3LTOA

Crystal structure of a mevalonate diphosphate decarboxylase from legionella pneumophila
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
MHWFAQAPANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIPGAPEFNLSVEAQKRFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTKCASIALSELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALWTGDKVSAIDLPYKDLLHQVIVISSQEKEIPSRVAHKLVKTSPFYETRSERAEANLKLLLNAFENKDWTSIYQICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVVTMDAGPNVHLLYRSDQTDLARQFKSDHLVGNYDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Mevalonate diphosphate decarboxylase
publication title Crystal structure of a mevalonate diphosphate decarboxylase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
total genus 105
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 4.1.1.33: Diphosphomevalonate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18376 MDD_C Mevalonate 5-diphosphate decarboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3ltoA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3ltoA01
1HNXI 1PIEA 2X36A 4JI8I 3J81Q 2V2ZA 3H4LA 2UXBE 2HKEA 1H7UA 3PYGA 1ZM9A 3LNUA 2V2VA 2V2QA 3ZKBA 4OX9I 4LFCE 3PYFA 3LPSA 4B3RE 1N33I 1J5EI 2F4VE 1FWLA 4HACB 1Z0TA 2UU9I 4JI6I 3JAMQ 4JI2I 4AQYI 1S16A 4JYAI 1IBLE 1Z5CA 1HNWE 1H7SA 2VQEI 4ED4A 4DV4E 1N32I 5GMDA 2UXDE 4Z7YA 3QT6A 4DR5I 4UT4A 2CZ9A 1EA6A 4DV3E 4KQVA 1K47A 1KVKA 4LF7E 2HHHI 1Z59A 4DU7A 2WW4A 1S4EA 1QZRA 1PVGA 4DV5I 1FNMA 5BR8I 5A2QQ 4DR2E 3ZM7A 4KHPI 4M1KA 1MG7A 2V34A 1HNXE 3B78A 1KIJA 4JI8E 4FWHA 4PRXA 2HKJA 4DV7I 1N0UA 2UUBI 4DPXA 2DEJA 4WUDA 4LFBI 1Z0GA 3QT8A 5LMUI 2LJPA 1NHIA 2E1RA 1OJ4A 2HFUA 3D4JA 4DR7I 1N33E 1J5EE 5IT9Q 4P7AA 4JI4I 1IBMI 4JI0I 1MU5A 4B3SI 4B3MI 4I3HA 2UU9E 4USMA 1XMOI 1DARA 1EI1A 4JI6E 1HNZI 1I94I 1Z0CA 4JI2E 4AQYE 4X66I 4EMDA 4JYAE 4WUBA 2VQEE 2Q2EB 5LMNI 4DR6E 1N32E 4DR5E 4DR4I 3F0NA 2NPFA 4DPWA 2XEXA 2X7IA 3J80Q 2HHHE 4ZVIA 2A2CA 2VQFI 2BV3A 4DXLA 4DV5E 2A2DA 5BR8E 4GKKI 2ZBKB 4KHPE 1Z5AA 3ZZTA 3WU5A 3OTOI 3J7AM 4HYMA 4DPYA 2UUBE 1ZM3A 3J81C 1ZM4A 1NHHA 4LFBE 4DR1I 1U2RA 2UUAI 2ZM6I 1Z5BA 5LMUE 1PKPA 3T1HI 2UUCI 2VF3A 3GONA 4URLA 3WU4A 4DR7E 3Q1QA 1HR0I 3QT5A 1XMQI 5IWAI 1ZM2A 1NZ0A 4LF4I 4JI4E 5FLXQ 4LF5I 3V2UC 1N0VC 1IBME 4DV0I 4JI0E 3V5RA 4DU8A 1XMOE 1HNZE 1I94E 4X66E 4JI5I 1Z0WA 5LMNE 4DR4E 3WU3A 2OI2A 3JAMC 4JG4A 1N36I 4DV2I 4DV6I 2VQFE 1ZXNA 4DUZI 1B62A 4USKA 2E5LI 4YHHI 4GKKE 4WUCA 5GMEA 4Z7CA 4DV1I 4OX9E 2HK2A 2HFSA 3OTOE 4JI3I 5A2QC 4X64I 4R1FA 4JI7I 4LF6I 4LF8I 5L3JA 2UUAE 2ZM6E 1NHJA 4FWDA 3T1HE 2UUCE 1ZXMA 4JV5I 1HR0E 4JI1I 3T1YI 2HK3A 4FW9A 1KKHA 3LTOA 5IWAE 1XMQE 2V8PA 4X62I 4LF4E 2J7KA 4LF5E 3HULA 4DV0E 1H74A 2UXDI 4X65I 5IT9C 1BKNA 4B3TI 4NXMI 3B82A 2BM1A 2GS8A 1N34I 3CWVA 1N36E 4LFAI 1XNQI 4HY1A 4DV7E 3PYEA 4DUZE 2ZITA 3WU6A 2E5LE 4YHHE 4XTJA 3J80C 4RPFA 4GKJI 1XNRI 3ZKDA 4DV1E 4HACA 4JI3E 4P52A 4X64E 4LF9I 1A6FA 4JI7E 1XHKA 4LF6E 4LF8E 3B8HA 1MX0A 3ZZUA 4B3SE 4B3ME 4JV5E 4K0KI 4JI1E 1FJGI 3T1YE 4MYTA 4NXNI 2UXCI 4X62E 4YY3I 2AJ4A 4DR6I 1WUUA 4DR3I 4X65E 1IBKI 4NXME 4B3TE 5FLXC 4DUYI 4DPUA 1B63A 1VISA 1N34E 2UXBI 1KTVA 4LFAE 2R3VA 1XNQE 1D6TA 4FWGA 2EFGA 2R42A 1RREA 4LFCI 4DR1E 4GKJE 1ELOA 1Z0VA 1XNRE 4UTGA 3QT7A 3ZZ0A 4B3RI 4DPTA 2F4VI 4LF9E 1Z0BA 1H72C 4HXZA 1FKAE 1FI4A 1Z0EA 1IBLI 1HNWI 4FN5A 4DV4I 4PRVA 3K17A 3PYDA 1FJGE 4K0KE 4DV3I 4JI5E 1RR9A 4LF7I 4NXNE 2UXCE 3J7AG 1UEKA 3M6AA 4YY3E 3K1JA 5LL6R 4MYUA 2DEIA 1H73A 4PU9A 1FWKA 4DR3E 4DV2E 4DR2I 1IBKE 4DV6E 2BM0A 4DUYE
chains in the Genus database with same CATH superfamily
3MI7X 4DSEA 2KKHA 1Q7YT 2VD3A 1JKHA 3MDFA 2WSEC 1VYAA 4GKJJ 2HQDA 1XNRJ 4JBCA 1PJ5A 4YFUA 2J9EA 4ZCLA 4C3MA 1KNZA 1VOMA 2R8JA 4ZPTR 5GADU 1Q95G 1F5AA 4OI4A 1IJFB 2ZC4A 3HJCA 3TX0A 1TL1B 3PM9A 4Y2CA 2A6OA 2PGCA 4B9TA 5T7LB 3QT6A 3R5AA 4NLOA 2AWZA 4DLGA 4KQVA 3EVOA 4IFDD 3BPDA 2QFJA 2RRAA 4ER8A 4DU7A 5HATA 2RHQB 2WW4A 3LP2A 5AXKA 2DH9A 1TL3B 4Y2MA 2PO4A 3R3TA 3SZ2A 4CH1A 4DV6F 4LQ9A 4ZCKA 3FK4A 3CJKA 3NBPA 5CYQB 2V9KA 2IAJB 4C8YA 3HJFA 2DEJA 2E1CA 1DZ5A 3DRYA 4DFPA 1T3OA 1FFGB 5ETOA 3KOAA 2RB7A 2HWTA 2JH3A 3ZXWA 1M1GA 3M8WA 4UUXA 5HANA 2GO9A 4PZVA 3ITHB 5KG5A 3AB2B 3OTBA 2MQOA 1VRUA 4NYOA 4ZLJA 4DR4I 3H1CA 3HT0A 2QTWA 2HHPA 4NI2B 3NS6A 2A2CA 1HNXJ 1FRLA 1N5YB 1XR7A 3BDEA 1ACMB 3QLHB 3BJYA 3FFIA 4C3LA 3R5DA 4UOGA 1SUQB 5KG3A 2KT2A 7FDRA 3J7AM 3D1HA 3OTCA 2KJVA 1KBRA 1WOSA 3PX0A 1RWMB 4FYWB 1TL1A 2DISA 5HMYA 1DJ0A 5F8JA 3GSIA 1TMMA 5DG8A 4X4TA 2RIJA 2Q79A 2ILYA 5HVHA 1QTNB 2CPEA 1YIJS 4JYAJ 1BWVA 2ASDA 3W9IA 4RR5A 4RJVA 1VQNS 1CJKB 3C3LA 1BQXA 1Y4UA 3RGIA 2JX2A 4BBYA 5KTQA 4I6WA 3Q86A 2OP5A 2CJXB 2ZOFA 1S1TB 3JQMA 4WUCA 1KQKA 1QSYA 2V0NA 2PO2A 4FDFA 3D9BA 4JI3I 1WG5A 2XLKA 2FZKB 2HGNA 1Y5IB 5HVGA 5D6GA 3Q8QB 4EEYA 1M1KT 2VA2A 4F3MA 1IKWA 2ZJQQ 1SV5B 2V2KA 2P9CA 3DLEB 4IUFA 3RU0A 2JEBA 1NB2A 4FW9A 3FJ2A 2NYIA 3BM7A 2F8EX 1D9DA 1H74A 2DTJA 2IRXA 2BRLA 3BPSP 5IT9C 3GR0A 3M9OB 1N5YA 2CRLA 2VDHA 3MXHP 1KP6A 2J5AA 4ZLLA 2CQCA 3WZ0A 5KFPA 4LVOP 1HBUA 2J7UA 2YNGB 1PSDA 1CS4B 2BR0A 4RPFA 5KOXA 3KUEA 3HK2A 2JEAB 5A6PA 1T94A 2H5EA 3KDNA 3O44A 5J2MA 4X64E 2UUCJ 1U6FA 4LF9J 2CWKA 3LGNA 2LEBA 2KVIA 2YNHA 1N56A 2OTJS 4DV0J 4ICLB 4JI1E 2ALYB 4KGMA 3T1YE 1VHIA 1PBUA 1OYSA 3P49B 3IWXA 4W98A 2VQEF 4EUVA 4QPTA 2QA4S 1TU0B 1WF2A 4YN3B 2HHHF 4AL5A 3OT9A 2CPIA 2B56A 2G1HA 3D2WA 2F9JA 4KSEB 1H2VZ 5CD4A 1K73T 4O3OA 3N0VA 4HI2A 4F3OA 2W9AA 2CNOB 3OVSA 1SV5A 4LF6J 4BA1A 4RW8B 1RB0A 4UUWA 4U7UD 3NY0A 1HNVA 3HFKA 2OPQA 1U0HB 5DETA 4IO9Q 4QYZK 1T0TV 4F4KA 2GJIA 4PRVA 5KT6A 2RNEA 1LEOA 4BWJA 1S6UA 4AFFA 4QU6A 2ILZA 1N34J 3MEGB 5FDLB 2CQ1A 4DR2I 4LRCA 3BR9A 4L3KA 4WFYA 2ZJRQ 2X36A 4PG7A 4E2FB 2J6SA 1HBNA 4ED7A 2R7SA 3H4LA 1ZA2B 2HNZB 1GMUA 4Z37A 4J9UE 2V2VA 4G1QB 4CO3A 3C15B 4JB8B 3MM9B 3V6HA 3EZUA 3QGHA 3MM7A 4NLTA 3LWLA 3LPSA 3D6FB 4RBUA 4KKOB 1GH8A 2MJUA 2EFPA 2FUG9 1GTEA 4ALZA 5F0WA 4AL7A 4NXNJ 4TYBA 1VFJA 2FZCB 2XY6A 1HNWE 2LYVA 1MNEA 4DV4E 5DQIA 2RAQA 5A8WB 4DUYJ 2CG8A 1JLEB 4FW6A 4WK1A 1ZA1B 2FJBB 4Q2MA 3K0JA 3UD3P 4DUZF 4IFDB 2E7WA 1WHXA 4DF8A 1JXVA 2HZAA 4ZMMA 1FKPA 2W4DA 2DHXA 4LFCF 3D4JA 4DQIA 2WVEA 5HL7Q 4R8UA 2OSQA 4YS2A 1BLUA 3AOBA 1ICEB 3Q8VA 5IV3A 1DARA 1M1HA 3WBZA 4WUBA 4F4AA 1I1GA 3SCJE 3ZZPA 3SV3A 4K2JA 1FFSB 3MM6A 5KFTA 1IJEB 2XMMA 2NPFA 4DL7A 5LSRA 3CCES 2CFXA 2ZNZA 4NLVA 1FVQA 3JQKA 2W1BA 1NM2A 4HH0A 3EGVA 1O0PA 5FLXY 1SIWB 1ZM3A 1TZ0A 2OGUA 3PW0A 2K3IA 5FLXU 2FLNA 4LSZB 3KK2B 1OIAA 3HD1A 1B4SA 1HQ2A 4G3IA 1S9EB 1HBOA 3I5BA 3BGRB 4TN2A 4A8MP 5LOQA 3C6UB 4DU8A 4IZJB 5F8GA 1I94E 3A1YG 1RT5B 1MW7A 4URQU 2Z5BA 1YRUA 1K1SA 2RJZA 3FDSA 5K36E 1B62A 4KO0B 4YHHI 1ZS6A 2C2DA 2O1PA 2GHVC 3CVKA 2JE6B 5DJBA 1RWUA 4N8NA 2HHTA 2VESA 3GV8B 1KOOA 1UJ4A 3PR5B 1RCXB 2Z0GA 3J7Z5 4NASA 3G4SS 2WVDA 5L3JA 4HT5A 2AYGA 2R7OA 2JDJA 3PEHA 5MAOA 3BF4A 2DNZA 3K2YA 1KQFB 4EO6A 3KLHA 3TX8A 3E2EA 2BR2B 2GHWA 4DR4J 2MKHA 2ZNYA 3KNGA 4B3TI 1Q5YA 1PCAA 1S1VA 4PXDA 2BEFA 2W7AA 4UZCA 1Z2LA 1TFYA 2C37B 3WQPA 1PBAA 2GMJA 1S1XB 4UOFA 4XTTA 4KV8B 1RAHB 3AHPA 3NXZA 2E5LE 2BANA 4I64A 5CZXA 3SDEA 1E3PA 2QX0A 3UVJB 1S4FA 1RWPB 2RUGA 4MIWA 3DLGA 2B8PA 2QT7A 4WBFA 4RBVA 1SCJB 3LO3A 3HVAA 1PJ6A 2HW3A 1R8CA 4DL6A 4J9NA 1FRJA 4USIA 1WTBA 3R2CJ 4ZA1A 4QPXA 4IFVA 4X65E 2V9WA 1RHQB 3MHYA 1Y3JA 3C19A 4OJGA 2W2NP 4Y6IA 4C8ZA 4MH8A 5ITHA 5LJ3Y 4I69A 2DHSA 3FZBA 1RT7A 2Z2LA 4JI3J 5JEAD 2VFUA 4PWDA 1RABB 1Z0VA 3M4XA 1URRA 3OL6A 4DOZA 5FIIA 4DUTA 1VCTA 3WX8A 1GNKA 5D15A 3J81Y 4ITSA 1FX4A 4FN5A 1QE1A 1K8AT 1S7IA 5K20B 3H2LA 2NZCA 4B02A 3TEHB 3J81U 2QLXA 1KD1T 2M4MA 1S1XA 1RTDB 1JLBA 2WP8A 4KV8A 4QWDA 2E44A 1TK5A 5HVFA 3HHLA 2KFYA 3TEGA 4NLGA 1YITS 1UETA 2PDAA 3AT1B 1FXRA 4U8VA 4WP9A 4ZP7A 3S6EA 5T41A 2ZD1B 1VK3A 2FTRA 3SYZA 3DC2A 4WJBA 2L3MA 2COLA 2Z8QA 4ELVA 3UDEA 3W2WB 5ADZA 3BN4A 3BSCA 2P8IA 1KLNA 3P45B 1IKVB 1HLWA 4PXBA 1Z0TA 2XG8A 2C2EA 1RTJB 3IG1B 2Z4PA 2HHVA 2VC1A 2AD9A 4H4OA 1R8PA 1JLQB 1U4BA 5ETPA 1R8BA 2VBWA 1NDCA 4OYMA 4J9RA 2EI5A 2WNRB 1USUA 2HKJA 1W2IA 4DSJA 1FERA 4QWBA 1UW9A 2J8SA 3I0SB 3FNNA 1I3OB 1Q4RA 2FC9A 2M52A 2ROPA 4IH6A 4FNIA 2IA6A 5L38A 5KFZA 2VBXA 4CNYA 2BA1G 5CABA 4KHRA 1IBMI 2R2UA 1F0XA 4JI1F 3T1YF 1Q86T 2DGVA 1KQGB 1HMVB 4CLLA 4X4PA 1S6QB 2EK1A 1DFDA 2UXDF 3JYTA 5CA5A 2JRSA 4DR2J 3AQPA 4NCBA 3QO9A 1U45A 5BR8E 4F8RA 2DCLA 2EEYA 4WIQA 4KHPE 3J7YI 3MD3A 4CZCA 2DGSA 2EFNA 4V1Ak 4MK8A 1YJ7A 5KT7A 2GVZA 3PZPA 2XNQA 6FDRA 1ROFA 4O3RA 1N8RT 2PO1A 1P42A 2YX1A 4DR7E 3CMES 4XPEA 2A6MA 5K36A 5ETQA 1J5EF 2R8GA 4LF5I 2LA6A 2HIQA 1WG1A 2IPOB 2HVIA 2KG0A 3FKBA 3FBBA 3UN5A 5LMNE 2VFSA 4I0WA 4DR5F 4LRFA 1OY6A 4ED2A 1S0NA 1CJUB 3TAPA 3MECA 2YH1A 4B9UA 3DRSA 4DL5A 1S6OA 5D0EA 2CQDA 2L08A 3ZO7A 3GCMA 2B0GA 2YWKA 5K5MA 1SH2A 4CM2A 1VLOA 1C4CA 3LGHA 3VVUA 3CUNA 4X64J 5HK4A 2PE8A 2MY7A 5H9FJ 1NHJA 3Q8RB 1D8ZA 3AH6A 5EHHA 1T9XA 1J2VA 1JNRB 1UFWA 1HMVA 2HK3A 4URGA 1XMQE 3U1KA 3L7ZB 1HNWF 4LF4E 1UVKA 3HULA 2KH9A 3VGVA 1RAJA 1UDQA 3I0RA 4WPAA 4Q8EA 4CLPA 4A8KA 3BKTA 2D3O1 4PWUA 3TRGA 3PY8A 1RWVB 1P8GA 3AFGA 2I2YA 4UQTA 3M7ND 1QSSA 5JVGQ 2DCUB 1PYSB 3VTIA 4UOHA 3I82A 2DHAA 2ZITA 3QZ8A 2CVEA 4NZ6A 4C6AA 5C24B 2V67A 4KQZA 5IM0A 4GO5X 1B70B 4HACA 2MQ8A 3CJ3A 3LOUA 1U49A 3FEZA 1YKWA 2QE5A 1DTQB 3MMJA 4M5GA 2J0SD 2C1EB 1BQNB 3Q6NA 1S6PA 1BMQB 1MU2A 1L5UA 3T1HF 4M63A 2O1UA 1VJQA 3M2RB 5D4OA 4QNJA 1E6VA 4ECRA 4EI2A 3EICA 1FEHA 3G2XA 2OEJA 3G9CA 2CJAA 3CC2S 2DNRA 3Q22A 3DXSX 2V69A 3MEEB 3NWRA 1RT1B 4LRDA 2ACMA 4YHHJ 4QU7A 4X4UA 4QWCA 3FBCA 3GIIA 3MMCB 3TUJC 4LFCI 3HHDA 1F1BB 4P71A 2ZH8A 2OMLA 4UTGA 2M0GB 3H2VE 4RNOA 1N4LA 1UTAA 2YNIB 1Z0BA 4OO1A 1JXLA 2ZE2A 3ET6A 4C97A 1FI4A 1Z0EA 1G7CB 4K4ZA 3ZZOA 3R2DJ 2MYFA 4IZKB 4DV4J 3M6VA 1AROP 1I94F 1KWMA 4B3TJ 2GQ0A 2XYHB 2E7VA 4OQJA 4HHJA 4PU9A 1NDPA 3MM5B 2KM8C 4P9SA 1XXEA 2XSFA 5K36F 1LQ9A 3KK1A 3MEDB 1RAFB 3WIVA 1ZZNA 2RSQA 5AXNA 4HHUA 1OO0B 5J2QA 3RJMB 3TYTA 3SQGA 4IQXA 3ZKBA 1HD1A 1D8YA 5JXSA 2W9BA 3J7AN 2U2FA 3R7SB 1IWAA 4DR1F 2ASLA 4QYZJ 3US5A 3NKYA 2MGZB 1M5SA 1FTCA 2B7CB 2DBBA 3CF5Q 3LP0A 1Y0HA 2BE7D 1JLAB 5I42B 5IXUA 4OI3A 5CYMB 1SH3A 3PW5A 3HKWA 2EKNA 3HI9A 1WC5A 2B9XA 3N01A 3M2UB 2CJ9A 1J5OB 4DV3E 4ES2A 2WTFA 2FJEB 3W62A 1OSDA 2UV8A 3JXOA 3D6HB 3GG0A 3MR3A 2E5LF 2GJ2A 3A8IA 4R25A 5AXMA 1DLOB 4WUDA 3QT8A 3NNHA 2UVVA 3KHLA 3R27A 2ATLA 4EFAC 4NA2A 2BKPA 2HFUA 1KTQA 2M9KA 1F3FA 2FY8A 4IZKA 1NLKL 2LFVA 4RW4A 4JI0I 3TOQA 4LOMA 3AD8C 3D1QA 1HIYA 1HQEB 2ZWOA 2NN6D 4X66I 4EMDA 1EETB 2J9DE 3CULA 1SL1A 3MR7A 3W7BA 2RS8A 3DM2B 3EZ5A 4OI6A 2MPUA 3AXKA 4LSLB 5KOWA 2DY9A 1W26A 2A2DA 1C4AA 4OI1A 2BOPA 4IG3B 1U2FA 1YJTA 3TR5A 1S9GA 4F26A 3IWLA 2KT3A 3QRQA 2H3EB 3MPWA 2AZ3A 1X60A 4C8MA 4M5DB 4ZKAA 2E5HA 1U2RA 3I9V9 3AD7C 4F67A 2JT2A 2AGPA 2EKYA 5K8OA 5CYMA 3CB4A 3VR1A 5D4LA 3G8TA 1LFPA 1C1BB 3TAMB 2VG7A 2HQGA 1HR0I 2BZ2A 2PSZA 1SVDA 5CQGA 3VCDA 4JI4E 3NS5A 3QYYA 1R8AA 2W7PA 2MKIA 3V4IA 1P6TA 2UU9F 3CSKA 3CMAS 3EZOA 4DQQA 5C2CA 3WU3A 3LGMA 2BJEA 1S0MA 2JWNA 2P5VA 5M2UA 3RRHA 1N54B 3FSXA 5A6WA 4HTJA 4GKKE 2F8MA 3QFWA 3EM1A 3RW7A 4HEA9 2KL8A 4ZP8A 3NCRA 1U1PA 5D4NA 4J9PA 1IBCB 4QR1A 3EPGA 2FQQB 2CQHA 3GTYX 2BJ1A 2W2MP 5A8KB 3R5BA 1VR6A 1IBMJ 4MJKA 4DZDA 3FRYA 3OFHA 1TMJA 3H5YA 1X31C 5IWAE 2V8PA 1HW8A 3M2VA 3PW4A 1DTTB 1PKUA 3CDJA 1WC1A 2B43A 3PIOQ 5KAKA 2C3YA 4DQSA 4LSLA 1LWFA 2VOOA 3B82A 1KQSR 5F41A 2CADA 4P75A 1ZZFA 2ADCA 4MKAA 1X4BA 4M5DA 3V6JA 3RYLA 2OUGA 1WHYA 2RQ4A 2R7XA 3DD6A 5JVHQ 1YX2A 4KFBB 1U26A 2C2ZB 4WU2A 1DQ9A 4DV1E 4OX9F 1NCLA 4Y65A 2DITA 3Q8PB 2JJ4D 4O3SA 3KWMA 1QM9A 4UQGA 1H0HB 3FEYB 4OLPA 4LF5J 1CJTA 1P1TA 4DF4A 4JV5E 1RHRB 2V50A 3HSGA 1KRPA 3N79A 1RBLA 2W9CB 4U7CA 2B3TB 2AJ4A 3OJUA 3I31A 3SI8A 2CJKA 4JV1A 1JLGA 2XMJA 4FYYB 1CULB 4TY8A 5A8RB 2B4PA 2CKWA 3A4TA 1EZZB 1VISA 2EPIA 5BR8F 2VBZA 1UVLA 3ZFVA 1Y5YA 1Y00A 2Z30B 4M5IA 2QO3A 2XQCA 2APOA 2N7YA 3UDVA 5SZTA 5I3UB 2BE2A 1UDSA 3UWTA 1VC5A 3TNVA 4DR7F 1DTTA 3OSPA 4OYOA 2LDYA 3QRPA 4RX6A 1B0PA 2E9TA 3MUVP 2XI3A 1NZAA 4L74A 4NEYA 2IFXA 2XO7A 2IM3A 2W2QP 2L41A 2GNKA 4JI5E 4LF7I 2YKPA 4ED3A 4FF1A 2IJNA 4J9MA 2UXCE 4F2RA 3W61A 1KDNA 4NMLA 2HBRB 1IBKE 3B54A 1DURA 1S9FA 3P76A 1RAIB 1F2HA 1X4EA 5HMZA 4PQUB 4F7VA 2H5IB 3NP5A 4OX7A 4NLDA 2VG6A 4UOCA 2G2OA 4ANCA 1X4FA 1ZM9A 3JAMY 2NLWA 2ZUGA 2M70A 4J9VA 3N28A 4Q8FA 4AM3A 4OZ1A 5DRRA 2JC1A 3JAMU 4MU1A 1J5EI 1RTIA 4FW5A 4AIDA 1HNIB 3DOLA 1XC9A 4A8QA 2PNLA 1XMQF 3Q23A 2OPRB 4LF4F 3D28A 2XMUA 3P06A 5C0XE 3JTOA 1N32I 4DR5I 2V68A 1GTHA 3K85A 1O8BA 2FLLA 1VQMS 1C0UB 1S4EA 2C22A 3CEDA 3JTPA 2V34A 1ZBTA 4KHPJ 3MMBA 2I5JA 3CJSA 3EX7B 4LFCJ 4OI0A 3LWMA 2V6AA 2LQJA 1IWGA 5B7WA 5U47A 2J9DA 3Q8SB 3HD2A 1U1OA 3ILLA 1BE4A 1RKJA 2E1RA 2BW7A 2KYZA 1U1LA 3J7A1 4BHQA 1VQKS 4LBHA 1KONA 1WHWA 2Z57B 3RG6A 1U1NA 1HBMA 2AYBA 4OZNA 2BJ8A 1MN7A 3GYXB 5E41A 1NHUA 4I3HA 3HCXA 3W5ZA 2EW9A 1BQMB 1UA0A 5BYRA 5DDPC 1OS5A 2KO1A 5LMNJ 1G1XA 5HMXA 2GX8A 3RBXA 1FJ7A 4HI1A 2HZVA 2JSXA 1OY8A 1D9AA 2JEFA 4V19X 2XC9A 3EXYA 3ADAC 3C2PA 1S72S 4Q45A 4YR0A 1Z5AA 4U3DA 2R7TA 3ZZTA 4DI6A 3DI6B 3HSDA 1WEZA 1R0AA 3F44A 3T1HI 2XS7A 4ELTA 2HAFA 1J27A 4L76A 2PEHA 2AW0A 1RA6A 3BZQA 5E33A 1N88A 2J9CA 2PC6A 1ZM2A 3I4PA 4K50A 4DCJB 5HP1B 2QSWA 1XEZA 2PNMA 2GJFA 3KG1A 3M8QB 4JI5I 2CPHA 4QBUA 1IR0A 4L73A 4AD6A 3HXMA 4JOUA 2CPJA 2DO4A 1FFWB 1KS2A 2DD8S 3HHNB 1PILA 1DY3A 2FHMA 4CIOA 1NK4A 1ZAXA 2HK2A 4OHXA 4KAIA 5LJ5Y 1SKRA 2VFVA 4QW8A 3GPAA 3BDPA 4CH7A 2FVPA 2WB1D 4ZP6A 3R97A 2XZWA 1S59A 4JI0J 3MUTP 4WWSA 3HVWA 4J9LA 1BQMA 4BC7A 2AV5A 2EG2A 4FW3A 4P10A 4X66J 2V4QA 2NUUG 2HWIA 4RWWA 2PNZA 2MZTA 4DV3F 3T5KA 1CQNA 4RNFA 2AT1B 4NX9A 5RUBA 1YDLA 4H4KA 4IRCA 1XNQI 1D09B 4HY1A 1IN0A 2YNFA 3BQ0A 4HHHA 2UVUA 4ZPWR 3L7UA 5SUHA 1Q53A 1SH0A 4J90A 3CCRS 3HX9A 2B8QA 3FMBA 3HSZA 2OFHX 2QIFA 4B17A 3W8PA 4B3OA 5A0YB 1HR0J 2M5YA 3OVBA 3TQEA 3L7PA 2R4FA 4MFBA 3M8QA 4K0KI 1FD8A 1TKZB 1TAUA 5FWKA 3DLKA 2Z2MA 3DDKA 3HP6A 3PX4A 1WUUA 2MZJA 1EAYC 1R7IA 4X2BA 2H48B 3UO0A 4Q2LA 5KFLA 3AA8A 1T9WA 3EJMA 2HNDB 4YP3A 2C2OB 3DYAA 1T11A 3D6MB 2R8KA 2VV5A 3LAMA 1EARA 1W7WA 1O5JA 3BKFA 4GKJE 1GAOA 1VK8A 1MROB 1XNRE 3NRBA 3HKZD 4B3RI 4DPTA 4X84A 4WCEQ 2H9ZA 1RCOB 1KEKA 4ZVHA 2L9WA 2C38A 4HXZA 1LWXA 3ILOA 2KZMA 4KJIA 5JEAE 2LEAA 3C46A 2XULA 4JI4F 1FK9B 3DOMA 5HQMA 1UVNA 4WZMA 1TV6A 4B3SF 1IM6A 4O4GA 4F4ZA 3OXGA 3KLFA 1YLXA 3BBBA 4DV2E 4MDTA 1VGYA 2X1AA 2XSJB 1NEEA 2HAIA 2DNNA 3WDOA 3DLHA 1H7UA 3UPFA 1U1KA 2IJFA 1C2PA 4TY9A 3VAKA 1RT3B 1AUSL 5C0XA 4OHVA 3C14B 3NGTA 1CPZA 3MPYA 1EX8A 4C3KA 2I9SA 3BGFA 4N41A 1WC3A 1CVJA 1AFJA 1RP5A 3BN7A 2UU9I 4NRTA 2DNMA 3BGOP 5IWAF 2HRUA 4Y28C 5KFRA 9ATCB 1UWAA 1SJFA 4AIMA 4O0NA 4MU0A 3CDBA 4RUCA 2K8GA 3RUBL 1HNXE 3PFEA 3DXBA 3WHIA 2CNLB 3BGUA 1MROA 3MAAA 4EYHB 2Q43A 1TKTA 3D6TB 1HQUA 3VWSA 4IOCQ 3CD5A 4CI0B 4DV1F 2E1PA 3I96A 3CNQP 4KH0B 2HVHA 5ETMA 3JSMB 2RRBA 1NRKA 3DHXA 3IAS9 1HWUA 2G0JA 3H2UB 3P8BB 2UVRA 4RWXA 4KRWA 2O3DA 2FGCA 4LF7J 3OJSA 3DRRA 4JYAE 4D3GA 3M6XA 2AJFE 4ZVFA 2LMIA 3QIDA 4BA2A 2QRRA 4ZVIA 4IH5A 2VQFI 4DXLA 3LAKA 4CT9A 3CC7S 2MZQA 3VAFA 2Z5CA 1U1MA 1N52B 1T9YA 4GKKJ 3F41A 2ZEJA 4YUDA 3CJ8A 4EBCA 3MMAB 2AIRB 4DL4A 1O51A 3HHKA 4LR9A 3R6GB 1QAYA 3MUMP 3SEOA 1LKZA 2RH3A 2AX0A 4ES1A 1IKXA 1J5EJ 1R0BG 4CLTA 4CQ1A 3R8YA 1N6QB 2D74B 5EX3A 1R8HA 1Q5VA 3QATA 4M8LA 3G71S 1ZPVA 2N4CA 5FLXQ 4DZ6A 4M5JA 1N32J 1UMJA 1HNZE 1UJ6A 4G6VB 4C8OA 2JEIA 3BKUA 3BEGB 1G4CA 1D3WA 1M5HA 1XBWA 3POTA 1IBKF 2H51B 2DR9A 3I56S 3IM8A 4DV2I 2JNJA 1R31A 1WDDA 4ZJQA 1B3TA 3Q89A 3NG8A 3RW6A 4X4VA 1QVGR 5IC4B 4DFJA 3OTOE 5ETRA 3DMJA 4DEZA 4L3NA 1XR5A 5HLFB 4AXIA 4DHVA 4LF8I 2MSSA 1L3KA 2YWHA 4LREA 1X9MA 2UUCE 3ENVA 4G1PA 4WE1B 3NMRA 3NS7B 1S1UB 2DNOA 1IKYA 4CTAA 2J7KA 3E01B 5C0XF 3LW5C 1Q0NA 4DV0E 2MQMA 2C3PA 1A9NB 3CJ5A 4OX6A 4GVLA 4OV6A 1FNOA 1HPZA 3SCKE 1IR2A 4RBTA 1C1CB 2OSRA 5L1IA 3DLBA 2XY5A 1NJYA 1HYSA 4NPOA 2WK4A 3PVXA 4OZLA 4LF6E 1XHKA 1S57A 4QCLA 5IQQA 2DXFA 2FJWA 1TKXB 1UFLA 1T95A 5F3ZA 2YPYA 2FVRA 1R43A 3KK3B 3K57A 4TNOA 4NA3A 5K8PA 8RUCA 4JI5J 2UXCJ 2CA9A 4ZPBA 2EBGA 3CPWR 4RW6A 3M30B 1VQ7S 4DR3I 5ETSA 1UAWA 3ILIA 1HWIA 2MY8A 1BWEA 1N48A 2KG1A 4F4XA 2ZFHA 1X7VA 1N34E 4OZ3A 1N36F 1D6TA 5JEAA 1GMVA 3EXCX 5CCMA 1F9EB 2RQKA 1LNQA 2OPSA 3SIPB 4FBUA 1O6XA 2F8HA 1YJUA 3OHAA 1RTHA 4DS4A 1H72C 1X4CA 1E6YA 2YWEA 3KJVB 1VMBA 4TLRA 2GVDB 3M05A 2JFDA 1NDKA 5K36C 2D3OR 1LWEA 1FJGE 3OFFA 1HWLA 2B5JA 1RR9A 4NXNE 4LF1A 2HFNA 2LVWA 3FUYA 3SXLA 2KJWA 2DEIA 2OEKA 2VHGA 2M8DB 1Z1ZA 2QL7B 3UQSA 1XNQJ 2K06A 2BM0A 3K7RA 4DUYE 1Q78A 1PIEA 3J81Q 3Q2TC 1X4GA 4ZPVR 3QNWB 1HWJA 4LFAF 1HFEL 3AXMA 2OELA 5EWFA 1ITPA 4OI2A 1FESA 4EU0A 3O1LA 1N33I 3PKYA 1UVJA 4FVCA 1XJWB 3MTKA 1WG4A 4K0KJ 3V6DA 4JI6I 4EWTA 3MFIA 3BYPA 2Y9HA 3RBDA 4QNKA 4A8SA 3TUPA 3B6BA 4UT4A 2CZ9A 3CCVS 2XS2A 1SQFA 1TP7A 3IS9A 1JJ2R 2HIYA 5IS2A 4BCAA 3NCPA 2UUWA 4OYXA 4H4MA 2KFZA 2MLYA 5K8MA 3MD1A 3A8JA 3B78A 2CYYA 4TKTA 4AYBD 1KLMB 3W2VA 4FBTA 1VRQC 2UUBI 1KOHA 4N47A 4LFBI 5E0OA 2XYGB 4ECTA 2DGQA 3VZIA 1Y9OA 4ED1A 4B3RJ 4N5SA 1VDHA 1EKSA 4K59A 3GYGA 2IJRA 3PXGa 3J80Y 4CO1A 1FDAA 4CM0A 3JB9k 4IFYA 2GQ2A 1FO1A 1U09A 2ZBCA 3J80U 4USMA 1EI1A 5J1EA 4OHZA 5LXYA 1FEEA 4IS9A 3IRWP 3G87A 4DR6E 2QV6A 3P5TL 2EC2A 2F5GA 2ZH2A 3QRRA 2KI2A 2BOAA 5B0FA 2RF2B 4QJVA 5B0EA 4RUAA 4F0KA 2NN6E 1MWZA 2V8GA 3WC2A 7AT1B 5HROB 3HFVA 1UEVA 1UWBB 4K7QA 2ZHBA 5C25A 3ZNUA 2RKIA 1XNRF 2UUAI 2CQ0A 2ZM6I 2J6UA 1JKHB 2R7UA 1TL5A 2B9EA 3SMZA 2AGQA 2H65B 1NK7A 2R7QA 3DRXA 5B08A 2UU9J 2DGUA 1RT2A 3LANA 1RACB 5DROA 4YDXA 1FT8A 5KFVA 2FHKA 2WONA 2I8EA 3OL7A 2Y1LB 1YRTA 5KFOA 2K1RB 4DR4E 5DDOC 2JEJA 5GAEI 3H5UA 1TL7A 4TXSA 2DK2A 3UCUP 4O0IA 1MMLA 4USKA 3QIPA 5EWEA 2BACA 3AB4B 4U9RA 4OHWA 3LP2B 4QWAA 2FJVA 2JVOA 2E66A 4IRDA 3B4DA 1B7FA 1K0VA 5B0CA 1PYTA 2VG5A 1QUPA 2ROEA 2N7CA 4R0EA 3OUYA 4JI7I 1MWQA 3CJKB 2CJYB 3NBPB 2BXJA 4OHYA 2PA8D 1FE4A 4PYDA 5L1KA 2YKAA 4F3QA 2NZ4A 1R6MA 2GC8A 3A8EA 2DGTA 2XY7A 1SB6A 1T9UA 2VKRA 4NXMI 2BM1A 2F1FA 2VQFJ 1Q8LA 5GVQA 3D67A 2NPIA 2XLIA 1V6HA 4ATNA 2MZRA 1HNXF 5JMNA 2VB6A 1VRUB 3EUNA 3C16A 4E98A 3OL9A 3GU0A 2RVJA 3MF5A 4IKAA 4LBPA 1CG2A 4JI3E 3FFIB 5B0DA 3LQVA 1NAQA 3V4MA 4USJC 1H7XA 4B3ME 3QJLA 2ADBA 2O1VA 2MHEA 4MYTA 2K1RA 4JYAF 3LF0A 1RT4A 4YY3I 4DR6I 1NNDA 3K58A 2RDJA 3R1HA 3KLGA 5FLXC 2AJ1A 5HBMA 4DPUA 4DV2J 3U27A 3MEKA 2Z2ZA 4QYRA 1X5TA 2O66A 3T5LA 4HT7A 3GFHA 2HLUA 2PD1A 4FZVA 2H1YA 4FP9A 3GSDA 1ZTTA 4LF8J 1KHVA 1RWOB 2MQNA 5C5JA 4FXWA 2F4VI 2D7SA 3GYNA 2PO2B 3GIMA 1IBLI 2GO4A 2BA1D 2OLWA 2QN6B 3R1LA 1IKWB 2BBEA 4DQRA 4DL3A 2JEBB 3M6AA 1CSJA 4MYUA 2P9GA 2CPYA 3OFEA 3CDWA 1S0VA 3B4TA 4M5NA 1QDUB 3QBCA 2Z58B 3HMJG 2CPFA 5DRPA 1BXNA 4K5SA 3HVTB 3PYGA 2QLJB 5JUMA 1D0EA 3V81A 2ZH9A 1CJVA 2OD4A 4QIFA 1HBUB 4RNNA 1YHCA 1T03A 4UY85 2QLWA 2UUCF 2XLJA 4WKRA 1VRTA 5K9FA 4LF9F 1S1WA 4CLYA 4IZJD 5F8NA 4NLYA 1UPMB 4Y2KA 3SBMA 5J2NA 5J2MB 4JI2I 4MIBA 1DAXA 4F04B 4OZ2A 4DV0F 2A10A 5H9FK 4ZITA 2CAJA 1RBAA 2AEFA 2YNHB 4RKUC 4DR3J 1Q7LB 3MR2A 2YKNA 4ELUA 3BH7B 4XO0A 2IIHA 1HI8A 1PVGA 4DV5I 1P9QC 4DR2E 1RHUB 3EE3A 2MSTA 3GJSB 1FX2A 2Y8YA 2JC0A 3U7JA 4RL1A 2LU1A 3HFZB 1SC1B 4B08A 1YZ6A 5LMUI 1YHQS 5GMKa 1OPZA 4E8UA 3UD4P 1T7PA 4LF6F 4J3DA 3MPUB 3PRYA 1HI1A 3T9ZA 4CRJA 1NPRA 4ZVQB 4TQSA 4BA1B 5LT5A 2NN6A 4B3MI 5D3GA 1RTZA 1XMOI 3QGPA 1HNVB 3DGPB 3GLLA 1HNZJ 1RQ0A 2OPQB 2ZBPA 3VF0B 4C0HA 3UI3A 4P7TA 2CQ4A 3KKFA 3HVTA 4ZPDA 8ATCB 1RBOB 1N34F 3OQ2A 1Q8BA 2ALZA 5KFFA 3P3EA 2CDQA 5CYJA 3FZ2A 3D0GE 1QTMA 1HHTP 3NLCA 4KPCA 4DPYA 1Y6ZA 4NCGA 3OTOJ 3TZWA 3J81C 1FRKA 1NHHA 3EMTA 1OPIA 2GW8A 1HBNB 1K1QA 1N33J 2VF3A 1JLFA 3A12A 2FPHX 3CCZA 4HYKA 2I6WA 5KFNA 3MM7B 4JI6J 3SSQA 2IM0A 1RT6B 2E9RX 4YEAA 4NXNF 5GAHI 2KXFA 3PRVA 1WOPA 1H98A 2R2RA 1XQIA 3FBFA 2W4CA 4OYBA 4R0JA 4WYWA 3MFHA 1N36I 2VODA 3PO4A 2OJ3A 1QAIA 4DUYF 2DR6A 2FVCA 1WC6A 3M1VA 4YB1P 2K7KA 4OYZA 1UA1A 1TK8A 2UUBJ 5D8HB 3TA0A 4CLWA 4LFBJ 5GMEA 3PNIA 2W01A 1YGYA 1KHWA 3Q8UA 3FQLA 3J7YU 4IDKA 5EX0A 4LT6A 2O01C 2HWHA 4TU9A 1RLDA 2LQBA 4FPRA 2YXLA 4BS2A 4Z2XA 3DGPA 1FKPB 4NYZA 4CLFA 2DR5A 1X5SA 4ILRA 4X62I 4JP8A 4OYPA 1HD0A 4URSA 4R8UB 4X4SA 1NK0A 2V63A 3MM8B 3KHHA 2PMHA 4HDGA 2GS8A 4I56A 2DH8A 4GMKA 3TW0A 4LFAI 3TAQA 1EB0A 1OYPA 3FMWA 4DV7E 2AF6A 3DKDA 3AODA 3MM6B 1H3DA 1TQLA 2BX6A 2YPZA 2ZBIA 4QR2A 3SSSA 2NYHA 1U7LA 4YHHE 4U3BA 4ERDA 2OPPA 2ATCB 4K4SA 3KJQB 5KFQA 2ZJPQ 1L3VA 2UUAJ 4WXWA 2ZM6J 3TJAA 1APSA 2C3MA 1RT6A 2GCFA 5K36D 4AUKA 3HLUA 2JLEA 2W7OA 3Q0AA 4OFZA 2V94A 3DOKB 1FJGJ 2EVZA 5M2PA 3HPOA 2GHPA 2JEGA 4RW7A 1Y4ZB 2LEPA 1G6BA 1HBOB 4J9QA 2AKWB 1RKIA 1HW9A 4KT0C 4B3TE 3TWZA 3T5HA 4YOEA 1K44A 2UXBI 4K4YA 2NN6F 1RAOA 1HARA 4O3NA 2GIRA 2PN6A 4B9VA 2XTJP 4G1IA 4DX8H 2Z5BB 2OEMA 2P9EA 3PRDA 1RREA 4NE9C 3CDEA 3DLLQ 3RB0A 1CEZA 5AE1A 4JI7J 4M94A 5IFMA 4OJHA 3IGNA 2M2BA 1NU4A 3GV5B 4LJMA 2D1CA 1L3UA 2W4PA 2NS1B 4DN9A 5DQHA 1PAUB 3G96A 3MM8A 5G4DA 2QZ8A 1VIOA 1LWCA 2O1WA 4NXMJ 1KVJA 4PCQA 3W63A 2NQPA 3QZ7A 2RT3A 4DR4F 1V3ZA 1FWKA 1OMSA 3KLHB 5D0HA 4DV6E 2RHSB 4JI8I 2AQ4A 4P72A 1U1QA 1WEYA 3TUIC 1S1VB 1NHKL 1GXLA 2A3JA 2VBYA 1VQ8S 3QGIA 2V4JA 1Q8KA 4DL0C 3MAQA 3I9ZA 2BANB 1FXDA 3UDLA 3NNCA 3SDEB 5F8MA 1VBKA 3DOKA 3I5CA 5A2QY 4DG1A 3CTRA 3JAMQ 3DLGB 4AQYI 1NJZA 1S16A 4TQRA 4YY3J 2GZOA 5A2QU 3HM9A 3CCSS 4DR6J 1KR4A 1K47A 2FZGB 3PDNA 1NKCA 4DFKA 3MCOA 4C98A 2DGWA 4H4KC 2HURA 3BO3A 4IFVB 4U8YA 4PRXA 4N7TA 4DV7I 2NSCA 4P2SA 5HJYA 2VU5A 2V4RA 3TA1A 3SCLE 1U0SA 1ZAWA 1FRHA 5AJ3J 4JI3F 2LJPA 2F4VJ 3CCQS 3HHEA 2WSCC 3KTQA 4LMZA 1RT7B 4ZPCA 1P1LA 1IBLJ 4MIAA 3O6QA 4MKVA 4PWDB 2JZ5A 3W8GA 2PO0A 4R5PA 4ECYA 3NGRA 2G4BA 3FQKA 3J81j 5DLFA 3PHTA 4RZRA 1P9YA 4WKYA 1SC4B 1B0TA 1RWXB 3ENQA 3AA9A 1QE1B 4DPWA 2RRNA 3H20A 3D0IE 4ED6A 2W2PP 2IESA 4MKYA 2Q3PA 3M8SA 1DQ8A 1K0TA 4AL6A 5J2PA 3CCWA 1RJJA 1SKSA 1JLBB 4DL2A 3H90A 2WP8B 4NCAA 2HG4A 4FNHA 3HHLB 3UN2A 2AYEA 2DNLA 2J0WA 2BRKA 3VV2B 2MDAA 1X8DA 3GFZA 4EBDA 1KFSA 5KG6A 2MJNA 4CO5A 4LR7A 9RUBA 1UJ5A 4JI2J 2WVBA 4DPOA 1TAQA 5ETNA 2EFQA 8AT1B 1IBME 3QJPA 4W90B 2GMLA 2IC3A 5HO4A 4ANDA 5EN1A 4FXVA 4PUOA 3NZKA 4NEZA 4DV5J 1ZTWA 4RW9A 2GQQA 2PI5A 4DV6I 4ID5A 2IVMA 1JK9B 1Q16B 2IMOA 2ZOMA 5F0UA 1N5VA 4DSFA 4H4OB 3W64A 3CIZA 1PO6A 2GMHA 1UDNA 3NGDA 5LMUJ 1PYOB 4EYIB 4FW7A 4G65A 5E3AA 3Q2SC 5C0XC 1LW2A 1RAAB 2QGFB 5HI7A 5J1NA 5ETTA 1VLYA 4Q5VA 1RLCL 2C2MB 1UEUA 1OSCA 4B3MJ 3UNGC 1XMOJ 3L9ZA 3KLVA 2OO4A 2DNQA 2QA2A 3O8WA 4K8RA 5DDQC 4LF5E 2WB4A 3ZZYA 5CD4H 1JLCA 1JJ4A 3I55S 2G2ZA 5KG4A 2Y1IA 4DR2F 4HL9A 1MSWD 4OO1E 1S79A 2XWXA 3JYTB 3P4UB 5AXLA 3THPA 4I2PA 3PKMA 1CC8A 4HDHA 3IMQJ 3QO9B 3GILA 3QSIA 2Y8WA 2LCWA 1REVA 5BXIA 3WC0A 2V5HG 3QPIA 5ETVA 4LPFA 4LF9I 4OYIA 1I6JA 4GVBA 3KLEB 4M5KA 5KFIA 4K4UA 1CLFA 4N76A 2GVZB 3C66A 2PO1B 5K36B 1SXLA 4DCPB 1EKRA 2F1DA 5I4MA 4PG5A 2Y1JA 5G0RA 3JSBA 2DXEA 3VHQA 3M9NB 3G82A 2R3VA 5F8IA 3FRZA 3FGVA 1AZSA 4P73A 4PRFA 3CWJA 3DDNA 2KRRA 3MECB 3DRSB 3MPDA 1EP4A 2PEBA 4X64F 3PJ9A 1ZH5A 3K5PA 2VZ9A 3QWUA 2ZVSA 2WCXA 1OQ3A 2WZ1A 5DNXA 4X62J 2YWFA 2X1FA 1JNZB 2JLFA 4A8WA 2HNYA 4Q0BA 3MZIA 3K17A 1PJ7A 4MK7A 3GIKA 4DMZA 2HHXA 1LW0B 4F4YA 3I4HX 3K1JA 4B9MA 1VBXA 4LFAJ 2GIQA 3UW1A 4K4TA 5BYSA 3PV8A 5D78A 3I0RB 3MCSA 4LSNA 2MKYA 3NGSA 3L7OA 2MLXA 4LFCE 3KLEA 3NOCA 1QUVA 2NXJA 1VBYA 3Q83A 1VBZA 3LH2S 5IM0B 2EG1A 4RO0A 4HACB 1BHNA 3KLIA 3S01A 1IQZA 2VQEI 2FJDB 3EDQB 2XGQA 1S6PB 3OR1A 2KFNA 5C7PA 1MU2B 1WI8A 2XCAA 2HHHI 4UY8T 1E6VB 4QIEA 2UXBJ 3OXLA 2DKOB 1T05B 2XO6A 4M1KA 3G8SA 2IOQA 4YHHF 4CYUA 1YJRA 2GGPA 2EXUA 4A8OA 4DLEA 4P2FA 2KTQA 2DJWA 1Z0GA 4FF4A 1NHIA 2CXEA 3JS9A 3CJ2A 3DRPB 1YH8A 3OVAA 4ED0A 2I0XA 4ZHRA 1LW0A 1X9SA 2ZH3A 1Z0CA 3K89A 3OHBA 2JHEA 4OO1B 1YTYA 2ZE2B 3ET6B 4DV4F 3RAQA 3K5NA 4B3TF 3LALA 3P5BP 4WP8A 4JI8J 2Y1RI 1RHYA 5D4PA 2QYGA 5DRQA 1DQAA 1BY9A 2A18A 4DCOB 1HHSA 1RE1B 5JEAC 1MLAA 2H4WB 1S48A 4I2QA 3KK1B 3BREA 3F56A 2IVFB 5DO2A 1Z5BA 3MOJB 4C11A 3WU4A 1WC0A 4USUA 2XZTB 4DX7A 5J2QB 4ECXA 3SQGB 4ANEA 4ZCIA 3ISZA 2W9BB 4AQYJ 3CCTA 2ZBQA 4JI0E 2GAHC 1S0OA 2A1BA 3NGKA 2LLZA 3MGJA 4ZVOB 3LP0B 2B6AA 4X66E 5DGAA 4WIIA 1XIQA 4PG4A 4RNHA 1T05A 2GA7A 3SFUA 3JAMC 5KFJA 4I68A 2V8VA 2HMIA 1HWKA 2K2PA 2VFRA 3BBFA 4P2XA 1FNXH 1YG0A 4DUZI 4DV7J 1UFKA 1C0TA 4ECZA 2AZ1A 2DGXA 2DRAA 1ZAVA 2D3UA 1WJ9A 2DNKA 3DRPA 1RZMA 3DHWC 1Y10A 1CC7A 4K2XA 3NL0A 3UFCX 4FWDA 3MAHA 5LL6d 3AJ1A 5IZHA 1HR0E 2P6SA 4KYZA 4TU7A 2DRBA 5K14A 3LTOA 3GQCA 4P6QA 2YKMA 5B09A 2OFGX 4PYAA 4V19J 4RW4B 1T3NA 5J1PA 4TYAA 1JQGA 2CQGA 2KRBA 4WFZA 4I67A 4NMXA 3PS3A 3ZTRA 4C0BA 1AA1B 4QQBA 2XMWA 1RHMB 2R7WA 2W24A 3PYEA 3OFGA 3RZAA 3ICLA 2F3JA 3GR1A 2BVZA 4HR2A 3JSRA 5KFKA 1A6FA 4WTYA 2HVDA 4GRSA 1NB7A 1LXJA 1S9GB 5T7LA 3KJFB 2OIHA 2HVEA 3ZZUA 2QMUB 3R7NB 4PAAA 2CIMA 2IRUA 4IYQA 3CCLS 3KDOA 3HO1A 2RDIA 4ECUA 1TL3A 1VQYA 2DPJA 3BBCA 4FS1A 1PG5B 4MT1A 2VG7B 2D9PA 2B7BB 4QIWD 1WD6A 3R5JB 3BSOA 2HFZA 5CYQA 2AHOB 2FGOA 4H54A 2IAJA 3IBFB 4DV6J 2C42A 1R27B 1YI2S 1G2EA 3V4IB 1SJQA 3I87A 3H8YA 5THWA 3HSJA 2ROGA 2C3OA 1WNEA 2IRYA 4OJ1A 2AP6A 1M90T 3ILJA 3T5JA 2J76E 2I1RA 4TU8A 2MZSA 4IFDE 3FCWA 4BWMA 1NJXA 3IBCB 1TVRB 2KHDA 3OR2B 1JB0C 3ITHA 3MPVA 4ZPAA 4U67Q 3UCGA 1WSRA 4RNMA 1FKAE 4NI2A 1JIHA 2BQUA 1I51B 2HVZA 1DBDA 2QMXA 1IBMF 1T9TA 3LPYA 4J7CA 3IA0A 1WACA 1UEKA 3QLHA 5LL6R 3T19A 3BS9A 1SUQA 3M2VB 3ZZZA 4X65F 2YKOA 3R9LA 1R3NA 1OY9A 1LWFB 1A6LA 2HBYB 2X51A 2JVRA 4C48A 1LOUA 2MHNA 3QAUA 2V2QA 3M6UA 2ZDOA 3SV4A 3MURP 3P96A 4CLZA 3VAIA 3RAMA 1CJKA 2DRDA 3ZC4A 1GT8A 4ZVUB 5KFXA 2RS2A 2AYMA 3TP2A 4LF5F 3R5CA 1Q81T 1FHTA 1XR6A 3H59A 1AYEA 2UXDE 2EWHA 4B9LA 1S1TA 1DRZA 4LF7E 2ZC3A 2WW8A 2HHUA 1CJTB 2EFVA 3G86A 5L1LA 4KIAA 1FTRA 2CJBA 3CMQA 4I1TA 4OO1F 1KIJA 4LIWA 2AX1A 5KG0A 2XMAA 2HQ3A 1JLGB 4GC6A 4RUBA 2GQCA 4TY8B 1TVRA 3OR2A 3DLEA 2ZHAA 2P6TA 5L9NA 2FHOB 2UZAA 3TQ1A 2HZCA 4EZ9A 1VQ5S 3GZ7A 5DRKA 1FKOB 4GO7X 1J5EE 1VC6A 3TVZA 1MU5A 2BE2B 4CWBA 1H2UX 2QYCA 1N32E 1S10A 4DR5E 2OKQA 2YNGA 2MKKA 1Q8IA 1CS4A 1AUDA 3J80Q 1VI7A 2C28A 2JEAA 2XZDB 3C8YA 4U7UK 2DNPA 4ZJOA 2VPXB 3HDSA 5C0XD 4I6AA 3HJVA 2XGPA 4DBQA 2HGMA 5KT5A 4CO0A 1SKWA 2VG6B 4ICLA 1PKPA 4OZJA 3GONA 4EO8A 4MU3A 5GAGI 3H5XA 1IR1A 2VONA 5I3QA 2VQEJ 1NHVA 2RILA 4ZVPB 1RTIB 4HTIA 2IOPA 4PG8A 3DOLB 2HHHJ 1E3HA 4FF2A 5EGYA 5LSLA 2OI2A 3PW2A 4ED5A 1M0SA 2H4YB 5BJRA 1QY7A 5CHCB 1ZXNA 2VPWB 2R8IA 4Y3CA 4RW8A 2UV8G 2AEJA 1IVZA 4KHPF 1NDLA 5ETKA 5KFMA 4DSKA 2DGOA 1TTHB 2GFFA 1U0HA 4X64I 2GAGC 1FKOA 2FHJA 3MMBB 2I5JB 4PG6A 3PTWA 2RU9A 1AFIA 3T1HE 3EVMA 5IT0A 3SCIE 1JJHA 2N3LA 4DX6A 2ABYA 4AT1B 2DT9A 2F63A 4JI1I 3T1YI 3K5LA 4DSIA 2W25A 5DGBA 4X4RA 3MEGA 5FDLA 2ZH1A 4K4VA 4U96A 2UXDI 1AT1B 2DPIA 1HBMB 4ECWA 3TARA 2NXNA 1BKNA 4IQMA 3MOZA 3WX4A 1VQOS 2Z2YB 3TVKA 4OL8A 2BJ3A 2HNZA 5LMNF 4G1QA 3C15A 3KNAA 3MM9A 2XHWA 4KGXB 1HKAA 1WEXA 3D5MA 4HVZA 4KKOA 3GFXA 3GCXP 1LXNA 2X3GA 3IR6B 4A8XA 4CP5A 1YJWS 4LQ3A 2XB2D 1S99A 4EGLA 1RA7A 3MWBA 3NAIA 3OTEA 1W25A 5LXRA 5AE2A 2NXEA 1YJVA 5A8WA 2G1DA 1R0AB 2B51A 4NA1A 1JLEA 1FRXA 2Q6CA 2ZWPA 2NN6C 3ONQA 1GX6A 2QFIA 4ECQA 2B4OA 1HK7A 2YWGA 4IFDA 2R7VA 3P3CA 2BQ3A 2XI2A 4WFNQ 1F3VA 4DUZJ 2BJ9A 3CT9A 3OLBA 1KTVA 2L9DA 2IYGA 3CDAA 1XNQE 5HQLA 2ZZMA 4USTA 1RHKB 3D7SB 2K7JA 3ZTQA 5KFAA 2FIUA 2M88A 4I4BA 5GADI 1B99A 1N5QA 2G0CA 4DR1E 5F8HA 2VOPA 4I7FB 1KC8T 3D68A 1USVA 4N77A 2CPXA 3KYLA 1FA0A 3DCAA 4FW4A 1T8EA 2K3KA 1HNWI 4DV4I 4JI0F 2HFOA 4K0KE 2FLOA 4X4OA 4KGVB 4X66F 1SIZA 1LK7A 5F3TA 4A46A 3PS1A 4ES3A 1UPPA 1U6BA 5DDRC 1LK5A 1NBEB 5HAOA 2QLBB 1ULRA 2E9ZA 2PNZB 2F4FA 5DM7Q 4QIVA 2V2ZA 2VPZB 2V8DA 1WHVA 3KK2A 3BO2A 2VASA 1S9EA 2LXFA 4U6PA 2YNFB 1SL0A 3AY0A 2LXIA 3BQ1A 3BGRA 4B3RE 3I5AA 4K4WA 3C6UA 4ZP9A 4IZJA 3IR7B 1RT5A 3W5XA 4NOHA 1HR0F 2OD6A 4NWBA 4B3OB 4WFXA 1T9VA 2W8KA 5KG7A 3PG9A 4NBQA 5KFDA 2CZ4A 2QSFA 4KO0A 4MFBB 1HI0P 4IO1A 4AE5A 3PHEA 3AOAA 2JE6A 1NO8A 4NZ7A 1NK9A 3DLKB 1W2BR 1MG7A 2Z5EA 2N3OA 3OBIA 5IT9Y 4USVA 3G6YA 3O3LA 1YBAA 2B9YA 1OYEA 5EL9A 4DPXA 4I7FA 4ZVRB 2ASJA 5IT9U 5AE3A 3H4BA 3RR8A 3DYAB 3CXCR 4E0DA 1XN9A 1MN9A 5DLGA 2BR2A 2FJAB 3VAMA 3U1NA 2HHSA 2WRMA 1N5TA 4S0MA 1U8WA 5DS7A 3D54A 5E2QA 1BUXA 2UU9E 4P7VA 1UP1A 1I94I 4L6V3 4LCFA 2C37A 2C38B 2CVIA 2WSFC 1X4DA 4Y0FA 5L39A 4ZIWA 3DOMB 2KDOA 4BLGA 3NAHA 2X7IA 1TV6B 1XWLA 2C2KB 4O4GB 3NMAA 2XYPB 3UVJA 3PJWA 3KLFB 2ZBKB 1V3RA 1RU2A 2PT0A 2LECA 5IOLA 2VUGA 4IFDF 2YX7A 3M85D 4DR1I 2WAQD 1ZETA 3D66A 5KG2A 3CE8A 1GMWD 5C0XB 3AJDA 1FD2A 1FKAF 3ZNJ1 4N8OA 2MEWA 4ZLNA 3GMGA 1V5VA 2M7SA 3GB0A 1RHJB 3T9NA 2YVSA 2LP4A 5EKWA 3CCUS 3FBEA 2VQFE 1U8SA 3V6KA 2E5LI 3ULHA 2ZHOA 1NZ8A 1FXLA 3GJRB 2NCKL 4OX9E 3H5SA 4R1FA 3D1OA 4O44B 1FWPA 2XNRA 3K8WA 1VHFA 4CO4A 3MAAB 3PCOB 1TKTB 3ZTSA 4CLSA 2PMZD 1HQUB 1GXTA 4LR8A 1JXEA 1IXKA 1RSCA 4ZCMA 2CG9A 5H9EK 4IOBA 1RTDA 2KN4A 4N56A 2CNNB 2HHWA 1H7WA 4FXDA 3RRKA 1Y3KA 2XMTA 4X65I 4LF7F 3SQOP 4F2SA 2BJ7A 5CXTA 3CWVA 3DRRB 2ZD1A 3RAXA 1X5PA 2QA1A 5KFHA 5GAEU 2LA4A 1VQLS 3WU6A 4BA2B 3J80C 4GKKF 3W2WA 3HZGA 4C8NA 4C9DA 2Z5CB 3KXDA 1IKVA 4ZS6A 2G2YA 3T3FA 2QL9B 4ZLPA 1JX4A 4LF8E 1RTJA 4LF2A 3IG1A 2HPUA 2UVWA 1RISA 2WBMA 3MTJA 3IWNC 2F40A 1S7HA 3B4MA 5KFWA 3UD5A 4O3PA 2D69A 1NK5A 1B0VA 1IKXB 1JLQA 4TVAB 2DO0A 2ERRA 2B9WA 2BKOA 3IP0A 2ZUAA 2WNRA 1N32F 3NOGA 1SQEA 4P2MA 1GX5A 4MTPA 3I0SA 1B63A 2N82B 4JUZA 1NJWA 3GLJA 4UW2A 3H98A 1QVFR 3N5FA 2FJXA 4WZQA 1X9WA 3OL8A 3POTB 4ZK7M 4O44A 5IV4A 2XS5A 3R7BB 1FVSA 1NUEA 3EGZA 4DS5A 3ENWA 2N4DA 3A3NB 1LFWA 4MQYA 4OZEA 1IM4A 3GJTB 1S6QA 2HS3A 4JI1J 3DMJB 3FSYA 3IC1A 3VAGA 3T1YJ 1NK6A 3JSYA 1NK8A 3VAJA 3FVYA 2YH0A 2YX4A 3P3DA 4PABA 3WIUA 1U24A 4UF4A 2UXDJ 4JV5F 2ZH6A 3I6PA 3J7AG 4IR9A 2O5DA 1IKYB 4CTAB 2EBEA 4DR3E 2QLFB 1NH8A 1EQ0A 2Y3YA 4CT8A 2X1GA 1R0CB 3A3OB 4F25A 4M95A 4USWA 1HPZB 4F0HA 5EUHA 1UCNA 1JJCB 1YVFA 4OX9I 4C2MA 4HKQA 2PMWA 2POKA 4FYVB 1TL4A 4CNZA 3ZZRA 1OYDA 3BSAA 1R6VA 4JV2A 1HYSB 4DDFA 1FWLA 1TUWA 5IQ6A 2HFVA 1VQ4S 1YZ7A 1FDDA 4Q43A 4Z7YA 2FD2A 2AGOA 2IM2A 4LUBA 2FDNA 1CJUA 4DR5J 1WDTA 4JI5F 2UXCF 1VC0A 1Z59A 1WORA 2KVQE 1FNMA 5DQGA 5BR8I 1VQ9S 5A2QQ 4ECSA 4KHPI 4RW6B 1FE0A 4LVNP 1U02A 3JQJA 4PKDB 1N0UA 2ACYA 1BGXT 3HHLC 1U6ZA 2HEKA 4OYWA 2J7WA 2GO8A 3BSNA 1XK8A 2BJDA 2YY3A 2MTLA 2HYIB 3L7ZA 5JEAB 5HJXA 4DR7I 1XERA 5ELWA 1N33E 5H1SV 1HNWJ 2J6TA 1TR0A 3W66A 4P7AA 3IN5A 3CDIA 2OPSB 4JI6E 3CCMS 1RTHB 1P27B 1F5BA 5LMNI 2PFFB 1E6YB 3ISNC 4ZVSB 2RU3A 3F0NA 4K5RA 1R6LA 1LWEB 5C24A 2B5JB 3AQOA 3W9HA 2ZOGA 3H25A 1XTZA 3VVTA 2XM3A 1XNQF 2BA0D 1V3SA 1DTQA 4NYPA 1UW4A 4O4RA 2YWWA 5EDWA 1BQNA 3QSYB 2DNYA 3K5OA 4HYMA 2UUBE 4DFMA 4LFBE 1REGX 3M2RA 1MWYA 1NMEB 3X1LB 3T1HJ 3EVWA 2LXUA 2IBKA 2U1AA 4J9OA 3L4BC 3Q1QA 1XMQI 1PC4A 1NZ0A 3O2IA 4LF4I 4YB5A 2Z56B 3V2UC 2VC0A 4K0KF 3MEEA 1G3OA 1RT1A 2C2NA 5CH7B 3V6DB 4MMOA 3MMCA 2FYXA 2G13A 1Y11A 1SKUB 2BA9A 3O5TB 1RK8A 1RADB 4QR0A 3IS9B 3L3CA 3DN9A 2BABA 3X3UA 2YNIA 3VGSA 4H4MB 4Z7CA 4QZVB 2HFSA 3M8RA 2HRYA 2IDLA 2VKZG 2MB0B 2UUAE 3W2VB 3AOCA 2ZM6E 1S5ZA 1WTFA 4B3RF 3CJRA 4WF9Q 1NPKA 5KT3A 3N9UC 2EFOA 5LM7E 1ZXMA 3TJ8A 4O3QA 1KKHA 1CQMA 1WOOA 1I94J 4J5OA 2JOQA 3OTDA 3MM5A 5AT1B 2MQPA 4FS2A 3MEDA 1VS3A 4IFYB 5GAHU 2HS4A 3EDRB 2WVCA 2OHDA 3FEXB 2QJ3A 4YR2A 3CC4S 5B0AA 2ZKUA 4ZOSA 5J1EB 3GWCA 1VQSA 3RB4A 4HH1A 4QIGA 1S12A 3KJNB 3N6NA 2AEMA 1S49A 2MGZA 3RB6A 2FB0A 3GG1A 4DR1J 1JLAA 5I42A 1RWNB 4KGZB 3OW2R 3LUYA 2HQIA 3F73A 4JI7E 3B8HA 1S77D 1MX0A 3N5BA 3M2UA 2DHGA 5C25B 1J5OA 2O1TA 4CO2A 2RKIB 4B3SE 3NGUA 2ZH4A 1SPBP 1SBRA 1TFWA 4EBEA 1RDRA 3P6YC 1SL2A 1RT2B 3A13A 2MMYA 4WU3A 5DZ7A 4CH0S 4NXME 2QEXS 1DLOA 3CDUA 2OAUA 1UL3A 3Q24A 2E5LJ 2WONB 2DB1A 2VPYB 4NLWA 2CPDA 3H7HB 5FJ4A 4FPIA 4U95A 1TL7B 2PI4A 2QMWA 4RUHA 3QIPB 1HQEA 2MQLA 2CQPA 2A0FB 1K9MT 1EETA 2VG5B 4PEOA 3DM2A 3OUYB 1JWWA 3TUZC 4CLUA 3J7ZT 1ZPWX 3PYDA 1NKEA 4LCGA 4DV3I 3FSIA 4X65J 2CJQA 2H5JB 1Q79A 3A8KA 2NXCA 4YY3E 4IG3A 1TUGB 4A8YA 1OQ6A 1RI7A 2DHHA 2C2RA 2JLGA 2PIIA 4Y2IA 2YQ1A 3PJXA 3H40A 3KHRA 3UR3C 2VQFF 1T02A 4ZN1A 1NSAA 3LNUA 3ENAA 4WP3A 6FD1A 1C1BA 4KC5A 3TAMA 2XHCA 5E5NA 2KU7A 3HF5A 3M8PB 3C16B 4GKJF 4KH1B 2QC3A 1VJWA 3W5YA 3S8SA 2F4VE 4OKGA 4ILLA 3KG4A 3H4DA 1IBLE 3S1TA 4OO1C 5JEAF 3BO4A 4ED4A 3BR8A 2QA4G 2V8HA 4OMFG 1KVKA 1NJIT 4ZVTB 3HZEA 4QW9A 4IOAQ 5A76A 2D3ZA 1V5IB 1RT4B 2RUSA 4DV2F 1Y4SA 3VGUA 4RLEA 4HLBA 1WKLA 3AAWB 3KLGB 5HBMB 4ETXA 4LCHA 5A8KA 3VALA 3IO1A 3ZTOA 3AJ2A 1B64A 3QAEA 3G6XA 4LF8F 1EIYB 3TO8A 4EK2A 1TELA 2MKCA 4OJ3A 1X4HA 4JI4I 2IYIA 2NREA 3LP1B 4B3SI 3U1YA 3DDIA 4WK3A 5CAAA 4JI2E 5IC6B 2GIFA 1F9FA 3M6WA 1MMNA 2RQMA 2Q2EB 3CO9A 4ILMA 1OWXA 5C2GA 2SXLA 1R89A 4A8FA 1QAJA 4KFBA 3CW2C 4NLUA 4XDCA 2YTCA 4P74A 3PFOA 3NWGA 4DV5E 1RAGB 2GV1A 4YMEA 5D0GA 4GKKI 2CNKB 2RE1A 1X0FA 1WSVA 3M8PA 3A3PB 4OX9J 3M8ZA 3QFHA 3M85G 1RGVA 2HQCA 5LMUE 4QOTA 2AE8A 5E3QA 2W9CA 4O23A 3V81B 3RR7A 1CJVB 5IWAI 4NRUA 1CULA 2R2TA 2C39B 1T03B 5A8RA 5L46A 2CQ3A 3V5RA 3Q8YA 1XMOE 4L75A 1VRTB 4ID8A 1TK0A 1S1WB 4L72B 3KFWX 4WXOA 5J2NB 4ZN3A 2LQ8A 4DR3F 4JG4A 1FF2A 5BR8J 1H6KX 1BD6A 1EQMA 2HHQA 5HMWA 2HBZB 2KXNB 5I3UA 2E1AA 2YKNB 3CD7A 2IERA 2WVFA 2AJQA 7FD1A 1UDOA 2HSEB 4DV1I 2RQCA 2C3UA 5A2QC 1PAEX 2MZ1A 4CLKA 1F60B 3UR0A 4DR7J 2E5JA 3LP1A 3TI0A 4IG0B 2IA0A 4F50A 1L3TA 4JV5I 3QMQA 4FF3A 4KBIA 3UNYA 4OLOA 3UE2A 2Q1LA 3M7VA 4YDDB 2J8AA 4PQUA 4YB6A 1HNZF 3D0HE 2NN6B 4LRAA 1U2CA 4J9KA 5C42B 2OH2A 2F65A 5D3GB 2F9DA 1N36E 1IUJA 5KFUA 5E3PA 4FYXB 5B0BA 3MCNA 3GMEA 3PO5A 1YSJA 1RWWB 2LQ9A 2YQ3A 1HNIA 2VICA 3ZKDA 2CWXA 2DY1A 4KHMA 4P52A 3MCMA 5H9EJ 3OTOF 3E51A 2OPRA 3RBEA 2VL1A 1YQHA 1N33F 2C39A 2I38A 4NCGB 1FRMA 1XMQJ 4LF4J 3OLAA 3PRBA 1C0UA 2AU0A 1M5VC 4OYAA 4JI6F 2UXCI 1JLFB 4X62E 2NSBA 2DVIA 1D9FA 2Q66A 4USHA 1AW0A 3W60A 5K8NA 1IBKI 4PXEA 3W9JA 4WFBQ 1X0PA 3RTVA 1VQPS 4LFAE 2J65A 4FYDA 2MKJA 4FWGA 2EFGA 2ZZTA 3CCJS 4KPYA 2UUBF 1AB8A 4F36A 4F4WA 2EC0A 3M1VB 4LFBF 1M5KC 3QT7A 2BUNA 4IG0A 4NLSA 2O67A 4WTOB 5DZ6A 4C8LA 4IDKB 1URNA 2CPZA 1QJHA 1SJ4P 5C42A 4NLPA 2IM1A 4KTQA 3M7NG 3GIRA 1KSPA 3DI6A 4Q7AA 4CCHA 3U1MA 1YK9A 4W4MA 2ZH5A 1RU1A 3HHLD 2UXBE 1HL6A 4MKBA 2HKEA 1NH7A 1IQTA 2FLPA 3DU5A 4WYLA 4ENOA 5KFEA 3KRNA 3PYFA 3T6JA 2UUAF 2ZM6F 5HP1A 4UZBA 3CD0A 2OPPB 3TZXA 1YJNS 3VAHA 4A48A 1Z4UA 5E3RA 1Z5CA 1WKJA 1H7SA 2W8LA 4F02A 5GMDA 3ISND 5IT4A 4K4XA 1FJGF 4X4QA 4PPZA 1UZDA 3GFYA 1RYRA 1QZRA 1S97A 2LDIA 2J0XA 4RW7B 3G6ES 4JI8E 4FWHA 2NR0A 2CQ2A 1FJEB 4JV0A 3GCWP 4JI7F 2YKQA 2KB2A 3DNCA 3N4WA 3KHGA 3Q6MA 3M32B 4DV3J 2XCPA 4AQYE 4GQUA 1SJRA 1GFWB 3CO0P 3D3BJ 3OD2A 3QJJA 2ASYA 3CGIA 1RAEB 1U48A 4DWIA 4NL5A 4NXMF 2R2SA 4IFDC 1A7GE 2BV3A 1LWCB 5E7OB 4PR6A 4Y2AA 2CUYA 3RRGA 1WC4A 2BA0G 4EZ6A 1A0OB 4MU4A 4QWEA 3WU5A 5A0YA 3RBZA 3QGGA 4OV1A 3EGWB 3C6TB 3OXFA 1H38A 1ZM4A 4X4NA 3DLJA 2YQ0A 2MKSA 1TKZA 1Q82T 4URLA 5HSPA 2IBOA 2ZVIA 1TKDA 4PPDA 3M8YA 2HRTA 3MR6A 2V4JB 2QL5B 3JTNA 2OTLS 2HLTA 3BH6B 1FCAA 2KHCA 5ETLA 2R7RA 1Z2ZA 1N0VC 3G6VA 5D0RA 1SJ1A 2CQIA 2E5IA 3TANA 1Q1KA 2FVQA 4I6YA 2F7VA 4YY3F 1Z0WA 2HNDA 4KB7A 3ELHA 4DR6F 4DG1B 1NXIA 5T14A 3FC9A 4PQAA 1GK8A 5DNLA 2B4VA 4FKYA 4M5LA 5D77A 3W1YC 1YBTA 1M5OC 1WF1A 1WI6A 3TZZA 1F2GA 1U25A 3NEKA 2JL9A 2J0QD 3IR5B 5AJ3F 1FK9A 4XDDA 2F4VF 3M32A 3BB5A 4JI4J 3M9MB 4WFAQ 3R6LB 4B3SJ 2LQ5A 4Q44A 2ZDPA 1IBLF 4J91A 3HVRA 1GEHA 5L8RC 3PX6A 3VQTA 3E8OA 1UVMA 3VGTA 2LU2A 3DFEA 5KG1A 2XSJA 2NXUA 4KY3A 1U47A 1RWKB 2PO0B 4R5PB 2ZH7A 3S7RA 1WF0A 3U02A 1RT3A 2O3ZA 4XIUA 4RU2A 1BC6A 4J9SA 1F5CA 3IBWA 3C14A 3CJTA 4DJBA 2XMVA 2CGEA 3C6TA 2BQRA 4J37A 4GKJI 4MK9A 2CG4A 2JFKA 3BV8A 3TVYA 2CQBA 1XNRI 3K59A 5J2PB 3PACA 5E3CA 6AT1B 2IMWP 4YQWA 3UDCA 4DX5A 1EJ7L 5IWAJ 3IRXB 4NLXA 3HKMA 2WHOA 2DYAA 2PFDA 3UN3A 3TZYA 4JI2F 1FRIA 4KGKA 1QD1A 2EK6A 4NLRA 1Y5NB 5DG7A 3GE9A 1U1RA 1NSKL 4YB7A 4DV5F 2IC3B 3KUGA 4PUOB 5KFYA 3ETMA 5JJBA 2AJ2A 3JSMA 5MLCV 3IM9A 1YWXA 5DM6Q 4DV1J 4RW9B 3U1LA 3N6MA 5LSOA 3IAM9 3EWGA 4ID5B 3PR4A 2VIHA 2RMLA 5HN0A 4OX8A 3CJ4A 5LMUF 2E5GA 4DQPA 2M3DA 4LF9E 2MXYA 3QWPA 1M5PC 3TA2A 5FD1A 4JV5J 4M5MA 4OO1D 3TJ9A 1LW2B 4BC9A 2FVSA 1TUVA 1DHMA 1KVIA 3I32A 4B3MF 4NLQA 1XMOF 2AMCB 2WBRA 2DNHA 3THTA 3AD9C 1AXQA 2KZZA 4Y34A 1H73A 1Y60A 5KT4A 3EGNA 3MMAA 4B9SA 3W65A 3K8VA 3IGVA 2Y0SD 3BQ2A 1HNXI 1JLCB 4IR1A 4XAKA 2DIVA 2BW2A 1N6QA 1WELA 3HT3A 4N3OA 3T1AA 4FKXA 1NSPA 2VFTA 2XWYA 2HQFA 4YR3A 3OSNA 5F9LA 3IRXA 1KN6A 4NZ0A 1RYSA 1XMBA 3G8QA 4I2PB 4OZ0A 1YJ9S 1D1UA 1REVB 2Y0BB 2UP1A 4CDIA 3IXQA 1R6YA 2HS0A 4JYAI 2P2CB 5F9NA 5KFSA 4XPCA 2HGLA 1NPPA 1SQGA 3CJQA 3T41A 4GVBB 1EA6A 1SC6A 1UZHA 1IBKJ 3KUHA 1WKKA 4BDPA 1X5OA 2L48A 4ETZA 1HHQA 3ZM7A 1YRXA 1N5SA 2KM8B 5HLFA 4DSLA 3EPIA 5BYQA 1L3SA 2DNGA 2IY5B 3EYZA 5G0RB 1MMDA 4WE1A 3G82B 3LPEA 2D9OA 1S1UA 1AZSB 5F8LA 4C8KA 1OJ4A 3H42A 4M5HA 3E01A 1H2TZ 3PS2A 3UCZP 1NKBA 4C0OC 3ETOA 3L09A 5IT9Q 2DH7A 4KR0B 4W92B 5KT2A 1EP4B 2VA3A 4ISAA 2B4UA 1HNZI 2VDIA 5M2RA 4X62F 3N6LA 2WOMB 4PXCA 2KYXA 2VQEE 3FCVA 1C1CA 5CZVA 5I3PA 2YBVA 4C7QA 1F6TA 2XEXA 2HNYB 4OZ5A 4Q0BB 2HHHE 5CCLA 3CJ0A 2H54B 4ZVEA 3UHMA 1UVIA 2MQQA 1VQ6S 3GIJA 2FY1A 1X4AA 2G0IA 4ED8A 3OTOI 3MR5A 1LV5A 1TKXA 1VIXA 3OPKA 2BKNA 2LKZA 3E3XA 2ZKTA 4LSNB 3KK3A 1NSQA 3CD6S 3BYRA 1JMTA 2UUCI 1GMWA 1ZOTA 1QSLA 3KMQA 2M8HA 2VJVA 3OV7A 1YBUA 2DXDA 3QT5A 3H0PA 3M30A 3BGLA 2ZBRA 2R8HA 3NNAA 2PA3A 2ZZNA 4DV0I 2QG9B 4LRBA 3PEJA 2FC8A 3IFEA 4D3HA 4MAKA 2IHR1 4RU9A 3GV7B 3GJQB 1QLNA 2IVYA 3KLIB 5HQ8A 3CIMA 3RB3A 1N36J 2E1MC 3SFGA 1UKUA 4FVMA 3OR1B 3DGVA 2UXBF 2XBPA 4IRKA 3SSRA 1ZYQA 2BE9B 1FJCA 2RDDA 4Y00A 3KJVA 2GVDA 4ZJLA 1OYRA 4LF6I 2VH7A 3P3GA 4CYUB 2GGPB 5KFBA 3VQSA 3KMSA 5KFCA 2WOMA 3ZTPA 4ZDNA 1PC5A 4F0MA 4DN0A 1B7YB 2KT5A 5DG9A 5GAGU 3R5GA 1PGZA 4ZHRB 3LA0A 4LBIA 2DIUA 3GP9A 4AXJA 5L9XA 1N34I 2DR7A 4PWWA 2NUHA 4KE5A 1GXUA 4JI8F 3THVA 2D41A 4DUZE 2CDRB 4XTJA 4GC7A 2GO3A 2XMKA 1QAXA 1F9HA 1WWHA 2X1BA 2VJUA 2HBQB 2AJ0A 3NCQA 2E29A 2BDPA 2BYCA 5KFGA 1KFDA 4A47A 1SJ3P 2W2OP 1EHWA 1S76D 4ZVGA 2OMOA 1RUSA 4I2QB 1FDNA 1GQEA 4TLQA 2E7XA 1FJGI 4C4WA 2BMBA 4NXNI 4AQYF 4OIXA 3D3CJ 2RD5C 4C11B 3T6BA 4B9NA 1KLMA 1HA1A 4XK8C 4DUYI 1SI9A 3QQCD 2KXHA 3PIPQ 2B6AB 3KG0A 1Y7PA 3FCHA 2DR8A 1CBKA 1Y5LB 2UUTA 4DV7F 2X3DA 2R42A 4LIRA 2L9NA 2HMIB 3VZHA 3PW7A 1ELOA 2FHJD 1C0TB 3ZZ0A 1I5OB 3K5MA 2IDEA 1RXOB 4A4JA 5L1JA 2Q6BA 2G9OA 1FDBA 3L95X 5EWGA 1SC3B 2RF2A 4IH7A 1V9OA 3W3SA 2MLZA 4ECVA 4ZIVA 2R9LA 5HROA 2CZVC 5K14B 5B0GA 1UWBA 2YKMB 3DU6A
chains in the Genus database with same CATH topology
1HNXI 1PIEA 2X36A 4JI8I 3J81Q 2V2ZA 3H4LA 2UXBE 2HKEA 1H7UA 3PYGA 1ZM9A 3LNUA 2V2VA 4N3OA 2V2QA 3ZKBA 4OX9I 4LFCE 3PYFA 3LPSA 4B3RE 1N33I 1J5EI 2F4VE 4IZJA 3HJCA 1FWLA 4IZJD 4HACB 1Z0TA 2UU9I 2PNLA 4JI6I 3JAMQ 4JI2I 4AQYI 1S16A 4JYAI 1IBLE 1Z5CA 1HNWE 1H7SA 2VQEI 4ED4A 3P06A 4DV4E 1N32I 5GMDA 2UXDE 4Z7YA 3QT6A 4DR5I 4UT4A 2CZ9A 1EA6A 4DV3E 4KQVA 1K47A 1KVKA 4LF7E 3K85A 2HHHI 1Z59A 4DU7A 2WW4A 1S4EA 1QZRA 1PVGA 4DV5I 1FNMA 5BR8I 5A2QQ 4DR2E 3ZM7A 4KHPI 2Z5EA 1MG7A 4M1KA 2V34A 3B78A 1KIJA 1Y4SA 4JI8E 1HNXE 1USUA 4FWHA 4PRXA 2HKJA 4DV7I 2IOQA 1N0UA 2UUBI 4DPXA 2DEJA 4WUDA 4LFBI 1Z0GA 3QT8A 5LMUI 2LJPA 1NHIA 2E1RA 1OJ4A 2HFUA 3D4JA 4DR7I 3PRYA 1N33E 1J5EE 4IZKA 5IT9Q 4P7AA 4JI4I 1IBMI 3Q6MA 4JI0I 1MU5A 4B3SI 4B3MI 4I3HA 2UU9E 4USMA 1XMOI 1DARA 1EI1A 4JI6E 1HNZI 1I94I 1Z0CA 4JI2E 4AQYE 4X66I 4EMDA 4JYAE 4WUBA 2VQEE 2Q2EB 5LMNI 4DR6E 1N32E 4DR5E 4DR4I 3F0NA 2NPFA 4DPWA 2XEXA 2X7IA 3J80Q 2HHHE 4ZVIA 2A2CA 2VQFI 2BV3A 4DXLA 4DV5E 2A2DA 5BR8E 4GKKI 2Z5CA 2ZBKB 4KHPE 1Z5AA 3ZZTA 3WU5A 3OTOI 3J7AM 4HYMA 4DPYA 2UUBE 1Y6ZA 1ZM3A 3J81C 1ZM4A 1NHHA 4LFBE 4DR1I 1U2RA 2UUAI 2ZM6I 1Z5BA 5LMUE 1PKPA 3T1HI 2UUCI 2VF3A 3GONA 4URLA 3WU4A 4DR7E 3Q1QA 1HR0I 3QT5A 1XMQI 5IWAI 1ZM2A 1NZ0A 4LF4I 4JI4E 5FLXQ 4LF5I 3V2UC 1N0VC 1IBME 4DV0I 4JI0E 3V5RA 2PNMA 4DU8A 2IOPA 1XMOE 4IZJB 1HNZE 1I94E 4X66E 4JI5I 1Z0WA 5LMNE 4DR4E 3WU3A 1Y4UA 2OI2A 3JAMC 2Z5BA 4JG4A 1N36I 4DV2I 4DV6I 2VQFE 1ZXNA 4DUZI 1B62A 4USKA 2E5LI 4YHHI 4GKKE 4WUCA 5GMEA 4Z7CA 4DV1I 4OX9E 2HK2A 2HFSA 3OTOE 4JI3I 5A2QC 4X64I 4R1FA 4JI7I 4LF6I 4LF8I 5L3JA 2UUAE 2ZM6E 1NHJA 4FWDA 3T1HE 2UUCE 1ZXMA 2CG9A 4JV5I 1HR0E 4JI1I 3T1YI 2HK3A 4FW9A 1KKHA 3LTOA 5IWAE 1XMQE 2V8PA 4X62I 4LF4E 2J7KA 4LF5E 3HULA 4DV0E 1H74A 2UXDI 4X65I 5IT9C 1BKNA 4B3TI 4NXMI 3B82A 2BM1A 2GS8A 1N34I 3CWVA 1N36E 4LFAI 1XNQI 4HY1A 4DV7E 3PYEA 4DUZE 2CGEA 2ZITA 3WU6A 2E5LE 4YHHE 4XTJA 3J80C 4RPFA 4GKJI 1XNRI 3ZKDA 4DV1E 4HACA 2Z5CB 4JI3E 4P52A 4X64E 4LF9I 1A6FA 4JI7E 1XHKA 4LF6E 4LF8E 3B8HA 1MX0A 3Q6NA 3ZZUA 2O1TA 4B3SE 2O1UA 4B3ME 2O1VA 4JV5E 4K0KI 4JI1E 1FJGI 3T1YE 4MYTA 4NXNI 2UXCI 5FWKA 4X62E 4YY3I 2AJ4A 1HK7A 4DR6I 1WUUA 4DR3I 4X65E 1IBKI 4NXME 4B3TE 5FLXC 4DUYI 4DPUA 1B63A 1VISA 1N34E 2UXBI 1KTVA 4LFAE 2R3VA 1XNQE 1D6TA 4FWGA 2EFGA 2Z5BB 2R42A 1RREA 4LFCI 4DR1E 4GKJE 1ELOA 1Z0VA 1XNRE 4UTGA 3QT7A 3ZZ0A 4B3RI 4DPTA 2F4VI 1USVA 4LF9E 1Z0BA 1H72C 4HXZA 1FKAE 1FI4A 1Z0EA 1IBLI 1HNWI 4FN5A 4DV4I 4PRVA 4IZKB 3K17A 3PYDA 1FJGE 4K0KE 4DV3I 4JI5E 1RR9A 2O1WA 4LF7I 4NXNE 2UXCE 3J7AG 1UEKA 2GQ0A 3M6AA 4YY3E 3K1JA 5LL6R 4MYUA 2DEIA 1H73A 4PU9A 1FWKA 4DR3E 4DV2E 4DR2I 1IBKE 4DV6E 2BM0A 4DUYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX I;  1PIE A;  2X36 A;  4JI8 I;  3J81 Q;  2V2Z A;  3H4L A;  2UXB E;  2HKE A;  1H7U A;  3PYG A;  1ZM9 A;  3LNU A;  2V2V A;  2V2Q A;  3ZKB A;  4OX9 I;  4LFC E;  3PYF A;  3LPS A;  4B3R E;  1N33 I;  1J5E I;  2F4V E;  1FWL A;  4HAC B;  1Z0T A;  2UU9 I;  4JI6 I;  3JAM Q;  4JI2 I;  4AQY I;  1S16 A;  4JYA I;  1IBL E;  1Z5C A;  1HNW E;  1H7S A;  2VQE I;  4ED4 A;  4DV4 E;  1N32 I;  5GMD A;  2UXD E;  4Z7Y A;  3QT6 A;  4DR5 I;  4UT4 A;  2CZ9 A;  1EA6 A;  4DV3 E;  4KQV A;  1K47 A;  1KVK A;  4LF7 E;  2HHH I;  1Z59 A;  4DU7 A;  2WW4 A;  1S4E A;  1QZR A;  1PVG A;  4DV5 I;  1FNM A;  5BR8 I;  5A2Q Q;  4DR2 E;  3ZM7 A;  4KHP I;  4M1K A;  1MG7 A;  2V34 A;  1HNX E;  3B78 A;  1KIJ A;  4JI8 E;  4FWH A;  4PRX A;  2HKJ A;  4DV7 I;  1N0U A;  2UUB I;  4DPX A;  2DEJ A;  4WUD A;  4LFB I;  1Z0G A;  3QT8 A;  5LMU I;  2LJP A;  1NHI A;  2E1R A;  1OJ4 A;  2HFU A;  3D4J A;  4DR7 I;  1N33 E;  1J5E E;  5IT9 Q;  4P7A A;  4JI4 I;  1IBM I;  4JI0 I;  1MU5 A;  4B3S I;  4B3M I;  4I3H A;  2UU9 E;  4USM A;  1XMO I;  1DAR A;  1EI1 A;  4JI6 E;  1HNZ I;  1I94 I;  1Z0C A;  4JI2 E;  4AQY E;  4X66 I;  4EMD A;  4JYA E;  4WUB A;  2VQE E;  2Q2E B;  5LMN I;  4DR6 E;  1N32 E;  4DR5 E;  4DR4 I;  3F0N A;  2NPF A;  4DPW A;  2XEX A;  2X7I A;  3J80 Q;  2HHH E;  4ZVI A;  2A2C A;  2VQF I;  2BV3 A;  4DXL A;  4DV5 E;  2A2D A;  5BR8 E;  4GKK I;  2ZBK B;  4KHP E;  1Z5A A;  3ZZT A;  3WU5 A;  3OTO I;  3J7A M;  4HYM A;  4DPY A;  2UUB E;  1ZM3 A;  3J81 C;  1ZM4 A;  1NHH A;  4LFB E;  4DR1 I;  1U2R A;  2UUA I;  2ZM6 I;  1Z5B A;  5LMU E;  1PKP A;  3T1H I;  2UUC I;  2VF3 A;  3GON A;  4URL A;  3WU4 A;  4DR7 E;  3Q1Q A;  1HR0 I;  3QT5 A;  1XMQ I;  5IWA I;  1ZM2 A;  1NZ0 A;  4LF4 I;  4JI4 E;  5FLX Q;  4LF5 I;  3V2U C;  1N0V C;  1IBM E;  4DV0 I;  4JI0 E;  3V5R A;  4DU8 A;  1XMO E;  1HNZ E;  1I94 E;  4X66 E;  4JI5 I;  1Z0W A;  5LMN E;  4DR4 E;  3WU3 A;  2OI2 A;  3JAM C;  4JG4 A;  1N36 I;  4DV2 I;  4DV6 I;  2VQF E;  1ZXN A;  4DUZ I;  1B62 A;  4USK A;  2E5L I;  4YHH I;  4GKK E;  4WUC A;  5GME A;  4Z7C A;  4DV1 I;  4OX9 E;  2HK2 A;  2HFS A;  3OTO E;  4JI3 I;  5A2Q C;  4X64 I;  4R1F A;  4JI7 I;  4LF6 I;  4LF8 I;  5L3J A;  2UUA E;  2ZM6 E;  1NHJ A;  4FWD A;  3T1H E;  2UUC E;  1ZXM A;  4JV5 I;  1HR0 E;  4JI1 I;  3T1Y I;  2HK3 A;  4FW9 A;  1KKH A;  3LTO A;  5IWA E;  1XMQ E;  2V8P A;  4X62 I;  4LF4 E;  2J7K A;  4LF5 E;  3HUL A;  4DV0 E;  1H74 A;  2UXD I;  4X65 I;  5IT9 C;  1BKN A;  4B3T I;  4NXM I;  3B82 A;  2BM1 A;  2GS8 A;  1N34 I;  3CWV A;  1N36 E;  4LFA I;  1XNQ I;  4HY1 A;  4DV7 E;  3PYE A;  4DUZ E;  2ZIT A;  3WU6 A;  2E5L E;  4YHH E;  4XTJ A;  3J80 C;  4RPF A;  4GKJ I;  1XNR I;  3ZKD A;  4DV1 E;  4HAC A;  4JI3 E;  4P52 A;  4X64 E;  4LF9 I;  1A6F A;  4JI7 E;  1XHK A;  4LF6 E;  4LF8 E;  3B8H A;  1MX0 A;  3ZZU A;  4B3S E;  4B3M E;  4JV5 E;  4K0K I;  4JI1 E;  1FJG I;  3T1Y E;  4MYT A;  4NXN I;  2UXC I;  4X62 E;  4YY3 I;  2AJ4 A;  4DR6 I;  1WUU A;  4DR3 I;  4X65 E;  1IBK I;  4NXM E;  4B3T E;  5FLX C;  4DUY I;  4DPU A;  1B63 A;  1VIS A;  1N34 E;  2UXB I;  1KTV A;  4LFA E;  2R3V A;  1XNQ E;  1D6T A;  4FWG A;  2EFG A;  2R42 A;  1RRE A;  4LFC I;  4DR1 E;  4GKJ E;  1ELO A;  1Z0V A;  1XNR E;  4UTG A;  3QT7 A;  3ZZ0 A;  4B3R I;  4DPT A;  2F4V I;  4LF9 E;  1Z0B A;  1H72 C;  4HXZ A;  1FKA E;  1FI4 A;  1Z0E A;  1IBL I;  1HNW I;  4FN5 A;  4DV4 I;  4PRV A;  3K17 A;  3PYD A;  1FJG E;  4K0K E;  4DV3 I;  4JI5 E;  1RR9 A;  4LF7 I;  4NXN E;  2UXC E;  3J7A G;  1UEK A;  3M6A A;  4YY3 E;  3K1J A;  5LL6 R;  4MYU A;  2DEI A;  1H73 A;  4PU9 A;  1FWK A;  4DR3 E;  4DV2 E;  4DR2 I;  1IBK E;  4DV6 E;  2BM0 A;  4DUY E; 
#chains in the Genus database with same CATH topology
 3MI7 X;  4DSE A;  2KKH A;  1Q7Y T;  2VD3 A;  1JKH A;  3MDF A;  2WSE C;  1VYA A;  4GKJ J;  2HQD A;  1XNR J;  4JBC A;  1PJ5 A;  4YFU A;  2J9E A;  4ZCL A;  4C3M A;  1KNZ A;  1VOM A;  2R8J A;  4ZPT R;  5GAD U;  1Q95 G;  1F5A A;  4OI4 A;  1IJF B;  2ZC4 A;  3HJC A;  3TX0 A;  1TL1 B;  3PM9 A;  4Y2C A;  2A6O A;  2PGC A;  4B9T A;  5T7L B;  3QT6 A;  3R5A A;  4NLO A;  2AWZ A;  4DLG A;  4KQV A;  3EVO A;  4IFD D;  3BPD A;  2QFJ A;  2RRA A;  4ER8 A;  4DU7 A;  5HAT A;  2RHQ B;  2WW4 A;  3LP2 A;  5AXK A;  2DH9 A;  1TL3 B;  4Y2M A;  2PO4 A;  3R3T A;  3SZ2 A;  4CH1 A;  4DV6 F;  4LQ9 A;  4ZCK A;  3FK4 A;  3CJK A;  3NBP A;  5CYQ B;  2V9K A;  2IAJ B;  4C8Y A;  3HJF A;  2DEJ A;  2E1C A;  1DZ5 A;  3DRY A;  4DFP A;  1T3O A;  1FFG B;  5ETO A;  3KOA A;  2RB7 A;  2HWT A;  2JH3 A;  3ZXW A;  1M1G A;  3M8W A;  4UUX A;  5HAN A;  2GO9 A;  4PZV A;  3ITH B;  5KG5 A;  3AB2 B;  3OTB A;  2MQO A;  1VRU A;  4NYO A;  4ZLJ A;  4DR4 I;  3H1C A;  3HT0 A;  2QTW A;  2HHP A;  4NI2 B;  3NS6 A;  2A2C A;  1HNX J;  1FRL A;  1N5Y B;  1XR7 A;  3BDE A;  1ACM B;  3QLH B;  3BJY A;  3FFI A;  4C3L A;  3R5D A;  4UOG A;  1SUQ B;  5KG3 A;  2KT2 A;  7FDR A;  3J7A M;  3D1H A;  3OTC A;  2KJV A;  1KBR A;  1WOS A;  3PX0 A;  1RWM B;  4FYW B;  1TL1 A;  2DIS A;  5HMY A;  1DJ0 A;  5F8J A;  3GSI A;  1TMM A;  5DG8 A;  4X4T A;  2RIJ A;  2Q79 A;  2ILY A;  5HVH A;  1QTN B;  2CPE A;  1YIJ S;  4JYA J;  1BWV A;  2ASD A;  3W9I A;  4RR5 A;  4RJV A;  1VQN S;  1CJK B;  3C3L A;  1BQX A;  1Y4U A;  3RGI A;  2JX2 A;  4BBY A;  5KTQ A;  4I6W A;  3Q86 A;  2OP5 A;  2CJX B;  2ZOF A;  1S1T B;  3JQM A;  4WUC A;  1KQK A;  1QSY A;  2V0N A;  2PO2 A;  4FDF A;  3D9B A;  4JI3 I;  1WG5 A;  2XLK A;  2FZK B;  2HGN A;  1Y5I B;  5HVG A;  5D6G A;  3Q8Q B;  4EEY A;  1M1K T;  2VA2 A;  4F3M A;  1IKW A;  2ZJQ Q;  1SV5 B;  2V2K A;  2P9C A;  3DLE B;  4IUF A;  3RU0 A;  2JEB A;  1NB2 A;  4FW9 A;  3FJ2 A;  2NYI A;  3BM7 A;  2F8E X;  1D9D A;  1H74 A;  2DTJ A;  2IRX A;  2BRL A;  3BPS P;  5IT9 C;  3GR0 A;  3M9O B;  1N5Y A;  2CRL A;  2VDH A;  3MXH P;  1KP6 A;  2J5A A;  4ZLL A;  2CQC A;  3WZ0 A;  5KFP A;  4LVO P;  1HBU A;  2J7U A;  2YNG B;  1PSD A;  1CS4 B;  2BR0 A;  4RPF A;  5KOX A;  3KUE A;  3HK2 A;  2JEA B;  5A6P A;  1T94 A;  2H5E A;  3KDN A;  3O44 A;  5J2M A;  4X64 E;  2UUC J;  1U6F A;  4LF9 J;  2CWK A;  3LGN A;  2LEB A;  2KVI A;  2YNH A;  1N56 A;  2OTJ S;  4DV0 J;  4ICL B;  4JI1 E;  2ALY B;  4KGM A;  3T1Y E;  1VHI A;  1PBU A;  1OYS A;  3P49 B;  3IWX A;  4W98 A;  2VQE F;  4EUV A;  4QPT A;  2QA4 S;  1TU0 B;  1WF2 A;  4YN3 B;  2HHH F;  4AL5 A;  3OT9 A;  2CPI A;  2B56 A;  2G1H A;  3D2W A;  2F9J A;  4KSE B;  1H2V Z;  5CD4 A;  1K73 T;  4O3O A;  3N0V A;  4HI2 A;  4F3O A;  2W9A A;  2CNO B;  3OVS A;  1SV5 A;  4LF6 J;  4BA1 A;  4RW8 B;  1RB0 A;  4UUW A;  4U7U D;  3NY0 A;  1HNV A;  3HFK A;  2OPQ A;  1U0H B;  5DET A;  4IO9 Q;  4QYZ K;  1T0T V;  4F4K A;  2GJI A;  4PRV A;  5KT6 A;  2RNE A;  1LEO A;  4BWJ A;  1S6U A;  4AFF A;  4QU6 A;  2ILZ A;  1N34 J;  3MEG B;  5FDL B;  2CQ1 A;  4DR2 I;  4LRC A;  3BR9 A;  4L3K A;  4WFY A;  2ZJR Q;  2X36 A;  4PG7 A;  4E2F B;  2J6S A;  1HBN A;  4ED7 A;  2R7S A;  3H4L A;  1ZA2 B;  2HNZ B;  1GMU A;  4Z37 A;  4J9U E;  2V2V A;  4G1Q B;  4CO3 A;  3C15 B;  4JB8 B;  3MM9 B;  3V6H A;  3EZU A;  3QGH A;  3MM7 A;  4NLT A;  3LWL A;  3LPS A;  3D6F B;  4RBU A;  4KKO B;  1GH8 A;  2MJU A;  2EFP A;  2FUG 9;  1GTE A;  4ALZ A;  5F0W A;  4AL7 A;  4NXN J;  4TYB A;  1VFJ A;  2FZC B;  2XY6 A;  1HNW E;  2LYV A;  1MNE A;  4DV4 E;  5DQI A;  2RAQ A;  5A8W B;  4DUY J;  2CG8 A;  1JLE B;  4FW6 A;  4WK1 A;  1ZA1 B;  2FJB B;  4Q2M A;  3K0J A;  3UD3 P;  4DUZ F;  4IFD B;  2E7W A;  1WHX A;  4DF8 A;  1JXV A;  2HZA A;  4ZMM A;  1FKP A;  2W4D A;  2DHX A;  4LFC F;  3D4J A;  4DQI A;  2WVE A;  5HL7 Q;  4R8U A;  2OSQ A;  4YS2 A;  1BLU A;  3AOB A;  1ICE B;  3Q8V A;  5IV3 A;  1DAR A;  1M1H A;  3WBZ A;  4WUB A;  4F4A A;  1I1G A;  3SCJ E;  3ZZP A;  3SV3 A;  4K2J A;  1FFS B;  3MM6 A;  5KFT A;  1IJE B;  2XMM A;  2NPF A;  4DL7 A;  5LSR A;  3CCE S;  2CFX A;  2ZNZ A;  4NLV A;  1FVQ A;  3JQK A;  2W1B A;  1NM2 A;  4HH0 A;  3EGV A;  1O0P A;  5FLX Y;  1SIW B;  1ZM3 A;  1TZ0 A;  2OGU A;  3PW0 A;  2K3I A;  5FLX U;  2FLN A;  4LSZ B;  3KK2 B;  1OIA A;  3HD1 A;  1B4S A;  1HQ2 A;  4G3I A;  1S9E B;  1HBO A;  3I5B A;  3BGR B;  4TN2 A;  4A8M P;  5LOQ A;  3C6U B;  4DU8 A;  4IZJ B;  5F8G A;  1I94 E;  3A1Y G;  1RT5 B;  1MW7 A;  4URQ U;  2Z5B A;  1YRU A;  1K1S A;  2RJZ A;  3FDS A;  5K36 E;  1B62 A;  4KO0 B;  4YHH I;  1ZS6 A;  2C2D A;  2O1P A;  2GHV C;  3CVK A;  2JE6 B;  5DJB A;  1RWU A;  4N8N A;  2HHT A;  2VES A;  3GV8 B;  1KOO A;  1UJ4 A;  3PR5 B;  1RCX B;  2Z0G A;  3J7Z 5;  4NAS A;  3G4S S;  2WVD A;  5L3J A;  4HT5 A;  2AYG A;  2R7O A;  2JDJ A;  3PEH A;  5MAO A;  3BF4 A;  2DNZ A;  3K2Y A;  1KQF B;  4EO6 A;  3KLH A;  3TX8 A;  3E2E A;  2BR2 B;  2GHW A;  4DR4 J;  2MKH A;  2ZNY A;  3KNG A;  4B3T I;  1Q5Y A;  1PCA A;  1S1V A;  4PXD A;  2BEF A;  2W7A A;  4UZC A;  1Z2L A;  1TFY A;  2C37 B;  3WQP A;  1PBA A;  2GMJ A;  1S1X B;  4UOF A;  4XTT A;  4KV8 B;  1RAH B;  3AHP A;  3NXZ A;  2E5L E;  2BAN A;  4I64 A;  5CZX A;  3SDE A;  1E3P A;  2QX0 A;  3UVJ B;  1S4F A;  1RWP B;  2RUG A;  4MIW A;  3DLG A;  2B8P A;  2QT7 A;  4WBF A;  4RBV A;  1SCJ B;  3LO3 A;  3HVA A;  1PJ6 A;  2HW3 A;  1R8C A;  4DL6 A;  4J9N A;  1FRJ A;  4USI A;  1WTB A;  3R2C J;  4ZA1 A;  4QPX A;  4IFV A;  4X65 E;  2V9W A;  1RHQ B;  3MHY A;  1Y3J A;  3C19 A;  4OJG A;  2W2N P;  4Y6I A;  4C8Z A;  4MH8 A;  5ITH A;  5LJ3 Y;  4I69 A;  2DHS A;  3FZB A;  1RT7 A;  2Z2L A;  4JI3 J;  5JEA D;  2VFU A;  4PWD A;  1RAB B;  1Z0V A;  3M4X A;  1URR A;  3OL6 A;  4DOZ A;  5FII A;  4DUT A;  1VCT A;  3WX8 A;  1GNK A;  5D15 A;  3J81 Y;  4ITS A;  1FX4 A;  4FN5 A;  1QE1 A;  1K8A T;  1S7I A;  5K20 B;  3H2L A;  2NZC A;  4B02 A;  3TEH B;  3J81 U;  2QLX A;  1KD1 T;  2M4M A;  1S1X A;  1RTD B;  1JLB A;  2WP8 A;  4KV8 A;  4QWD A;  2E44 A;  1TK5 A;  5HVF A;  3HHL A;  2KFY A;  3TEG A;  4NLG A;  1YIT S;  1UET A;  2PDA A;  3AT1 B;  1FXR A;  4U8V A;  4WP9 A;  4ZP7 A;  3S6E A;  5T41 A;  2ZD1 B;  1VK3 A;  2FTR A;  3SYZ A;  3DC2 A;  4WJB A;  2L3M A;  2COL A;  2Z8Q A;  4ELV A;  3UDE A;  3W2W B;  5ADZ A;  3BN4 A;  3BSC A;  2P8I A;  1KLN A;  3P45 B;  1IKV B;  1HLW A;  4PXB A;  1Z0T A;  2XG8 A;  2C2E A;  1RTJ B;  3IG1 B;  2Z4P A;  2HHV A;  2VC1 A;  2AD9 A;  4H4O A;  1R8P A;  1JLQ B;  1U4B A;  5ETP A;  1R8B A;  2VBW A;  1NDC A;  4OYM A;  4J9R A;  2EI5 A;  2WNR B;  1USU A;  2HKJ A;  1W2I A;  4DSJ A;  1FER A;  4QWB A;  1UW9 A;  2J8S A;  3I0S B;  3FNN A;  1I3O B;  1Q4R A;  2FC9 A;  2M52 A;  2ROP A;  4IH6 A;  4FNI A;  2IA6 A;  5L38 A;  5KFZ A;  2VBX A;  4CNY A;  2BA1 G;  5CAB A;  4KHR A;  1IBM I;  2R2U A;  1F0X A;  4JI1 F;  3T1Y F;  1Q86 T;  2DGV A;  1KQG B;  1HMV B;  4CLL A;  4X4P A;  1S6Q B;  2EK1 A;  1DFD A;  2UXD F;  3JYT A;  5CA5 A;  2JRS A;  4DR2 J;  3AQP A;  4NCB A;  3QO9 A;  1U45 A;  5BR8 E;  4F8R A;  2DCL A;  2EEY A;  4WIQ A;  4KHP E;  3J7Y I;  3MD3 A;  4CZC A;  2DGS A;  2EFN A;  4V1A k;  4MK8 A;  1YJ7 A;  5KT7 A;  2GVZ A;  3PZP A;  2XNQ A;  6FDR A;  1ROF A;  4O3R A;  1N8R T;  2PO1 A;  1P42 A;  2YX1 A;  4DR7 E;  3CME S;  4XPE A;  2A6M A;  5K36 A;  5ETQ A;  1J5E F;  2R8G A;  4LF5 I;  2LA6 A;  2HIQ A;  1WG1 A;  2IPO B;  2HVI A;  2KG0 A;  3FKB A;  3FBB A;  3UN5 A;  5LMN E;  2VFS A;  4I0W A;  4DR5 F;  4LRF A;  1OY6 A;  4ED2 A;  1S0N A;  1CJU B;  3TAP A;  3MEC A;  2YH1 A;  4B9U A;  3DRS A;  4DL5 A;  1S6O A;  5D0E A;  2CQD A;  2L08 A;  3ZO7 A;  3GCM A;  2B0G A;  2YWK A;  5K5M A;  1SH2 A;  4CM2 A;  1VLO A;  1C4C A;  3LGH A;  3VVU A;  3CUN A;  4X64 J;  5HK4 A;  2PE8 A;  2MY7 A;  5H9F J;  1NHJ A;  3Q8R B;  1D8Z A;  3AH6 A;  5EHH A;  1T9X A;  1J2V A;  1JNR B;  1UFW A;  1HMV A;  2HK3 A;  4URG A;  1XMQ E;  3U1K A;  3L7Z B;  1HNW F;  4LF4 E;  1UVK A;  3HUL A;  2KH9 A;  3VGV A;  1RAJ A;  1UDQ A;  3I0R A;  4WPA A;  4Q8E A;  4CLP A;  4A8K A;  3BKT A;  2D3O 1;  4PWU A;  3TRG A;  3PY8 A;  1RWV B;  1P8G A;  3AFG A;  2I2Y A;  4UQT A;  3M7N D;  1QSS A;  5JVG Q;  2DCU B;  1PYS B;  3VTI A;  4UOH A;  3I82 A;  2DHA A;  2ZIT A;  3QZ8 A;  2CVE A;  4NZ6 A;  4C6A A;  5C24 B;  2V67 A;  4KQZ A;  5IM0 A;  4GO5 X;  1B70 B;  4HAC A;  2MQ8 A;  3CJ3 A;  3LOU A;  1U49 A;  3FEZ A;  1YKW A;  2QE5 A;  1DTQ B;  3MMJ A;  4M5G A;  2J0S D;  2C1E B;  1BQN B;  3Q6N A;  1S6P A;  1BMQ B;  1MU2 A;  1L5U A;  3T1H F;  4M63 A;  2O1U A;  1VJQ A;  3M2R B;  5D4O A;  4QNJ A;  1E6V A;  4ECR A;  4EI2 A;  3EIC A;  1FEH A;  3G2X A;  2OEJ A;  3G9C A;  2CJA A;  3CC2 S;  2DNR A;  3Q22 A;  3DXS X;  2V69 A;  3MEE B;  3NWR A;  1RT1 B;  4LRD A;  2ACM A;  4YHH J;  4QU7 A;  4X4U A;  4QWC A;  3FBC A;  3GII A;  3MMC B;  3TUJ C;  4LFC I;  3HHD A;  1F1B B;  4P71 A;  2ZH8 A;  2OML A;  4UTG A;  2M0G B;  3H2V E;  4RNO A;  1N4L A;  1UTA A;  2YNI B;  1Z0B A;  4OO1 A;  1JXL A;  2ZE2 A;  3ET6 A;  4C97 A;  1FI4 A;  1Z0E A;  1G7C B;  4K4Z A;  3ZZO A;  3R2D J;  2MYF A;  4IZK B;  4DV4 J;  3M6V A;  1ARO P;  1I94 F;  1KWM A;  4B3T J;  2GQ0 A;  2XYH B;  2E7V A;  4OQJ A;  4HHJ A;  4PU9 A;  1NDP A;  3MM5 B;  2KM8 C;  4P9S A;  1XXE A;  2XSF A;  5K36 F;  1LQ9 A;  3KK1 A;  3MED B;  1RAF B;  3WIV A;  1ZZN A;  2RSQ A;  5AXN A;  4HHU A;  1OO0 B;  5J2Q A;  3RJM B;  3TYT A;  3SQG A;  4IQX A;  3ZKB A;  1HD1 A;  1D8Y A;  5JXS A;  2W9B A;  3J7A N;  2U2F A;  3R7S B;  1IWA A;  4DR1 F;  2ASL A;  4QYZ J;  3US5 A;  3NKY A;  2MGZ B;  1M5S A;  1FTC A;  2B7C B;  2DBB A;  3CF5 Q;  3LP0 A;  1Y0H A;  2BE7 D;  1JLA B;  5I42 B;  5IXU A;  4OI3 A;  5CYM B;  1SH3 A;  3PW5 A;  3HKW A;  2EKN A;  3HI9 A;  1WC5 A;  2B9X A;  3N01 A;  3M2U B;  2CJ9 A;  1J5O B;  4DV3 E;  4ES2 A;  2WTF A;  2FJE B;  3W62 A;  1OSD A;  2UV8 A;  3JXO A;  3D6H B;  3GG0 A;  3MR3 A;  2E5L F;  2GJ2 A;  3A8I A;  4R25 A;  5AXM A;  1DLO B;  4WUD A;  3QT8 A;  3NNH A;  2UVV A;  3KHL A;  3R27 A;  2ATL A;  4EFA C;  4NA2 A;  2BKP A;  2HFU A;  1KTQ A;  2M9K A;  1F3F A;  2FY8 A;  4IZK A;