UQG A;  5LM7 E;  2VF3 A;  2DIU A;  1JLC A;  4HI1 A;  4JYA I;  3RG6 A;  4CIO A;  1MX0 A;  1I6J A;  8AT1 B;  1RDR A;  2GIF A;  5L8R C;  2R9L A;  2C37 A;  2OP5 A;  3PS1 A;  5IM0 A;  2EPI A;  2ILZ A;  3H90 A;  3IM9 A;  2RRB A;  2OSR A;  4AFF A;  3CJT A;  2UXB J;  1GTH A;  3R5D A;  1DBD A;  3LQV A;  4FXW A;  4WU2 A;  3BS9 A;  3J80 U;  1CBK A;  5CQG A;  5CXT A;  4E0D A;  2VON A;  2ILY A;  2RSQ A;  1FTR A;  3CD5 A;  3FZB A;  4TN2 A;  1O0P A;  1SJ3 P;  2DEJ A;  2GNK A;  2WW4 A;  3W2V A;  3T9Z A;  5ETL A;  2IFX A;  1N8R T;  4DV3 F;  4AL5 A;  1Z2L A;  1DLO A;  2W24 A;  3DRY A;  1WC4 A;  2GO9 A;  1C4A A;  2NXC A;  2R8H A;  1REG X;  2DNM A;  3OXF A;  1WF0 A;  3ENW A;  3QZ8 A;  4FF2 A;  3I9V 9;  5HLF A;  2DR5 A;  4WKR A;  1YQH A;  1HD1 A;  4UZC A;  3P5T L;  5JEA F;  3TJA A;  4DR5 I;  2CVI A;  2P9G A;  3FC9 A;  1KHW A;  5ADZ A;  1RTI A;  1HFE L;  2MEW A;  2VQE E;  3OFG A;  4Y2A A;  3P76 A;  2OTJ S;  1GAO A;  1S6P B;  3IM8 A;  2E5L F;  2V6A A;  2MKK A;  5C24 A;  2WON A;  2PO0 A;  4IFY B;  4WU3 A;  4F4X A;  3KNG A;  1EET A;  3K5P A;  1QVG R;  3KK1 A;  1BQX A;  1VK3 A;  3I5C A;  3TUI C;  1U0H A;  1YVF A;  3T6J A;  3EPG A;  4B9T A;  3L7Z B;  4C8M A;  4HXZ A;  1VI7 A;  2EI5 A;  1C1B B;  1F2H A;  1X31 C;  3LUY A;  1Y5N B;  2UUT A;  3QT6 A;  3FEX B;  5AXN A;  4DV5 J;  4CO4 A;  4BA2 B;  1BXN A;  1N36 J;  4LBP A;  1FKP B;  3JSR A;  4K2X A;  3DM2 B;  4I6Y A;  3LF0 A;  4MDT A;  1DTQ A;  2A10 A;  3OXG A;  2FD2 A;  4F4W A;  5CCL A;  2IER A;  2A2C A;  1RE1 B;  5KFZ A;  1DTT B;  4ZPC A;  3OLB A;  1IBM I;  1Q8B A;  5JEA A;  1RWP B;  2ZBK B;  3OSP A;  1XHK A;  1VRU B;  1XN9 A;  3HF5 A;  4FP9 A;  2BDP A;  2XNR A;  1G2E A;  1XMO E;  2YXL A;  3A8I A;  5J2M A;  3CD6 S;  2BAN B;  2QT7 A;  3NAH A;  3TUP A;  3OVB A;  4FW7 A;  5IT9 Q;  4ZVE A;  5ETQ A;  1GMW D;  4IH6 A;  3IWL A;  4P52 A;  3PW2 A;  3NXZ A;  1YSJ A;  4J9U E;  2WRM A;  4TU8 A;  4ZKA A;  3T3F A;  4X64 E;  3DDN A;  2KHC A;  4GKJ J;  1TKX B;  4USW A;  1L3V A;  5K8M A;  1E3P A;  1N36 E;  1D09 B;  1HWI A;  2V8V A;  4KGM A;  4RNM A;  4CLZ A;  2PGC A;  3FSI A;  1CJV B;  2YKP A;  4ECZ A;  3LP2 A;  2FJW A;  3C16 A;  2CPZ A;  5HI7 A;  1I3O B;  1D9F A;  2BKO A;  3ZZY A;  2ZH7 A;  3T1Y J;  4NCB A;  1LWE A;  2IM1 A;  4ECT A;  4IG3 A;  1U49 A;  1TVR A;  2KG1 A;  3BGR A;  1SJR A;  3O1L A;  4YQW A;  2ALZ A;  2DTJ A;  1T9Y A;  1TZ0 A;  1V3Z A;  1JJ4 A;  1SI9 A;  3M85 G;  2V8D A;  2OH2 A;  2KU7 A;  1FER A;  2JWN A;  4DLG A;  3OFH A;  5CA5 A;  2JJ4 D;  3A1Y G;  1AZS A;  2OEJ A;  2HWI A;  3QAE A;  2M8H A;  3TEH B;  4QW9 A;  2VFT A;  4QZV B;  3U1M A;  1HI1 A;  3MM5 B;  1E6V B;  2BR0 A;  4TYB A;  4DQQ A;  4X2B A;  4L76 A;  2GMH A;  3R1L A;  2E9Z A;  3DN9 A;  3UVJ A;  3K7R A;  1PIE A;  5FJ4 A;  3V6D B;  4NYP A;  2RAQ A;  1Z0T A;  2DIV A;  5T7L A;  7FDR A;  3RBZ A;  3M1V B;  2HHX A;  3M30 A;  3MMA B;  4J9Q A;  3QID A;  2LMI A;  2NYI A;  4LUB A;  1ELO A;  3S1T A;  2D3O 1;  1XNR E;  1NJZ A;  3BKU A;  2E5L J;  3TX0 A;  4AL7 A;  1FA0 A;  4Q44 A;  1HW8 A;  1VQM S;  4DR5 F;  1XNQ F;  3DYA A;  3B4D A;  3G8Q A;  2I5J A;  2Z5C A;  5EX3 A;  3AA8 A;  3PRD A;  4XK8 C;  4PCQ A;  2FHM A;  3NAI A;  4JB8 B;  4NLV A;  1G7C B;  1UPP A;  4A8M P;  2KG0 A;  2DY1 A;  3U1Y A;  2ZH2 A;  3D28 A;  2ZH9 A;  1VRT A;  4NI2 B;  2AGQ A;  3W61 A;  2FJB B;  1NHJ A;  4CRJ A;  4O3R A;  1R27 B;  4M5D B;  4DX8 H;  3MF5 A;  3RJM B;  1VQN S;  2F4V E;  1S6Q A;  4OI2 A;  5KFI A;  5H9E K;  1NK6 A;  5KT2 A;  2HVH A;  2GC8 A;  3NL0 A;  2NRE A;  2UU9 I;  4ECV A;  2DIT A;  4DCO B;  3W9J A;  2RQK A;  2ZFH A;  1R0A B;  1NHU A;  2BR2 A;  2PII A;  1TTH B;  3MCS A;  1P9Q C;  4YN3 B;  1HL6 A;  2A0F B;  2QGF B;  3J7Y I;  3KJV B;  1FJE B;  1HR0 F;  4C48 A;  2XG8 A;  1NSK L;  3CDA A;  5AXK A;  4DR4 E;  3ZC4 A;  5K14 B;  5HN0 A;  1YHC A;  1M5S A;  4WFZ A;  4B3M E;  4OX9 E;  4XTT A;  4C2M A;  3T1H E;  4JV1 A;  1NDP A;  3DM2 A;  4CLL A;  4ZIT A;  3OFE A;  1X7V A;  1KLM B;  3TA2 A;  2VPZ B;  3SCI E;  3TAR A;  3T9N A;  5A6P A;  3OW2 R;  4JI0 F;  2UUB F;  4BS2 A;  2HW3 A;  2YKA A;  4QNJ A;  4TNO A;  1FJG J;  4DR2 I;  3CW2 C;  3FFI A;  3JAM Q;  4I7F A;  3NBP A;  3GCX P;  3M05 A;  3RW7 A;  2GQ0 A;  4N7T A;  2I38 A;  2QO3 A;  4P7A A;  2AE8 A;  3JQK A;  3QBC A;  3KK2 B;  5KFU A;  4W98 A;  3JSM B;  1K9M T;  3KLG A;  4B9S A;  3PVX A;  2DHS A;  3A13 A;  4LVN P;  4DV6 J;  3PO4 A;  1KTQ A;  1MU2 B;  2IY5 B;  4B9N A;  5SZT A;  5EDW A;  1RAG B;  3ISN C;  4LOM A;  3GIJ A;  1RT2 A;  2RT3 A;  2J6S A;  2HHH E;  4IFD E;  1JIH A;  3LP0 A;  1HNZ J;  2V4J A;  1Z0G A;  2FLL A;  1RTZ A;  1R31 A;  3KDO A;  2OI2 A;  2P2C B;  2VFR A;  2SXL A;  1T11 A;  4DL4 A;  5LL6 d;  4Z7Y A;  4J9S A;  2EFV A;  4LF6 F;  3BYR A;  3C2P A;  1SB6 A;  2EKY A;  4K0K E;  5C0X A;  3C66 A;  2VJU A;  3LNU A;  3DXB A;  2CAJ A;  4X4P A;  4ED4 A;  2FHK A;  2R3V A;  4G1I A;  4OYB A;  1FEH A;  2DRD A;  2KB2 A;  2NN6 B;  4DR6 E;  3WBZ A;  5A2Q Y;  4NPO A;  3GII A;  1R6V A;  2K3K A;  1NPP A;  3MM8 B;  3MEC A;  1CJT B;  2H4Y B;  1U2C A;  1ZPV A;  2RS8 A;  3O8W A;  3DMJ A;  1T7P A;  1QD1 A;  2VUG A;  4JYA J;  1N34 I;  4LPF A;  2J9D E;  2VAS A;  2GVD A;  4OMF G;  1ARO P;  1HBO B;  1YKW A;  4X4R A;  2Z5E A;  3OHB A;  3CUL A;  3H25 A;  1O6X A;  2W8L A;  4K4X A;  4DV1 J;  4DV6 I;  1WUU A;  2HBY B;  5C42 A;  5AE1 A;  3J80 Y;  3SZ2 A;  2ROE A;  2D74 B;  4YHH F;  5DG7 A;  4AT1 B;  4FF1 A;  1U8S A;  4DV7 F;  2QIF A;  3Q83 A;  2GX8 A;  4O44 A;  2F40 A;  3NMR A;  3MCN A;  1IQT A;  4WFX A;  1SH3 A;  1FXR A;  3GP9 A;  4BC9 A;  5DDP C;  2XMK A;  4AM3 A;  2MPU A;  2WHO A;  4X62 E;  3AD8 C;  3IRX A;  4XDC A;  3C3L A;  3ISZ A;  3T1A A;  3D68 A;  1Y5I B;  1OYE A;  4AND A;  3HVW A;  4YY3 F;  1RTD B;  3ILO A;  1S7I A;  2Z56 B;  3BSN A;  2RKI B;  1FEE A;  2CQP A;  2YWK A;  2CZV C;  4NYZ A;  4C98 A;  1FJG F;  2VPW B;  1ZET A;  5DS7 A;  3MDF A;  1Q95 G;  3I32 A;  3H42 A;  5U47 A;  4ZIV A;  1WAC A;  2FDN A;  2GFF A;  3DRX A;  3PNI A;  5GAH I;  1UVI A;  3EZU A;  3FCH A;  3ILL A;  4OI4 A;  2CUY A;  2QL7 B;  1RU1 A;  4M5J A;  4DR4 F;  1U1L A;  1D9A A;  2DNN A;  3K8W A;  1UVJ A;  1UMJ A;  1H7W A;  2QLW A;  3I4P A;  3IR7 B;  4ZP9 A;  4MU1 A;  3HZE A;  4ZN3 A;  1J2V A;  4GKK I;  2HWH A;  1F9H A;  1YG0 A;  2QFJ A;  1XEZ A;  4O0I A;  1R8B A;  3CMQ A;  4Y34 A;  4C3L A;  2ZDP A;  4AE5 A;  2RH3 A;  3SQG A;  1JX4 A;  1EI1 A;  1R89 A;  3KJN B;  3OLA A;  2NUU G;  3B8H A;  1H74 A;  4B3T I;  4A4J A;  1DQ8 A;  2LVW A;  4HHU A;  5C5J A;  1R0A A;  3EDQ B;  1K44 A;  1CLF A;  2R4F A;  3RRH A;  1SPB P;  2XMJ A;  1Z0C A;  1HI8 A;  1U6F A;  1VQO S;  1JLB A;  3R7N B;  4U9R A;  3CF5 Q;  2CJ9 A;  5D0R A;  4FYY B;  5HP1 B;  1FVQ A;  4B3S E;  5RUB A;  1E6Y B;  4OHV A;  3ZO7 A;  3OJS A;  2MHE A;  1VHI A;  3GJR B;  2DXD A;  3PEH A;  1F1B B;  1QE1 B;  1QE1 A;  1S57 A;  2B9E A;  2EFN A;  2XHC A;  4YDD B;  2Z57 B;  4ED1 A;  1UA1 A;  4C4W A;  1DJ0 A;  3RGI A;  3T5L A;  3R1H A;  4ITS A;  1S99 A;  1FWP A;  2UXC J;  2LU2 A;  2DGS A;  2ZBP A;  3D6T B;  4LF6 E;  3RUB L;  2KVI A;  3UD4 P;  1RAF B;  4C8O A;  1JLE A;  2EC0 A;  4KTQ A;  2JLG A;  2UXD J;  4JV5 I;  2B8P A;  4QNK A;  2Z2M A;  3NOC A;  1JJC B;  1IR0 A;  4Y2K A;  3SBM A;  4HY1 A;  2ZOG A;  5B08 A;  2W9C B;  3VAK A;  4OJH A;  3TWZ A;  2C2D A;  1XNR F;  4DV4 I;  2LKZ A;  1R6Y A;  2UVR A;  3BYP A;  1WC0 A;  2DGT A;  2HK2 A;  3I5B A;  2E5I A;  1YIT S;  4HDH A;  2AYG A;  3C6U B;  4B17 A;  2Z0G A;  1U1O A;  1USV A;  5F3Z A;  2YNF A;  2DR7 A;  1XMO J;  3EE3 A;  2EFQ A;  3NS5 A;  4QWB A;  3G96 A;  1EIY B;  3DOL B;  5MLC V;  3ZTQ A;  2HGN A;  2BV3 A;  2KDO A;  1YRT A;  3QFW A;  3GJS B;  1RWK B;  1U2R A;  4I2Q A;  4P75 A;  4USK A;  1F6T A;  1GQE A;  1UFW A;  2VBX A;  3OD2 A;  3M8R A;  1AW0 A;  1Q8I A;  2FVC A;  1RAD B;  2VBZ A;  3FBF A;  1Y6Z A;  1NXI A;  4NXM J;  4DV3 E;  4DV7 E;  4E98 A;  5IWA F;  1FRM A;  5F0W A;  4IZK B;  1VQL S;  2CDR B;  1L3T A;  1TEL A;  5JXS A;  1KFS A;  2X36 A;  2AZ1 A;  2XWX A;  4FF3 A;  1APS A;  5CYJ A;  3FJ2 A;  5CZV A;  3BO4 A;  1HR0 E;  3T1Y E;  5GAD U;  4UOC A;  3NS7 B;  2C2Z B;  2WBR A;  2OTL S;  2D3Z A;  4FNI A;  3BH7 B;  2PA8 D;  3DKD A;  1HWJ A;  3CVK A;  5D4L A;  1ZYQ A;  1WHV A;  2DNO A;  4G6V B;  1UET A;  1A6L A;  2HQF A;  3DMJ B;  3IRX B;  4RBT A;  2C2O B;  3NEK A;  5EWF A;  1FJG E;  1S6O A;  4QIV A;  1KC8 T;  4DV3 J;  3DLG B;  3EPI A;  4DJB A;  2K7K A;  4OZL A;  1RU2 A;  4K7Q A;  2F8E X;  2HIY A;  4FPR A;  5FDL A;  3WDO A;  1MWY A;  4FNH A;  4DV5 F;  1M90 T;  4JI1 E;  1VQS A;  2DNK A;  4KT0 C;  4RKU C;  1V9O A;  1IVZ A;  1RHK B;  3AOB A;  4MKB A;  3UO0 A;  1IKV A;  4DFK A;  1B4S A;  1FDA A;  5LSO A;  2EBE A;  1PBU A;  1I94 F;  4JV5 J;  1BKN A;  2IM3 A;  4EYI B;  1NHH A;  2DR8 A;  2KM8 C;  3Q89 A;  3AJ2 A;  2XY7 A;  1RB0 A;  1ZA1 B;  1JK9 B;  2PT0 A;  1YX2 A;  2Y1L B;  2C22 A;  3OL9 A;  2HS0 A;  2YWW A;  2EKN A;  1SC6 A;  1C0T B;  4H4M B;  2ZH5 A;  3HK2 A;  4OZN A;  3TX8 A;  2Q3P A;  3E2E A;  2BE9 B;  2RJZ A;  3I0R B;  2VIC A;  2CQC A;  3GV5 B;  2FVP A;  3GLL A;  3CJ8 A;  1GFW B;  1F9F A;  3B54 A;  3D0G E;  1N32 J;  4PQU A;  2EFG A;  1O5J A;  3M7V