1K47A

Crystal structure of the streptococcus pneumoniae phosphomevalonate kinase (pmk)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
322
Chain Sequence
HMMIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQSFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphomevalonate kinase
publication title Crystal structure of the Streptococcus pneumoniae phosphomevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Streptococcus pneumoniae r6
molecule tags Transferase
total genus 102
structure length 322
sequence length 331
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.2: Phosphomevalonate kinase.
pdb deposition date 2001-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1k47A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1k47A01
4DR7E 3V2UC 4DV7E 2UXBI 4MYTA 4WUDA 4GKKE 1Z0GA 5FLXQ 2UUBE 4DPTA 4I3HA 3K1JA 1FNMA 1N0VC 4JI4I 1IBLI 1Z5CA 1Z5BA 5IT9C 3J7AG 4USMA 4LFCE 4UT4A 4FWGA 3J81C 4LF4E 4JI7E 4DPWA 4XTJA 3M6AA 5LL6R 3JAMC 4X64E 4DV5E 4FWHA 1MX0A 3ZM7A 1Z0BA 3GONA 4JI0E 3PYFA 1EI1A 2Q2EB 4X62E 5LMNI 5IT9Q 2R3VA 2EFGA 4DR5I 4JV5E 4LF6E 4Z7CA 5A2QQ 4LF8E 1HR0I 4LFAI 1BKNA 1MU5A 4JYAE 3ZZUA 3H4LA 1S16A 1N0UA 2VQFE 3CWVA 2F4VI 4DPUA 1FWLA 5GMEA 4B3RE 1ELOA 1NZ0A 4GKJI 3OTOE 1HNWI 1KIJA 2E5LI 1J5EE 4DV0I 1U2RA 2HHHI 5BR8E 2ZBKB 4K0KE 4DV6E 1XNQE 1Z0TA 4WUCA 1H72C 1VISA 2V8PA 4ED4A 4DR1E 1NHHA 2J7KA 4FWDA 4OX9I 2ZM6I 4DR2I 1PKPA 3PYDA 4PU9A 4NXMI 4HXZA 4LFBE 4JI1I 4B3TE 4USKA 4WUBA 1FKAE 1HNZI 3T1HI 4DUZI 3ZKBA 4Z7YA 2E1RA 1N34I 2HK3A 3QT5A 4AQYI 1IBKI 2CZ9A 4JI8E 4ZVIA 1I94E 2UUAE 3Q1QA 3PYEA 4YHHE 4DUYE 2AJ4A 1ZM3A 3LTOA 2VQEE 1FJGE 4X66I 4DPXA 2V2QA 2DEIA 1Z0WA 1N33I 3QT6A 4NXNI 1Z59A 1XHKA 1A6FA 4JI4E 4JI6I 1IBLE 3J80Q 4DV3I 1KVKA 1XNRI 3WU4A 4JI3I 2X7IA 1MG7A 5A2QC 2UUCI 2HFUA 2UUBI 4B3MI 3WU3A 3T1YE 2GS8A 2HKEA 1H73A 4UTGA 5LMNE 4B3SI 1IBMI 2UXDI 4HACA 1ZM2A 4DR6I 1HNXI 1H74A 2BM0A 4JI5E 1WUUA 4R1FA 4LFAE 3WU5A 2BM1A 4DU7A 1XMOE 4HACB 1EA6A 3HULA 2F4VE 1PIEA 4YY3I 5LMUI 4X62I 2X36A 4GKJE 1HNWE 2UXCI 4PRXA 2E5LE 4M1KA 4DV0E 4DR3I 4JI2I 2HHHE 4LF9I 1XMQI 1ZXMA 1OJ4A 3V5RA 4OX9E 2ZM6E 2HFSA 2UU9I 5GMDA 4DV4E 4JI1E 2WW4A 1FWKA 1Z0EA 1H7UA 4DV6I 3T1HE 4DUZE 4DV2E 1N36I 4PRVA 4DR4E 1N32I 1Z0VA 5IWAI 2XEXA 4AQYE 1IBKE 3B82A 4HYMA 1ZM9A 1RR9A 4LF7I 4X66E 4DPYA 3J80C 4DV1E 4P52A 1B62A 2UXBE 2HKJA 1N33E 4LF5I 3WU6A 4JI8I 4NXNE 4KHPI 2LJPA 4MYUA 2NPFA 4X65I 5L3JA 2HK2A 4JI6E 3QT8A 3B78A 1XNRE 1FJGI 4DR7I 4JI3E 4DV7I 4DU8A 2UUCE 4GKKI 4B3ME 1NHJA 3J7AM 4B3SE 1Z0CA 1IBME 2UXDE 2DEJA 4JG4A 4DR5E 4DR6E 4HY1A 1HNXE 3K17A 4LFCI 1H7SA 4EMDA 1HR0E 1KKHA 3F0NA 4LF4I 3B8HA 4JI7I 4KQVA 4X64I 3T1YI 2OI2A 4DV5I 3ZKDA 4JI0I 4YY3E 5LMUE 2V2ZA 2UXCE 3ZZ0A 2VF3A 4DR3E 1QZRA 4JI2E 3J81Q 4JV5I 4LF6I 4JI5I 4LF8I 4LF9E 2V2VA 3JAMQ 1XMOI 1XMQE 2A2CA 4P7AA 4JYAI 2VQFI 4B3RI 1UEKA 3OTOI 1ZM4A 4DR2E 4FW9A 1J5EI 2UU9E 4NXME 2R42A 1RREA 1KTVA 5BR8I 4K0KI 1XNQI 3D4JA 4FN5A 1N36E 1HNZE 1B63A 3ZZTA 1N32E 4DR1I 1FI4A 1S4EA 1N34E 5IWAE 1DARA 1K47A 4DXLA 4DV4I 4LFBI 3LNUA 1ZXNA 4LF7E 4B3TI 4DV2I 4DR4I 1D6TA 2V34A 2ZITA 4LF5E 2A2DA 3PYGA 1Z5AA 5FLXC 4KHPE 4X65E 3LPSA 1PVGA 1I94I 2UUAI 1NHIA 4YHHI 4DUYI 4RPFA 4DV3E 2BV3A 4URLA 3QT7A 2VQEI 4DV1I
chains in the Genus database with same CATH superfamily
2HMIB 4OX7A 2RF2A 2V4QA 1YH8A 2V68A 1NLKL 2VESA 5FLXQ 5BR8J 5D4LA 3KDNA 2VBWA 4I6WA 4PWUA 4N47A 3MURP 2K7KA 3M1VB 5E3QA 1FE0A 5L1KA 4F04B 3BV8A 3W66A 1NBEB 2XS5A 4IRCA 4UOCA 1U4BA 5BJRA 5LL6R 2ZDPA 2XS2A 4OMFG 2H65B 5ELWA 3CJSA 3EPIA 2LECA 4P7TA 1Q5YA 3BDPA 1RT7B 3CE8A 3IWXA 4ZP9A 4OZ5A 5KG1A 4RUCA 2M52A 4FW3A 1CLFA 3JTNA 3ILOA 4YHHJ 5SZTA 2F1FA 1HYSB 2CJ9A 2BA1G 3G8QA 1FDBA 3J80Y 2E5LI 4DV0I 1TKZA 4NMXA 3LWMA 4IYQA 3QLHA 4ILLA 1REVA 2XB2D 1HBUB 4CWBA 1H72C 3T19A 2W9BA 4OX9I 2Y1LB 2Q79A 4DR2I 4P75A 1U45A 5ETKA 4EK2A 5C0XB 3DMJB 1TUVA 2VBZA 1RWKB 2QA1A 3IAM9 4R0EA 3L7ZB 3GCMA 4JI5J 4LFAJ 2HW3A 1DHMA 3A8IA 2OO4A 3DU6A 2XM3A 1ICEB 2HQFA 3DXSX 1CPZA 1FFWB 1W26A 3HPOA 1X9MA 5E33A 1CJVB 5DQHA 1J5EJ 1QSYA 2IYIA 2RAQA 2HVEA 4FW5A 2L48A 1UVLA 1SH3A 2B5JA 2VFTA 3GSDA 2NREA 3I6PA 1A6FA 2ZD1B 2XI2A 4WZQA 4F2RA 2VFRA 4QCLA 1F9HA 1XR6A 3C19A 1FA0A 1TP7A 3G8SA 1SUQB 2PO2A 2AE8A 2C3OA 3ENQA 1FKAF 2HKEA 4DV2J 3GMEA 2MTLA 4YR0A 1UJ4A 4DR6I 2V0NA 4IOCQ 1K0TA 2ILZA 5CABA 4YDDB 3M6WA 2GQQA 3LW5C 5HI7A 1HNWE 1SL2A 3SSQA 5DM7Q 1W25A 1KQGB 1JLGB 2XHCA 4NXNF 4BHQA 1K73T 3GFZA 1X0PA 3OR1B 5CCMA 4Y65A 1HIYA 1D09B 2CZ4A 1VQSA 4D3HA 2QT7A 2DNOA 3KLEA 3K7RA 3GR0A 1EQ0A 2DNMA 4DUZE 4IG0B 3TVZA 4DN0A 4DR5J 1HR0F 1YJTA 3R97A 3N01A 1IBKE 1R0CB 5KT4A 2VOOA 3IFEA 3J7AN 2VASA 4Z2XA 1FEEA 2BJ8A 2KVIA 1DZ5A 2AMCB 1MU2B 2R7SA 1EETA 1R8PA 2UXBE 3A13A 1N33E 1U1OA 3GR1A 1K44A 3HD1A 4FXWA 1RAJA 4JI6E 2FZKB 3NCPA 1U1MA 4CCHA 2R7TA 3DI6B 1ZAXA 2B3TB 3UDCA 2ZFHA 2FJWA 2FLLA 2WP8A 4GKKI 1GT8A 1Z0CA 1FRJA 4A47A 4KHRA 2LYVA 1NPKA 2WAQD 1S6PB 2YQ1A 4QPTA 5B0GA 1AXQA 4K7QA 3TUZC 1IUJA 1NPPA 2QE5A 3ENAA 2CDQA 2DHSA 1QZRA 4P9SA 4DBQA 3HM9A 4LF5J 5CXTA 1P1TA 1OQ3A 4OO1D 5HVFA 4OYBA 1QM9A 4AXJA 1Q7LB 2IRYA 1RI7A 1R43A 2YWWA 4ZN1A 2XCPA 3NCRA 3DHXA 5HROA 1UCNA 1YG0A 4N5SA 4FVCA 2JVRA 2YBVA 2VD3A 3MTKA 2BA0G 3M8WA 3KWMA 3DOLB 4B9SA 1SJ1A 3KUGA 3MECA 2ZUAA 4X62J 2R2UA 3MM8B 1Y10A 4JV5F 5F0UA 4HI1A 2OEKA 4KV8B 3H90A 2VQFF 4OYOA 4AD6A 1KP6A 3QSIA 4DX7A 4B3RJ 1NHIA 3PG9A 4K2XA 3D6MB 2XNQA 4WP9A 4B17A 4DQPA 5KFXA 2UUBE 2OPSB 3ETMA 3VGUA 1DQ9A 5KFEA 1FO1A 1UVMA 5A6PA 2OPRB 3NEKA 3G6VA 2R7QA 3M8PB 4JI4I 3W61A 4DR1J 2E1CA 1B0TA 3J81C 5LXYA 1WNEA 2YWFA 3C16B 3CJ2A 1RWOB 3GONA 4RL1A 4LF7J 3PTWA 3POTA 3RZAA 5LMNI 3DOMA 1X4CA 3M30A 4HDGA 4WFYA 3FSYA 4G1PA 1EP4B 1S1WA 4JYAE 4QR0A 1N0UA 3DGPB 2MKCA 2VQEF 1B7FA 4O4GB 2JL9A 3PFOA 4NLQA 3OVAA 1WKKA 3RRGA 4YB7A 2GO3A 3TW0A 1USUA 2EFQA 2WONA 1R8HA 3FKBA 3M8YA 3BB5A 4DV6E 1GEHA 3Q8YA 5FLXU 3HSGA 3UI3A 1VQLS 4DS4A 2QFIA 3LP0A 3PYDA 3T1YF 1Y11A 1HBNA 2VFVA 3FQLA 3GJSB 4USKA 2B7CB 1BQMA 1KN6A 5ETSA 3ISZA 2HNZA 3ZXWA 2BYCA 4GRSA 3M8SA 4KKOA 2QYCA 2VC1A 1FJGE 1AB8A 4WTOB 4KAIA 1CQNA 4ED0A 3UR3C 1RWPB 1U1KA 2ZE2B 4PEOA 3M8QA 1IR1A 1EKRA 1WHXA 2BJ1A 4DV3I 2AEMA 2E5GA 3OV7A 1MG7A 1R8CA 5HP1B 2UUCI 2B8QA 3KYLA 4B3MI 2W4DA 2GS8A 4TYBA 4DR4F 5KFTA 2O1WA 1FD8A 4HACA 3JQKA 3DYAA 2YKOA 4KGZB 4NLPA 2NUUG 2BJ7A 3KLFA 1NJWA 4UY85 1RT5B 2VFUA 1U6ZA 1I94J 2UVRA 4J3DA 2PEBA 5ETOA 5KG3A 4YY3I 3EDRB 2IRUA 2E5LE 4M1KA 4ECVA 4DV0E 4ETZA 4DG1B 1QE1B 2JDJA 4HHJA 4FXVA 1XMQI 1IR2A 2VB6A 4YB1P 5E5NA 4A8QA 3EE3A 2KZMA 3HHLA 2E9ZA 4OYWA 3R7SB 4OX9E 5D4PA 2Y0BB 3T3FA 4Q8EA 2BANB 3P49B 1RT4B 3R5CA 1F2GA 3QFWA 5D78A 1PJ5A 3DRSA 2N7YA 3IWNC 4Q44A 2OUGA 5JMNA 5L1LA 1NHVA 3B82A 3DDNA 4KGMA 3X1LB 4IH7A 2AEFA 1RWMB 2UV8G 1F60B 4ECQA 1N52B 4AFFA 3D2WA 2O5DA 2DXFA 4ZJLA 2CJYB 4RO0A 1B62A 5K36E 2RJZA 3ITHA 1Q7YT 2P9EA 3TARA 2BJEA 2Z2ZA 1JXEA 4RLEA 2EG2A 2J9DE 2VIHA 4QNKA 3QT8A 3K85A 1JXLA 3DNCA 2UU9J 3BKFA 4WXOA 4DSLA 4KY3A 1FWPA 1HNZF 4PG5A 4DUZF 2KT2A 2M9KA 1X8DA 4DR6E 1G3OA 1T05A 4M5LA 4AQYJ 5J2QA 3KLIB 4FBUA 3ISND 2VC0A 2I0XA 2ATLA 1WWHA 3H98A 4X66J 1JKHB 2J6UA 3QJJA 4LF6I 4ID5A 5I42A 2F4FA 5G4DA 2UUWA 4OV1A 2Z57B 2V2VA 1XMOI 4DL7A 2IA0A 3RB6A 2GAHC 5J2PA 4EYIB 5IXUA 5EDWA 2F8EX 3D1HA 5BR8I 1RADB 3F41A 2QJ3A 5B0BA 1Y5YA 2XBPA 3LF0A 4Q2LA 3CTRA 3ZZTA 3PS1A 4Y3CA 1R0AB 1VQNS 1RLCL 3MEGB 4DFKA 3DLKA 2G2ZA 1B4SA 1GMWA 4I6YA 4K4VA 3NMRA 2J9EA 3G82B 1ZOTA 3CCUS 4V19J 3DCAA 2XY6A 2ASDA 1Y4ZB 3HVTB 3ZC4A 1Z5AA 3D67A 3VHQA 2KFNA 3N6LA 1PVGA 4MU0A 2DTJA 3AJ2A 3SEOA 2UUAI 1VLYA 3UR0A 4YHHI 4RPFA 3MWBA 3IR6B 4GKKE 1YJRA 1S10A 2POKA 1B70B 3RAQA 2HVIA 2V69A 3M32A 5C7PA 3K1JA 3W8GA 1VQYA 1YRTA 2QGFB 1N32J 2BQ3A 2NPIA 1Z5BA 4P7VA 5L1IA 3R2DJ 4NLTA 4Y2MA 4LFBF 1UVNA 1PYTA 4CYUB 2DNLA 4IFDF 5KG0A 5I3UB 4PWDA 1IKVB 2Q2EB 1TFWA 4U8VA 2GMHA 4LSNB 1FJCA 2ZOGA 3W8PA 2HFZA 2DBBA 4LFAI 5K36D 2R4FA 2PI5A 2W9CA 2LQBA 2JEAA 5HMWA 4Y28C 2FHMA 4XDCA 2OAUA 4CO2A 5E3PA 4I7FA 3PX0A 1UETA 4Q7AA 2DR5A 4RW6B 1FRMA 1YWXA 1FESA 2PMZD 2B8PA 4F4ZA 5KG5A 1YHCA 2XY5A 2MPUA 2HNDA 2PEHA 2J7KA 5KOXA 8ATCB 1ULRA 3V6DA 4IZJB 2O66A 3BBBA 4DCJB 1CS4B 3G87A 2Z30B 1VBXA 1SIZA 5EUHA 2HHQA 2C1EB 1S49A 1CULA 2Z2YB 1ZZFA 3TZZA 3KHLA 1IM6A 2HMIA 4GQUA 4KH1B 1FE4A 2HS4A 3EGVA 4USIA 1GXLA 1VRUB 2DH7A 2G4BA 2FHJA 3TO8A 1YRXA 2HYIB 3ENVA 3M1VA 3LP1B 4FKXA 1Z59A 5EN1A 1RACB 1JLCB 4JI4E 1Y3JA 5FWKA 1RTIB 3K89A 5LJ3Y 4DV4F 3VVUA 5D6GA 3MCOA 3UO0A 2W4PA 4QR1A 5LMNE 1UVIA 2E7WA 1NH8A 3KK1B 2NN6A 3AJDA 3WU5A 5DRPA 1GXTA 1C0UA 1MWQA 5H9EJ 5DJBA 4NA1A 3GYNA 3H5UA 2GHPA 5C25A 4DUYJ 4ZLNA 3F73A 3H2VE 1EARA 4A8KA 4PRXA 1TMJA 2ZH4A 4DR3I 2PN6A 3C6TB 4EO6A 3FDSA 3V5RA 4O3PA 1SH2A 2W2OP 3BN7A 5C0XA 2MKKA 2R8JA 1C1BB 5F9NA 1P9QC 2K3IA 2MY8A 2WVBA 3A8EA 3GCXP 3MMBB 3HHDA 2WBMA 3DRRB 2XNRA 2CFXA 4I69A 5L8RC 4CO3A 1LK5A 3BSOA 1FTRA 3C66A 3MPWA 3GV7B 5B08A 5A2QY 2CNLB 3W63A 5DM6Q 2YQ3A 1USVA 2WBRA 1RAEB 4Y00A 3BH6B 4AM3A 5KOWA 2J7WA 4DV1E 4MDTA 5A8WA 1VLOA 3GIKA 2ZD1A 3CIMA 2QRRA 5B0AA 2OSQA 5HATA 3PO4A 4LF5I 1WC4A 2LJPA 1WORA 2VDHA 2DPIA 2J65A 3MOZA 4CLLA 4DR2F 2DNZA 3B78A 1L3SA 3NG8A 5KFHA 2EFVA 2UUCE 2DR6A 4B3ME 2LU2A 5IT4A 4ER8A 4OHZA 5AE3A 4EBEA 3J7AM 4OI0A 3W9JA 4YS2A 4KGKA 2HS3A 5CHCB 4DUTA 2DHGA 1S72S 1C1CB 2MY7A 4NLGA 2DIVA 1IWAA 4LFCI 3V4IB 1G6BA 3O8WA 2DNPA 3F0NA 3B8HA 4H4OB 3C15B 1ITPA 1TU0B 4WZMA 4YY3E 1S9GB 4ELUA 1HWKA 4EU0A 4FF3A 2M70A 5EWEA 4ILMA 3Q6NA 1XMQE 3BBFA 2HHVA 2G1DA 1UW9A 3I4HX 4B3RI 1R7IA 1RHMB 3R1HA 4URSA 4K4ZA 1N6QA 1J5OA 1KFDA 2HZVA 5GAGI 5D15A 4I2QB 4J9RA 4FN5A 4DR1I 1T9YA 1FI4A 2VG6B 1JX4A 1V5IB 5KFCA 4UW2A 3ZNJ1 2FJAB 2C2RA 1JLQA 2IDEA 5LMUJ 3MEDA 6AT1B 2RSQA 5GVQA 4OZNA 1E6VB 2LDYA 1WD6A 1D8ZA 2MQ8A 2G2YA 3MEEA 2IRXA 1O0PA 4YR2A 2LQJA 1XXEA 3PJWA 3WIUA 5HVGA 2CYYA 5SUHA 1RAIB 2LMIA 3QT7A 1JLFB 4MK8A 1F5AA 1VC5A 2E44A 3OHBA 3JSMB 2ZVSA 3OBIA 2B4OA 4KO0B 5C42B 3GCWP 5F8JA 2D74B 3TNVA 4ECRA 1NK8A 4AUKA 1S6PA 3US5A 5AE1A 1K1SA 2H5JB 2ZHOA 2LEAA 2BJ3A 4DX5A 3IO1A 3AA9A 3ZZYA 1KSPA 2JX2A 3PFEA 5LT5A 2KKHA 4TYAA 1Y5LB 3LAKA 2PO1B 4LF6E 3RAMA 3EM1A 1S1TB 4C8KA 4CLPA 1I94F 5GMEA 5LSOA 5A8KB 2CQCA 3BSCA 2W2NP 1WF1A 2X3GA 5EHHA 4V19X 2QC3A 1VRTB 2I2YA 3SMZA 5BR8E 2BXJA 2K7JA 1IBLF 3T5HA 4IG3B 3DOLA 4NLSA 2V8PA 3OL9A 4F4KA 5JEAC 1QDUB 1WTBA 2C22A 4X64J 2ZBRA 1HL6A 4JI1I 1RB0A 4JI0J 2GFFA 1NXIA 4X4SA 1RCOB 3MMAA 2IVMA 3BBCA 4UQTA 2DISA 2VFSA 3QWUA 4LF8J 5MLCV 4OLPA 1HD1A 4RWXA 2Z56B 2DH8A 2VICA 2KM8C 2UUAE 1P8GA 3Q1QA 3PYEA 5F8IA 4YHHE 2IBOA 2AJ4A 2W24A 2GVDA 4PXDA 2EKNA 4AE5A 2ZHAA 1TK5A 1ACMB 4A4JA 4DPXA 4K8RA 3M8PA 4GMKA 4FF1A 2XTJP 2W4CA 5D8HB 5T41A 4BA2B 1X7VA 2DRDA 4ISAA 1KVKA 1VOMA 3DD6A 1R6VA 1NHUA 3L09A 1X4GA 3QJLA 1YI2S 3MOJB 1WC1A 1PG5B 4B3SI 3J81j 1EP4A 4NEZA 3I56S 4AQYF 2YKAA 1RHQB 3CULA 2IC3B 3DGPA 1U24A 2BM0A 4JI5E 4R1FA 4LFAE 4F50A 4KSEB 3V6JA 1YJVA 1RZMA 2G0IA 4QBUA 4LUBA 2AQ4A 5KFKA 1KHWA 3V6HA 1HI0P 2XLJA 5DRQA 5JEAB 4RNFA 3GTYX 1HQEA 1KQFB 2JE6B 3MM6A 3CW2C 4XPCA 1ZXMA 1WC0A 3UPFA 1BQNA 1S1UB 2EBEA 2GJ2A 2FIUA 3UW1A 2JSXA 4JI3J 2QTWA 4WXWA 2HFSA 1OYSA 2UU9I 5GMDA 3R2CJ 3AD8C 1Z0EA 1FT8A 2KM8B 4WFAQ 2B6AB 3Q86A 4DV2E 4FW4A 2V8VA 5FIIA 1AYEA 1S6OA 1LQ9A 4ZIVA 1VQ4S 3J81Y 2ZKUA 4KFBA 1RSCA 2ZBIA 4ZITA 5J1PA 1S59A 2MZSA 3LALA 2C39A 4GKJJ 2FJXA 1FD2A 4RNNA 1HPZB 4RR5A 1NH7A 4JB8B 5EGYA 1VR6A 1VMBA 2HGNA 2CPFA 4KHPI 3T5JA 2VJVA 2A6OA 5DRRA 2J6TA 1RWUA 3PRDA 4MU1A 3OVSA 4NXMJ 3RW7A 1RU1A 4KTQA 3UNGC 4RW9A 1N32F 1OPZA 2QL5B 3M2RB 4DR5E 1N34J 1RWWB 3VALA 2YX1A 2WHOA 4M95A 2CG8A 2R7XA 1FKPA 1LFWA 3HHEA 2EC2A 2H1YA 2IM3A 1LW2B 2OH2A 5E0OA 1L3UA 5F3TA 4DR3E 4QWAA 2Z5CA 4P2MA 1YQHA 4P7AA 5EX3A 1VIOA 5IOLA 4DV3F 1NHKL 2KHDA 1RT4A 3HZGA 4C6AA 2XGQA 2V50A 4R0JA 3CJ4A 4K5SA 4TQRA 4OQJA 3K59A 1GH8A 2CNOB 1S1XA 4P74A 4FW7A 2D3O1 3RGIA 1RT3A 2HBYB 4ZN3A 2VG5B 4DV5J 3BO2A 4YY3F 1RT6A 3S6EA 4ANDA 4IRDA 1KOOA 1W2IA 3QNWB 2OEMA 2ABYA 2FLNA 3OSPA 4LF5E 4K4TA 3UN3A 3OTCA 3OFEA 1K8AT 5K14B 1SKRA 2FHOB 3OFHA 4URLA 3PY8A 3J7A1 5L46A 3MUVP 4CQ1A 4WU2A 1Z0GA 2ZBPA 2QLJB 3KLGB 5DQIA 2I38A 1NSAA 4IFVA 3ILJA 1UDOA 2J0SD 4Y0FA 1VBYA 4ECXA 4C98A 4IFDD 4LFCE 4OHWA 3KMQA 4DPWA 3OSNA 3GFHA 1ZYQA 2NYHA 3CCWA 3Q89A 2AGPA 2PA3A 2AIRB 4LRCA 5IV3A 3M9NB 2CQBA 4X62E 1Z1ZA 1DAXA 1OS5A 1U2CA 4W92B 1PBUA 3TA0A 1BC6A 3OTEA 4JI8J 3K2YA 5FDLB 1IVZA 3MM9B 2B51A 4DUYF 1N4LA 3CWVA 2D69A 2KFYA 2WRMA 4C4WA 4B3RE 4TQSA 3I9V9 4ECWA 1X4FA 2MDAA 3D6FB 4DR7J 3RJMB 3CGIA 2IAJB 1B0VA 1U1RA 5M2RA 1Q86T 2BR2B 2BRLA 2C38B 2ZBKB 2DNGA 3THVA 1UVKA 4LRDA 2V5HG 1S99A 4Q5VA 2GQ0A 3HK2A 1FRHA 4ED4A 4DR1E 2V67A 2KO1A 4XK8C 4HH0A 1PYOB 1HFEL 1RBOB 3DOKA 2IM1A 1RT2A 5K20B 4WE1B 1TL7A 4I1TA 1T9UA 1XMOF 2YY3A 3D7SB 1WF0A 4OO1A 2MKIA 3OL6A 2F4VJ 2FJDB 5DDQC 2HAFA 2O1TA 1YJWS 3U7JA 4B3OB 2YWKA 1NNDA 4WU3A 3LTOA 3GG0A 3DRPB 2KFZA 3EZ5A 4WBFA 1FXRA 5L38A 3DGVA 3QRPA 4BWMA 1LWXA 3A3NB 2FB0A 1CJKA 4CYUA 3LANA 5I3UA 2BEFA 1EJ7L 1LW0B 3F44A 3Q8QB 4OIXA 1AA1B 2DRBA 1U0SA 1H73A 2RHSB 2RE1A 4WFZA 1BE4A 1Y60A 2I1RA 2PNMA 5HO4A 7FDRA 2HFOA 3R27A 2FYXA 4O44B 2UUAF 2IVYA 4HHHA 1CG2A 1Y5NB 4J9LA 4RW8B 1X9WA 3BO4A 2X36A 3WC0A 1H6KX 3A3PB 5E3RA 3SZ2A 4NRUA 1KS2A 3M05A 2AWZA 2HQ3A 5DROA 3QFHA 4X4VA 2P8IA 3UVJB 2G2OA 3W5XA 4IS9A 4RW7A 1JLBA 2LP4A 3CD5A 3VGTA 1TKTB 4OI1A 3SIPB 2CUYA 4FF2A 1DURA 4OYPA 1C4CA 4JI1E 1OY6A 3DLEA 3KK3A 1H7UA 2R7WA 4K4XA 2Q6CA 2XWXA 1N36I 2KL8A 4YUDA 2X51A 4OJGA 1ZM9A 3WIVA 1FKOB 4XIUA 3BQ1A 2HFVA 4M5NA 1Y4SA 2GW8A 2UXCJ 3W5ZA 4CT8A 1FK9B 1OY8A 2DR8A 2WOMA 1JLCA 2BJ9A 5KFYA 1X4DA 4XPEA 2R7OA 1LXNA 3HO1A 3UQSA 4X4RA 4MK7A 1UEVA 3KJNB 4CLZA 4NYOA 2GQCA 5G0RB 3AJ1A 1R6MA 3KJVB 2HHTA 1NUEA 3CC2S 3KK1A 3U1MA 2O3DA 4B3SE 3H5YA 2WB4A 2GGPB 2CQ0A 1SQGA 5IWAJ 3CMES 2Q6BA 1KQKA 2VL1A 3HHLD 5E2QA 1IKYB 1IQTA 2R2TA 4J9MA 1YBTA 4WFNQ 1FEHA 1WKJA 3KNGA 2RIJA 4RW4A 1HQUB 4N56A 1QLNA 3EGNA 1UFLA 2VF3A 4DQSA 2YNHB 2MJNA 2VODA 3JAMQ 3TRGA 4ANEA 3NOGA 4DZ6A 2AD9A 3D54A 1P9YA 5B0EA 4PG7A 1AT1B 4CLYA 3MMBA 1ZM4A 2UU9E 1TVRA 3DRRA 3TEGA 4KJIA 2HZCA 1AUDA 3QAEA 1RTJA 4DL3A 2G1HA 3L7UA 3FUYA 2GHVC 1V3RA 1TL3A 4C8OA 4LF4F 2PO0A 1F6TA 1DARA 2EEYA 2FGOA 1K47A 1QAJA 4X64F 1ZETA 4UOHA 3CMQA 3TVYA 1YJNS 1LFPA 2KDOA 1FJEB 4U95A 3T5LA 3OJSA 2C28A 3IGNA 2B9WA 3D0GE 4WJBA 3MAAB 2E9RX 4LF9J 2A2DA 3VV2B 4NL5A 4KHPE 2CPHA 2AYBA 3A3OB 2CGEA 2ROGA 2N4DA 1LWCA 4MYTA 1N0VC 2EBGA 4KE5A 4PXBA 4J37A 1UJ5A 4C48A 1Q1KA 1S1VB 3MD1A 1S9GA 1Y6ZA 3ZM7A 2JEBA 1G4CA 3BYPA 2EFGA 3NGRA 2EK6A 5L1JA 1S6UA 4Y2AA 5IT0A 5A2QQ 3LO3A 4FF4A 3OL7A 5GAGU 3RRKA 5HBMB 4NYPA 3DLJA 1S16A 4Y34A 3OJUA 4DPUA 2JNJA 3EJMA 2NN6E 1R8AA 4DMZA 2HHHI 3FSIA 2L9DA 2F3JA 4ZPWR 2IM2A 4LBPA 4LFCF 3G71S 4FW6A 1RAAB 1QJHA 2EC0A 4LQ3A 4DLEA 2K1RB 3DU5A 3NCQA 1E6VA 1WDDA 4GVBB 4L75A 1XERA 2JH3A 1HNIA 3DFEA 3CD0A 4QZVB 1OYPA 5B7WA 4UUXA 5C0XE 3C14B 3P76A 2K2PA 1JLFA 2DD8S 4GKJF 2OGUA 4H4MA 1PKUA 4AIMA 1EQMA 2D3UA 4LR7A 4KO0A 2DEIA 1IWGA 1HNVB 4U67Q 5CCLA 1HHSA 3QT6A 4YDXA 1WF2A 4FZVA 4F26A 3I4PA 4G1QB 3GV5B 3IR7B 2DXEA 4CI0B 2I9SA 5DS7A 4JI3I 2BDPA 3I5BA 3IRXB 1DTQB 5KFRA 2PO1A 1SVDA 4TVAB 4O23A 1N8RT 4LPFA 1H2TZ 2ZWPA 5IQQA 4B9UA 3I9ZA 1JLAA 4OJ3A 2CPIA 1WUUA 2RT3A 5JJBA 3RYLA 1WACA 3PV8A 1QTNB 3DC2A 3ICLA 3GV8B 3QGGA 2BE9B 1VRTA 4Z37A 3GYGA 1B64A 3SCIE 3A8KA 2GVZA 4R5PB 1BGXT 2VONA 3KG1A 1L3VA 1T8EA 2B9YA 3RU0A 5L9XA 1NO8A 4HI2A 4ED8A 3FVYA 3BN4A 3BPSP 1N5YB 2DCLA 5F3ZA 1NZ8A 3PW5A 1IR0A 3O2IA 3R6GB 1HR0J 4IZKA 2O1PA 4D3GA 3VAKA 3FRZA 5EKWA 3I96A 5DETA 2V6AA 3ELHA 1FRLA 1VQ8S 1YLXA 1NJZA 3BR8A 1NB7A 1NPRA 2DY9A 5K36C 2FDNA 2GHWA 2BKNA 3TAMA 1KNZA 4QNJA 3P96A 3IG1A 2DR7A 4HDHA 1QY7A 2ZUGA 4USWA 4ZVRB 4NLVA 2KJVA 4QU7A 2GA7A 1A0OB 3D28A 3M7NG 2IC3A 3PIPQ 2QFJA 3MF5A 3TAPA 5LL6d 2CQGA 2IBKA 5DO2A 4DFMA 1KLMB 5C2CA 4DV5I 2AGQA 5C0XD 3FMWA 3W62A 1KD1T 2DT9A 4CO1A 4OZ0A 1YSJA 2B56A 1J27A 4DN9A 1RBAA 2RRNA 4X65F 3H20A 2JRSA 2B0GA 1U8SA 4KHMA 2HQIA 3M6UA 1M90T 2KRRA 1BHNA 1GXUA 3K8VA 2V9WA 4Q0BB 4DZDA 2C2MB 4MFBA 4DR7F 1VK8A 4X4UA 2FZCB 2PC6A 1U47A 3MCSA 1RCXB 4HT5A 1RDRA 1UAWA 1SL0A 4USTA 4K0KI 2MKJA 1N36E 4O0NA 1ZAWA 3WQPA 2DNRA 3PVXA 4ZHRA 5HMZA 4CTAB 1IJEB 1HPZA 5D0RA 9ATCB 4NI2A 4B9VA 2CPEA 2ASLA 4B3TI 1BLUA 1ZTWA 2B4PA 1LOUA 2QLBB 2YKMB 2DGOA 3DRYA 3KJFB 2VQFJ 2CDRB 1FX4A 3JAMU 1NK9A 2E66A 2P5VA 1JMTA 4PUOA 3CJKB 2UXBI 1R89A 2YKQA 5F8NA 2Y1RI 3M2RA 1RGVA 3CJ5A 5KFNA 2M5YA 4DQRA 1PYSB 1HWLA 3AT1B 3TUPA 2VKRA 5F0WA 2HVDA 2PSZA 4R25A 1T03A 3N6MA 1WOSA 4CLKA 3H4DA 2JEFA 4DLGA 1CJUA 5GAEI 4C11B 3GP9A 1TUGB 4LSLA 3IXQA 3P06A 1SJ3P 1WHWA 1S12A 4CLWA 1VC6A 1SH0A 3H25A 2F4VI 4RZRA 1RTDA 2VQEJ 3KNAA 3QZ8A 1N5QA 5LM7E 2J0QD 3CF5Q 4ZIWA 4CM2A 4WUCA 2W7PA 4WF9Q 3EUNA 1WTFA 3GZ7A 4FWDA 1UWBB 5C24A 4PU9A 3AFGA 1CEZA 2ZKTA 3T1YJ 2HNYA 3NWGA 1WHYA 3Q23A 4DQQA 2XI3A 2Z8QA 3T1HI 3ZKBA 3CCLS 2E1RA 3OFFA 1Q82T 1NKBA 5AXNA 1S7IA 2PDAA 2J6SA 3PRBA 1TL1B 5J2NB 5A2QU 1WKLA 5EWFA 5ETPA 1KOHA 5A0YB 3NGDA 1RK8A 3OUYB 3MCMA 4FNIA 1G7CB 3BGUA 1OWXA 2QL9B 4U96A 1UPMB 2KTQA 2LXIA 2ZM6F 1S57A 1UDNA 3M2VB 2MHNA 1YIJS 2JHEA 5J2MB 3NBPB 2JWNA 5KFJA 1HWUA 2UUBI 4F4AA 1RKJA 3GIIA 3CSKA 1E6YA 4C2MA 4DR4J 1VI7A 5FDLA 4TXSA 1HNXI 1GFWB 2MLXA 4QPXA 3MMCB 4DU7A 2ACYA 3K5NA 3DM2A 1HWJA 1EA6A 3GG1A 4OHYA 2VHGA 3ONQA 3NXZA 2C38A 2YWEA 4OZ2A 2UXCI 2ASYA 1YKWA 4E8UA 4E98A 2HHHE 2YX7A 5AXKA 3TYTA 4EZ6A 4K5RA 3CDEA 3EICA 2F1DA 3PIOQ 3GIJA 1RP5A 3T5KA 1EAYC 1YJ9S 4J9UE 1HBOA 2UXDF 3K5MA 4DV6I 2OMLA 4F4WA 3EXCX 1Q5VA 2KYXA 1TV6B 3U1NA 4G3IA 5IWAI 1NDKA 3KG0A 4U6PA 4B3OA 2U1AA 5KT3A 2GV1A 2MMYA 2AJ1A 4CLFA 4RNHA 4NEYA 3KLVA 4FPRA 2V8DA 1BY9A 3IMQJ 1WG1A 1RU2A 1HNWJ 2R8HA 2U2FA 4TY8A 4LF9F 3LGHA 2HKJA 3WU6A 3E01A 2JOQA 2E5HA 4P73A 3Q6MA 2ZWOA 4M63A 1ROFA 2HRYA 2Y8WA 1QSSA 2QIFA 4RKUC 4CH0S 2LLZA 4TU9A 1FJGI 4JI3E 2DO0A 2K06A 3MR2A 4FYDA 2QA4G 5EL9A 1T0TV 2AU0A 1HNZJ 4DUZJ 2MQNA 4JV1A 4O44A 2CG9A 4O3QA 4HY1A 3T6BA 2C3MA 7AT1B 3SCKE 1H7SA 5CA5A 4RW8A 1IBKJ 3D0HE 4LVOP 3SYZA 2DHXA 1F5BA 1RAGB 5H9FJ 2GC8A 4RNOA 2V4JA 4OI6A 3MUTP 5DNXA 2ZHBA 3FCVA 3BQ0A 2NXEA 4Y2CA 1AROP 2PE8A 5HLFB 4LR9A 3SV4A 2FLOA 3HMJG 4MIWA 3TX8A 1TKTA 1NRKA 5I3QA 3HJCA 4DV7F 4A8SA 5E7OB 5EWGA 4X4PA 4NXME 1VS3A 2PD1A 3QO9B 3OR2B 1FFGB 1FFSB 2B4VA 3RBZA 1HBMB 3D4JA 2L9WA 2WB1D 2CPZA 2PNLA 2LDIA 3NAHA 1BD6A 1N34E 1H0HB 2D3ZA 3IBCB 2ADBA 2Y3YA 3H2LA 4X84A 3E3XA 3FBBA 1KRPA 3BO3A 2QA2A 5CD4H 3CB4A 2I5JB 5ITHA 2C3PA 1U25A 2FY1A 3DLBA 4P2FA 4DWIA 2Z58B 4X4QA 3I0SB 3RR7A 1DRZA 2IYGA 1DTTA 4HLBA 4CRJA 1WHVA 2IESA 4HEA9 3PYGA 2ZNZA 5HAOA 1X5OA 2FZGB 2DB1A 3BQ2A 3ZTSA 3MXHP 2C3YA 1S6QA 4WUDA 3LP2A 2GGPA 1GMVA 2G0CA 1U09A 5B0FA 5KFWA 5JEAF 3V6KA 1BXNA 1N36F 4OO1E 2RF2B 4C0HA 4ATNA 3I0RB 2CPXA 1SJ4P 1HQUA 4L73A 4P2SA 4FWGA 3VGVA 2XZDB 4LFBJ 2OKQA 3TWZA 2QN6B 3NRBA 3MHYA 4DV5E 4FWHA 2YNHA 3Q2SC 5KFAA 3FGVA 2KJWA 2R3VA 3PHTA 2VG7A 1KTQA 5JVGQ 3CDAA 1MU5A 1NK7A 3VAMA 3HKZD 4QWBA 2HBQB 1HQ2A 1KDNA 4DCOB 2N7CA 2ZBQA 2XS7A 5HL7Q 1WEYA 2F63A 3CO9A 2R8IA 2CPYA 2XCAA 1QUVA 4ZLPA 2H5EA 3HKWA 2PFDA 4U9RA 1WEZA 4F0MA 4QIFA 4IR1A 1D8YA 4K0KE 1TKZB 2OD4A 3QLHB 2BE7D 2MQMA 3VGSA 2KXNB 3CCTA 2B7BB 2QX0A 3V4MA 2KG1A 4KIAA 1REVB 3I32A 1EHWA 4X4NA 2WNRA 3R1LA 1HMVA 1L3KA 4F3QA 4H4KA 4B3TE 2PNZB 1GK8A 4M8LA 4U7UK 3Q8UA 1T7PA 4GC6A 1PC5A 4UY8T 1FDNA 4JI8E 3QMQA 2XYGB 2DH9A 1UJ6A 2HQGA 2IJNA 2VU5A 1ZM3A 1S7HA 1SQEA 2BQUA 2BBEA 1SJRA 1T95A 1BMQB 2XO7A 1JJHA 2W25A 3TJAA 4FKYA 2M8DB 4NXNI 3W64A 8AT1B 3H1CA 2F7VA 1U02A 3D0IE 2YQ0A 5AXLA 3RBXA 3WZ0A 5DGAA 2B5JB 2P6TA 1RE1B 3PKYA 1YBAA 3D1OA 4MU4A 4K4UA 2X7IA 4DV4J 3PR5B 5KFFA 3AXMA 4PWWA 4BA1A 1UP1A 3BJYA 2PO2B 1YZ6A 3R3TA 4ZVQB 2GO9A 4DI6A 5LXRA 1GAOA 2KZZA 2M8HA 4KC5A 2IMOA 2ZEJA 3QSYB 4ZA1A 2ALYB 2NSCA 3HULA 2F4VE 1T3NA 3K5OA 4U8YA 4QWCA 3D66A 4N8OA 2BE2A 4JI2I 3ADAC 3PDNA 4CNYA 4IFDA 2JC1A 4KRWA 1WI6A 1SC1B 2MKSA 1WOOA 3S8SA 2IMWP 1RBLA 1RTHA 4PRFA 2FHKA 3B4MA 3G6ES 1RWNB 2R7UA 3TQ1A 2LQ5A 2OPPB 2EFOA 3CVKA 1LWEA 3T1HE 3KLEB 2YNGB 4PRVA 3NS7B 3C14A 2ZH9A 4DPOA 1TK8A 2LXFA 1RHKB 4QJVA 3CDUA 2OMOA 4OYAA 1KEKA 4BS2A 2HAIA 4MIBA 1M1HA 2Q1LA 2C2NA 3V81A 1HNVA 4ZVHA 4DSJA 4ETXA 2E5LJ 2VUGA 4DV0J 4ELTA 3DHWC 4IKAA 2JFDA 3CD7A 1VGYA 1Q95G 5JUMA 4MYUA 3VZIA 2P9GA 1HHQA 3IRXA 9RUBA 4DQIA 4OX9J 4DR2J 3BGRA 4RUBA 2R2SA 4P71A 3ET6B 3M4XA 1O8BA 3WX8A 4J9PA 2CNKB 2WP8B 5DZ7A 4CIOA 1SI9A 2DEJA 1RLDA 1NB2A 1NSPA 4JG4A 1Q78A 1U0HB 1HNXE 2BW7A 2XYHB 5F8LA 4K50A 4IZJD 4JI7I 4G6VB 3TA1A 3U1LA 2W2PP 4PQAA 1PAUB 2RKIA 2UXCE 4NLRA 3IR5B 4PYDA 3O6QA 4JV5I 2H54B 3NP5A 1U49A 1RTZA 3M8ZA 3SCJE 2VQFI 3JQJA 2DHHA 3DN9A 4PKDB 3OTOI 4C8YA 5GAHI 1RAOA 1RISA 4L74A 1A7GE 1T02A 1N5YA 2C2ZB 4WYWA 2JEGA 3QGHA 4ENOA 3QJPA 2IY5B 1NK5A 1XNQI 2GJIA 2XMKA 5KFLA 4DR6J 4OL8A 1P6TA 3H5XA 3VF0B 5IWAE 1N5SA 1MNEA 2A6MA 4O3NA 1SBRA 1O51A 4LR8A 3HFKA 1X5PA 2QSWA 1TELA 1ZXNA 1WSVA 2FVPA 1C0TB 4M5GA 1V3SA 4X4OA 3MECB 1KQSR 2ZZMA 2EKYA 4ZVTB 4F3OA 5IV4A 2D7SA 1B0PA 2DXDA 5D3GA 3BSAA 2Y8YA 3UD5A 5A8RB 2LVWA 2VQEI 4DV1I 4NCGA 5CYMA 5M2UA 2BRKA 4C97A 3EZUA 2ZZNA 2AP6A 3RBEA 2EW9A 3LH2S 1FNMA 3HHKA 3G6YA 1ZPVA 1KLMA 2OD6A 1X5TA 1UEUA 3TVKA 1S48A 4USMA 2W1BA 1OO0B 3I55S 1JQGA 5K9FA 4YEAA 3M9MB 3QIPA 1LWFA 4AIDA 2HWTA 3U02A 3M85G 2CWXA 4TN2A 1HLWA 2KG0A 2PI4A 4ES3A 3RW6A 4Q0BA 3OTBA 3MM7A 3DOMB 2IHR1 3ZZUA 3LAMA 2OJ3A 3NAIA 2B9XA 3OHAA 2X1FA 4GKKJ 4OO1F 5U47A 3DLLQ 1N88A 1PGZA 3W2VB 1NK0A 1XMBA 4CTAA 2IVFB 4R8UA 1IBLJ 4YB5A 2WONB 2W9AA 4KPCA 2BW2A 2V8GA 3OXLA 2FUG9 1HI1A 4ICLA 3G86A 2YKMA 3FNNA 2Y9HA 4MQYA 4C0OC 3IS9A 3HHLC 5K5MA 2GMLA 3SV3A 1XN9A 3AD9C 4LOMA 1HNWF 3AAWB 4DCPB 2MZTA 1CBKA 2CAJA 4KKOB 1IKWA 4CZCA 4USVA 4K0KF 5GAEU 4RBVA 4ED2A 2B9EA 4CLSA 1NM2A 1XNRI 3BF4A 1FJ7A 3M8QB 4C11A 3WC2A 1IBCB 4B3TF 1OYDA 3NZKA 1UWAA 1X4BA 3GWCA 5HSPA 4DSEA 5DRKA 4CP5A 1IBMI 3EGWB 5JXSA 1IBKF 3F56A 3RB3A 2JJ4D 3VWSA 1NSQA 1MW7A 1R0BG 4HACB 2PO4A 1SKSA 3DYAB 4LT6A 2ZOMA 2UUTA 4DX8H 1XQIA 3DLGB 2UXBF 3JTPA 3MM5A 4I56A 4L6V3 3G96A 1OY9A 3W7BA 1HD0A 1N33F 2YNFA 4JI6F 2O1VA 3BM7A 4B08A 2NXUA 2RHQB 3QBCA 3JYTB 1MMNA 4M5JA 1D9AA 5B09A 3W65A 2WW8A 2JEJA 2VA3A 3CCSS 1RHJB 3R7BB 2E1PA 1JJ4A 5J2NA 3AA8A 1M5HA 4OZEA 4J9KA 3EDQB 4M5HA 5DDRC 3DRSB 4V1Ak 2COLA 3CDWA 3GIMA 3M9OB 2IJFA 2RUSA 1XR7A 2KT3A 2CVIA 4F02A 1HI8A 4ZVGA 1EB0A 2BX6A 2ILYA 2QMUB 2EVZA 3LGNA 5GADI 3M2VA 3CCMS 4NXNE 2BR0A 2HBRB 3ITHB 4Y6IA 1U6FA 4OLOA 2Z2MA 6FDRA 2QSFA 1NAQA 2AJ2A 3G4SS 2L3MA 5IC6B 4BCAA 1NHJA 1T9XA 2V94A 4IDKA 4I2PB 4IH5A 3PRYA 2ZH3A 5IM0A 4NASA 4EMDA 4NCAA 1HR0E 2HS0A 3MPVA 3VR1A 1T05B 3ZKDA 4AL6A 2JVOA 2VH7A 1X9SA 2HIQA 2W2QP 3N4WA 1WELA 4JI2E 1OYRA 4JI5I 3HFVA 1H98A 2ZJPQ 3TP2A 5IQ6A 2F5GA 4ID5B 2CQIA 4DV3J 3ZZZA 1CJTB 4ZKAA 2UUBF 1J5EI 4WKYA 5J2PB 4B3MJ 2F9JA 2HSEB 4N7TA 5AJ3F 4PPZA 3SDEB 4L76A 1HNXF 4H54A 1U7LA 4M5DA 4ZVFA 2I6WA 2Q3PA 1NDLA 2DJWA 4LFBI 1UMJA 2Y1JA 1TKXA 3PJXA 4QYRA 4YY3J 3BKUA 1ZPWX 5ETLA 4DV2I 3C8YA 2V34A 4U3BA 2KHCA 3MPDA 4JYAF 1TL4A 2VPWB 2ZITA 2QLWA 4PABA 3U1KA 2ASJA 4QWDA 2A18A 3P3DA 2DR9A 5JEAD 4IQXA 4ZCMA 2YKNB 4AYBD 4DV6F 4EWTA 2G9OA 4DPTA 4I3HA 1NDPA 5D0EA 5KFVA 2QYGA 5IT9C 4JV2A 3HSZA 3M32B 3D68A 4JI7E 2RU3A 3JAMC 4LRFA 3KRNA 1XK8A 2FC8A 3CNQP 2CWKA 2XMTA 3NWRA 3MTJA 4YN3B 2M7SA 2YNIB 5KG4A 1RT7A 1SKWA 1MN7A 3QZ7A 2F8MA 4DR5I 3CO0P 1TQLA 3FMBA 4JV5E 3UN2A 3S01A 1HYSA 1YJUA 2EI5A 4F0KA 3G2XA 1BKNA 3EVWA 4N41A 4KYZA 3VAIA 2KRBA 2VQFE 5H1SV 1FJGF 4KGXB 3OTOE 2RILA 3ZTOA 4ZJOA 2XYPB 1M5PC 2MQLA 1HBUA 3CJTA 1U2RA 3RRHA 2JFKA 5KT5A 3NNCA 1JWWA 2QMXA 2NN6C 1XNQE 3ILIA 2W7AA 3AD7C 2L9NA 4I7FB 2OP5A 3JTOA 3CCVS 2QA4S 4UUWA 2I5JA 2RH3A 1EIYB 3DMJA 3ZZOA 4DHVA 1TL5A 2HNDB 4HT7A 2ROPA 4WPAA 3I0SA 2L08A 3IP0A 3L7ZA 3SI8A 5L39A 2JT2A 3M2UB 3V6DB 2DKOB 4JUZA 3JSRA 2XMVA 4O3SA 3L7PA 3P5TL 1FF2A 4Z7YA 4Q2MA 3QT5A 1XMOJ 2DNKA 4BLGA 1VQOS 2OFHX 2DGQA 2RU9A 1CJVA 1T3OA 3Q22A 2E5LF 1CULB 4DV0F 2GZOA 2VQEE 2W7OA 3I0RA 1N54B 3RBDA 1Q8BA 6FD1A 1SUQA 5DDPC 4OX9F 1PSDA 3J80Q 5H9EK 4A8YA 3K0JA 5A2QC 3T1YE 3H0PA 3HDSA 3IAS9 4HL9A 4IO9Q 2QV6A 1VQ7S 1MROB 2VZ9A 3GSIA 1MMDA 4S0MA 2HPUA 4OHVA 2D3OR 5ETTA 3IM8A 2HBZB 2NN6B 4RUAA 4RX6A 1JLGA 3RB0A 2UUAJ 2LA6A 4X62I 5K36F 3IGVA 1IN0A 1C0UB 3QRRA 2V8HA 4A8MP 3OR1A 5C25B 1SL1A 3HD2A 1YK9A 2WTFA 3OLAA 2PFFB 1ZS6A 2CQ1A 4GO7X 3WDOA 5CD4A 3J7Z5 2XHWA 1VYAA 2PNZA 4IG0A 4ZVPB 2WW4A 3ZFVA 2ZBCA 2A0FB 4DR6F 5KAKA 3OT9A 4RBUA 4C3LA 4DR4E 3MD3A 1OQ6A 2C2EA 1S0MA 1MU2A 1S5ZA 4QU6A 1F9EB 4J9VA 3MI7X 4YMEA 5KFOA 4LF7I 2Q43A 3K5PA 2CKWA 3VZHA 4TU7A 4CO0A 4DPYA 2OEJA 1SJQA 1Q79A 4CM0A 2IOQA 4MK9A 4ZVEA 5ETMA 2HG4A 5KG7A 2GAGC 3DI6A 1QVFR 5A8WB 3KLHB 3S1TA 1JNZB 1YRUA 2AYMA 1XNRE 2FY8A 4NBQA 1D1UA 4OFZA 5IFMA 2YWHA 3LWLA 1CSJA 2M88A 1RKIA 1NKEA 3GU0A 1WC6A 2JLEA 1IBME 1U26A 2XC9A 2QLXA 1GQEA 2DHAA 1BUXA 2BVZA 2H51B 3CDBA 1IKXB 2KXHA 1LKZA 4NOHA 4LIRA 2RD5C 2RQCA 1AFIA 4C8MA 3THPA 1ZA1B 3BSNA 4NWBA 3HXMA 4LRBA 4OZJA 2ACMA 2FVRA 2BACA 3B4DA 2RQMA 2MGZB 4JBCA 5KG6A 1DFDA 1WG4A 3FCHA 3B6BA 7FD1A 1GMUA 1VRQC 4URGA 3I87A 1UEKA 1GX5A 4GKKF 2OPPA 5HK4A 3WBZA 1I3OB 1S4FA 2YNGA 2R42A 4IFYB 5CAAA 1HNZE 1B63A 3NMAA 1N6QB 3JSYA 1J5OB 3KJQB 4LF4J 3RR8A 3FEXB 1Q8IA 3MM8A 1QAIA 2KN4A 1Y9OA 2CQHA 2AZ3A 2GX8A 2X1BA 1AZSB 2WVFA 5DDOC 4KV8A 1WOPA 1CC8A 4JI2F 3CEDA 4DR3J 4B9LA 4FYXB 5BYQA 1JLQB 2FQQB 2HWHA 3CJQA 1G2EA 3MEDB 5B0DA 3PEJA 3CD6S 3KKFA 2HGMA 1HW9A 1I94I 3ET6A 2OPSA 4A8WA 2OPQB 4EBDA 4WIIA 5LOQA 3MEEB 3CC4S 2OPRA 3PNIA 1Q16B 2XZWA 1SPBP 4I6AA 2OTJS 1U0HA 1KVIA 3PHEA 2DYAA 2D41A 3RUBL 2UVVA 3C16A 1IBLI 1LXJA 3N6NA 4OX8A 1JJCB 3RG6A 3PZPA 1I6JA 2ZC3A 3GE9A 1N48A 4DSFA 4QYZK 3AXKA 1Z0BA 2XG8A 4DL4A 4NZ7A 1GTEA 5GAHU 3NKYA 1AUSL 3CC7S 2Z2LA 4Z7CA 4I0WA 4O4GA 3H4LA 2N3OA 2DGUA 5LJ5Y 2XMMA 2A10A 3C6UB 1Z4UA 4X4TA 1J5EE 2F8HA 3W3SA 4JI4F 2YPYA 1U8WA 4FBTA 4DL5A 4C8NA 1VBZA 1K9MT 4LFCJ 4JI7F 2WK4A 3UCUP 4NLUA 5KT6A 2HHPA 1S0NA 2FLPA 3TZYA 2R7RA 4LFBE 1C0TA 4XDDA 5LMNF 2OIHA 2FVQA 1RABB 4IFDE 3K5LA 1F3VA 1RXOB 3P45B 3M6VA 1H3DA 3BDEA 4AQYI 1CQMA 3QGPA 5A8RA 3OPKA 4OJ1A 4EUVA 1E3PA 3MMAB 3P3GA 3KOAA 1D0EA 4LVNP 3OTOF 2GJFA 2BMBA 2R8GA 4X66I 2C3UA 1I51B 2ZE2A 1UW4A 1UZDA 3IM9A 3HI9A 1XNQF 2GVDB 1UA1A 1YJ7A 3W2WB 4IOBA 5HP1A 2CQDA 1U1PA 1RWVB 2NQPA 5ETNA 1XWLA 3HSJA 4CO5A 1FCAA 3KHGA 4RU2A 2AHOB 3GPAA 4UF4A 4FVMA 4KGVB 4WTYA 2IOPA 1KONA 4DX6A 1RT5A 3FEYB 1TAQA 2BM1A 1VIXA 2WZ1A 3CT9A 5MAOA 1YHQS 2AJFE 2VBXA 1S9FA 4DG1A 2C42A 3PCOB 4DV1F 1QE1A 1KHVA 4PYAA 3G9CA 2BJDA 3W2VA 2E7VA 1H2UX 2BKOA 4W4MA 3FBEA 1SV5B 5K8OA 2XLIA 3BS9A 2E9TA 1URRA 1B99A 4DL0C 5BYSA 1HQEB 1KVJA 3MM6B 2BANA 3HT3A 3DRXA 4OI3A 2UUCF 2DNQA 2V9KA 4B3MF 3N9UC 1BQNB 1UA0A 1YGYA 3UD4P 3VAFA 4DV4E 3J80U 4DL2A 3PKMA 3UFCX 2CPDA 2MXYA 2GIQA 2C2OB 1N32I 3AY0A 3TQEA 4ZPDA 5DGBA 3H8YA 3RB4A 1RA7A 4KFBB 3FFIB 2XO6A 2WSEC 1XMQF 4WKRA 2C39B 2X3DA 1S77D 2MJUA 4MAKA 3BPDA 3ULHA 3L7OA 1FHTA 4O3RA 5K8MA 2IIHA 4DF8A 1FXDA 4FYWB 2XLKA 3FZ2A 1YVFA 1GTHA 1Y3KA 4JI1J 1OSCA 4X2BA 4JOUA 1YDLA 3R8YA 3KLIA 2HRTA 4U3DA 3K17A 4CLUA 4RW9B 2LEPA 1NDCA 2XMWA 3DLGA 3Q0AA 4CT9A 1VC0A 1JKHA 3LGMA 4BBYA 3OFGA 3A1YG 1FKPB 4KT0C 3KMSA 1R6YA 4QIEA 4C3MA 4X65J 4NLWA 2KU7A 4NA3A 3GQCA 3PO5A 4GVLA 1UPPA 2Z5CB 2R9LA 2WSCC 3JYTA 1AFJA 1XNRF 4B02A 3QWPA 4OYXA 4DR2E 4Q45A 5F41A 2P9CA 3MZIA 1R0AA 2DGSA 1IBMF 2V63A 4B3SJ 3PW7A 3NGKA 3OVBA 3MEGA 1NJXA 4EI2A 4ED5A 5GADU 1TKDA 4DXLA 1S1XB 1PJ7A 2DIUA 2BKPA 1Y0HA 1WG5A 3HVRA 3G82A 4W90B 1NJIT 4LF7E 2DNYA 1DQ8A 2LFVA 1RT3B 3HVTA 5AE2A 4LF6F 4LCGA 5A6WA 1RT6B 3R5DA 2JLGA 5FLXC 4KH0B 4ZP7A 3R5BA 5DZ6A 3PW0A 4RNMA 4QOTA 4TLRA 2EFPA 3T1AA 4DUYI 2GIRA 4I2PA 4ZOSA 3NS5A 5BR8F 1T9VA 2FGCA 4LIWA 3Q83A 4CH7A 3AH6A 3LA0A 5KFIA 2PGCA 1XBWA 4YB6A 2NXCA 2Z5BB 4FDFA 1TR0A 4OO1C 3B54A 5KFDA 1IKVA 4IFVB 3UDLA 4LSNA 3I82A 1ZBTA 1MX0A 4CLTA 3ZZPA 1EI1A 4RU9A 3D3BJ 4EEYA 1J2VA 1WC5A 3MEKA 2EFNA 4PAAA 3VVTA 2M0GB 4ZCKA 2CG4A 4IR9A 5HJXA 1CJTA 4KHPJ 2CJQA 1MN9A 4YHHF 4OKGA 1FWLA 2XMAA 4RW6A 1NZ0A 4YR3A 2UP1A 3SDEA 4ZP6A 1S76D 2CNNB 3PX4A 3SFUA 3NLCA 4IZJA 2ADCA 1U48A 1CS4A 3OTDA 2Q66A 4DF4A 4JV0A 4TKTA 3TJ8A 2Z0GA 1VJQA 3SBMA 3Q8SB 4JI5F 3DOKB 4LFAF 1Q8LA 1RT2B 3ZTPA 2R8KA 1VRUA 4DS5A 4G65A 4C8LA 1TL7B 4P10A 1PJ6A 3UHMA 1I94E 2YKNA 4LJMA 4O4RA 3BR9A 3NNHA 4OO1B 1J5EF 1X31C 3IN5A 3LP1A 1R3NA 2C37B 2K3KA 3ZTQA 1RTIA 3GJRB 2N82B 3P3CA 1XHKA 1RHRB 4GO5X 1IBLE 1DQAA 3B4TA 4ERDA 4TY9A 4EYHB 2ZM6J 4M5IA 4QIWD 4J5OA 2YNIA 1U1QA 3VAHA 1XR5A 1CJKB 2CJXB 3VAGA 2RRAA 5D4OA 4DV2F 3AODA 4O0IA 2A3JA 5K8NA 4M5MA 3CJ0A 4OJHA 1YZ7A 4N3OA 3C6TA 1KR4A 3MR7A 5LMUI 3SSSA 2HHWA 1FXLA 1JB0C 4J7CA 3TUJC 4ITSA 3L95X 2DVIA 3AQOA 1C1BA 1F0XA 1JJ2R 5D0GA 3C3LA 1X4EA 2IM0A 3M2UA 5J1EB 2ZH7A 4RW7B 1UDQA 1JLBB 3I31A 4GC7A 1Q8KA 2F40A 4DR5F 4N76A 2UXDJ 4A48A 1XEZA 4PR6A 4ZPCA 3DLEB 5IT9Y 3KK3B 4AQYE 5IC4B 1VHFA 3HJFA 3JAMY 3EYZA 5KFZA 4DR3F 4X66E 4BC9A 1F3FA 2BUNA 1I5OB 1QUPA 3JXOA 2FTRA 2QZ8A 2BABA 4IRKA 4MTPA 2WOMB 2Y0SD 2HK2A 2RQ4A 2AKWB 3E8OA 2MQOA 3KK2B 1S79A 2VPXB 3Q8VA 1ZTTA 3BREA 3KXDA 2HHXA 1C1CA 5CZVA 1SCJB 1MROA 3N0VA 3V4IA 2ZC4A 1TMMA 3JB9k 4H4OA 3C15A 1RUSA 2ZVIA 3VCDA 2DO4A 3OXGA 4LF4I 3AQPA 1Z2LA 2AEJA 4ZVSB 2YH0A 4X64I 2HEKA 4JI0I 5HMXA 2KH9A 1NCLA 3H4BA 4LF5F 4RW4B 2XMJA 4LCHA 4LF8I 5E3CA 3UE2A 4RJVA 4F25A 4DV7J 2E29A 3CCJS 4I2QA 5L9NA 3AOCA 1RREA 1KTVA 1Q4RA 2VG6A 1X4HA 1TVRB 3MCNA 3PEHA 4MMOA 3OXFA 1N32E 3FRYA 1RTJB 2I8EA 2XSJB 2B4UA 1TL3B 4X62F 2PO0B 2OHDA 4USJC 4PQUB 1RT1B 3T6JA 4UOFA 4FP9A 3KLHA 4ECZA 4F3MA 4I4BA 2O3ZA 1VQKS 2KVQE 3ISNC 4QW8A 3WHIA 1M5SA 4OYZA 4B3RF 2H4WB 3LPSA 4E0DA 3JSMA 4DV3E 2ROEA 3T9NA 4LQ9A 5C42A 2KYZA 3R7NB 1Y00A 1LWCB 1UFWA 1IKXA 4DR1F 1N36J 4LSZB 3TA2A 3NNAA 1FVQA 1X60A 1S9EB 3ILLA 2J8AA 3M6AA 4LF7F 3PYFA 1S1TA 2RUGA 1V6HA 2MGZA 1SC4B 3BH7B 1L5UA 3D5MA 2FJVA 5KFQA 3CXCR 2JEBB 1S97A 3NL0A 5A8KA 5KG2A 1CVJA 4IFYA 1ELOA 4GKJI 1KIJA 5D4NA 2WVEA 3EXYA 4IG3A 3HFZB 5I3PA 3PR4A 1KLNA 2LQ9A 4FYYB 1Z0TA 4HH1A 1T9WA 1M1GA 5DNLA 4CNZA 1AZSA 4L3NA 1PKPA 4FYVB 2CADA 4NXMI 2DRAA 4WP8A 4NX9A 2FD2A 4NLOA 4J9NA 3SQOP 2B43A 4LBIA 2C2DA 4I64A 2A1BA 3H5SA 2KXFA 1N34I 2HK3A 1VHIA 1P1LA 2RRBA 3LOUA 2OPQA 3FK4A 1HNIB 1SC6A 1FRKA 1XTZA 2HHUA 4NLYA 4KBIA 3L4BC 2WSFC 5A76A 4DUYE 3WX4A 3OLBA 2IFXA 2MKYA 2MKHA 4BA2A 1B7YB 4LCFA 4H4MB 2BZ2A 2QMWA 3FCWA 1ZAVA 4JI1F 5KT2A 5HQLA 3WU3A 4N8NA 3GJQB 1AW0A 4DOZA 3UD3P 2XGPA 1VQPS 1H7WA 3R5GA 3NGTA 3UCGA 1XMOE 2UV8A 4ZPBA 3C6UA 4QQBA 1W7WA 5JEAA 4A8FA 5AT1B 1YBUA 1JLAB 4UZCA 4ILRA 4FXDA 2JE6A 4ZDNA 4HHUA 3PX6A 4ES2A 3R9LA 4QYZJ 3BGFA 1S1UA 3A12A 4HTIA 4PCQA 3BEGB 4L72B 2Y1IA 2AW0A 2GVZB 2J8SA 3CCQS 4ID8A 2EK1A 3N5FA 4ECSA 5M2PA 2B6AA 2MLYA 5F8HA 2ZH8A 5CQGA 4B3SF 2WVDA 3AOAA 5E41A 1M1KT 3L3CA 2XEXA 3SXLA 3FC9A 3HP6A 3CCZA 3BGLA 4ED6A 4KQZA 1ZZNA 5K36B 2LU1A 2G13A 3PM9A 4ZLJA 4WYLA 4IZKB 1RYRA 4WK3A 1ZH5A 1RJJA 3U1YA 2UVWA 4P52A 3W2WA 1DLOB 3W9HA 2DGTA 2HHHJ 3CWJA 3N79A 3LPEA 4ZP8A 3MDFA 4JI8I 4MT1A 2RB7A 4X65I 4ZK7M 3CCRS 4Q8FA 3UNYA 2N4CA 2UU9F 1JLEB 4DR7I 1A9NB 4DU8A 3SCLE 4NPOA 4NLDA 3TAMB 1FX2A 3HHNB 4AL7A 3IG1B 1RA6A 2E7XA 1FTCA 2FVCA 2H3EB 3QPIA 3ZTRA 2IDLA 1DY3A 1YITS 1LW2A 1FNXH 4NRTA 4KQVA 1N5TA 1SV5A 4X66F 1TFYA 5LMUE 3EMTA 1TTHB 4FS1A 2OTLS 2PMHA 4MU3A 1H2VZ 8RUCA 2PIIA 2YH1A 3J81Q 4KHPF 5CZXA 2AZ1A 2VPYB 4CO4A 4KR0B 4WWSA 4ANCA 3HLUA 1PO6A 2RVJA 2M4MA 2MSSA 3QAUA 4DSIA 2EXUA 1NKCA 4MFBB 4PZVA 2VG5A 1S4EA 2C2KB 2SXLA 3VQTA 1DJ0A 3FEZA 1W2BR 4HVZA 2CA9A 1F5CA 1VDHA 3FFIA 2MZ1A 3HVWA 2GCFA 3LNUA 4ZHRB 3THTA 2DY1A 4QR2A 1RYSA 1LEOA 2OELA 5K14A 4ZPTR 4NI2B 3HVAA 1IQZA 1MLAA 1OIAA 4WP3A 3W60A 5HN0A 4UOGA 4OX6A 2NN6F 3KLGA 2VJUA 5BXIA 1D3WA 4LMZA 1EKSA 3T9ZA 5HQMA 4LF1A 4PUOB 1V9OA 1QVGR 2ZH1A 4ZMMA 2JEIA 4LF4E 2MQPA 4X64E 1C4AA 4MKBA 2QG9B 4JI0E 1X5SA 3GFYA 1T03B 3M7ND 5J1NA 2O01C 4PG8A 2QL7B 3SQGB 4K4SA 1YTYA 3MM9A 5D77A 5C0XF 1CJUB 1NK6A 4LF8E 2DPJA 2CRLA 2MQQA 2IAJA 2NZ4A 4LSLB 3CDJA 5HQ8A 2BR2A 4A8XA 3HT0A 2HGLA 2YX4A 2PMWA 5CYQB 1RAFB 1RTDB 1UZHA 3GILA 3NS6A 4RUHA 4IUFA 3MAHA 3MR6A 2X1GA 3MMJA 1H7XA 1UL3A 3M7VA 1VQ6S 5HMYA 2PT0A 1U2FA 2ZM6I 3Q8PB 3ENWA 1VFJA 4Q43A 4WE1A 4DL6A 4HXZA 3SSRA 4FNHA 4AXIA 5IS2A 3R5JB 2O67A 1TUWA 4WUBA 5C24B 3CMAS 3FQKA 3D1QA 2HNYB 2RS8A 3I5AA 3JS9A 5GMKa 4U7CA 1XIQA 3C2PA 2IPOB 4OHXA 2CZ9A 2MZRA 3DRPA 2YXLA 2ZDOA 1T9TA 2QEXS 2MSTA 1RWXB 4JP8A 3GJTB 3CJ3A 4U7UD 3PJ9A 3HJVA 4P6QA 3EPGA 2V2QA 1Z0WA 2M3DA 3E2EA 3QATA 2Z5BA 3UDEA 4K0KJ 5IZHA 1LW0A 3I5CA 3TI0A 2IJRA 1SB6A 2APOA 3W5YA 4ELVA 3VAJA 3K58A 5JVHQ 4PG6A 2HFUA 1JIHA 4YQWA 1UKUA 4PG4A 2HLUA 4B3TJ 3KG4A 2M2BA 4Y2KA 2UXDI 3X3UA 1IXKA 4OYIA 1Z2ZA 1E6YB 3DDKA 2HRUA 2E1AA 3GB0A 4K4WA 3E51A 3ZO7A 1CC7A 1HWIA 2DK2A 1PIEA 4E2FB 1N56A 4XTTA 4GKJE 1FDDA 2HURA 3QIDA 3DM2B 3PW2A 2UXBJ 1WSRA 1WC3A 3J7YI 1WDTA 3UVJA 1N33J 4LF9I 2YWGA 5FLXY 1XJWB 4P2XA 2W01A 4OZ3A 4JI6J 2HLTA 1WEXA 4A46A 2L41A 1T94A 2PA8D 5DLFA 2YTCA 4HYKA 4B9TA 3EGZA 2AYEA 1OMSA 1LK7A 3D6HB 4ED1A 3TZWA 3KUEA 3K57A 2JZ5A 4FPIA 1FKOA 1HBOB 1S0VA 2HIYA 3KHHA 4PXEA 3UWTA 2E5JA 1FK9A 4NCBA 5T7LB 4J9OA 2AV5A 1RR9A 2LXUA 2C37A 4ED7A 1QD1A 1OSDA 4MKYA 4ZVUB 3J80C 3O5TB 1TAUA 4LBHA 2D9PA 2EG1A 3QGIA 2AJ0A 4W98A 3QQCD 5G0RA 3KJVA 4TY8B 3HCXA 2NPFA 1Q53A 5KFBA 1QAXA 5ETVA 3E01B 5H9FK 2ZJQQ 4DV7I 1G1XA 3HF5A 4HR2A 2ZZTA 2HFNA 3PXGa 3R5AA 3T1HJ 1IKYA 2V4RA 4IOAQ 5F9LA 1M5KC 1VQ9S 1YX2A 1KKHA 4ECTA 3NOCA 3EZOA 3KUHA 2OI2A 1GNKA 3AOBA 2VV5A 2RDIA 4A8OA 3ZZ0A 4DFPA 1FERA 2V4JB 2P2CB 2H4YB 1X0FA 2JC0A 4F36A 5J1EA 3JQMA 3TAQA 2X1AA 1FNOA 4F8RA 1VK3A 3GFXA 5K8PA 4I67A 2UUBJ 4BC7A 3PS3A 2ZH5A 2J9CA 1P42A 2EWHA 5AJ3J 1D9DA 1HNXJ 5B0CA 4AL5A 1X4AA 4OI4A 2NR0A 3H42A 2W9BB 5KTQA 5LMUF 4RWWA 1Y4UA 4ECUA 3MAAA 2AX0A 4PPDA 2MB0B 2BOAA 4K4YA 3CDIA 2O1UA 3TANA 2DNNA 3KK2A 1KFSA 4JYAJ 4M5KA 4X65E 2ERRA 3NGSA 2HQDA 1JXVA 3J81U 1DTTB 2ALZA 1L3TA 3KHRA 4H4KC 4DR7E 1PILA 3NY0A 3LQVA 1HA1A 4Y2IA 3CJ8A 2CZVC 4DSKA 4MKVA 4DV6J 4F7VA 3DLHA 3PS2A 1S1VA 1S6QB 3KTQA 2ZH2A 2KB2A 1F2HA 2OFGX 3LP2B 3HSDA 4J90A 3J7AG 4LREA 4UT4A 3GIRA 4TLQA 3D6TB 1IM4A 3OL8A 4C3KA 1PCAA 2YVSA 4ECYA 1SJFA 2EPIA 2F9DA 5IT9Q 1DBDA 5HBMA 3MUMP 2GQ2A 5HVHA 1APSA 3MPUB 2RS2A 1V5VA 1HR0I 4XAKA 2LCWA 2VG7B 1SC3B 4URQU 2W8LA 3D9BA 1FJGJ 3EVMA 1PC4A 1F9FA 2CJAA 2BOPA 3W9IA 1S0OA 1T11A 2MHEA 2NSBA 1K0VA 4OZLA 3H40A 2GO4A 3TX0A 5BYRA 4ZJQA 3O1LA 2CJBA 4K59A 2XSJA 1MWZA 2K1RA 3C46A 1VISA 1BWVA 2BA1D 4GVBA 4PQUA 2GO8A 1RT1A 1H38A 1Y5IB 1HKAA 2H5IB 4JI0F 1UVJA 4RBTA 2J0WA 2WNRB 1HMVB 3TUIC 1REGX 4C7QA 4LF8F 4IFDC 4TNOA 4J9QA 1SKUB 2E1MC 5KFSA 2NUHA 4OZ1A 2CQ4A 4ZVIA 4LF2A 4J91A 3DKDA 2LQ8A 3IBWA 2HHHF 1IJFB 4USHA 4G1QA 3LUYA 1EETB 1S9EA 2NLWA 3O3LA 3MPYA 1BWEA 1VQ5S 1DTQA 1EX8A 2Z4PA 3RTVA 5THWA 1A6LA 3WU4A 4ZLLA 3Q24A 3A4TA 2XWYA 1RHYA 3ZZRA 4UTGA 2VBYA 1LNQA 1ZM2A 3Q2TC 2HHSA 4BA1B 1H74A 4C0BA 3PACA 2FVSA 1QAYA 2UZAA 4NA2A 3A8JA 5E3AA 5KFPA 1WI8A 4R5PA 3AB4B 2HVHA 1GMWD 2RMLA 2VA2A 1O6XA 2LKZA 3AHPA 3TJ9A 1OJ4A 2JLFA 2BE2B 3QRQA 2XMUA 2RQKA 3TOQA 4I68A 1RHUB 4WFBQ 4JI3F 4IFDB 4QIVA 2ZM6E 2IERA 4ZPAA 3BZQA 1FWKA 1TK0A 4BDPA 2R7VA 2J5AA 1RTHB 1Q0NA 4YP3A 3GLJA 5HROB 5DG9A 1KC8T 2XY7A 2D1CA 2GMJA 1Z0VA 1NSKL 1LWEB 3VTIA 3HZEA 4FS2A 2IA6A 5KFUA 4DDFA 1QTMA 4O3OA 2P6SA 3G8TA 5F8GA 3IRWP 3M6XA 4F0HA 3V81B 4WIQA 4QW9A 5KFMA 4TU8A 2H9ZA 2J76E 3K8WA 5HJYA 1SIWB 1JK9B 1UTAA 4USUA 4NXMF 1KWMA 4EGLA 1GX6A 4MJKA 5HANA 4EZ9A 5LSLA 4NLXA 4F4YA 4LRAA 3U27A 1HARA 3P3EA 2FJBB 5FD1A 3BGRB 5DLGA 2UXDE 1N34F 3PRVA 4CDIA 2DCUB 4XO0A 1KBRA 2DITA 4NYZA 5D0HA 4DJBA 1SQFA 3N5BA 3T1YI 2J0XA 1PBAA 1O5JA 2DNHA 2V2ZA 4ED3A 1K1QA 4KPYA 1C2PA 2RKIB 3FJ2A 2XULA 3POTB 4LF9E 4NXNJ 1NEEA 3M30B 3UDVA 5ETRA 1S1WB 1BQXA 3CIZA 1HK7A 1U6BA 4NE9C 2YKPA 5LSRA 4FW9A 2CQ2A 2DGVA 3OD2A 2XQCA 2NS1B 3HKMA 1R8BA 1VBKA 4QWEA 2FC9A 2FPHX 2FHJD 2K8GA 2J7UA 5K36A 1HW8A 3ZNUA 4EBCA 3T41A 3D3CJ 4DV5F 5DG7A 3BKTA 5FJ4A 5I4MA 1DLOA 4MKAA 2J9DA 2ZOFA 2HQCA 3LP0B 2RNEA 3O44A 2E5IA 4F67A 1JNRB 1HBNB 1MMLA 4DR4I 4PXCA 4JI2J 1D6TA 1NZAA 3CUNA 2BA0D 1BQMB 2NN6D 1JLEA 1OYEA 3H2UB 3CJKA 5F8MA 1FVSA 2HNZB 3CPWR 1N5VA 3UN5A 4WK1A 3V2UC 4DV7E 5C5JA 3GLLA 2XSFA 5D3GB 3GYXB 3KDOA 3S7RA 2CJKA 4NCGB 3H7HB 5CYMB 1Z5CA 4IQMA 4UZBA 3H59A 2ATCB 3LPYA 4OI2A 4NZ0A 4XTJA 5DG8A 3EVOA 3R6LB 1U1NA 2BQRA 2W8KA 3QIPB 1LWFB 4JI8F 2WVCA 1M5VC 2AF6A 1HHTP 2OLWA 2MZQA 4NMLA 2QLFB 3TR5A 2KI2A 3Q8RB 2WCXA 2D9OA 3KLFB 4C9DA 3MM7B 4ZS6A 1HNWI 2RDDA 1UWBA 4L3KA 3IBFB 5JEAE 3FSXA 2DGWA 4JI4J 1Q81T 1F1BB 3AB2B 1NHHA 2CXEA 5DQGA 2G0JA 2ZNYA 2MYFA 4JI7J 3HHLB 4R8UB 2NXJA 5LMNJ 1R6LA 1V3ZA 1FKAE 4DFJA 1HNZI 2DGXA 4DUZI 4BWJA 3UCZP 1NJYA 1E3HA 2NZCA 3TEHB 4JV5J 2NYIA 2MLZA 1TL1A 4ICLB 2XZTB 1IBKI 2HZAA 3P5BP 1FDAA 2F4VF 5IT9U 5A0YA 1XC9A 2NXNA 1LV5A 3MR5A 3OUYA 5C2GA 3IS9B 2GIFA 4HKQA 3OTOJ 3BYRA 4J9SA 1URNA 3BGOP 3P6YC 2VDIA 1N33I 5J2MA 1XNQJ 4C8ZA 3NGUA 1RAHB 3NBPA 1IKWB 4JI6I 4HTJA 1R27B 3J7ZT 2BA9A 3L9ZA 3SQGA 4ZCIA 2ZJRQ 3DXBA 5ADZA 4B9NA 2NCKL 4IH6A 3T1HF 3MMCA 3GMGA 1ZA2B 2Z5EA 3QYYA 4G1IA 5KFGA 1B3TA 1FRXA 2LA4A 1MWYA 3KFWX 4DEZA 3CJRA 3CCES 1SXLA 1NMEB 1WJ9A 4F4XA 4ZCLA 5J2QB 5CYQA 2F65A 4DV1J 3M85D 3MGJA 5ETQA 2GNKA 4EO8A 1I1GA 4OV6A 3MM5B 2YNFB 5I42B 3EWGA 2AGOA 2VPZB 1UFKA 4B9MA 4YFUA 2HVZA 2UUCJ 4M94A 3N28A 3SFGA 3FBCA 2HWIA 2KT5A 2FJEB 1TV6A 1VJWA 2N3LA 5CH7B 3IWLA 1M5OC 3MFIA 5RUBA 5EX0A 4CH1A 4MH8A 4QIGA 1FRIA 3EX7B 3RAXA 4HYMA 2QO3A 5T14A 4WFXA 3FBFA 2UXCF 2V2KA 3P8BB 3DLKB 1P27B 1XMQJ 3ETOA 5KT7A 2CQPA 3OQ2A 4K2JA 5L3JA 2AJQA 4ALZA 2AX1A 2MEWA 3JSBA 3W1YC 1UDSA 2ZH6A 2AYGA 1PAEX 2MZJA 1QSLA 4OYMA 4IO1A 4ZVOB 1TZ0A 3MAQA 4P72A 2YPZA 4WCEQ 1VQMS 2VOPA 5IWAF 3J7YU 3PW4A 3MFHA 2OSRA 2CVEA 4IDKB 3TZXA 2CPJA 4YOEA 5IM0B 1MSWD 2VKZG 3M8RA 1OPIA 2R2RA 2RDJA 1VCTA 2CIMA 2W2MP 5HLFA 1U1LA 5AXMA 4PWDB 2CQ3A 2A2CA 4JYAI 4EFAC 1D9FA 3QO9A 1NK4A 4ES1A 3OR2A 4KB7A 1XNRJ 3G6XA 4MIAA 2LEBA 1HBMA 2W9CB 1Y7PA 2JEAB 3OW2R 1R31A 3HX9A 3VQSA 1IBMJ 3DDIA 5T7LA 4ZPVR 4AT1B 4UQGA 3P4UB 1NU4A 3IC1A 4DV4I 4NZ6A 1EZZB 1M0SA 4M5DB 3MR3A 4N77A 4LF6J 1TKXB 5CYJA 2H48B 3FZBA 2AT1B 1RQ0A 5C0XC 2BV3A 4F2SA 3IA0A 2UVUA
chains in the Genus database with same CATH topology
4DR7E 3V2UC 4DV7E 2UXBI 4MYTA 4WUDA 4GKKE 1Z0GA 5FLXQ 2UUBE 4DPTA 4I3HA 3K1JA 1FNMA 1N0VC 4JI4I 1IBLI 2Z5BB 1Z5CA 1Z5BA 5IT9C 3J7AG 4USMA 4LFCE 4UT4A 4FWGA 3J81C 4LF4E 4JI7E 4DPWA 4XTJA 1Y6ZA 3M6AA 5LL6R 3JAMC 4X64E 4DV5E 4FWHA 1MX0A 3ZM7A 1Z0BA 3GONA 4JI0E 3PYFA 1EI1A 2Q2EB 4X62E 5LMNI 5IT9Q 2R3VA 2EFGA 4DR5I 4JV5E 4LF6E 4Z7CA 5A2QQ 4LF8E 1HR0I 3P06A 4LFAI 1BKNA 1MU5A 4JYAE 3ZZUA 3H4LA 1S16A 1N0UA 2VQFE 3CWVA 2F4VI 4DPUA 1FWLA 5GMEA 4B3RE 1ELOA 1NZ0A 4GKJI 3OTOE 1HNWI 1KIJA 2E5LI 1J5EE 4DV0I 1U2RA 1USUA 2HHHI 5BR8E 2ZBKB 4K0KE 4DV6E 1XNQE 1Z0TA 4WUCA 4IZJA 1H72C 1VISA 2GQ0A 2V8PA 4ED4A 4DR1E 1NHHA 2J7KA 4FWDA 4OX9I 2ZM6I 4DR2I 1PKPA 3PYDA 4IZJB 4PU9A 4NXMI 4HXZA 4LFBE 4JI1I 4B3TE 4USKA 4WUBA 1FKAE 1HNZI 3T1HI 4DUZI 3ZKBA 4Z7YA 2E1RA 1N34I 2HK3A 3QT5A 4AQYI 1IBKI 2CZ9A 4JI8E 4ZVIA 2O1TA 1I94E 2UUAE 3Q1QA 3PYEA 4YHHE 4DUYE 2AJ4A 1ZM3A 3LTOA 2VQEE 1FJGE 4X66I 4DPXA 2V2QA 2DEIA 1Z0WA 1N33I 2Z5BA 3QT6A 4NXNI 1Z59A 1XHKA 1A6FA 4JI4E 4JI6I 5FWKA 1IBLE 3J80Q 4DV3I 1KVKA 1XNRI 3WU4A 4JI3I 2X7IA 1MG7A 5A2QC 2UUCI 2HFUA 2UUBI 4B3MI 3WU3A 3T1YE 2GS8A 2HKEA 1H73A 4UTGA 5LMNE 2IOPA 4B3SI 1IBMI 2O1WA 2UXDI 4HACA 1ZM2A 2Z5EA 4DR6I 1HNXI 2PNMA 1H74A 2BM0A 4JI5E 1WUUA 4R1FA 4LFAE 3WU5A 2BM1A 4DU7A 1XMOE 4HACB 1EA6A 3HULA 2F4VE 4N3OA 1PIEA 4YY3I 5LMUI 4X62I 2X36A 4GKJE 1HNWE 2UXCI 4PRXA 2E5LE 4M1KA 4DV0E 4DR3I 4JI2I 2HHHE 4LF9I 1XMQI 1ZXMA 1OJ4A 2O1VA 3V5RA 4OX9E 2ZM6E 2HFSA 2UU9I 5GMDA 4DV4E 4JI1E 2WW4A 1FWKA 1Z0EA 1H7UA 4DV6I 3T1HE 4DUZE 4DV2E 1N36I 4PRVA 4DR4E 1N32I 1Z0VA 5IWAI 2XEXA 4AQYE 1IBKE 3B82A 4IZKA 4HYMA 1ZM9A 1USVA 1RR9A 1Y4SA 4LF7I 4IZKB 4X66E 4DPYA 3J80C 4DV1E 4P52A 1B62A 2UXBE 2IOQA 2HKJA 1N33E 4LF5I 3WU6A 4JI8I 4NXNE 3Q6MA 4KHPI 2LJPA 4MYUA 2NPFA 4X65I 5L3JA 2HK2A 4JI6E 3QT8A 3B78A 3K85A 1XNRE 1FJGI 4DR7I 4JI3E 4DV7I 4DU8A 2UUCE 4GKKI 4B3ME 1NHJA 3J7AM 4B3SE 3PRYA 1Z0CA 1IBME 2UXDE 2DEJA 2CG9A 4JG4A 4DR5E 4DR6E 4HY1A 1HNXE 3K17A 4LFCI 1H7SA 4EMDA 1KKHA 4IZJD 1HR0E 3F0NA 4LF4I 3B8HA 4JI7I 4KQVA 4X64I 3T1YI 2OI2A 4DV5I 3ZKDA 4JI0I 4YY3E 5LMUE 2V2ZA 2UXCE 3ZZ0A 2VF3A 4DR3E 1QZRA 4JI2E 2Z5CA 3J81Q 4LF6I 4JV5I 4JI5I 4LF8I 3Q6NA 2V2VA 3JAMQ 1XMOI 4LF9E 1XMQE 2A2CA 4P7AA 4JYAI 2VQFI 2Z5CB 3HJCA 4B3RI 1UEKA 1HK7A 3OTOI 1ZM4A 4DR2E 4FW9A 1J5EI 2UU9E 4NXME 2R42A 1RREA 1KTVA 5BR8I 4K0KI 1XNQI 3D4JA 4FN5A 1N36E 1HNZE 1B63A 2PNLA 3ZZTA 1N32E 4DR1I 1FI4A 1S4EA 1N34E 5IWAE 1DARA 1K47A 4DXLA 4DV4I 4LFBI 1Y4UA 3LNUA 1ZXNA 4LF7E 4B3TI 4DV2I 4DR4I 1D6TA 2V34A 2O1UA 2ZITA 4LF5E 2A2DA 3PYGA 1Z5AA 5FLXC 4KHPE 4X65E 2CGEA 1PVGA 3LPSA 1I94I 2UUAI 1NHIA 4YHHI 4DUYI 4RPFA 4DV3E 2BV3A 4URLA 3QT7A 2VQEI 4DV1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 E;  3V2U C;  4DV7 E;  2UXB I;  4MYT A;  4WUD A;  4GKK E;  1Z0G A;  5FLX Q;  2UUB E;  4DPT A;  4I3H A;  3K1J A;  1FNM A;  1N0V C;  4JI4 I;  1IBL I;  1Z5C A;  1Z5B A;  5IT9 C;  3J7A G;  4USM A;  4LFC E;  4UT4 A;  4FWG A;  3J81 C;  4LF4 E;  4JI7 E;  4DPW A;  4XTJ A;  3M6A A;  5LL6 R;  3JAM C;  4X64 E;  4DV5 E;  4FWH A;  1MX0 A;  3ZM7 A;  1Z0B A;  3GON A;  4JI0 E;  3PYF A;  1EI1 A;  2Q2E B;  4X62 E;  5LMN I;  5IT9 Q;  2R3V A;  2EFG A;  4DR5 I;  4JV5 E;  4LF6 E;  4Z7C A;  5A2Q Q;  4LF8 E;  1HR0 I;  4LFA I;  1BKN A;  1MU5 A;  4JYA E;  3ZZU A;  3H4L A;  1S16 A;  1N0U A;  2VQF E;  3CWV A;  2F4V I;  4DPU A;  1FWL A;  5GME A;  4B3R E;  1ELO A;  1NZ0 A;  4GKJ I;  3OTO E;  1HNW I;  1KIJ A;  2E5L I;  1J5E E;  4DV0 I;  1U2R A;  2HHH I;  5BR8 E;  2ZBK B;  4K0K E;  4DV6 E;  1XNQ E;  1Z0T A;  4WUC A;  1H72 C;  1VIS A;  2V8P A;  4ED4 A;  4DR1 E;  1NHH A;  2J7K A;  4FWD A;  4OX9 I;  2ZM6 I;  4DR2 I;  1PKP A;  3PYD A;  4PU9 A;  4NXM I;  4HXZ A;  4LFB E;  4JI1 I;  4B3T E;  4USK A;  4WUB A;  1FKA E;  1HNZ I;  3T1H I;  4DUZ I;  3ZKB A;  4Z7Y A;  2E1R A;  1N34 I;  2HK3 A;  3QT5 A;  4AQY I;  1IBK I;  2CZ9 A;  4JI8 E;  4ZVI A;  1I94 E;  2UUA E;  3Q1Q A;  3PYE A;  4YHH E;  4DUY E;  2AJ4 A;  1ZM3 A;  3LTO A;  2VQE E;  1FJG E;  4X66 I;  4DPX A;  2V2Q A;  2DEI A;  1Z0W A;  1N33 I;  3QT6 A;  4NXN I;  1Z59 A;  1XHK A;  1A6F A;  4JI4 E;  4JI6 I;  1IBL E;  3J80 Q;  4DV3 I;  1KVK A;  1XNR I;  3WU4 A;  4JI3 I;  2X7I A;  1MG7 A;  5A2Q C;  2UUC I;  2HFU A;  2UUB I;  4B3M I;  3WU3 A;  3T1Y E;  2GS8 A;  2HKE A;  1H73 A;  4UTG A;  5LMN E;  4B3S I;  1IBM I;  2UXD I;  4HAC A;  1ZM2 A;  4DR6 I;  1HNX I;  1H74 A;  2BM0 A;  4JI5 E;  1WUU A;  4R1F A;  4LFA E;  3WU5 A;  2BM1 A;  4DU7 A;  1XMO E;  4HAC B;  1EA6 A;  3HUL A;  2F4V E;  1PIE A;  4YY3 I;  5LMU I;  4X62 I;  2X36 A;  4GKJ E;  1HNW E;  2UXC I;  4PRX A;  2E5L E;  4M1K A;  4DV0 E;  4DR3 I;  4JI2 I;  2HHH E;  4LF9 I;  1XMQ I;  1ZXM A;  1OJ4 A;  3V5R A;  4OX9 E;  2ZM6 E;  2HFS A;  2UU9 I;  5GMD A;  4DV4 E;  4JI1 E;  2WW4 A;  1FWK A;  1Z0E A;  1H7U A;  4DV6 I;  3T1H E;  4DUZ E;  4DV2 E;  1N36 I;  4PRV A;  4DR4 E;  1N32 I;  1Z0V A;  5IWA I;  2XEX A;  4AQY E;  1IBK E;  3B82 A;  4HYM A;  1ZM9 A;  1RR9 A;  4LF7 I;  4X66 E;  4DPY A;  3J80 C;  4DV1 E;  4P52 A;  1B62 A;  2UXB E;  2HKJ A;  1N33 E;  4LF5 I;  3WU6 A;  4JI8 I;  4NXN E;  4KHP I;  2LJP A;  4MYU A;  2NPF A;  4X65 I;  5L3J A;  2HK2 A;  4JI6 E;  3QT8 A;  3B78 A;  1XNR E;  1FJG I;  4DR7 I;  4JI3 E;  4DV7 I;  4DU8 A;  2UUC E;  4GKK I;  4B3M E;  1NHJ A;  3J7A M;  4B3S E;  1Z0C A;  1IBM E;  2UXD E;  2DEJ A;  4JG4 A;  4DR5 E;  4DR6 E;  4HY1 A;  1HNX E;  3K17 A;  4LFC I;  1H7S A;  4EMD A;  1HR0 E;  1KKH A;  3F0N A;  4LF4 I;  3B8H A;  4JI7 I;  4KQV A;  4X64 I;  3T1Y I;  2OI2 A;  4DV5 I;  3ZKD A;  4JI0 I;  4YY3 E;  5LMU E;  2V2Z A;  2UXC E;  3ZZ0 A;  2VF3 A;  4DR3 E;  1QZR A;  4JI2 E;  3J81 Q;  4JV5 I;  4LF6 I;  4JI5 I;  4LF8 I;  4LF9 E;  2V2V A;  3JAM Q;  1XMO I;  1XMQ E;  2A2C A;  4P7A A;  4JYA I;  2VQF I;  4B3R I;  1UEK A;  3OTO I;  1ZM4 A;  4DR2 E;  4FW9 A;  1J5E I;  2UU9 E;  4NXM E;  2R42 A;  1RRE A;  1KTV A;  5BR8 I;  4K0K I;  1XNQ I;  3D4J A;  4FN5 A;  1N36 E;  1HNZ E;  1B63 A;  3ZZT A;  1N32 E;  4DR1 I;  1FI4 A;  1S4E A;  1N34 E;  5IWA E;  1DAR A;  1K47 A;  4DXL A;  4DV4 I;  4LFB I;  3LNU A;  1ZXN A;  4LF7 E;  4B3T I;  4DV2 I;  4DR4 I;  1D6T A;  2V34 A;  2ZIT A;  4LF5 E;  2A2D A;  3PYG A;  1Z5A A;  5FLX C;  4KHP E;  4X65 E;  3LPS A;  1PVG A;  1I94 I;  2UUA I;  1NHI A;  4YHH I;  4DUY I;  4RPF A;  4DV3 E;  2BV3 A;  4URL A;  3QT7 A;  2VQE I;  4DV1 I; 
#chains in the Genus database with same CATH topology
 2HMI B;  4OX7 A;  2RF2 A;  2V4Q A;  1YH8 A;  2V68 A;  1NLK L;  2VES A;  5FLX Q;  5BR8 J;  5D4L A;  3KDN A;  2VBW A;  4I6W A;  4PWU A;  4N47 A;  3MUR P;  2K7K A;  3M1V B;  5E3Q A;  1FE0 A;  5L1K A;  4F04 B;  3BV8 A;  3W66 A;  1NBE B;  2XS5 A;  4IRC A;  4UOC A;  1U4B A;  5BJR A;  5LL6 R;  2ZDP A;  2XS2 A;  4OMF G;  2H65 B;  5ELW A;  3CJS A;  3EPI A;  2LEC A;  4P7T A;  1Q5Y A;  3BDP A;  1RT7 B;  3CE8 A;  3IWX A;  4ZP9 A;  4OZ5 A;  5KG1 A;  4RUC A;  2M52 A;  4FW3 A;  1CLF A;  3JTN A;  3ILO A;  4YHH J;  5SZT A;  2F1F A;  1HYS B;  2CJ9 A;  2BA1 G;  3G8Q A;  1FDB A;  3J80 Y;  2E5L I;  4DV0 I;  1TKZ A;  4NMX A;  3LWM A;  4IYQ A;  3QLH A;  4ILL A;  1REV A;  2XB2 D;  1HBU B;  4CWB A;  1H72 C;  3T19 A;  2W9B A;  4OX9 I;  2Y1L B;  2Q79 A;  4DR2 I;  4P75 A;  1U45 A;  5ETK A;  4EK2 A;  5C0X B;  3DMJ B;  1TUV A;  2VBZ A;  1RWK B;  2QA1 A;  3IAM 9;  4R0E A;  3L7Z B;  3GCM A;  4JI5 J;  4LFA J;  2HW3 A;  1DHM A;  3A8I A;  2OO4 A;  3DU6 A;  2XM3 A;  1ICE B;  2HQF A;  3DXS X;  1CPZ A;  1FFW B;  1W26 A;  3HPO A;  1X9M A;  5E33 A;  1CJV B;  5DQH A;  1J5E J;  1QSY A;  2IYI A;  2RAQ A;  2HVE A;  4FW5 A;  2L48 A;  1UVL A;  1SH3 A;  2B5J A;  2VFT A;  3GSD A;  2NRE A;  3I6P A;  1A6F A;  2ZD1 B;  2XI2 A;  4WZQ A;  4F2R A;  2VFR A;  4QCL A;  1F9H A;  1XR6 A;  3C19 A;  1FA0 A;  1TP7 A;  3G8S A;  1SUQ B;  2PO2 A;  2AE8 A;  2C3O A;  3ENQ A;  1FKA F;  2HKE A;  4DV2 J;  3GME A;  2MTL A;  4YR0 A;  1UJ4 A;  4DR6 I;  2V0N A;  4IOC Q;  1K0T A;  2ILZ A;  5CAB A;  4YDD B;  3M6W A;  2GQQ A;  3LW5 C;  5HI7 A;  1HNW E;  1SL2 A;  3SSQ A;  5DM7 Q;  1W25 A;  1KQG B;  1JLG B;  2XHC A;  4NXN F;  4BHQ A;  1K73 T;  3GFZ A;  1X0P A;  3OR1 B;  5CCM A;  4Y65 A;  1HIY A;  1D09 B;  2CZ4 A;  1VQS A;  4D3H A;  2QT7 A;  2DNO A;  3KLE A;  3K7R A;  3GR0 A;  1EQ0 A;  2DNM A;  4DUZ E;  4IG0 B;  3TVZ A;  4DN0 A;  4DR5 J;  1HR0 F;  1YJT A;  3R97 A;  3N01 A;  1IBK E;  1R0C B;  5KT4 A;  2VOO A;  3IFE A;  3J7A N;  2VAS A;  4Z2X A;  1FEE A;  2BJ8 A;  2KVI A;  1DZ5 A;  2AMC B;  1MU2 B;  2R7S A;  1EET A;  1R8P A;  2UXB E;  3A13 A;  1N33 E;  1U1O A;  3GR1 A;  1K44 A;  3HD1 A;  4FXW A;  1RAJ A;  4JI6 E;  2FZK B;  3NCP A;  1U1M A;  4CCH A;  2R7T A;  3DI6 B;  1ZAX A;  2B3T B;  3UDC A;  2ZFH A;  2FJW A;  2FLL A;  2WP8 A;  4GKK I;  1GT8 A;  1Z0C A;  1FRJ A;  4A47 A;  4KHR A;  2LYV A;  1NPK A;  2WAQ D;  1S6P B;  2YQ1 A;  4QPT A;  5B0G A;  1AXQ A;  4K7Q A;  3TUZ C;  1IUJ A;  1NPP A;  2QE5 A;  3ENA A;  2CDQ A;  2DHS A;  1QZR A;  4P9S A;  4DBQ A;  3HM9 A;  4LF5 J;  5CXT A;  1P1T A;  1OQ3 A;  4OO1 D;  5HVF A;  4OYB A;  1QM9 A;  4AXJ A;  1Q7L B;  2IRY A;  1RI7 A;  1R43 A;  2YWW A;  4ZN1 A;  2XCP A;  3NCR A;  3DHX A;  5HRO A;  1UCN A;  1YG0 A;  4N5S A;  4FVC A;  2JVR A;  2YBV A;  2VD3 A;  3MTK A;  2BA0 G;  3M8W A;  3KWM A;  3DOL B;  4B9S A;  1SJ1 A;  3KUG A;  3MEC A;  2ZUA A;  4X62 J;  2R2U A;  3MM8 B;  1Y10 A;  4JV5 F;  5F0U A;  4HI1 A;  2OEK A;  4KV8 B;  3H90 A;  2VQF F;  4OYO A;  4AD6 A;  1KP6 A;  3QSI A;  4DX7 A;  4B3R J;  1NHI A;  3PG9 A;  4K2X A;  3D6M B;  2XNQ A;  4WP9 A;  4B17 A;  4DQP A;  5KFX A;  2UUB E;  2OPS B;  3ETM A;  3VGU A;  1DQ9 A;  5KFE A;  1FO1 A;  1UVM A;  5A6P A;  2OPR B;  3NEK A;  3G6V A;  2R7Q A;  3M8P B;  4JI4 I;  3W61 A;  4DR1 J;  2E1C A;  1B0T A;  3J81 C;  5LXY A;  1WNE A;  2YWF A;  3C16 B;  3CJ2 A;  1RWO B;  3GON A;  4RL1 A;  4LF7 J;  3PTW A;  3POT A;  3RZA A;  5LMN I;  3DOM A;  1X4C A;  3M30 A;  4HDG A;  4WFY A;  3FSY A;  4G1P A;  1EP4 B;  1S1W A;  4JYA E;  4QR0 A;  1N0U A;  3DGP B;  2MKC A;  2VQE F;  1B7F A;  4O4G B;  2JL9 A;  3PFO A;  4NLQ A;  3OVA A;  1WKK A;  3RRG A;  4YB7 A;  2GO3 A;  3TW0 A;  1USU A;  2EFQ A;  2WON A;  1R8H A;  3FKB A;  3M8Y A;  3BB5 A;  4DV6 E;  1GEH A;  3Q8Y A;  5FLX U;  3HSG A;  3UI3 A;  1VQL S;  4DS4 A;  2QFI A;  3LP0 A;  3PYD A;  3T1Y F;  1Y11 A;  1HBN A;  2VFV A;  3FQL A;  3GJS B;  4USK A;  2B7C B;  1BQM A;  1KN6 A;  5ETS A;  3ISZ A;  2HNZ A;  3ZXW A;  2BYC A;  4GRS A;  3M8S A;  4KKO A;  2QYC A;  2VC1 A;  1FJG E;  1AB8 A;  4WTO B;  4KAI A;  1CQN A;  4ED0 A;  3UR3 C;  1RWP B;  1U1K A;  2ZE2 B;  4PEO A;  3M8Q A;  1IR1 A;  1EKR A;  1WHX A;  2BJ1 A;  4DV3 I;  2AEM A;  2E5G A;  3OV7 A;  1MG7 A;  1R8C A;  5HP1 B;  2UUC I;  2B8Q A;  3KYL A;  4B3M I;  2W4D A;  2GS8 A;  4TYB A;  4DR4 F;  5KFT A;  2O1W A;  1FD8 A;  4HAC A;  3JQK A;  3DYA A;  2YKO A;  4KGZ B;  4NLP A;  2NUU G;  2BJ7 A;  3KLF A;  1NJW A;  4UY8 5;  1RT5 B;  2VFU A;  1U6Z A;  1I94 J;  2UVR A;  4J3D A;  2PEB A;  5ETO A;  5KG3 A;  4YY3 I;  3EDR B;  2IRU A;  2E5L E;  4M1K A;  4ECV A;  4DV0 E;  4ETZ A;  4DG1 B;  1QE1 B;  2JDJ A;  4HHJ A;  4FXV A;  1XMQ I;  1IR2 A;  2VB6 A;  4YB1 P;  5E5N A;  4A8Q A;  3EE3 A;  2KZM A;  3HHL A;  2E9Z A;  4OYW A;  3R7S B;  4OX9 E;  5D4P A;  2Y0B B;  3T3F A;  4Q8E A;  2BAN B;  3P49 B;  1RT4 B;  3R5C A;  1F2G A;  3QFW A;  5D78 A;  1PJ5 A;  3DRS A;  2N7Y A;  3IWN C;  4Q44 A;  2OUG A;  5JMN A;  5L1L A;  1NHV A;  3B82 A;  3DDN A;  4KGM A;  3X1L B;  4IH7 A;  2AEF A;  1RWM B;  2UV8 G;  1F60 B;  4ECQ A;  1N52 B;  4AFF A;  3D2W A;  2O5D A;  2DXF A;  4ZJL A;  2CJY B;  4RO0 A;  1B62 A;  5K36 E;  2RJZ A;  3ITH A;  1Q7Y T;  2P9E A;  3TAR A;  2BJE A;  2Z2Z A;  1JXE A;  4RLE A;  2EG2 A;  2J9D E;  2VIH A;  4QNK A;  3QT8 A;  3K85 A;  1JXL A;  3DNC A;  2UU9 J;  3BKF A;  4WXO A;  4DSL A;  4KY3 A;  1FWP A;  1HNZ F;  4PG5 A;  4DUZ F;  2KT2 A;  2M9K A;  1X8D A;  4DR6 E;  1G3O A;  1T05 A;  4M5L A;  4AQY J;  5J2Q A;  3KLI B;  4FBU A;  3ISN D;  2VC0 A;  2I0X A;  2ATL A;  1WWH A;  3H98 A;  4X66 J;  1JKH B;  2J6U A;  3QJJ A;  4LF6 I;  4ID5 A;  5I42 A;  2F4F A;  5G4D A;  2UUW A;  4OV1 A;  2Z57 B;  2V2V A;  1XMO I;  4DL7 A;  2IA0 A;  3RB6 A;  2GAH C;  5J2P A;  4EYI B;  5IXU A;  5EDW A;  2F8E X;  3D1H A;  5BR8 I;  1RAD B;  3F41 A;  2QJ3 A;  5B0B A;  1Y5Y A;  2XBP A;  3LF0 A;  4Q2L A;  3CTR A;  3ZZT A;  3PS1 A;  4Y3C A;  1R0A B;  1VQN S;  1RLC L;  3MEG B;  4DFK A;  3DLK A;  2G2Z A;  1B4S A;  1GMW A;  4I6Y A;  4K4V A;  3NMR A;  2J9E A;  3G82 B;  1ZOT A;  3CCU S;  4V19 J;  3DCA A;  2XY6 A;  2ASD A;  1Y4Z B;  3HVT B;  3ZC4 A;  1Z5A A;  3D67 A;  3VHQ A;  2KFN A;  3N6L A;  1PVG A;  4MU0 A;  2DTJ A;  3AJ2 A;  3SEO A;  2UUA I;  1VLY A;  3UR0 A;  4YHH I;  4RPF A;  3MWB A;  3IR6 B;  4GKK E;  1YJR A;  1S10 A;  2POK A;  1B70 B;  3RAQ A;  2HVI A;  2V69 A;  3M32 A;  5C7P A;  3K1J A;  3W8G A;  1VQY A;  1YRT A;  2QGF B;  1N32 J;  2BQ3 A;  2NPI A;  1Z5B A;  4P7V A;  5L1I A;  3R2D J;  4NLT A;  4Y2M A;  4LFB F;  1UVN A;  1PYT A;  4CYU B;  2DNL A;  4IFD F;  5KG0 A;  5I3U B;  4PWD A;  1IKV B;  2Q2E B;  1TFW A;  4U8V A;  2GMH A;  4LSN B;  1FJC A;  2ZOG A;  3W8P A;  2HFZ A;  2DBB A;  4LFA I;  5K36 D;  2R4F A;  2PI5 A;  2W9C A;  2LQB A;  2JEA A;  5HMW A;  4Y28 C;  2FHM A;  4XDC A;  2OAU A;  4CO2 A;  5E3P A;  4I7F A;  3PX0 A;  1UET A;  4Q7A A;  2DR5 A;  4RW6 B;  1FRM A;  1YWX A;  1FES A;  2PMZ D;  2B8P A;  4F4Z A;  5KG5 A;  1YHC A;  2XY5 A;  2MPU A;  2HND A;  2PEH A;  2J7K A;  5KOX A;  8ATC B;  1ULR A;  3V6D A;  4IZJ B;  2O66 A;  3BBB A;  4DCJ B;  1CS4 B;  3G87 A;  2Z30 B;  1VBX A;  1SIZ A;  5EUH A;  2HHQ A;  2C1E B;  1S49 A;  1CUL A;  2Z2Y B;  1ZZF A;  3TZZ A;  3KHL A;  1IM6 A;  2HMI A;  4GQU A;  4KH1 B;  1FE4 A;  2HS4 A;  3EGV A;  4USI A;  1GXL A;  1VRU B;  2DH7 A;  2G4B A;  2FHJ A;  3TO8 A;  1YRX A;  2HYI B;  3ENV A;  3M1V A;  3LP1 B;  4FKX A;  1Z59 A;  5EN1 A;  1RAC B;  1JLC B;  4JI4 E;  1Y3J A;  5FWK A;  1RTI B;  3K89 A;  5LJ3 Y;  4DV4 F;  3VVU A;  5D6G A;  3MCO A;  3UO0 A;  2W4P A;  4QR1 A;  5LMN E;  1UVI A;  2E7W A;  1NH8 A;  3KK1 B;  2NN6 A;  3AJD A;  3WU5 A;  5DRP A;  1GXT A;  1C0U A;  1MWQ A;  5H9E J;  5DJB A;  4NA1 A;  3GYN A;  3H5U A;  2GHP A;  5C25 A;  4DUY J;  4ZLN A;  3F73 A;  3H2V E;  1EAR A;  4A8K A;  4PRX A;  1TMJ A;  2ZH4 A;  4DR3 I;  2PN6 A;  3C6T B;  4EO6 A;  3FDS A;  3V5R A;  4O3P A;  1SH2 A;  2W2O P;  3BN7 A;  5C0X A;  2MKK A;  2R8J A;  1C1B B;  5F9N A;  1P9Q C;  2K3I A;  2MY8 A;  2WVB A;  3A8E A;  3GCX P;  3MMB B;  3HHD A;  2WBM A;  3DRR B;  2XNR A;  2CFX A;  4I69 A;  5L8R C;  4CO3 A;  1LK5 A;  3BSO A;  1FTR A;  3C66 A;  3MPW A;  3GV7 B;  5B08 A;  5A2Q Y;  2CNL B;  3W63 A;  5DM6 Q;  2YQ3 A;  1USV A;  2WBR A;  1RAE B;  4Y00 A;  3BH6 B;  4AM3 A;  5KOW A;  2J7W A;  4DV1 E;  4MDT A;  5A8W A;  1VLO A;  3GIK A;  2ZD1 A;  3CIM A;  2QRR A;  5B0A A;  2OSQ A;  5HAT A;  3PO4 A;  4LF5 I;  1WC4 A;  2LJP A;  1WOR A;  2VDH A;  2DPI A;  2J65 A;  3MOZ A;  4CLL A;  4DR2 F;  2DNZ A;  3B78 A;  1L3S A;  3NG8 A;  5KFH A;  2EFV A;  2UUC E;  2DR6 A;  4B3M E;  2LU2 A;  5IT4 A;  4ER8 A;  4OHZ A;  5AE3 A;  4EBE A;  3J7A M;  4OI0 A;  3W9J A;  4YS2 A;  4KGK A;  2HS3 A;  5CHC B;  4DUT A;  2DHG A;  1S72 S;  1C1C B;  2MY7 A;  4NLG A;  2DIV A;  1IWA A;  4LFC I;  3V4I B;  1G6B A;  3O8W A;  2DNP A;  3F0N A;  3B8H A;  4H4O B;  3C15 B;  1ITP A;  1TU0 B;  4WZM A;  4YY3 E;  1S9G B;  4ELU A;  1HWK A;  4EU0 A;  4FF3 A;  2M70 A;  5EWE A;  4ILM A;  3Q6N A;  1XMQ E;  3BBF A;  2HHV A;  2G1D A;  1UW9 A;  3I4H X;  4B3R I;  1R7I A;  1RHM B;  3R1H A;  4URS A;  4K4Z A;  1N6Q A;  1J5O A;  1KFD A;  2HZV A;  5GAG I;  5D15 A;  4I2Q B;  4J9R A;  4FN5 A;  4DR1 I;  1T9Y A;  1FI4 A;  2VG6 B;  1JX4 A;  1V5I B;  5KFC A;  4UW2 A;  3ZNJ 1;  2FJA B;  2C2R A;  1JLQ A;  2IDE A;  5LMU J;  3MED A;  6AT1 B;  2RSQ A;  5GVQ A;  4OZN A;  1E6V B;  2LDY A;  1WD6 A;  1D8Z A;  2MQ8 A;  2G2Y A;  3MEE A;  2IRX A;  1O0P A;  4YR2 A;  2LQJ A;  1XXE A;  3PJW A;  3WIU A;  5HVG A;  2CYY A;  5SUH A;  1RAI B;  2LMI A;  3QT7 A;  1