3LTOA

Crystal structure of a mevalonate diphosphate decarboxylase from legionella pneumophila
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
MHWFAQAPANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIPGAPEFNLSVEAQKRFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTKCASIALSELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALWTGDKVSAIDLPYKDLLHQVIVISSQEKEIPSRVAHKLVKTSPFYETRSERAEANLKLLLNAFENKDWTSIYQICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVVTMDAGPNVHLLYRSDQTDLARQFKSDHLVGNYDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate diphosphate decarboxylase
publication title Crystal structure of a mevalonate diphosphate decarboxylase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Lyase
total genus 105
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 4.1.1.33: Diphosphomevalonate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18376 MDD_C Mevalonate 5-diphosphate decarboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3ltoA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3ltoA01
2BV3A 4JI2I 4YY3E 4B3SI 4DPTA 4DR5E 1XMOI 4AQYI 3PYEA 4LFAE 4I3HA 3GONA 4DR4I 4MYTA 4JG4A 1N0UA 3OTOE 2HFUA 3T1YI 2R3VA 4LF4I 4OX9I 4Z7CA 3WU6A 3WU4A 2UXDI 2E5LI 4JI6E 4DV5E 1N33E 1D6TA 1MX0A 3CWVA 4DV3I 4GKKI 4HYMA 2WW4A 4FN5A 4YY3I 2UXCE 4DV1E 4DR1I 3WU3A 2HK2A 4X62I 4USMA 4DPYA 1XNRE 1HR0I 3OTOI 2UUBE 2EFGA 2DEIA 3HULA 3F0NA 4JI6I 4JYAE 1H72C 1N33I 1PVGA 3ZM7A 4KHPE 5LMUE 4JI3I 3ZKDA 4DR2E 1EA6A 1IBKE 2UXCI 2V2ZA 2V2VA 2HFSA 4DU8A 1EI1A 3WU5A 1I94I 1QZRA 1N32I 4LF5E 4LFCE 3B82A 1J5EE 3T1HE 4FW9A 4X64I 4B3MI 1XNQI 1MU5A 3J7AG 1PKPA 4R1FA 1H7SA 4JI2E 1KKHA 2VQEI 4B3SE 4NXNI 2VQFI 1Z5BA 4AQYE 4Z7YA 5LL6R 4DR4E 5GMEA 1Z5CA 2R42A 1J5EI 3T1YE 4NXMI 1MG7A 4FWHA 2ZM6E 4LF4E 2UXDE 2F4VE 4LF8E 2E5LE 4DV3E 4PRXA 4GKKE 2HKEA 4JI0I 1HNWE 4P52A 1ZM2A 4JI7E 1ZXNA 4LF9I 3D4JA 4P7AA 4DR1E 2OI2A 4DV6E 5A2QC 4ED4A 1WUUA 2ZBKB 4X62E 1HNZE 4JI5E 1HR0E 2A2CA 1FWLA 2XEXA 1NZ0A 2ZM6I 2F4VI 4LF7I 4LF8I 2BM1A 3K1JA 2VF3A 5BR8I 4JI3E 5A2QQ 1HNWI 3J7AM 3QT8A 1NHIA 4JI7I 1I94E 5IWAE 4EMDA 1N32E 4DV6I 1VISA 1BKNA 4HXZA 1XHKA 4X64E 1ZM3A 1HNZI 4B3ME 1Z5AA 4XTJA 4JI5I 4FWDA 1XNQE 4DV7I 2HKJA 2J7KA 2HK3A 3LTOA 4UTGA 1XMQE 4DR3E 1Z0CA 2VQEE 3ZKBA 4NXNE 2DEJA 2VQFE 1ZXMA 4M1KA 4DXLA 2HHHI 4B3RE 1H73A 2GS8A 4HY1A 1PIEA 3B78A 5GMDA 5IWAI 4MYUA 2ZITA 4NXME 5FLXC 1NHJA 4DV4E 1ELOA 4JI1E 4HACA 2A2DA 2X7IA 1UEKA 3ZZ0A 3LPSA 4PU9A 1FWKA 1XMQI 4JI0E 5L3JA 4DR3I 4PRVA 4DV0E 4LF9E 2UUAE 4USKA 4DUYE 3PYFA 1N36I 5FLXQ 4B3RI 4GKJE 2BM0A 1FJGE 4DR6E 1Z59A 4DV4I 1FNMA 4JI4I 4LF7E 4DPWA 4JI1I 1HNXI 2X36A 1Z0EA 5BR8E 3J80C 2V34A 3H4LA 2E1RA 1S4EA 4DUZI 4B3TE 4DV0I 1A6FA 4X65I 4DV2E 4WUBA 2UUAI 4DUYI 1KIJA 2UU9E 4RPFA 2CZ9A 3M6AA 4WUCA 4GKJI 1DARA 1FJGI 4DR6I 3ZZUA 4DV7E 1IBLI 3J80Q 5IT9C 1RR9A 3K17A 2NPFA 1Z0WA 1N34E 4K0KE 2HHHE 4B3TI 1OJ4A 4DV2I 2UU9I 1KVKA 4LFBI 4LF6E 1H7UA 5IT9Q 3QT5A 2AJ4A 3J81C 2V2QA 1B63A 4DPUA 4JI8E 4DR5I 1Z0TA 4LFAI 4KQVA 1N34I 4JV5E 5LMNE 3PYDA 3B8HA 4UT4A 4K0KI 1N36E 4ZVIA 4DR7E 3V2UC 3J81Q 1RREA 4DV5I 1IBME 4LF6I 4DPXA 4URLA 3Q1QA 4JI4E 1H74A 1HNXE 4FWGA 3ZZTA 1ZM9A 4JI8I 4DV1I 2UUCE 4X66E 3QT7A 1B62A 4DUZE 4X65E 4JV5I 5LMNI 3LNUA 3JAMC 1NHHA 1U2RA 1XNRI 4DR7I 2UUBI 4YHHE 2UXBE 1Z0BA 3V5RA 1N0VC 1KTVA 1FKAE 4JYAI 1IBMI 1IBLE 2Q2EB 3PYGA 4KHPI 2V8PA 2LJPA 5LMUI 4WUDA 3QT6A 4DU7A 1XMOE 4DR2I 1K47A 1IBKI 1ZM4A 1Z0GA 3JAMQ 2UUCI 1FI4A 1S16A 4X66I 4HACB 4LFCI 4LF5I 3T1HI 4OX9E 4LFBE 1Z0VA 4YHHI 2UXBI
chains in the Genus database with same CATH superfamily
2OPSB 1TKXA 3W65A 4AQYI 1IJEB 4NLOA 5A2QU 2EVZA 3BH7B 3C14A 3WU6A 3WU4A 1VK8A 4WKRA 2E5LI 3WIUA 1VS3A 4HYMA 2XO7A 1HW8A 4F3MA 4AQYF 1KRPA 3KOAA 1TKZA 1YIJS 2V4JB 2WK4A 2CJBA 3TJAA 3L3CA 4USMA 2XY5A 3W5XA 4O0IA 3DGPA 1R8PA 2E5LF 5DDPC 1HBUB 4HT5A 4P6QA 3OL7A 2AKWB 4CH7A 1H72C 3M4XA 3I31A 3LP1B 3KLFA 3W9HA 1EA6A 1UWBA 4RWWA 1IBKE 2WBRA 1B0PA 3PACA 2PO0A 3UW1A 1FD2A 3NNHA 1WSVA 2QE5A 4LCFA 3K5NA 2E9RX 2FHMA 3PIPQ 2B5JB 1HWKA 2Z5EA 4JI4J 2OD4A 2WTFA 2RNEA 3NEKA 1Z5CA 3OR1A 2DR9A 2W4PA 4YHHJ 3SYZA 3ICLA 2UXBJ 3JYTB 1RU1A 4FW4A 1X60A 2UVWA 2HKEA 1FFWB 1LW0B 1IKVA 1KLMA 1T95A 5J1NA 3KG4A 1XXEA 1AYEA 1HBNB 2ZBKB 3T1YJ 4TU8A 3NL0A 4OO1E 1D9DA 3RR7A 2BE7D 3SIPB 3T5HA 4TYAA 9ATCB 3BGUA 4YY3J 2CUYA 1YLXA 4AIMA 4WFZA 5E3RA 3C8YA 4MK9A 1UVNA 1P1LA 3ZZPA 4QPTA 3SBMA 5LSLA 3C15A 1HNVA 4F04B 2IJRA 2FVRA 4JI3J 1IKXA 2VQFE 4DXLA 5C24B 3MMBA 5HN0A 4WE1B 1KVJA 2R2RA 1R6LA 2DNHA 1RT7B 4CTAB 4IH7A 2YWEA 2L3MA 2HW3A 1CS4B 1Q79A 1BQNA 1QJHA 2LP4A 1QVGR 2VPWB 2Y0SD 3W5ZA 4OZNA 1S1TA 1XN9A 5DJBA 2N4CA 4WYWA 3MHYA 1RWNB 1RZMA 4YQWA 1XQIA 2R7WA 1WHYA 2AQ4A 4JV0A 4DR6E 2LXFA 2I8EA 4LRAA 2KT3A 2CQBA 4KO0A 3DRPA 1XIQA 1WG5A 5KFIA 1ACMB 1DQ9A 4JP8A 2DR6A 4Y2IA 2V34A 3CCQS 3OLAA 4U6PA 1S4EA 3R5JB 2YNFB 5T41A 4X65I 4YS2A 2U1AA 4ZCKA 3O6QA 2ZH6A 4LF8J 5F3TA 1HARA 2L9DA 2YNIB 4JBCA 5C0XD 5JEAB 4HHHA 4K4YA 4WYLA 3AJ1A 4PYDA 1T8EA 2RIJA 1ZPWX 4CDIA 2JT2A 3J81C 5CYJA 2AT1B 2IA6A 2HHXA 2J0QD 2AHOB 3TUZC 4X4NA 1L3VA 1JXVA 3DRRA 1X7VA 5DG8A 4RUCA 4NZ7A 3GV7B 4ER8A 2MZ1A 4CLLA 4EBCA 4RJVA 4H4KA 5ITHA 3J81Q 1SUQA 2QFIA 1U1MA 1UDOA 1V5VA 3SSQA 3H2LA 4LMZA 4JI4E 4CM2A 3GJSB 1FRMA 1CG2A 3TA0A 4DV1I 2XS2A 3QT7A 3HSJA 2DNKA 2HHUA 4B3RJ 5LMNI 2UV8G 4U8YA 1WJ9A 3QIPA 2UUBI 2UP1A 2EBGA 4YHHE 3I56S 3CULA 2UXBE 1RI7A 3H90A 3ENQA 4OHYA 2L9WA 5GAGI 1OMSA 4DV1F 2WAQD 4Y0FA 5LMNF 2GIFA 2UUBF 3B4DA 3PFOA 4GKJJ 5HAOA 1QUVA 4KAIA 1F3FA 4H4MB 4MQYA 1TK5A 4IR1A 4EZ9A 2W7OA 1FCAA 4YY3E 1FK9A 5ETVA 3M6UA 4PR6A 3IRWP 4F26A 4YMEA 1KSPA 3S7RA 3HPOA 1HBUA 4JG4A 2FY1A 2PGCA 1RT6A 4FXDA 3LP1A 3MM6A 4NLPA 3GG0A 3RTVA 3UD4P 3DXSX 2K8GA 1TL3A 3ZZZA 4DV5E 3DLEB 2GIQA 3FZBA 2XBPA 4XIUA 4WF9Q 4QCLA 4FN5A 5KFUA 4YP3A 1UEVA 2B5JA 4CLUA 2R7OA 4QYZK 3HHDA 4DPOA 4KRWA 2B4UA 3QSIA 3KUHA 4G65A 1T9UA 1QSLA 3OTOI 2VG5A 1Y5YA 1UJ6A 3I9V9 3RBZA 3VVTA 1D1UA 1JLCB 2DNZA 3UCUP 3CCES 2DGOA 3UR0A 3TYTA 5CHCB 1H2UX 4CLSA 2NN6C 2V2VA 2HFSA 2IMWP 3OTOF 4FP9A 1OWXA 1L3SA 2F8MA 1N54B 3MF5A 1TK8A 1XJWB 5C5JA 4O44B 5JXSA 2DNGA 1AA1B 1HBNA 1X5PA 4HL9A 1HNXJ 5F3ZA 4EBEA 2HWHA 4QPXA 2XSJB 2F8HA 5ETSA 5F8JA 4DUZJ 2AEJA 3R1LA 5FIIA 2HNDB 4EUVA 1J5EI 4B9TA 3MPWA 1D9FA 4FXVA 4P2SA 2MLYA 4LF8E 3FCWA 5F0WA 1FTRA 1VRQC 2FVSA 1N48A 1XMOJ 1ZM2A 3CJ8A 1WC6A 2EFPA 2B7BB 2BX6A 4CLFA 3JSBA 2JEAA 4EK2A 3SQGA 1Q81T 1J5EF 3OTEA 2IVFB 3ILOA 4P74A 1Y5NB 2R9LA 2MHNA 1V3ZA 3ISNC 2RQCA 2D3OR 1NZ0A 2VL1A 3M9NB 2KJVA 2BRKA 4WE1A 2BM1A 4RR5A 1XMBA 2FVCA 4W92B 2PFFB 4OYWA 3EGVA 5C2GA 3QT8A 1GEHA 4CTAA 4FBUA 4IFYA 2VZ9A 2POKA 1PGZA 1P1TA 4XK8C 4IZJB 2MLZA 1ZM3A 4LF4F 3JSMA 2C3OA 4X4QA 2FJAB 3TUIC 1T03A 4ZVRB 4O23A 2ZD1B 2H65B 3U1LA 5AE1A 3EPGA 3WX8A 2JDJA 1H7XA 3J7AN 3MPUB 2DEJA 1GFWB 4RUBA 4B3RE 3G87A 1B99A 1S48A 1PIEA 3B78A 2WNRB 2KTQA 1CULB 1LWFA 3WHIA 4K8RA 2OUGA 4QYRA 3TA2A 1M5PC 2DR8A 2OTLS 4GO7X 4CWBA 1V5IB 1N52B 1XMQI 5B0BA 3D0GE 2YKMA 2CVIA 1RLDA 4LT6A 2HNZB 2VPYB 4OYOA 1IKWA 4P2MA 2VDIA 4I6AA 1TV6B 4GKJE 4RW9A 1XTZA 4F2SA 2DXFA 4WP9A 4QIFA 3G2XA 4RBVA 1XMQF 2HBYB 3A12A 3FSXA 5JVHQ 4OV6A 2UV8A 4MK8A 4QWDA 2CFXA 2GHVC 1KOOA 3MEEA 2EKNA 3BQ2A 4M95A 3M2RB 3FMWA 1MMLA 5U47A 3UCZP 2P9CA 4ZIWA 2H4YB 1U6BA 3AXMA 2ZNYA 5HLFB 2Q66A 4PABA 2G1DA 4HH0A 1EX8A 4C7QA 1NRKA 1RAGB 2C39A 1OJ4A 4DV2I 1W7WA 5KFEA 5KFRA 5DDOC 1HNZJ 3R3TA 1MLAA 3T9NA 4HDHA 2ZJPQ 4DV7J 3T5JA 5KFNA 1K9MT 4CO2A 5L39A 5HQMA 1Y0HA 2BE2B 3L7ZB 5H9FK 4DV2F 4JV1A 3B8HA 3G6VA 4L3NA 1XBWA 2EW9A 5HJYA 1XC9A 1WDTA 2VFTA 1YRUA 4H4OA 2I5JB 4DCPB 1HNXE 4DR3J 1SKSA 4FXWA 4WP3A 2O1WA 3CDIA 1U0SA 3PO5A 1DAXA 5IV3A 3ILIA 1AUSL 4DUZE 3B4MA 4KGMA 1A0OB 2E9ZA 3LNUA 1U2RA 5IOLA 2BOAA 1RYRA 4DR7I 3R5GA 4N8NA 3V5RA 3A3NB 4JYAI 1IBLE 2CJYB 4LVOP 1S76D 3IWNC 4USWA 1IN0A 1D9AA 3MM9B 5D0RA 1XMOE 2J65A 2JFKA 2HRYA 3EUNA 2EC2A 1RXOB 2KXFA 1Z1ZA 3D67A 4I64A 4DR7F 1RHRB 2GW8A 4V19X 4MIBA 4CH0S 3TAQA 2PI5A 4ZVHA 4PCQA 2CPZA 3PG9A 4QWCA 4RNFA 2ASDA 1TZ0A 4WBFA 4NYPA 1P8GA 4HHJA 3MEDA 5BR8J 3KJVA 3L7OA 4LFAE 4NYOA 2CG9A 2OLWA 3HVRA 2EC0A 2XTJP 4LJMA 4UQTA 1NPRA 4ID5B 3AJ2A 2CKWA 1Q7LB 3JB9k 4N56A 4IFDD 1D6TA 2R8IA 2MZJA 1HFEL 3DRSB 3N01A 4ZP8A 2W1BA 3CC2S 5CYQB 2X1FA 1VQ8S 5I42A 3IAM9 4K4XA 2NUHA 3EDQB 1SCJB 3KHRA 4M5IA 5EWGA 5KFTA 2ROPA 1O6XA 5EN1A 2P2CB 4DR5F 1P27B 3CJ5A 2HBZB 2UXCI 3HSGA 2B4VA 2GO4A 3QRPA 3B82A 4F7VA 4LQ3A 1JWWA 1Y00A 4ZLLA 3T5LA 2DITA 3MPDA 5CYMA 3RRGA 3PVXA 3OFFA 4OZ1A 5LMUJ 1D3WA 1RAAB 2BE9B 2UXCF 2XLIA 1WDDA 2LLZA 1LXJA 4NA1A 4USTA 2B9WA 3R5BA 1U2CA 1B0VA 4P7TA 4CZCA 1LW2B 3BN4A 2MQPA 2R42A 5GADI 5J2MA 3KK1A 4FWHA 2CADA 3MPVA 3NS7B 3Q2SC 5KFPA 4B9NA 2R8HA 5CD4H 3VAIA 1VBYA 5A8WA 4JI2J 5EKWA 2HHSA 5LMUF 3KG1A 3KJFB 4NLXA 2R7XA 4IZJA 5CCMA 3MR2A 2FY8A 5K8MA 2WP8A 4RNOA 4P9SA 3GIMA 5AE3A 1HNZE 4LFBJ 4AL6A 4ZVGA 2AGPA 5E0OA 3GMGA 3T9ZA 2CVEA 1FNXH 3HD2A 3CJ4A 1DLOB 4JI2F 4L72B 4ZVFA 3IWXA 1TL7B 2C2ZB 3MOZA 1APSA 4URQU 3MURP 4OX6A 2H51B 2HNYB 1XHKA 4FF3A 3E8OA 5DG7A 1KOHA 4HI2A 4JI6J 2YH0A 4DV3F 5M2UA 4ILLA 3F44A 4OYPA 4F25A 4DR3E 2XGPA 2YY3A 3CJRA 4HYKA 1NKCA 3RAMA 3DU5A 1HWLA 5DRKA 4XDCA 2IM0A 1NUEA 3MMJA 1UVLA 3MM5B 3OSNA 2B7CB 2QL9B 4Q45A 4IO9Q 5AXNA 1UA0A 2F65A 1Y4SA 1K73T 1VQ6S 3E01A 3R7NB 1CJUB 1NK9A 3J7A1 1YZ7A 1KEKA 1S1UB 4CO0A 3W2VB 4NI2A 2GGPA 2OAUA 1CJVB 2OELA 1IKYB 2YKAA 4X64F 2R8KA 3DOLA 2BM0A 5E3PA 5HSPA 1KS2A 4DV4I 2LEPA 1IM6A 2PEHA 8RUCA 2PD1A 4C48A 3AXKA 5BR8E 1GXLA 2IIHA 2GHWA 2VQEF 5JEAD 3VGUA 4NXNF 3OV7A 3IA0A 2LMIA 4IRKA 3X3UA 5C7PA 2HQFA 5L38A 4DV4F 1OY8A 3I4HX 3L7ZA 3BBFA 4DSJA 4RNMA 1RR9A 5GAEU 2JZ5A 4OHXA 4LF9F 1S57A 2IJFA 4LBHA 2HIQA 3ZO7A 3NY0A 4KB7A 3IM9A 2QA1A 2QLFB 1HQ2A 4OYAA 1TTHB 2MLXA 2BKPA 2FD2A 3WQPA 2X3DA 2GJFA 2P6TA 4YDXA 4NZ6A 3Q86A 3MM9A 2XULA 4G3IA 2QRRA 1A6LA 2AGQA 2C2RA 2GO3A 1QM9A 4QZVB 3FFIB 1L3KA 3L7UA 3JSYA 1NHHA 1RADB 2VBXA 5KFZA 1KWMA 3MWBA 1NO8A 4K4ZA 4DG1A 4C11A 1ZA1B 3OJSA 1WACA 4DU7A 3RZAA 3ONQA 2OMOA 1X4FA 2Y1IA 3V6DA 5AXKA 1WOSA 3R5CA 1VQ9S 3U7JA 4Q0BB 4LFCI 4X4RA 3G6YA 3PM9A 1XR6A 3DKDA 4LFBE 4I2PA 4R8UB 3OVSA 4OI1A 5HMXA 5L46A 4LOMA 4CQ1A 3NGDA 4J7CA 1JKHB 1X9SA 4N5SA 4KGVB 1WELA 1NNDA 3R6LB 4OI4A 4A48A 3H59A 4ZJQA 3LQVA 1D8ZA 4ZN1A 4IG3B 5GVQA 4NLQA 2Z5BA 2HQ3A 4JI6E 1NJIT 2W2PP 4P71A 4KSEB 3CWVA 2WW4A 3R9LA 1TFWA 3OUYB 5IQ6A 1G2EA 4WZMA 3D9BA 1N34J 4NMLA 2JL9A 3OXLA 2O3DA 3IR6B 2OPQB 3EZOA 3IG1B 4PG6A 5D8HB 3PR5B 1EP4B 2LXUA 2KO1A 1S6QA 3CJQA 1FFGB 4CP5A 3D6TB 4XDDA 1LW2A 4NEYA 3PRBA 3MM8B 4HTIA 1M1KT 3NP5A 2CNKB 3PEJA 3FK4A 1NPKA 2JJ4D 3KUGA 1OPZA 4OL8A 3CIMA 2C38B 1REGX 1UEUA 1PBAA 2XLJA 2ZJRQ 1FVQA 1YBTA 1D09B 3ENVA 1H7SA 2J0SD 4MIAA 4AQYE 3VAJA 3UDVA 4X65J 5D4OA 2LEAA 4RNNA 2BA1G 1F5CA 2WVEA 4F50A 3RBXA 1FJ7A 2EEYA 4NLTA 4ZVSB 4RNHA 4CO4A 1NK8A 2E5LE 3IBWA 3MAQA 3K7RA 2IYIA 1ZTWA 2A18A 1TR0A 3IBCB 4I4BA 2HNYA 1SL1A 2W7AA 3VAGA 1SKRA 1FXRA 2OI2A 3RBEA 1JB0C 3P3EA 2Z5CB 3EGWB 1BWVA 4OKGA 2V4QA 3PJWA 4QR2A 1RHYA 2ZM6I 3GFZA 3W9JA 1GMVA 4N3OA 2IDLA 1PYTA 2NN6F 3MXHP 1RT5B 4R5PB 3KJNB 1NHIA 3KDNA 1VQ5S 5KFJA 3MR6A 1DTQB 1NHUA 3TZYA 3GB0A 3HFKA 4I67A 1Q7YT 1U1OA 2ZM6F 2JLEA 2CYYA 5F41A 2VG7B 3EICA 1BQXA 1VIOA 4A8MP 4LBIA 4CLTA 2G2OA 3TR5A 2HHHI 2W4DA 2I6WA 5C0XF 2C2OB 4MK7A 4ICLA 1Q8BA 3FGVA 2ZZNA 1QUPA 1S7IA 3IGVA 2MJNA 4OZ3A 1UEKA 2B8PA 1VQNS 3LPSA 3MTJA 4C8NA 1X4EA 3G96A 1WI8A 2IESA 1ZBTA 3K8WA 4QR0A 3CD0A 1RTJB 2QA4S 3G4SS 4IR9A 2Y9HA 4U7CA 1MSWD 2DHGA 2NSCA 1T94A 4B3MF 3G86A 3K5OA 4MIWA 5BXIA 3MECA 1FE0A 3T5KA 2ASLA 3BSNA 2FGOA 2XWXA 5KFFA 5BYRA 3PS1A 3BKUA 5KFLA 1Z0EA 3DOMB 2QLBB 4BHQA 2NN6A 4KGXB 3BJYA 1S9GB 3DI6A 4M5DB 1RAIB 1KIJA 1SJQA 3M32A 1NU4A 1LWEB 2VBYA 4B02A 4WUCA 5K14A 4ZPAA 4LBPA 2Q6CA 1S1VA 2HIYA 5AE2A 5KG6A 3OPKA 2WSEC 2B6AA 2WHOA 3CIZA 3AOCA 3N6NA 2DGUA 4RZRA 1FKOA 1N34E 2VHGA 4JI7J 2H4WB 2CG8A 2W8LA 3OVBA 4CCHA 1WHXA 1WKLA 2P8IA 2ZH2A 1URNA 4WP8A 1KONA 4LSZB 4NL5A 3WX4A 1SJ3P 2FHOB 4DQIA 3O3LA 4NRUA 4CO5A 2AW0A 2MGZB 2PO2B 3W2WB 1RAFB 4QIGA 4HTJA 1SH3A 2RDJA 3PW0A 4C8LA 5E33A 5LXRA 3H5SA 4FKYA 4WXWA 1E6VA 1RAEB 4O3PA 1B3TA 4X4VA 1T02A 1RWUA 3GR0A 3B4TA 1NDPA 3NGRA 5DS7A 5KFGA 2VV5A 1JJHA 5LSRA 4P2XA 1UJ5A 3ZZTA 4WCEQ 4R8UA 1OS5A 3QWUA 5KFQA 4X65E 3NNAA 1M5OC 2HVDA 3IMQJ 1JKHA 2YWKA 1SI9A 3EYZA 4DMZA 4BA2B 2K3IA 2ADCA 1FERA 1X5OA 4R0EA 1RTHB 1RT2B 1KQKA 4JI1J 1NCLA 4I69A 3PYGA 2XCAA 2FGCA 4WUDA 2MTLA 1VLOA 4DR2I 2O5DA 2ZH3A 2OD6A 3M8WA 2NZCA 3NGUA 3TA1A 1GTHA 4EO6A 1WTFA 1UW9A 3HLUA 5JUMA 5ETMA 2J6SA 4Y2AA 4DR2F 1FKPA 1C1BA 1FWPA 2QMWA 4ZITA 2LA4A 1EP4A 2EG2A 5KG3A 3HJCA 1HPZA 3BDEA 1U8WA 4DL0C 4DR4I 1FFSB 5EX0A 2AIRB 3HK2A 1UZHA 2VA3A 2XO6A 1PJ5A 1SQEA 4OX9I 1MN9A 2YPZA 5ETNA 3S01A 4IG0B 1VRTA 2NYHA 1X0PA 1Q5VA 2KFZA 2NXJA 1WSRA 1EQMA 3HHEA 4DV1E 4DR1I 1S6OA 4KGKA 4K0KJ 2AJQA 1MU2B 1SJRA 2IOPA 5FDLB 4X62I 4OX9F 4OZJA 2UUBE 3R5DA 3C46A 2OSQA 1Q8KA 1VJWA 1VQLS 3DYAB 2Y8WA 2VKZG 1HNIA 1CC7A 4DR1F 4JI8J 5HMYA 4J9OA 2M2BA 4CLKA 1HIYA 4X62F 4JV5J 1DBDA 4C3LA 2V2KA 2R2SA 5H9EK 1ZZFA 4FW9A 4IRDA 1ULRA 1S9EB 1QDUB 3MMCB 2W2QP 3CCJS 2QMUB 3MMAB 1XNQI 1JLBB 4F4WA 4Z2XA 1OQ3A 3HKWA 4KHPJ 3N5FA 2HFVA 4R1FA 1R0CB 2RRBA 5J1EB 2RUSA 3D7SB 8ATCB 1UA1A 1TQLA 2MDAA 3OL9A 3CMES 2UUTA 4F4XA 4K4VA 1UKUA 1Q95G 3NMRA 1CJKB 4NLUA 2RKIA 4B3OA 1IWGA 1XNQF 2FJBB 3PW5A 1R0AA 2A10A 4OO1C 1WC5A 3TZZA 1WOPA 5D0HA 1DTQA 3AB4B 2M5YA 4NCGB 3HVWA 3LUYA 2OFGX 4JI7E 2KXNB 3L7PA 4P7AA 2K2PA 2BDPA 2PNMA 3T1HF 3CVKA 4ZPDA 2EG1A 4AM3A 2AGOA 2PI4A 1UP1A 2BA0D 1T11A 4B3SF 2CJKA 1HNWI 3I0RA 1PJ6A 5ETRA 2YKOA 4DHVA 2DCUB 1JLQA 4AIDA 2ZH1A 4FW6A 3QMQA 1JLFB 1Z5AA 3NWRA 1JMTA 4ELTA 4FKXA 1FRHA 4HT7A 3EGZA 5DQIA 1RT1B 3J81U 2ASJA 2D1CA 2Q6BA 3EE3A 4LREA 1HNWF 2VDHA 4CT8A 5KG1A 4HLBA 5ETKA 1YJTA 3LO3A 2EK1A 1HR0F 4FDFA 2R4FA 4D3GA 4TVAB 2UVVA 3DOMA 4JI1E 4ZHRA 1RA6A 3WBZA 4F3OA 3I4PA 5J1PA 1I94F 1N32F 5KAKA 3A3OB 2XSFA 3T3FA 1BMQB 3ZNUA 2R7RA 3PX0A 4MT1A 1Z59A 4LQ9A 4YB5A 1X4GA 3HHLC 4KQZA 3BB5A 5ETPA 3F41A 4DPWA 1OYEA 4CO1A 3H1CA 4ED3A 3W5YA 1URRA 3H4LA 2Z58B 3KK3B 3U1MA 2P9EA 5E41A 2MGZA 3NGKA 4UW2A 4DSKA 2DNNA 2KFYA 1VHFA 3D1QA 3PKYA 1RT4B 2MKKA 1Z0WA 3FSYA 2G0CA 4J9KA 4K0KE 1GH8A 4DX8H 2DYAA 4UUXA 1JXLA 2PC6A 1D0EA 4J3DA 4Q8EA 1C0UA 1H7UA 2JX2A 3QT5A 1Q5YA 3QATA 1WWHA 2BJDA 1B63A 2UVUA 4JI8E 3J80Y 4EYHB 4BA2A 4JV5E 3NKYA 2Y1RI 2C3MA 1TVRB 2KFNA 1RREA 3U1NA 4CRJA 2GV1A 3H2VE 3Q1QA 2IMOA 3GE9A 2E7VA 3OTDA 4AD6A 5T7LB 4FW5A 1WTBA 4K2JA 5I3QA 1Z0BA 4OQJA 1YHCA 4QBUA 1WD6A 2OGUA 2DR7A 4LSNB 1FRXA 1OYSA 1PAUB 1UPMB 3OD2A 3OR2B 5B0FA 1WKJA 3UR3C 4IH6A 1N5QA 4NASA 4CO3A 5KFMA 2F5GA 1MU2A 5FDLA 4M63A 4AXIA 5A8RA 3HM9A 5HROA 4RL1A 2W25A 1BQMA 1DHMA 4A8FA 4L6V3 1NPPA 4OIXA 2G0IA 1K0VA 1TFYA 3QFHA 1HHSA 3TAMB 1RYSA 2VODA 1UFWA 2XLKA 3TQ1A 2DNOA 1RBAA 2BRLA 2KZZA 1WG4A 2M9KA 4OHWA 1M5VC 2B3TB 2AJ1A 3M8QA 3BSCA 3I87A 4QQBA 4FYDA 2JE6B 4Y2KA 3NS6A 4PXCA 5GAGU 1NZAA 5J2PB 4DSLA 2K3KA 3KHHA 4J9RA 2BOPA 3M2VA 3HULA 1T9WA 3F0NA 2V8VA 4JYAE 1KTQA 2FPHX 2MKSA 3T19A 3A3PB 3MPYA 5KOWA 3NBPB 3EPIA 1R0BG 2MEWA 2CDQA 3WU5A 3M6WA 4TNOA 1S6PB 3BYPA 1XNRJ 4W90B 4AE5A 4NCGA 1E6YB 2DGSA 1P42A 1HMVB 5EUHA 3U1KA 1XK8A 1OSCA 4X66J 5GMEA 3LP2A 1RT3B 1XNRF 2MKYA 2VJUA 2JVOA 2Q3PA 4WTYA 2R7VA 4ED6A 2IM2A 3KLGA 1GAOA 2CQDA 3GV5B 3I96A 1G7CB 3MGJA 1DTTB 3MOJB 4P52A 3GYGA 2BZ2A 4DWIA 3TJ8A 2HFNA 2DRBA 4LF5F 3HFZB 1Y7PA 5LXYA 1RT1A 1BLUA 3PRDA 4LR7A 2QSFA 4C0BA 5EX3A 4WWSA 1REVA 3MAAB 3VQSA 4LF7I 4U3DA 2CPFA 1HI0P 4MKVA 5D15A 4EMDA 5GMKa 3HT0A 1RTDB 2HHWA 2UXDF 1VQ7S 2GQCA 2DTJA 1ITPA 2W4CA 1TK0A 4PWDB 3HVTB 1X5SA 4KE5A 5D4PA 1UZDA 2RDDA 2VJVA 5C0XB 6FDRA 1WI6A 4FNHA 4NLRA 1ZYQA 1LOUA 2H5EA 1O51A 2W2NP 3QIDA 1YI2S 4I2QB 3TVZA 3MEGB 4WKYA 3FVYA 3IP0A 4NCAA 1FF2A 1UVMA 3BS9A 5AXMA 4PU9A 1PO6A 4LF1A 1NM2A 2OEKA 2Q79A 4QU6A 1GX6A 2Z8QA 1NB2A 3POTA 1S0MA 2FIUA 4LUBA 1Q53A 1N36I 4J9VA 3H2UB 4OYXA 2O1VA 5DNXA 1PYOB 2ABYA 2GJIA 1Q0NA 4IYQA 4N47A 4U7UK 4AL7A 1MMDA 4JI0J 5J2QA 1USVA 4YEAA 1HW9A 2JOQA 1YQHA 3TUPA 3PW2A 4PUOB 1N36F 2KG1A 3HVAA 3L09A 4CYUA 5DZ7A 4FF4A 2PN6A 4B9VA 2GO8A 2BEFA 2RJZA 1VIXA 5K36F 3CCTA 3DM2B 1CEZA 4JI0F 5C42B 3K17A 1UVJA 1CJTA 2DIVA 4TN2A 5I3UB 5F8NA 5EGYA 1QAJA 2PO1B 2FUG9 4DL7A 1YJNS 1MROB 2W8KA 3L95X 3C19A 2BJ1A 2DGQA 3M1VB 2XMUA 2KG0A 1AZSA 4NRTA 1RTIB 4CLPA 4PQUB 2V2QA 4DL5A 2ZH5A 5IS2A 2FVQA 1JJ4A 1WKKA 1U49A 2MSSA 3P3DA 5KFDA 3UHMA 4XAKA 2HHTA 2ZKTA 3CGIA 2EWHA 3MR3A 5JEAC 3I5CA 3S8SA 4LF6I 1PC5A 1YGYA 3BN7A 3RJMB 5I4MA 4HKQA 4X66E 1GQEA 2IPOB 3QRQA 5LJ5Y 3CCWA 4P73A 1AW0A 2IC3A 1RISA 1FO1A 1N8RT 4LF6F 5C25B 2Q2EB 2Q1LA 3D1HA 4DS5A 3TAMA 4ZVTB 3VZIA 3KFWX 1LWCB 1X5TA 3GFXA 2ZH7A 4F4ZA 1NXIA 3DCAA 3HZEA 4ILMA 2ROGA 4EYIB 2UUAJ 3RB6A 2A6MA 1XR7A 2GAGC 4UZBA 2COLA 1K0TA 5KG2A 2IERA 3P45B 1YJWS 3RR8A 1NHVA 2HWTA 3Q89A 4ECRA 2IRYA 5K9FA 1WC0A 1U1LA 1S4FA 3V81B 4ZP7A 1RKJA 3OLBA 1SV5B 1N0UA 4OZ0A 1HBMB 4G6VB 2UU9J 4C8OA 3DDIA 1Q1KA 2R3VA 4ZPTR 4GKKI 4ELVA 2FDNA 1BC6A 2YKNB 3KLIB 3FJ2A 1B0TA 2HHHJ 1VK3A 2IM3A 5L1KA 1MWYA 1IR2A 3UPFA 2HQDA 2PMWA 2QN6B 3ZTQA 3C66A 4TU9A 3I32A 5KG7A 3W8PA 4ANCA 5IQQA 3SCJE 3AY0A 2C37A 5CABA 4MU4A 4EO8A 4LFCE 1YJ7A 3ZFVA 1P6TA 3FQKA 4G1QA 1NK4A 2CZ4A 5KFYA 1QE1A 2HGNA 3D28A 2LDIA 2EFVA 4M5HA 1JLAA 4GVBB 2RB7A 1PKPA 5IZHA 3QO9B 2ZOFA 1IBKJ 1Z5BA 2XMJA 4U7UD 2RF2B 1S0OA 1FA0A 4N7TA 3MAAA 4AT1B 1H7WA 4PXBA 2MYFA 2LQ9A 4NXMI 4KKOA 2GZOA 3C2PA 4K4UA 1KLNA 4PRXA 5EL9A 1A9NB 2BANB 2NREA 1RTDA 1ZXNA 2P6SA 2D7SA 2LKZA 4PWDA 3VGSA 2QA4G 3HVTA 4O4GB 2KZMA 2B4PA 3HHNB 5HMWA 2AV5A 5L9XA 3GMEA 1S99A 3SCLE 2C2NA 2MSTA 2M88A 3PJ9A 2FJVA 3BBBA 2XYPB 5LM7E 3VAKA 3IR5B 2M8HA 3BO4A 1BKNA 2PNZB 1X9MA 3LGNA 4WU2A 3N4WA 4ZVEA 3KHGA 2BJ7A 1KVIA 2QC3A 2J7KA 5G0RA 3EJMA 3QJJA 1V3RA 2HFZA 1Z0CA 4M1KA 2BJ3A 5A2QY 4ZA1A 4DFMA 1YJ9S 1FE4A 4IOAQ 1TMMA 4OO1F 3CDBA 1I3OB 5FLXC 5D0EA 2B51A 1RWOB 4Y34A 3KMQA 3W7BA 2RILA 4HACA 1EB0A 1M90T 5AT1B 1LEOA 5DLFA 2FQQB 5IC4B 2PEBA 7AT1B 2UUAE 3MM7A 1NSAA 1IM4A 2V8GA 5FLXQ 3DM2A 3JTPA 2OPRA 3G8QA 4CNYA 3VAFA 5I3UA 2Z0GA 1PC4A 3BSOA 1MROA 4USVA 3GIIA 1W2IA 4QWEA 1U1NA 1S12A 2VQFF 2E1RA 1TP7A 2IVYA 2OEMA 4DR4J 1YVFA 4DI6A 4ED2A 4LRCA 2UU9E 5JMNA 2CZ9A 1R8HA 3K8VA 2QYGA 3M6AA 3HSDA 1U6FA 1YG0A 1DARA 3HKMA 3TWZA 4DR6I 1JJCB 1KDNA 3CD7A 5IT9C 1ZZNA 2HVZA 4F4YA 2N4DA 1S77D 3CCLS 1PYSB 2IAJB 1ZAVA 3UDEA 1X4HA 2HHHE 1EQ0A 2MQQA 7FD1A 4N77A 2QL7B 1UDQA 4DR6F 4OO1A 1N6QB 4NBQA 5IT9Q 2F63A 2MXYA 4LSLB 5KFAA 3FDSA 1R3NA 5K8OA 4OHZA 2W9CA 4EBDA 2M4MA 3IRXA 2W9BB 3P06A 1EKRA 3HT3A 4UT4A 2LU2A 2KVIA 3GFHA 4ZVIA 3T6JA 2WOMB 4DQRA 1SC6A 3M85D 3THTA 2AJ2A 1EKSA 2X3GA 4BA1B 4IFDB 1RHUB 2F1FA 1NMEB 1VR6A 3DU6A 4MKAA 4Y00A 2GNKA 4FZVA 4O3NA 3MCSA 4MDTA 3CNQP 4DEZA 3SSSA 1H0HB 1H2TZ 4TKTA 1TUGB 1VCTA 1VRUA 2XWYA 3V6JA 4MU0A 3CT9A 4KIAA 4WK1A 2FVPA 2FJXA 1N0VC 1VJQA 5A8KA 2DISA 4KPYA 1HBMA 1PBUA 2WB4A 1GXTA 1U0HB 4DV0J 2I9SA 1R6YA 4TY8B 5LJ3Y 2LXIA 4M5KA 2J9CA 3HCXA 4ECTA 2NXCA 1FJGJ 4YHHI 2UXBI 3SDEB 2B0GA 4A8KA 3HJFA 4JI4F 5LL6d 4ES2A 3SZ2A 3THVA 3ET6B 3GP9A 4J9MA 1LFWA 5F8IA 3OJUA 4DPTA 3BQ1A 3V4IB 5IM0A 4DZDA 3GONA 5BYSA 4B3TJ 2BMBA 1Y9OA 3Q8SB 3CCZA 3CSKA 4YHHF 3T1YI 2UXBF 4XO0A 3HHLA 3HFVA 3AH6A 4ZVQB 5FJ4A 3BEGB 4PZVA 4RW8A 1UJ4A 1VQYA 4DFPA 2C2EA 4IOCQ 3TAPA 4YY3I 1OQ6A 4QYZJ 1BHNA 1VC0A 1VOMA 3T1YF 3FEZA 3JQKA 1RGVA 4DPYA 3TQEA 4IO1A 3DLJA 3QO9A 1O0PA 4DV5J 3C16B 2R2UA 4RW7A 4F67A 3G82B 3QJPA 4MU3A 1PSDA 4YY3F 4JI3I 3ZKDA 4DR2E 4TY9A 2MKCA 1WF0A 1V6HA 3B54A 3ELHA 5B7WA 1YZ6A 1Y4ZB 1EETA 4WZQA 4DV5F 5KFHA 4N8OA 5A76A 4JI3F 2HGMA 5B0AA 3Q2TC 5CD4A 3K59A 3GCWP 3P6YC 1MWZA 4DR4E 3TNVA 2ZZTA 1T7PA 5DQGA 1C2PA 3NGSA 2QSWA 3LH2S 2VG6A 4ZP6A 3UVJB 2NN6D 2EFOA 1FRJA 3KLHB 1RQ0A 2ZBIA 3TX0A 3BBCA 1H98A 2RQ4A 2CWXA 2PIIA 2AJ0A 4OX7A 2XI2A 4DR1E 2MZRA 3LANA 4IZKB 4MMOA 3U02A 4X62E 3R7BB 2JRSA 4FYYB 4KBIA 4C4WA 1LNQA 1PKUA 4A8XA 3VWSA 4LF8I 3DD6A 4UOHA 2ACYA 4KJIA 2HYIB 2KRBA 1U24A 3L4BC 1HQUA 2GMJA 3CCUS 3BKFA 4DS4A 5E3CA 3D0IE 1YITS 3Q8UA 5G4DA 3D6MB 4LF8F 5J2NB 1XNQE 2VONA 3IS9A 3D66A 2G9OA 4U9RA 2F3JA 2HK3A 2E7XA 1FT8A 4OZ2A 1QAXA 4J9PA 2AF6A 1S7HA 3M2UA 2DXEA 1AXQA 4PWWA 1XEZA 2GS8A 3WDOA 2E9TA 4HY1A 2V9KA 2V5HG 2ATCB 3DOKB 2YQ0A 2ROEA 4ECYA 5ETTA 3N79A 5E7OB 1Q16B 4J9SA 4LRFA 3N6MA 5L3JA 2NXEA 1N5YA 4B9UA 4DV0E 3CJKB 4CNZA 1Q82T 2DD8S 3EWGA 4B3RI 3BGRB 4LRBA 1DQAA 2PT0A 3AAWB 2OPSA 3LPEA 2K1RB 1FJGE 3E2EA 1YRTA 2RU3A 5K8PA 1R89A 3M30B 4NEZA 1WG1A 2X36A 3A8JA 1FNOA 2KM8B 3O44A 2AYMA 2XS5A 4B3TE 4B3RF 2IA0A 1S1XB 4OV1A 4GKJI 2DH9A 3ZC4A 2V4JA 3Q6MA 4CM0A 2F4VJ 1HQEB 4WK3A 3GG1A 1DFDA 3CJ3A 2DO4A 2P9GA 1RWVB 1L5UA 4DV6J 2FJWA 1X4CA 3OHAA 4GKJF 4JI5J 1U2FA 1GT8A 1ICEB 2JH3A 5KG0A 3NLCA 2LYVA 2DT9A 1FEHA 5H9FJ 2XMAA 2KHCA 3P96A 4ECQA 4CIOA 5IWAJ 6AT1B 5HP1B 2HZVA 2AE8A 2VFVA 2DNQA 1U0HA 4DPXA 1EJ7L 3OFHA 2V67A 4TY8A 2RVJA 5DLGA 2KDOA 3CPWR 1Y5IB 3DMJB 5D6GA 3QLHB 3JYTA 4HHUA 1SPBP 5DGBA 3NWGA 1U25A 4LIRA 3I82A 4B08A 4PG4A 2KYXA 5D4NA 1E3PA 1LW0A 1ZH5A 2FZKB 3W60A 3DLKB 1FKAE 2BABA 5HVGA 1YHQS 4KV8B 4PEOA 4ETXA 3M7VA 3WZ0A 2DRAA 3RU0A 2DNMA 5ETOA 4ZJLA 2MY8A 2I38A 4DUYJ 4IFVB 3BZQA 4QWBA 2NXNA 4ZLPA 3D54A 4P2FA 1RWWB 2DGXA 3RAQA 3CD6S 1GMUA 1IBLJ 4EGLA 4LF7J 2GX8A 1HNXF 3GZ7A 1YJRA 1XMOI 4IFDE 4ECUA 4DUZF 2FHJD 2JC1A 4RUHA 3CDJA 2ZC3A 3PXGa 2ALYB 2R7SA 4LF4I 4Z7CA 3QGIA 5C24A 4BWMA 4Q43A 1IBLF 1U26A 2RH3A 4TU7A 1XMOF 1RT7A 4LFAJ 3NCPA 4FNIA 1CS4A 2B9YA 3CDEA 4USUA 1SQFA 3IO1A 2MPUA 3MDFA 4IDKB 2PSZA 1D8YA 4P7VA 3C6UB 2DGWA 1C0TB 3DC2A 4DUTA 2AX0A 3KWMA 4OI0A 2UZAA 2DXDA 4LFAF 2C22A 4HI1A 3UVJA 4I7FB 2F9JA 2EFNA 4ECVA 2O3ZA 1K44A 2BR2B 2XI3A 2YNFA 1V3SA 2KB2A 2KU7A 2CA9A 3GSIA 3AOBA 4F4KA 4J5OA 4RX6A 3T41A 2UUCJ 1FVSA 1BGXT 1M1GA 2J5AA 2YNIA 1KBRA 3A13A 3UNYA 3FBBA 2FB0A 5JEAA 3RW6A 4W98A 2QV6A 2F4VE 2OEJA 1RDRA 3EXYA 4PWUA 3EM1A 4YOEA 1HYSB 4QU7A 4DV6E 4LRDA 3JS9A 1QVFR 4A4JA 1CVJA 4JI5E 2LFVA 1H6KX 4Q7AA 3BO3A 3P8BB 4WFNQ 2XEXA 1NLKL 3LGMA 2NPIA 4KFBB 1WC1A 2Y0BB 4EEYA 1TL1B 1Y6ZA 1JK9B 4HR2A 2G2YA 2CQ3A 3EZ5A 3J7AM 4DF8A 3VGTA 5IWAE 2RE1A 2RT3A 1RWXB 1Y10A 5GAHU 1TKXB 1HNZI 2CNNB 2QIFA 1N5SA 5B08A 1YRXA 4RUAA 4ETZA 1NDCA 4I1TA 1N33J 4DV7I 3C14B 5E5NA 2C3PA 1TAQA 3BGRA 5DGAA 4ATNA 3ZKBA 4FF2A 4USJC 5CAAA 3V6HA 2YX7A 5IT0A 3K0JA 2IRXA 5KFBA 4X4SA 1N56A 1HNZF 2VC0A 5C2CA 2X1AA 5CA5A 5F9NA 4DV7F 2HMIB 3TRGA 1TKZB 2CQ4A 3GCMA 2Y3YA 4ECWA 2ZUAA 4DR3I 3DGPB 3CCRS 2CDRB 1NAQA 2VFUA 1O8BA 4H4MA 2Z2ZA 4DUYE 3GIRA 3JQMA 5JEAE 1HQEA 4ZJOA 3KLFB 2IY5B 1UWBB 4V1Ak 3MD3A 3OQ2A 1TELA 2HHPA 4LF7E 1VHIA 3P3GA 4DR3F 3LAMA 4IH5A 3ILLA 1Q78A 1UMJA 1C4AA 2DJWA 2HRUA 3CDWA 3DLEA 2LVWA 3H4DA 2DH8A 2KT2A 2XMWA 3KLVA 2XNQA 2WVBA 4IOBA 3O8WA 3SSRA 3EVMA 3V4MA 1MN7A 2N7CA 4F02A 4GKKJ 3FSIA 3OR1B 2YWFA 1NEEA 3DDKA 5B0EA 1NKEA 4NE9C 3OL6A 2AEFA 5I3PA 3ULHA 2DY1A 4NX9A 1JLCA 1KVKA 3QQCD 2GQQA 1EARA 4YN3B 1IKVB 1KLMB 1YBAA 2XGQA 4WFYA 5BR8F 1OY9A 3N9UC 3RGIA 1S10A 4DR5I 4QNKA 4EI2A 4M5LA 3MCOA 1LXNA 4O44A 3PYDA 1SXLA 1N36E 2XHCA 5EWFA 2F7VA 2PA3A 3PY8A 2XSJA 3OFEA 1RU2A 2YWHA 4Q2LA 2D3UA 2HNDA 4G1IA 2ZBPA 3Q83A 2J0WA 2DRDA 2ZOGA 2UUCE 1B62A 2G1HA 3M7ND 1Y4UA 3C15B 3PKMA 1HNVB 4KGZB 3GU0A 5LOQA 1IKXB 4NXMJ 1X4BA 3MMBB 4X4OA 4ZPCA 4QIEA 4J91A 5LMUI 3QT6A 4Q2MA 5KT7A 1K47A 2BW7A 1BQNB 3KJQB 5D4LA 4BWJA 4PG8A 1HHQA 1LQ9A 4FYVB 2MQOA 1R7IA 3G8TA 1Z0VA 1S1TB 3PX6A 4ZIVA 2CJQA 3K5LA 4KH1B 3FRYA 5DNLA 4JI2I 4J9UE 3IWLA 4RBTA 3M6XA 4QNJA 4IDKA 4KO0B 2ZD1A 3DRPB 1C0TA 2XZTB 2JWNA 1Z2ZA 2VPZB 2AX1A 4URSA 2DNRA 1FJEB 1N33E 3BH6B 4DV3I 2WNRA 1CULA 1NSQA 5KT2A 2QLJB 2HRTA 2R7QA 1F6TA 3MD1A 2GFFA 2OP5A 1RHMB 2J76E 3SFGA 3H42A 4LFBF 1VMBA 2OH2A 1VQSA 3Q8RB 2HNZA 2B9XA 4JI6I 1PVGA 1HBOB 1TV6A 2FZCB 4LR9A 1GMWA 2R8JA 2YWGA 3EX7B 5DZ6A 4X64I 3W8GA 4JI6F 4ZPWR 1IBMJ 1K8AT 2PA8D 1E3HA 3M2RA 1MU5A 2ILYA 2VQEI 3ZNJ1 4NXNI 2YQ3A 3FEYB 1SUQB 5HLFA 2E1CA 2HBQB 3S1TA 4OZLA 4FPIA 4KFBA 2MY7A 2HAIA 3EZUA 5DG9A 3S6EA 3UN3A 2RSQA 3QSYB 2BA0G 4GKKE 2WVDA 3QIPB 4AQYJ 3AODA 1EHWA 4LF9I 4DBQA 1F2HA 2ZH8A 2CJ9A 4QW8A 2HS0A 1WUUA 2CRLA 5T14A 1TUVA 3TOQA 5LT5A 2BE2A 2E29A 1Y60A 2E5LJ 2QA2A 3DDNA 1RTZA 4ED5A 1R6VA 3O5TB 3Q6NA 4A8WA 2QZ8A 2I5JA 1CLFA 2XHWA 4OJ3A 2HMIA 1YBUA 4YR2A 2B8QA 3BR8A 4I6WA 2O01C 2M70A 1FK9B 2C28A 2MQNA 2JLFA 4AFFA 2Z4PA 1C4CA 4CI0B 2KJWA 1F9FA 2HKJA 3LTOA 3QFWA 3R97A 1RT6B 1ZTTA 2AMCB 5KFKA 3MM6B 1RBLA 5A6WA 1NHKL 3PNIA 3FKBA 1TL3B 2ZHBA 1CBKA 1J27A 3G8SA 2K7KA 3GWCA 3G71S 3ILJA 3IN5A 4NXME 3FBFA 4YFUA 3J81j 2Y1JA 1UVKA 1K1QA 2VH7A 1S97A 1UL3A 2VG5B 3KMSA 1F1BB 3TZXA 1RLCL 2PE8A 3J7YU 3K2YA 3V6KA 3NAIA 2YWWA 5K36D 1Y3KA 4QW9A 2JEFA 1VBXA 3I6PA 3Q0AA 1OYDA 2VFRA 3RRHA 1UFLA 4ID5A 3SMZA 2FLPA 1P9QC 1X4AA 3ISZA 3G9CA 1TKTB 4RPFA 2KN4A 3DRSA 5B0GA 5CYQA 1JLGB 2ASYA 3CW2C 3NCRA 1ROFA 4PQAA 1Z4UA 3D6FB 1FRKA 3TANA 3PJXA 1BUXA 2EFQA 4L74A 1VC5A 2ALZA 2N3LA 4PAAA 3RB4A 3D2WA 3BGLA 4K4WA 2XY7A 3IBFB 2AJFE 5L1LA 2BA9A 2LQ8A 1HLWA 3JQJA 2NSBA 2JEAB 3SQGB 1FJCA 2MZTA 3KK2B 1YJUA 2LECA 1N34I 1UCNA 1LKZA 2OKQA 1PG5B 4LF2A 1DY3A 2JEGA 4O0NA 2ACMA 3IXQA 4MTPA 3SEOA 4ZLNA 1F9EB 3TI0A 2I1RA 2LDYA 1IBME 2OO4A 4Q8FA 3H8YA 4URLA 4IFYB 3NOGA 2HFOA 3BR9A 4B17A 2ZJQQ 2GMHA 3ZZYA 2LCWA 1N34F 3QZ7A 1QTMA 3JSMB 2RQKA 1QSSA 1BD6A 2QFJA 1T03B 4YUDA 3FUYA 2NQPA 3JAMC 5D78A 3MEKA 2CQPA 5MAOA 2W9AA 2WW8A 3PCOB 3UWTA 4E8UA 3ZTOA 3FZ2A 2H9ZA 4GC6A 1WEYA 2VFSA 1LWFB 2NZ4A 2QL5B 3JAMQ 1DLOA 2ZBQA 3VR1A 1TL7A 2GVZB 4OJ1A 2ZHOA 4MJKA 2GQ2A 5FLXY 4CH1A 2YKMB 4EFAC 1RAJA 3GTYX 1UAWA 1RK8A 3CXCR 1IKWB 1NDLA 2WVCA 2FJEB 4DL2A 1W26A 4RW9B 1ZETA 3PYEA 4NA3A 2B4OA 4X65F 2MQ8A 4KR0B 2QLXA 5CXTA 5HMZA 1MNEA 1WNEA 1HBOA 3CJSA 3W63A 2AU0A 2YBVA 4C8ZA 4DF4A 3MEEB 4FVCA 3QYYA 4F0MA 4USHA 3MM5A 6FD1A 2BR0A 4KY3A 3BM7A 2V0NA 4ECZA 3UDCA 3RB0A 4U67Q 1CJUA 3DLBA 2HK2A 3JXOA 1W25A 1R8CA 4K4SA 4YR3A 1S1UA 3W2VA 4FBTA 2EFGA 1RHKB 2Y1LB 4ZCLA 2C39B 1CJVA 1IKYA 4KTQA 3NZKA 2V8DA 2HVEA 2V8HA 4OJGA 4F3QA 5IT9Y 4Y3CA 4DV1J 2E5JA 3EDRB 2V2ZA 5H9EJ 5LMNJ 2BYCA 1U1PA 1USUA 2J9EA 4OMFG 4HDGA 2UUBJ 4NWBA 1VQPS 4B3MI 5FLXU 3BPSP 3CO0P 4KHMA 4C97A 1S0VA 3HZGA 2OMLA 3GCXP 4YB6A 2F9DA 2JVRA 3D3BJ 4H4OB 4R25A 1VYAA 5K5MA 1I5OB 2MZQA 3U27A 2RDIA 2HS4A 1A7GE 3T1YE 4PPDA 4KH0B 3MCMA 2FJDB 2FLOA 5F8HA 4XPCA 4OYZA 3CWJA 1FDAA 3M8ZA 1Q4RA 4U96A 2XMKA 3AQOA 3ENAA 4BBYA 5CZXA 1U48A 4FS2A 1N4LA 5IFMA 1BWEA 3I9ZA 2H48B 1XWLA 2A2CA 3O2IA 4FW7A 2BXJA 2AYBA 2JEBB 3D6HB 4ZPVR 5IT9U 5ETQA 3DFEA 4JI3E 4ECSA 1NJWA 4OO1D 4C9DA 4JI7I 2OPPB 2RAQA 1T9VA 1HI8A 4X4PA 3K85A 3OTOJ 4M8LA 3MEDB 3KJVB 2A0FB 5B09A 3I5AA 3FFIA 2QJ3A 3G6ES 4DQPA 1AT1B 3TUJC 2DK2A 1JXEA 2QGFB 3KDOA 4UTGA 4ES3A 4DCOB 1UETA 4A46A 4JI7F 4AXJA 1QAYA 1PJ7A 2XMMA 3VCDA 3VGVA 3CD5A 2XNRA 4OZEA 1X9WA 3AQPA 3W64A 1B70B 2DKOB 4FW3A 1ELOA 2C2KB 2V94A 3HJVA 4Q0BA 2WONB 2CIMA 3R6GB 1TKTA 5I42B 1NJZA 3QGPA 4F36A 4PRVA 3H5XA 2K06A 5L8RC 1CPZA 1JLGA 1J5EJ 2DVIA 4ED7A 2BKOA 1U4BA 5C0XC 3VV2B 4ZCIA 3QZ8A 4EWTA 2M52A 4JI1I 1RWMB 2E5HA 4QIWD 1EIYB 2H5JB 4IG3A 3J80C 1IR1A 2HZAA 2KKHA 2V63A 5CYMB 2VKRA 1OYPA 2IDEA 2HQGA 5KFCA 3OUYA 2IFXA 3OHBA 3R27A 3TO8A 3QWPA 3KK2A 2XQCA 4LF4J 1B7YB 1NSPA 4JI1F 2OPQA 1VI7A 3EXCX 4LCHA 3J80Q 3IG1A 5KT4A 4PXEA 3BQ0A 2C1EB 1NBEB 3PFEA 4ES1A 5J2MB 3HHLD 1LFPA 3KK1B 1WC4A 5A8WB 3KG0A 4DX6A 3MM8A 3NRBA 2OTJS 3OFGA 4OHVA 2XYGB 3NG8A 2H5IB 3CC7S 2CAJA 5DETA 2WP8B 2C38A 4OYMA 3JTNA 4WFAQ 5LMNE 1EAYC 4QOTA 4K0KI 4NYZA 5A6PA 2HURA 4USIA 4C8KA 3N5BA 2ZH4A 5ETLA 3ZTRA 2GAHC 4OZ5A 5DRRA 4OLPA 4DJBA 1XMQJ 3UCGA 2GVZA 1H2VZ 4JI8I 1PCAA 4K0KF 2ZUGA 4JV5I 1M5KC 3HXMA 4E98A 2LQJA 5CH7B 1SC4B 3RW7A 2E1MC 3ZZOA 3J81Y 3MZIA 4U95A 2Z5CA 1RWKB 1NB7A 4KHPI 1OSDA 2NCKL 4PYAA 4JI8F 3TW0A 4U3BA 2X1BA 1KQGB 4JV5F 2J7UA 5E2QA 1Q8LA 3E01B 4DOZA 5LSOA 1SBRA 3T1HI 3UE2A 1RT5A 4R5PA 2YH1A 2MKJA 4NI2B 4KHPF 2GGPB 2AYEA 4PKDB 1U02A 2V4RA 4F8RA 2BV3A 2B43A 2C42A 4TYBA 2HBRB 2ZVIA 1TKDA 4B3SI 3THPA 1NH8A 3DOLB 2VG7A 2D74B 2W7PA 5ADZA 2ZHAA 3P3CA 4DV2J 4Y2MA 4ZVOB 4X4UA 3OTOE 5F8LA 2K7JA 3MFHA 3IR7B 5BYQA 2BQ3A 3GLLA 2CQ0A 4TLQA 3OSPA 3WIVA 3ETOA 4ZN3A 1JQGA 2Q43A 1VDHA 3P4UB 2VOPA 4J37A 2MMYA 4URGA 1KN6A 5F0UA 2YQ1A 1HR0I 4DL4A 3DXBA 2QG9B 4K5SA 3FCVA 4DSIA 1F5AA 1RTJA 5HL7Q 1YJVA 2Z57B 1SIWB 3H40A 2YKPA 2P5VA 3ZM7A 3BO2A 2QTWA 2YNHB 1I94I 1N32I 3P49B 1QY7A 1J5EE 4DR7J 1WC3A 3OBIA 3EVWA 2C3YA 2WVFA 4KC5A 1CC8A 3OXGA 1H38A 1HWUA 4JYAJ 1S9GA 2YX4A 3Q8YA 4M5DA 1UWAA 2DGTA 1ZOTA 3HDSA 2A1BA 1LWEA 2R7TA 1YSJA 2JEBA 4NCBA 3AT1B 1MG7A 4TQRA 4LF4E 3NCQA 5B0CA 4JYAF 3BYRA 3K5MA 1IQTA 3O1LA 2OPPA 4EU0A 4PG7A 4BDPA 2HQCA 5K20B 4DX7A 2NYIA 3D4JA 2FC9A 3BGOP 4C2MA 3GFYA 5RUBA 3Q24A 4DG1B 4C11B 3KTQA 4HEA9 1RKIA 3BF4A 4FYWB 4NLGA 2PO2A 3W2WA 3V6DB 2HHQA 4QR1A 1HI1A 2VIHA 4DR5J 3MTKA 2HAFA 4I2PB 3LA0A 3DRXA 2W2MP 2MQMA 2WONA 2O1TA 2V9WA 2CNOB 3KLEB 1FTCA 2ZVSA 4M5GA 2DB1A 1XMQE 2F8EX 4E0DA 5E3QA 4X4TA 2HGLA 1RHQB 4O3OA 1JX4A 2UXCJ 1RTHA 1RT2A 2Z5BB 4Q44A 2ZBCA 2ZITA 4K4TA 2JEIA 1S72S 3SV4A 2YPYA 3RYLA 2CPIA 2EI5A 1U47A 2X7IA 2CQCA 1FWKA 1WEZA 4ZDNA 4IUFA 1S6QB 2VA2A 3FBEA 4USKA 2AEMA 2M8DB 1U7LA 3KNAA 2GQ0A 3CJTA 1LK7A 1SKUB 2NUUG 3E3XA 1ZAXA 1RACB 2BKNA 1F5BA 1OO0B 2F1DA 4IG0A 4OYIA 1A6FA 5IV4A 4DV2E 2H3EB 1DRZA 1IVZA 1RAOA 2GA7A 2GC8A 3W9IA 1R43A 2G2ZA 4DV7E 4ILRA 1VQKS 3H98A 4DV3J 2CPJA 4ZS6A 4Y2CA 4JB8B 2J6TA 4WFXA 3GYNA 1J5OB 1RHJB 3DYAA 1SJ1A 3M85G 3CCSS 5DO2A 5HBMB 1X8DA 4UQGA 2I0XA 4NLDA 1SH2A 1JNRB 5THWA 1S9EA 4DSFA 2KVQE 3UD5A 4ELUA 3MMCA 1N5TA 3MMAA 1JLBA 3C6TB 3NNCA 1UDNA 2ZFHA 3FCHA 4DR7E 1GK8A 5J1EA 2HHVA 1IWAA 3GLJA 4CLYA 4X64J 2DNYA 4RU9A 1CJKA 3SV3A 2OIHA 2HSEB 4UZCA 2VQEJ 3DLHA 1VQOS 4NXNJ 1AFJA 5KFOA 1SVDA 4V19J 4PRFA 3HD1A 1FHTA 1HWJA 4ED1A 1XNRI 1KR4A 2Z2MA 4DV4J 2IBOA 1KTVA 2CPEA 3DHXA 3MR5A 3SFUA 4ICLB 3BV8A 3I55S 3A4TA 3DLLQ 1U1KA 4LF9J 1FI4A 2FZGB 1JJ2R 4X66I 4IFDC 4LF5I 4UF4A 2CNLB 4Y28C 5DQHA 3UNGC 4RKUC 3PS2A 3G6XA 1VQMS 4O3RA 1U1RA 3CCVS 1JLFA 4DR5E 3MECB 4X66F 3MR7A 5EDWA 3PX4A 4MYTA 4J9QA 1IBCB 2N3OA 2IYGA 2H54B 4UUWA 2QLWA 1RP5A 9RUBA 2NN6B 2UXDI 4XTTA 2HS3A 3DI6B 2NS1B 2YNHA 4WTOB 5KG5A 3M32B 1ZAWA 2UXCE 5K14B 1RSCA 5AXLA 1S1VB 4RLEA 4IRCA 5M2PA 2B6AB 4DZ6A 1DJ0A 1FKOB 4WXOA 3OW2R 5DRPA 3CO9A 4QIVA 4LCGA 1VBZA 1RUSA 2IRUA 2VOOA 3ZTSA 5LMUE 3PW4A 4K50A 1P9YA 3PDNA 1L3TA 3PW7A 4OI2A 1KD1T 2ZH9A 3GIKA 2VBWA 1EI1A 4IQMA 3R8YA 2M0GB 1RJJA 3GIJA 3KK3A 3J7AG 4F4AA 4JI2E 3CE8A 1QD1A 1E6VB 4ZLJA 5HVHA 2WCXA 4LFCJ 3T1AA 1YKWA 2O1PA 1CQNA 1RCOB 1FX2A 2V69A 2CQIA 3Q8VA 1RT4A 1WF1A 2BQRA 3Q22A 4DV3E 2ZDOA 2KYZA 4JI0I 4Z37A 2MKIA 4ED0A 2CJXB 3KLEA 5A2QC 2ERRA 2ZNZA 4LFCF 4KT0C 1HL6A 5KFWA 3SXLA 1FWLA 4RO0A 1F3VA 3N0VA 2QT7A 3K1JA 2C2DA 5A2QQ 1TVRA 1SQGA 4EZ6A 1FKPB 2DY9A 1C1BB 2BJEA 3E51A 2AZ3A 4X64E 1HD1A 4FWDA 3LGHA 1HPZB 3ITHB 5T7LA 4UOCA 1M1HA 1QTNB 2VQEE 3GPAA 4NXNE 4DX5A 4HH1A 1GTEA 4LSNA 1VRTB 3RAXA 2R8GA 1UTAA 2R2TA 4K7QA 1G1XA 2OHDA 1GXUA 1Z2LA 1K1SA 2WSFC 4DV4E 3LOUA 3OR2A 2E5IA 2EK6A 1G3OA 1ZA2B 5D0GA 3P5TL 3ZZ0A 2YKQA 1VBKA 5M2RA 3UDLA 3WC0A 4LF9E 5KFXA 1M0SA 4ZVPB 3SI8A 3RBDA 4A8OA 4GC7A 2G4BA 1HNIB 4RBUA 4ID8A 1C1CB 1J5OA 4JV2A 1UFKA 5KT6A 5HO4A 3HKZD 2DNLA 3GSDA 4NLVA 3A8KA 4ED8A 5HBMA 3I0SB 4WUBA 2UUAI 4NZ0A 5D77A 3VHQA 3Q23A 4IZJD 1U8SA 2OJ3A 1S59A 2VBZA 1VGYA 2HG4A 2JE6A 2ZM6J 1T9XA 3UO0A 3C6TA 4YDDB 5J2PA 2RKIB 4B3OB 2W01A 1WEXA 1Y3JA 2DHXA 1R0AB 2UUAF 2MJUA 3UN5A 2KT5A 3PV8A 3NBPA 2UU9I 3GJTB 3H5UA 1UVIA 2KM8C 3LP0B 5IT4A 1S6PA 5H1SV 3R5AA 4I0WA 4FF1A 2QMXA 1T3NA 1E6YA 1Z0TA 1O5JA 5K36C 2M3DA 2UU9F 1HMVA 1OPIA 5HQLA 5CCLA 4B3MJ 2VESA 1FDNA 3I0RB 1GMWD 2Y8YA 1RT3A 2X51A 1KNZA 1JLQB 1T05B 1H74A 4H54A 4MH8A 4NPOA 4NLSA 3NXZA 3K57A 1HK7A 1ZM9A 2IBKA 2D69A 2HHHF 2YVSA 3FRZA 1S6UA 1FESA 1DTTA 3A1YG 3NOCA 5KT3A 5DRQA 3PEHA 2ADBA 3MUVP 3VAHA 2LU1A 3AA9A 3N28A 1IBKI 1ZM4A 5DDRC 4F2RA 1Z0GA 2QYCA 2VU5A 4ZHRB 2GVDB 4XPEA 3VALA 3SCKE 4B9MA 2JLGA 1IXKA 2C3UA 1BE4A 3WC2A 4OI3A 5HATA 3P5BP 4G1PA 2PFDA 1RE1B 3M9MB 1IBKF 4C0HA 3VTIA 1KHWA 2M7SA 1I1GA 2XYHB 4I3HA 1KP6A 3LF0A 1SH0A 1PAEX 2NXUA 1XERA 2ZKUA 3DRYA 2HFUA 5C0XA 1LK5A 4J90A 4ZCMA 2XMTA 5CZVA 1MX0A 4I2QA 2LQ5A 3QGHA 3MEGA 4AYBD 3KRNA 4L3KA 2RRAA 4I56A 1IJFB 3UFCX 3WU3A 2BJ9A 1SC1B 4BC7A 4UOGA 4C6AA 2DEIA 1NKBA 2NR0A 4W4MA 1SIZA 1VLYA 3PHEA 2RUGA 5GADU 2BUNA 2DHHA 1B64A 1C0UB 4DU8A 2J0XA 4PG5A 3H7HB 3GJQB 2Z56B 3LWMA 2XCPA 1FRLA 4PUOA 3M8SA 3ADAC 4DR2J 3R7SB 3DN9A 3JTOA 2NN6E 2XB2D 2VQFI 4NA2A 2BJ8A 5HVFA 5D3GB 4Z7YA 4M5NA 3HHKA 2IJNA 1LV5A 5C42A 4BLGA 3W3SA 2ZM6E 2PO1A 1F0XA 3CJ2A 2WRMA 3CDUA 2FLLA 2LA6A 3VAMA 1KFSA 3M1VA 1JIHA 1IR0A 1WHVA 2GIRA 1RTIA 4J9LA 4PQUA 1Q8IA 4ED4A 5C0XE 3ITHA 2E5GA 3PHTA 3JAMY 3LW5C 4OX9J 3X1LB 4IS9A 1AROP 3FMBA 3FBCA 1NK6A 2KHDA 4DL6A 1Y5LB 4DR1J 2HPUA 3TEHB 4PXDA 4DR4F 2IOQA 4X62J 2XM3A 1G4CA 2QX0A 3IAS9 3GYXB 2RMLA 2VASA 3ZZRA 4B3ME 5A8RB 5HROB 1AUDA 1BQMB 3TX8A 5EWEA 4NMXA 1W2BR 1FXLA 2O1UA 3M8PB 3AFGA 1VQ4S 1N5VA 3HMJG 1C1CA 4OI6A 5C25A 3BPDA 4FPRA 4MYUA 4F0HA 3EGNA 3M8QB 3PTWA 3NS5A 2CWKA 2RRNA 1LWCA 1XNQJ 4KHRA 4MU1A 2A2DA 4D3HA 1Q86T 3I0SA 2U2FA 1F2GA 3U1YA 2CPHA 1NSKL 1JNZB 2JSXA 4LPFA 3M2VB 2J8SA 5GAHI 1R31A 3PYFA 4YR0A 5IXUA 5MLCV 4C3KA 3CF5Q 3JAMU 1NZ8A 3T1HJ 3HSZA 3V81A 1KQSR 1M5SA 3CTRA 1DQ8A 1SV5A 1F60B 2BQUA 1SJ4P 4JI4I 3A8IA 3MFIA 1OIAA 2HEKA 2UUWA 4B3SJ 4WU3A 1F9HA 2KH9A 4DV0I 3LP0A 4DCJB 4LR8A 1I6JA 3PZPA 2YKNA 1GX5A 3BREA 1TAUA 3M05A 3KLIA 3TZWA 1EZZB 1FJGI 4MAKA 1ZS6A 2A3JA 2FHJA 3LP2B 4Y6IA 4ZPBA 1S79A 3VVUA 2NPFA 1YH8A 1SJFA 2MB0B 5DROA 1HNWJ 4DV0F 3KLGB 1DZ5A 2DPJA 4B3TI 2HVHA 4YB7A 3UI3A 1FRIA 1L3UA 2HLTA 1T05A 2PNLA 5CQGA 1HR0J 4P10A 3I5BA 1FJGF 4OX8A 1IUJA 2LQBA 3HI9A 4WPAA 3PR4A 2D41A 4DPUA 4B3TF 2J7WA 3M7NG 4KQVA 1RA7A 1REVB 4GVBA 1I94J 2I2YA 1N32J 4JOUA 1SL2A 2CXEA 1NJYA 3V2UC 3QBCA 1M5HA 3CC4S 2CGEA 1BXNA 1GNKA 4DV5I 1HA1A 2RF2A 3HF5A 4MFBB 2GVDA 5KTQA 4UOFA 4OYBA 4X2BA 2AD9A 2BW2A 4ANEA 3M9OB 1U45A 2ZZMA 4RU2A 2BANA 4ERDA 1U1QA 2DHAA 3PS3A 1U6ZA 2WBMA 3K89A 2LJPA 4O4GA 1S5ZA 3K58A 2VICA 2WB1D 4OLOA 2CQHA 1S16A 1XR5A 1HWIA 2D9OA 4PPZA 2FTRA 4OX9E 1ZPVA 5HANA 3POTB 5A0YB 3MUMP 4B9LA 1B4SA 3CB4A 2PNZA 1R27B 3ETMA 2HZCA 5KFSA 2E7WA 3TJ9A 3RRKA 4L73A 3J7ZT 3P76A 2OSRA 2H1YA 3AD9C 4U8VA 5J2QB 5BJRA 2XY6A 1VC6A 2GCFA 1FKAF 3FEXB 1S49A 2HQIA 4DLGA 4P75A 4JUZA 4CYUB 2FLNA 3OXFA 1T9TA 2XG8A 3FNNA 2GJ2A 4NLWA 1MMNA 2QEXS 3CJ0A 3AA8A 3GR1A 1DURA 1R6MA 3H4BA 1RAHB 1CJTB 1H3DA 1FDDA 3QNWB 3IC1A 5D3GA 2RU9A 1T0TV 4KHPE 3AOAA 3ISND 1YWXA 2MZSA 3IGNA 4IFDF 1AZSB 4DFKA 3DNCA 3SQOP 2ZC4A 4DL3A 2VC1A 3T1HE 1WHWA 4L75A 5KT5A 3KKFA 4QJVA 2ZE2B 1YTYA 4C8YA 3AJDA 2IVMA 1SKWA 1J2VA 4B3SE 2PMZD 3QPIA 1CSJA 5LL6R 4UY8T 4C0OC 4F0KA 2CZVC 1S1WB 3HO1A 2AYGA 2J9DA 2IAJA 2LEBA 1KQFB 2IC3B 1HNWE 3J80U 1X31C 2GHPA 1N6QA 2ZOMA 2RQMA 4LSLA 3DLGB 3QAUA 5K36B 4C8MA 2BA1D 1HR0E 2W9BA 4H4KC 3M8PA 2ZWPA 3K5PA 2F4VI 2VF3A 2EKYA 2WOMA 4GVLA 2E66A 1PILA 3LALA 5F9LA 1QAIA 3TVKA 4C98A 4BA1A 2L08A 4IFDA 2D3O1 3OTBA 5K8NA 4O4RA 1I94E 4RW4B 4DV6I 1N32E 2RHSB 1VISA 4QWAA 4GMKA 4JI5I 4XTJA 3R2CJ 2C2MB 1V9OA 2F4VF 4B9SA 2JHEA 1YK9A 3CUNA 4OJHA 4N41A 3PO4A 2CPYA 2JFDA 1ZXMA 2HLUA 4DV6F 2SXLA 2RS2A 3PIOQ 2NLWA 5IWAI 4JI5F 2DGVA 2MKHA 3CMAS 2O67A 5GAEI 1JLEB 4DLEA 4TLRA 2BACA 3UN2A 2FHKA 3M8RA 3OVAA 3KYLA 3EVOA 3TP2A 4O3SA 2F40A 3W66A 1U09A 1HD0A 3SCIE 4K5RA 3SDEA 4GQUA 3US5A 2E1AA 1X0FA 5IWAF 4FS1A 3ET6A 4LF5J 4GO5X 2J9DE 5SZTA 1KC8T 3V4IA 2OFHX 1FNMA 2C37B 3DHWC 3PRYA 1HNXI 4DQQA 2MHEA 4G1QB 5KFVA 3EMTA 2Z30B 4DUZI 1QE1B 2RD5C 1I51B 3GJRB 3LWLA 1JLAB 4DUYI 2CJAA 1RWPB 2DHSA 2CPDA 2YNGB 1B7FA 2N7YA 2JC0A 5FWKA 2UXDJ 3VF0B 1IBLI 3CEDA 4ENOA 4DFJA 3J7YI 2EBEA 4KKOB 3AB2B 3C16A 4MKYA 2PO4A 4DUYF 3G82A 2JEJA 3BDPA 1T9YA 5JEAF 5KG4A 2V50A 2ZBRA 4MFBA 4DSEA 5HQ8A 1NDKA 5EHHA 4DQSA 1NK5A 3DGVA 4LF7F 2AJ4A 2B9EA 4NOHA 4LFAI 4RW6B 4OFZA 2KRRA 1TL4A 4CLZA 3HP6A 3BKTA 2GMLA 3LAKA 2Z2YB 2JNJA 1CQMA 2V68A 3GV8B 2J6UA 1NH7A 2L48A 2B56A 4FWGA 2PMHA 2XZWA 1FD8A 2YTCA 3KLHA 5A0YA 2V6AA 1RCXB 1N36J 5G0RB 3F73A 4MKBA 4LVNP 2WSCC 3D68A 2KI2A 5B0DA 2EXUA 3LPYA 2D9PA 4NLYA 5KOXA 3RG6A 1AFIA 3QRRA 4IZKA 3VQTA 2V8PA 2XZDB 4WJBA 3W61A 2N82B 1RABB 3B6BA 3H0PA 3PRVA 2GO9A 5HJXA 4J9NA 2UUCI 3H20A 4HACB 4X84A 2APOA 2PDAA 2YX1A 4Q5VA 3Q8QB 1TUWA 3W62A 1X4DA 7FDRA 1NK0A 3MM7B 3OT9A 5F8MA 2EPIA 4AL5A 1YX2A 2OPRB 3N6LA 2UUCF 1FEEA 5J2NA 2CQ1A 3RUBL 5AJ3J 2HVIA 3ENWA 1G6BA 1TMJA 2CPXA 4KPCA 2MQLA 3OTCA 3GQCA 3DOKA 2FYXA 3QGGA 3KUEA 4AUKA 5AJ3F 4ZK7M 2ZWOA 4R0JA 3M8YA 2DO0A 5L1JA 1KFDA 2ZE2A 1XNRE 1N88A 1OY6A 3CJKA 4LF6J 1WF2A 5HI7A 1N33I 4M5MA 2CQ2A 5SUHA 1NK7A 3TARA 1S1WA 2K1RA 1VFJA 4OO1B 2IM1A 2G0JA 4K59A 4A8SA 2FC8A 3M30A 1QZRA 3FQLA 2XS7A 2VUGA 4LF5E 3J7Z5 2W9CB 2ZEJA 3IRXB 4BS2A 4ALZA 1N33F 3NMAA 4BC9A 4M5JA 4IKAA 3H25A 3DLGA 1S1XA 1KKHA 5K36A 4CLWA 3ZXWA 1R8AA 4RWXA 3MUTP 1UPPA 2IHR1 1FXDA 5DM7Q 4Y65A 4ZP9A 2W2OP 3VZHA 3R2DJ 2PO0B 2AP6A 2UXDE 1UDSA 4FVMA 2KXHA 1VRUB 4RW4A 2AWZA 3D5MA 4A8QA 3T6BA 5JJBA 3BSAA 3GILA 3NAHA 3H5YA 4IQXA 5A8KB 2BBEA 3AD8C 3W1YC 3KHLA 4DDFA 1UW4A 2ZDPA 4GRSA 2VD3A 4WIIA 3QJLA 4C3MA 3ZTPA 5DDQC 1YDLA 4TXSA 5HP1A 5BR8I 1HHTP 1QLNA 5DM6Q 3KXDA 3C3LA 1JLEA 4ZVUB 4BCAA 5L9NA 4FYXB 4UY85 3CDAA 3IFEA 4I68A 3NGTA 1BY9A 4HXZA 2VB6A 3DMJA 2ILZA 3QLHA 1LWXA 5IM0B 1AB8A 5L1IA 3D3CJ 2CG4A 3AHPA 4GKKF 3OL8A 4A8YA 2CQGA 1FDBA 3D0HE 1T3OA 3FC9A 3DLKA 2Z2LA 4DN0A 3HHLB 3UQSA 2E1PA 1H73A 2QO3A 4YB1P 4KV8A 5GMDA 1KHVA 4RW8B 1NHJA 4O3QA 3A8EA 4IFVA 4K2XA 3MAHA 5K36E 2O66A 2DPIA 4JI0E 4DN9A 2HWIA 3TVYA 2XC9A 4ZMMA 1RB0A 2YNGA 4ITSA 3AD7C 4RW7B 5HK4A 1MWQA 3MI7X 1FX4A 5F8GA 5E3AA 2E44A 4ECXA 4HVZA 1QSYA 1S9FA 4WFBQ 1WORA 4L76A 1EETB 4ANDA 2D3ZA 2G13A 3CMQA 4I6YA 1TU0B 2F4FA 3IM8A 4NXMF 4CT9A 3MCNA 1TL5A 1OYRA 3Q8PB 4M94A 1SC3B 2RS8A 3ZZUA 4RW6A 2ATLA 3HX9A 3CCMS 1S0NA 1RBOB 3C6UA 2VG6B 4ZKAA 8AT1B 2DNPA 4S0MA 3F56A 4LFBI 4LF6E 2J8AA 3TEGA 2A6OA 2DCLA 4I7FA 2AZ1A 2L9NA 4N76A 3M6VA 3QAEA 2BR2A 2X1GA 1Y11A 4A47A 3KNGA 2YXLA 2UVRA 3R1HA 1HQUB 1MW7A 2DBBA 1SL0A 3RB3A 4WIQA 2VQFJ 1IQZA 3IS9B 2R7UA 4TQSA 3UD3P 2L41A 3DRRB 2RHQB 1SB6A 4KYZA 1HKAA 2KL8A 1HYSA 3L9ZA 3M2UB 2WZ1A 1NJXA 2DR5A 1IBMI 2DIUA 5JVGQ 2W24A 1R8BA 4ZOSA 5IC6B 4P72A 1WOOA 2BVZA 4LIWA 5FD1A 3JSRA 3BGFA 1TL1A 2XMVA 4ISAA 1N5YB 3D1OA 5ELWA 2VPXB 4DR6J 1IBMF 4E2FB 2DH7A
chains in the Genus database with same CATH topology
2BV3A 4JI2I 4YY3E 4B3SI 4DPTA 4DR5E 1XMOI 4AQYI 3PYEA 4LFAE 3HJCA 2CG9A 4I3HA 3GONA 4DR4I 4MYTA 4JG4A 1N0UA 3OTOE 2HFUA 3T1YI 2R3VA 4LF4I 4OX9I 4Z7CA 3WU6A 3WU4A 2UXDI 2Z5BA 2E5LI 4JI6E 4DV5E 1N33E 1D6TA 1MX0A 3CWVA 4DV3I 4GKKI 4HYMA 2WW4A 4FN5A 4YY3I 2UXCE 4DV1E 4DR1I 3WU3A 2IOPA 2HK2A 4X62I 4USMA 4DPYA 1XNRE 1HR0I 3OTOI 2UUBE 2EFGA 2DEIA 3HULA 3F0NA 4JI6I 4JYAE 1H72C 1N33I 1PVGA 3ZM7A 4KHPE 5LMUE 4JI3I 3ZKDA 4DR2E 1EA6A 1IBKE 2UXCI 2V2ZA 2V2VA 2HFSA 4DU8A 1EI1A 3WU5A 1I94I 1QZRA 1N32I 4LF5E 4LFCE 3B82A 1USUA 1J5EE 3T1HE 4FW9A 4X64I 4B3MI 1XNQI 2Z5EA 1MU5A 3J7AG 1PKPA 4R1FA 1H7SA 4JI2E 1KKHA 2VQEI 4B3SE 4NXNI 2VQFI 1Z5BA 4AQYE 4Z7YA 5LL6R 4DR4E 5GMEA 1Z5CA 2R42A 1J5EI 3T1YE 4NXMI 1MG7A 4FWHA 2ZM6E 4LF4E 2UXDE 2F4VE 4LF8E 2E5LE 4DV3E 4PRXA 4GKKE 2HKEA 4JI0I 1HNWE 4P52A 1ZM2A 4IZJA 4JI7E 1ZXNA 4LF9I 3D4JA 4P7AA 4DR1E 2OI2A 4DV6E 5A2QC 4IZKB 4ED4A 2PNMA 1WUUA 2Z5CB 2ZBKB 4X62E 1HNZE 4JI5E 1HR0E 2A2CA 1FWLA 2XEXA 1NZ0A 2ZM6I 2F4VI 4LF7I 4LF8I 4N3OA 2BM1A 3K1JA 2VF3A 5BR8I 4JI3E 3Q6NA 1Y6ZA 5A2QQ 1HNWI 3J7AM 3QT8A 1NHIA 4JI7I 2IOQA 1I94E 5IWAE 4EMDA 1N32E 4DV6I 1VISA 1BKNA 3K85A 4IZJB 4HXZA 1XHKA 2O1TA 4X64E 1ZM3A 1HNZI 4B3ME 1Z5AA 4XTJA 4JI5I 4FWDA 1XNQE 4DV7I 2HKJA 2J7KA 2HK3A 3LTOA 4UTGA 1XMQE 4DR3E 2O1UA 1Z0CA 2VQEE 3ZKBA 4NXNE 2DEJA 2VQFE 1ZXMA 4M1KA 4DXLA 2Z5BB 2HHHI 4B3RE 1H73A 2GS8A 4HY1A 1PIEA 3B78A 5GMDA 5IWAI 4MYUA 2ZITA 4NXME 5FLXC 1NHJA 4DV4E 1Y4SA 1ELOA 4JI1E 4HACA 2A2DA 2X7IA 1UEKA 3ZZ0A 3LPSA 4PU9A 1FWKA 1XMQI 4JI0E 5L3JA 4DR3I 4PRVA 4DV0E 4LF9E 2UUAE 4USKA 4DUYE 3PYFA 1N36I 5FLXQ 4B3RI 2GQ0A 2O1VA 4GKJE 2BM0A 1FJGE 4DR6E 1Z59A 4DV4I 1FNMA 4JI4I 4LF7E 4DPWA 4JI1I 3PRYA 2X36A 1USVA 1HNXI 1Z0EA 5BR8E 3J80C 2V34A 3H4LA 2E1RA 1S4EA 4DUZI 4B3TE 4DV0I 1A6FA 4X65I 4DV2E 4WUBA 2UUAI 4DUYI 1KIJA 2UU9E 4RPFA 2CZ9A 4IZJD 3M6AA 4WUCA 4GKJI 1DARA 5FWKA 3Q6MA 1FJGI 4DR6I 3ZZUA 4DV7E 1IBLI 3J80Q 5IT9C 1RR9A 3K17A 2NPFA 1Z0WA 1N34E 4K0KE 2HHHE 4B3TI 1OJ4A 4DV2I 2UU9I 2PNLA 1KVKA 4LFBI 4LF6E 1H7UA 5IT9Q 3QT5A 2AJ4A 3J81C 2V2QA 1B63A 4DPUA 4JI8E 4DR5I 1Z0TA 4LFAI 4KQVA 3P06A 1N34I 4JV5E 5LMNE 3PYDA 3B8HA 4UT4A 4K0KI 1N36E 4ZVIA 4DR7E 3V2UC 3J81Q 2CGEA 1RREA 4DV5I 1IBME 4LF6I 4DPXA 4URLA 3Q1QA 4JI4E 1H74A 1HNXE 2O1WA 4FWGA 3ZZTA 1HK7A 1ZM9A 4JI8I 4DV1I 2UUCE 4X66E 3QT7A 1B62A 4DUZE 4X65E 1Y4UA 4JV5I 5LMNI 3LNUA 3JAMC 1NHHA 1U2RA 1XNRI 4DR7I 2UUBI 4YHHE 2UXBE 1Z0BA 3V5RA 1N0VC 1KTVA 4IZKA 1FKAE 4JYAI 1IBMI 1IBLE 2Z5CA 2Q2EB 3PYGA 4KHPI 2V8PA 2LJPA 5LMUI 4WUDA 3QT6A 4DU7A 1XMOE 4DR2I 1K47A 1IBKI 1ZM4A 1Z0GA 3JAMQ 2UUCI 1FI4A 1S16A 4X66I 4HACB 4LFCI 4LF5I 3T1HI 4OX9E 4LFBE 1Z0VA 4YHHI 2UXBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BV3 A;  4JI2 I;  4YY3 E;  4B3S I;  4DPT A;  4DR5 E;  1XMO I;  4AQY I;  3PYE A;  4LFA E;  4I3H A;  3GON A;  4DR4 I;  4MYT A;  4JG4 A;  1N0U A;  3OTO E;  2HFU A;  3T1Y I;  2R3V A;  4LF4 I;  4OX9 I;  4Z7C A;  3WU6 A;  3WU4 A;  2UXD I;  2E5L I;  4JI6 E;  4DV5 E;  1N33 E;  1D6T A;  1MX0 A;  3CWV A;  4DV3 I;  4GKK I;  4HYM A;  2WW4 A;  4FN5 A;  4YY3 I;  2UXC E;  4DV1 E;  4DR1 I;  3WU3 A;  2HK2 A;  4X62 I;  4USM A;  4DPY A;  1XNR E;  1HR0 I;  3OTO I;  2UUB E;  2EFG A;  2DEI A;  3HUL A;  3F0N A;  4JI6 I;  4JYA E;  1H72 C;  1N33 I;  1PVG A;  3ZM7 A;  4KHP E;  5LMU E;  4JI3 I;  3ZKD A;  4DR2 E;  1EA6 A;  1IBK E;  2UXC I;  2V2Z A;  2V2V A;  2HFS A;  4DU8 A;  1EI1 A;  3WU5 A;  1I94 I;  1QZR A;  1N32 I;  4LF5 E;  4LFC E;  3B82 A;  1J5E E;  3T1H E;  4FW9 A;  4X64 I;  4B3M I;  1XNQ I;  1MU5 A;  3J7A G;  1PKP A;  4R1F A;  1H7S A;  4JI2 E;  1KKH A;  2VQE I;  4B3S E;  4NXN I;  2VQF I;  1Z5B A;  4AQY E;  4Z7Y A;  5LL6 R;  4DR4 E;  5GME A;  1Z5C A;  2R42 A;  1J5E I;  3T1Y E;  4NXM I;  1MG7 A;  4FWH A;  2ZM6 E;  4LF4 E;  2UXD E;  2F4V E;  4LF8 E;  2E5L E;  4DV3 E;  4PRX A;  4GKK E;  2HKE A;  4JI0 I;  1HNW E;  4P52 A;  1ZM2 A;  4JI7 E;  1ZXN A;  4LF9 I;  3D4J A;  4P7A A;  4DR1 E;  2OI2 A;  4DV6 E;  5A2Q C;  4ED4 A;  1WUU A;  2ZBK B;  4X62 E;  1HNZ E;  4JI5 E;  1HR0 E;  2A2C A;  1FWL A;  2XEX A;  1NZ0 A;  2ZM6 I;  2F4V I;  4LF7 I;  4LF8 I;  2BM1 A;  3K1J A;  2VF3 A;  5BR8 I;  4JI3 E;  5A2Q Q;  1HNW I;  3J7A M;  3QT8 A;  1NHI A;  4JI7 I;  1I94 E;  5IWA E;  4EMD A;  1N32 E;  4DV6 I;  1VIS A;  1BKN A;  4HXZ A;  1XHK A;  4X64 E;  1ZM3 A;  1HNZ I;  4B3M E;  1Z5A A;  4XTJ A;  4JI5 I;  4FWD A;  1XNQ E;  4DV7 I;  2HKJ A;  2J7K A;  2HK3 A;  3LTO A;  4UTG A;  1XMQ E;  4DR3 E;  1Z0C A;  2VQE E;  3ZKB A;  4NXN E;  2DEJ A;  2VQF E;  1ZXM A;  4M1K A;  4DXL A;  2HHH I;  4B3R E;  1H73 A;  2GS8 A;  4HY1 A;  1PIE A;  3B78 A;  5GMD A;  5IWA I;  4MYU A;  2ZIT A;  4NXM E;  5FLX C;  1NHJ A;  4DV4 E;  1ELO A;  4JI1 E;  4HAC A;  2A2D A;  2X7I A;  1UEK A;  3ZZ0 A;  3LPS A;  4PU9 A;  1FWK A;  1XMQ I;  4JI0 E;  5L3J A;  4DR3 I;  4PRV A;  4DV0 E;  4LF9 E;  2UUA E;  4USK A;  4DUY E;  3PYF A;  1N36 I;  5FLX Q;  4B3R I;  4GKJ E;  2BM0 A;  1FJG E;  4DR6 E;  1Z59 A;  4DV4 I;  1FNM A;  4JI4 I;  4LF7 E;  4DPW A;  4JI1 I;  1HNX I;  2X36 A;  1Z0E A;  5BR8 E;  3J80 C;  2V34 A;  3H4L A;  2E1R A;  1S4E A;  4DUZ I;  4B3T E;  4DV0 I;  1A6F A;  4X65 I;  4DV2 E;  4WUB A;  2UUA I;  4DUY I;  1KIJ A;  2UU9 E;  4RPF A;  2CZ9 A;  3M6A A;  4WUC A;  4GKJ I;  1DAR A;  1FJG I;  4DR6 I;  3ZZU A;  4DV7 E;  1IBL I;  3J80 Q;  5IT9 C;  1RR9 A;  3K17 A;  2NPF A;  1Z0W A;  1N34 E;  4K0K E;  2HHH E;  4B3T I;  1OJ4 A;  4DV2 I;  2UU9 I;  1KVK A;  4LFB I;  4LF6 E;  1H7U A;  5IT9 Q;  3QT5 A;  2AJ4 A;  3J81 C;  2V2Q A;  1B63 A;  4DPU A;  4JI8 E;  4DR5 I;  1Z0T A;  4LFA I;  4KQV A;  1N34 I;  4JV5 E;  5LMN E;  3PYD A;  3B8H A;  4UT4 A;  4K0K I;  1N36 E;  4ZVI A;  4DR7 E;  3V2U C;  3J81 Q;  1RRE A;  4DV5 I;  1IBM E;  4LF6 I;  4DPX A;  4URL A;  3Q1Q A;  4JI4 E;  1H74 A;  1HNX E;  4FWG A;  3ZZT A;  1ZM9 A;  4JI8 I;  4DV1 I;  2UUC E;  4X66 E;  3QT7 A;  1B62 A;  4DUZ E;  4X65 E;  4JV5 I;  5LMN I;  3LNU A;  3JAM C;  1NHH A;  1U2R A;  1XNR I;  4DR7 I;  2UUB I;  4YHH E;  2UXB E;  1Z0B A;  3V5R A;  1N0V C;  1KTV A;  1FKA E;  4JYA I;  1IBM I;  1IBL E;  2Q2E B;  3PYG A;  4KHP I;  2V8P A;  2LJP A;  5LMU I;  4WUD A;  3QT6 A;  4DU7 A;  1XMO E;  4DR2 I;  1K47 A;  1IBK I;  1ZM4 A;  1Z0G A;  3JAM Q;  2UUC I;  1FI4 A;  1S16 A;  4X66 I;  4HAC B;  4LFC I;  4LF5 I;  3T1H I;  4OX9 E;  4LFB E;  1Z0V A;  4YHH I;  2UXB I; 
#chains in the Genus database with same CATH topology
 2OPS B;  1TKX A;  3W65 A;  4AQY I;  1IJE B;  4NLO A;  5A2Q U;  2EVZ A;  3BH7 B;  3C14 A;  3WU6 A;  3WU4 A;  1VK8 A;  4WKR A;  2E5L I;  3WIU A;  1VS3 A;  4HYM A;  2XO7 A;  1HW8 A;  4F3M A;  4AQY F;  1KRP A;  3KOA A;  1TKZ A;  1YIJ S;  2V4J B;  2WK4 A;  2CJB A;  3TJA A;  3L3C A;  4USM A;  2XY5 A;  3W5X A;  4O0I A;  3DGP A;  1R8P A;  2E5L F;  5DDP C;  1HBU B;  4HT5 A;  4P6Q A;  3OL7 A;  2AKW B;  4CH7 A;  1H72 C;  3M4X A;  3I31 A;  3LP1 B;  3KLF A;  3W9H A;  1EA6 A;  1UWB A;  4RWW A;  1IBK E;  2WBR A;  1B0P A;  3PAC A;  2PO0 A;  3UW1 A;  1FD2 A;  3NNH A;  1WSV A;  2QE5 A;  4LCF A;  3K5N A;  2E9R X;  2FHM A;  3PIP Q;  2B5J B;  1HWK A;  2Z5E A;  4JI4 J;  2OD4 A;  2WTF A;  2RNE A;  3NEK A;  1Z5C A;  3OR1 A;  2DR9 A;  2W4P A;  4YHH J;  3SYZ A;  3ICL A;  2UXB J;  3JYT B;  1RU1 A;  4FW4 A;  1X60 A;  2UVW A;  2HKE A;  1FFW B;  1LW0 B;  1IKV A;  1KLM A;  1T95 A;  5J1N A;  3KG4 A;  1XXE A;  1AYE A;  1HBN B;  2ZBK B;  3T1Y J;  4TU8 A;  3NL0 A;  4OO1 E;  1D9D A;  3RR7 A;  2BE7 D;  3SIP B;  3T5H A;  4TYA A;  9ATC B;  3BGU A;  4YY3 J;  2CUY A;  1YLX A;  4AIM A;  4WFZ A;  5E3R A;  3C8Y A;  4MK9 A;  1UVN A;  1P1L A;  3ZZP A;  4QPT A;  3SBM A;  5LSL A;  3C15 A;  1HNV A;  4F04 B;  2IJR A;  2FVR A;  4JI3 J;  1IKX A;  2VQF E;  4DXL A;  5C24 B;  3MMB A;  5HN0 A;  4WE1 B;  1KVJ A;  2R2R A;  1R6L A;  2DNH A;  1RT7 B;  4CTA B;  4IH7 A;  2YWE A;  2L3M A;  2HW3 A;  1CS4 B;  1Q79 A;  1BQN A;  1QJH A;  2LP4 A;  1QVG R;  2VPW B;  2Y0S D;  3W5Z A;  4OZN A;  1S1T A;  1XN9 A;  5DJB A;  2N4C A;  4WYW A;  3MHY A;  1RWN B;  1RZM A;  4YQW A;  1XQI A;  2R7W A;  1WHY A;  2AQ4 A;  4JV0 A;  4DR6 E;  2LXF A;  2I8E A;  4LRA A;  2KT3 A;  2CQB A;  4KO0 A;  3DRP A;  1XIQ A;  1WG5 A;  5KFI A;  1ACM B;  1DQ9 A;  4JP8 A;  2DR6 A;  4Y2I A;  2V34 A;  3CCQ S;  3OLA A;  4U6P A;  1S4E A;  3R5J B;  2YNF B;  5T41 A;  4X65 I;  4YS2 A;  2U1A A;  4ZCK A;  3O6Q A;  2ZH6 A;  4LF8 J;  5F3T A;  1HAR A;  2L9D A;  2YNI B;  4JBC A;  5C0X D;  5JEA B;  4HHH A;  4K4Y A;  4WYL A;  3AJ1 A;  4PYD A;  1T8E A;  2RIJ A;  1ZPW X;  4CDI A;  2JT2 A;  3J81 C;  5CYJ A;  2AT1 B;  2IA6 A;  2HHX A;  2J0Q D;  2AHO B;  3TUZ C;  4X4N A;  1L3V A;  1JXV A;  3DRR A;  1X7V A;  5DG8 A;  4RUC A;  4NZ7 A;  3GV7 B;  4ER8 A;  2MZ1 A;  4CLL A;  4EBC A;  4RJV A;  4H4K A;  5ITH A;  3J81 Q;  1SUQ A;  2QFI A;  1U1M A;  1UDO A;  1V5V A;  3SSQ A;  3H2L A;  4LMZ A;  4JI4 E;  4CM2 A;  3GJS B;  1FRM A;  1CG2 A;  3TA0 A;  4DV1 I;  2XS2 A;  3QT7 A;  3HSJ A;  2DNK A;  2HHU A;  4B3R J;  5LMN I;  2UV8 G;  4U8Y A;  1WJ9 A;  3QIP A;  2UUB I;  2UP1 A;  2EBG A;  4YHH E;  3I56 S;  3CUL A;  2UXB E;  1RI7 A;  3H90 A;  3ENQ A;  4OHY A;  2L9W A;  5GAG I;  1OMS A;  4DV1 F;  2WAQ D;  4Y0F A;  5LMN F;  2GIF A;  2UUB F;  3B4D A;  3PFO A;  4GKJ J;  5HAO A;  1QUV A;  4KAI A;  1F3F A;  4H4M B;  4MQY A;  1TK5 A;  4IR1 A;  4EZ9 A;  2W7O A;  1FCA A;  4YY3 E;  1FK9 A;  5ETV A;  3M6U A;  4PR6 A;  3IRW P;  4F26 A;  4YME A;  1KSP A;  3S7R A;  3HPO A;  1HBU A;  4JG4 A;  2FY1 A;  2PGC A;  1RT6 A;  4FXD A;  3LP1 A;  3MM6 A;  4NLP A;  3GG0 A;  3RTV A;  3UD4 P;  3DXS X;  2K8G A;  1TL3 A;  3ZZZ A;  4DV5 E;  3DLE B;  2GIQ A;  3FZB A;  2XBP A;  4XIU A;  4WF9 Q;  4QCL A;  4FN5 A;  5KFU A;  4YP3 A;  1UEV A;  2B5J A;  4CLU A;  2R7O A;  4QYZ K;  3HHD A;  4DPO A;  4KRW A;  2B4U A;  3QSI A;  3KUH A;  4G65 A;  1T9U A;  1QSL A;  3OTO I;  2VG5 A;  1Y5Y A;  1UJ6 A;  3I9V 9;  3RBZ A;  3VVT A;  1D1U A;  1JLC B;  2DNZ A;  3UCU P;  3CCE S;  2DGO A;  3UR0 A;  3TYT A;  5CHC B;  1H2U X;  4CLS A;  2NN6 C;  2V2V A;  2HFS A;  2IMW P;  3OTO F;  4FP9 A;  1OWX A;  1L3S A;  2F8M A;  1N54 B;  3MF5 A;  1TK8 A;  1XJW B;  5C5J A;  4O44 B;  5JXS A;  2DNG A;  1AA1 B;  1HBN A;  1X5P A;  4HL9 A;  1HNX J;  5F3Z A;  4EBE A;  2HWH A;  4QPX A;  2XSJ B;  2F8H A;  5ETS A;  5F8J A;  4DUZ J;  2AEJ A;  3R1L A;  5FII A;  2HND B;  4EUV A;  1J5E I;  4B9T A;  3MPW A;  1D9F A;  4FXV A;  4P2S A;  2MLY A;  4LF8 E;  3FCW A;  5F0W A;  1FTR A;  1VRQ C;  2FVS A;  1N48 A;  1XMO J;  1ZM2 A;  3CJ8 A;  1WC6 A;  2EFP A;  2B7B B;  2BX6 A;  4CLF A;  3JSB A;  2JEA A;  4EK2 A;  3SQG A;  1Q81 T;  1J5E F;  3OTE A;  2IVF B;  3ILO A;  4P74 A;  1Y5N B;  2R9L A;  2MHN A;  1V3Z A;  3ISN C;  2RQC A;  2D3O R;  1NZ0 A;  2VL1 A;  3M9N B;  2KJV A;  2BRK A;  4WE1 A;  2BM1 A;  4RR5 A;  1XMB A;  2FVC A;  4W92 B;  2PFF B;  4OYW A;  3EGV A;  5C2G A;  3QT8 A;  1GEH A;  4CTA A;  4FBU A;  4IFY A;  2VZ9 A;  2POK A;  1PGZ A;  1P1T A;  4XK8 C;  4IZJ B;  2MLZ A;  1ZM3 A;  4LF4 F;  3JSM A;  2C3O A;  4X4Q A;  2FJA B;  3TUI C;  1T03 A;  4ZVR B;  4O23 A;  2ZD1 B;  2H65 B;  3U1L A;  5AE1 A;  3EPG A;  3WX8 A;  2JDJ A;  1H7X A;  3J7A N;  3MPU B;  2DEJ A;  1GFW B;  4RUB A;  4B3R E;  3G87 A;  1B99 A;  1S48 A;  1PIE A;  3B78 A;  2WNR B;  2KTQ A;  1CUL B;  1LWF A;  3WHI A;  4K8R A;  2OUG A;  4QYR A;  3TA2 A;  1M5P C;  2DR8 A;  2OTL S;  4GO7 X;  4CWB A;  1V5I B;  1N52 B;  1XMQ I;  5B0B A;  3D0G E;  2YKM A;  2CVI A;  1RLD A;  4LT6 A;  2HNZ B;  2VPY B;  4OYO A;  1IKW A;  4P2M A;  2VDI A;  4I6A A;  1TV6 B;  4GKJ E;  4RW9 A;  1XTZ A;  4F2S A;  2DXF A;  4WP9 A;  4QIF A;  3G2X A;  4RBV A;  1XMQ F;  2HBY B;  3A12 A;  3FSX A;  5JVH Q;  4OV6 A;  2UV8 A;  4MK8 A;  4QWD A;  2CFX A;  2GHV C;  1KOO A;  3MEE A;  2EKN A;  3BQ2 A;  4M95 A;  3M2R B;  3FMW A;  1MML A;  5U47 A;  3UCZ P;  2P9C A;  4ZIW A;  2H4Y B;  1U6B A;  3AXM A;  2ZNY A;  5HLF B;  2Q66 A;  4PAB A;  2G1D A;  4HH0 A;  1EX8 A;  4C7Q A;  1NRK A;  1RAG B;  2C39 A;  1OJ4 A;  4DV2 I;  1W7W A;  5KFE A;  5KFR A;  5DDO C;  1HNZ J;  3R3T A;  1MLA A;  3T9N A;  4HDH A;  2ZJP Q;  4DV7 J;  3T5J A;  5KFN A;  1K9M T;  4CO2 A;  5L39 A;  5HQM A;  1Y0H A;  2BE2 B;  3L7Z B;  5H9F K;  4DV2 F;  4JV1 A;  3B8H A;  3G6V A;  4L3N A;  1XBW A;  2EW9 A;  5HJY A;  1XC9 A;  1WDT A;  2VFT A;  1YRU A;  4H4O A;  2I5J B;  4DCP B;  1HNX E;  4DR3 J;  1SKS A;  4FXW A;  4WP3 A;  2O1W A;  3CDI A;  1U0S A;  3PO5 A;  1DAX A;  5IV3 A;  3ILI A;  1AUS L;  4DUZ E;  3B4M A;  4KGM A;  1A0O B;  2E9Z A;  3LNU A;  1U2R A;  5IOL A;  2BOA A;  1RYR A;  4DR7 I;  3R5G A;  4N8N A;  3V5R A;  3A3N B;  4JYA I;  1IBL E;  2CJY B;  4LVO P;  1S76 D;  3IWN C;  4USW A;  1IN0 A;  1D9A A;  3MM9 B;  5D0R A;  1XMO E;  2J65 A;  2JFK A;  2HRY A;  3EUN A;  2EC2 A;  1RXO B;  2KXF A;  1Z1Z A;  3D67 A;  4I64 A;  4DR7 F;  1RHR B;  2GW8 A;  4V19 X;  4MIB A;  4CH0 S;  3TAQ A;  2PI5 A;  4ZVH A;  4PCQ A;  2CPZ A;  3PG9 A;  4QWC A;  4RNF A;  2ASD A;  1TZ0 A;  4WBF A;  4NYP A;  1P8G A;  4HHJ A;  3MED A;  5BR8 J;  3KJV A;  3L7O A;  4LFA E;  4NYO A;  2CG9 A;  2OLW A;  3HVR A;  2EC0 A;  2XTJ P;  4LJM A;  4UQT A;  1NPR A;  4ID5 B;  3AJ2 A;  2CKW A;  1Q7L B;  3JB9 k;  4N56 A;  4IFD D;  1D6T A;  2R8I A;  2MZJ A;  1HFE L;  3DRS B;  3N01 A;  4ZP8 A;  2W1B A;  3CC2 S;  5CYQ B;  2X1F A;  1VQ8 S;  5I42 A;  3IAM 9;  4K4X A;  2NUH A;  3EDQ B;  1SCJ B;  3KHR A;  4M5I A;  5EWG A;  5KFT A;  2ROP A;  1O6X A;  5EN1 A;  2P2C B;  4DR5 F;  1P27 B;  3CJ5 A;  2HBZ B;  2UXC I;  3HSG A;  2B4V A;  2GO4 A;  3QRP A;  3B82 A;  4F7V A;  4LQ3 A;  1JWW A;  1Y00 A;  4ZLL A;  3T5L A;  2DIT A;  3MPD A;  5CYM A;  3RRG A;  3PVX A;  3OFF A;  4OZ1 A;  5LMU J;  1D3W A;  1RAA B;  2BE9 B;  2UXC F;  2XLI A;  1WDD A;  2LLZ A;  1LXJ A;  4NA1 A;  4UST A;  2B9W A;  3R5B A;  1U2C A;  1B0V A;  4P7T A;  4CZC A;  1LW2 B;  3BN4 A;  2MQP A;  2R42 A;  5GAD I;  5J2M A;  3KK1 A;  4FWH A;  2CAD A;  3MPV A;  3NS7 B;  3Q2S C;  5KFP A;  4B9N A;  2R8H A;  5CD4 H;  3VAI A;  1VBY A;  5A8W A;  4JI2 J;  5EKW A;  2HHS A;  5LMU F;  3KG1 A;  3KJF B;  4NLX A;  2R7X A;  4IZJ A;  5CCM A;  3MR2 A;  2FY8 A;  5K8M A;  2WP8 A;  4RNO A;  4P9S A;  3GIM A;  5AE3 A;  1HNZ E;  4LFB J;  4AL6 A;  4ZVG A;  2AGP A;  5E0O A;  3GMG A;  3T9Z A;  2CVE A;  1FNX H;  3HD2 A;  3CJ4 A;  1DLO B;  4JI2 F;  4L72 B;  4ZVF A;  3IWX A;  1TL7 B;  2C2Z B;  3MOZ A;  1APS A;  4URQ U;  3MUR P;  4OX6 A;  2H51 B;  2HNY B;  1XHK A;  4FF3 A;  3E8O A;  5DG7 A;  1KOH A;  4HI2 A;  4JI6 J;  2YH0 A;  4DV3 F;  5M2U A;  4ILL A;  3F44 A;  4OYP A;  4F25 A;  4DR3 E;  2XGP A;  2YY3 A;  3CJR A;  4HYK A;  1NKC A;  3RAM A;  3DU5 A;  1HWL A;  5DRK A;  4XDC A;  2IM0 A;  1NUE A;  3MMJ A;  1UVL A;  3MM5 B;  3OSN A;  2B7C B;  2QL9 B;  4Q45 A;  4IO9 Q;  5AXN A;  1UA0 A;  2F65 A;  1Y4S A;  1K73 T;  1VQ6 S;  3E01 A;  3R7N B;  1CJU B;  1NK9 A;  3J7A 1;  1YZ7 A;  1KEK A;  1S1U B;  4CO0 A;  3W2V B;  4NI2 A;  2GGP A;  2OAU A;  1CJV B;  2OEL A;  1IKY B;  2YKA A;  4X64 F;  2R8K A;  3DOL A;  2BM0 A;  5E3P A;  5HSP A;  1KS2 A;  4DV4 I;  2LEP A;  1IM6 A;  2PEH A;  8RUC A;  2PD1 A;  4C48 A;  3AXK A;  5BR8 E;  1GXL A;  2IIH A;  2GHW A;  2VQE F;  5JEA D;  3VGU A;  4NXN F;  3OV7 A;  3IA0 A;  2LMI A;  4IRK A;  3X3U A;  5C7P A;  2HQF A;  5L38 A;  4DV4 F;  1OY8 A;  3I4H X;  3L7Z A;  3BBF A;  4DSJ A;  4RNM A;  1RR9 A;  5GAE U;  2JZ5 A;  4OHX A;  4LF9 F;  1S57 A;  2IJF A;  4LBH A;  2HIQ A;  3ZO7 A;  3NY0 A;  4KB7 A;  3IM9 A;  2QA1 A;  2QLF B;  1HQ2 A;  4OYA A;  1TTH B;  2MLX A;  2BKP A;  2FD2 A;  3WQP A;  2X3D A;  2GJF A;  2P6T A;  4YDX A;  4NZ6 A;  3Q86 A;  3MM9 A;  2XUL A;  4G3I A;  2QRR A;  1A6L A;  2AGQ A;  2C2R A;  2GO3 A;  1QM9 A;  4QZV B;  3FFI B;  1L3K A;  3L7U A;  3JSY A;  1NHH A;  1RAD B;  2VBX A;  5KFZ A;  1KWM A;  3MWB A;  1NO8 A;  4K4Z A;  4DG1 A;  4C11 A;  1ZA1 B;  3OJS A;  1WAC A;  4DU7 A;  3RZA A;  3ONQ A;  2OMO A;  1X4F A;  2Y1I A;  3V6D A;  5AXK A;  1WOS A;  3R5C A;  1VQ9 S;  3U7J A;  4Q0B B;  4LFC I;  4X4R A;  3G6Y A;  3PM9 A;  1XR6 A;  3DKD A;  4LFB E;  4I2P A;  4R8U B;  3OVS A;  4OI1 A;  5HMX A;  5L46 A;  4LOM A;  4CQ1 A;  3NGD A;  4J7C A;  1JKH B;  1X9S A;  4N5S A;  4KGV B;  1WEL A;  1NND A;  3R6L B;  4OI4 A;  4A48 A;  3H59 A;  4ZJQ A;  3LQV A;  1D8Z A;  4ZN1 A;  4IG3 B;  5GVQ A;  4NLQ A;  2Z5B A;  2HQ3 A;  4JI6 E;  1NJI T;  2W2P P;  4P71 A;  4KSE B;  3CWV A;  2WW4 A;  3R9L A;  1TFW A;  3OUY B;  5IQ6 A;  1G2E A;  4WZM A;  3D9B A;  1N34 J;  4NML A;  2JL9 A;  3OXL A;  2O3D A;  3IR6 B;  2OPQ B;