3LTOA

Crystal structure of a mevalonate diphosphate decarboxylase from legionella pneumophila
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
b'MHWFAQAPANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIPGAPEFNLSVEAQKRFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTKCASIALSELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALWTGDKVSAIDLPYKDLLHQVIVISSQEKEIPSRVAHKLVKTSPFYETRSERAEANLKLLLNAFENKDWTSIYQICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVVTMDAGPNVHLLYRSDQTDLARQFKSDHLVGNYDVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate diphosphate decarboxylase
publication title Crystal structure of a mevalonate diphosphate decarboxylase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Lyase
total genus 105
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 4.1.1.33: Diphosphomevalonate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18376 MDD_C Mevalonate 5-diphosphate decarboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3ltoA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3ltoA01
1I94I 4X64E 4LF7E 3HULA 1ZM2A 2UXDE 1PVGA 2V2QA 4XTJA 4LF7I 2HKJA 2UXDI 2XEXA 4DPUA 4Z7YA 4DV4E 4NXNE 4DV4I 4ZVIA 2J7KA 2HK3A 1RR9A 4I3HA 4LF8I 1H7SA 4MYTA 4FN5A 2F4VE 1KVKA 2HKEA 2F4VI 3ZZ0A 3T1HI 2UXCE 1BKNA 1MU5A 4JI6E 2EFGA 1NZ0A 2GS8A 4X66E 1ZM9A 5FLXC 3PYFA 4JYAE 4X66I 1Z5BA 1Z0CA 1ZM4A 4NXME 1Z0TA 4Z7CA 3QT7A 3WU4A 4DUZE 1XNRE 5IT9Q 2V2VA 1VISA 4R1FA 1QZRA 2HHHE 4DUZI 1NHIA 4DV5E 4P7AA 1XNRI 1H74A 3T1YI 4DV5I 4LF6E 2R42A 4DR5E 3OTOI 1IBME 4ED4A 4LF6I 4DR4E 4DR5I 1IBMI 4DXLA 5IT9C 3QT6A 1MX0A 3J7AG 1Z0EA 4JG4A 3ZZUA 1HNZE 3H4LA 2V2ZA 2V8PA 2E5LE 1HNZI 3CWVA 2VQFI 4LFCE 4LFCI 2OI2A 3PYEA 1N0UA 1EA6A 1Z0BA 1WUUA 4DPXA 3ZZTA 4LF9E 5BR8E 2HFUA 1XHKA 1J5EE 2WW4A 1N36E 3LNUA 3V5RA 1ELOA 4LF9I 5BR8I 4LFAI 4DV6I 2ZBKB 4DV7I 4UTGA 4LFBE 4GKJI 4DR3E 1KTVA 4DR3I 5L3JA 4RPFA 1FWLA 4X64I 1NHJA 4JI8E 4OX9E 4JI8I 3B82A 3B78A 1ZXMA 4OX9I 3WU3A 4NXNI 4YY3E 4DPTA 1H72C 4YY3I 4DV1E 4JV5E 3JAMQ 2LJPA 4DV1I 3K17A 4JV5I 4DR1E 4PU9A 1ZXNA 4DR1I 1PIEA 2AJ4A 1B63A 2BM1A 3K1JA 4JI7E 3QT5A 2UXCI 4JI7I 4DPYA 4JI6I 3JAMC 2HK2A 1HNXE 3J81Q 1HNXI 1NHHA 4JYAI 4EMDA 4NXMI 1K47A 2A2DA 2UUCE 1N32E 4JI3E 2UUCI 1N32I 2HHHI 4JI3I 1B62A 4GKKE 4KHPE 1EI1A 4B3TE 1MG7A 4GKKI 4KHPI 4AQYE 4DR4I 1Z5AA 3Q1QA 3WU6A 1FWKA 4AQYI 1RREA 5LL6R 1XNQE 2R3VA 1IBKE 4WUDA 4JI4E 1DARA 3J80Q 1IBKI 2E5LI 5GMDA 4JI4I 3ZKDA 3ZKBA 2NPFA 4WUBA 1FNMA 4JI0E 4B3RE 5GMEA 4HACB 2CZ9A 4JI0I 4B3RI 4FWGA 4DR6E 4HY1A 2UUBE 4P52A 4DR6I 1S4EA 3B8HA 4DV3E 1J5EI 2X36A 1N36I 4DV3I 2UUAE 1HNWE 4LF4E 1HNWI 3QT8A 4YHHE 4LFBI 2BV3A 4B3ME 4LF4I 4YHHI 5LMNE 4DR7E 4B3MI 1N34E 4JI1E 5LMNI 4DR7I 3LPSA 1N34I 1Z0VA 4B3SE 1D6TA 1Z0WA 4UT4A 2A2CA 4B3SI 4K0KE 2HFSA 3WU5A 4DV0E 4PRVA 1KIJA 1I94E 1Z5CA 1FJGE 1FJGI 4FWHA 4DUYE 1FKAE 3GONA 1FI4A 4FWDA 5LMUE 4DUYI 1XMQE 1H73A 5IWAE 4LF8E 3M6AA 2X7IA 5LMUI 1XMQI 5IWAI 4HYMA 1Z0GA 5FLXQ 4X65E 1HR0E 3T1HE 4X65I 1HR0I 1OJ4A 2V34A 2E1RA 4DU7A 2ZM6E 3J81C 2ZM6I 4JI5E 4JI5I 4USKA 4HXZA 4KQVA 4B3TI 4PRXA 3D4JA 3PYDA 3LTOA 3T1YE 2VF3A 4MYUA 3OTOE 1XNQI 2UU9E 1UEKA 1N0VC 1XMOE 2UU9I 1XMOI 1IBLE 3V2UC 4DV2E 1IBLI 1S16A 5A2QQ 1A6FA 1ZM3A 3J80C 2VQEE 2VQFE 4DV2I 4USMA 2VQEI 3ZM7A 1N33E 2UXBE 1U2RA 2UUBI 4DU8A 4JI2E 1N33I 2UXBI 4M1KA 4DPWA 5A2QC 4JI2I 1Z59A 2UUAI 3PYGA 4X62E 2DEJA 4X62I 4URLA 4LFAE 4DV6E 2ZITA 2DEIA 2Q2EB 3F0NA 4FW9A 1PKPA 4DV7E 4JI1I 2BM0A 4GKJE 4WUCA 4LF5E 1H7UA 4DR2E 4K0KI 4LF5I 1KKHA 3J7AM 4HACA 4DR2I 4DV0I
chains in the Genus database with same CATH superfamily
1HWLA 5CYMA 5L39A 2ZBPA 5HJYA 1EZZB 2PO2B 2DD8S 4LFAJ 3JTPA 3M6UA 3PJ9A 2FGCA 3MPDA 4Z37A 2RS8A 2KI2A 4MJKA 4J9SA 5FD1A 1FRXA 5KFXA 5KOWA 1UMJA 1HR0F 2QJ3A 1LQ9A 2UXDJ 5D78A 1VQPS 4DQQA 2UXCE 5F8MA 1MU5A 4NA2A 4NXNJ 2J9DE 2CPHA 4LRAA 1OQ3A 1GMWA 1VBKA 5C0XF 1K0TA 1RHMB 2VJUA 3ENVA 1TUGB 4JI7J 2MDAA 1TKZB 1SCJB 2JC1A 1HBUB 1NKEA 3J81U 2RU9A 1JLEB 3WBZA 4NYZA 2HHHJ 1WG1A 5H9FK 2DHHA 2HQCA 4NZ0A 4M5KA 2B6AB 4Q8FA 1WUUA 2AGPA 1HHTP 3TZZA 5CYMB 4QIWD 1LFWA 1WTBA 5KFKA 1OYPA 3J7A1 4MH8A 4GKJF 2KT3A 1W2IA 1T7PA 4GKJI 5C25A 2YKPA 3NRBA 4DR2F 3ISNC 5KFQA 1QY7A 2OPRA 3HSJA 1MN9A 5L3JA 1FDNA 3LGMA 4ICLA 4LRBA 2JT2A 2X3DA 3KYLA 3OLBA 2R7QA 3U1LA 4RBTA 3GPAA 5F0UA 4F4AA 3HI9A 2VB6A 4IO9Q 4ECSA 1RU1A 1X9SA 4J9PA 4Y6IA 3KHGA 3T41A 3THPA 3K5PA 3OFEA 1KR4A 3VAJA 5C0XD 2C2ZB 4JV2A 5B0DA 5B7WA 5F8NA 4LF6F 4KHPE 4CIOA 3J7YU 2XB2D 4NLOA 3DFEA 4L75A 1HKAA 1CLFA 4P2SA 4EBCA 1QAIA 1R8AA 2DIVA 5H1SV 3ENWA 2VFTA 5DS7A 1X0FA 2UVWA 3H4BA 4KHRA 2EFOA 4WFNQ 1FNMA 2OPRB 4C6AA 3M6WA 4R0EA 3GJSB 4ICLB 3AH6A 3PHEA 3QRQA 3GFHA 3NBPB 2QMWA 3TQ1A 3NCQA 1BQNB 5HQ8A 4PQUA 3VHQA 2Y1IA 4LQ3A 4FXWA 2VV5A 1YZ6A 2J0XA 2WVBA 4DR6J 2DGTA 4GO7X 2R2TA 4J9NA 2QN6B 5CXTA 2AJ1A 2HHPA 2XWYA 4DHVA 1CJKA 1UL3A 5C0XB 3OL9A 2Y0BB 4KJIA 2PE8A 4JV5F 2ACMA 4Y34A 1SV5A 3UPFA 1NJYA 4JI1J 3VAFA 1PO6A 5E3QA 2ALYB 1P27B 2XHCA 4WE1A 2LXFA 3IN5A 3PKYA 2GX8A 4DUYI 2M52A 3KDNA 2CQPA 2M8HA 1XMQI 1PC5A 1U2CA 3P3DA 4OI0A 3K5NA 1JLFB 4Y0FA 4TU9A 4PKDB 1UDOA 1F6TA 3T1HE 1KEKA 2W9BA 2YH0A 2XMTA 1VQSA 4WZQA 3NNCA 2B43A 1UW9A 4EO6A 2EFPA 4DV4J 3O8WA 5JJBA 2IM1A 4GKKF 3NMRA 1DQ8A 3IXQA 1TZ0A 1NDCA 1F9FA 1U48A 3LTOA 4X65J 4H4KA 5E2QA 3R1LA 1FFSB 1JXLA 4NLGA 3LP1B 3FRYA 4K4XA 5KFLA 1NEEA 3KDOA 3CCLS 5KT3A 2ERRA 5J1PA 3GIRA 3PIOQ 4G65A 4KGMA 4U3BA 2VL1A 3OL6A 1CJKB 4KH0B 1RT3A 3W9JA 2VKZG 1CSJA 4URLA 1FRLA 2WW8A 1SV5B 2N3LA 5F8IA 5A0YB 4P71A 3ILLA 1ZAVA 2EC0A 1H7UA 3W7BA 5JVGQ 1RHQB 1S0MA 4LSZB 3CF5Q 1AFJA 4OV1A 1F2GA 2PEBA 4EYIB 2UXDI 1PSDA 1LWEA 1VBZA 2L9DA 2NZCA 3TAPA 3BQ2A 1WSRA 2WBRA 2QGFB 3NKYA 1FXRA 1FRKA 1WG5A 1H7SA 2XZWA 4WIIA 5T7LB 3FZBA 4RNHA 1O8BA 2F4VE 3R6LB 1MU2A 3E2EA 1WI6A 4LVOP 1HA1A 3MTJA 2V50A 2MJUA 2ZM6F 4OX9J 2WP8A 1OPZA 4AE5A 2EK1A 2F7VA 2HYIB 2ZJQQ 4RNNA 4DX7A 2C2MB 1WC3A 5K8NA 4FP9A 4P7AA 2Y3YA 3K58A 3CCMS 1S12A 2GA7A 3CMES 4DR4E 2Z8QA 1Z0EA 5F8LA 5FWKA 1ZAXA 1HWUA 4W90B 3H4LA 1IXKA 2KTQA 3M9MB 1ZETA 3L95X 3LP0A 3IM8A 2VQFI 1FNXH 3MR5A 3QGIA 3IGNA 1N33F 4OYPA 4JI2F 4KGKA 3FBBA 2JC0A 1G7CB 1Q81T 3PFOA 3Q6NA 3OTDA 3CDBA 2LQJA 5CD4A 4USIA 5K5MA 1Q8KA 4ZVEA 4IO1A 3CCZA 2Y9HA 1OYDA 4TQSA 3KRNA 1NRKA 1LWEB 5DRRA 2PO0A 1EJ7L 3SCJE 1FD8A 2AHOB 2PIIA 5ETKA 3PS3A 3HT3A 2DO4A 1YJTA 2E29A 2XBPA 4RPFA 1MU2B 3T5JA 2XNRA 3L7ZB 1E6YB 2CQBA 2I0XA 4OJ1A 2WP8B 5LXYA 5BYRA 1S57A 2VASA 2V8DA 3DRSB 3AXKA 2FUG9 2BA1G 2MKCA 2YPYA 2HQGA 2Q6BA 4WP8A 5I3PA 2BJ8A 5E3AA 4JI7E 5HVGA 3KUHA 4MTPA 1SVDA 3AAWB 4YY3J 5GAGU 2ZVIA 2XWXA 4IDKA 1YJ7A 1LNQA 4HKQA 4DLGA 1IR1A 2C3MA 5A8RA 3L9ZA 3EICA 4JI3E 1SKWA 1NO8A 3LP0B 4CNZA 1NSAA 2YNFB 1XXEA 4PG4A 1S7IA 4KFBA 1Y3KA 2FY8A 1RKIA 3PX4A 1UPPA 2HNDA 2IVMA 3H1CA 5LL6R 1XNQE 4MKAA 4KE5A 1G1XA 5DGAA 2PO0B 3UI3A 3CJQA 4V19X 3J80Y 4B3TJ 4EU0A 4JI0E 3LPEA 5JVHQ 5I42B 4DR6I 3CD6S 1F60B 3M32A 4QW8A 1SH2A 1S79A 1HNWE 1B64A 5LJ3Y 2CGEA 5RUBA 1F9HA 1DURA 2V68A 3MXHP 1S7HA 4DR7E 2EW9A 3QZ7A 4WFXA 1Z0VA 1YHCA 5GVQA 4IFVB 2UXBJ 5IC4B 2IJRA 2UUAJ 2DGWA 2XMMA 3NZKA 4D3GA 4ZP8A 2C1EB 4F2RA 2FDNA 5LMUE 4LF8E 2Z0GA 4QYZK 3R5BA 1R27B 3PVXA 5FLXQ 4O0NA 4K2JA 5HANA 1YSJA 4NCGB 1FXDA 2MQOA 4LF2A 4X65I 1RHKB 3PS2A 2JVRA 3FQLA 4BBYA 6FD1A 4PPDA 2DPIA 4ZLPA 4M8LA 5E33A 3A3OB 2WVEA 3RZAA 2JEIA 2ZNZA 3NGSA 1TV6A 3GFYA 1IVZA 1UETA 3Q2TC 2YQ1A 3HT0A 4QPXA 5U47A 4R8UA 3BZQA 2CPFA 2VF3A 1TKTA 3C8YA 1Q8LA 3A8KA 2JFKA 3M32B 3C3LA 1JNRB 5BXIA 2IRUA 1VK8A 3I9ZA 2O01C 5KG1A 4FNIA 2AW0A 4LQ9A 2MPUA 1URNA 2CWKA 2XMVA 4XTTA 1NH8A 1B0TA 4I2QB 1Q86T 2OPQA 1B7FA 1R8HA 1QUPA 1VQNS 3SXLA 4CCHA 4C8OA 4W92B 1WELA 1VIOA 1TTHB 4UOHA 2YWFA 3UDEA 5LSLA 2QO3A 2V5HG 3TI0A 1YWXA 4LF9J 2MKSA 1BQXA 3G6YA 2FJXA 4J90A 4DV4E 3M7ND 3MM5A 3FFIA 5G0RA 2UV8G 1CC8A 4K4ZA 2YQ0A 5HI7A 3PW4A 4UZCA 3Q83A 2AYGA 3DDKA 2JEAA 3QPIA 5IT0A 1RT7A 1VRQC 2KM8B 1VBYA 1RBOB 2CQ1A 4R8UB 3G96A 1VBXA 4WK3A 7AT1B 2GS8A 2XZDB 1ZM9A 1T9WA 1EQMA 5AXMA 4FPIA 1ZM4A 2FZGB 1GFWB 1B99A 3NS5A 4DX5A 2DXEA 3EGNA 2W4DA 2FJAB 1XNRI 4DWIA 1GX6A 4MAKA 3I5AA 1D9AA 1KOHA 4L3KA 2XMAA 4JBCA 2AX0A 3BO3A 1IBLF 2NSCA 3NS6A 3ZC4A 4USHA 5K9FA 2AE8A 2OPQB 3KNAA 4C4WA 3QGHA 2HNZB 4BWMA 2AU0A 5I3QA 3OFFA 2L9NA 4H4KC 2XHWA 3D66A 1N36E 2SXLA 2H4WB 1OWXA 2L3MA 3MM5B 3OTCA 5HN0A 5G0RB 1TFYA 2HWHA 1RAHB 3PV8A 1KLMA 4ED0A 4P2FA 2V4RA 4OHVA 2JEAB 1RT7B 1UVKA 4OX9E 1JKHA 3H5YA 2YWHA 1FERA 4YY3I 3GIKA 2ILZA 1AB8A 2Z58B 4RWWA 4EWTA 1B63A 2UXCF 4LR9A 2O1TA 2VZ9A 3DYAB 2UXCI 3LWLA 2DXFA 3DKDA 1C4CA 4QIFA 2WTFA 1FDDA 2QIFA 5B0CA 4HTIA 1YJRA 2C37A 4QQBA 3THVA 2Z5CA 4K2XA 2XSJB 4OZ2A 2G9OA 5GMKa 4DZ6A 1FE4A 4CLYA 1GH8A 1BQMA 1E3HA 3MEEB 1JK9B 3N4WA 2NUUG 1UFKA 3ZKDA 2ROGA 1BE4A 4HT5A 2W24A 1C1CA 5A76A 1XN9A 3AT1B 5EX3A 3GV8B 3EE3A 4M5GA 4AQYJ 1RT6A 3NNHA 3CW2C 4WYLA 4DSLA 4HY1A 3W9IA 3ETMA 5E7OB 5BYSA 4ITSA 1JKHB 2K7JA 3R6GB 4B02A 4Q43A 2BYCA 1R7IA 2WCXA 3BBBA 4LSLA 3NXZA 1J2VA 4LF1A 2HFOA 2UUBJ 3OTBA 5DROA 4OO1A 2PO1A 2FC9A 2HQIA 3MOJB 1YK9A 1EKRA 4OO1D 4EFAC 2FTRA 1JMTA 4U96A 5LMNJ 4K5SA 3BKTA 4B9MA 2DNNA 1MWQA 3MOZA 1S6PA 4B9VA 3OSPA 3D3CJ 2IA0A 1M1KT 5KT5A 1I94J 3HVWA 3GV5B 4IFDA 1OS5A 1U0HA 4CRJA 2F9JA 1M1HA 1RWPB 1HQEA 4KHPF 4ZCMA 5KFZA 5IFMA 1C1CB 3KK1A 1NM2A 2FIUA 4ILLA 4PRXA 1VC6A 2ZZNA 2VG6A 2H1YA 4CM0A 1RT6B 2XLKA 3IWXA 2ZH1A 2C2RA 4J91A 3R97A 2L9WA 2EFNA 2V8HA 1LK7A 4ELVA 3V2UC 2HVDA 2KT5A 4IUFA 2BJ1A 4DV2E 1MSWD 3FQKA 4FDFA 4OKGA 5EWGA 2UXBE 4IRCA 2Q3PA 4DQRA 2LU1A 4OO1B 3JSYA 1IBMJ 2KYZA 5A2QC 5CQGA 3NCRA 2QFJA 4WYWA 3BGFA 3IC1A 4IRDA 1O5JA 2KH9A 4U95A 2XLJA 1NK0A 4DV7E 3CB4A 1NZ8A 4HEA9 2C2NA 4DZDA 1S6PB 2MB0B 5AJ3F 2WB1D 3TP2A 4QIVA 4WK1A 4OQJA 3QSYB 1PJ5A 4BCAA 2XM3A 2O67A 1U0HB 4WU3A 4DX6A 4YMEA 3QGGA 4O3PA 1S1TA 5EL9A 1NPRA 2MEWA 2Z4PA 2HLTA 1HQEB 1R8CA 5KG2A 1RB0A 3OTEA 1ZZNA 4X64J 3T1HF 3ZTRA 2BR0A 3T1HI 3FKBA 3LA0A 2GO4A 3VF0B 4MIWA 3MEGA 4LRDA 3HSZA 1U25A 3VVTA 4NXME 2KG1A 1SKRA 1FDAA 3SBMA 1H38A 1Y5YA 3JQJA 2ZD1B 2E1MC 2OTLS 1NHIA 3K5LA 2W7AA 3GCXP 4F4WA 4OL8A 4L74A 3I56S 1S72S 4HHHA 3K8VA 2AV5A 1T0TV 1MX0A 3TEHB 2F4FA 1S1VB 3IG1A 1SKUB 5K36E 3KFWX 3CDUA 4DR5J 2VC0A 3GCWP 2K1RA 4CTAB 3DLHA 2BKOA 3MGJA 5HK4A 4YR2A 4M5DB 3THTA 4LF9E 3C6TA 3HD1A 1PAEX 2GMHA 2PGCA 1NSKL 3H5SA 1H2TZ 1C1BA 4OMFG 1R6VA 2DRBA 1V9OA 2M0GB 4F04B 5EHHA 2RE1A 1U09A 1FKOB 2YVSA 1SC4B 1O6XA 5L46A 2QLJB 2W7PA 1D9DA 1W7WA 3PKMA 1QD1A 3MEGB 4LF4J 4LVNP 4DR3J 3FGVA 4TKTA 3BGUA 2F4VF 3LQVA 2CNOB 1YRUA 2CQDA 3CD7A 4FW7A 1F5AA 4QU6A 3HDSA 2CZ4A 2NPIA 2H3EB 3FBEA 2XO7A 5J2NA 1DJ0A 3EVOA 2DNRA 2J5AA 2U2FA 4DR1J 3A8EA 2DVIA 2XG8A 4CM2A 4NLSA 3FMWA 2X1BA 3OTOF 4ECXA 3O2IA 2UUTA 2NN6E 1MG7A 3AQPA 2MXYA 4DR4I 3QO9B 1VQ4S 4AQYI 4IZJA 2YKMA 3W2VA 4NLPA 5CCMA 3GV7B 3J80Q 3PTWA 4ER8A 1GNKA 3ZKBA 2G1HA 4MFBA 3OXLA 4ZP9A 1NXIA 4LSNA 5J2MA 1UW4A 1YGYA 4Y2IA 1WTFA 1TU0B 3KG0A 2F1DA 4JI4J 2FVCA 1R8BA 5SUHA 4J9LA 1T8EA 2YH1A 4WP9A 4MK7A 2OIHA 4PAAA 4CLWA 3H25A 1TR0A 4CH0S 5LMNI 2VHGA 1S97A 3I87A 1N5TA 5FJ4A 2P8IA 2HFSA 3TX0A 2QLXA 3AA9A 1FEHA 5J2NB 1FJGE 2WHOA 2O1VA 3CSKA 1ACMB 2A10A 3C14B 4JI7F 4FWDA 1URRA 5AXKA 4DV0J 3N5FA 1KC8T 2GAHC 3WX8A 2YWEA 1QE1A 3WX4A 4GC6A 4OYWA 1I3OB 4M5LA 4FXDA 3W9HA 4JI3F 1IWAA 1XEZA 5MAOA 1D09B 4ANDA 2YWKA 1T11A 5ETLA 4LSNB 5J2MB 1FNOA 3PYDA 1NB7A 3CJ2A 3KXDA 3Q8RB 4ZPWR 1XNQI 5A8WB 3GR1A 3L4BC 2XS5A 2RQCA 3MEDA 5AE3A 1RDRA 3OVBA 1WC0A 1IN0A 1XQIA 1Q16B 2UZAA 4JI0F 2IMOA 1AUDA 4YEAA 4DUZJ 1YBAA 2MY7A 2AF6A 2DNPA 3ZM7A 1ZYQA 5DQHA 1QVGR 2A6OA 3MUTP 1HNWF 3JS9A 4ID5A 1X9MA 5KFDA 3UW1A 4DR7F 3I4HX 2BRKA 2VQEJ 5IM0A 2YNIB 3TUPA 3K0JA 2FHJA 2XYPB 2VOOA 3MMCB 1M5SA 5D0EA 2BQ3A 4MKYA 4OLOA 2CKWA 1OMSA 2KO1A 2FD2A 2IMWP 1QE1B 4J9OA 2Q43A 5D0HA 3BS9A 2XGPA 2AZ1A 1BMQB 4DV6J 3G71S 2FLLA 2IM0A 5LMUF 4LF8F 4ED6A 1C2PA 4LF8I 5EX0A 3OW2R 1WEYA 4W4MA 4DOZA 1CJVA 3TRGA 2MSTA 3AD8C 5ETRA 2XTJP 1TQLA 4OO1C 4BC9A 1RCXB 4P2XA 3KJFB 5FLXC 4X66I 4RZRA 5ETOA 5ITHA 3IAM9 3TJ8A 2MLXA 1IKXA 2ZVSA 5K14A 4N76A 2BUNA 4LMZA 3JYTB 1H74A 1UZHA 4CO0A 1IBME 4OX7A 4EBDA 4DR5I 1HNXJ 4IFDC 4ID5B 2HRTA 1NHUA 2V2ZA 1U45A 4PG5A 4Y2CA 5IM0B 2ZKUA 5HVFA 2HWIA 2D9PA 3CPWR 4CH1A 4E0DA 3M7NG 4DFMA 3LGNA 1U1OA 4ES1A 1SUQA 3BJYA 1AYEA 5H9EK 3I0SB 5F8JA 3H59A 1LW2A 3LNUA 3BO2A 2CJQA 2CJKA 4K4SA 2ZJPQ 3TX8A 4YP3A 1PCAA 2OEKA 4Y2AA 2PI4A 1VQLS 4KKOB 4DR3I 1OIAA 4F8RA 3M2VA 5KFBA 3OPKA 1ZAWA 3CDEA 5BR8J 3VTIA 1U4BA 1J5EJ 1P1TA 4DV4F 1UJ5A 2ZH2A 3KG1A 2VFSA 3ET6A 2H51B 4DPTA 1J5OA 1O0PA 4DV1E 3FEZA 2LQ8A 5J2PA 1IKXB 2N4CA 4DR1I 2CQ3A 4HT7A 4B3SJ 5KAKA 3PO4A 3JAMY 4QU7A 1LWCA 2DHSA 1UA1A 1ZTTA 1FVQA 4I7FB 4P9SA 3HJCA 2YBVA 5G4DA 2NYIA 2JVOA 2UUCE 1LXNA 3K5MA 3ITHA 1N32E 2XCAA 1S10A 2IAJA 2PNZA 3W8GA 1W25A 3HFKA 2QA4G 4EI2A 4OJGA 1S6QA 1HBOA 1YH8A 4B08A 3LALA 3CC2S 3IWNC 2ATLA 3C66A 5JUMA 1Z5AA 3NG8A 2K7KA 4N41A 3CJ8A 4JI4I 3MM9A 5GADU 3CCSS 2RVJA 5IQ6A 1T05B 1MWYA 3B4TA 2OO4A 4FWGA 4DQIA 1ZA1B 2Q1LA 3RB4A 4GVBA 5CAAA 4F3OA 1N36I 4OJ3A 5LT5A 1HBMA 4LF4E 3ET6B 4ZVPB 2CDRB 4FF1A 2M88A 1D8ZA 1J5OB 2CJ9A 3IA0A 1RBAA 4IR9A 1N34E 2CJXB 3MAHA 5J2PB 2X1AA 4EUVA 3NOCA 1UFWA 2BR2A 4ZOSA 3M8ZA 3UVJA 4OX9F 4RUBA 2R7UA 4USTA 3HKMA 2VPYB 1JLCB 1BWEA 1LWCB 1UVNA 1S48A 3DDNA 4CQ1A 3V6KA 3SEOA 2FB0A 2WOMA 1MROB 3AD9C 2CNLB 2V8GA 4KRWA 2NXEA 1N6QB 1XERA 2IAJB 2PNZB 2ADBA 4OYIA 4F4KA 3DLGA 1P6TA 5D6GA 3DGVA 1HBOB 4ED5A 1C4AA 4PR6A 2FLPA 5LL6d 3OVAA 1LWFB 4RU2A 2GC8A 2YKAA 3H2LA 4JP8A 3CCWA 3LP2A 4FVMA 3SQOP 1T9UA 3MM9B 1NKBA 4C11A 1M1GA 3V6DA 3AJDA 2LVWA 3TEGA 1M0SA 2R8HA 2B3TB 1S1XB 2OAUA 5DG8A 2C3OA 2FLOA 5HP1A 1RKJA 3HXMA 3OR1A 2F1FA 1DFDA 1U24A 2UU9E 4GVBB 1XMOE 3CTRA 1HBMB 4A8XA 1S1UA 4K4WA 1A6FA 3IWLA 2VQEI 1RSCA 4ELTA 2BR2B 3UVJB 3CD5A 2GVDA 2R7TA 2A1BA 2KU7A 3KLGA 1Z59A 4UY85 2MYFA 4ZVQB 2DEJA 1VDHA 2JRSA 3CE8A 1HNZJ 4DSFA 1SJRA 2WOMB 3V6JA 2MKIA 1NDLA 4X4TA 4AL6A 2VONA 3BSAA 1M5VC 4M5HA 1X31C 3DLGB 3HHKA 1NNDA 1E6VA 2LXUA 4J5OA 3AB2B 3SCKE 2EXUA 1PJ7A 1ZM2A 2V2QA 2N7YA 4DCOB 3M8SA 2XEXA 3BH6B 4NLYA 3G6ES 1VHFA 2BXJA 4J9VA 4I3HA 3LP2B 2BVZA 4ZVRB 5KFGA 4C11B 3V6DB 4NLXA 3BKFA 4LF7J 1YQHA 5GAEI 1MWZA 4JI8J 2ZE2A 3P3EA 1NK4A 2X1GA 1IM4A 4OJHA 4AL7A 1I51B 4TXSA 4DL3A 1Z0CA 2AYMA 3TAQA 1UFLA 2Y8WA 3Q8QB 5F0WA 3QZ8A 4DUZE 3BYPA 1FO1A 2D74B 9ATCB 1OYEA 1JWWA 1V3SA 3KLHA 1HW8A 4JI6J 3BGRB 2C2OB 2APOA 3R1HA 1NZAA 2MZTA 3PJWA 4TNOA 1WNEA 2Z2YB 1Q8IA 4RNMA 4ZLJA 3IR6B 4DV2F 3ZTOA 7FDRA 4ZA1A 4LFCE 4X4PA 3N01A 2QA4S 1FX2A 5CH7B 4DV5J 3KMQA 4QW9A 2UXBF 5DZ7A 2KVIA 2UUAF 1EA6A 1E6VB 2VFRA 4CYUB 3Q86A 3R7NB 3ZZTA 4LUBA 1WC5A 5A6PA 2YNHA 2H9ZA 2E5LJ 4DV7F 1YTYA 5BR8I 5ADZA 4DV7I 3MM7A 5ETPA 3KOAA 2BQRA 1QSLA 3M4XA 4LFBE 2VUGA 3PG9A 5HLFA 1V5IB 4RJVA 3AQOA 4I6YA 1SIWB 2O5DA 2I9SA 4M94A 4X4VA 2ZE2B 1EQ0A 1RGVA 4FYYB 2PI5A 1I6JA 5KFHA 1T9YA 2BA0D 2BJ9A 3R5AA 1HHSA 4KT0C 1S0VA 4ZDNA 1PJ6A 4CT9A 3IRXB 2HK2A 2DNLA 2ALZA 1HNXE 2K06A 1N8RT 2W4PA 4CLUA 4NXMF 4CP5A 4ZVOB 3CULA 1NK8A 3NWRA 1Q78A 4NZ6A 4NXMI 2CPDA 1H2VZ 1QM9A 2WBMA 2NREA 4YUDA 2XMUA 1IKWA 3TUIC 2QA1A 3ZZYA 1WF0A 3KMSA 5IWAJ 2IERA 2YX1A 4CWBA 4RW8A 4A8OA 3Q1QA 4LT6A 3OHBA 4MDTA 2E5IA 4WUDA 2YNHB 4HI2A 3Q6MA 1X4FA 2BJ7A 3LPYA 1AA1B 3TAMB 2GGPA 2AYEA 3MM7B 1G6BA 5KG7A 4DBQA 3CD0A 2AEJA 2V9KA 4BC7A 3I0RA 4U8VA 4AXIA 5HLFB 3ZFVA 4LF9F 4DV3E 4NRTA 1DY3A 1G3OA 2ZEJA 2V6AA 4DMZA 2K8GA 4G6VB 2KXFA 2OP5A 4B3RJ 3ZTQA 3LPSA 3QMQA 4B3SE 5J1EB 3EX7B 1F5CA 3AOAA 2CDQA 4LIRA 4IOCQ 2ADCA 5L1KA 1FJ7A 5KFFA 1H2UX 4EEYA 2EVZA 1OY8A 3AD7C 1X4AA 1RYSA 3GJTB 4R5PA 3CCJS 1IKWB 4RW6B 2Q66A 1SJ4P 4GQUA 5HQMA 3FEXB 4RW8B 3U7JA 2E1RA 1KDNA 3W2WA 3D54A 1VOMA 2KRRA 1NSQA 2GGPB 4JI5I 3G87A 2F8MA 2NN6F 2AIRB 4PWUA 5KG4A 2XI3A 4WTOB 3EMTA 4NBQA 3RG6A 3S7RA 5K36A 1HR0J 2J0SD 3MMAA 2VA2A 1SH0A 2AYBA 3TW0A 4OYXA 1YBUA 1NDPA 3US5A 5K36D 4J37A 1U6ZA 3TVYA 2GQ2A 1BC6A 2I1RA 1KSPA 3GFXA 2EEYA 2MZQA 1JXEA 5GAHI 2PA3A 3J80C 4XDCA 3IBCB 2OPSA 4ECUA 2XZTB 2PA8D 1WKLA 3K7RA 3FCVA 4CO3A 4TY8A 5C2CA 1F2HA 5DG9A 4H4OA 2MQQA 4X62E 1XWLA 1FEEA 2Q2EB 3OR2B 1GXLA 4C9DA 5HVHA 3HHLD 3BQ1A 4R5PB 3MDFA 3A3PB 3DRRA 2BANB 2CRLA 4MU0A 5AXLA 4N56A 2IESA 1FJGF 4Y3CA 4LF7I 4FS1A 1RTJA 4Z7YA 5KFSA 3W2WB 4GKJJ 2W4CA 3V4IA 1IKYA 2JLGA 2O3ZA 1N5SA 2C2KB 3D1HA 2Y1RI 2HRYA 5K36B 4N3OA 3MMAB 4QNKA 3G4SS 5KFVA 5CZXA 2WONB 2NN6A 1QVFR 5EDWA 2AGOA 3ISZA 4P73A 2D9OA 5A8KB 2Z30B 1YLXA 3HM9A 1D8YA 4I6WA 5ETQA 5K8MA 2NN6D 1R89A 1WKKA 3MMBA 3P3GA 4ZJLA 1XTZA 5I4MA 3WU4A 2F8HA 2V2VA 1X5PA 1QZRA 3MTKA 1TUWA 1R3NA 4DV5I 2RD5C 2LMIA 5EN1A 3K89A 2VD3A 4C8YA 4QNJA 1HNZE 2JX2A 1U6FA 2YKOA 3HHLB 4ZIWA 5C5JA 1U2FA 2OI2A 2E1AA 3H5UA 1Q0NA 4LF6J 4FW3A 3FCHA 1EKSA 2Z5EA 4ECWA 1V5VA 2E1PA 2L41A 1CPZA 4LIWA 4DPXA 3AOBA 2QG9B 3FC9A 1FRMA 1NB2A 2ZH3A 1RTJB 2P9GA 4QOTA 2DBBA 2WVCA 3E51A 3FJ2A 3UN5A 2ASLA 1RXOB 1I94F 1WC6A 3W64A 1IKYB 3QIPA 1IQZA 2H5EA 3LW5C 2GNKA 5LM7E 3DOMB 3SV3A 2C38A 1S6UA 3ULHA 4JI8E 2HBRB 3TVKA 3EGZA 2BEFA 2NN6B 6FDRA 4Y65A 1X4GA 1EB0A 1TELA 3ELHA 3CC4S 4ZPVR 4ED8A 3QAUA 4G1QA 3JAMQ 2CPXA 5HROB 2VICA 2JLFA 3GB0A 2AJ4A 3KUEA 4QJVA 1WDTA 1WG4A 4DSEA 5IOLA 2XY6A 2RSQA 3MPYA 4ZLLA 4U8YA 4ZN1A 1Q95G 3PR5B 1LOUA 2GO9A 1VRUA 3QSIA 1KTQA 1S49A 4YB5A 4AIMA 4ZMMA 3BDEA 1IBMF 3BBFA 2HS0A 3MM8A 4AD6A 1M5HA 2HBYB 2DNMA 2HS4A 2ZH6A 1DTTA 3TQEA 3M8YA 3AFGA 2R2SA 3BQ0A 2ZC4A 1RREA 4CO1A 2CUYA 3KLFA 1IR2A 2GIFA 3N6MA 1QSYA 1IBKI 1RLDA 3PEHA 4ZPTR 2RDJA 4DL0C 2DH9A 1GAOA 2L08A 1QAYA 3MMJA 2VDHA 2CZ9A 3QIPB 4B3RI 2Z5BA 4BA2B 1V6HA 1TKZA 2RJZA 4NLVA 2X36A 2E1CA 4PWWA 5KTQA 4ETXA 1HBUA 2MKKA 3BGOP 1MW7A 2JEBA 4YHHE 2VODA 4B3ME 1X7VA 2AJFE 2C3UA 4C0BA 3QGPA 5HMXA 1JLEA 4G1QB 4DL5A 3K5OA 5K20B 1RAFB 1GK8A 3CIZA 2V2KA 1KHVA 2DKOB 3C19A 1MMLA 1YJVA 2DNYA 4B9TA 2B6AA 2P9EA 4RBUA 3KUGA 3IRWP 2CVIA 4DV1F 2RDIA 3EDRB 3OVSA 1JX4A 4A47A 4QR2A 1VRUB 2A0FB 4KBIA 1KP6A 1FI4A 2FZKB 5IWAE 4I1TA 3DC2A 3SZ2A 1QAXA 2VH7A 4YR3A 2MZRA 4ZK7M 3VAMA 3MM8B 1EETA 3FZ2A 4WFYA 1L3SA 4J9MA 1DTTB 2XULA 1TL1B 4NYPA 3PIPQ 1HR0I 3M6XA 4A8SA 2UUCF 4ED1A 1N32F 4HYKA 3KLFB 4C0OC 5KFCA 1OQ6A 2ASDA 3SSSA 1B70B 2V4JB 2IVYA 5HBMA 4GC7A 4C8MA 1OY9A 3FEYB 3T1YE 2Z5BB 2V69A 2IDEA 2GMLA 2F5GA 3EDQB 4MYUA 2ZM6J 3MCMA 1T94A 3PRYA 5D3GA 3N28A 3I31A 3MR7A 2AEFA 2JEBB 4IR1A 3VWSA 2QL7B 3W8PA 4USMA 4E98A 5B0AA 2OMLA 2KFZA 1UP1A 2CG4A 1FWPA 4HLBA 4DX8H 1XMBA 2BOPA 4LF4F 2MJNA 3I5BA 3PYGA 1RTZA 1Y9OA 2BX6A 3NEKA 2KG0A 3Q8SB 1Y6ZA 3BV8A 1N34F 2ZHBA 2VQFJ 1R6LA 4YQWA 2E9RX 1N5YB 4LF5E 4I4BA 4KPYA 2J8SA 2W7OA 4DR2I 4JB8B 1JB0C 1EETB 1H98A 3NBPA 2VBZA 4RU9A 1BQNA 3ZZRA 1HBNA 1H7XA 4MYTA 2IM3A 1LKZA 2G2OA 1TAQA 3HKWA 2CVEA 5HBMB 4ID8A 4LBHA 3WZ0A 4ECTA 4ZLNA 3ZZ0A 4ENOA 4FBTA 3HZEA 1F9EB 1VIXA 3KKFA 1U1LA 5C0XA 4JYAE 3DLEA 5D3GB 4XO0A 4Z7CA 2FLNA 2G0CA 2ZOGA 1T02A 2DH7A 2ZH7A 2NXUA 1VISA 4R1FA 4CLFA 4Q0BA 3HFZB 5THWA 1YVFA 2IFXA 4RW9A 1GEHA 2QTWA 3HK2A 2UU9F 1HQUA 3MFHA 4LF6I 1XMOF 4RWXA 4BLGA 1JLFA 5IT9C 3M8QB 4HHUA 2I38A 3Q8PB 2HNYA 3HD2A 1P9QC 2V8PA 3D6MB 3NL0A 1SQGA 1FT8A 3M7VA 2XSFA 2YY3A 3B4MA 4RW4B 1HI1A 3GG0A 1S99A 5IC6B 3OV7A 1HMVA 5KFWA 1NU4A 4IH7A 3MUMP 4NX9A 5K36C 3AXMA 4ETZA 2ZFHA 2XYHB 3M30A 3TUZC 3QIDA 1KQKA 3NGRA 1VMBA 3E8OA 3MWBA 3LP1A 1HBNB 4WIQA 4DV0F 3R5CA 5DGBA 5DDOC 3RB0A 3O1LA 3EVWA 2XNQA 3QYYA 1KFDA 2IBOA 2EI5A 1A9NB 5A2QU 4KV8B 2DISA 1PAUB 2YQ3A 1HPZA 2HHSA 1FXLA 3DLEB 1UVIA 3QJPA 3SSRA 4JV5I 3EPGA 3PCOB 1VQ5S 1PIEA 5A0YA 2WNRB 4Q0BB 1AFIA 2ABYA 4NCAA 4RW9B 1UZDA 4O3NA 1HQUB 1Y4SA 2PDAA 1RI7A 3P96A 4CZCA 3G8SA 2EBEA 3KK2A 3LO3A 2HNYB 4DUZF 3J81Y 2C3PA 2NSBA 4MU4A 2I8EA 1WHWA 5T7LA 1EI1A 1S1WB 2F63A 4GKKI 1HMVB 3L09A 4AFFA 3TJ9A 2IYIA 2ROPA 3M30B 3GTYX 2NN6C 3TARA 4AUKA 2VKRA 4U3DA 4LFCF 4CLLA 4J7CA 5E0OA 2NPFA 2A6MA 1HFEL 4HHJA 2DR7A 4O44A 2N4DA 1N56A 4WXWA 3F73A 4DV6F 3HJFA 4P52A 5E41A 4F4XA 2ZZMA 1RAEB 2BMBA 4OYZA 3D1QA 4PG7A 4CLZA 4LFBF 4LFBI 5IT4A 4DQSA 1HPZB 2DRDA 2W9CA 4OV6A 3IMQJ 4LJMA 4FYVB 1Z0WA 3MR3A 3OQ2A 5ETNA 3KK3A 4DCJB 2C39B 3RTVA 4K0KE 3JSMB 3A8IA 3P45B 1B4SA 4OHWA 3NOGA 3M05A 5DNLA 4IG0A 4UY8T 1FRJA 5L38A 3VCDA 1SJ3P 4NMLA 3KK2B 4DUYE 3DGPA 3KHLA 1SC3B 3N6NA 3WC2A 1XMQE 1MN7A 1HNXF 1YG0A 9RUBA 2N7CA 1IQTA 4CDIA 3L7ZA 1E6YA 4PCQA 1OJ4A 2V34A 4FF3A 4OI1A 1YJWS 1NBEB 4DDFA 2ZM6I 3CCQS 3W5YA 3DRSA 3IR7B 1S5ZA 3OXGA 2LU2A 1TMMA 3VR1A 4F3QA 2QL5B 5E3CA 4O44B 4Y00A 3OTOE 2HZCA 2KZZA 1Q8BA 2ZDPA 3RGIA 1VQKS 2QV6A 2JDJA 3HHEA 3LOUA 1I5OB 1VGYA 3KG4A 1CQNA 1OO0B 4ZHRB 2W9CB 1XNRJ 1JJ2R 3J7AN 4ATNA 2ZZTA 3DLKB 5KFEA 2RRBA 4DV3F 3KK3B 2YNFA 2ZJRQ 4WTYA 1N33I 4JI2I 2WSCC 4B9UA 2E9ZA 1USVA 2PT0A 4IG0B 2ASJA 1IBLJ 4IQMA 1RWNB 4X2BA 4LFAE 2DEIA 3TR5A 4B3SF 3DGPB 2FVRA 2DR9A 4UUXA 1YIJS 1RQ0A 2JLEA 3CDJA 3D5MA 5IS2A 5KFRA 4DFKA 4QYRA 5I42A 2UXDE 2D7SA 4XTJA 2QSFA 3VQSA 1K9MT 4QZVB 4NXNE 3D0IE 4ZVIA 2F8EX 1RR9A 5CYJA 2PMWA 1S76D 3FBFA 1U26A 5J2QA 3GYNA 4QWBA 1NPPA 3PW5A 1KVKA 1R0CB 3W62A 4IFVA 3WC0A 3NNAA 5B09A 1RUSA 4ALZA 1O51A 4OYOA 3W60A 3RR7A 3MAAB 5HO4A 3E3XA 2HHTA 1UJ4A 4ECYA 2HHHE 3QRPA 2UXCJ 2G0JA 5B0GA 2B56A 2RUSA 3TUJC 4ED4A 1Q5VA 3DU6A 1FF2A 3QT6A 1WEZA 4NCGA 2LQ5A 3J7AG 3HVAA 2HHXA 3H40A 2M9KA 1X0PA 4R25A 3UDVA 2BW2A 2RKIA 3AOCA 1XJWB 1HNIB 3N9UC 2BJEA 2WAQD 1N0UA 4X62F 2YWWA 4NPOA 3UFCX 2RAQA 2HFUA 1VJQA 3C16B 1VFJA 5JEAE 2P2CB 2VBXA 1C0TA 3CEDA 1QLNA 1B0PA 3NWGA 1FVSA 2CQHA 5J2QB 2HPUA 1Q7YT 3CJ4A 1CJUA 5CCLA 3OXFA 1SPBP 1IWGA 2PSZA 1UDNA 3WU3A 4P74A 1UAWA 2LEAA 2E7XA 1HHQA 2ASYA 4I2QA 3BR8A 4TVAB 3K17A 3P3CA 7FD1A 2BE7D 3OUYB 3HJVA 1HNVA 2XMJA 1UEUA 2BKNA 1ULRA 2VFUA 1Z2LA 1YJNS 4A8FA 3CMAS 5D4NA 2OGUA 2DNOA 4NEZA 2ZUGA 1S9GA 4F0HA 1SBRA 3UD3P 2KDOA 3KHHA 1YBTA 2NS1B 2Z56B 2IM2A 2BW7A 2RKIB 3SFUA 4ANCA 1BWVA 4DFJA 4HH0A 2MQMA 2KXHA 4ECZA 2XI2A 1RHUB 3IM9A 4FZVA 2RNEA 4WFBQ 2GW8A 1DQ9A 1OY6A 4ECQA 1HNZF 5C2GA 2OEMA 1NK9A 4PEOA 2FVQA 5FLXU 3PX6A 3HFVA 2H48B 5C0XC 2K3KA 1IJFB 3HCXA 3ILIA 3R27A 3N79A 2HQDA 1C0TB 4CLKA 3CCVS 5H9EJ 3DRYA 4DR6E 1VC5A 1CJUB 5EWFA 1WD6A 2XGQA 4OYMA 2MQPA 1K73T 4RO0A 4RKUC 1WOPA 3QQCD 2GFFA 1FTCA 3IS9B 4NEYA 3MF5A 3CNQP 2H4YB 1EP4B 1M5KC 4JI1E 2MGZA 4JI8F 4UT4A 2A2CA 1HNVB 2HNZA 2ZBQA 4OX8A 2Y1LB 4ZCKA 1UVJA 2HZAA 1UVMA 2FZCB 4K4YA 4WJBA 1N4LA 2VG5A 1SI9A 1S9GB 3IBWA 1S0NA 1YRXA 4NYOA 1GX5A 1RAGB 3BSNA 3DDIA 2KRBA 2W25A 1KFSA 1Y3JA 3RBEA 1EHWA 2FJWA 4TQRA 2HIQA 4L73A 4HYMA 5AJ3J 3NAIA 5L8RC 1XIQA 4KHMA 3CO9A 4RW7A 3ADAC 1OYSA 2JWNA 4X65E 3ETOA 4DG1A 2BRLA 2YX4A 3RAQA 2DNQA 4C8LA 2BE2A 1EARA 1Y4UA 4TY9A 3MEKA 3OLAA 3T1HJ 3A1YG 4TLQA 3DYAA 1AUSL 3UN2A 2AD9A 1WORA 2RRNA 3U27A 1XC9A 4PXDA 5DDPC 3ZXWA 1P9YA 2ZH8A 1IBLI 1PYOB 4TU8A 3X1LB 1B7YB 1RT5A 4P2MA 2XSJA 2MGZB 2GO3A 1BGXT 1U2RA 3MUVP 2PC6A 3V81A 4NRUA 5D8HB 1Y7PA 1VS3A 4DJBA 4YHHF 4B3MF 2VG5B 3T9NA 3CGIA 4ZITA 3B6BA 3MEEA 4FW9A 1VQ8S 2M3DA 1RAAB 3E01B 3JTOA 4IG3B 4U67Q 1JLQB 1Q4RA 1BHNA 2C2EA 1AZSA 1WOOA 4RW7B 2POKA 1YJUA 3JTNA 1K0VA 2CPZA 4DG1B 5IWAF 1BXNA 2HK3A 1Y5NB 3OL8A 2BE2B 2HFZA 4GMKA 1J27A 4Y28C 2F40A 4NLWA 2P9CA 3OHAA 2MY8A 3D6TB 4OFZA 3PYFA 2CNKB 3VALA 3EZ5A 2B5JA 5KFAA 4O4GB 2B8QA 2HGNA 3K57A 2D3ZA 3QT7A 1XNRE 5EGYA 5DLGA 3T1YF 4TYBA 1RT5B 2GAGC 3T1YI 3RBXA 2DR5A 4WZMA 2ZH9A 1L3KA 3V81B 2E5GA 3PHTA 1NHVA 3OJSA 4Y2KA 4WKYA 3GZ7A 1H6KX 2OKQA 3NAHA 3BN7A 1KWMA 3DCAA 4A48A 2J7UA 1T3OA 2V0NA 2M8DB 2LP4A 3GCMA 4DR4J 3UD4P 2J0QD 1PG5B 1JJCB 1AW0A 4RNOA 1AZSB 1YX2A 3BPSP 2E5HA 2ZBKB 3SFGA 3DRXA 3HZGA 4LF5F 1RZMA 5EUHA 2HURA 4MIBA 1KVJA 2DGVA 2PMZD 1U1QA 1RISA 1RTHA 1BD6A 1JJ4A 5ETMA 3T5HA 4OI4A 5KT2A 2E44A 5HL7Q 4YY3E 2JEGA 2B9XA 1YITS 2DGSA 4OO1E 1RCOB 2B5JB 2F9DA 3C46A 1FFWB 3R2CJ 3KTQA 1WWHA 2C22A 1X8DA 3D28A 2J9DA 4LBPA 1FJCA 1A0OB 3PX0A 4B3OB 5T41A 3TA1A 4ED2A 1LW0A 1REGX 4JYAF 2DGQA 3J81Q 1D0EA 4N47A 4JYAI 3RBDA 1TL5A 1UVLA 3Q8VA 3IP0A 3A13A 3NGTA 1GMWD 4O3RA 2CPJA 1VR6A 4IFDE 1IKVB 4PABA 4XPEA 2QC3A 2WVDA 2ACYA 2ZWOA 5SZTA 1RABB 4B3TE 4KHPI 3T6JA 5I3UB 3PO5A 3V6HA 2PD1A 3EM1A 3Q2SC 2KFYA 3K59A 4JI3J 4IZKA 1VI7A 3L7PA 3VGSA 3U1MA 2ZD1A 4HACB 4IOBA 2B4VA 1RWMB 4K59A 3RW6A 3BO4A 1KD1T 4UOCA 1XNQJ 1RTHB 1VQ7S 5KFYA 1S9FA 2UUAE 4ZPBA 2CQIA 1HW9A 2FJBB 3LANA 2DXDA 1S1VA 4JI0J 3PY8A 1SL0A 1D6TA 3RRKA 2ZBIA 4X4OA 4CTAA 2LFVA 2I6WA 1HNWJ 2PNMA 1LW0B 4M5DA 4QBUA 4DR7J 4RUAA 1FTRA 3FSYA 4HDGA 2HHVA 3RAMA 4K50A 2VJVA 2X7IA 1FKOA 2YX7A 3DI6A 4RL1A 2B4UA 2GIQA 3GE9A 4EZ9A 1FHTA 1DAXA 2X51A 5B08A 3T5LA 5LMUJ 3DN9A 4LF8J 2QRRA 4XK8C 1MLAA 1S9EA 4IZKB 4KQVA 4N77A 1HYSA 3NGKA 3VV2B 4ES3A 4TYAA 1TK5A 1JLGA 3S8SA 1KHWA 4YDXA 4X66J 5EKWA 5C25B 1X4HA 5F3ZA 5BYQA 5A2QQ 1VQMS 1R0AA 2VPXB 2KHDA 2HBQB 2EC2A 2E9TA 3SCIE 1KVIA 2IY5B 3EJMA 4ZN3A 4KIAA 3EYZA 3DD6A 1RHJB 4S0MA 4YB7A 3QO9A 1CEZA 2KM8C 3MPUB 1N88A 4KC5A 1WOSA 3F0NA 2N3OA 2UP1A 3VAKA 3W61A 2YPZA 2DY1A 4UOFA 4QWEA 4K0KF 4ILMA 4K0KI 3J7AM 4XAKA 3DI6B 3DRPA 4PG6A 5J1NA 2AEMA 4ERDA 1NDKA 4MU3A 3ZNUA 4DUYF 2YKNA 1XMQF 5LJ5Y 1F1BB 2WB4A 3TVZA 4LCFA 1FK9A 1S9EB 3HVRA 2PMHA 4FN5A 2AQ4A 1HYSB 5C42A 2IYGA 1U7LA 1TKXA 2F4VI 2AZ3A 4ZJQA 4J9QA 3RB3A 2MSSA 1JLGB 4LCGA 3FMBA 3P5TL 1XR5A 5CZVA 3BBCA 1HARA 3JQMA 3HO1A 1R0AB 3C14A 2DHGA 3PACA 4ECVA 2LXIA 3OTOI 4DQPA 4PQUB 2MKJA 2XC9A 2RDDA 1DLOA 1KONA 3ZZUA 2QMUB 2W2PP 2CFXA 1W26A 3O6QA 1JXVA 2DHAA 4P7TA 2Z2LA 2JJ4D 4OZJA 2N82B 1NJZA 4MKBA 4ZVUB 3GIIA 3A8JA 3DRPB 3GFZA 4LFAF 4NA3A 5A8WA 4LFAI 4O3QA 3MPVA 2YKNB 3R7SB 3D67A 4UTGA 3G8TA 4WE1B 1RWOB 2IDLA 3J80U 1KTVA 5M2UA 2E5JA 4L6V3 4V1Ak 1FK9B 2HHUA 3PM9A 3A12A 5C42B 2UXDF 1S6OA 5DQIA 1TKXB 3CJRA 3OT9A 2W9BB 2Y0SD 1U49A 1N36J 4NXNF 1ZXMA 4WP3A 3B54A 4NXNI 3N0VA 3MZIA 2CG9A 3BYRA 2LKZA 4LRCA 1GTHA 1E3PA 3J7YI 1HD0A 2V63A 2LDIA 2YNIA 2CPEA 3HP6A 2MQLA 1JQGA 2BM1A 3GMGA 2ZDOA 3MMCA 4JI7I 4IH6A 3QAEA 3PZPA 1FJEB 5F8GA 2CIMA 4FF2A 4F7VA 1VLOA 1NHHA 1NJIT 2O66A 4KR0B 1K47A 4QIEA 1DLOB 5DLFA 1VJWA 2HW3A 3MCOA 2BA9A 2HHHF 4IQXA 1RA6A 1WHXA 4MK9A 3U1KA 1CC7A 2HHHI 4JI3I 2CWXA 1VQ9S 1B62A 4TLRA 4FS2A 4I69A 2DNZA 5D4LA 3NMAA 2VBYA 2FJVA 4AQYE 3ENQA 2VESA 1REVA 3BM7A 3BREA 1RT3B 1X5TA 1M5OC 4PPZA 2VQFF 3OBIA 3CJKA 3W3SA 3PS1A 4OZ3A 4DUTA 3O5TB 4CI0B 1PYSB 4NMXA 5KFTA 4JI0I 2HGLA 4AM3A 1D9FA 3JYTA 1P1LA 2UUBE 2H5JB 3B8HA 5JEAF 1JLBA 3SDEA 5DETA 2RHSB 3HSDA 1HNWI 3QT8A 3CCUS 2BV3A 2BKPA 3BR9A 4OYBA 2R2RA 5LMNE 3NGDA 4U9RA 1XBWA 4DR7I 1TL7A 2MQ8A 5EWEA 2B4PA 1SKSA 1S59A 4ZJOA 3WU5A 4BA1A 2MZJA 2ZOMA 2F3JA 4IH5A 1I94E 3P6YC 1QDUB 1X4CA 3I0SA 1RACB 1TL3A 1X4EA 3P5BP 1NK6A 3J7Z5 2CQ4A 3IFEA 2FHMA 3M6AA 3PRVA 4IOAQ 5LMUI 4KKOA 1EAYC 4PXEA 1U1RA 2D1CA 4M5MA 2CYYA 4J9RA 5ETTA 1REVB 4KSEB 2XY7A 3CJKB 2DO0A 3TA0A 2XO6A 3D7SB 2RF2A 4X4RA 2DR6A 3UNGC 1R0BG 3BSCA 5D77A 1GMUA 1QTMA 1TMJA 2G0IA 4P10A 4RBVA 2B7CB 4IFYA 1UEKA 4I7FA 1JLBB 3SDEB 2MZSA 4C8ZA 1S4FA 2QA2A 2GJFA 5L9NA 3GIJA 2VPWB 3PR4A 3BN4A 4PRFA 5JEAA 4DR6F 1TL7B 2DCLA 3VGUA 5JEAD 4XDDA 1BY9A 1CG2A 1W2BR 2JHEA 4BA1B 1YI2S 1X4BA 4ZVTB 2XMKA 3BGLA 4DV2J 4JI1F 2NXCA 4NE9C 1TL3B 4JI1I 1WC4A 3CXCR 1ZPVA 4USUA 1YZ7A 4WUCA 1N54B 3L7UA 1ZTWA 1YRTA 1KKHA 1RWWB 1T05A 3VAIA 1IM6A 3FSIA 3G9CA 4X64E 4IDKB 3HULA 3LH2S 1K1SA 4B9LA 4K4TA 2HAFA 4OZLA 4DV7J 5A8RB 3D68A 4DV4I 1FA0A 3DXBA 5C7PA 2RF2B 4C8NA 4KFBB 4P72A 2X3GA 5F9NA 4X65F 4NLRA 2HNDB 1M5PC 2DJWA 4JUZA 1JLCA 2VIHA 4IFYB 4NWBA 5KFJA 3I6PA 4DEZA 2FHOB 4X66E 3TYTA 2QE5A 2QEXS 1QJHA 4O23A 1MROA 4YS2A 1N6QA 1Y00A 2M2BA 4MK8A 5JEAB 2PFDA 1SL1A 3U1YA 8ATCB 1VLYA 1BLUA 1KLNA 4DR5E 2MTLA 3SSQA 4QR1A 2XYGB 1T03A 4XPCA 4NXMJ 1LWFA 1RADB 1BUXA 5GAEU 2AJ2A 2JNJA 4CH7A 1APSA 3CWVA 2E7VA 5H9FJ 4FW5A 2H5IB 1UA0A 4RNFA 3PYEA 3GP9A 4OI3A 1S1XA 2UUWA 3JSRA 1TK0A 2DR8A 1RP5A 2ZKTA 2NLWA 4IYQA 2XCPA 2KL8A 2CG8A 4DR3E 1TUVA 4X4UA 5GAGI 3AJ2A 3OFGA 2EFVA 4P6QA 2L48A 1A7GE 4K4VA 4KH1B 1FWLA 1L3VA 4WFZA 2Z2MA 3CDWA 1T95A 4OX9I 1R31A 3DLJA 3G6VA 3PNIA 2W2OP 4EGLA 3H98A 4F67A 2KFNA 4DR1E 4FYWB 3R8YA 2DRAA 1TV6B 2YXLA 4A8KA 4MT1A 2RQMA 3TWZA 2HVIA 3K1JA 3QBCA 3EXCX 2B9YA 3QT5A 4CO5A 3CVKA 1PKUA 4YDDB 1TKTB 1RT1A 3DU5A 1T03B 3X3UA 4N8OA 4IS9A 1Y60A 3L3CA 5M2PA 2BZ2A 2J76E 1XNRF 3KLIA 2RIJA 3RJMB 3W1YC 4A8QA 2EWHA 5DDQC 2GHWA 2GO8A 3M2UA 1FWKA 4OI6A 4JI4E 2MQNA 2W8LA 4JI5J 4N7TA 3BPDA 4JOUA 3CJTA 1XR6A 4M63A 4WUBA 3ILOA 5GMEA 2RS2A 2W01A 3HF5A 1QAJA 5HATA 3BGRA 5IT9U 1U02A 2GQ0A 3FFIB 1EX8A 2R2UA 1IJEB 2P5VA 2ZBRA 3MI7X 2XY5A 1N5VA 4KPCA 2RRAA 5DRQA 2KXNB 1KS2A 2MLYA 3KLVA 3VAGA 3SMZA 4Z2XA 1MMDA 1SJFA 4ECRA 4DV0E 2D41A 4PRVA 4YY3F 3UCGA 4CYUA 1RT1B 3VQTA 2VFVA 4OO1F 2GHPA 1NSPA 2J9EA 4URSA 4DN0A 1WJ9A 1SQFA 3M9NB 4F25A 3KLIB 3DHXA 1H73A 2CQCA 3JQKA 1IBCB 3UE2A 1B3TA 2B51A 3MD1A 3NP5A 4X4QA 4ISAA 1NMEB 4GVLA 1Z0GA 3D2WA 4OZ0A 4UW2A 1FJGJ 2HS3A 3M2UB 1SJQA 3R5DA 5KT7A 4IFDF 1OPIA 3J81C 2W8KA 2OFGX 2QSWA 4B3TF 4USKA 2KJWA 3ICLA 4B3TI 1OSDA 4J9KA 4KGVB 2CAJA 5AXNA 4NZ7A 4QWAA 3BB5A 2PEHA 3IRXA 4DCPB 4WBFA 4KGZB 1N0VC 1H0HB 5LXRA 3T19A 1WACA 4A46A 2NUHA 3CJSA 2JZ5A 2LQ9A 2VQEE 4DV2I 1KLMB 1A6LA 1HLWA 4UQGA 1ROFA 4P7VA 1XR7A 2UXBI 2ZBCA 2IA6A 3QRRA 4JV0A 4FF4A 3OD2A 2UUAI 2LECA 1ZA2B 4DV6E 4OHXA 3NGUA 1PKPA 3BSOA 4CLSA 3TAMA 3QFWA 4OLPA 4DF8A 3H42A 4MU1A 2GJIA 4C3LA 2ROEA 5GAHU 1RE1B 1UTAA 5ETSA 4QWDA 4ZVGA 1NLKL 4NOHA 2HKJA 2C37B 4Y2MA 4DPUA 4UOGA 2Z5CB 2GMJA 3PW2A 4X84A 2GQQA 2OMOA 3S6EA 2X1FA 4DPOA 3N6LA 5J1EA 3DHWC 3FRZA 4F4ZA 2CQGA 4IKAA 3UD5A 1BQMB 3S1TA 4IFDD 2EFGA 5HQLA 1Y4ZB 1PGZA 3CWJA 2WVFA 4CLPA 4EO8A 5DM6Q 4OYAA 1HI0P 4I68A 3PW7A 4C3MA 4Q2LA 2W9AA 2RQKA 5HMZA 3J81j 1WI8A 2IOQA 1NK7A 3VGTA 3NLCA 4RW6A 5IT9Y 2JFDA 1T9VA 2I5JA 4ZCLA 4E8UA 1U1NA 1KNZA 3CJ5A 4LSLB 1SL2A 4LREA 5DRKA 4KAIA 5JXSA 4M5IA 5D4OA 2XS2A 2HWTA 5D0GA 2PO1B 4NI2A 2K2PA 2NYHA 3PEJA 3GU0A 4KTQA 4C3KA 3K85A 1S0OA 2HAIA 2DCUB 4HTJA 4EYHB 4C48A 5BR8E 1J5EE 1LXJA 1IBKJ 1ELOA 3V5RA 4LF9I 1WSVA 1LFPA 3WIUA 4HVZA 2NR0A 2RH3A 2DNKA 4PXCA 2D3UA 4OHYA 3GYGA 2ZNYA 2J9CA 4ED7A 5JEAC 3EUNA 2G2ZA 4IFDB 1PC4A 3ZO7A 3KJQB 2R7XA 2H65B 4O0IA 3UCUP 2YTCA 4FBUA 3KK1B 2FQQB 3OR2A 2HIYA 1CULA 2VG6B 5CA5A 1QSSA 5L1LA 2R8GA 3FNNA 2D3OR 2EFQA 1CBKA 4DPYA 3L7OA 5DDRC 1CJTA 2BANA 4MIAA 1WEXA 2I5JB 3I82A 4ANEA 1X9WA 3MHYA 4QPTA 4BS2A 4DV1J 2GZOA 4C8KA 2KN4A 2A2DA 1F5BA 5LSRA 2EKYA 5KFOA 2R8JA 1CVJA 5KT6A 3RYLA 5MLCV 2VDIA 2CPYA 3CIMA 2G4BA 3MCSA 4WXOA 3ZTSA 3BEGB 4NI2B 4DL4A 3AJ1A 3TZXA 4EBEA 3EPIA 1YKWA 5KG0A 2WONA 2R3VA 6AT1B 2ZH5A 2HQFA 5A8KA 2UUCJ 1N32J 5GMDA 2CNNB 3HX9A 2UVRA 3SV4A 5K8OA 1QTNB 5E3RA 1PILA 4QR0A 4C98A 1B0VA 1DBDA 3WIVA 3CDIA 3TZWA 1VQOS 5A6WA 4I0WA 3IGVA 1FX4A 3OJUA 2J6UA 1FKPA 4AXJA 3JSBA 1I1GA 1ZZFA 4MMOA 1GTEA 1ITPA 2GVZA 3W66A 4U7UD 1S1TB 2EK6A 4DSKA 5DG7A 4XIUA 2BABA 1VYAA 3RW7A 4B9SA 3HHLA 4ZP7A 3MPWA 3HKZD 3FCWA 5DNXA 2OLWA 2W2QP 3RAXA 1LK5A 1CULB 1RT4A 1RJJA 2KB2A 4ZP6A 2AX1A 2B7BB 3WQPA 2R7VA 3RUBL 1CJTB 3GLJA 3UQSA 2ZOFA 4M95A 2FPHX 1FJGI 1N34J 2HMIA 2OSRA 1FKAE 5KFIA 3QNWB 3GONA 3UR0A 1LEOA 2DHXA 2W2MP 4QYZJ 4DR2J 5M2RA 1U8WA 2DGXA 3IR5B 1S77D 4L76A 3DOMA 2LEPA 1NUEA 4KB7A 5DO2A 4Q5VA 3IG1B 5B0BA 1KN6A 4JI5E 4V19J 2AKWB 5KFMA 2MZ1A 4DR4F 5HROA 4AQYF 2K1RB 2DYAA 2YNGA 2IHR1 2GCFA 1YHQS 4URGA 1FKPB 3TZYA 2FGOA 4IZJD 3C6TB 4WPAA 3M9OB 1U1MA 3IAS9 1SXLA 2GVZB 1C1BB 4BWJA 5BJRA 5LOQA 1MMNA 4K5RA 2EG2A 2BDPA 1AXQA 3I5CA 4OI2A 1S16A 2CJYB 2ATCB 1JIHA 2QL9B 2UUBF 1RT4B 3FBCA 2UUBI 3R9LA 2UU9J 2QLFB 3GJQB 1XMOJ 2DIUA 5LMNF 4JV1A 3SCLE 5AE1A 4A8WA 2HMIB 3QWUA 1LV5A 3F44A 1GQEA 2UVUA 4DLEA 1NCLA 2HGMA 1I94I 4BA2A 5KFPA 4LF7E 4LRFA 5DM7Q 2JE6A 4FPRA 3O44A 1KQSR 2B8PA 2DK2A 2ZH4A 4PYAA 2JH3A 4X4SA 3VZHA 5E5NA 3JXOA 3GWCA 2XS7A 3ILJA 3W5XA 4RUCA 2J6SA 1Q1KA 4G3IA 4DSJA 1Q53A 3UWTA 1JJHA 3QLHA 2YNGB 3UCZP 4IZJB 1NK5A 2YKMB 3W2VB 4JI6E 2PO4A 3OFHA 2V9WA 1RU2A 4F4YA 2BJ3A 2IPOB 5JMNA 4GO5X 2O1PA 3I32A 4ZKAA 4DL2A 4MFBB 3PJXA 4PG8A 4JV5J 2W2NP 4LBIA 1Q5YA 3FUYA 3DOLA 1XNQF 1PBAA 4TU7A 1RYRA 4DV5E 1NKCA 2KVQE 3JAMU 4F02A 4WCEQ 3GYXB 1G4CA 2ZUAA 3AB4B 1GXUA 3ZZOA 1IBMI 5B0FA 2IC3A 3V4MA 4OX6A 1TL1A 4USJC 3U02A 4JG4A 3TOQA 3DXSX 4PWDA 3GILA 1FFGB 2M7SA 2E5LE 3LWMA 2QYCA 2AGQA 1SQEA 4WKRA 1UDSA 4C7QA 2KYXA 2V4JA 1DHMA 4GKKJ 1Y5IB 2Z57B 1Z0BA 1P8GA 3T5KA 3AA8A 2JE6B 1VK3A 1VC0A 2AJ0A 1RAIB 1XHKA 2WW4A 2DT9A 2QX0A 1CS4A 1DTQA 3P8BB 3KJNB 5F8HA 3RR8A 2LA6A 4LFCJ 3HMJG 3K8WA 3BDPA 4RR5A 3Q24A 5HAOA 2FHJD 1G2EA 2WK4A 1UCNA 4X64F 2FVPA 3DNCA 3QLHB 4WFAQ 4X64I 1NHJA 2GV1A 2JOQA 3EGVA 2J65A 3B82A 4M5JA 1P42A 4F2SA 4LFBJ 1H72C 1Y5LB 3R7BB 1V3RA 4AIDA 4DV1I 2FY1A 4PU9A 4BHQA 1N5YA 4ELUA 3BKUA 4F36A 3DOLB 3NY0A 1RLCL 4N8NA 3T1AA 1RT2A 4IRKA 4X66F 5F3TA 2C3YA 5AE2A 3MEDB 1WC1A 5FDLA 3A4TA 1USUA 2IC3B 2LLZA 2CJAA 3SIPB 3LAMA 3CCTA 2Z2ZA 3M85D 4PWDB 4KY3A 3J7ZT 1FESA 4NLUA 5ELWA 2LQBA 3LGHA 4I67A 2UUCI 1N32I 2FHKA 4PUOA 3G6XA 4LR7A 1FRIA 4DR5F 3EVMA 4LCHA 1UPMB 4NASA 3IBFB 1NPKA 1RAOA 2AMCB 2MKHA 3EZUA 2D3O1 2LDYA 3WU6A 3LF0A 2Q79A 1IBKE 5AT1B 1ZBTA 1PBUA 1DARA 3WHIA 4FNHA 1CS4B 1DTQB 3CJ3A 5IQQA 2IJNA 3MD3A 3R5JB 3QJLA 2R7OA 2CPIA 1X5OA 4O3OA 3VAHA 3D0GE 4B3RE 4HL9A 3RBZA 1X5SA 2R7SA 1DRZA 1TFWA 2HBZB 3M8QA 4YB6A 4DR3F 4LF4I 2A3JA 2KKHA 3FSXA 5KG6A 1CJVB 1N34I 3D1OA 3ZZZA 4RW4A 2WRMA 2BE9B 5B0EA 1OYRA 1WDDA 3D9BA 1N33J 4RX6A 4DV3J 3LAKA 1U1KA 4JI2J 5HJXA 1RT2B 3JB9k 5FDLB 4ZIVA 1Z2ZA 3K2YA 3EXYA 4DR1F 3ONQA 1Q82T 5K14B 1TK8A 2RQ4A 2ZHOA 2RILA 4PYDA 4YOEA 2NQPA 2HVHA 1RWXB 1RTDA 5HMYA 3I96A 4PUOB 3GJRB 1L3TA 4U7UK 1IR0A 3NS7B 3FK4A 3KNGA 3OL7A 2C28A 3UHMA 5D4PA 2OJ3A 1HR0E 1T9TA 1HWIA 2C42A 5C24A 2DPJA 4K8RA 4KV8A 3ENAA 2UVVA 5CABA 4URQU 3DLLQ 4FKXA 2HFNA 2LA4A 2NCKL 4HXZA 3SYZA 5D15A 2E66A 4NCBA 2H54B 5C0XE 4E2FB 3R2DJ 3C6UA 2COLA 1HQ2A 2WNRA 1SUQB 1CQMA 3GIMA 4WF9Q 3UO0A 2E7WA 4ILRA 3B4DA 4JI4F 1LW2B 4FXVA 2CZVC 4Q7AA 2QMXA 2UU9I 4LPFA 1XMOI 1D3WA 4AYBD 3MFIA 1M90T 4RLEA 1ZM3A 1H3DA 1R43A 2U1AA 1JNZB 3M2VB 4USWA 1N36F 1S1WA 1WF1A 2IBKA 2DY9A 4Q44A 4KYZA 3M1VA 4DPWA 4DI6A 5KFNA 4OZNA 2HLUA 2F65A 2KZMA 2QT7A 4UQTA 3F56A 3TO8A 4GKJE 4ES2A 3R5GA 2OEJA 3G8QA 1UEVA 1Q79A 1HD1A 1RTDB 2JEFA 3Q8UA 4DR2E 4DV0I 4R0JA 1WKJA 4X62J 3WDOA 3P06A 4DSIA 1PVGA 4FKYA 3M2RA 3IO1A 3RB6A 2B0GA 3ITHB 1ICEB 5C24B 3MAQA 2BJDA 4UUWA 3SI8A 2AWZA 4C2MA 4NLQA 3W65A 3HHLC 2M70A 1S6QB 4L3NA 2FJEB 1L5UA 3F41A 3C6UB 2C39A 2KT2A 5L1IA 3P4UB 1SIZA 3ZZPA 3JSMA 2DITA 2WSEC 4MQYA 1F3FA 1NZ0A 4KGXB 2MHEA 4DL6A 2CADA 3T6BA 1R6YA 3POTA 4QIGA 4CO4A 2MLZA 4N5SA 4O4RA 5IT9Q 1VQYA 3UN3A 4DUZI 2RHQB 4F3MA 4LF6E 2MMYA 2R42A 2HVEA 1NAQA 2HHQA 1FE0A 3M1VB 4WWSA 4DXLA 3PDNA 2GIRA 2BACA 2VQEF 1FRHA 2BQUA 1SB6A 4AT1B 2W1BA 3EWGA 4I2PA 4OIXA 2EKNA 4LFCI 2MHNA 3PRDA 3RRHA 3D6HB 2HG4A 2HSEB 1AT1B 3UR3C 2K3IA 1Z4UA 2EBGA 3I4PA 2CJBA 3CDAA 3PW0A 4YR0A 4PQAA 2PN6A 2M4MA 2BA0G 4DV6I 3M2RB 4UF4A 5DJBA 4F0KA 4LOMA 3HSGA 3GSDA 3FDSA 3A3NB 3HLUA 2V67A 3CCRS 4ZHRA 5FIIA 3DLKA 1T3NA 5DZ6A 2VOPA 2OUGA 2HHWA 1KQFB 2Y1JA 2JSXA 2CXEA 2R4FA 1DQAA 4CLTA 3GR0A 3CMQA 1D1UA 4JV5E 3POTB 3KWMA 4I6AA 4ZVFA 2LJPA 2BBEA 1ZXNA 2G2YA 2OSQA 4F26A 5HP1B 3OR1B 1AROP 3QFHA 5GADI 4P75A 4U7CA 1HNXI 4EMDA 4TN2A 4ZPAA 1UDQA 1S1UB 3H4DA 4F50A 4O3SA 1UJ6A 4DF4A 3PXGa 4I2PB 4KO0A 3DLBA 2HFVA 5KOXA 4GKKE 4C97A 1KBRA 5CHCB 1V3ZA 2GVDB 4A4JA 3P76A 4QCLA 3AODA 4CT8A 3KLGB 1IUJA 1F3VA 1VCTA 2FVSA 5KFUA 1TVRA 3M6VA 4J3DA 4M5NA 4C0HA 1PYTA 3MAAA 1KQGB 1NJXA 1SC1B 4OZ5A 2RT3A 4ZVHA 3P49B 2CA9A 5BR8F 2XQCA 1J5EF 1S4EA 1K1QA 5A2QY 4G1PA 1J5EI 4HR2A 4DV3I 4KQZA 2VA3A 2O3DA 2DGUA 4LR8A 5ETVA 3AHPA 4ZS6A 2Q6CA 2GQCA 5IV4A 2EG1A 4Q2MA 1HNIA 5HMWA 3MCNA 4B3SI 4QWCA 2OTJS 4DL7A 1Q7LB 1WHYA 1KIJA 1Z5CA 1Z1ZA 3Q23A 4YHHJ 4EK2A 4B3MJ 2KHCA 3C16A 4FWHA 1ZS6A 5KT4A 3SQGA 3CT9A 4EZ6A 3M8WA 4KO0B 3KLHB 2HVZA 2QYGA 1R8PA 2OFHX 1MNEA 2XLIA 5IZHA 3CC7S 2QLWA 2ZM6E 2O1UA 1VRTA 1TVRB 5F41A 5L1JA 3KLEA 5IV3A 3D4JA 2XMWA 3OUYA 4PXBA 3GMEA 1TAUA 1SC6A 1RWVB 4NA1A 2DGOA 1HL6A 1ZH5A 5K36F 2DH8A 2IRYA 3PFEA 1X4DA 1C0UA 3EZOA 1TL4A 2OD4A 2P6SA 3MECA 2VQFE 4ZPCA 2AJQA 2LEBA 1UWBA 4U6PA 1RWKB 3T1YJ 3ISND 1KRPA 4FW6A 1N33E 3W5ZA 1GXTA 4DU8A 4JI2E 4M1KA 3TJAA 3BH7B 3TANA 4FW4A 4X62I 4BDPA 2YWGA 3FVYA 2V8VA 2ZITA 1K44A 2RUGA 2P6TA 4F0MA 3TA2A 2FYXA 3MR6A 3MURP 5HSPA 1GT8A 3SQGB 2AP6A 1KOOA 2A18A 4HDHA 5IXUA 1Y10A 5CYQA 4OZEA 4GRSA 5DQGA 1RTIA 2WSFC 1HIYA 5D0RA 3QJJA 4B17A 1FKAF 1VRTB 2RB7A 2J7KA 3IS9A 4LF5J 2FC8A 2DNGA 4CO2A 3H0PA 2OD6A 1EP4A 3KLEB 2CQ0A 2HKEA 2OPPA 2R8KA 3ZNJ1 4ZVSB 2NXJA 3EGWB 1BKNA 3AY0A 3DM2A 4OZ1A 4JI5F 5T14A 2G1DA 3KHRA 1U6BA 1Z5BA 2O1WA 1Z0TA 5KG5A 2OELA 3ZTPA 1C0UB 1U0SA 1FD2A 3MECB 2NXNA 3I0RB 1UWBB 1U1PA 3LUYA 3HHDA 4HI1A 5F9LA 2BA1D 1Y0HA 2YKQA 4JYAJ 1SJ1A 2JL9A 1YJ9S 3DOKA 1HNZI 3C15A 3H5XA 1VHIA 2R9LA 3VVUA 1N48A 3VZIA 5L9XA 4DS5A 2ZC3A 2RMLA 4KHPJ 2OH2A 2D69A 4I56A 2J8AA 2NZ4A 5CYQB 2HQ3A 1RTIB 3S01A 3Q22A 3BF4A 4X4NA 1FDBA 4ZPDA 1NH7A 1FCAA 3N5BA 1TP7A 3MM6A 1YDLA 4K7QA 2B9WA 3NCPA 4LF7F 1GMVA 2OPPB 4H54A 2VG7A 1NJWA 4USVA 2ZHAA 2Y8YA 3W63A 4JI8I 3B78A 3DM2B 3HHNB 2B4OA 2C2DA 3Q0AA 4K4UA 2WZ1A 5K8PA 3M8PA 3G2XA 3H7HB 4MKVA 2R7RA 1TKDA 4YB1P 4A8YA 4J9UE 3GG1A 3T3FA 1T9XA 2IVFB 3E01A 4NLDA 3DMJA 5CD4H 2GJ2A 3D6FB 3G82A 4JI6F 4IG3A 1JLQA 2VU5A 4JI6I 3JAMC 4OHZA 3R3TA 2J7WA 3Q8YA 1VQ6S 2VC1A 4AL5A 4DFPA 2VBWA 4L72B 3CJ0A 1UWAA 3DOKB 4HH1A 3T9ZA 2OPSB 4DV5F 1UKUA 3C15B 2QZ8A 3TNVA 3CO0P 1U47A 4UZBA 4D3HA 4TY8B 3GQCA 4FVCA 1WF2A 4PZVA 2RU3A 4H4OB 1NHKL 3QWPA 8RUCA 4CNYA 2PNLA 3MR2A 2E5LF 2OHDA 2R8IA 2GHVC 2E5LI 2HZVA 2HRUA 4O4GA 2J0WA 3MM6B 5DRPA 3DRRB 2ZWPA 2DNHA 1SH3A 4I64A 3RU0A 1JLAA 2DTJA 3UNYA 2IRXA 1RHYA 2VG7B 3KJVA 8AT1B 1HK7A 2HEKA 1RHRB 1RBLA 2CQ2A 1OSCA 2MKYA 1L3UA 3RRGA 3I55S 4Q8EA 3H2VE 1EIYB 3V4IB 4YHHI 4B3MI 3M8PB 2G13A 4DN9A 3UDLA 3C2PA 1ZOTA 3H90A 2V4QA 1RAJA 4NL5A 1RK8A 3DMJB 4NLTA 4RUHA 4A8MP 3G82B 2VPZB 1DZ5A 2QFIA 3M85G 3HVTA 3H2UB 5LSOA 1RWUA 1ZPWX 3PRBA 3M8RA 2QLBB 4ED3A 2IOPA 3MMBB 3GSIA 5E3PA 4ZCIA 1K8AT 1Y11A 4H4MA 2IJFA 4Q45A 1XK8A 2ILYA 1N52B 3H8YA 3H20A 2JEJA 4K0KJ 2B9EA 5IWAI 1X60A 2PO2A 1RA7A 4B9NA 4DU7A 3OSNA 5FLXY 4DUYJ 1F0XA 3U1NA 2LYVA 1XMQJ 1HWJA 2V94A 3O3LA 4YN3B 2LCWA 2UV8A 4FYXB 1WHVA 2F4VJ 1N5QA 1JLAB 3CUNA 1IBKF 4B3OA 2J6TA 3QATA 3KJVB 5KG3A 3D3BJ 4FYDA 3Q89A 1HWKA 1IBLE 2AT1B 3I9V9 4B3RF 1U8SA 1H7WA 2FJDB 1IKVA 2BOAA 3VGVA 4G1IA 2DB1A 2C38B 2I2YA 3OTOJ 4YFUA 2EPIA 4W98A 2IIHA 5I3UA 2KJVA 3HVTB 3UDCA 2R7WA 4WU2A 1HI8A 3D0HE 4H4MB 2PFFB 1LWXA 2BM0A 1QUVA 4DS4A 3GLLA 4LF5I 1R6MA 3CCES 3HPOA 2M5YA 3G86A 4HACA
chains in the Genus database with same CATH topology
1I94I 4X64E 4LF7E 3P06A 3HULA 1ZM2A 2UXDE 1PVGA 2V2QA 4XTJA 4LF7I 2HKJA 2UXDI 2XEXA 4DPUA 4Z7YA 4DV4E 4NXNE 2Z5CB 4DV4I 4ZVIA 2J7KA 2HK3A 1RR9A 4I3HA 4LF8I 1H7SA 4MYTA 4FN5A 2F4VE 1KVKA 2HKEA 2F4VI 4IZJB 3ZZ0A 4N3OA 3T1HI 2UXCE 1BKNA 1MU5A 4JI6E 2EFGA 1NZ0A 2GS8A 4X66E 1ZM9A 5FLXC 3PYFA 4JYAE 4X66I 1Z5BA 1Z0CA 1ZM4A 2O1WA 4NXME 1Z0TA 4Z7CA 3QT7A 3WU4A 4DUZE 1XNRE 5IT9Q 2V2VA 1VISA 4R1FA 2IOQA 1QZRA 4DV5E 4DUZI 1NHIA 2HHHE 4P7AA 1XNRI 1H74A 3T1YI 4DV5I 4LF6E 2R42A 4DR5E 3OTOI 1IBME 4ED4A 4LF6I 4DR4E 4DR5I 1IBMI 4DXLA 5IT9C 3QT6A 1MX0A 3J7AG 1Z0EA 4JG4A 3ZZUA 5FWKA 1HNZE 3H4LA 2V2ZA 2V8PA 2E5LE 1HNZI 3CWVA 2VQFI 4LFCE 4LFCI 2OI2A 3PYEA 1N0UA 1EA6A 2Z5EA 1Z0BA 1WUUA 3Q6NA 3K85A 4DPXA 3ZZTA 4LF9E 5BR8E 2HFUA 1XHKA 1J5EE 2WW4A 1N36E 3LNUA 3V5RA 1ELOA 4LF9I 5BR8I 4LFAI 4DV6I 2ZBKB 4DV7I 4UTGA 4LFBE 4GKJI 4DR3E 1KTVA 4DR3I 5L3JA 4RPFA 1FWLA 4X64I 1NHJA 4JI8E 4OX9E 4JI8I 3B82A 3B78A 1ZXMA 4OX9I 3WU3A 4NXNI 2CG9A 4YY3E 4DPTA 1H72C 4YY3I 4DV1E 4JV5E 3JAMQ 2LJPA 4DV1I 3K17A 4JV5I 4DR1E 4PU9A 1ZXNA 4DR1I 1PIEA 2AJ4A 1B63A 2BM1A 3K1JA 4JI7E 2O1TA 3QT5A 2UXCI 4JI7I 4DPYA 4JI6I 3JAMC 2HK2A 1HNXE 1Y4SA 3HJCA 3J81Q 1HNXI 1NHHA 4JYAI 1USUA 4EMDA 4NXMI 1K47A 2A2DA 2UUCE 2Z5CA 1N32E 4JI3E 2UUCI 1N32I 2HHHI 4JI3I 1B62A 4GKKE 4KHPE 1EI1A 4B3TE 1MG7A 4GKKI 4KHPI 4AQYE 4DR4I 1Z5AA 3Q1QA 3WU6A 1FWKA 4IZJA 4AQYI 1RREA 5LL6R 2PNLA 1XNQE 2R3VA 1IBKE 4WUDA 4JI4E 1DARA 3Q6MA 3J80Q 1IBKI 2E5LI 5GMDA 4JI4I 3ZKDA 3ZKBA 4IZKA 2NPFA 4WUBA 1FNMA 4JI0E 4B3RE 5GMEA 4HACB 2CZ9A 4JI0I 4B3RI 2Z5BA 4FWGA 4DR6E 4HY1A 2UUBE 4P52A 4DR6I 1S4EA 3B8HA 4DV3E 1J5EI 1HK7A 2X36A 1N36I 2GQ0A 4DV3I 2UUAE 1HNWE 4LF4E 2CGEA 1HNWI 3QT8A 4YHHE 4LFBI 2BV3A 4B3ME 4LF4I 4YHHI 5LMNE 4DR7E 4B3MI 1N34E 4JI1E 5LMNI 4DR7I 3LPSA 1N34I 1Z0VA 4B3SE 1D6TA 1Z0WA 4UT4A 2A2CA 4B3SI 4K0KE 2HFSA 3WU5A 4DV0E 4PRVA 2PNMA 1KIJA 1I94E 1Z5CA 2IOPA 1FJGE 1FJGI 2O1VA 4FWHA 4DUYE 1FKAE 3GONA 1FI4A 4FWDA 5LMUE 4DUYI 1XMQE 1H73A 5IWAE 4LF8E 3M6AA 2X7IA 5LMUI 1XMQI 5IWAI 4HYMA 1Z0GA 5FLXQ 4X65E 1HR0E 3T1HE 4X65I 1HR0I 1OJ4A 2V34A 2E1RA 4DU7A 2ZM6E 2O1UA 3J81C 2ZM6I 4JI5E 4JI5I 4USKA 4IZKB 4HXZA 4KQVA 1Y4UA 4B3TI 4PRXA 3D4JA 3PYDA 3LTOA 3T1YE 2Z5BB 2VF3A 4MYUA 3OTOE 1XNQI 2UU9E 1UEKA 4IZJD 1N0VC 1XMOE 2UU9I 3PRYA 1XMOI 1IBLE 3V2UC 4DV2E 1IBLI 1S16A 5A2QQ 1A6FA 1ZM3A 3J80C 2VQEE 2VQFE 4DV2I 4USMA 2VQEI 3ZM7A 1N33E 2UXBE 1U2RA 2UUBI 4DU8A 4JI2E 1N33I 2UXBI 4M1KA 4DPWA 5A2QC 4JI2I 1Z59A 2UUAI 1USVA 3PYGA 4X62E 2DEJA 1Y6ZA 4X62I 4URLA 4LFAE 4DV6E 2ZITA 2DEIA 2Q2EB 3F0NA 4FW9A 1PKPA 4DV7E 4JI1I 2BM0A 4GKJE 4WUCA 4LF5E 1H7UA 4DR2E 4K0KI 4LF5I 1KKHA 3J7AM 4HACA 4DR2I 4DV0I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 I;  4X64 E;  4LF7 E;  3HUL A;  1ZM2 A;  2UXD E;  1PVG A;  2V2Q A;  4XTJ A;  4LF7 I;  2HKJ A;  2UXD I;  2XEX A;  4DPU A;  4Z7Y A;  4DV4 E;  4NXN E;  4DV4 I;  4ZVI A;  2J7K A;  2HK3 A;  1RR9 A;  4I3H A;  4LF8 I;  1H7S A;  4MYT A;  4FN5 A;  2F4V E;  1KVK A;  2HKE A;  2F4V I;  3ZZ0 A;  3T1H I;  2UXC E;  1BKN A;  1MU5 A;  4JI6 E;  2EFG A;  1NZ0 A;  2GS8 A;  4X66 E;  1ZM9 A;  5FLX C;  3PYF A;  4JYA E;  4X66 I;  1Z5B A;  1Z0C A;  1ZM4 A;  4NXM E;  1Z0T A;  4Z7C A;  3QT7 A;  3WU4 A;  4DUZ E;  1XNR E;  5IT9 Q;  2V2V A;  1VIS A;  4R1F A;  1QZR A;  2HHH E;  4DUZ I;  1NHI A;  4DV5 E;  4P7A A;  1XNR I;  1H74 A;  3T1Y I;  4DV5 I;  4LF6 E;  2R42 A;  4DR5 E;  3OTO I;  1IBM E;  4ED4 A;  4LF6 I;  4DR4 E;  4DR5 I;  1IBM I;  4DXL A;  5IT9 C;  3QT6 A;  1MX0 A;  3J7A G;  1Z0E A;  4JG4 A;  3ZZU A;  1HNZ E;  3H4L A;  2V2Z A;  2V8P A;  2E5L E;  1HNZ I;  3CWV A;  2VQF I;  4LFC E;  4LFC I;  2OI2 A;  3PYE A;  1N0U A;  1EA6 A;  1Z0B A;  1WUU A;  4DPX A;  3ZZT A;  4LF9 E;  5BR8 E;  2HFU A;  1XHK A;  1J5E E;  2WW4 A;  1N36 E;  3LNU A;  3V5R A;  1ELO A;  4LF9 I;  5BR8 I;  4LFA I;  4DV6 I;  2ZBK B;  4DV7 I;  4UTG A;  4LFB E;  4GKJ I;  4DR3 E;  1KTV A;  4DR3 I;  5L3J A;  4RPF A;  1FWL A;  4X64 I;  1NHJ A;  4JI8 E;  4OX9 E;  4JI8 I;  3B82 A;  3B78 A;  1ZXM A;  4OX9 I;  3WU3 A;  4NXN I;  4YY3 E;  4DPT A;  1H72 C;  4YY3 I;  4DV1 E;  4JV5 E;  3JAM Q;  2LJP A;  4DV1 I;  3K17 A;  4JV5 I;  4DR1 E;  4PU9 A;  1ZXN A;  4DR1 I;  1PIE A;  2AJ4 A;  1B63 A;  2BM1 A;  3K1J A;  4JI7 E;  3QT5 A;  2UXC I;  4JI7 I;  4DPY A;  4JI6 I;  3JAM C;  2HK2 A;  1HNX E;  3J81 Q;  1HNX I;  1NHH A;  4JYA I;  4EMD A;  4NXM I;  1K47 A;  2A2D A;  2UUC E;  1N32 E;  4JI3 E;  2UUC I;  1N32 I;  2HHH I;  4JI3 I;  1B62 A;  4GKK E;  4KHP E;  1EI1 A;  4B3T E;  1MG7 A;  4GKK I;  4KHP I;  4AQY E;  4DR4 I;  1Z5A A;  3Q1Q A;  3WU6 A;  1FWK A;  4AQY I;  1RRE A;  5LL6 R;  1XNQ E;  2R3V A;  1IBK E;  4WUD A;  4JI4 E;  1DAR A;  3J80 Q;  1IBK I;  2E5L I;  5GMD A;  4JI4 I;  3ZKD A;  3ZKB A;  2NPF A;  4WUB A;  1FNM A;  4JI0 E;  4B3R E;  5GME A;  4HAC B;  2CZ9 A;  4JI0 I;  4B3R I;  4FWG A;  4DR6 E;  4HY1 A;  2UUB E;  4P52 A;  4DR6 I;  1S4E A;  3B8H A;  4DV3 E;  1J5E I;  2X36 A;  1N36 I;  4DV3 I;  2UUA E;  1HNW E;  4LF4 E;  1HNW I;  3QT8 A;  4YHH E;  4LFB I;  2BV3 A;  4B3M E;  4LF4 I;  4YHH I;  5LMN E;  4DR7 E;  4B3M I;  1N34 E;  4JI1 E;  5LMN I;  4DR7 I;  3LPS A;  1N34 I;  1Z0V A;  4B3S E;  1D6T A;  1Z0W A;  4UT4 A;  2A2C A;  4B3S I;  4K0K E;  2HFS A;  3WU5 A;  4DV0 E;  4PRV A;  1KIJ A;  1I94 E;  1Z5C A;  1FJG E;  1FJG I;  4FWH A;  4DUY E;  1FKA E;  3GON A;  1FI4 A;  4FWD A;  5LMU E;  4DUY I;  1XMQ E;  1H73 A;  5IWA E;  4LF8 E;  3M6A A;  2X7I A;  5LMU I;  1XMQ I;  5IWA I;  4HYM A;  1Z0G A;  5FLX Q;  4X65 E;  1HR0 E;  3T1H E;  4X65 I;  1HR0 I;  1OJ4 A;  2V34 A;  2E1R A;  4DU7 A;  2ZM6 E;  3J81 C;  2ZM6 I;  4JI5 E;  4JI5 I;  4USK A;  4HXZ A;  4KQV A;  4B3T I;  4PRX A;  3D4J A;  3PYD A;  3LTO A;  3T1Y E;  2VF3 A;  4MYU A;  3OTO E;  1XNQ I;  2UU9 E;  1UEK A;  1N0V C;  1XMO E;  2UU9 I;  1XMO I;  1IBL E;  3V2U C;  4DV2 E;  1IBL I;  1S16 A;  5A2Q Q;  1A6F A;  1ZM3 A;  3J80 C;  2VQE E;  2VQF E;  4DV2 I;  4USM A;  2VQE I;  3ZM7 A;  1N33 E;  2UXB E;  1U2R A;  2UUB I;  4DU8 A;  4JI2 E;  1N33 I;  2UXB I;  4M1K A;  4DPW A;  5A2Q C;  4JI2 I;  1Z59 A;  2UUA I;  3PYG A;  4X62 E;  2DEJ A;  4X62 I;  4URL A;  4LFA E;  4DV6 E;  2ZIT A;  2DEI A;  2Q2E B;  3F0N A;  4FW9 A;  1PKP A;  4DV7 E;  4JI1 I;  2BM0 A;  4GKJ E;  4WUC A;  4LF5 E;  1H7U A;  4DR2 E;  4K0K I;  4LF5 I;  1KKH A;  3J7A M;  4HAC A;  4DR2 I;  4DV0 I; 
#chains in the Genus database with same CATH topology
 1HWL A;  5CYM A;  5L39 A;  2ZBP A;  5HJY A;  1EZZ B;  2PO2 B;  2DD8 S;  4LFA J;  3JTP A;  3M6U A;  3PJ9 A;  2FGC A;  3MPD A;  4Z37 A;  2RS8 A;  2KI2 A;  4MJK A;  4J9S A;  5FD1 A;  1FRX A;  5KFX A;  5KOW A;  1UMJ A;  1HR0 F;  2QJ3 A;  1LQ9 A;  2UXD J;  5D78 A;  1VQP S;  4DQQ A;  2UXC E;  5F8M A;  1MU5 A;  4NA2 A;  4NXN J;  2J9D E;  2CPH A;  4LRA A;  1OQ3 A;  1GMW A;  1VBK A;  5C0X F;  1K0T A;  1RHM B;  2VJU A;  3ENV A;  1TUG B;  4JI7 J;  2MDA A;  1TKZ B;  1SCJ B;  2JC1 A;  1HBU B;  1NKE A;  3J81 U;  2RU9 A;  1JLE B;  3WBZ A;  4NYZ A;  2HHH J;  1WG1 A;  5H9F K;  2DHH A;  2HQC A;  4NZ0 A;  4M5K A;  2B6A B;  4Q8F A;  1WUU A;  2AGP A;  1HHT P;  3TZZ A;  5CYM B;  4QIW D;  1LFW A;  1WTB A;  5KFK A;  1OYP A;  3J7A 1;  4MH8 A;  4GKJ F;  2KT3 A;  1W2I A;  1T7P A;  4GKJ I;  5C25 A;  2YKP A;  3NRB A;  4DR2 F;  3ISN C;  5KFQ A;  1QY7 A;  2OPR A;  3HSJ A;  1MN9 A;  5L3J A;  1FDN A;  3LGM A;  4ICL A;  4LRB A;  2JT2 A;  2X3D A;  3KYL A;  3OLB A;  2R7Q A;  3U1L A;  4RBT A;  3GPA A;  5F0U A;  4F4A A;  3HI9 A;  2VB6 A;  4IO9 Q;  4ECS A;  1RU1 A;  1X9S A;  4J9P A;  4Y6I A;  3KHG A;  3T41 A;  3THP A;  3K5P A;  3OFE A;  1KR4 A;  3VAJ A;  5C0X D;  2C2Z B;  4JV2 A;  5B0D A;  5B7W A;  5F8N A;  4LF6 F;  4KHP E;  4CIO A;  3J7Y U;  2XB2 D;  4NLO A;  3DFE A;  4L75 A;  1HKA A;  1CLF A;  4P2S A;  4EBC A;  1QAI A;  1R8A A;  2DIV A;  5H1S V;  3ENW A;  2VFT A;  5DS7 A;  1X0F A;  2UVW A;  3H4B A;  4KHR A;  2EFO A;  4WFN Q;  1FNM A;  2OPR B;  4C6A A;  3M6W A;  4R0E A;  3GJS B;  4ICL B;  3AH6 A;  3PHE A;  3QRQ A;  3GFH A;  3NBP B;  2QMW A;  3TQ1 A;  3NCQ A;  1BQN B;  5HQ8 A;  4PQU A;  3VHQ A;  2Y1I A;  4LQ3 A;  4FXW A;  2VV5 A;  1YZ6 A;  2J0X A;  2WVB A;  4DR6 J;  2DGT A;  4GO7 X;  2R2T A;  4J9N A;  2QN6 B;  5CXT A;  2AJ1 A;  2HHP A;  2XWY A;  4DHV A;  1CJK A;  1UL3 A;  5C0X B;  3OL9 A;  2Y0B B;  4KJI A;  2PE8 A;  4JV5 F;  2ACM A;  4Y34 A;  1SV5 A;  3UPF A;  1NJY A;  4JI1 J;  3VAF A;  1PO6 A;  5E3Q A;  2ALY B;  1P27 B;  2XHC A;  4WE1 A;  2LXF A;  3IN5 A;  3PKY A;  2GX8 A;  4DUY I;  2M52 A;  3KDN A;  2CQP A;  2M8H A;  1XMQ I;  1PC5 A;  1U2C A;  3P3D A;  4OI0 A;  3K5N A;  1JLF B;  4Y0F A;  4TU9 A;  4PKD B;  1UDO A;  1F6T A;  3T1H E;  1KEK A;  2W9B A;  2YH0 A;  2XMT A;  1VQS A;  4WZQ A;  3NNC A;  2B43 A;  1UW9 A;  4EO6 A;  2EFP A;  4DV4 J;  3O8W A;  5JJB A;  2IM1 A;  4GKK F;  3NMR A;  1DQ8 A;  3IXQ A;  1TZ0 A;  1NDC A;  1F9F A;  1U48 A;  3LTO A;  4X65 J;  4H4K A;  5E2Q A;  3R1L A;  1FFS B;  1JXL A;  4NLG A;  3LP1 B;  3FRY A;  4K4X A;  5KFL A;  1NEE A;  3KDO A;  3CCL S;  5KT3 A;  2ERR A;  5J1P A;  3GIR A;  3PIO Q;  4G65 A;  4KGM A;  4U3B A;  2VL1 A;  3OL6 A;  1CJK B;  4KH0 B;  1RT3 A;  3W9J A;  2VKZ G;  1CSJ A;  4URL A;  1FRL A;  2WW8 A;  1SV5 B;  2N3L A;  5F8I A;  5A0Y B;  4P71 A;  3ILL A;  1ZAV A;  2EC0 A;  1H7U A;  3W7B A;  5JVG Q;  1RHQ B;  1S0M A;  4LSZ B;  3CF5 Q;  1AFJ A;  4OV1 A;  1F2G A;  2PEB A;  4EYI B;  2UXD I;  1PSD A;  1LWE A;  1VBZ A;  2L9D A;  2NZC A;  3TAP A;  3BQ2 A;  1WSR A;  2WBR A;  2QGF B;  3NKY A;  1FXR A;  1FRK A;  1WG5 A;  1H7S A;  2XZW A;  4WII A;  5T7L B;  3FZB A;  4RNH A;  1O8B A;  2F4V E;  3R6L B;  1MU2 A;  3E2E A;  1WI6 A;  4LVO P;  1HA1 A;  3MTJ A;  2V50 A;  2MJU A;  2ZM6 F;  4OX9 J;  2WP8 A;  1OPZ A;  4AE5 A;  2EK1 A;  2F7V A;  2HYI B;  2ZJQ Q;  4RNN A;  4DX7 A;  2C2M B;  1WC3 A;  5K8N A;  4FP9 A;  4P7A A;  2Y3Y A;  3K58 A;  3CCM S;  1S12 A;  2GA7 A;  3CME S;  4DR4 E;  2Z8Q A;  1Z0E A;  5F8L A;  5FWK A;  1ZAX A;  1HWU A;  4W90 B;  3H4L A;  1IXK A;  2KTQ A;  3M9M B;  1ZET A;  3L95 X;  3LP0 A;  3IM8 A;  2VQF I;  1FNX H;  3MR5 A;  3QGI A;  3IGN A;  1N33 F;  4OYP A;  4JI2 F;  4KGK A;  3FBB A;  2JC0 A;  1G7C B;  1Q81 T;  3PFO A;  3Q6N A;  3OTD A;  3CDB A;  2LQJ A;  5CD4 A;  4USI A;  5K5M A;  1Q8K A;  4ZVE A;  4IO1 A;  3CCZ A;  2Y9H A;  1OYD A;  4TQS A;  3KRN A;  1NRK A;  1LWE B;  5DRR A;  2PO0 A;  1EJ7 L;  3SCJ E;  1FD8 A;  2AHO B;  2PII A;  5ETK A;  3PS3 A;  3HT3 A;  2DO4 A;  1YJT A;  2E29 A;  2XBP A;  4RPF A;  1MU2 B;  3T5J A;  2XNR A;  3L7Z B;  1E6Y B;  2CQB A;  2I0X A;  4OJ1 A;  2WP8 B;  5LXY A;  5BYR A;  1S57 A;  2VAS A;  2V8D A;  3DRS B;  3AXK A;  2FUG 9;  2BA1 G;  2MKC A;  2YPY A;  2HQG A;  2Q6B A;  4WP8 A;  5I3P A;  2BJ8 A;  5E3A A;  4JI7 E;  5HVG A;  3KUH A;  4MTP A;  1SVD A;  3AAW B;  4YY3 J;  5GAG U;  2ZVI A;  2XWX A;  4IDK A;  1YJ7 A;  1LNQ A;  4HKQ A;  4DLG A;  1IR1 A;  2C3M A;  5A8R A;  3L9Z A;  3EIC A;  4JI3 E;  1SKW A;  1NO8 A;  3LP0 B;  4CNZ A;  1NSA A;  2YNF B;  1XXE A;  4PG4 A;  1S7I A;  4KFB A;  1Y3K A;  2FY8 A;  1RKI A;  3PX4 A;  1UPP A;  2HND A;  2IVM A;  3H1C A;  5LL6 R;  1XNQ E;  4MKA A;  4KE5 A;  1G1X A;  5DGA A;  2PO0 B;  3UI3 A;  3CJQ A;  4V19 X;  3J80 Y;  4B3T J;  4EU0 A;  4JI0 E;  3LPE A;  5JVH Q;  5I42 B;  4DR6 I;  3CD6 S;  1F60 B;  3M32 A;  4QW8 A;  1SH2 A;  1S79 A;  1HNW E;  1B64 A;  5LJ3 Y;  2CGE A;  5RUB A;  1F9H A;  1DUR A;  2V68 A;  3MXH P;  1S7H A;  4DR7 E;  2EW9 A;  3QZ7 A;  4WFX A;  1Z0V A;  1YHC A;  5GVQ A;  4IFV B;  2UXB J;  5IC4 B;  2IJR A;  2UUA J;  2DGW A;  2XMM A;  3NZK A;  4D3G A;  4ZP8 A;  2C1E B;  4F2R A;  2FDN A;  5LMU E;  4LF8 E;  2Z0G A;  4QYZ K;  3R5B A;  1R27 B;  3PVX A;  5FLX Q;  4O0N A;  4K2J A;  5HAN A;  1YSJ A;  4NCG B;  1FXD A;  2MQO A;  4LF2 A;  4X65 I;  1RHK B;  3PS2 A;  2JVR A;  3FQL A;  4BBY A;  6FD1 A;  4PPD A;  2DPI A;  4ZLP A;  4M8L A;  5E33 A;  3A3O B;  2WVE A;  3RZA A;  2JEI A;  2ZNZ A;  3NGS A;  1TV6 A;  3GFY A;  1IVZ A;  1UET A;  3Q2T C;  2YQ1 A;  3HT0 A;  4QPX A;  5U47 A;  4R8U A;  3BZQ A;  2CPF A;  2VF3 A;  1TKT A;  3C8Y A;  1Q8L A;  3A8K A;  2JFK A;  3M32 B;  3C3L A;  1JNR B;  5BXI A;  2IRU A;  1VK8 A;  3I9Z A;  2O01 C;  5KG1 A;  4FNI A;  2AW0 A;  4LQ9 A;  2MPU A;  1URN A;  2CWK A;  2XMV A;  4XTT A;  1NH8 A;  1B0T A;  4I2Q B;  1Q86 T;  2OPQ A;  1B7F A;  1R8H A;  1QUP A;  1VQN S;  3SXL A;  4CCH A;  4C8O A;  4W92 B;  1WEL A;  1VIO A;  1TTH B;  4UOH A;  2YWF A;  3UDE A;  5LSL A;  2QO3 A;  2V5H G;  3TI0 A;  1YWX A;  4LF9 J;  2MKS A;  1BQX A;  3G6Y A;  2FJX A;  4J90 A;  4DV4 E;  3M7N D;  3MM5 A;  3FFI A;  5G0R A;  2UV8 G;  1CC8 A;  4K4Z A;  2YQ0 A;  5HI7 A;  3PW4 A;  4UZC A;  3Q83 A;  2AYG A;  3DDK A;  2JEA A;  3QPI A;  5IT0 A;  1RT7 A;  1VRQ C;  2KM8 B;  1VBY A;  1RBO B;  2CQ1 A;  4R8U B;  3G96 A;  1VBX A;  4WK3 A;  7AT1 B;  2GS8 A;  2XZD B;  1ZM9 A;  1T9W A;  1EQM A;  5AXM A;  4FPI A;  1ZM4 A;  2FZG B;  1GFW B;  1B99 A;  3NS5 A;  4DX5 A;  2DXE A;  3EGN A;  2W4D A;  2FJA B;  1XNR I;  4DWI A;  1GX6 A;  4MAK A;  3I5A A;  1D9A A;  1KOH A;  4L3K A;  2XMA A;  4JBC A;  2AX0 A;  3BO3 A;  1IBL F;  2NSC A;  3NS6 A;  3ZC4 A;  4USH A;  5K9F A;  2AE8 A;  2OPQ B;  3KNA A;  4C4W A;  3QGH A;  2HNZ B;  4BWM A;  2AU0 A;  5I3Q A;  3OFF A;  2L9N A;  4H4K C;  2XHW A;  3D66 A;  1N36 E;  2SXL A;  2H4W B;  1OWX A;  2L3M A;  3MM5 B;  3OTC A;  5HN0 A;  5G0R B;  1TFY A;  2HWH A;  1RAH B;  3PV8 A;  1KLM A;  4ED0 A;  4P2F A;  2V4R A;  4OHV A;  2JEA B;  1RT7 B;  1UVK A;  4OX9 E;  1JKH A;  3H5Y A;  2YWH A;  1FER A;  4YY3 I;  3GIK A;  2ILZ A;  1AB8 A;  2Z58 B;  4RWW A;  4EWT A;  1B63 A;  2UXC F;  4LR9 A;  2O1T A;  2VZ9 A;  3DYA B;  2UXC I;  3LWL A;  2DXF A;  3DKD A;  1C4C A;  4QIF A;  2WTF A;  1FDD A;  2QIF A;  5B0C A;  4HTI A;  1YJR A;  2C37 A;  4QQB A;  3THV A;  2Z5C A;  4K2X A;  2XSJ B;  4OZ2 A;  2G9O A;  5GMK a;  4DZ6 A;  1FE4 A;  4CLY A;  1GH8 A;  1BQM A;  1E3H A;  3MEE B;  1JK9 B;  3N4W A;  2NUU G;  1UFK A;  3ZKD A;  2ROG A;  1BE4 A;  4HT5 A;  2W24 A;  1C1C A;  5A76 A;  1XN9 A;  3AT1 B;  5EX3 A;  3GV8 B;  3EE3 A;  4M5G A;  4AQY J;  1RT6 A;  3NNH A;  3CW2 C;  4WYL A;  4DSL A;  4HY1 A;  3W9I A;  3ETM A;  5E7O B;  5BYS A;  4ITS A;  1JKH B;  2K7J A;  3R6G B;  4B02 A;  4Q43 A;  2BYC A;  1R7I A;  2WCX A;  3BBB A;  4LSL A;  3NXZ A;  1J2V A;  4LF1 A;  2HFO A;  2UUB J;  3OTB A;  5DRO A;  4OO1 A;  2PO1 A;  2FC9 A;  2HQI A;  3MOJ B;  1YK9 A;  1EKR A;  4OO1 D;  4EFA C;  2FTR A;  1JMT A;  4U96 A;  5LMN J;  4K5S A;  3BKT A;  4B9M A;  2DNN A;  1MWQ A;  3MOZ A;  1S6P A;  4B9V A;  3OSP A;  3D3C J;  2IA0 A;  1M1K T;  5KT5 A;  1I94 J;  3HVW A;  3GV5 B;  4IFD A;  1OS5 A;  1U0H A;  4CRJ A;  2F9J A;  1M1H A;  1RWP B;  1HQE A;  4KHP F;  4ZCM A;  5KFZ A;  5IFM A;  1C1C B;  3KK1 A;  1NM2 A;  2FIU A;  4ILL A;  4PRX A;  1VC6 A;  2ZZN A;  2VG6 A;  2H1Y A;  4CM0 A;  1RT6 B;  2XLK A;  3IWX A;  2ZH1 A;  2C2R A;  4J91 A;  3R97 A;  2L9W A;  2EFN A;  2V8H A;  1LK7 A;  4ELV A;  3V2U C;  2HVD A;  2KT5 A;  4IUF A;  2BJ1 A;  4DV2 E;  1MSW D;  3FQK A;  4FDF A;  4OKG A;  5EWG A;  2UXB E;  4IRC A;  2Q3P A;  4DQR A;  2LU1 A;  4OO1 B;  3JSY A;  1IBM J;  2KYZ A;  5A2Q C;  5CQG A;  3NCR A;  2QFJ A;  4WYW A;  3BGF A;  3IC1 A;  4IRD A;  1O5J A;  2KH9 A;  4U95 A;  2XLJ A;  1NK0 A;  4DV7 E;  3CB4 A;  1NZ8 A;  4HEA 9;  2C2N A;  4DZD A;  1S6P B;  2MB0 B;  5AJ3 F;  2WB1 D;  3TP2 A;  4QIV A;  4WK1 A;  4OQJ A;  3QSY B;  1PJ5 A;  4BCA A;  2XM3 A;  2O67 A;  1U0H B;  4WU3 A;  4DX6 A;  4YME A;  3QGG A;  4O3P A;  1S1T A;  5EL9 A;  1NPR A;  2MEW A;  2Z4P A;  2HLT A;  1HQE B;  1R8C A;  5KG2 A;  1RB0 A;  3OTE A;  1ZZN A;  4X64 J;  3T1H F;  3ZTR A;  2BR0 A;  3T1H I;  3FKB A;  3LA0 A;  2GO4 A;  3VF0 B;  4MIW A;  3MEG A;  4LRD A;  3HSZ A;  1U25 A;  3VVT A;  4NXM E;  2KG1 A;  1SKR A;  1FDA A;  3SBM A;  1H38 A;  1Y5Y A;  3JQJ A;  2ZD1 B;  2E1M C;  2OTL S;  1NHI A;  3K5L A;  2W7A A;  3GCX P;  4F4W A;  4OL8 A;  4L74 A;  3I56 S;  1S72 S;  4HHH A;  3K8V A;  2AV5 A;  1T0T V;  1MX0 A;  3TEH B;  2F4F A;  1S1V B;  3IG1 A;  1SKU B;  5K36 E;  3KFW X;  3CDU A;  4DR5 J;  2VC0 A;  3GCW P;  2K1R A;  4CTA B;  3DLH A;  2BKO A;  3MGJ A;  5HK4 A;  4YR2 A;  4M5D B;  3THT A;  4LF9 E;  3C6T A;  3HD1 A;  1PAE X;  2GMH A;  2PGC A;  1NSK L;  3H5S A;  1H2T Z;  1C1B A;  4OMF G;  1R6V A;  2DRB A;  1V9O A;  2M0G B;  4F04 B;  5EHH A;  2RE1 A;  1U09 A;  1FKO B;  2YVS A;  1SC4 B;  1O6X A;  5L46 A;  2QLJ B;  2W7P A;  1D9D A;  1W7W A;  3PKM A;  1QD1 A;  3MEG B