2BA0G

Archaeal exosome core
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
255
structure length
255
Chain Sequence
EDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPYPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal exosome RNA binding protein RRP4
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 72
structure length 255
sequence length 255
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2ba0G01
2WNRA 4AIDA 3HKMA 2WP8A 2NN6D 4IFDF 4BA2A 1UDSA 4IFDA 2C39A 2PO1A 5K36E 2JEBA 1R6MA 3B4TA 1OYPA 5JEAE 3M85G 3DD6A 2NN6E 4IFDD 3CDIA 4OO1C 1OYRA 4BA1B 2PNZA 2BA0D 3KRNA 5C0XB 3GLLA 2C37B 4IFDE 5K36B 5C0XC 2PO2B 4AM3A 4OO1B 1UDQA 5JEAB 2PO0B 5K36C 2BR2B 5C0XF 2BA1D 5JEAC 1E3PA 2BA0G 2C37A 5K36F 2NN6C 2JEAB 4OO1F 1R6LA 1UDOA 2WNRB 2PO2A 4OO1A 1E3HA 4NBQA 2BR2A 5C0XD 4BA2B 3CDJA 1UDNA 3U1KA 2C39B 5K36D 3L7ZB 2PO1B 3M7ND 4OO1D 2JEBB 3GMEA 4IFDC 4BA1A 5JEAD 2C38B 3M85D 2NN6B 5C0XA 2JE6B 3H1CA 5K36A 5C0XE 5JEAF 2WP8B 3L7ZA 3GCMA 5JEAA 2NN6F 2PO0A 3M7NG 2C38A 2NN6A 4OO1E 4AIMA 2PNZB 4IFDB 2BA1G 2JE6A 2JEAA 1OYSA
chains in the Genus database with same CATH superfamily
5L3JA 2CZ9A 1XHKA 3PS1A 1H73A 2NN6D 4EMDA 3JAMQ 4U3DA 4DUYI 4FW7A 4R1FA 4RPFA 4IFDA 1I94E 1HNWI 4P52A 4MQYA 4IZKA 1HNXI 2PO1A 3GONA 4WUCA 2UUBI 3LNUA 3CWVA 3ZZUA 2E1RA 4DU7A 5JEAE 4B3ME 3T1YE 3CDIA 4KHPI 5FLXC 1KVKA 4DV3E 1OYRA 1ZM3A 4ZVIA 4DR6E 5DRPA 4DV6E 3J81C 1XXEA 4X64E 4DPXA 2F1DA 5IT9Q 1Y5YA 5C0XB 4FWGA 5IWAE 4JI7E 4YY3E 1N33I 1USUA 4JI8I 2VQEI 4JI6E 5C0XC 4LF7I 3J7AG 1XMOI 2UU9E 1H7UA 2GO3A 3T1HE 2BA1D 1K47A 1J5EE 4JV5I 5K36F 4DV1E 2JEAB 2DEIA 5LMUI 4NXME 2ZM6E 4WUDA 4LF6E 2OI2A 4JI3E 1WUUA 4LPFA 1H72C 4DR7E 3HULA 4JI5I 2V2QA 1MX0A 3CDJA 1XMQE 2PNLA 3QT5A 3ZZ0A 4Z7YA 1IBLE 1N34I 2UXDI 2JEBB 2O1UA 4DV4E 5JEAD 3M85D 4DV0I 3QT8A 2ZITA 4FN5A 1B63A 4LF8E 1HNZE 2HKJA 1PVGA 4IS9A 4MYUA 3Q1QA 4J3DA 4DR5I 4DR1I 4AQYI 1HR0E 3P76A 4HACB 5JEAA 3P06A 4M1KA 3OTOE 1N0VC 2PNZB 4X65E 3J80C 4JI0I 4OX9E 4X66I 4DV5I 4GKKI 1FI4A 1OJ4A 2BV3A 5LMNI 4GKJE 1OYSA 1Z0EA 1Z0BA 4HYMA 4K0KI 4JI4E 3D4JA 4BA2A 1ZM2A 1N36E 3ZM7A 1Y4UA 4JYAI 2Q2EB 4DV2E 2PNMA 3J80Q 2GS8A 1H7SA 3B4TA 1KIJA 4U3BA 1OYPA 3DD6A 4IFDD 2LJPA 2CG9A 4OO1C 4DUYE 1KTVA 1HNWE 2UXBI 4QNKA 1MG7A 1FNMA 1HNXE 4WUBA 1NHJA 1VI7A 5LL6R 2GO4A 3P3CA 4N3OA 2UUBE 3KRNA 2XEXA 3GLLA 1QZRA 2C37B 3K1JA 4MU3A 3B82A 2J7KA 5K36B 4KHPE 4B3TI 4AM3A 1Z0TA 3B78A 4FW3A 2PO0B 4JI2I 5K36C 4LFCE 4IZJB 2UUCI 1A6FA 1E3PA 1XNQI 2C37A 2HK3A 2NN6C 3LPSA 2Z5EA 4MYTA 4B3RE 4OO1F 4LF9I 2WNRB 3Q6MA 4YHHI 1N33E 4JI8E 3HJCA 2VQEE 2Z5BB 2V2VA 4LF7E 4NBQA 4DR2I 1XMOE 4JG4A 4IZJA 4USKA 4PRVA 5C0XD 1UDNA 1P42A 2C39B 1VISA 4DPUA 1KKHA 4X62I 4DUZI 1Z5AA 2AE8A 3L7ZB 5A2QC 2X36A 3ZZTA 4JV5E 2C38B 1D6TA 5FLXQ 1PKPA 4MU0A 5LMUE 5C0XA 2UUAE 1BKNA 5FWKA 3J81Q 1RR9A 1N32I 4JI1I 2UXCE 2WP8B 3L7ZA 1USVA 4DV6I 1Z5CA 4DV7I 2NN6F 4X64I 2C38A 1N34E 1Y60A 2UXDE 4OO1E 4B3SI 1ZXNA 5EL9A 2HHHI 2HFUA 4YY3I 2BA1G 2VQFI 5EKWA 4I3HA 2JEAA 2NPFA 2VF3A 3ZKDA 4DPYA 3HKMA 4KQVA 2WP8A 4DR5E 4DR1E 4AQYE 4DR3I 4LF5E 2CVEA 2CGEA 1UDSA 4FW4A 4DV1I 4JI0E 2F4VI 3U1YA 4GKKE 1Z0GA 2JEBA 2E5LI 5K36E 1PIEA 4NXNI 2VESA 3PYFA 2HK2A 3WU3A 1FWKA 4LFBE 3M85G 1ZXMA 1XNRE 1XMQI 2NN6E 3V2UC 4DR4I 2BM1A 3K17A 1S4EA 3WU4A 1IBLI 1IBKI 1HK7A 4LCGA 4MU1A 4HACA 4JYAE 3WU5A 1ELOA 2IOQA 4BA1B 1Z59A 2PNZA 1YH8A 1FKAE 2BA0D 2O1VA 3UHMA 1FWLA 1ZM4A 4DPWA 3P3EA 2JT2A 5BR8I 4UT4A 2PO2B 4LOMA 3P3GA 2V34A 4OO1B 1IBMI 4OX9I 2UXBE 2AJ4A 3B8HA 2ZBKB 3QT6A 2BA0G 4GKJI 4LCFA 3JAMC 3NZKA 1RREA 4Z7CA 4QNJA 2PO2A 4XTJA 4OO1A 4B3TE 4JI4I 5DRQA 4LFAI 1NZ0A 1NHIA 3QT7A 1N0UA 3U1KA 4ISAA 4LF4I 2X7IA 3LTOA 5GMDA 1FJGI 5DNXA 1S16A 1Y4SA 4PRXA 4UTGA 5K36D 3PYDA 4OZEA 1YHCA 1XNQE 2PO1B 4PU9A 3M7ND 4USMA 1H74A 4IFDC 4URLA 2NN6B 1B62A 4LF9E 4IZJD 4YHHE 4OKGA 2Z5CB 5DROA 2JE6B 3H1CA 4DR2E 5K36A 5IT9C 2IOPA 3WU6A 2PO0A 4X62E 4DUZE 3M7NG 2O1TA 2NN6A 1I94I 4AIMA 1Z0VA 1MU5A 3K85A 2IERA 3Q6NA 2Z5CA 2BM0A 2JE6A 4P7AA 3PS3A 2WNRA 4AIDA 1N32E 4JI1E 1Z5BA 1UEKA 4B3MI 2WW4A 2Z5BA 4LFCI 3T1YI 4DXLA 4DV7E 4IFDF 4DV3I 4JI5E 4B3SE 2C39A 4ED4A 2EFGA 2HHHE 4B3RI 4DR6I 2VQFE 2A2DA 1R6MA 1ZM9A 4LCHA 4DV0E 5A2QQ 5IWAI 4JI7I 4DR3E 4JI6I 1Z0CA 2HKEA 2UU9I 1NHHA 5GMEA 2F4VE 3J7AM 3T1HI 2J65A 4FW6A 2E5LE 4FW5A 1J5EI 2A2CA 2IESA 2UUAI 4NXNE 2UXCI 3V5RA 4X66E 4DV5E 4IFDE 3PYEA 4DR4E 4NXMI 2ZM6I 5LMNE 4LF6I 4JI3I 1IBKE 4DR7I 3PRYA 1UDQA 3PYGA 5JEAB 2BR2B 3ZKBA 5DRRA 4HY1A 5C0XF 4K0KE 5JEAC 3H4LA 4DV4I 2HFSA 1R6LA 1UDOA 4GQUA 4FWHA 1RHYA 4MU4A 4LF5I 2R42A 1E3HA 4LF8I 1HNZI 5BR8E 2BR2A 1EA6A 1IBME 1Z0WA 2GQ0A 4BA2B 2O3ZA 1HR0I 3OTOI 4FWDA 4MDTA 3F0NA 4OO1D 4X65I 3GMEA 4LFBI 4BA1A 2DEJA 4DU8A 4FW9A 1XNRI 1U2RA 2V2ZA 5DNLA 3M6AA 4LFAE 2R3VA 1DARA 5C0XE 5ELWA 1Y6ZA 4LF4E 5JEAF 3GCMA 1FJGE 2O1WA 1N36I 4DPTA 1EI1A 3PS2A 4JI2E 4IFDB 2UUCE 4DV2I 4IZKB 2V8PA 4HXZA
chains in the Genus database with same CATH topology
2WNRA 4AIDA 3HKMA 2WP8A 2NN6D 4IFDF 4BA2A 1UDSA 4IFDA 2C39A 2PO1A 5K36E 2JEBA 1R6MA 3B4TA 1OYPA 5JEAE 3M85G 3DD6A 2NN6E 4IFDD 3CDIA 4OO1C 1OYRA 4BA1B 2PNZA 2BA0D 3KRNA 5C0XB 3GLLA 2C37B 4IFDE 5K36B 5C0XC 2PO2B 4AM3A 4OO1B 1UDQA 5JEAB 2PO0B 5K36C 2BR2B 5C0XF 2BA1D 5JEAC 1E3PA 2BA0G 2C37A 5K36F 2NN6C 2JEAB 4OO1F 1R6LA 1UDOA 2WNRB 2PO2A 4OO1A 1E3HA 4NBQA 2BR2A 5C0XD 4BA2B 3CDJA 1UDNA 3U1KA 2C39B 5K36D 3L7ZB 2PO1B 3M7ND 4OO1D 2JEBB 3GMEA 4IFDC 4BA1A 5JEAD 2C38B 3M85D 2NN6B 5C0XA 2JE6B 3H1CA 5K36A 5C0XE 5JEAF 2WP8B 3L7ZA 3GCMA 5JEAA 2NN6F 2PO0A 3M7NG 2C38A 2NN6A 4OO1E 4AIMA 2PNZB 4IFDB 2BA1G 2JE6A 2JEAA 1OYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNR A;  4AID A;  3HKM A;  2WP8 A;  2NN6 D;  4IFD F;  4BA2 A;  1UDS A;  4IFD A;  2C39 A;  2PO1 A;  5K36 E;  2JEB A;  1R6M A;  3B4T A;  1OYP A;  5JEA E;  3M85 G;  3DD6 A;  2NN6 E;  4IFD D;  3CDI A;  4OO1 C;  1OYR A;  4BA1 B;  2PNZ A;  2BA0 D;  3KRN A;  5C0X B;  3GLL A;  2C37 B;  4IFD E;  5K36 B;  5C0X C;  2PO2 B;  4AM3 A;  4OO1 B;  1UDQ A;  5JEA B;  2PO0 B;  5K36 C;  2BR2 B;  5C0X F;  2BA1 D;  5JEA C;  1E3P A;  2BA0 G;  2C37 A;  5K36 F;  2NN6 C;  2JEA B;  4OO1 F;  1R6L A;  1UDO A;  2WNR B;  2PO2 A;  4OO1 A;  1E3H A;  4NBQ A;  2BR2 A;  5C0X D;  4BA2 B;  3CDJ A;  1UDN A;  3U1K A;  2C39 B;  5K36 D;  3L7Z B;  2PO1 B;  3M7N D;  4OO1 D;  2JEB B;  3GME A;  4IFD C;  4BA1 A;  5JEA D;  2C38 B;  3M85 D;  2NN6 B;  5C0X A;  2JE6 B;  3H1C A;  5K36 A;  5C0X E;  5JEA F;  2WP8 B;  3L7Z A;  3GCM A;  5JEA A;  2NN6 F;  2PO0 A;  3M7N G;  2C38 A;  2NN6 A;  4OO1 E;  4AIM A;  2PNZ B;  4IFD B;  2BA1 G;  2JE6 A;  2JEA A;  1OYS A; 
#chains in the Genus database with same CATH topology
 5L3J A;  2CZ9 A;  1XHK A;  3PS1 A;  1H73 A;  2NN6 D;  4EMD A;  3JAM Q;  4U3D A;  4DUY I;  4FW7 A;  4R1F A;  4RPF A;  4IFD A;  1I94 E;  1HNW I;  4P52 A;  4MQY A;  4IZK A;  1HNX I;  2PO1 A;  3GON A;  4WUC A;  2UUB I;  3LNU A;  3CWV A;  3ZZU A;  2E1R A;  4DU7 A;  5JEA E;  4B3M E;  3T1Y E;  3CDI A;  4KHP I;  5FLX C;  1KVK A;  4DV3 E;  1OYR A;  1ZM3 A;  4ZVI A;  4DR6 E;  5DRP A;  4DV6 E;  3J81 C;  1XXE A;  4X64 E;  4DPX A;  2F1D A;  5IT9 Q;  1Y5Y A;  5C0X B;  4FWG A;  5IWA E;  4JI7 E;  4YY3 E;  1N33 I;  1USU A;  4JI8 I;  2VQE I;  4JI6 E;  5C0X C;  4LF7 I;  3J7A G;  1XMO I;  2UU9 E;  1H7U A;  2GO3 A;  3T1H E;  2BA1 D;  1K47 A;  1J5E E;  4JV5 I;  5K36 F;  4DV1 E;  2JEA B;  2DEI A;  5LMU I;  4NXM E;  2ZM6 E;  4WUD A;  4LF6 E;  2OI2 A;  4JI3 E;  1WUU A;  4LPF A;  1H72 C;  4DR7 E;  3HUL A;  4JI5 I;  2V2Q A;  1MX0 A;  3CDJ A;  1XMQ E;  2PNL A;  3QT5 A;  3ZZ0 A;  4Z7Y A;  1IBL E;  1N34 I;  2UXD I;  2JEB B;  2O1U A;  4DV4 E;  5JEA D;  3M85 D;  4DV0 I;  3QT8 A;  2ZIT A;  4FN5 A;  1B63 A;  4LF8 E;  1HNZ E;  2HKJ A;  1PVG A;  4IS9 A;  4MYU A;  3Q1Q A;  4J3D A;  4DR5 I;  4DR1 I;  4AQY I;  1HR0 E;  3P76 A;  4HAC B;  5JEA A;  3P06 A;  4M1K A;  3OTO E;  1N0V C;  2PNZ B;  4X65 E;  3J80 C;  4JI0 I;  4OX9 E;  4X66 I;  4DV5 I;  4GKK I;  1FI4 A;  1OJ4 A;  2BV3 A;  5LMN I;  4GKJ E;  1OYS A;  1Z0E A;  1Z0B A;  4HYM A;  4K0K I;  4JI4 E;  3D4J A;  4BA2 A;  1ZM2 A;  1N36 E;  3ZM7 A;  1Y4U A;  4JYA I;  2Q2E B;  4DV2 E;  2PNM A;  3J80 Q;  2GS8 A;  1H7S A;  3B4T A;  1KIJ A;  4U3B A;  1OYP A;  3DD6 A;  4IFD D;  2LJP A;  2CG9 A;  4OO1 C;  4DUY E;  1KTV A;  1HNW E;  2UXB I;  4QNK A;  1MG7 A;  1FNM A;  1HNX E;  4WUB A;  1NHJ A;  1VI7 A;  5LL6 R;  2GO4 A;  3P3C A;  4N3O A;  2UUB E;  3KRN A;  2XEX A;  3GLL A;  1QZR A;  2C37 B;  3K1J A;  4MU3 A;  3B82 A;  2J7K A;  5K36 B;  4KHP E;  4B3T I;  4AM3 A;  1Z0T A;  3B78 A;  4FW3 A;  2PO0 B;  4JI2 I;  5K36 C;  4LFC E;  4IZJ B;  2UUC I;  1A6F A;  1E3P A;  1XNQ I;  2C37 A;  2HK3 A;  2NN6 C;  3LPS A;  2Z5E A;  4MYT A;  4B3R E;  4OO1 F;  4LF9 I;  2WNR B;  3Q6M A;  4YHH I;  1N33 E;  4JI8 E;  3HJC A;  2VQE E;  2Z5B B;  2V2V A;  4LF7 E;  4NBQ A;  4DR2 I;  1XMO E;  4JG4 A;  4IZJ A;  4USK A;  4PRV A;  5C0X D;  1UDN A;  1P42 A;  2C39 B;  1VIS A;  4DPU A;  1KKH A;  4X62 I;  4DUZ I;  1Z5A A;  2AE8 A;  3L7Z B;  5A2Q C;  2X36 A;  3ZZT A;  4JV5 E;  2C38 B;  1D6T A;  5FLX Q;  1PKP A;  4MU0 A;  5LMU E;  5C0X A;  2UUA E;  1BKN A;  5FWK A;  3J81 Q;  1RR9 A;  1N32 I;  4JI1 I;  2UXC E;  2WP8 B;  3L7Z A;  1USV A;  4DV6 I;  1Z5C A;  4DV7 I;  2NN6 F;  4X64 I;  2C38 A;  1N34 E;  1Y60 A;  2UXD E;  4OO1 E;  4B3S I;  1ZXN A;  5EL9 A;  2HHH I;  2HFU A;  4YY3 I;  2BA1 G;  2VQF I;  5EKW A;  4I3H A;  2JEA A;  2NPF A;  2VF3 A;  3ZKD A;  4DPY A;  3HKM A;  4KQV A;  2WP8 A;  4DR5 E;  4DR1 E;  4AQY E;  4DR3 I;  4LF5 E;  2CVE A;  2CGE A;  1UDS A;  4FW4 A;  4DV1 I;  4JI0 E;  2F4V I;  3U1Y A;  4GKK E;  1Z0G A;  2JEB A;  2E5L I;  5K36 E;  1PIE A;  4NXN I;  2VES A;  3PYF A;  2HK2 A;  3WU3 A;  1FWK A;  4LFB E;  3M85 G;  1ZXM A;  1XNR E;  1XMQ I;  2NN6 E;  3V2U C;  4DR4 I;  2BM1 A;  3K17 A;  1S4E A;  3WU4 A;  1IBL I;  1IBK I;  1HK7 A;  4LCG A;  4MU1 A;  4HAC A;  4JYA E;  3WU5 A;  1ELO A;  2IOQ A;  4BA1 B;  1Z59 A;  2PNZ A;  1YH8 A;  1FKA E;  2BA0 D;  2O1V A;  3UHM A;  1FWL A;  1ZM4 A;  4DPW A;  3P3E A;  2JT2 A;  5BR8 I;  4UT4 A;  2PO2 B;  4LOM A;  3P3G A;  2V34 A;  4OO1 B;  1IBM I;  4OX9 I;  2UXB E;  2AJ4 A;  3B8H A;  2ZBK B;  3QT6 A;  2BA0 G;  4GKJ I;  4LCF A;  3JAM C;  3NZK A;  1RRE A;  4Z7C A;  4QNJ A;  2PO2 A;  4XTJ A;  4OO1 A;  4B3T E;  4JI4 I;  5DRQ A;  4LFA I;  1NZ0 A;  1NHI A;  3QT7 A;  1N0U A;  3U1K A;  4ISA A;  4LF4 I;  2X7I A;  3LTO A;  5GMD A;  1FJG I;  5DNX A;  1S16 A;  1Y4S A;  4PRX A;  4UTG A;  5K36 D;  3PYD A;  4OZE A;  1YHC A;  1XNQ E;  2PO1 B;  4PU9 A;  3M7N D;  4USM A;  1H74 A;  4IFD C;  4URL A;  2NN6 B;  1B62 A;  4LF9 E;  4IZJ D;  4YHH E;  4OKG A;  2Z5C B;  5DRO A;  2JE6 B;  3H1C A;  4DR2 E;  5K36 A;  5IT9 C;  2IOP A;  3WU6 A;  2PO0 A;  4X62 E;  4DUZ E;  3M7N G;  2O1T A;  2NN6 A;  1I94 I;  4AIM A;  1Z0V A;  1MU5 A;  3K85 A;  2IER A;  3Q6N A;  2Z5C A;  2BM0 A;  2JE6 A;  4P7A A;  3PS3 A;  2WNR A;  4AID A;  1N32 E;  4JI1 E;  1Z5B A;  1UEK A;  4B3M I;  2WW4 A;  2Z5B A;  4LFC I;  3T1Y I;  4DXL A;  4DV7 E;  4IFD F;  4DV3 I;  4JI5 E;  4B3S E;  2C39 A;  4ED4 A;  2EFG A;  2HHH E;  4B3R I;  4DR6 I;  2VQF E;  2A2D A;  1R6M A;  1ZM9 A;  4LCH A;  4DV0 E;  5A2Q Q;  5IWA I;  4JI7 I;  4DR3 E;  4JI6 I;  1Z0C A;  2HKE A;  2UU9 I;  1NHH A;  5GME A;  2F4V E;  3J7A M;  3T1H I;  2J65 A;  4FW6 A;  2E5L E;  4FW5 A;  1J5E I;  2A2C A;  2IES A;  2UUA I;  4NXN E;  2UXC I;  3V5R A;  4X66 E;  4DV5 E;  4IFD E;  3PYE A;  4DR4 E;  4NXM I;  2ZM6 I;  5LMN E;  4LF6 I;  4JI3 I;  1IBK E;  4DR7 I;  3PRY A;  1UDQ A;  3PYG A;  5JEA B;  2BR2 B;  3ZKB A;  5DRR A;  4HY1 A;  5C0X F;  4K0K E;  5JEA C;  3H4L A;  4DV4 I;  2HFS A;  1R6L A;  1UDO A;  4GQU A;  4FWH A;  1RHY A;  4MU4 A;  4LF5 I;  2R42 A;  1E3H A;  4LF8 I;  1HNZ I;  5BR8 E;  2BR2 A;  1EA6 A;  1IBM E;  1Z0W A;  2GQ0 A;  4BA2 B;  2O3Z A;  1HR0 I;  3OTO I;  4FWD A;  4MDT A;  3F0N A;  4OO1 D;  4X65 I;  3GME A;  4LFB I;  4BA1 A;  2DEJ A;  4DU8 A;  4FW9 A;  1XNR I;  1U2R A;  2V2Z A;  5DNL A;  3M6A A;  4LFA E;  2R3V A;  1DAR A;  5C0X E;  5ELW A;  1Y6Z A;  4LF4 E;  5JEA F;  3GCM A;  1FJG E;  2O1W A;  1N36 I;  4DPT A;  1EI1 A;  3PS2 A;  4JI2 E;  4IFD B;  2UUC E;  4DV2 I;  4IZK B;  2V8P A;  4HXZ A; 
#chains in the Genus database with same CATH homology
 2WNR A;  4AID A;  3HKM A;  2WP8 A;  2NN6 D;  4IFD F;  4BA2 A;  1UDS A;  4IFD A;  2C39 A;  2PO1 A;  5K36 E;  2JEB A;  1R6M A;  3B4T A;  1OYP A;  5JEA E;  3M85 G;  3DD6 A;  2NN6 E;  4IFD D;  3CDI A;  4OO1 C;  1OYR A;  4BA1 B;  2PNZ A;  2BA0 D;  3KRN A;  5C0X B;  3GLL A;  2C37 B;  4IFD E;  5K36 B;  5C0X C;  2PO2 B;  4AM3 A;  4OO1 B;  1UDQ A;  5JEA B;  2PO0 B;  5K36 C;  2BR2 B;  5C0X F;  2BA1 D;  5JEA C;  1E3P A;  2BA0 G;  2C37 A;  5K36 F;  2NN6 C;  2JEA B;  4OO1 F;  1R6L A;  1UDO A;  2WNR B;  2PO2 A;  4OO1 A;  1E3H A;  4NBQ A;  2BR2 A;  5C0X D;  4BA2 B;  3CDJ A;  1UDN A;  3U1K A;  2C39 B;  5K36 D;  3L7Z B;  2PO1 B;  3M7N D;  4OO1 D;  2JEB B;  3GME A;  4IFD C;  4BA1 A;  5JEA D;  2C38 B;  3M85 D;  2NN6 B;  5C0X A;  2JE6 B;  3H1C A;  5K36 A;  5C0X E;  5JEA F;  2WP8 B;  3L7Z A;  3GCM A;  5JEA A;  2NN6 F;  2PO0 A;  3M7N G;  2C38 A;  2NN6 A;  4OO1 E;  4AIM A;  2PNZ B;  4IFD B;  2BA1 G;  2JE6 A;  2JEA A;  1OYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...