2BA0G

Archaeal exosome core
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
255
structure length
255
Chain Sequence
b'EDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPYPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal exosome RNA binding protein RRP4
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 72
structure length 255
sequence length 255
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2ba0G01
2BR2A 5JEAC 4OO1D 2WP8B 2JEBA 2NN6D 5C0XC 2PNZB 2BA0D 5K36D 2C39A 4IFDA 2PO0A 1UDOA 2WNRB 4OO1F 3M7NG 4IFDE 3L7ZA 3GCMA 2PNZA 2JEAB 4BA2B 2C38B 5JEAB 2JE6B 2WNRA 1R6LA 5C0XB 1UDSA 2PO1A 3GLLA 2BA0G 2JEAA 4AIDA 4IFDD 2C38A 5JEAA 5C0XA 4BA1B 2PO2B 4IFDF 2BA1G 2NN6B 5JEAE 2WP8A 5K36B 5C0XE 2C37B 4OO1C 1R6MA 2NN6C 5K36C 1E3PA 3KRNA 1OYSA 2C37A 4NBQA 3B4TA 1UDNA 5JEAD 4BA2A 2BR2B 3M85D 5C0XD 2JE6A 3CDJA 1OYRA 4OO1B 1OYPA 5JEAF 2C39B 5C0XF 4AIMA 2PO0B 3CDIA 4IFDC 3L7ZB 4BA1A 2PO2A 4OO1A 2NN6A 1UDQA 5K36A 3U1KA 3DD6A 3M85G 4AM3A 2NN6F 4OO1E 2NN6E 1E3HA 5K36F 2BA1D 3M7ND 2PO1B 5K36E 2JEBB 3GMEA 3HKMA 3H1CA 4IFDB
chains in the Genus database with same CATH superfamily
1HNXI 4M1KA 2BR2A 1KKHA 1VISA 1H73A 3P3GA 1XMQI 2WP8B 4RPFA 5C0XC 1PVGA 4DR5I 4IFDA 4DR1I 1UDOA 4OO1F 4LF6I 1XNQE 4LFCE 2UXDI 3PYGA 2Z5CB 3PS2A 3L7ZA 3B8HA 1YH8A 3JAMQ 4MQYA 4NXMI 2ZM6E 2C38B 4FW5A 4DV5E 4FWHA 4FW3A 2PO1A 4DV7I 4N3OA 2BA0G 4AIDA 4IFDD 3ZKDA 1RREA 3T1HE 2VQFE 1ZXMA 4B3RE 4JI3E 5A2QC 2AE8A 5C0XA 2PO2B 5BR8E 2CZ9A 5FLXQ 3J81C 4DR3E 1HNWE 4LF7E 4URLA 2C37B 4B3ME 1USUA 2UXCI 4FN5A 2NN6C 2F4VI 1FWLA 4MYTA 4LFBE 1H72C 2GS8A 1HNZI 2UXBE 4U3DA 1EI1A 3OTOE 3P3CA 2Z5BA 4WUDA 1OYSA 4JI8I 2CVEA 4X62I 3PS1A 2UUCI 3B4TA 5LMUE 4LF8I 4HY1A 4BA2A 5C0XD 1Z0CA 1EA6A 1H7SA 4DR6E 1K47A 1HK7A 1OYPA 2EFGA 4YY3E 5JEAF 4X66I 1XNRE 2C39B 4HACA 4X65I 4DR7E 4AIMA 4DV1I 3QT8A 5IWAI 3D4JA 1ELOA 4BA1A 1N33I 3B78A 4AQYE 2NN6A 4DV6I 1HR0E 1Z0WA 2Q2EB 2NN6F 1A6FA 2UU9I 4DV5I 5DRQA 4JI6E 5K36E 4FW6A 4XTJA 4IZJB 2XEXA 4LFAE 3JAMC 1P42A 1B63A 2IOQA 5EL9A 4I3HA 4GKKI 4DUZE 1N0VC 2VQFI 4FW4A 1H74A 3F0NA 1IBME 5FWKA 1J5EE 1Z0GA 4DPUA 4B3TE 2J65A 1Y4SA 2NN6D 2BA0D 3J80Q 3M6AA 2E5LE 1N36E 2CGEA 2HFUA 3CWVA 4KHPE 4LFBI 3M7NG 4JV5I 5FLXC 2R3VA 2HKJA 3OTOI 1Z0VA 4JI5E 4DR4E 2UUBE 4USMA 3WU6A 4DV4E 1RHYA 2O1TA 3P76A 4LPFA 4HYMA 2HHHI 4JI0I 3HJCA 4DR2I 4JI1E 2Z5CA 1UDSA 1MU5A 1H7UA 4MU0A 2V2QA 4PRVA 4DR7I 2C38A 3GONA 5DNLA 2AJ4A 4KQVA 4B3SI 4IFDF 2LJPA 1NZ0A 1XMOE 1N34I 4LF9I 2BM1A 2Z5EA 4NXNI 1FNMA 2VQEI 4K0KE 5LMNE 1ZXNA 5K36C 2UUAI 2ZBKB 4U3BA 3ZM7A 1E3PA 4LCGA 4FW7A 3K17A 3PYDA 4DU8A 2C37A 2IOPA 4PU9A 2BR2B 2R42A 2JE6A 3CDJA 5EKWA 4IZKA 2GO4A 4JG4A 4YHHE 4DV0E 4OO1B 4OX9E 5C0XF 4GQUA 4GKJI 3QT7A 1N36I 1D6TA 4OZEA 4WUBA 4JYAE 3L7ZB 1MG7A 4LF4E 4LF5E 3J80C 1IBLI 1UDQA 2PNLA 5K36A 2HK3A 2UUBI 4OO1E 2HFSA 2O1UA 4DV3E 1E3HA 4MDTA 1I94I 4JI7I 5K36F 2BA1D 3M7ND 3Q6MA 2PO1B 2JEBB 1ZM9A 4R1FA 5LL6R 4JI1I 1N32E 4MYUA 3B82A 3HKMA 2HKEA 1IBKE 2JT2A 3T1YE 4Z7CA 1FJGE 1PIEA 2BM0A 1DARA 4JI2E 4IS9A 3ZKBA 1XNQI 1WUUA 4LFCI 2PNZB 4JI4E 5K36D 1HNXE 2E1RA 2PO0A 2WNRB 1U2RA 1XMQE 3LPSA 2ZM6I 5LMNI 2DEJA 4DR5E 1Z59A 4P7AA 2JEAB 4DR1E 1VI7A 4BA2B 1USVA 4LF6E 3ZZ0A 5JEAB 4DXLA 4FWDA 1R6LA 3T1HI 2X7IA 4B3RI 4JI3I 1BKNA 5ELWA 2O1WA 3PYEA 3WU5A 4FW9A 5BR8I 1Z0EA 4DPWA 4YHHI 4OX9I 4USKA 4DR3I 3WU4A 2V2VA 4LF7I 1HNWI 4B3MI 4BA1B 4EMDA 4DUYE 4DV7E 1Z5BA 2BA1G 2NN6B 1S4EA 1KVKA 2UXBI 5JEAE 2WP8A 4LF5I 4OO1C 3J7AM 1R6MA 2CG9A 1ZM2A 5LMUI 2F1DA 4DV3I 1NHHA 5IT9Q 4DR6I 2UXCE 2HK2A 1XXEA 2F4VE 1OJ4A 2WW4A 5DRRA 1XNRI 4NBQA 4YY3I 1UDNA 2DEIA 1HNZE 1OYRA 4JI8E 4X62E 2PNMA 1Z0TA 2VF3A 2UUCE 4ED4A 4LF8E 2V2ZA 1FKAE 1Y6ZA 3P06A 4AQYI 3CDIA 4DPYA 1HR0I 4X66E 2PO2A 4X65E 4DV2E 3Q1QA 4OO1A 1S16A 4DV1E 4JI6I 1YHCA 5IWAE 4DPXA 3LTOA 2O1VA 4LFAI 3M85G 1Y4UA 1N33E 4DUZI 2A2DA 1ZM4A 3PYFA 4DV6E 3GMEA 1IBMI 1Z5CA 1J5EI 4B3TI 4JI7E 1I94E 1ZM3A 4IFDB 4LCFA 1QZRA 3V2UC 2UU9E 2E5LI 3QT5A 5JEAC 2IESA 2GO3A 4OO1D 4DUYI 2JEBA 3Q6NA 3WU3A 4GKKE 4KHPI 2C39A 4JI5I 4DR4I 2VESA 4DV4I 4J3DA 2V8PA 4LOMA 4IFDE 4X64E 3GCMA 2PNZA 4DU7A 2A2CA 2JE6B 2WNRA 3K1JA 4JV5E 3HULA 1KTVA 5C0XB 3P3EA 4IZKB 3H4LA 5IT9C 1XHKA 4WUCA 3GLLA 2JEAA 4IZJA 3ZZUA 4LCHA 2HHHE 1MX0A 1XMOI 4ISAA 4JI0E 5JEAA 5DNXA 4QNKA 4DR2E 1Y60A 2ZITA 3J7AG 4K0KI 3QT6A 4MU3A 3PS3A 4Z7YA 2Z5BB 3PRYA 4DV2I 1Z5AA 5K36B 5C0XE 1NHJA 1RR9A 1UEKA 2BV3A 4B3SE 5L3JA 2X36A 2UXDE 4HXZA 1N34E 4OKGA 4QNJA 4LF9E 4NXNE 3KRNA 5GMEA 1KIJA 4NXME 2VQEE 4HACB 5DRPA 4IZJD 2OI2A 4MU4A 4DV0I 1NHIA 5JEAD 2UUAE 3M85D 5A2QQ 4DPTA 1N0UA 3V5RA 3J81Q 4JYAI 3UHMA 3LNUA 2PO0B 4PRXA 4LF4I 1B62A 2GQ0A 4IFDC 3U1YA 1Z0BA 3NZKA 4P52A 4GKJE 2NPFA 4FWGA 4X64I 3ZZTA 3U1KA 3DD6A 2IERA 1N32I 2V34A 4AM3A 2O3ZA 4MU1A 2NN6E 4ZVIA 1IBKI 3T1YI 2J7KA 1FWKA 3K85A 1FJGI 1IBLE 5DROA 4JI2I 5GMDA 1Y5YA 4UT4A 3H1CA 1FI4A 4UTGA 1PKPA 4JI4I
chains in the Genus database with same CATH topology
2BR2A 5JEAC 4OO1D 2WP8B 2JEBA 2NN6D 5C0XC 2PNZB 2BA0D 5K36D 2C39A 4IFDA 2PO0A 1UDOA 2WNRB 4OO1F 3M7NG 4IFDE 3L7ZA 3GCMA 2PNZA 2JEAB 4BA2B 2C38B 5JEAB 2JE6B 2WNRA 1R6LA 5C0XB 1UDSA 2PO1A 3GLLA 2BA0G 2JEAA 4AIDA 4IFDD 2C38A 5JEAA 5C0XA 4BA1B 2PO2B 4IFDF 2BA1G 2NN6B 5JEAE 2WP8A 5K36B 5C0XE 2C37B 4OO1C 1R6MA 2NN6C 5K36C 1E3PA 3KRNA 1OYSA 2C37A 4NBQA 3B4TA 1UDNA 5JEAD 4BA2A 2BR2B 3M85D 5C0XD 2JE6A 3CDJA 1OYRA 4OO1B 1OYPA 5JEAF 2C39B 5C0XF 4AIMA 2PO0B 3CDIA 4IFDC 3L7ZB 4BA1A 2PO2A 4OO1A 2NN6A 1UDQA 5K36A 3U1KA 3DD6A 3M85G 4AM3A 2NN6F 4OO1E 2NN6E 1E3HA 5K36F 2BA1D 3M7ND 2PO1B 5K36E 2JEBB 3GMEA 3HKMA 3H1CA 4IFDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR2 A;  5JEA C;  4OO1 D;  2WP8 B;  2JEB A;  2NN6 D;  5C0X C;  2PNZ B;  2BA0 D;  5K36 D;  2C39 A;  4IFD A;  2PO0 A;  1UDO A;  2WNR B;  4OO1 F;  3M7N G;  4IFD E;  3L7Z A;  3GCM A;  2PNZ A;  2JEA B;  4BA2 B;  2C38 B;  5JEA B;  2JE6 B;  2WNR A;  1R6L A;  5C0X B;  1UDS A;  2PO1 A;  3GLL A;  2BA0 G;  2JEA A;  4AID A;  4IFD D;  2C38 A;  5JEA A;  5C0X A;  4BA1 B;  2PO2 B;  4IFD F;  2BA1 G;  2NN6 B;  5JEA E;  2WP8 A;  5K36 B;  5C0X E;  2C37 B;  4OO1 C;  1R6M A;  2NN6 C;  5K36 C;  1E3P A;  3KRN A;  1OYS A;  2C37 A;  4NBQ A;  3B4T A;  1UDN A;  5JEA D;  4BA2 A;  2BR2 B;  3M85 D;  5C0X D;  2JE6 A;  3CDJ A;  1OYR A;  4OO1 B;  1OYP A;  5JEA F;  2C39 B;  5C0X F;  4AIM A;  2PO0 B;  3CDI A;  4IFD C;  3L7Z B;  4BA1 A;  2PO2 A;  4OO1 A;  2NN6 A;  1UDQ A;  5K36 A;  3U1K A;  3DD6 A;  3M85 G;  4AM3 A;  2NN6 F;  4OO1 E;  2NN6 E;  1E3H A;  5K36 F;  2BA1 D;  3M7N D;  2PO1 B;  5K36 E;  2JEB B;  3GME A;  3HKM A;  3H1C A;  4IFD B; 
#chains in the Genus database with same CATH topology
 1HNX I;  4M1K A;  2BR2 A;  1KKH A;  1VIS A;  1H73 A;  3P3G A;  1XMQ I;  2WP8 B;  4RPF A;  5C0X C;  1PVG A;  4DR5 I;  4IFD A;  4DR1 I;  1UDO A;  4OO1 F;  4LF6 I;  1XNQ E;  4LFC E;  2UXD I;  3PYG A;  2Z5C B;  3PS2 A;  3L7Z A;  3B8H A;  1YH8 A;  3JAM Q;  4MQY A;  4NXM I;  2ZM6 E;  2C38 B;  4FW5 A;  4DV5 E;  4FWH A;  4FW3 A;  2PO1 A;  4DV7 I;  4N3O A;  2BA0 G;  4AID A;  4IFD D;  3ZKD A;  1RRE A;  3T1H E;  2VQF E;  1ZXM A;  4B3R E;  4JI3 E;  5A2Q C;  2AE8 A;  5C0X A;  2PO2 B;  5BR8 E;  2CZ9 A;  5FLX Q;  3J81 C;  4DR3 E;  1HNW E;  4LF7 E;  4URL A;  2C37 B;  4B3M E;  1USU A;  2UXC I;  4FN5 A;  2NN6 C;  2F4V I;  1FWL A;  4MYT A;  4LFB E;  1H72 C;  2GS8 A;  1HNZ I;  2UXB E;  4U3D A;  1EI1 A;  3OTO E;  3P3C A;  2Z5B A;  4WUD A;  1OYS A;  4JI8 I;  2CVE A;  4X62 I;  3PS1 A;  2UUC I;  3B4T A;  5LMU E;  4LF8 I;  4HY1 A;  4BA2 A;  5C0X D;  1Z0C A;  1EA6 A;  1H7S A;  4DR6 E;  1K47 A;  1HK7 A;  1OYP A;  2EFG A;  4YY3 E;  5JEA F;  4X66 I;  1XNR E;  2C39 B;  4HAC A;  4X65 I;  4DR7 E;  4AIM A;  4DV1 I;  3QT8 A;  5IWA I;  3D4J A;  1ELO A;  4BA1 A;  1N33 I;  3B78 A;  4AQY E;  2NN6 A;  4DV6 I;  1HR0 E;  1Z0W A;  2Q2E B;  2NN6 F;  1A6F A;  2UU9 I;  4DV5 I;  5DRQ A;  4JI6 E;  5K36 E;  4FW6 A;  4XTJ A;  4IZJ B;  2XEX A;  4LFA E;  3JAM C;  1P42 A;  1B63 A;  2IOQ A;  5EL9 A;  4I3H A;  4GKK I;  4DUZ E;  1N0V C;  2VQF I;  4FW4 A;  1H74 A;  3F0N A;  1IBM E;  5FWK A;  1J5E E;  1Z0G A;  4DPU A;  4B3T E;  2J65 A;  1Y4S A;  2NN6 D;  2BA0 D;  3J80 Q;  3M6A A;  2E5L E;  1N36 E;  2CGE A;  2HFU A;  3CWV A;  4KHP E;  4LFB I;  3M7N G;  4JV5 I;  5FLX C;  2R3V A;  2HKJ A;  3OTO I;  1Z0V A;  4JI5 E;  4DR4 E;  2UUB E;  4USM A;  3WU6 A;  4DV4 E;  1RHY A;  2O1T A;  3P76 A;  4LPF A;  4HYM A;  2HHH I;  4JI0 I;  3HJC A;  4DR2 I;  4JI1 E;  2Z5C A;  1UDS A;  1MU5 A;  1H7U A;  4MU0 A;  2V2Q A;  4PRV A;  4DR7 I;  2C38 A;  3GON A;  5DNL A;  2AJ4 A;  4KQV A;  4B3S I;  4IFD F;  2LJP A;  1NZ0 A;  1XMO E;  1N34 I;  4LF9 I;  2BM1 A;  2Z5E A;  4NXN I;  1FNM A;  2VQE I;  4K0K E;  5LMN E;  1ZXN A;  5K36 C;  2UUA I;  2ZBK B;  4U3B A;  3ZM7 A;  1E3P A;  4LCG A;  4FW7 A;  3K17 A;  3PYD A;  4DU8 A;  2C37 A;  2IOP A;  4PU9 A;  2BR2 B;  2R42 A;  2JE6 A;  3CDJ A;  5EKW A;  4IZK A;  2GO4 A;  4JG4 A;  4YHH E;  4DV0 E;  4OO1 B;  4OX9 E;  5C0X F;  4GQU A;  4GKJ I;  3QT7 A;  1N36 I;  1D6T A;  4OZE A;  4WUB A;  4JYA E;  3L7Z B;  1MG7 A;  4LF4 E;  4LF5 E;  3J80 C;  1IBL I;  1UDQ A;  2PNL A;  5K36 A;  2HK3 A;  2UUB I;  4OO1 E;  2HFS A;  2O1U A;  4DV3 E;  1E3H A;  4MDT A;  1I94 I;  4JI7 I;  5K36 F;  2BA1 D;  3M7N D;  3Q6M A;  2PO1 B;  2JEB B;  1ZM9 A;  4R1F A;  5LL6 R;  4JI1 I;  1N32 E;  4MYU A;  3B82 A;  3HKM A;  2HKE A;  1IBK E;  2JT2 A;  3T1Y E;  4Z7C A;  1FJG E;  1PIE A;  2BM0 A;  1DAR A;  4JI2 E;  4IS9 A;  3ZKB A;  1XNQ I;  1WUU A;  4LFC I;  2PNZ B;  4JI4 E;  5K36 D;  1HNX E;  2E1R A;  2PO0 A;  2WNR B;  1U2R A;  1XMQ E;  3LPS A;  2ZM6 I;  5LMN I;  2DEJ A;  4DR5 E;  1Z59 A;  4P7A A;  2JEA B;  4DR1 E;  1VI7 A;  4BA2 B;  1USV A;  4LF6 E;  3ZZ0 A;  5JEA B;  4DXL A;  4FWD A;  1R6L A;  3T1H I;  2X7I A;  4B3R I;  4JI3 I;  1BKN A;  5ELW A;  2O1W A;  3PYE A;  3WU5 A;  4FW9 A;  5BR8 I;  1Z0E A;  4DPW A;  4YHH I;  4OX9 I;  4USK A;  4DR3 I;  3WU4 A;  2V2V A;  4LF7 I;  1HNW I;  4B3M I;  4BA1 B;  4EMD A;  4DUY E;  4DV7 E;  1Z5B A;  2BA1 G;  2NN6 B;  1S4E A;  1KVK A;  2UXB I;  5JEA E;  2WP8 A;  4LF5 I;  4OO1 C;  3J7A M;  1R6M A;  2CG9 A;  1ZM2 A;  5LMU I;  2F1D A;  4DV3 I;  1NHH A;  5IT9 Q;  4DR6 I;  2UXC E;  2HK2 A;  1XXE A;  2F4V E;  1OJ4 A;  2WW4 A;  5DRR A;  1XNR I;  4NBQ A;  4YY3 I;  1UDN A;  2DEI A;  1HNZ E;  1OYR A;  4JI8 E;  4X62 E;  2PNM A;  1Z0T A;  2VF3 A;  2UUC E;  4ED4 A;  4LF8 E;  2V2Z A;  1FKA E;  1Y6Z A;  3P06 A;  4AQY I;  3CDI A;  4DPY A;  1HR0 I;  4X66 E;  2PO2 A;  4X65 E;  4DV2 E;  3Q1Q A;  4OO1 A;  1S16 A;  4DV1 E;  4JI6 I;  1YHC A;  5IWA E;  4DPX A;  3LTO A;  2O1V A;  4LFA I;  3M85 G;  1Y4U A;  1N33 E;  4DUZ I;  2A2D A;  1ZM4 A;  3PYF A;  4DV6 E;  3GME A;  1IBM I;  1Z5C A;  1J5E I;  4B3T I;  4JI7 E;  1I94 E;  1ZM3 A;  4IFD B;  4LCF A;  1QZR A;  3V2U C;  2UU9 E;  2E5L I;  3QT5 A;  5JEA C;  2IES A;  2GO3 A;  4OO1 D;  4DUY I;  2JEB A;  3Q6N A;  3WU3 A;  4GKK E;  4KHP I;  2C39 A;  4JI5 I;  4DR4 I;  2VES A;  4DV4 I;  4J3D A;  2V8P A;  4LOM A;  4IFD E;  4X64 E;  3GCM A;  2PNZ A;  4DU7 A;  2A2C A;  2JE6 B;  2WNR A;  3K1J A;  4JV5 E;  3HUL A;  1KTV A;  5C0X B;  3P3E A;  4IZK B;  3H4L A;  5IT9 C;  1XHK A;  4WUC A;  3GLL A;  2JEA A;  4IZJ A;  3ZZU A;  4LCH A;  2HHH E;  1MX0 A;  1XMO I;  4ISA A;  4JI0 E;  5JEA A;  5DNX A;  4QNK A;  4DR2 E;  1Y60 A;  2ZIT A;  3J7A G;  4K0K I;  3QT6 A;  4MU3 A;  3PS3 A;  4Z7Y A;  2Z5B B;  3PRY A;  4DV2 I;  1Z5A A;  5K36 B;  5C0X E;  1NHJ A;  1RR9 A;  1UEK A;  2BV3 A;  4B3S E;  5L3J A;  2X36 A;  2UXD E;  4HXZ A;  1N34 E;  4OKG A;  4QNJ A;  4LF9 E;  4NXN E;  3KRN A;  5GME A;  1KIJ A;  4NXM E;  2VQE E;  4HAC B;  5DRP A;  4IZJ D;  2OI2 A;  4MU4 A;  4DV0 I;  1NHI A;  5JEA D;  2UUA E;  3M85 D;  5A2Q Q;  4DPT A;  1N0U A;  3V5R A;  3J81 Q;  4JYA I;  3UHM A;  3LNU A;  2PO0 B;  4PRX A;  4LF4 I;  1B62 A;  2GQ0 A;  4IFD C;  3U1Y A;  1Z0B A;  3NZK A;  4P52 A;  4GKJ E;  2NPF A;  4FWG A;  4X64 I;  3ZZT A;  3U1K A;  3DD6 A;  2IER A;  1N32 I;  2V34 A;  4AM3 A;  2O3Z A;  4MU1 A;  2NN6 E;  4ZVI A;  1IBK I;  3T1Y I;  2J7K A;  1FWK A;  3K85 A;  1FJG I;  1IBL E;  5DRO A;  4JI2 I;  5GMD A;  1Y5Y A;  4UT4 A;  3H1C A;  1FI4 A;  4UTG A;  1PKP A;  4JI4 I; 
#chains in the Genus database with same CATH homology
 2BR2 A;  5JEA C;  4OO1 D;  2WP8 B;  2JEB A;  2NN6 D;  5C0X C;  2PNZ B;  2BA0 D;  5K36 D;  2C39 A;  4IFD A;  2PO0 A;  1UDO A;  2WNR B;  4OO1 F;  3M7N G;  4IFD E;  3L7Z A;  3GCM A;  2PNZ A;  2JEA B;  4BA2 B;  2C38 B;  5JEA B;  2JE6 B;  2WNR A;  1R6L A;  5C0X B;  1UDS A;  2PO1 A;  3GLL A;  2BA0 G;  2JEA A;  4AID A;  4IFD D;  2C38 A;  5JEA A;  5C0X A;  4BA1 B;  2PO2 B;  4IFD F;  2BA1 G;  2NN6 B;  5JEA E;  2WP8 A;  5K36 B;  5C0X E;  2C37 B;  4OO1 C;  1R6M A;  2NN6 C;  5K36 C;  1E3P A;  3KRN A;  1OYS A;  2C37 A;  4NBQ A;  3B4T A;  1UDN A;  5JEA D;  4BA2 A;  2BR2 B;  3M85 D;  5C0X D;  2JE6 A;  3CDJ A;  1OYR A;  4OO1 B;  1OYP A;  5JEA F;  2C39 B;  5C0X F;  4AIM A;  2PO0 B;  3CDI A;  4IFD C;  3L7Z B;  4BA1 A;  2PO2 A;  4OO1 A;  2NN6 A;  1UDQ A;  5K36 A;  3U1K A;  3DD6 A;  3M85 G;  4AM3 A;  2NN6 F;  4OO1 E;  2NN6 E;  1E3H A;  5K36 F;  2BA1 D;  3M7N D;  2PO1 B;  5K36 E;  2JEB B;  3GME A;  3HKM A;  3H1C A;  4IFD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...