2BA0G

Archaeal exosome core
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
255
structure length
255
Chain Sequence
EDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPYPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal exosome RNA binding protein RRP4
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 72
structure length 255
sequence length 255
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2ba0G01
1OYRA 4IFDF 2PO0A 2C39A 3KRNA 2JEBB 2NN6B 3CDIA 1OYPA 2PO2A 2NN6F 1OYSA 4OO1E 2C38B 2JEAA 2PO1B 3U1KA 5C0XD 4AM3A 5JEAE 1UDSA 4AIMA 3GCMA 2BA1G 2C39B 2BR2B 2BA0D 5K36A 4OO1B 3H1CA 1UDOA 4BA1B 2NN6D 5JEAB 4NBQA 2PNZA 2JE6B 4OO1F 5JEAC 5K36E 2NN6C 4BA2B 3M85D 5JEAF 1R6LA 3L7ZA 1R6MA 2C37A 1UDNA 5C0XA 5K36B 4IFDA 2WP8A 2WNRA 2PO0B 4OO1D 2BA0G 5K36F 5JEAD 2PO2B 4OO1C 2JEBA 2JEAB 3M85G 3HKMA 2C38A 1E3HA 5K36D 1E3PA 5K36C 1UDQA 2BR2A 5C0XE 2PNZB 4OO1A 3CDJA 4BA1A 4IFDE 5JEAA 2NN6A 3DD6A 3L7ZB 4AIDA 2C37B 2JE6A 3M7ND 3M7NG 4BA2A 3GMEA 3B4TA 2NN6E 5C0XB 4IFDD 2PO1A 4IFDB 2WP8B 5C0XC 2WNRB 2BA1D 4IFDC 3GLLA 5C0XF
chains in the Genus database with same CATH superfamily
1J5EI 4JYAE 3J81Q 4DR2I 2F4VI 1OYRA 4DV3E 2PO0A 4IFDF 1N36E 2VQEE 2AJ4A 2UXBE 3KRNA 2Z5CA 4MU4A 4ZVIA 3CDIA 5DRPA 4M1KA 1H7UA 2VQFE 1OYSA 5GMEA 4DV0E 3PYFA 4FWHA 1IBME 4DR4I 4QNJA 5DRQA 1Z0EA 4EMDA 1ZM4A 4AM3A 4LF7E 4ISAA 2A2DA 4KQVA 4R1FA 2BA1G 2C39B 4DV1I 4DV4I 2GO4A 4BA1B 2UXCE 4DUZE 4JG4A 3P76A 2DEJA 1ELOA 4FW7A 3PYGA 2HK3A 3V2UC 1R6MA 2X36A 3ZZUA 4HACA 1FJGI 3J7AM 4DV5I 1USUA 5K36B 1HNZI 2PO0B 4DR5E 2O3ZA 2E5LI 2UU9I 2Z5CB 4B3MI 1PVGA 1FI4A 4Z7YA 1WUUA 4MDTA 4YHHI 4K0KI 4OO1C 1IBLI 4FW4A 2GQ0A 3D4JA 3CWVA 1OJ4A 1HR0E 4MU1A 3HKMA 2C38A 1N32I 1XMQE 1I94E 4LF6E 2AE8A 5K36D 1ZM3A 2UUCE 3ZKDA 3PS3A 4DR3E 4LFCE 4JV5E 2R42A 4JI0E 4OO1A 4AQYI 2HKEA 4RPFA 5A2QC 5JEAA 3DD6A 4AIDA 1B63A 3M7NG 4DV3I 2VQEI 3GMEA 4LF5E 2UXBI 4HACB 3B4TA 4IFDD 4JI2E 1KVKA 1KKHA 4JI4I 3GLLA 2VQFI 4USKA 3LNUA 1ZXMA 1Y4SA 4DV0I 1HNXE 5L3JA 3V5RA 2C39A 4HY1A 4KHPE 4LF7I 2GO3A 1OYPA 2IOQA 4LFAI 3QT5A 4LF8E 1PIEA 2NN6F 2VESA 3T1YE 2UUBE 4N3OA 2C38B 4XTJA 2PO1B 2UXCI 3U1KA 4DUZI 1MX0A 3T1HE 5EL9A 1FNMA 2UUAE 4GKKE 4MU3A 2O1WA 5LL6R 4IZJA 2BA0D 2E1RA 5K36A 4OO1B 4JI5E 1UDOA 4OX9E 5BR8E 4X64E 1YH8A 2BV3A 4DV7I 5JEAB 1N0UA 1Z5BA 1ZXNA 4QNKA 5K36E 4DR5I 2Z5EA 1H73A 4FWGA 3M85D 1R6LA 3L7ZA 2PNMA 4DR7E 1VI7A 5IT9C 1H74A 1NHHA 1UDNA 4DPXA 5C0XA 2OI2A 1DARA 4FW3A 1H7SA 2IOPA 4IFDA 1Z0CA 4JI8E 4IS9A 1HR0I 4USMA 4OO1D 4LCGA 3P3EA 3J80C 4LCHA 5JEAD 1XMQI 1I94I 4DR6E 4LF6I 1B62A 2UUCI 1NHJA 2V2QA 1XHKA 4DR3I 4LFCI 2HFSA 3H4LA 4JI0I 3B82A 4MQYA 1E3HA 4DR1E 4MYTA 4DPTA 4IZJB 4JI6E 4JI3E 2HKJA 1UDQA 3LTOA 2GS8A 4MYUA 3P3CA 3K85A 4JI2I 1D6TA 3QT8A 3GONA 1YHCA 1S4EA 1FWKA 4PRVA 1KTVA 1XMOI 3L7ZB 4X66E 4B3RE 4HXZA 1HNXI 4DR2E 1S16A 4BA2A 4ED4A 3HJCA 4KHPI 4P7AA 5C0XB 3J80Q 5LMUE 2ZM6I 2PO1A 4J3DA 4IFDB 3P3GA 4LF8I 3WU6A 1QZRA 3JAMC 2V34A 2BA1D 4IZJD 3T1YI 4U3BA 4JI7E 4B3SE 2CG9A 4B3TE 1XNQE 3HULA 3QT6A 4DPYA 5EKWA 2UUAI 1KIJA 2NPFA 4GKKI 1K47A 5DNXA 3OTOE 4JYAI 4Z7CA 4JI5I 4OO1E 4OX9I 1A6FA 1N36I 2JEAA 2JT2A 4X64I 5C0XD 5DNLA 5JEAE 3PRYA 1VISA 4WUDA 3WU4A 1U2RA 4FN5A 3ZZTA 1H72C 4HYMA 3WU3A 4DR7I 1Z0VA 4X62E 1IBMI 2WW4A 4LCFA 1XXEA 3PS2A 4PRXA 4NBQA 2NN6C 4JI8I 3JAMQ 4DUYE 4BA2B 2HHHE 2C37A 4B3ME 4GKJE 3LPSA 3M6AA 2ZBKB 4YHHE 2V2ZA 3K17A 4DR6I 4NXNE 1HNWE 1XNRE 4IZKA 3Q1QA 1IBKE 5A2QQ 1EI1A 1N33E 1MU5A 1Y5YA 2X7IA 4URLA 1MG7A 2CGEA 4DR1I 2IERA 5K36F 4YY3E 4X65E 1Z0GA 1N32E 4FW5A 2JEBA 2LJPA 4OKGA 2BM1A 1ZM9A 5DROA 2V2VA 4JI6I 3ZZ0A 2JEAB 4JI3I 1N34E 1PKPA 4AQYE 4WUCA 2J7KA 4U3DA 4DV2E 4B3RI 4X66I 5LMNE 4DV6E 3P06A 1USVA 4UTGA 4JI1E 1NZ0A 1E3PA 3NZKA 3F0NA 4DPWA 3U1YA 2UXDE 2BR2A 2Z5BA 5C0XE 4LF9E 5LMUI 1Z5AA 5FWKA 5IWAE 4IFDE 4JI4E 4LFBE 2F1DA 2C37B 2JE6A 4JI7I 4B3SI 4NXME 3J7AG 4B3TI 5DRRA 1XNQI 4JV5I 1EA6A 2PNLA 4IZKB 4LFAE 1NHIA 2DEIA 1UEKA 3OTOI 3B78A 3WU5A 1N0VC 4DXLA 4LF5I 4LOMA 3QT7A 2JEBB 2NN6B 2VF3A 3PYDA 5IT9Q 1Z0BA 2IESA 2PO2A 2Q2EB 4MU0A 4DPUA 4LF4E 2V8PA 4LPFA 4DU7A 4X62I 1J5EE 2F4VE 5ELWA 2ZITA 4DV7E 1UDSA 3Q6MA 4DUYI 4AIMA 2HHHI 3GCMA 2UUBI 2BR2B 2Z5BB 4GKJI 3H1CA 4DR4E 2NN6D 3T1HI 4NXNI 4DU8A 2O1VA 1XNRI 1HNWI 4FW6A 2PNZA 2JE6B 1IBKI 5JEAC 4OO1F 1N33I 1Y6ZA 5FLXC 5JEAF 4DV1E 3B8HA 2A2CA 1ZM2A 2CVEA 5BR8I 4YY3I 4DV4E 3K1JA 4UT4A 4X65I 2R3VA 3ZKBA 4P52A 1RR9A 2HK2A 2O1UA 3Q6NA 2WP8A 2WNRA 1HK7A 1N34I 2BA0G 4FW9A 4DV2I 2PO2B 1FJGE 2HFUA 5LMNI 1Z5CA 3ZM7A 4DV6I 4DV5E 2J65A 2XEXA 4JI1I 3J81C 1HNZE 4FWDA 2EFGA 2BM0A 1BKNA 2UU9E 1Z0WA 3M85G 2E5LE 2UXDI 1FWLA 4LF9I 5IWAI 1RHYA 1Z59A 2CZ9A 4K0KE 1Z0TA 4LFBI 1XMOE 1IBLE 1P42A 4NXMI 5FLXQ 5K36C 4PU9A 5GMDA 3UHMA 2PNZB 3CDJA 4BA1A 2ZM6E 4WUBA 1FKAE 3PYEA 2NN6A 3M7ND 3PS1A 4I3HA 4GQUA 1Y60A 2O1TA 1RREA 2NN6E 4OZEA 2WP8B 5C0XC 4LF4I 2WNRB 1Y4UA 4IFDC 5C0XF
chains in the Genus database with same CATH topology
1OYRA 4IFDF 2PO0A 2C39A 3KRNA 2JEBB 2NN6B 3CDIA 1OYPA 2PO2A 2NN6F 1OYSA 4OO1E 2C38B 2JEAA 2PO1B 3U1KA 5C0XD 4AM3A 5JEAE 1UDSA 4AIMA 3GCMA 2BA1G 2C39B 2BR2B 2BA0D 5K36A 4OO1B 3H1CA 1UDOA 4BA1B 2NN6D 5JEAB 4NBQA 2PNZA 2JE6B 4OO1F 5JEAC 5K36E 2NN6C 4BA2B 3M85D 5JEAF 1R6LA 3L7ZA 1R6MA 2C37A 1UDNA 5C0XA 5K36B 4IFDA 2WP8A 2WNRA 2PO0B 4OO1D 2BA0G 5K36F 5JEAD 2PO2B 4OO1C 2JEBA 2JEAB 3M85G 3HKMA 2C38A 1E3HA 5K36D 1E3PA 5K36C 1UDQA 2BR2A 5C0XE 2PNZB 4OO1A 3CDJA 4BA1A 4IFDE 5JEAA 2NN6A 3DD6A 3L7ZB 4AIDA 2C37B 2JE6A 3M7ND 3M7NG 4BA2A 3GMEA 3B4TA 2NN6E 5C0XB 4IFDD 2PO1A 4IFDB 2WP8B 5C0XC 2WNRB 2BA1D 4IFDC 3GLLA 5C0XF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYR A;  4IFD F;  2PO0 A;  2C39 A;  3KRN A;  2JEB B;  2NN6 B;  3CDI A;  1OYP A;  2PO2 A;  2NN6 F;  1OYS A;  4OO1 E;  2C38 B;  2JEA A;  2PO1 B;  3U1K A;  5C0X D;  4AM3 A;  5JEA E;  1UDS A;  4AIM A;  3GCM A;  2BA1 G;  2C39 B;  2BR2 B;  2BA0 D;  5K36 A;  4OO1 B;  3H1C A;  1UDO A;  4BA1 B;  2NN6 D;  5JEA B;  4NBQ A;  2PNZ A;  2JE6 B;  4OO1 F;  5JEA C;  5K36 E;  2NN6 C;  4BA2 B;  3M85 D;  5JEA F;  1R6L A;  3L7Z A;  1R6M A;  2C37 A;  1UDN A;  5C0X A;  5K36 B;  4IFD A;  2WP8 A;  2WNR A;  2PO0 B;  4OO1 D;  2BA0 G;  5K36 F;  5JEA D;  2PO2 B;  4OO1 C;  2JEB A;  2JEA B;  3M85 G;  3HKM A;  2C38 A;  1E3H A;  5K36 D;  1E3P A;  5K36 C;  1UDQ A;  2BR2 A;  5C0X E;  2PNZ B;  4OO1 A;  3CDJ A;  4BA1 A;  4IFD E;  5JEA A;  2NN6 A;  3DD6 A;  3L7Z B;  4AID A;  2C37 B;  2JE6 A;  3M7N D;  3M7N G;  4BA2 A;  3GME A;  3B4T A;  2NN6 E;  5C0X B;  4IFD D;  2PO1 A;  4IFD B;  2WP8 B;  5C0X C;  2WNR B;  2BA1 D;  4IFD C;  3GLL A;  5C0X F; 
#chains in the Genus database with same CATH topology
 1J5E I;  4JYA E;  3J81 Q;  4DR2 I;  2F4V I;  1OYR A;  4DV3 E;  2PO0 A;  4IFD F;  1N36 E;  2VQE E;  2AJ4 A;  2UXB E;  3KRN A;  2Z5C A;  4MU4 A;  4ZVI A;  3CDI A;  5DRP A;  4M1K A;  1H7U A;  2VQF E;  1OYS A;  5GME A;  4DV0 E;  3PYF A;  4FWH A;  1IBM E;  4DR4 I;  4QNJ A;  5DRQ A;  1Z0E A;  4EMD A;  1ZM4 A;  4AM3 A;  4LF7 E;  4ISA A;  2A2D A;  4KQV A;  4R1F A;  2BA1 G;  2C39 B;  4DV1 I;  4DV4 I;  2GO4 A;  4BA1 B;  2UXC E;  4DUZ E;  4JG4 A;  3P76 A;  2DEJ A;  1ELO A;  4FW7 A;  3PYG A;  2HK3 A;  3V2U C;  1R6M A;  2X36 A;  3ZZU A;  4HAC A;  1FJG I;  3J7A M;  4DV5 I;  1USU A;  5K36 B;  1HNZ I;  2PO0 B;  4DR5 E;  2O3Z A;  2E5L I;  2UU9 I;  2Z5C B;  4B3M I;  1PVG A;  1FI4 A;  4Z7Y A;  1WUU A;  4MDT A;  4YHH I;  4K0K I;  4OO1 C;  1IBL I;  4FW4 A;  2GQ0 A;  3D4J A;  3CWV A;  1OJ4 A;  1HR0 E;  4MU1 A;  3HKM A;  2C38 A;  1N32 I;  1XMQ E;  1I94 E;  4LF6 E;  2AE8 A;  5K36 D;  1ZM3 A;  2UUC E;  3ZKD A;  3PS3 A;  4DR3 E;  4LFC E;  4JV5 E;  2R42 A;  4JI0 E;  4OO1 A;  4AQY I;  2HKE A;  4RPF A;  5A2Q C;  5JEA A;  3DD6 A;  4AID A;  1B63 A;  3M7N G;  4DV3 I;  2VQE I;  3GME A;  4LF5 E;  2UXB I;  4HAC B;  3B4T A;  4IFD D;  4JI2 E;  1KVK A;  1KKH A;  4JI4 I;  3GLL A;  2VQF I;  4USK A;  3LNU A;  1ZXM A;  1Y4S A;  4DV0 I;  1HNX E;  5L3J A;  3V5R A;  2C39 A;  4HY1 A;  4KHP E;  4LF7 I;  2GO3 A;  1OYP A;  2IOQ A;  4LFA I;  3QT5 A;  4LF8 E;  1PIE A;  2NN6 F;  2VES A;  3T1Y E;  2UUB E;  4N3O A;  2C38 B;  4XTJ A;  2PO1 B;  2UXC I;  3U1K A;  4DUZ I;  1MX0 A;  3T1H E;  5EL9 A;  1FNM A;  2UUA E;  4GKK E;  4MU3 A;  2O1W A;  5LL6 R;  4IZJ A;  2BA0 D;  2E1R A;  5K36 A;  4OO1 B;  4JI5 E;  1UDO A;  4OX9 E;  5BR8 E;  4X64 E;  1YH8 A;  2BV3 A;  4DV7 I;  5JEA B;  1N0U A;  1Z5B A;  1ZXN A;  4QNK A;  5K36 E;  4DR5 I;  2Z5E A;  1H73 A;  4FWG A;  3M85 D;  1R6L A;  3L7Z A;  2PNM A;  4DR7 E;  1VI7 A;  5IT9 C;  1H74 A;  1NHH A;  1UDN A;  4DPX A;  5C0X A;  2OI2 A;  1DAR A;  4FW3 A;  1H7S A;  2IOP A;  4IFD A;  1Z0C A;  4JI8 E;  4IS9 A;  1HR0 I;  4USM A;  4OO1 D;  4LCG A;  3P3E A;  3J80 C;  4LCH A;  5JEA D;  1XMQ I;  1I94 I;  4DR6 E;  4LF6 I;  1B62 A;  2UUC I;  1NHJ A;  2V2Q A;  1XHK A;  4DR3 I;  4LFC I;  2HFS A;  3H4L A;  4JI0 I;  3B82 A;  4MQY A;  1E3H A;  4DR1 E;  4MYT A;  4DPT A;  4IZJ B;  4JI6 E;  4JI3 E;  2HKJ A;  1UDQ A;  3LTO A;  2GS8 A;  4MYU A;  3P3C A;  3K85 A;  4JI2 I;  1D6T A;  3QT8 A;  3GON A;  1YHC A;  1S4E A;  1FWK A;  4PRV A;  1KTV A;  1XMO I;  3L7Z B;  4X66 E;  4B3R E;  4HXZ A;  1HNX I;  4DR2 E;  1S16 A;  4BA2 A;  4ED4 A;  3HJC A;  4KHP I;  4P7A A;  5C0X B;  3J80 Q;  5LMU E;  2ZM6 I;  2PO1 A;  4J3D A;  4IFD B;  3P3G A;  4LF8 I;  3WU6 A;  1QZR A;  3JAM C;  2V34 A;  2BA1 D;  4IZJ D;  3T1Y I;  4U3B A;  4JI7 E;  4B3S E;  2CG9 A;  4B3T E;  1XNQ E;  3HUL A;  3QT6 A;  4DPY A;  5EKW A;  2UUA I;  1KIJ A;  2NPF A;  4GKK I;  1K47 A;  5DNX A;  3OTO E;  4JYA I;  4Z7C A;  4JI5 I;  4OO1 E;  4OX9 I;  1A6F A;  1N36 I;  2JEA A;  2JT2 A;  4X64 I;  5C0X D;  5DNL A;  5JEA E;  3PRY A;  1VIS A;  4WUD A;  3WU4 A;  1U2R A;  4FN5 A;  3ZZT A;  1H72 C;  4HYM A;  3WU3 A;  4DR7 I;  1Z0V A;  4X62 E;  1IBM I;  2WW4 A;  4LCF A;  1XXE A;  3PS2 A;  4PRX A;  4NBQ A;  2NN6 C;  4JI8 I;  3JAM Q;  4DUY E;  4BA2 B;  2HHH E;  2C37 A;  4B3M E;  4GKJ E;  3LPS A;  3M6A A;  2ZBK B;  4YHH E;  2V2Z A;  3K17 A;  4DR6 I;  4NXN E;  1HNW E;  1XNR E;  4IZK A;  3Q1Q A;  1IBK E;  5A2Q Q;  1EI1 A;  1N33 E;  1MU5 A;  1Y5Y A;  2X7I A;  4URL A;  1MG7 A;  2CGE A;  4DR1 I;  2IER A;  5K36 F;  4YY3 E;  4X65 E;  1Z0G A;  1N32 E;  4FW5 A;  2JEB A;  2LJP A;  4OKG A;  2BM1 A;  1ZM9 A;  5DRO A;  2V2V A;  4JI6 I;  3ZZ0 A;  2JEA B;  4JI3 I;  1N34 E;  1PKP A;  4AQY E;  4WUC A;  2J7K A;  4U3D A;  4DV2 E;  4B3R I;  4X66 I;  5LMN E;  4DV6 E;  3P06 A;  1USV A;  4UTG A;  4JI1 E;  1NZ0 A;  1E3P A;  3NZK A;  3F0N A;  4DPW A;  3U1Y A;  2UXD E;  2BR2 A;  2Z5B A;  5C0X E;  4LF9 E;  5LMU I;  1Z5A A;  5FWK A;  5IWA E;  4IFD E;  4JI4 E;  4LFB E;  2F1D A;  2C37 B;  2JE6 A;  4JI7 I;  4B3S I;  4NXM E;  3J7A G;  4B3T I;  5DRR A;  1XNQ I;  4JV5 I;  1EA6 A;  2PNL A;  4IZK B;  4LFA E;  1NHI A;  2DEI A;  1UEK A;  3OTO I;  3B78 A;  3WU5 A;  1N0V C;  4DXL A;  4LF5 I;  4LOM A;  3QT7 A;  2JEB B;  2NN6 B;  2VF3 A;  3PYD A;  5IT9 Q;  1Z0B A;  2IES A;  2PO2 A;  2Q2E B;  4MU0 A;  4DPU A;  4LF4 E;  2V8P A;  4LPF A;  4DU7 A;  4X62 I;  1J5E E;  2F4V E;  5ELW A;  2ZIT A;  4DV7 E;  1UDS A;  3Q6M A;  4DUY I;  4AIM A;  2HHH I;  3GCM A;  2UUB I;  2BR2 B;  2Z5B B;  4GKJ I;  3H1C A;  4DR4 E;  2NN6 D;  3T1H I;  4NXN I;  4DU8 A;  2O1V A;  1XNR I;  1HNW I;  4FW6 A;  2PNZ A;  2JE6 B;  1IBK I;  5JEA C;  4OO1 F;  1N33 I;  1Y6Z A;  5FLX C;  5JEA F;  4DV1 E;  3B8H A;  2A2C A;  1ZM2 A;  2CVE A;  5BR8 I;  4YY3 I;  4DV4 E;  3K1J A;  4UT4 A;  4X65 I;  2R3V A;  3ZKB A;  4P52 A;  1RR9 A;  2HK2 A;  2O1U A;  3Q6N A;  2WP8 A;  2WNR A;  1HK7 A;  1N34 I;  2BA0 G;  4FW9 A;  4DV2 I;  2PO2 B;  1FJG E;  2HFU A;  5LMN I;  1Z5C A;  3ZM7 A;  4DV6 I;  4DV5 E;  2J65 A;  2XEX A;  4JI1 I;  3J81 C;  1HNZ E;  4FWD A;  2EFG A;  2BM0 A;  1BKN A;  2UU9 E;  1Z0W A;  3M85 G;  2E5L E;  2UXD I;  1FWL A;  4LF9 I;  5IWA I;  1RHY A;  1Z59 A;  2CZ9 A;  4K0K E;  1Z0T A;  4LFB I;  1XMO E;  1IBL E;  1P42 A;  4NXM I;  5FLX Q;  5K36 C;  4PU9 A;  5GMD A;  3UHM A;  2PNZ B;  3CDJ A;  4BA1 A;  2ZM6 E;  4WUB A;  1FKA E;  3PYE A;  2NN6 A;  3M7N D;  3PS1 A;  4I3H A;  4GQU A;  1Y60 A;  2O1T A;  1RRE A;  2NN6 E;  4OZE A;  2WP8 B;  5C0X C;  4LF4 I;  2WNR B;  1Y4U A;  4IFD C;  5C0X F; 
#chains in the Genus database with same CATH homology
 1OYR A;  4IFD F;  2PO0 A;  2C39 A;  3KRN A;  2JEB B;  2NN6 B;  3CDI A;  1OYP A;  2PO2 A;  2NN6 F;  1OYS A;  4OO1 E;  2C38 B;  2JEA A;  2PO1 B;  3U1K A;  5C0X D;  4AM3 A;  5JEA E;  1UDS A;  4AIM A;  3GCM A;  2BA1 G;  2C39 B;  2BR2 B;  2BA0 D;  5K36 A;  4OO1 B;  3H1C A;  1UDO A;  4BA1 B;  2NN6 D;  5JEA B;  4NBQ A;  2PNZ A;  2JE6 B;  4OO1 F;  5JEA C;  5K36 E;  2NN6 C;  4BA2 B;  3M85 D;  5JEA F;  1R6L A;  3L7Z A;  1R6M A;  2C37 A;  1UDN A;  5C0X A;  5K36 B;  4IFD A;  2WP8 A;  2WNR A;  2PO0 B;  4OO1 D;  2BA0 G;  5K36 F;  5JEA D;  2PO2 B;  4OO1 C;  2JEB A;  2JEA B;  3M85 G;  3HKM A;  2C38 A;  1E3H A;  5K36 D;  1E3P A;  5K36 C;  1UDQ A;  2BR2 A;  5C0X E;  2PNZ B;  4OO1 A;  3CDJ A;  4BA1 A;  4IFD E;  5JEA A;  2NN6 A;  3DD6 A;  3L7Z B;  4AID A;  2C37 B;  2JE6 A;  3M7N D;  3M7N G;  4BA2 A;  3GME A;  3B4T A;  2NN6 E;  5C0X B;  4IFD D;  2PO1 A;  4IFD B;  2WP8 B;  5C0X C;  2WNR B;  2BA1 D;  4IFD C;  3GLL A;  5C0X F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...