1K47A

Crystal structure of the streptococcus pneumoniae phosphomevalonate kinase (pmk)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
322
Chain Sequence
HMMIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQSFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords phosphomevalonate kinase
publication title Crystal structure of the Streptococcus pneumoniae phosphomevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Streptococcus pneumoniae r6
total genus 102
structure length 322
sequence length 331
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2001-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1k47A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1k47A01
1HNWI 4UTGA 5LMNI 2HK2A 3J81Q 1RR9A 1ZXMA 4PRVA 1N34I 2BM0A 5LL6R 2CZ9A 1FWLA 2HK3A 4X66I 4ZVIA 4DPWA 4YY3E 3LNUA 1IBME 1ZM9A 3WU4A 3ZZ0A 2UXCE 4HYMA 4HY1A 1D6TA 3V2UC 4LF5I 1S4EA 1FI4A 2HFUA 2XEXA 1H73A 4JI0I 4DUZE 2UUBE 4EMDA 4JI7E 4JI3E 4JYAE 1PVGA 2UXBE 4DPXA 1XHKA 4YY3I 1RREA 4GKKE 5FLXC 4X62E 2ZM6I 1IBMI 4DR4E 2UUAE 5GMDA 2VQFE 2UXCI 5IT9C 4KQVA 4K0KE 1EA6A 2HKEA 5LMUE 3B8HA 3J80Q 1MX0A 2UUBI 1FWKA 4JI7I 3HULA 4PU9A 3GONA 1KKHA 2HKJA 3JAMC 4JI8E 4WUBA 4JYAI 1B62A 1XNRE 1NZ0A 2UXBI 1NHJA 4DR2E 4GKKI 4X62I 3ZZUA 2UUAI 2AJ4A 5BR8E 4XTJA 1HR0E 4K0KI 3ZKBA 2UUCE 3V5RA 3PYGA 5L3JA 3H4LA 1XNQE 1FJGE 1ELOA 2EFGA 4HXZA 4DR6E 4ED4A 4LF4E 3D4JA 4DR1E 4DR3I 4P52A 4DR2I 4FW9A 1Z0BA 1XMQE 5BR8I 3QT8A 4JV5E 4DR5E 2UUCI 4WUDA 4Z7YA 1XNQI 3WU5A 4FWHA 3QT7A 4JI2E 4DR6I 1KVKA 4LF4I 1Z59A 3J7AG 4JI4I 3QT6A 4DR1I 3ZM7A 3K1JA 3T1YE 3OTOE 3J80C 4LFAE 4DUYE 4LF9E 4B3RI 4JI1E 4LF6E 2HFSA 3WU6A 1J5EE 1XMQI 1S16A 1VISA 3ZZTA 4JV5I 4DR5I 3CWVA 4DV7E 2LJPA 4JI2I 2GS8A 1KIJA 4JI6I 2V34A 1DARA 3OTOI 4DUYI 1Z5CA 4LF9I 4JI1I 3T1HE 4NXME 2V2QA 3K17A 2A2CA 1J5EI 2Q2EB 1H7UA 1MG7A 1H72C 4X64E 4DV1E 4M1KA 4DV7I 5A2QC 4DV5E 4OX9E 4DV2E 4GKJE 3F0NA 3Q1QA 2UU9E 4UT4A 4LF8E 4LFCE 1PKPA 3B78A 4DUZI 4JI3I 2V8PA 4DV6E 1MU5A 2ZITA 4DV0E 4AQYE 4X64I 4DV5I 4DV2I 4R1FA 3J81C 1IBKE 1ZM4A 4DR4I 4RPFA 4GKJI 2VQFI 4LFBE 2UU9I 5LMUI 4LFCI 2VF3A 3QT5A 4B3SE 1FKAE 4MYUA 1K47A 4DV0I 1ZM3A 4JI8I 4AQYI 1XNRI 1Z0TA 2VQEE 1EI1A 2J7KA 4FWGA 1NHIA 2OI2A 4JG4A 4YHHE 1N33E 3PYFA 1HR0I 3M6AA 1UEKA 1FJGI 1WUUA 4B3SI 2UXDE 1I94E 1Z0CA 1N0VC 4DR7E 1Z5BA 5IWAE 5LMNE 4DV4E 4MYTA 1N34E 2VQEI 4X66E 4DV3E 2R3VA 3WU3A 4YHHI 3LPSA 5GMEA 1HNZE 2HHHE 3JAMQ 1HNXE 2UXDI 1I94I 4KHPE 2E5LE 4DU7A 5IWAI 4LF7E 4DPUA 3T1YI 1Z5AA 2X36A 4LFAI 4WUCA 4DV4I 4LF6I 3ZKDA 1B63A 4DV3I 2ZM6E 4HACB 2DEIA 4DPTA 2BM1A 4DU8A 1OJ4A 1FNMA 1HNZI 2HHHI 1HNXI 4KHPI 2E5LI 4B3TE 1XMOE 4LF7I 1U2RA 4HACA 1IBLE 3J7AM 4USMA 4NXNE 3T1HI 4NXMI 1ZXNA 1ZM2A 1Z0GA 2V2ZA 1N0UA 4DV1I 4OX9I 2F4VE 4X65E 4B3TI 1KTVA 3B82A 1XMOI 4LF8I 1N32E 1IBLI 4NXNI 4DR3E 4DV6I 2E1RA 1N36E 1Z0VA 2X7IA 4USKA 1Z0WA 1NHHA 4FWDA 1IBKI 3PYEA 2F4VI 4X65I 2A2DA 1H7SA 4LFBI 1PIEA 2NPFA 4PRXA 1N32I 4DPYA 4JI4E 3PYDA 1Z0EA 4I3HA 4URLA 4B3ME 4JI5E 2BV3A 4P7AA 4B3RE 1HNWE 4FN5A 5A2QQ 1N36I 2DEJA 5FLXQ 1H74A 3LTOA 2WW4A 5IT9Q 2R42A 1BKNA 1N33I 4DXLA 1A6FA 4JI6E 4LF5E 2ZBKB 4Z7CA 4JI5I 4B3MI 1QZRA 2V2VA 4DR7I 4JI0E
chains in the Genus database with same CATH superfamily
2WNRB 1IJFB 1RR9A 4JI6F 3DOLB 3C46A 2W7OA 4IOBA 5DM7Q 3PEJA 1HWUA 4A47A 4HY1A 1KOHA 3H98A 1F3VA 4YY3F 2FLOA 1HWJA 3CCJS 3JXOA 1RU1A 1GTHA 5DLFA 4IFDD 4PPDA 4IZKA 4DPXA 4J90A 3T9NA 1XXEA 2HHSA 3UFCX 2FLLA 2UP1A 2OHDA 4OJGA 2KDOA 1RU2A 5DZ6A 4DR4F 2ADCA 3FK4A 2Q6CA 1KFSA 1X8DA 2G4BA 5E5NA 1NZ0A 3AA9A 3PJWA 2HS3A 1NK7A 2KXFA 5AE2A 3CCMS 2LEAA 5F3ZA 3FVYA 1OMSA 3MECA 4NA2A 1U1PA 3J7A1 2UUCF 4DV6J 1K73T 4DF4A 5D3GA 2AT1B 4KH1B 4WIIA 2I2YA 3EVWA 1T03A 4EZ9A 5GAHI 1LW0A 1NPRA 1XNQI 5F8LA 2YX7A 1NM2A 2RF2A 3MTKA 3GIIA 4LF4I 1HI1A 2F4FA 2B9EA 2J0WA 4OYXA 4LF9E 3O44A 4R5PA 3SV3A 4O23A 1Z4UA 5EX3A 3CCWA 4FP9A 1RP5A 2VBZA 3O6QA 3UO0A 3LOUA 1HW8A 1JJCB 3KJQB 5E3AA 3WX8A 4DBQA 2NZ4A 3BBFA 4NXME 2A2CA 2F9DA 1T05A 4BLGA 1N34J 2AP6A 2FQQB 2FJXA 5A0YA 3I0RB 2VPYB 1VRQC 2WVBA 2EXUA 3B6BA 4DV2E 2C39B 4O3QA 4B9UA 3W2WA 1YK9A 3TZXA 2WSEC 4QQBA 1RWMB 1FNOA 4DV5F 2C3PA 2OSQA 4Y2KA 3I56S 5CYMA 3A1YG 1UFWA 4USVA 4H4OA 4NX9A 2OJ3A 2QA1A 4LF8F 1U09A 2R4FA 3FRYA 2RT3A 3AQPA 1UKUA 1TP7A 2J6SA 1RA7A 2XG8A 3Q8PB 3L3CA 5B0EA 3CD6S 2AF6A 2GFFA 1VQYA 4KE5A 4MKBA 3A13A 3QT5A 5F8JA 3KLEA 1WWHA 1SQEA 4DDFA 4OX7A 2QA4S 2DT9A 4QIWD 2XY7A 2R7QA 4M5DB 1X5PA 1I5OB 3NY0A 5B0DA 3RB6A 1WUUA 4B3SI 1VQPS 1OQ6A 1UVLA 3VQTA 4NLVA 4ZVHA 1YG0A 2G0CA 3BEGB 2PSZA 4DR3J 3THVA 1GK8A 1JLQB 2LMIA 3F73A 4MU3A 3JQKA 4C9DA 3R7BB 4LBIA 5KFTA 1VLOA 3BPDA 3SXLA 3LP0B 2ASDA 3MUTP 3QJJA 4DV3F 2UXDI 2FC9A 1E6YB 2MPUA 2WAQD 1X5TA 1RYRA 4IR9A 1VQ9S 1Z5AA 3GV5B 4DV4I 1OY6A 2CQ1A 3K57A 3P8BB 3CJKA 1XQIA 2ZM6E 4NPOA 5B0AA 3K8VA 4RWWA 4AUKA 1FXLA 2ZH4A 2YNHA 3DM2B 2GQQA 4QIFA 4F8RA 2ZE2B 4F4WA 1PJ7A 1ZTWA 2E5LI 1YJTA 2QJ3A 1NJXA 4NWBA 1VBZA 1FKPA 2BE9B 3OFGA 2WSFC 3PFEA 1LKZA 4KB7A 1JMTA 1JB0C 2GQ2A 3TW0A 5LSLA 2AEJA 2VBXA 3DLLQ 3IS9A 2P9CA 1Q8IA 4WTYA 1A0OB 1N32E 1NB7A 1W2BR 4C3KA 3K5LA 4JI7J 4NXNI 1GXLA 3MM7A 4MT1A 2V4JB 2N4CA 4C11A 4WFNQ 2GVZA 3P3GA 2ZDPA 1S72S 4ZN3A 1HA1A 2ZOGA 2Z58B 5CH7B 2Z5CB 1V5IB 4PQUB 1X4GA 3BYRA 4TNOA 4CNYA 4B3RE 3UCZP 4K4UA 5LXRA 1N36I 1XIQA 2ZOFA 3NBPA 2JLEA 5BR8J 5T14A 4DSFA 3O5TB 1N33I 2JX2A 2MKCA 3ZTOA 4ECZA 3M2VB 4O4GA 3EWGA 3NZKA 1RHUB 1YZ6A 3AB2B 1PJ5A 4USWA 2VFRA 4EBCA 3VAIA 3MFHA 5LM7E 3RRHA 2ZVSA 2R2SA 4H4KA 1R0BG 5B0FA 1LQ9A 2HQ3A 2BJDA 3A3PB 2FVCA 5B08A 4ENOA 2KHCA 4ZLLA 1V9OA 2OTJS 1FRJA 5DROA 2F65A 4G3IA 2FVRA 2XS5A 3EUNA 2D74B 2IM2A 1NKCA 2ZKUA 2IOPA 2AYEA 2FHKA 2YQ1A 5J1EA 2R7OA 5HANA 4X4UA 1IBMI 3KDNA 3MPYA 1URRA 3TA1A 3M1VA 2UXCI 5A8WB 2AHOB 7FDRA 3B8HA 2DHAA 1S6QA 2ALZA 4OZEA 5HL7Q 2IHR1 5IFMA 3M2UB 1SB6A 4X62I 1X4DA 1FDNA 1YSJA 2GGPA 4K4SA 2A1BA 4GKJJ 1NSPA 4LUBA 1XNQE 4L72B 3CUNA 4LF4E 5D8HB 4HHUA 3HVWA 2MKKA 4O3PA 2NREA 4FXVA 4XK8C 2WONA 3U1LA 4FW9A 3AD8C 3D3CJ 2BJ8A 3I6PA 1WC1A 3HD2A 3WU5A 3HP6A 3HVAA 4DR6I 3MMAA 2AIRB 1JNRB 1TV6B 4DR1I 2Q79A 3DCAA 1NKEA 2LQBA 4ZVFA 4LF6E 4ED7A 4RKUC 2BJ9A 1EKRA 4LF9F 1Z2ZA 6FD1A 2IDLA 2LQ5A 1VRTB 4JI2I 1VHFA 2EK6A 1NDKA 3UNYA 1TKXA 1DARA 2CQGA 4URQU 2E7XA 2V2QA 2W01A 2YWEA 3RG6A 3W62A 2WVEA 1ZA1B 1JXLA 2RDJA 2C38A 4OI2A 5ELWA 1EP4B 2A18A 2VJVA 5C25A 3EPGA 4JV0A 1RJJA 3SCLE 3HHKA 4UT4A 3GSDA 3KNAA 4Y6IA 2E9ZA 2HNDB 1Y4SA 2QL7B 4DV2F 3VHQA 4NCAA 4LF7J 4Q5VA 1H98A 2YWWA 3CIMA 4I7FA 4Q44A 2B6AB 1UPPA 2FJBB 2ZJPQ 1YHQS 1PBAA 2GW8A 4LSLA 1LWEA 1N5SA 1WHWA 4R1FA 2PEHA 2QA4G 5IQ6A 2WP8B 8AT1B 5GAEI 4C2MA 4B3SE 2BQ3A 4DG1A 2ASLA 3LQVA 1WKKA 3MM9B 4WBFA 4TVAB 2CADA 3SFUA 3WBZA 5H9FJ 1EJ7L 2AMCB 3H2UB 2VG5B 3PYFA 3LUYA 3PO4A 1HR0I 3CTRA 1VYAA 4QWCA 1B0PA 4NL5A 3MMCA 5GAEU 3KK1B 3R1LA 3W64A 1V3ZA 2UXDE 4ED5A 5IT9Y 3RR8A 2EWHA 4LQ9A 4DL2A 5LMNE 5ADZA 2KZZA 2N4DA 3AT1B 1KLMA 5LL6d 5DDRC 4DV4E 4NRUA 1S1VA 2RIJA 1U26A 2VD3A 3DLKB 2MQ8A 1C4AA 3SEOA 4K5SA 4M94A 4RBVA 1DTQA 1KQKA 2JC0A 3IR6B 2E5LE 3NCRA 1PBUA 3Q8RB 3GR1A 4CLTA 2MGZA 3JTNA 3RZAA 2R8GA 2HG4A 2L9NA 3P5TL 5BYRA 2PMZD 2F3JA 2ALYB 1VIXA 2WNRA 4KHRA 1FVSA 1RTJB 1UCNA 1HNZI 4WP8A 4J9NA 3GYGA 3DOLA 4I68A 3MR5A 2ZM6F 4LF5J 3C2PA 2L08A 3GJTB 2OO4A 2OKQA 1CLFA 3QQCD 4NXNE 4O3SA 5JEAA 3US5A 1Z0GA 4CH0S 5JVHQ 1YJ9S 1NK9A 3J80Y 1U4BA 1N0UA 4DV1I 1FE0A 3DRYA 2IVYA 1WEZA 2DPJA 2V0NA 3V4MA 1S9GB 4EU0A 5SZTA 4B3TI 1OSCA 4RX6A 3B82A 1G3OA 4EYHB 2FY8A 5D77A 1LFPA 2BE7D 2ZWOA 2RRNA 3L9ZA 3UDEA 1X0FA 3E01B 1N36E 2CQ4A 1N32F 4OZ2A 2IM3A 5B0BA 2IBKA 2F4VI 3ELHA 3PW5A 2VQFJ 1EETA 2CQPA 4LFBI 1LW2B 3SSRA 2W8KA 2V68A 5ITHA 3BQ2A 3IWNC 3TI0A 3QLHB 3I32A 1TFWA 1F2GA 1S76D 3Q8YA 3LTOA 3CMQA 3L7ZA 4B3RF 2PA3A 3DKDA 3MGJA 4F36A 2EG2A 3GFHA 2CJXB 3PW4A 3G96A 3A8EA 3HF5A 2OIHA 1GFWB 3GFZA 2HK3A 3TA0A 2VOOA 1IBME 2FTRA 1UZDA 1YQHA 2V50A 4OX6A 2UXCE 3GIRA 1J27A 2X51A 3KJFB 3M85D 1RTHA 2HFUA 3VWSA 2PO2B 5C0XE 2HWHA 2XO7A 4JI3E 4C0OC 5A8KA 5K36B 1VQ5S 3H5YA 2KO1A 2L41A 1RTDB 1RREA 4C97A 4X62E 2BKOA 3W2VA 4CLYA 3I0RA 2DBBA 3H5UA 5IT9U 3I4PA 2O01C 2C39A 2UXBI 2G2OA 3W1YC 5DDPC 2UUAI 3QNWB 2R7UA 2ZHBA 2DD8S 4DZ6A 5KOXA 2E1CA 4OO1B 3ZKBA 5EKWA 3FDSA 4DR6E 3PKMA 3EX7B 3ZZRA 1CC7A 2ZBCA 5KAKA 3OSNA 2EFOA 1T02A 1NJYA 4DR1E 3R5GA 5JVGQ 3GB0A 4NLDA 1XNQF 1H0HB 2NYIA 5BYQA 1OYDA 4LF4F 4EBEA 2J8AA 3RGIA 1TL1A 2F1FA 3D66A 2V67A 3CD7A 4JI2E 4P2XA 2ZBRA 4M5DA 1RT5A 2EBEA 3T1YE 3GG1A 4I2QB 2HBYB 1CULA 4K4TA 1JLCA 1XMQI 4F2SA 1S16A 1P42A 3J80U 5KFSA 4LF6F 1HK7A 2K3IA 1KIJA 1Q78A 3KTQA 1RQ0A 1HWKA 1N5QA 2XCAA 3GIJA 4DHVA 3EE3A 2E9TA 1G7CB 3LP0A 4QR1A 4ITSA 4A8SA 3AXKA 3FZBA 3OXLA 2KM8C 5CHCB 5CYJA 3CEDA 2E44A 4ZVSB 2XNRA 1S59A 1FRKA 3VF0B 3I31A 4F50A 2ZFHA 2R8JA 4WXWA 3T6BA 1FXRA 2ZE2A 2CQ0A 2VFTA 2I5JB 4ICLB 3H5XA 3D54A 4PKDB 4FNHA 1FD8A 1OYSA 2R7XA 1F9EB 2GO4A 1WTBA 3W65A 3TVZA 4B17A 3N9UC 4FKYA 4KO0A 3JSYA 1QSLA 3CD5A 3PACA 5JMNA 4B3SF 1ROFA 2GQ0A 2ADBA 2H4WB 3EZUA 1UWAA 2MXYA 3KOAA 4RU9A 5ETPA 1L5UA 4XDCA 2LYVA 4I0WA 4ZKAA 3M8RA 4AD6A 4X66E 2UXDF 3RYLA 2Z5CA 4PQUA 1MMDA 3QRPA 4P2FA 2QMXA 1RT3A 5LMNF 4DV4F 2QGFB 1V6HA 1HNZE 1U8WA 5C2GA 3WX4A 1I94I 4X4OA 3G8SA 2W4CA 4IO1A 4ED8A 4Y2CA 2HURA 5DRQA 4IFDE 2YKPA 2FJVA 4U7CA 2E5LF 3HSJA 1HBMA 3RB4A 4C7QA 1WI8A 1XR5A 1SXLA 2B7BB 4B3TE 3SI8A 2Q66A 2QFJA 1Y6ZA 2HSEB 5HMWA 1Q7LB 4NXNF 3DLGB 4CH7A 2F4VE 1H38A 2OGUA 2D3OR 3LAMA 4PXEA 4QU6A 1IKWA 2UUBJ 3K2YA 2DB1A 5E3PA 1IM6A 1S1UA 2YWGA 4I64A 1MMNA 1DZ5A 3FMBA 3QGIA 1IBKI 4NZ7A 1HARA 4NASA 2O3DA 1N36F 3JYTA 2MZ1A 2NXNA 1VI7A 3HFKA 2MZTA 4CLWA 2MKJA 1M1GA 1HHSA 2BV3A 1U47A 3HKMA 1U1MA 1RTZA 2OPPB 3A4TA 1TUWA 2HLUA 2V4QA 4CP5A 3DRSB 1N8RT 4DFKA 3ISZA 4B3MI 3IN5A 2IYIA 2DNQA 4ID8A 3ENQA 3BSAA 1ZXMA 4PRVA 3TAMB 1BMQB 1DTTB 4PUOB 3DMJA 4IOCQ 2LECA 3J7ZT 5J2PA 3N5FA 3PIOQ 2YKNB 1UMJA 2DGXA 1D09B 3VTIA 4OZ3A 3Q0AA 2MKIA 1IBMF 4JI0I 4BA1A 1BWEA 3OTOJ 2UXCF 1VRTA 3UQSA 2P9GA 3QRRA 2UXBE 4FBTA 2WCXA 1WSRA 1Y7PA 3MR6A 5C0XF 4JI3F 3NLCA 4ECXA 2UUAE 2HFOA 1H3DA 3NKYA 4KQVA 2J8SA 2E1AA 1OPIA 5LMUE 2OEKA 4X62F 4M95A 1QVGR 2XGQA 1RACB 3G4SS 4PG8A 1KSPA 2BA0G 5IXUA 4GKKI 4X64J 2M9KA 4CYUB 4MU1A 2VICA 4UOHA 4FVCA 1D9AA 2HQGA 3O8WA 3SYZA 4IZJA 3V4IA 4DL4A 1E3PA 1UDQA 4ZCMA 2QZ8A 4JV2A 2GVDB 3LGHA 2EKYA 2WP8A 2MMYA 3KG4A 4U7UK 2BJEA 4DR6F 1UPMB 1NMEB 1XMQE 5E33A 4DR1F 3H2LA 5L38A 4ECSA 3QIDA 3SZ2A 1UW9A 2VA2A 2G9OA 2VG5A 1GAOA 2HVHA 1QE1B 4JI2F 3DN9A 3KK1A 2CPHA 4ECUA 3NGUA 1HNVB 2J0SD 1PAUB 1N5TA 3T1YF 1UVMA 5LJ5Y 1RABB 1ZAWA 1SV5B 1VBYA 2LVWA 5T7LB 2MZQA 3BBCA 3UR3C 3GSIA 3MOZA 4CCHA 3CWJA 3QPIA 1CQNA 2DISA 5M2UA 2GMJA 5FWKA 1TTHB 3KK2B 4P2MA 2AWZA 4ILMA 2O3ZA 4OX9E 4F7VA 1RAOA 1VMBA 4HTIA 1Y3KA 4PAAA 4DZDA 2CKWA 2KXNB 2YNGB 1K1SA 2V8PA 2AGOA 1MU5A 2JLFA 4ED1A 5K20B 3HCXA 4CWBA 5KFBA 2XQCA 3KG1A 5C2CA 2A3JA 1ZM4A 3CDEA 1FO1A 5D6GA 1YIJS 1N4LA 2BR0A 2VF3A 2DR8A 4IFVA 4B3OA 2VV5A 3M8SA 1HR0F 4IFYA 1QTMA 4OYAA 2F63A 2GIFA 2I38A 2RJZA 1UJ6A 1S1XB 1U0HA 3M9OB 2VFUA 3Q83A 4K8RA 5IZHA 3GLLA 3HLUA 1I94E 1LK5A 3G2XA 1LW2A 5K14B 3HDSA 3HJFA 2R3VA 2CNNB 2XLJA 3B54A 1KR4A 3PW0A 4PABA 4X66F 1T9XA 4J9QA 4B08A 3OD2A 5K8MA 2BUNA 1HBOB 3ILIA 1HNZF 4FNIA 2HQFA 3OTBA 1UAWA 3TX0A 3ZKDA 5F8IA 4FPIA 1OS5A 1JKHB 1FJCA 1VLYA 4IFDF 1E3HA 1DJ0A 2J9CA 1RWOB 4YFUA 2ZH1A 1FNMA 1C0UB 2K3KA 2V9KA 3OFHA 1KQGB 5J1NA 4ES2A 1DBDA 5AJ3J 2JEAA 4J37A 1EB0A 3N0VA 4HACA 2ZZTA 1Q8KA 2KRBA 2Q3PA 4ZIWA 2RRBA 4CO1A 4B3TF 3G6ES 2PO2A 5AE3A 4C8MA 1UETA 5K36A 4ZP8A 1NH7A 3RR7A 2JZ5A 4A48A 2F4VF 2QMWA 4ZVRB 4ISAA 2XULA 3D1HA 1LXNA 2OPSB 1Q81T 2V9WA 2DNNA 4F4KA 2B9YA 4QWAA 1LWFB 4I6YA 2PIIA 4GO7X 3RBZA 4BHQA 3BM7A 1B64A 3ISNC 4P75A 5A2QY 2ZH8A 5K36D 4DPYA 4DLEA 5IM0B 4B3ME 3C6UB 5HP1B 4OO1A 4CTAB 4IG3B 4IKAA 3AOBA 2CYYA 1H6KX 2ILYA 2HBQB 3UPFA 2J0XA 3BGLA 1WOOA 3EDQB 4I6WA 4M63A 3OL7A 1KEKA 1USUA 2WVCA 4A8KA 1JK9B 3JTOA 1YITS 2GMLA 5DM6Q 2BKNA 1S1WA 4JI0E 2JWNA 4WK1A 3D0IE 4OO1D 3CJ8A 3MD1A 4K7QA 1ZBTA 2BM0A 5D4OA 2K06A 4X4VA 3L95X 4I2QA 1KRPA 2K1RB 4PWDB 5HI7A 2C3OA 3M6VA 3MPDA 1Q8BA 1H73A 5KFEA 1VIOA 4EMDA 1CJUA 4FYVB 5KFGA 2CQHA 4JI1J 3M8PB 1N88A 2WVFA 1AUDA 1PYSB 4GKKE 1TR0A 5E2QA 1YDLA 2EFNA 2UXBF 3KLHB 1CJKB 4UQTA 2UUAF 4JI7I 4PU9A 4QPXA 1SH0A 3PJXA 5LMUF 3F41A 4QOTA 2XMJA 3R7SB 2OPQB 3M32A 4ED2A 3OJUA 3HZEA 1AB8A 1FJGE 4ICLA 3BKTA 3KLIB 3HPOA 4HXZA 4C4WA 2RUGA 2GCFA 1P6TA 4J9UE 3GWCA 4Y2AA 2LQJA 1JLEB 5BR8I 2XMTA 3LF0A 5JEAC 4NCBA 4OFZA 5KFQA 2CWKA 2HIYA 4WUDA 4Z2XA 3QT7A 1XMQF 4KKOB 3M6XA 2NUUG 3M9NB 4PEOA 4JI4I 2DR5A 3ZC4A 3B4DA 2HMIB 1AFJA 3CW2C 3UW1A 3ZTRA 1N33J 4Y3CA 4DQPA 1UDSA 5KFLA 2EBGA 1MN9A 3MM6B 1K9MT 1WACA 1X7VA 4V1Ak 4M1KA 1GX5A 2PN6A 2EC2A 1NEEA 2P2CB 4OKGA 3ILJA 2CJAA 2DGTA 4O4RA 5F0UA 2POKA 2XSFA 3LGMA 3MUVP 3PX6A 1C0TA 5A2QU 3K5NA 4OX9F 3TAQA 4DV6E 4KC5A 4XAKA 4YS2A 2CQCA 2YTCA 2A6OA 1T9WA 4DL6A 3DXSX 3D6TB 3Q2SC 4O0NA 4CM2A 4GKJI 1H2UX 3AQOA 4LSZB 2Z4PA 2WW8A 2QEXS 4M5HA 4F67A 4YN3B 4UY85 2R9LA 1XMOJ 1QAJA 1DQAA 1YLXA 3JSRA 4DS5A 2OP5A 1EAYC 1XNRI 1MMLA 2ROEA 2DITA 2B43A 1P1LA 2YPZA 3EJMA 2ZH3A 2RHQB 3D0GE 3RRKA 3MM8A 2DXFA 4K2XA 3UNGC 2HLTA 3TOQA 1UEKA 3HMJG 3SQGB 4IDKB 1SJFA 3P49B 4IYQA 2D9PA 4P71A 1U45A 1N34E 3UN2A 4HI1A 1I94F 4J91A 5A6PA 3A12A 3CJ2A 3GCMA 4ECQA 1VQ4S 4LRFA 5D4LA 3CCUS 4ZITA 1OO0B 2EEYA 1WC4A 3OV7A 2J65A 3BGFA 5HO4A 4WZMA 2ATCB 2L9WA 1O0PA 5A8RA 1F2HA 2OFGX 1WDDA 3CT9A 3ZFVA 4KGZB 1TL7B 4EYIB 3SDEB 2BRKA 3TAMA 3OTEA 4C8NA 1DTTA 2W2PP 1Q16B 4PUOA 4LF7I 2DCUB 3TEHB 3CC4S 2XZWA 2X1FA 4OLOA 2KL8A 2XMMA 3DD6A 2YKNA 2FLNA 3CGIA 4OI4A 2X1BA 1QUVA 4TU7A 3PW7A 3LH2S 4BWMA 3X3UA 2HVEA 4URSA 5FDLB 1JLAA 1SJ4P 2C3MA 3DDKA 4KT0C 4ZJLA 3V81B 4OLPA 2ZWPA 3DOKA 4NRTA 1DFDA 4DR3E 5KFDA 3RBXA 4I6AA 4C6AA 5D4NA 3H42A 4GVBB 4USKA 3QFHA 1M5VC 4KGMA 2IMOA 2KM8B 2HFVA 4PRXA 4MIWA 3CULA 2HQCA 2QE5A 2ZBQA 3DLEA 3CCLS 5ETVA 3DOMB 3M7NG 5A2QQ 3L7PA 4OJ1A 4CO0A 1JLGA 4B3MF 2CJQA 2DNLA 2GVDA 2KFZA 4FW4A 1SJQA 4W98A 2DR7A 1HNIB 3NEKA 1S77D 1WI6A 3HD1A 3BO2A 4DR7I 2CG9A 1AYEA 4ELUA 1NDLA 1WG1A 4C8LA 5JJBA 1KS2A 5KT7A 1W2IA 3Q8QB 1FFGB 4JI0F 2CQDA 3MEEB 5EWGA 1D8ZA 3K59A 3G9CA 3TRGA 4AL5A 4IZKB 4E98A 4QBUA 4LF5I 1HNVA 2KT5A 2DKOB 3BO3A 1NJIT 4JI7E 1M5SA 1WC3A 2WSCC 5KT2A 1LNQA 4WU2A 5B0GA 1BD6A 1FWPA 1UW4A 3BF4A 3MPWA 2HBRB 2B56A 2AZ1A 2NN6C 4YB7A 1RKIA 1IXKA 2HKEA 3BO4A 3KK2A 4GKKF 4MIBA 3DDIA 2LEBA 4OHZA 3BQ0A 3NCQA 2JL9A 3JAMC 4MU4A 3IO1A 4XPCA 3ETOA 1WC6A 3KLVA 3MECB 1FFSB 3AH6A 4JV1A 4DV1J 4ZP7A 5BR8E 4DFMA 1PILA 1UA1A 1ZPWX 2I9SA 3CVKA 5CQGA 2UU9J 1R0AA 1Y60A 1EHWA 1RYSA 4U95A 1T03B 5DS7A 5IS2A 3THPA 1LW0B 4DSJA 5IC4B 4P52A 1X4FA 4DV0J 3FEZA 3DYAA 1S9FA 4G65A 3QFWA 4B9TA 3M2RB 1T3NA 5KFKA 1KNZA 3QT8A 1FJEB 1VCTA 1FRMA 3M8QB 3NG8A 1GH8A 5FIIA 4FWHA 4LFBJ 2DO0A 2LXFA 4DI6A 1SCJB 3LP2B 4MH8A 1EIYB 3FSIA 4MFBB 3I0SB 3WU6A 2M0GB 2RD5C 4F04B 4Q2MA 4CNZA 4F3OA 3FC9A 2LJPA 3VZIA 1T05B 3VAJA 4DS4A 4L73A 1HLWA 3DRXA 3A8IA 3K89A 3ZZOA 2NSCA 3S6EA 2BW2A 5D78A 2KRRA 2MZRA 3RBDA 3K17A 4Q8FA 2ZH2A 3QRQA 1Y4UA 5CYMB 2Q1LA 1RAHB 4H4OB 1SI9A 1HBOA 4C98A 4GKJE 3F0NA 3CJ0A 4KHPJ 3TUZC 2A10A 4UOFA 1C0UA 1U48A 3T19A 4KAIA 2DGQA 2RQKA 4DV6F 3SV4A 3ZTPA 4LOMA 2A0FB 2KG1A 4ILRA 2IM1A 1QM9A 2V8DA 3ENVA 4K4XA 3PY8A 5HBMA 4JI8I 3R6GB 5A76A 4CRJA 4NLTA 1JWWA 3G82B 3D2WA 2KI2A 3RW7A 3DU6A 1TUGB 1YVFA 1GTEA 2DCLA 1RDRA 1WOPA 1WELA 4MMOA 3D6FB 3J7AN 3MDFA 2B51A 3BH6B 1FA0A 2HEKA 3DLJA 3BR8A 5LJ3Y 4DL7A 1OYPA 1X4CA 4OMFG 2IC3A 1RLCL 5I42B 3C6UA 1KWMA 3ZZPA 2PD1A 3CJKB 3UD5A 4LF7E 1BHNA 4JI5J 4RR5A 5HLFA 3WIUA 1E6VA 2XMUA 2YNHB 4RNMA 4OHWA 3AY0A 3GMEA 2M8HA 2DEIA 1UVKA 1HD1A 1LV5A 2FZCB 2NZCA 3HT0A 3TZWA 5F9NA 3WZ0A 4RW6A 3IR7B 2XHCA 5HJYA 1NU4A 2F9JA 2HHWA 4CLSA 2V2ZA 5KFNA 4BC9A 3F44A 3MM7B 3BKFA 4TY9A 4C11B 4RUBA 4CO4A 3M8PA 2XCPA 3C16B 1OY8A 1HBUA 2XY6A 2VG7A 3KLHA 1AT1B 5HVHA 1CJKA 4IH6A 2AX0A 2Y3YA 3D0HE 4J3DA 3PCOB 4DR3F 4FWDA 4EK2A 2WTFA 2U1AA 1HKAA 4XPEA 2YH0A 2A2DA 3NBPB 1YBTA 1H7SA 4PG7A 4BBYA 3H7HB 2AJ0A 3EICA 1Z0EA 3GIMA 3ULHA 1LFWA 4W4MA 2K7JA 1CSJA 1IKXA 1FX4A 2HAIA 4CI0B 1WNEA 2MLZA 4M8LA 4ZLNA 2H1YA 4U67Q 1JLEA 1RGVA 4LF5E 3IBCB 4X2BA 5KTQA 2XS7A 1RHMB 1GMVA 2HK2A 3PHEA 4KKOA 3J7YI 2O1PA 2XM3A 1IQTA 1TK8A 5KFHA 3MCOA 1FERA 2D3UA 4ZPDA 3POTA 2IJFA 1ZM9A 2J7UA 4GRSA 3ZZ0A 3WC0A 1FRHA 2HMIA 1S4EA 5J1EB 4IG0B 3CCQS 5HATA 5SUHA 1B4SA 3HVRA 3I5CA 4PQAA 4CLZA 4DUYJ 4FS1A 4WK3A 2HFNA 3J7YU 1S6QB 3PZPA 4JI7F 3GYXB 4KIAA 4UUWA 4DV7J 2VQFE 4OZ1A 5H9EK 3LA0A 3MPVA 2F8HA 2VFVA 1D0EA 5AXKA 3T6JA 4UOGA 4O0IA 3G87A 2BOAA 2UUBI 1FWKA 1RHRB 4A8XA 3SFGA 4DQRA 3H2VE 4AXJA 4OYZA 3ZZUA 4DQIA 1EARA 4XDDA 4N56A 2WONB 2GAHC 3MD3A 4PZVA 3U1NA 1Y11A 3UDVA 2E1PA 4RBTA 2E5GA 5BR8F 2PT0A 4DL5A 5LT5A 4EEYA 3CCVS 2F8EX 4R25A 2QSWA 3MMAB 4AQYJ 2JSXA 1RKJA 4ZPCA 5CYQA 2BOPA 4MU0A 4JI4F 2ZVIA 2PNZA 1IBKJ 3ICLA 2AEFA 3NS5A 2XBPA 2FD2A 2KG0A 1SJRA 1NDPA 4OL8A 2DY1A 1MSWD 1SL1A 1RA6A 1FF2A 5DG9A 1TKXB 3SQOP 3GJRB 4IDKA 4OIXA 1KONA 4U6PA 4ZJOA 2GHVC 1VK3A 2OFHX 1HHTP 1VQLS 2HZAA 3X1LB 2I0XA 1NPKA 1VDHA 3OTOI 3L4BC 5B7WA 5C25B 5IWAJ 4QIGA 1H7UA 4OZNA 3BR9A 1MG7A 1MWYA 2Z2MA 3ETMA 1U49A 3QJLA 1W26A 2HHHJ 2BEFA 2LQ9A 1F5BA 2CQIA 1HNXJ 2FIUA 1RT4A 4DX6A 4EO6A 3BN4A 2ROPA 4PWUA 2DGSA 4DUZI 1TL7A 4GKJF 4RW4B 2Y1LB 2MZSA 4X64I 3ONQA 4WE1A 2XLKA 2XGPA 1D3WA 2C2EA 3RTVA 1FEHA 5K36E 2VDIA 3A3NB 1GEHA 3BGRA 4MIAA 3TVKA 1UP1A 3K8WA 1R7IA 4BCAA 2K2PA 3TO8A 2M2BA 3HSZA 1F6TA 2WOMA 3MMCB 1T95A 3DGVA 4DUTA 1QTNB 3V81A 2MKYA 2B4OA 2R2RA 4H4MA 5KFJA 5CD4A 4FWGA 1T3OA 3AJDA 4JG4A 2R7VA 4WIQA 3FSXA 1S5ZA 3MI7X 4KH0B 1S1VB 4J9RA 3ET6B 1R43A 3EGZA 3EZ5A 4OO1E 1BQNB 2UV8A 2YBVA 3JSMA 1ZA2B 3FUYA 3TVYA 3RAQA 1LK7A 1EQ0A 2MGZB 2IESA 3DOMA 3ADAC 1NKBA 5GMEA 4C8KA 3M8ZA 4YR3A 1PJ6A 2PFFB 3FJ2A 4LFAI 3SCJE 2ZJRQ 4EGLA 2Y1IA 3FEXB 2MSTA 1FK9A 3IAM9 1HNIA 3E2EA 2JEBB 4MK7A 1F5CA 3VAKA 4LF7F 4CZCA 2AX1A 3EPIA 4IS9A 3V6JA 5JEAB 2FZGB 3D28A 1D1UA 2NXEA 4YQWA 2DNZA 4PWWA 1USVA 4CO3A 3MEEA 4USMA 3CDUA 3T1HI 4PRFA 3SMZA 1M5OC 4WU3A 4A8OA 3K0JA 3PKYA 5HMZA 3UR0A 2E29A 2C28A 2J6UA 4YMEA 1VJWA 5CCLA 3ZTQA 1B3TA 5H9FK 2CRLA 3OHBA 5KFVA 1LWCB 1N6QB 2H5IB 4NYOA 3OSPA 1EETB 1FHTA 2DNPA 2ACYA 3K85A 3A8JA 2DYAA 4RO0A 8RUCA 3KJNB 2CVEA 3D3BJ 1TAUA 5DNXA 1PIEA 2GJ2A 3HJVA 1H2VZ 4ZA1A 1RT6A 3SSQA 3L7ZB 1S0NA 2RAQA 4CLKA 1VJQA 1GMWA 2FJWA 1JNZB 4DR2J 4AL6A 4F2RA 3CIZA 2HZVA 2C22A 2XSJA 1VC6A 4YR0A 2DGOA 2YH1A 3RRGA 2M8DB 4DXLA 3B4TA 1Y9OA 4MKVA 3MF5A 4MK9A 2MJUA 3M2RA 1FVQA 1O5JA 2EK1A 3M8QA 1VQSA 4UTGA 1GMWD 4WYLA 1K1QA 1IBCB 3HO1A 1RTHB 1U8SA 4LF5F 1YJ7A 1OWXA 1FWLA 2LXUA 4RJVA 5GAHU 4TN2A 3QWPA 2QC3A 5A8KB 3LP2A 5E3CA 4JV5J 2BA1G 2MLXA 3D5MA 2VJUA 4MFBA 2ZHAA 3I0SA 2WVDA 1YJNS 2HHUA 4X4QA 1NUEA 5F0WA 5H1SV 4RW9A 2UUBE 1RTIA 4CT8A 1R27B 3RB0A 4FW3A 1P9YA 3CJ5A 3W2VB 2FJEB 2F40A 1N52B 2DIVA 2HVIA 4HH0A 5GMDA 1JLBA 4LCHA 4M5LA 2W25A 5BYSA 3PR5B 2PI5A 1MX0A 2F8MA 1GQEA 5F3TA 4L3NA 2VQFF 1FDAA 2CG4A 1KOOA 2JH3A 3KUEA 5GAGI 3RBEA 1NHJA 3MHYA 5B09A 3QIPA 1NNDA 1VFJA 2XMWA 3JQJA 2IRYA 3AD9C 3LANA 3C3LA 3C15B 4HVZA 3VGTA 1TL1B 4LFCJ 4ID5A 5D4PA 2AYMA 5F8NA 5AT1B 2LU1A 1HHQA 4E0DA 3BGOP 1RT5B 2CJYB 3ENWA 3DLBA 3OR1B 4P9SA 1CULB 3T5JA 4FF2A 1JLCB 3Q24A 3G82A 2YQ0A 2VPZB 1QY7A 3GLJA 2AJ2A 3NAHA 3OTOE 4IRDA 4TYBA 2J76E 1HPZA 3M30A 3ZZTA 3QMQA 2P9EA 2EFQA 2GS8A 4DCOB 2W9CA 1F0XA 2ACMA 4XIUA 3I96A 2E9RX 4JI6I 2YY3A 5I42A 2MY7A 1SC4B 4PYAA 4OV1A 3CE8A 4LT6A 2DNOA 4JI1I 5F8GA 5L1JA 2I8EA 2J0QD 4X64E 3ZNJ1 1WHXA 2MQLA 4Q2LA 3N01A 3GZ7A 3KNGA 1WORA 1SIZA 4IQXA 3QBCA 2FY1A 4FF3A 4DL0C 2RMLA 2CZVC 2M4MA 3NOGA 2DH9A 3QGPA 4X4RA 4ZIVA 1UEVA 2J9DE 4KO0B 4R8UB 4DR4I 4U8YA 3W60A 2CDRB 2OEMA 1F5AA 4OYPA 3G8TA 3R2DJ 1IR0A 2HYIB 5K36F 2JC1A 5H9EJ 4ZS6A 2YXLA 1ZM3A 2FZKB 2HS0A 4FW7A 2MSSA 3C16A 1RWVB 1U24A 2QYCA 3H59A 4F0HA 2FJDB 2VKRA 2NN6B 2E5JA 3UE2A 2RHSB 4KGKA 4CT9A 2OD4A 1RT3B 2BR2A 2MJNA 4A46A 4ES1A 1BC6A 2CJKA 4NLYA 2RQMA 4ZJQA 3TZZA 4OO1F 1Q7YT 3WU3A 3W9IA 5BJRA 3KLGB 1KHVA 2EVZA 2JJ4D 2H65B 2V94A 3ZO7A 2LU2A 1YGYA 1HBMB 1W25A 4JI4J 4NLGA 3PRYA 5J2QB 2O5DA 1QLNA 4WUCA 1S97A 2W7PA 2RKIA 1SBRA 9ATCB 5CD4H 3CJ3A 1OJ4A 3DHWC 4LR9A 1IKVB 2BX6A 4UY8T 1IR1A 4LBPA 3PM9A 1X4AA 1J5OB 5D0GA 4L6V3 3FQKA 4IG0A 1IKWB 2HVZA 1S0OA 2M5YA 1NHUA 1S1UB 1Q79A 4HL9A 4ZVUB 1KTVA 1XMOI 4LF8I 2CFXA 2XHWA 1KTQA 2R8IA 3JYTB 1SQFA 1Z0VA 3LW5C 2RE1A 5B0CA 2EKNA 1TKTA 2VPWB 4K0KJ 2GA7A 1J2VA 1XK8A 4DMZA 1TKDA 4FYWB 5LSRA 2BA9A 5KT6A 3RW6A 4EZ6A 4I3HA 2FGCA 4WFBQ 1XNRJ 2K7KA 2DEJA 2R7SA 3KDOA 5FLXQ 2GIRA 3MTJA 3GCXP 1MN7A 2FJAB 2PI4A 4NBQA 3HFVA 1WF0A 5KFFA 1G2EA 2YX4A 2P8IA 1RT1A 3N28A 3DMJB 5J2PB 4V19J 4RNNA 2MB0B 2E7WA 1G1XA 4BA1B 3G6YA 4G1PA 1D6TA 2UVWA 2HHPA 2KHDA 3NP5A 1TL4A 1NPPA 5CABA 2ZZMA 5IQQA 2BQUA 4DOZA 2FHJA 2XLIA 4PCQA 3BSCA 2OSRA 1GX6A 2UUBF 4ERDA 5FLXC 1TL5A 1S6UA 4K2JA 3NGTA 2H54B 1CS4A 1U1QA 3H20A 4B9LA 1EA6A 4ETXA 5G4DA 3IRXA 1MLAA 3THTA 3BQ1A 5E0OA 2HKJA 3UWTA 1KBRA 1NDCA 1YTYA 4IZJB 3W3SA 3V4IB 4ECVA 4WFXA 1KVJA 3A8KA 2FHJD 3IBFB 3ISND 3BGUA 4RW4A 1R8PA 3I9ZA 2XZDB 4ZVEA 4K59A 1YHCA 3QSIA 2DH7A 1HD0A 2NPIA 2P6SA 4ED4A 1R8CA 3C8YA 1WJ9A 3LPEA 4ZCLA 2YPYA 1VQOS 3TQ1A 2M88A 3HSGA 4F3MA 2QG9B 1OYRA 1NZ8A 3S1TA 3OLAA 3T5HA 3BH7B 1TFYA 3J7AG 2EG1A 2RU3A 3QT6A 3ZM7A 2ZZNA 1RB0A 1V3SA 2DHXA 2VA3A 4JI1E 3ET6A 2VQEJ 2CVIA 2N3OA 3OTOF 4ED6A 3MEDA 4I1TA 3MCMA 1BQNA 4RW8B 1S10A 2CNLB 4YHHJ 2XNQA 3OVAA 2BANA 5I3QA 4M5GA 3I55S 4UZBA 3PRDA 2C1EB 3D6HB 2B4PA 5KT3A 3OQ2A 4DR7J 2LLZA 3BSNA 4NYZA 2VC1A 3W5XA 1S7HA 1RBLA 3W8PA 4TKTA 1WSVA 4FXWA 5DGBA 3HJCA 4X64F 2JEBA 2W2NP 7AT1B 4K4ZA 3UN3A 4AFFA 1Q5YA 4RUAA 3MUMP 2V4RA 1Q82T 4QPTA 4IFVB 4B3OB 1RI7A 4AYBD 2ZBPA 3J81C 4PXBA 4F4XA 4IFYB 1VC0A 3DRRA 2HHXA 2UU9I 1LXJA 2J5AA 5CZVA 1MWQA 4YDXA 2PC6A 1IBLJ 2KJVA 1U0HB 4DV0I 5JEAD 3CDWA 4AL7A 3K7RA 1Q86T 4ELVA 1VBXA 2BYCA 1VQKS 4U3DA 2CXEA 1LWCA 1N6QA 1NHIA 2OI2A 1N33E 5IOLA 2FVPA 1IKYB 2E1MC 4ECYA 1S57A 1U0SA 2M70A 1XJWB 1N0VC 2FC8A 3AODA 2RS2A 2DNYA 5L46A 3MMJA 2QT7A 2LDIA 2AZ3A 1IN0A 3MAHA 3IM9A 2DO4A 1MWZA 3LWLA 1YBUA 4OYOA 1IWGA 4DU7A 3Q22A 3BSOA 4N41A 4DPUA 3KMQA 1FXDA 4YP3A 4OYWA 4EI2A 2JEAB 4KHMA 2DR6A 1ZETA 4HACB 4CO5A 3GR0A 1M0SA 2VG6A 4DU8A 3U1KA 2HW3A 1ICEB 4X4SA 4KHPI 1L3UA 1O6XA 1FRLA 1XMOE 1U2RA 1VGYA 1NK8A 2C2OB 2IPOB 4DWIA 1N5VA 2B7CB 2DXEA 4NXMI 3UI3A 1ZXNA 1B7YB 1PC4A 3MURP 1UWBB 1VQNS 4Q7AA 3OLBA 1FX2A 3MEGA 2BE2A 3OT9A 1URNA 2Y1RI 4W92B 1SC6A 4P2SA 2AV5A 1RXOB 2HZCA 2KYXA 1UVIA 2KFNA 4M5JA 1ACMB 2DPIA 4CM0A 3KKFA 4ZP6A 5DJBA 4F4ZA 1U6FA 2DJWA 3QSYB 4ES3A 2MDAA 1FKAF 2MY8A 3PDNA 4NEYA 1D9FA 3DHXA 2COLA 2KT3A 2B4UA 2DTJA 3CDJA 4JI8J 2LA4A 2VHGA 4FN5A 2QLBB 1H74A 3C15A 1VQ8S 2WW4A 4ZDNA 1S1WB 5LXYA 1B70B 1WF1A 3LWMA 4OJHA 2H3EB 2QLWA 5HJXA 1A6FA 4NYPA 5BXIA 2I1RA 2ZBKB 2EPIA 5ETRA 1Y4ZB 4JI5I 2M3DA 4ZVTB 3OR1A 2ZOMA 4LMZA 2EW9A 4Y28C 3P06A 2QIFA 3P3CA 5AJ3F 1YJRA 3FBBA 2JE6B 1CJUB 5D0EA 1YWXA 2KFYA 4RLEA 4DR5J 1DURA 4LPFA 4ED3A 3TJ8A 2BVZA 1PCAA 3FBFA 3FRZA 2W1BA 2CJ9A 2XEXA 3MEKA 3NRBA 2VASA 4ZPVR 4QW9A 2YKMB 5K9FA 1J5EJ 3R5CA 1XHKA 2ZM6I 4HT7A 2JT2A 3W8GA 3OFFA 2PNMA 2YX1A 2AEMA 4CO2A 2Y8WA 2RILA 4LSNA 4KYZA 3HULA 3TX8A 4WUBA 3M32B 2BDPA 2W8LA 3ITHB 2IFXA 3UVJB 2PO4A 2RRAA 2DIUA 2XC9A 5KG3A 1HR0E 2VBWA 3PYGA 1XMBA 3V6HA 2NXUA 4R8UA 1FCAA 3PR4A 3MR2A 1NLKL 1HWIA 2CDQA 2UZAA 1RUSA 2D3ZA 1DHMA 2W7AA 4NA3A 5GADI 1Z0BA 2L3MA 2OTLS 3HHNB 5EWFA 4OHVA 4YUDA 4U96A 1R6YA 1HBNB 3M85G 2DHSA 3BBBA 1RBAA 1FJGJ 1I51B 3N5BA 4NLUA 2KB2A 4P74A 1T9YA 3NNCA 2O1UA 2QLJB 4AE5A 2NS1B 3WIVA 3WDOA 4B3RI 3IAS9 2NN6A 1CJTB 2H9ZA 3M05A 1DQ9A 5GADU 4IFDA 5KFZA 1CC8A 1VISA 4DCJB 4JI1F 1N48A 5DZ7A 2VESA 5HQMA 4MDTA 1KFDA 2MYFA 2WZ1A 1U6BA 3KLGA 1QVFR 4DUYI 1Z5CA 3HVTA 3ENAA 3PHTA 3GFYA 2BJ7A 1C0TB 1R31A 2NN6D 4DV1E 1UZHA 4DV7I 3MAQA 2CIMA 3UCUP 5J2QA 4F0MA 2Z57B 2HNZB 2LQ8A 2UU9E 1UVNA 2HHVA 4J5OA 2W9AA 3GJQB 3OTDA 4DV0E 2HQDA 2CZ4A 1IKVA 2VONA 2AW0A 2BW7A 2YWFA 4HTJA 3UDLA 1HQEB 3N4WA 4RPFA 2YNIB 1J5OA 2OH2A 2JDJA 2J6TA 1C1BA 4LFBE 3L7UA 2BQRA 4PG4A 5F8HA 4Y0FA 1WEXA 3FQLA 3IWLA 1Q0NA 2LFVA 2QMUB 3MM8B 2MKSA 4HYKA 2V8GA 4BA2B 4AQYI 5ETKA 4F4YA 5K8OA 3BJYA 1Z0TA 4DN9A 5DG7A 2M52A 3W9HA 3TARA 4KFBB 2RDIA 4X84A 1S99A 1UDNA 3M6AA 3UDCA 3HKZD 2NQPA 3KHHA 2AJQA 1G6BA 4PPZA 1N33F 1Z5BA 5KFAA 3GE9A 2JVRA 2KYZA 1OYEA 4OZ5A 2AJFE 1IM4A 3D1OA 2Z30B 5HMXA 3H4BA 1UDOA 1AXQA 3LPSA 2JNJA 2VKZG 2CGEA 5A8RB 2VDHA 4KHPE 4ER8A 3NGDA 3VGSA 5IWAI 3HHLB 4LJMA 3EXYA 1SJ3P 3PNIA 1HNWJ 4LF6I 1RT2A 1FFWB 5IT4A 3CB4A 5KFMA 2CPJA 2CA9A 2GO9A 3CC7S 2C2MB 4DSEA 1Q4RA 2HNYA 2HHHI 3EGVA 1BWVA 1HNXI 4L75A 1R6MA 3AD7C 4UOCA 1N54B 4IQMA 1JLAB 1X5OA 5F9LA 4Q0BB 5EN1A 2AQ4A 3EYZA 1CG2A 5ETMA 3IGNA 2FLPA 1ZM2A 1F60B 1FKOA 3DOKB 3KXDA 3QGHA 1XMOF 2X1AA 3RJMB 4G1QB 2Y9HA 4FF4A 5C42B 4G1IA 3D9BA 2FHOB 4DUZJ 2MQQA 1RWXB 4TYAA 4JYAJ 2D41A 1K8AT 4U8VA 2EC0A 2L9DA 1T9VA 3FMWA 2B9WA 3DLEB 5HVFA 3N6LA 7FD1A 3EDRB 3O3LA 1YBAA 2C37B 5U47A 3IA0A 4X4NA 1A9NB 1S1TB 5EUHA 2CPEA 3FFIA 1JLGB 2KN4A 1R6LA 4JI5E 2C2NA 3KUGA 3H8YA 2NSBA 1ULRA 2F1DA 1EKSA 1TK5A 1RHKB 2LDYA 5AXLA 4UQGA 4N77A 4FS2A 1S0VA 3CCTA 4IZJD 4TXSA 3M8YA 4RBUA 4QR2A 4W90B 1NH8A 5LMNI 1B0TA 3AOAA 5LL6R 2PNLA 3V6KA 1X4BA 3NWGA 3PS2A 3BKUA 5THWA 5J2NA 1A7GE 3PG9A 4ANEA 3Q89A 2D9OA 3JS9A 2ZH7A 3Q8SB 4CH1A 4RW8A 4LFAJ 2CNOB 4IRCA 4Y00A 3LO3A 1T11A 2AGPA 3P4UB 4LCFA 2BMBA 2ILZA 3WC2A 3I9V9 1VOMA 3IWXA 5KG6A 4NE9C 3T41A 1IJEB 1S4FA 1K44A 2ATLA 2NXCA 3EGWB 3T1HJ 1S6PB 2HVDA 1M5PC 3CDIA 4ANDA 1R0AB 2H5JB 3FSYA 2AJ4A 1U6ZA 3MWBA 4RNOA 2YNFA 3DYAB 4OI1A 5E3QA 1XC9A 4KRWA 1NK5A 3OJSA 4DR2I 4N47A 1U1RA 3MXHP 2CG8A 2PO0A 3QWUA 3HZGA 4FF1A 1Z59A 3TWZA 2DRDA 4DUYE 1IKYA 2W24A 1Q95G 2RUSA 4WYWA 4LR7A 2EFVA 2HFSA 2PFDA 1KDNA 3NWRA 4MK8A 2MQPA 1VHIA 5DETA 4JV5I 1OQ3A 2ASJA 4DV7E 2ZH9A 4NZ0A 4O44A 4CLUA 3NOCA 1TMJA 1REVB 2N3LA 1DLOB 3R9LA 3UCGA 1RT7B 3T5LA 3I82A 4KBIA 2G0JA 4J9PA 2W9BA 3P3EA 3JTPA 4QWDA 2XY5A 1IQZA 3R8YA 4DV1F 1SL2A 1KP6A 1UVJA 3DRPB 3UD4P 2DH8A 2WRMA 4ZCKA 2BBEA 4EFAC 4JI3I 4JB8B 4ZLJA 3QZ7A 1V5VA 1P9QC 4AQYE 2UU9F 3QGGA 5HBMB 1IBKE 1GT8A 4DV0F 1DQ8A 2QLXA 1S9EB 1XR7A 5ETSA 4DFPA 1NZAA 1RWNB 2W2OP 3H5SA 4LFCI 2IAJB 2FPHX 1SKRA 4K4VA 1UWBA 3U27A 4LFBF 2CPXA 4ANCA 4U9RA 4ZCIA 3MAAA 4WXOA 4PXDA 3IGVA 3PV8A 2IC3B 4X65J 5EL9A 3VALA 1KQSR 4HHJA 4RNFA 5IWAE 2DRBA 2QN6B 1X4EA 3T3FA 4ZPWR 4KTQA 3Q2TC 4M5MA 1T7PA 4I67A 3JAMY 3HFZB 4NCGA 5HLFB 1E6VB 5LSOA 3FBEA 2R7RA 4DFJA 2OPRB 2HHHE 1HNXE 4JBCA 5CZXA 2DR9A 1Y10A 2W2MP 4CLPA 3T1YI 2X36A 3KLFB 4D3HA 4DPOA 4ZN1A 4KHPF 3P96A 1OY9A 4RW6B 4DPTA 1IVZA 2HIQA 1BUXA 4LREA 4NXMF 4WJBA 1FESA 4JI6J 2JE6A 4RWXA 1KN6A 4PYDA 2VU5A 4OZJA 3KFWX 5HMYA 4DSLA 4L74A 3R1HA 3NNAA 3HM9A 1HBUB 3FNNA 4YY3J 3DC2A 2NUHA 3I5AA 4Q43A 1CJVB 2VG7B 5ETTA 3GTYX 1S48A 3MCNA 2YKMA 3LPYA 4K50A 2MLYA 3R2CJ 2IRXA 5KT4A 4Q45A 1FEEA 1R8HA 4GVLA 3CF5Q 3H4DA 1NSAA 1RWUA 5L9NA 4DR4J 1NBEB 1B7FA 3N79A 1IKXB 3DGPA 3P76A 3IFEA 4C8ZA 3ITHA 1CEZA 3UVJA 3P45B 3OVBA 3AJ2A 2N7YA 4Z37A 3PYDA 4URLA 4YDDB 1UA0A 4A8WA 2F5GA 4FDFA 4JI5F 2E66A 1BQMA 2XTJP 3IP0A 2UUCJ 4D3GA 3K58A 1N5YB 4YR2A 2AU0A 3CPWR 1QZRA 3POTB 1C2PA 4WTOB 4LBHA 3ILLA 3QO9B 2KTQA 1B0VA 1HBNA 1FT8A 2DVIA 1VRUB 1QAYA 2IOQA 4X66I 2IYGA 4V19X 1NHKL 1SUQB 3S01A 2JEFA 1NCLA 3SCIE 4R0JA 4KJIA 4NI2B 1CJTA 4HYMA 1BE4A 4K5RA 3HI9A 3PVXA 2A6MA 1RK8A 5KT5A 3AAWB 4FW6A 1EX8A 1M5KC 2ZHOA 4OQJA 5ETOA 3DNCA 1TAQA 3FCWA 4RW7B 5DO2A 1OPZA 4B9SA 2E5IA 4MTPA 3L09A 1HWLA 3KMSA 5L1LA 2Z5BB 3MR7A 5JEAE 4A4JA 1WKJA 1WC0A 2R2UA 4GC6A 2IJNA 2HNZA 4NLPA 3MM5B 4CLLA 2HHQA 5ETQA 1TVRB 4DR2E 3R3TA 4J9LA 3KK3B 3GG0A 2RQ4A 3IXQA 3JAMU 2QO3A 2JLGA 5C0XC 3CNQP 3PX4A 4DV5J 3MZIA 1BY9A 3CJQA 2WB1D 4K0KI 5CYQB 1WF2A 2IIHA 4LF8J 1NB2A 2PNZB 1HQEA 3ZZYA 3BS9A 3CC2S 3KHGA 2YNIA 1WKLA 2IVFB 3PO5A 1Y5IB 4JV5E 4BA2A 2N82B 4YB1P 4KGVB 2JEJA 4FBUA 3CO0P 4HDGA 4KFBA 3AOCA 2NXJA 4OZ0A 3ZNUA 3QAUA 4DCPB 1REGX 4FYDA 2ZC4A 2KJWA 4DUYF 3CWVA 1AZSB 1VR6A 1R6VA 3HKWA 1X4HA 2XS2A 5KFUA 4OHXA 4C3LA 4DV7F 1T0TV 4WCEQ 2OMLA 4HKQA 5KG2A 1C1CB 4Y34A 4KV8B 1RT4B 1DY3A 1P1TA 4DV3J 1L3KA 3Q23A 2IERA 3HHLA 4H54A 1L3SA 1XEZA 4WE1B 3Q1QA 3G6XA 1O8BA 5C7PA 2DGVA 4P7VA 2JEIA 3U1MA 4LFCE 3NS7B 1QDUB 3BGRB 4DL3A 3JB9k 5DLGA 2HRYA 3H1CA 4Q0BA 2J7WA 5EX0A 3AHPA 2WOMB 4AQYF 3HHLD 3CJTA 1CPZA 2H4YB 1YRUA 4H4MB 5LMUI 2OELA 2VBYA 3CD0A 1BLUA 4QCLA 1IBKF 4G1QA 2PDAA 1G4CA 5C42A 1GNKA 4OI0A 5J2MB 3DFEA 2WK4A 1EI1A 2J7KA 1UEUA 3D1QA 1RAEB 2V69A 1TMMA 5EWEA 3JSMB 5KG5A 2PGCA 2MKHA 4KQZA 3D7SB 2C37A 4K4YA 2VQEI 1S1TA 4DJBA 2DXDA 4YHHI 5IWAF 2GHWA 4I2PB 4PG5A 1SKSA 1FK9B 2D69A 4USIA 1JLQA 1TUVA 3CCZA 3JAMQ 2OEJA 1PAEX 5IC6B 4ZMMA 4OX8A 1W7WA 3AXMA 2HHHF 1HNXF 4L76A 1E6YA 1H2TZ 1TQLA 4MAKA 1F9FA 5DRKA 5E3RA 2YVSA 3PRVA 4ECTA 1RLDA 3I87A 2YWHA 5KFCA 3FGVA 2ZH6A 2F7VA 2SXLA 3DM2A 3UD3P 2AGQA 3OBIA 2UUWA 3OR2B 4WP9A 4IFDC 4OX9I 1T94A 1S12A 5C5JA 3PS1A 4HEA9 2K8GA 1NO8A 4LR8A 2BJ3A 1QJHA 4QIEA 1IBLI 2VIHA 2ZEJA 1IWAA 2Z8QA 1RT6B 1S49A 1Z0WA 3GFXA 4IH5A 1RAAB 1XERA 2MQNA 1S6PA 2MQOA 3V6DB 1RBOB 2V4JA 2W4DA 4JI4E 2XSJB 5CAAA 4I4BA 3VQSA 2DHGA 2XYPB 2G0IA 5E7OB 3IM8A 2BA0D 1TZ0A 2R2TA 5IT9Q 2R42A 1NJWA 4GC7A 2OLWA 4OYIA 2E7VA 4Z7CA 2YWKA 2Y0SD 4ED0A 2ZC3A 2V2VA 1PYOB 2G13A 2NN6E 5ETLA 3FZ2A 2CPZA 2RB7A 2O67A 3IBWA 3M2VA 2HWTA 4RW9B 4ZVIA 3C14B 4ETZA 1RTIB 5KFYA 1OIAA 3CSKA 1HI0P 3WU4A 1LWXA 3G86A 1RZMA 3ZZZA 1JLFB 3P6YC 1S6OA 2W4PA 2V2KA 2IMWP 1JLBB 2R7WA 4LF9J 4ZVGA 3OPKA 1Q8LA 4F26A 2CPYA 1REVA 4B9MA 1DLOA 4ZHRB 5HQ8A 5IT9C 4UW2A 1RT7A 1I6JA 4K0KE 1U02A 3W5ZA 4LF1A 3NXZA 3CCES 3J80Q 1PKUA 3QIPB 2JEGA 1B62A 1XNRE 4NXMJ 5A8WA 1HI8A 3WHIA 5JEAF 4ECRA 3AA8A 3NNHA 1SJ1A 3DRPA 4ID5B 3M8WA 1UFLA 5FJ4A 4XTJA 2Y0BB 3CJ4A 4DV2J 3EXCX 2D3O1 3CJRA 2HAFA 4LRAA 4TLRA 1SVDA 4DR2F 5L3JA 4BC7A 2B3TB 2EFGA 4DQSA 2VOPA 5J1PA 3M2UA 4BWJA 3PRBA 1UL3A 2ZJQQ 5GMKa 1LEOA 4OJ3A 1S9EA 4USTA 2QX0A 2XWYA 3CMES 3OVSA 3BDEA 2G1DA 2MQMA 2QL5B 2IAJA 4F3QA 1TL3B 2QLFB 1YRTA 3FCVA 3TJ9A 3BZQA 4NMXA 1HPZB 2ERRA 3M30B 4OHYA 4LIWA 3K1JA 4JV5F 2ZDOA 5KFXA 2LEPA 3J80C 4WFAQ 3R27A 2W9CB 2AE8A 4ZOSA 2D1CA 5CA5A 1HFEL 3KJVB 1TV6A 2NYHA 4DR5I 5DQIA 4P6QA 1ZPVA 2ZKTA 5L1IA 5K8NA 2V34A 5I4MA 4NMLA 3QYYA 1XR6A 2VUGA 1WC5A 2OPRA 2V5HG 1J5EI 5L9XA 1HMVB 1H7XA 1YRXA 4XTTA 1APSA 5L39A 1NRKA 4B9NA 4ELTA 1RADB 1R3NA 4IO9Q 2KZMA 3KLFA 4WPAA 4J9VA 1RWKB 5DQHA 1R8BA 2ZNYA 1NK6A 1F3FA 4HR2A 1PO6A 2C2ZB 2CQ3A 1EP4A 2ZITA 2DNRA 2YQ3A 4LFCF 3GPAA 3GILA 4G6VB 2ZM6J 2HNDA 2AD9A 2ROGA 4RUHA 3Q6MA 1U1KA 2B6AA 3W5YA 1NK0A 2VODA 1YI2S 1VQ6S 1CJVA 4QJVA 2HGMA 2VQEE 2G1HA 2BR2B 4J9SA 1X9WA 2C2DA 4HI2A 4YHHE 3RAXA 5IV4A 2ABYA 4CIOA 3C6TB 1O51A 3MM9A 3BYPA 1FJGI 4OI3A 2XO6A 1N32J 1Z0CA 3MPUB 4DR7E 3NGSA 5KG0A 3HK2A 4URGA 4HHHA 3L7OA 2LCWA 1QAXA 1VBKA 3GU0A 2Z2LA 2RKIB 2KU7A 4E8UA 2GJIA 4EWTA 1FTCA 4IR1A 4RZRA 3PIPQ 4B3RJ 3DLKA 5KFIA 3B4MA 1N5YA 3DI6B 5EDWA 1S7IA 2BM1A 3JSBA 4YB5A 4A8QA 1YJUA 1XTZA 3C19A 3QO9A 2CUYA 3TJAA 3VZHA 2QL9B 3TUPA 4ZPBA 3W61A 1VRUA 1NSKL 1SUQA 2BJ1A 2V8VA 3RU0A 1IBLE 2OD6A 3OL9A 3GIKA 4NI2A 4M5KA 1RTJA 1JJHA 2OMOA 4WKYA 5K5MA 5I3UB 1AUSL 1U2CA 3M6UA 3NGKA 1UJ5A 2BKPA 3QAEA 2CPDA 3FKBA 3PS3A 4RU2A 4RW7A 2R8KA 4AIMA 5KFOA 2O1WA 4H4KC 2CJBA 4C0HA 4RUCA 4QZVB 1TKTB 2GZOA 3H0PA 1YX2A 1RAGB 4HDHA 3HX9A 5KG7A 4DV6I 4OZLA 1R89A 3DLHA 2XWXA 2Z5BA 1S9GA 3K5OA 2KH9A 3PXGa 1ZS6A 1TKZB 3SSSA 4MJKA 1Y5LB 1Y3JA 1HQUB 1WHYA 1RSCA 3MM5A 1S79A 2IA6A 1TVRA 3KUHA 2BXJA 3KG0A 3E01A 3KK3A 1DRZA 1VQMS 1KQFB 2JFDA 1ZTTA 4EO8A 1RT1B 4NEZA 4ZLPA 1OSDA 4Q8EA 2FGOA 3GV7B 3QLHA 3OFEA 1IR2A 2IA0A 3HSDA 4XO0A 3QZ8A 1XNQJ 4N3OA 3SCKE 4LF4J 3NCPA 1CBKA 3I4HX 3GV8B 2D7SA 1SKWA 4WZQA 4OYBA 1HNWI 3E51A 2YKOA 3MMBB 2JOQA 4NLOA 4ZVPB 1N34I 4S0MA 3HHDA 5GVQA 3VAGA 2CZ9A 1AW0A 1AROP 1PG5B 3LNUA 2NN6F 3FCHA 3MR3A 1I3OB 3V2UC 1S0MA 1FI4A 3EZOA 1ZOTA 4GO5X 4HLBA 1AZSA 1CS4B 1L3TA 3R6LB 4DN0A 4LF6J 3CMAS 3IRXB 2MTLA 1TELA 4E2FB 4FPRA 3VVTA 2P6TA 1C1CA 4KV8A 3PW2A 4EUVA 3TANA 1RTDA 3GONA 4JI8E 4JYAI 1ZZFA 4K0KF 2ASYA 2L48A 1FRIA 3GJSB 4R0EA 1XNRF 5HROB 4ILLA 2B4VA 3KHRA 3HXMA 4DR3I 3P5BP 4FXDA 3IR5B 1MROB 1U7LA 1SQGA 3M4XA 1JQGA 5KFRA 3NMAA 4DR5E 1YJVA 2GX8A 4TQSA 2FDNA 2PO1B 3U02A 4FZVA 5J2MA 2MHNA 1KVKA 2C3UA 4USJC 3MEDB 3N6MA 4B3SJ 3AB4B 2BANB 3KWMA 2RS8A 3LALA 1J5EE 3NMRA 1VS3A 3GMGA 2XMKA 1RAJA 4GMKA 1VC5A 3EM1A 4ATNA 2XI2A 1BQXA 2IDEA 2DGWA 4O3OA 2UXDJ 5C24B 4A8MP 4I2PA 3TA2A 5LMNJ 3PX0A 4DV4J 3PJ9A 2Q2EB 1RHQB 4J7CA 4DX8H 4QIVA 3M7VA 4P10A 1JXEA 2R8HA 3OL8A 2E5LJ 2X3GA 1WTFA 3T9ZA 2IM0A 2UVVA 3DRRB 2Q43A 1BGXT 5D0RA 1IUJA 4WP3A 3VR1A 3OTCA 5IV3A 4LRBA 2UVRA 2HBZB 1L3VA 2I5JA 1M1KT 3OR2A 4Y2MA 2XMAA 2H48B 4NLRA 4UF4A 5EHHA 4NXNJ 2JFKA 3M9MB 1NAQA 3N6NA 4QWEA 3KRNA 1PGZA 1HYSB 2MEWA 3FBCA 1YH8A 3S8SA 5D0HA 2VQEF 2VH7A 5FLXY 4ECWA 4LVOP 2C2KB 3P3DA 4YHHF 4IOAQ 4CDIA 2VZ9A 2DGUA 4JUZA 4HH1A 3V6DA 1F1BB 4CQ1A 2RNEA 5M2PA 1N36J 3TZYA 1Y00A 2QTWA 4DR7F 3IG1B 1QUPA 3R5AA 2GIQA 2B5JB 5C0XB 2VB6A 1F9HA 2HWIA 3KYLA 3LAKA 5JXSA 4DSIA 3D67A 2E5HA 4ZK7M 3EVOA 2VG6B 1KD1T 3PFOA 1YKWA 3M7ND 1JX4A 5M2RA 5HK4A 1WD6A 4BDPA 1R8AA 2JHEA 1NK4A 5G0RB 4QNJA 3M6WA 1XBWA 1QSSA 2BABA 2HRTA 5HSPA 1JJ4A 1HW9A 4EBDA 2QV6A 3LP1B 3C14A 1MU2B 1SC1B 2LKZA 4J9KA 3MEGB 2GNKA 1NHVA 2H51B 2BE2B 1JLFA 2DHHA 1IBLF 4O3RA 2GO8A 1ZZNA 2KVIA 1IBMJ 4N5SA 3E8OA 1FD2A 2UXCJ 2GV1A 3NL0A 4J9OA 4ZHRA 5EGYA 4JI3J 2LA6A 1U1NA 3DLGA 4A8YA 3VV2B 2Z56B 1FE4A 3VVUA 2CPIA 2IVMA 4N8NA 2V8HA 4X62J 4DLGA 3BB5A 4X65I 3PEHA 4UZCA 4C8OA 2WB4A 1NJZA 2CPFA 2G2ZA 3HHLC 1M5HA 2GJFA 1KLNA 5GAGU 1X0PA 1HNWE 2UV8G 4DQQA 2B0GA 4TY8B 4NOHA 4LIRA 3R5BA 2VFSA 2XB2D 4QR0A 4P73A 3TUIC 3OUYB 3GQCA 2KXHA 3J81Y 4DR6J 2J9EA 1TL3A 2OPPA 4USHA 1JXVA 2NCKL 4DR1J 6FDRA 3DRSA 2GHPA 1FRXA 4CLFA 4AM3A 2G2YA 3DU5A 3U7JA 3GYNA 1JJ2R 2ZUAA 4RL1A 2FHMA 2GC8A 3SIPB 3EVMA 2XYGB 3BV8A 4RNHA 4JI2J 3GP9A 3KJVA 4AIDA 3MOJB 4DUZE 3T1YJ 1QAIA 1ITPA 1RAIB 2HRUA 4JYAE 2FVSA 1PVGA 4LSNB 4FVMA 1WG4A 4WF9Q 4YY3I 2QRRA 2J9DA 3OHAA 4M5NA 1HMVA 4LRCA 2P5VA 5FLXU 1M1HA 2ZD1B 3AJ1A 5AXNA 1MW7A 2NLWA 4KY3A 1Y5YA 2RQCA 3Q6NA 1I1GA 4JI8F 1RCXB 2FVQA 1HIYA 2IBOA 3H4LA 1ELOA 4CYUA 1Q53A 1U2FA 3C66A 2JRSA 2LXIA 1D9DA 3IMQJ 4J9MA 2EI5A 2Y1JA 2GAGC 3CDBA 3CCRS 4YB6A 1SH2A 4LF2A 2AYGA 2OUGA 4C8YA 2UUCI 4X4TA 1XN9A 4Z7YA 4IFDB 1HR0J 4NLQA 1YJWS 5T41A 3DDNA 3GCWP 3WQPA 4DR5F 3K5MA 4LFAE 3R5DA 4DEZA 1U1OA 3C6TA 4P72A 4WKRA 2CWXA 3AFGA 4LCGA 1KVIA 3HVTB 4FKXA 1KC8T 4QYZK 3CJSA 1QE1A 5IT0A 4A8FA 1J5EF 5FD1A 2B8PA 2CAJA 4OYMA 1SV5A 3T1HE 4FYXB 3TP2A 2U2FA 5T7LA 2YKAA 4X66J 1GXTA 2QYGA 1U1LA 3ILOA 5A2QC 3EGNA 4QU7A 4YEAA 1HNZJ 3DI6A 1LOUA 4WFYA 3VCDA 4ZVOB 3B78A 2BACA 1PKPA 3VGUA 4TU8A 2Y8YA 1BXNA 3CDAA 1C1BB 1SKUB 1X9SA 2CNKB 3BPSP 4P7TA 8ATCB 1RWWB 4F0KA 1T9UA 1WG5A 2IRUA 5CXTA 4DV5I 5E41A 1DAXA 1PC5A 2DNHA 2YNGA 2VQFI 3OL6A 1PSDA 1Z1ZA 4F4AA 5D3GB 4C3MA 3ZXWA 4I69A 2N7CA 3H90A 5I3UA 3J81U 2MHEA 3QATA 4B3TJ 1FKAE 4MYUA 1K47A 1FJ7A 3CCSS 5LOQA 3G71S 4ZVQB 1X60A 3H40A 2RF2B 1FJGF 2HPUA 2QA2A 3D68A 3HHEA 3RUBL 2F4VJ 2C3YA 1QSYA 4R5PB 3TYTA 1TKZA 3K5PA 2BZ2A 1EZZB 1HQUA 1S1XA 2VC0A 5KG1A 4GQUA 1RT2B 2V6AA 5K14A 4USUA 5A0YB 1RAFB 5A6WA 6AT1B 4ZP9A 2AJ1A 3J81j 2HNYB 2GQCA 3W2WB 1ZAVA 2XZTB 2YKQA 5KG4A 1B63A 4DV3I 2Z5EA 4ALZA 5L1KA 1ZAXA 3R97A 2QSFA 2DRAA 4KR0B 2Z2YB 3MMBA 3G6VA 3OW2R 1FKOB 2Z2ZA 2PA8D 4DX7A 5DDOC 3U1YA 2X3DA 3HT3A 1JKHA 2X1GA 4QNKA 5AE1A 3J7AM 1P27B 1GMUA 2UUTA 4N8OA 1Z2LA 5L8RC 2AYBA 1M90T 3MCSA 3I5BA 3KLEB 1WEYA 4X65E 1H7WA 3O2IA 2I6WA 1RWPB 3TQEA 3NGRA 3R5JB 2DNKA 4BS2A 5I3PA 5MLCV 3RAMA 2RU9A 4IUFA 1A6LA 3FFIB 2UXBJ 1WDTA 4N7TA 2X7IA 3W7BA 3W63A 2HQIA 4JP8A 2UUAJ 1NHHA 5K8PA 3PYEA 1CQMA 3FEYB 2NPFA 4DF8A 2AKWB 5LMUJ 4O3NA 2OPSA 2Q6BA 3MFIA 1LWFA 5HAOA 4KPCA 4P7AA 4TQRA 3W9JA 4U3BA 2LP4A 2WHOA 1XWLA 4F25A 5HROA 4LQ3A 5IM0A 2PEBA 2IJRA 1VQ7S 1HNWF 5HP1A 4CTAA 1FDBA 1SC3B 4IG3A 2FB0A 1MROA 1U25A 1N34F 2PMHA 4JI6E 5F8MA 5J2NB 2KT2A 2PO1A 1R0CB 3J81Q 1CVJA 2MZJA 1XMQJ 4DPWA 1NSQA 5KOWA 4YY3E 4AXIA 4WFZA 4Y2IA 2ZUGA 2O1TA 1FKPB 1SIWB 1Y0HA 4QYRA 3IC1A 1WHVA 2K1RA 1K0VA 3IS9B 4PWDA 4QWBA 4KPYA 4B9VA 3S7RA 4FYYB 3CXCR 2O66A 4DUZF 5C24A 5JUMA 4ZPTR 4DR4E 3H25A 2Z0GA 4JYAF 5HQLA 1HQ2A 3CO9A 2ZH5A 4IH7A 3Q86A 1JIHA 1ZH5A 2GVZB 1KKHA 4YOEA 2YNFB 3LGNA 2KKHA 4PG6A 1X31C 4OI6A 1D8YA 4HT5A 2C2RA 4OX9J 4FW5A 2B9XA 3QJPA 2UUCE 1NXIA 3V5RA 2QFIA 1SL0A 3NAIA 1TK0A 3IRWP 3D4JA 1HL6A 3VAMA 2PO0B 2OPQA 4MQYA 4X4PA 4UUXA 3DXBA 4O4GB 4PXCA 4C48A 1X5SA 4Y65A 3VAFA 3KLIA 1T9TA 1N56A 1ZYQA 4OV6A 4NZ6A 1K0TA 2DNGA 2RDDA 1HYSA 4O44B 4B02A 1V3RA 3T1AA 3Q8VA 2BRLA 3G8QA 2M7SA 4LFAF 2RH3A 4DX5A 5KFPA 4MKAA 2RVJA 3TR5A 3O1LA 3IG1A 2W9BB 1C4CA 1I94J 1SH3A 4LF9I 2B5JA 5C0XA 3M1VB 1RHYA 1X9MA 1QD1A 1MNEA 3UN5A 4M5IA 1H72C 4K4WA 2HHTA 3R7NB 1VK8A 2HS4A 4DV5E 3T1HF 2EFPA 3MM6A 2UVUA 2PE8A 4KSEB 2H5EA 4LF8E 9RUBA 5G0RA 5DG8A 2V63A 2GGPB 5F41A 4NLSA 2KVQE 5C0XD 2APOA 3LP1A 1UTAA 4L3KA 1Y5NB 1MU2A 4DV2I 2JVOA 2FUG9 2WBRA 1PYTA 3MAAB 1Q5VA 2OAUA 2CQBA 4LRDA 3RB3A 3BN7A 1T8EA 2VL1A 3F56A 1UFKA 2XYHB 5DQGA 5DRPA 1KHWA 5HVGA 1RHJB 2C42A 1AA1B 4IRKA 4NA1A 5CCMA 4NCGB 4F02A 4U7UD 2CQ2A 3OXFA 3UHMA 4LVNP 3ZTSA 2W2QP 4JOUA 5K36C 3BREA 2HFZA 5DDQC 2XI3A 1B99A 4MYTA 5ETNA 3KHLA 2HGLA 4TLQA 4NLXA 1WOSA 4DV3E 3A3OB 3SQGA 3EMTA 3JQMA 2O1VA 2DY9A 1FNXH 2XMVA 4TY8A 5RUBA 1EQMA 4AT1B 1RCOB 2B8QA 1RISA 4WWSA 2C38B 4B3MJ 3D6MB 3OUYA 5DRRA 3E3XA 1FTRA 1AFIA 1TU0B 5D15A 2VPXB 4OO1C 2RSQA 2HGNA 5KFWA 2NR0A 4I7FB 3BDPA 2FYXA 4LSLB 1LWEB 4QYZJ 4TU9A 1GXUA 5HN0A 4JI0J 3W66A 4PR6A 3Q8UA 4NLWA 3SDEA 2GMHA 5DGAA 2IY5B 2ZBIA 4DSKA 3OXGA 1P8GA 4DG1B 2BA1D 2ZNZA 3J7Z5 3TUJC 5MAOA 2PMWA 2DNMA 2R7TA 5FDLA 3SBMA 3T5KA 3DGPB 4X65F 2E1RA 5DNLA 2DK2A 1YZ7A 3TNVA 2ZD1A 4GKKJ 3NS6A 1Q1KA 3TAPA 4I56A 2GO3A 1KLMB 1N32I 3PTWA 4GVBA 5AXMA 1BQMB 1RE1B 1SPBP 4C0BA 1UJ4A 1DTQB 1FDDA 3TEGA 3VGVA 2WBMA 4ZPAA 3VAHA 1BKNA 4KGXB 4N76A 4QW8A 4MKYA
chains in the Genus database with same CATH topology
1HNWI 4UTGA 5LMNI 2HK2A 3P06A 1RR9A 1ZXMA 4PRVA 3J81Q 1N34I 2BM0A 5LL6R 2PNLA 2CZ9A 1FWLA 2HK3A 2IOQA 4X66I 4ZVIA 4DPWA 4YY3E 3LNUA 1IBME 1ZM9A 2O1TA 3WU4A 3ZZ0A 2UXCE 4HYMA 4HY1A 4IZKB 1D6TA 3V2UC 4LF5I 1S4EA 1FI4A 2HFUA 2XEXA 1H73A 4JI0I 4DUZE 2UUBE 4EMDA 4JI7E 4JI3E 4JYAE 2IOPA 1PVGA 2UXBE 4IZKA 4DPXA 1XHKA 4YY3I 1RREA 4GKKE 5FLXC 4X62E 2ZM6I 1IBMI 4DR4E 2UUAE 5GMDA 2VQFE 2UXCI 5IT9C 4KQVA 2PNMA 4K0KE 1EA6A 2HKEA 2Z5BB 5LMUE 3B8HA 3J80Q 1MX0A 2UUBI 1FWKA 4JI7I 3HULA 4PU9A 3GONA 1KKHA 2HKJA 3JAMC 4JI8E 4WUBA 4JYAI 1B62A 1XNRE 1NZ0A 2UXBI 4IZJB 1NHJA 4DR2E 3Q6NA 4GKKI 4X62I 3ZZUA 2UUAI 2AJ4A 5BR8E 4XTJA 1HR0E 4K0KI 3ZKBA 2UUCE 3V5RA 3PYGA 5L3JA 3H4LA 1XNQE 1FJGE 4IZJA 1ELOA 2EFGA 4HXZA 4DR6E 4ED4A 4LF4E 3D4JA 4DR1E 4DR3I 4P52A 4DR2I 4FW9A 1Z0BA 1XMQE 5BR8I 3QT8A 4JV5E 4DR5E 2UUCI 4WUDA 4Z7YA 1XNQI 3WU5A 4FWHA 3QT7A 4JI2E 4DR6I 1KVKA 4LF4I 1Z59A 3J7AG 4JI4I 3QT6A 4DR1I 3ZM7A 3K1JA 3T1YE 3OTOE 3J80C 4LFAE 4DUYE 2O1UA 4LF9E 4B3RI 4JI1E 4LF6E 2HFSA 3WU6A 1J5EE 1XMQI 1S16A 1VISA 3ZZTA 4JV5I 4DR5I 3CWVA 4DV7E 2LJPA 1HK7A 4JI2I 2GS8A 1KIJA 4JI6I 2V34A 1DARA 3OTOI 4DUYI 1Z5CA 4LF9I 4JI1I 3T1HE 4NXME 5FWKA 2V2QA 3K17A 2A2CA 2Q2EB 1J5EI 1H7UA 1MG7A 1H72C 4X64E 4DV1E 4M1KA 1Y4UA 4DV7I 5A2QC 4DV5E 4OX9E 4DV2E 4GKJE 3F0NA 3HJCA 3Q1QA 2UU9E 4UT4A 4LF8E 4LFCE 1Y4SA 1PKPA 3B78A 4DUZI 4JI3I 2V8PA 4DV6E 1MU5A 2ZITA 4DV0E 4AQYE 4X64I 4DV5I 4DV2I 4R1FA 3J81C 1IBKE 1ZM4A 4DR4I 4RPFA 4GKJI 2VQFI 3Q6MA 4LFBE 2UU9I 5LMUI 4LFCI 2VF3A 3QT5A 4B3SE 1FKAE 4MYUA 1K47A 4DV0I 1ZM3A 4JI8I 4AQYI 1XNRI 1Z0TA 2VQEE 1EI1A 2J7KA 2GQ0A 4FWGA 1NHIA 2OI2A 4JG4A 4YHHE 1N33E 3PYFA 1HR0I 3M6AA 1UEKA 1FJGI 1WUUA 4B3SI 2UXDE 1I94E 1Z0CA 1N0VC 4DR7E 1Z5BA 5IWAE 5LMNE 4DV4E 4MYTA 1N34E 2VQEI 4X66E 4DV3E 2R3VA 3WU3A 2Z5CA 4YHHI 2O1VA 3LPSA 2CGEA 5GMEA 1HNZE 2HHHE 3JAMQ 1HNXE 2UXDI 1I94I 4KHPE 2E5LE 3PRYA 4DU7A 5IWAI 4LF7E 4DPUA 3T1YI 1Z5AA 2X36A 4LFAI 4WUCA 4DV4I 4LF6I 3ZKDA 1B63A 4DV3I 2Z5EA 2ZM6E 4HACB 2DEIA 4DPTA 2BM1A 4DU8A 1OJ4A 1FNMA 1HNZI 2HHHI 1HNXI 4KHPI 2E5LI 4B3TE 1XMOE 4LF7I 1U2RA 4HACA 1USVA 1IBLE 3J7AM 4USMA 4NXNE 3T1HI 4NXMI 1ZXNA 1ZM2A 1Y6ZA 1Z0GA 2V2ZA 1N0UA 4DV1I 4OX9I 2F4VE 4X65E 4B3TI 1KTVA 3B82A 1XMOI 4LF8I 1N32E 2O1WA 1IBLI 4NXNI 4DR3E 4DV6I 2E1RA 2Z5BA 1N36E 1Z0VA 3K85A 2X7IA 4USKA 1Z0WA 1NHHA 4FWDA 1IBKI 3PYEA 2F4VI 4X65I 2A2DA 1H7SA 4LFBI 1PIEA 2NPFA 4PRXA 1N32I 4DPYA 4JI4E 2Z5CB 3PYDA 1Z0EA 4I3HA 4URLA 4B3ME 4JI5E 2BV3A 4P7AA 4B3RE 1HNWE 4FN5A 5A2QQ 1N36I 2DEJA 5FLXQ 1H74A 3LTOA 2WW4A 5IT9Q 2R42A 1BKNA 1N33I 4DXLA 1USUA 4IZJD 1A6FA 4JI6E 4N3OA 4LF5E 2ZBKB 4Z7CA 4JI5I 4B3MI 1QZRA 2V2VA 4DR7I 4JI0E 2CG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW I;  4UTG A;  5LMN I;  2HK2 A;  3J81 Q;  1RR9 A;  1ZXM A;  4PRV A;  1N34 I;  2BM0 A;  5LL6 R;  2CZ9 A;  1FWL A;  2HK3 A;  4X66 I;  4ZVI A;  4DPW A;  4YY3 E;  3LNU A;  1IBM E;  1ZM9 A;  3WU4 A;  3ZZ0 A;  2UXC E;  4HYM A;  4HY1 A;  1D6T A;  3V2U C;  4LF5 I;  1S4E A;  1FI4 A;  2HFU A;  2XEX A;  1H73 A;  4JI0 I;  4DUZ E;  2UUB E;  4EMD A;  4JI7 E;  4JI3 E;  4JYA E;  1PVG A;  2UXB E;  4DPX A;  1XHK A;  4YY3 I;  1RRE A;  4GKK E;  5FLX C;  4X62 E;  2ZM6 I;  1IBM I;  4DR4 E;  2UUA E;  5GMD A;  2VQF E;  2UXC I;  5IT9 C;  4KQV A;  4K0K E;  1EA6 A;  2HKE A;  5LMU E;  3B8H A;  3J80 Q;  1MX0 A;  2UUB I;  1FWK A;  4JI7 I;  3HUL A;  4PU9 A;  3GON A;  1KKH A;  2HKJ A;  3JAM C;  4JI8 E;  4WUB A;  4JYA I;  1B62 A;  1XNR E;  1NZ0 A;  2UXB I;  1NHJ A;  4DR2 E;  4GKK I;  4X62 I;  3ZZU A;  2UUA I;  2AJ4 A;  5BR8 E;  4XTJ A;  1HR0 E;  4K0K I;  3ZKB A;  2UUC E;  3V5R A;  3PYG A;  5L3J A;  3H4L A;  1XNQ E;  1FJG E;  1ELO A;  2EFG A;  4HXZ A;  4DR6 E;  4ED4 A;  4LF4 E;  3D4J A;  4DR1 E;  4DR3 I;  4P52 A;  4DR2 I;  4FW9 A;  1Z0B A;  1XMQ E;  5BR8 I;  3QT8 A;  4JV5 E;  4DR5 E;  2UUC I;  4WUD A;  4Z7Y A;  1XNQ I;  3WU5 A;  4FWH A;  3QT7 A;  4JI2 E;  4DR6 I;  1KVK A;  4LF4 I;  1Z59 A;  3J7A G;  4JI4 I;  3QT6 A;  4DR1 I;  3ZM7 A;  3K1J A;  3T1Y E;  3OTO E;  3J80 C;  4LFA E;  4DUY E;  4LF9 E;  4B3R I;  4JI1 E;  4LF6 E;  2HFS A;  3WU6 A;  1J5E E;  1XMQ I;  1S16 A;  1VIS A;  3ZZT A;  4JV5 I;  4DR5 I;  3CWV A;  4DV7 E;  2LJP A;  4JI2 I;  2GS8 A;  1KIJ A;  4JI6 I;  2V34 A;  1DAR A;  3OTO I;  4DUY I;  1Z5C A;  4LF9 I;  4JI1 I;  3T1H E;  4NXM E;  2V2Q A;  3K17 A;  2A2C A;  1J5E I;  2Q2E B;  1H7U A;  1MG7 A;  1H72 C;  4X64 E;  4DV1 E;  4M1K A;  4DV7 I;  5A2Q C;  4DV5 E;  4OX9 E;  4DV2 E;  4GKJ E;  3F0N A;  3Q1Q A;  2UU9 E;  4UT4 A;  4LF8 E;  4LFC E;  1PKP A;  3B78 A;  4DUZ I;  4JI3 I;  2V8P A;  4DV6 E;  1MU5 A;  2ZIT A;  4DV0 E;  4AQY E;  4X64 I;  4DV5 I;  4DV2 I;  4R1F A;  3J81 C;  1IBK E;  1ZM4 A;  4DR4 I;  4RPF A;  4GKJ I;  2VQF I;  4LFB E;  2UU9 I;  5LMU I;  4LFC I;  2VF3 A;  3QT5 A;  4B3S E;  1FKA E;  4MYU A;  1K47 A;  4DV0 I;  1ZM3 A;  4JI8 I;  4AQY I;  1XNR I;  1Z0T A;  2VQE E;  1EI1 A;  2J7K A;  4FWG A;  1NHI A;  2OI2 A;  4JG4 A;  4YHH E;  1N33 E;  3PYF A;  1HR0 I;  3M6A A;  1UEK A;  1FJG I;  1WUU A;  4B3S I;  2UXD E;  1I94 E;  1Z0C A;  1N0V C;  4DR7 E;  1Z5B A;  5IWA E;  5LMN E;  4DV4 E;  4MYT A;  1N34 E;  2VQE I;  4X66 E;  4DV3 E;  2R3V A;  3WU3 A;  4YHH I;  3LPS A;  5GME A;  1HNZ E;  2HHH E;  3JAM Q;  1HNX E;  2UXD I;  1I94 I;  4KHP E;  2E5L E;  4DU7 A;  5IWA I;  4LF7 E;  4DPU A;  3T1Y I;  1Z5A A;  2X36 A;  4LFA I;  4WUC A;  4DV4 I;  4LF6 I;  3ZKD A;  1B63 A;  4DV3 I;  2ZM6 E;  4HAC B;  2DEI A;  4DPT A;  2BM1 A;  4DU8 A;  1OJ4 A;  1FNM A;  1HNZ I;  2HHH I;  1HNX I;  4KHP I;  2E5L I;  4B3T E;  1XMO E;  4LF7 I;  1U2R A;  4HAC A;  1IBL E;  3J7A M;  4USM A;  4NXN E;  3T1H I;  4NXM I;  1ZXN A;  1ZM2 A;  1Z0G A;  2V2Z A;  1N0U A;  4DV1 I;  4OX9 I;  2F4V E;  4X65 E;  4B3T I;  1KTV A;  3B82 A;  1XMO I;  4LF8 I;  1N32 E;  1IBL I;  4NXN I;  4DR3 E;  4DV6 I;  2E1R A;  1N36 E;  1Z0V A;  2X7I A;  4USK A;  1Z0W A;  1NHH A;  4FWD A;  1IBK I;  3PYE A;  2F4V I;  4X65 I;  2A2D A;  1H7S A;  4LFB I;  1PIE A;  2NPF A;  4PRX A;  1N32 I;  4DPY A;  4JI4 E;  3PYD A;  1Z0E A;  4I3H A;  4URL A;  4B3M E;  4JI5 E;  2BV3 A;  4P7A A;  4B3R E;  1HNW E;  4FN5 A;  5A2Q Q;  1N36 I;  2DEJ A;  5FLX Q;  1H74 A;  3LTO A;  2WW4 A;  5IT9 Q;  2R42 A;  1BKN A;  1N33 I;  4DXL A;  1A6F A;  4JI6 E;  4LF5 E;  2ZBK B;  4Z7C A;  4JI5 I;  4B3M I;  1QZR A;  2V2V A;  4DR7 I;  4JI0 E; 
#chains in the Genus database with same CATH topology
 2WNR B;  1IJF B;  1RR9 A;  4JI6 F;  3DOL B;  3C46 A;  2W7O A;  4IOB A;  5DM7 Q;  3PEJ A;  1HWU A;  4A47 A;  4HY1 A;  1KOH A;  3H98 A;  1F3V A;  4YY3 F;  2FLO A;  1HWJ A;  3CCJ S;  3JXO A;  1RU1 A;  1GTH A;  5DLF A;  4IFD D;  4PPD A;  4IZK A;  4DPX A;  4J90 A;  3T9N A;  1XXE A;  2HHS A;  3UFC X;  2FLL A;  2UP1 A;  2OHD A;  4OJG A;  2KDO A;  1RU2 A;  5DZ6 A;  4DR4 F;  2ADC A;  3FK4 A;  2Q6C A;  1KFS A;  1X8D A;  2G4B A;  5E5N A;  1NZ0 A;  3AA9 A;  3PJW A;  2HS3 A;  1NK7 A;  2KXF A;  5AE2 A;  3CCM S;  2LEA A;  5F3Z A;  3FVY A;  1OMS A;  3MEC A;  4NA2 A;  1U1P A;  3J7A 1;  2UUC F;  4DV6 J;  1K73 T;  4DF4 A;  5D3G A;  2AT1 B;  4KH1 B;  4WII A;  2I2Y A;  3EVW A;  1T03 A;  4EZ9 A;  5GAH I;  1LW0 A;  1NPR A;  1XNQ I;  5F8L A;  2YX7 A;  1NM2 A;  2RF2 A;  3MTK A;  3GII A;  4LF4 I;  1HI1 A;  2F4F A;  2B9E A;  2J0W A;  4OYX A;  4LF9 E;  3O44 A;  4R5P A;  3SV3 A;  4O23 A;  1Z4U A;  5EX3 A;  3CCW A;  4FP9 A;  1RP5 A;  2VBZ A;  3O6Q A;  3UO0 A;  3LOU A;  1HW8 A;  1JJC B;  3KJQ B;  5E3A A;  3WX8 A;  4DBQ A;  2NZ4 A;  3BBF A;  4NXM E;  2A2C A;  2F9D A;  1T05 A;  4BLG A;  1N34 J;  2AP6 A;  2FQQ B;  2FJX A;  5A0Y A;  3I0R B;  2VPY B;  1VRQ C;  2WVB A;  2EXU A;  3B6B A;  4DV2 E;  2C39 B;  4O3Q A;  4B9U A;  3W2W A;  1YK9 A;  3TZX A;  2WSE C;  4QQB A;  1RWM B;  1FNO A;  4DV5 F;  2C3P A;  2OSQ A;  4Y2K A;  3I56 S;  5CYM A;  3A1Y G;  1UFW A;  4USV A;  4H4O A;  4NX9 A;  2OJ3 A;  2QA1 A;  4LF8 F;  1U09 A;  2R4F A;  3FRY A;  2RT3 A;  3AQP A;  1UKU A;  1TP7 A;  2J6S A;  1RA7 A;  2XG8 A;  3Q8P B;  3L3C A;  5B0E A;  3CD6 S;  2AF6 A;  2GFF A;  1VQY A;  4KE5 A;  4MKB A;  3A13 A;  3QT5 A;  5F8J A;  3KLE A;  1WWH A;  1SQE A;  4DDF A;  4OX7 A;  2QA4 S;  2DT9 A;  4QIW D;  2XY7 A;  2R7Q A;  4M5D B;  1X5P A;  1I5O B;  3NY0 A;  5B0D A;  3RB6 A;  1WUU A;  4B3S I;  1VQP S;  1OQ6 A;  1UVL A;  3VQT A;  4NLV A;  4ZVH A;  1YG0 A;  2G0C A;  3BEG B;  2PSZ A;  4DR3 J;  3THV A;  1GK8 A;  1JLQ B;  2LMI A;  3F73 A;  4MU3 A;  3JQK A;  4C9D A;  3R7B B;  4LBI A;  5KFT A;  1VLO A;  3BPD A;  3SXL A;  3LP0 B;  2ASD A;  3MUT P;  3QJJ A;  4DV3 F;  2UXD I;  2FC9 A;  1E6Y B;  2MPU A;  2WAQ D;  1X5T A;  1RYR A;  4IR9 A;  1VQ9 S;  1Z5A A;  3GV5 B;  4DV4 I;  1OY6 A;  2CQ1 A;  3K57 A;  3P8B B;  3CJK A;  1XQI A;  2ZM6 E;  4NPO A;  5B0A A;  3K8V A;  4RWW A;  4AUK A;  1FXL A;  2ZH4 A;  2YNH A;  3DM2 B;  2GQQ A;  4QIF A;  4F8R A;  2ZE2 B;  4F4W A;  1PJ7 A;  1ZTW A;  2E5L I;  1YJT A;  2QJ3 A;  1NJX A;  4NWB A;  1VBZ A;  1FKP A;  2BE9 B;  3OFG A;  2WSF C;  3PFE A;  1LKZ A;  4KB7 A;  1JMT A;  1JB0 C;  2GQ2 A;  3TW0 A;  5LSL A;  2AEJ A;  2VBX A;  3DLL Q;  3IS9 A;  2P9C A;  1Q8I A;  4WTY A;  1A0O B;  1N32 E;  1NB7 A;  1W2B R;  4C3K A;  3K5L A;  4JI7 J;  4NXN I;  1GXL A;  3MM7 A;  4MT1 A;  2V4J B;  2N4C A;  4C11 A;  4WFN Q;  2GVZ A;  3P3G A;  2ZDP A;  1S72 S;  4ZN3 A;  1HA1 A;  2ZOG A;  2Z58 B;  5CH7 B;  2Z5C B;  1V5I B;  4PQU B;  1X4G A;  3BYR A;  4TNO A;  4CNY A;  4B3R E;  3UCZ P;  4K4U A;  5LXR A;  1N36 I;  1XIQ A;  2ZOF A;  3NBP A;  2JLE A;  5BR8 J;  5T14 A;  4DSF A;  3O5T B;  1N33 I;  2JX2 A;  2MKC A;  3ZTO A;  4ECZ A;  3M2V B;  4O4G A;  3EWG A;  3NZK A;  1RHU B;  1YZ6 A;  3AB2 B;  1PJ5 A;  4USW A;  2VFR A;  4EBC A;  3VAI A;  3MFH A;  5LM7 E;  3RRH A;  2ZVS A;  2R2S A;  4H4K A;  1R0B G;  5B0F A;  1LQ9 A;  2HQ3 A;  2BJD A;  3A3P B;  2FVC A;  5B08 A;  4ENO A;  2KHC A;  4ZLL A;  1V9O A;  2OTJ S;  1FRJ A;  5DRO A;  2F65 A;  4G3I A;  2FVR A;  2XS5 A;  3EUN A;  2D74 B;  2IM2 A;  1NKC A;  2ZKU A;  2IOP A;  2AYE A;  2FHK A;  2YQ1 A;  5J1E A;  2R7O A;  5HAN A;  4X4U A;  1IBM I;  3KDN A;  3MPY A;  1URR A;  3TA1 A;  3M1V A;  2UXC I;  5A8W B;  2AHO B;  7FDR A;  3B8H A;  2DHA A;  1S6Q A;  2ALZ A;  4OZE A;  5HL7 Q;  2IHR 1;  5IFM A;  3M2U B;  1SB6 A;  4X62 I;  1X4D A;  1FDN A;  1YSJ A;  2GGP A;  4K4S A;  2A1B A;  4GKJ J;  1NSP A;  4LUB A;  1XNQ E;  4L72 B;  3CUN A;  4LF4 E;  5D8H B;  4HHU A;  3HVW A;  2MKK A;  4O3P A;  2NRE A;  4FXV A;  4XK8 C;  2WON A;  3U1L A;  4FW9 A;  3AD8 C;  3D3C J;  2BJ8 A;  3I6P A;  1WC1 A;  3HD2 A;  3WU5 A;  3HP6 A;  3HVA A;  4DR6 I;  3MMA A;  2AIR B;  1JNR B;  1TV6 B;  4DR1 I;  2Q79 A;  3DCA A;  1NKE A;  2LQB A;  4ZVF A;  4LF6 E;  4ED7 A;  4RKU C;  2BJ9 A;  1EKR A;  4LF9 F;  1Z2Z A;  6FD1 A;  2IDL A;  2LQ5 A;  1VRT B;  4JI2 I;  1VHF A;  2EK6 A;  1NDK A;  3UNY A;  1TKX A;  1DAR A;  2CQG A;  4URQ U;  2E7X A;  2V2Q A;  2W01 A;  2YWE A;  3RG6 A;  3W62 A;  2WVE A;  1ZA1 B;  1JXL A;  2RDJ A;  2C38 A;  4OI2 A;  5ELW A;  1EP4 B;  2A18 A;  2VJV A;  5C25 A;  3EPG A;  4JV0 A;  1RJJ A;  3SCL E;  3HHK A;  4UT4 A;  3GSD A;  3KNA A;  4Y6I A;  2E9Z A;  2HND B;  1Y4S A;  2QL7 B;  4DV2 F;  3VHQ A;  4NCA A;  4LF7 J;  4Q5V A;  1H98 A;  2YWW A;  3CIM A;  4I7F A;  4Q44 A;  2B6A B;  1UPP A;  2FJB B;  2ZJP Q;  1YHQ S;  1PBA A;  2GW8 A;  4LSL A;  1LWE A;  1N5S A;  1WHW A;  4R1F A;  2PEH A;  2QA4 G;  5IQ6 A;  2WP8 B;  8AT1 B;  5GAE I;  4C2M A;  4B3S E;  2BQ3 A;  4DG1 A;  2ASL A;  3LQV A;  1WKK A;  3MM9 B;  4WBF A;  4TVA B;  2CAD A;  3SFU A;  3WBZ A;  5H9F J;  1EJ7 L;  2AMC B;  3H2U B;  2VG5 B;  3PYF A;  3LUY A;  3PO4 A;  1HR0 I;  3CTR A;  1VYA A;  4QWC A;  1B0P A;  4NL5 A;  3MMC A;  5GAE U;  3KK1 B;  3R1L A;  3W64 A;  1V3Z A;  2UXD E;  4ED5 A;  5IT9 Y;  3RR8 A;  2EWH A;  4LQ9 A;  4DL2 A;  5LMN E;  5ADZ A;  2KZZ A;  2N4D A;  3AT1 B;  1KLM A;  5LL6 d;  5DDR C;  4DV4 E;  4NRU A;  1S1V A;  2RIJ A;  1U26 A;  2VD3 A;  3DLK B;  2MQ8 A;  1C4A A;  3SEO A;  4K5S A;  4M94 A;  4RBV A;  1DTQ A;  1KQK A;  2JC0 A;  3IR6 B;  2E5L E;  3NCR A;  1PBU A;  3Q8R B;  3GR1 A;  4CLT A;  2MGZ A;  3JTN A;  3RZA A;  2R8G A;  2HG4 A;  2L9N A;  3P5T L;  5BYR A;  2PMZ D;  2F3J A;  2ALY B;  1VIX A;  2WNR A;  4KHR A;  1FVS A;  1RTJ B;  1UCN A;  1HNZ I;  4WP8 A;  4J9N A;  3GYG A;  3DOL A;  4I68 A;  3MR5 A;  2ZM6 F;  4LF5 J;  3C2P A;  2L08 A;  3GJT B;  2OO4 A;  2OKQ A;  1CLF A;  3QQC D;  4NXN E;  4O3S A;  5JEA A;  3US5 A;  1Z0G A;  4CH0 S;  5JVH Q;  1YJ9 S;  1NK9 A;  3J80 Y;  1U4B A;  1N0U A;  4DV1 I;  1FE0 A;  3DRY A;  2IVY A;  1WEZ A;  2DPJ A;  2V0N A;  3V4M A;  1S9G B;  4EU0 A;  5SZT A;  4B3T I;  1OSC A;  4RX6 A;  3B82 A;  1G3O A;  4EYH B;  2FY8 A;  5D77 A;  1LFP A;  2BE7 D;  2ZWO A;  2RRN A;  3L9Z A;  3UDE A;  1X0F A;  3E01 B;  1N36 E;  2CQ4 A;  1N32 F;  4OZ2 A;  2IM3 A;  5B0B A;  2IBK A;  2F4V I;  3ELH A;  3PW5 A;  2VQF J;  1EET A;  2CQP A;  4LFB I;  1LW2 B;  3SSR A;  2W8K A;  2V68 A;  5ITH A;  3BQ2 A;  3IWN C;  3TI0 A;  3QLH B;  3I32 A;  1TFW A;  1F2G A;  1S76 D;  3Q8Y A;  3LTO A;  3CMQ A;  3L7Z A;  4B3R F;  2PA3 A;  3DKD A;  3MGJ A;  4F36 A;  2EG2 A;  3GFH A;  2CJX B;  3PW4 A;  3G96 A;  3A8E A;  3HF5 A;  2OIH A;  1GFW B;  3GFZ A;  2HK3 A;  3TA0 A;  2VOO A;  1IBM E;  2FTR A;  1UZD A;  1YQH A;  2V50 A;  4OX6 A;  2UXC E;  3GIR A;  1J27 A;  2X51 A;  3KJF B;  3M85 D;  1RTH A;  2HFU A;  3VWS A;  2PO2 B;  5C0X E;  2HWH A;  2XO7 A;  4JI3 E;  4C0O C;  5A8K A;  5K36 B;  1VQ5 S;  3H5Y A;  2KO1 A;  2L41 A;  1RTD B;  1RRE A;  4C97 A;  4X62 E;  2BKO A;  3W2V A;  4CLY A;  3I0R A;  2DBB A;  3H5U A;  5IT9 U;  3I4P A;  2O01 C;  2C39 A;  2UXB I;  2G2O A;  3W1Y C;  5DDP C;  2UUA I;  3QNW B;  2R7U A;  2ZHB A;  2DD8 S;  4DZ6 A;  5KOX A;  2E1C A;  4OO1 B;  3ZKB A;  5EKW A;  3FDS A;  4DR6 E;  3PKM A;  3EX7 B;  3ZZR A;  1CC7 A;  2ZBC A;  5KAK A;  3OSN A;  2EFO A;  1T02 A;  1NJY A;  4DR1 E;  3R5G A;  5JVG Q;  3GB0 A;  4NLD A;  1XNQ F;  1H0H B;  2NYI A;  5BYQ A;  1OYD A;  4LF4 F;  4EBE A;  2J8A A;  3RGI A;  1TL1 A;  2F1F A;  3D66 A;  2V67 A;  3CD7 A;  4JI2 E;  4P2X A;  2ZBR A;  4M5D A;  1RT5 A;  2EBE A;  3T1Y E;  3GG1 A;  4I2Q B;  2HBY B;  1CUL A;  4K4T A;  1JLC A;  1XMQ I;  4F2S A;  1S16 A;  1P42 A;  3J80 U;  5KFS A;  4LF6 F;  1HK7 A;  2K3I A;  1KIJ A;  1Q78 A;  3KTQ A;  1RQ0 A;  1HWK A;  1N5Q A;  2XCA A;  3GIJ A;  4DHV A;  3EE3 A;  2E9T A;  1G7C B;  3LP0 A;  4QR1 A;  4ITS A;  4A8S A;  3AXK A;  3FZB A;  3OXL A;  2KM8 C;  5CHC B;  5CYJ A;  3CED A;  2E44 A;  4ZVS B;  2XNR A;  1S59 A;  1FRK A;  3VF0 B;  3I31 A;  4F50 A;  2ZFH A;  2R8J A;  4WXW A;  3T6B A;  1FXR A;  2ZE2 A;  2CQ0 A;  2VFT A;  2I5J B;  4ICL B;  3H5X A;  3D54 A;  4PKD B;  4FNH A;  1FD8 A;  1OYS A;  2R7X A;  1F9E B;  2GO4 A;  1WTB A;  3W65 A;  3TVZ A;  4B17 A;  3N9U C;  4FKY A;  4KO0 A;  3JSY A;  1QSL A;  3CD5 A;  3PAC A;  5JMN A;  4B3S F;  1ROF A;  2GQ0 A;  2ADB A;  2H4W B;  3EZU A;  1UWA A;  2MXY A;  3KOA A;  4RU9 A;  5ETP A;  1L5U A;  4XDC A;  2LYV A;  4I0W A;  4ZKA A;  3M8R A;  4AD6 A;  4X66 E;  2UXD F;  3RYL A;  2Z5C A;  4PQU A;  1MMD A;  3QRP A;  4P2F A;  2QMX A;  1RT3 A;  5LMN F;  4DV4 F;  2QGF B;  1V6H A;  1HNZ E;  1U8W A;  5C2G A;  3WX4 A;  1I94 I;  4X4O A;  3G8S A;  2W4C A;  4IO1 A;  4ED8 A;  4Y2C A;  2HUR A;  5DRQ A;  4IFD E;  2YKP A;  2FJV A;  4U7C A;  2E5L F;  3HSJ A;  1HBM A;  3RB4 A;  4C7Q A;  1WI8 A;  1XR5 A;  1SXL A;  2B7B B;  4B3T E;  3SI8 A;  2Q66 A;  2QFJ A;  1Y6Z A;  2HSE B;  5HMW A;  1Q7L B;  4NXN F;  3DLG B;  4CH7 A;  2F4V E;  1H38 A;  2OGU A;  2D3O R;  3LAM A;  4PXE A;  4QU6 A;  1IKW A;  2UUB J;  3K2Y A;  2DB1 A;  5E3P A;  1IM6 A;  1S1U A;  2YWG A;  4I64 A;  1MMN A;  1DZ5 A;  3FMB A;  3QGI A;  1IBK I;  4NZ7 A;  1HAR A;  4NAS A;  2O3D A;  1N36 F;  3JYT A;  2MZ1 A;  2NXN A;  1VI7 A;  3HFK A;  2MZT A;  4CLW A;  2MKJ A;  1M1G A;  1HHS A;  2BV3 A;  1U47 A;  3HKM A;  1U1M A;  1RTZ A;  2OPP B;  3A4T A;  1TUW A;  2HLU A;  2V4Q A;  4CP5 A;  3DRS B;  1N8R T;  4DFK A;  3ISZ A;  4B3M I;  3IN5 A;  2IYI A;  2DNQ A;  4