3LTOA

Crystal structure of a mevalonate diphosphate decarboxylase from legionella pneumophila
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
b'MHWFAQAPANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIPGAPEFNLSVEAQKRFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTKCASIALSELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALWTGDKVSAIDLPYKDLLHQVIVISSQEKEIPSRVAHKLVKTSPFYETRSERAEANLKLLLNAFENKDWTSIYQICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVVTMDAGPNVHLLYRSDQTDLARQFKSDHLVGNYDVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate diphosphate decarboxylase
molecule tags Lyase
source organism Legionella pneumophila
publication title Crystal structure of a mevalonate diphosphate decarboxylase from Legionella pneumophila
rcsb
total genus 105
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 4.1.1.33: Diphosphomevalonate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18376 MDD_C Mevalonate 5-diphosphate decarboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3ltoA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3ltoA01
3V5RA 1Z0CA 2HK3A 4JI3I 4GKJI 4DUZE 2OI2A 1ZXMA 2V34A 1RR9A 1U2RA 1IBKE 4DPWA 1XNQI 2DEIA 1S16A 2VQEI 4DV2I 4JI1I 3J81Q 4DR6E 3OTOI 4FWGA 4B3TI 2HHHI 1Z0VA 4LF5I 4DV0I 4DR1I 2F4VE 4JI1E 3OTOE 4FWHA 4JI6I 2ZM6I 3JAMQ 1ZM4A 4B3TE 2UU9I 3PYFA 4WUCA 3F0NA 3LPSA 2UXCI 1B62A 4WUBA 3HULA 2BM0A 3M6AA 3ZZ0A 1XNQE 1BKNA 1XNRI 2ZITA 4DV7I 4LFCE 4UTGA 4K0KI 2NPFA 4DV1I 4ZVIA 2UXBE 4DR5E 3ZKDA 5L3JA 1OJ4A 4DXLA 2UU9E 3T1HE 1HNZE 4DPXA 4DV1E 4DR3E 2EFGA 4JI2E 3T1YI 1NZ0A 1RREA 1XHKA 3PYGA 4DPYA 2HK2A 1ZM9A 5FLXQ 4X64E 3ZKBA 1N33E 4DV3E 4B3RI 3H4LA 2X36A 4FW9A 4JI4E 4JI0I 4YHHI 4HY1A 4JI8I 2A2CA 2J7KA 4URLA 1N36I 1H7UA 1I94E 2GS8A 4JI8E 3WU4A 1K47A 5A2QQ 1N34I 1B63A 1WUUA 5LMNI 4LF9I 1FJGE 1DARA 1EI1A 2UUAI 2VQFE 2UUBI 4DU8A 4USMA 4NXME 4MYUA 4AQYE 1PVGA 1H73A 1KKHA 1KTVA 4R1FA 4DR5I 4HXZA 3WU3A 4DR7E 1IBME 4LF6I 1A6FA 1FWLA 3B82A 4DV4I 4LF4E 1N0UA 2E1RA 3T1YE 4PU9A 4AQYI 4LF6E 3PYDA 2HFUA 1ZM3A 1MG7A 4LF7E 3WU6A 1Z0TA 3ZZTA 5IWAI 5BR8I 1D6TA 4USKA 1J5EI 4DR3I 4LFAE 5GMEA 4DR2E 3ZM7A 1HR0I 1FI4A 4Z7CA 4X66E 1Z59A 1FWKA 2V2QA 4JI7E 4LF7I 3JAMC 1Z5CA 2E5LE 4PRXA 4JI6E 2DEJA 3QT5A 3LNUA 4LF5E 1HNXE 1HR0E 1Z0BA 1Z0EA 1N36E 4LF9E 3ZZUA 4Z7YA 5LMUE 2LJPA 1KVKA 4DR4I 4DV5E 4KHPI 1XNRE 2UXBI 1Z0WA 2HFSA 4DUYE 5IT9C 4M1KA 4ED4A 4DR4E 1PIEA 2HKJA 1N32I 2R3VA 3T1HI 3WU5A 4P7AA 2UUAE 4DPTA 4B3MI 4DR7I 4MYTA 4RPFA 2R42A 5IT9Q 4GKKI 2A2DA 4X65E 4JYAE 1NHHA 4KQVA 1HNWE 4LFAI 4DR2I 1HNZI 4I3HA 4PRVA 4JI4I 1H7SA 3J7AM 1N33I 4JV5E 4JI7I 2UUCI 5LL6R 4GKKE 1NHJA 3GONA 3J80Q 1I94I 1IBKI 2BV3A 5A2QC 5FLXC 1UEKA 1XMOE 4JG4A 5LMNE 1VISA 1XMQE 4DV6E 4YY3I 2UUCE 1MU5A 4DV0E 4DR1E 1XMQI 3Q1QA 2WW4A 3QT6A 2ZM6E 3QT8A 1N32E 1ZXNA 4P52A 4FN5A 4LF8I 4HACA 1EA6A 3D4JA 4EMDA 4DV5I 2UXDI 4DPUA 4KHPE 4B3SE 3V2UC 1S4EA 1N0VC 5GMDA 4YY3E 2VQFI 4DV4E 4LF4I 3QT7A 1NHIA 4NXNI 4LFBE 4JI5E 1IBMI 4XTJA 4K0KE 3J7AG 2V2VA 2BM1A 4LF8E 2CZ9A 4DV3I 4X65I 4JYAI 2UXDE 4OX9E 4B3SI 4JI2I 2XEXA 1PKPA 3K17A 3J81C 2V8PA 1QZRA 2AJ4A 4OX9I 4NXNE 4X64I 1KIJA 4WUDA 3J80C 4DUZI 4X66I 1XMOI 4B3RE 1J5EE 2E5LI 3LTOA 4DV6I 1FNMA 2VQEE 3B8HA 1Z0GA 1FJGI 4FWDA 1HNXI 4DU7A 4HACB 3K1JA 3PYEA 4LFCI 4UT4A 1N34E 3B78A 1IBLI 4DV2E 2UXCE 1ZM2A 4HYMA 2HKEA 2ZBKB 2F4VI 1MX0A 4DV7E 4DUYI 1FKAE 1Z5BA 2UUBE 2V2ZA 2X7IA 4NXMI 5LMUI 1IBLE 1ELOA 4B3ME 4LFBI 4JI5I 2Q2EB 1H74A 5BR8E 4X62E 4JI3E 4GKJE 1HNWI 4YHHE 4JI0E 2VF3A 4X62I 1H72C 5IWAE 4JV5I 3CWVA 4DR6I 1Z5AA 2HHHE
chains in the Genus database with same CATH superfamily
3TQ1A 4I6YA 4PQAA 1UL3A 2LP4A 1KQKA 1Z0CA 2R8HA 4LCFA 3MMCB 2PA3A 1BXNA 4JI6F 4QWDA 4DUZE 2LVWA 3CJ3A 4U7UK 4PG5A 5CYJA 2FUG9 3BSOA 3R1LA 4X4UA 1ZXMA 4IH6A 1F5CA 5C0XB 3MOJB 2BOPA 2IOPA 4BLGA 5E0OA 2R7SA 2B6AA 4HI2A 1F2GA 2YKMA 1N56A 5C0XA 3TAMA 1IWGA 4RW9A 2XNRA 4JI7F 1ZAWA 1AUSL 2MQLA 4M5KA 4MK9A 3KLEB 4EYHB 3H1CA 3J81Q 2CVEA 2OP5A 3AOCA 4OO1E 2DJWA 5CYQA 2FGCA 3M8RA 3CO0P 2QG9B 1IKXA 3ZTSA 1A6LA 4B3TI 1VR6A 1J5EF 2ALZA 1OYDA 3U7JA 1NLKL 3HP6A 4DV5J 4QWAA 3L7OA 3M8YA 2FTRA 2AYMA 1NUEA 1S6QB 3BYRA 4C3KA 1HR0F 2ZM6I 2ALYB 3KRNA 4X84A 2ZH4A 4B3TE 2UU9I 5IZHA 2FLPA 1QTMA 2HW3A 1S0NA 1RHUB 4KQZA 4K2XA 1BQNB 3UDVA 4WUBA 3G8TA 5GADU 2QTWA 1RK8A 1EX8A 3NOCA 3PIOQ 4LSLA 3M6AA 5ETLA 4JI1J 3ISND 3T1YF 4YOEA 1QE1B 2ZH2A 2RD5C 3MEGB 2ERRA 1UVLA 5L46A 3T5JA 2BQRA 1NK9A 3M32A 2MKCA 1FD2A 1BKNA 2XZWA 1CJVA 3CJ5A 3CUNA 2W25A 1M1HA 4DWIA 2ZITA 1YX2A 3MAAA 4OL8A 3GLLA 5D0RA 2VBWA 3UR0A 4DV3J 1WHXA 1FXLA 4K0KI 3NL0A 1RZMA 2DY1A 3W2VB 4IH5A 5EWFA 4DQRA 2J7WA 1H2TZ 2NSCA 1N52B 1LFWA 2CNOB 3EDQB 3GJRB 4FXVA 4ZMMA 1OJ4A 4NPOA 5FLXY 4B9TA 4I2QB 4DR6J 1LWCB 1KR4A 5H9FJ 2PO2B 3F41A 3GMEA 1HNZE 4V19X 1RT2B 3IR6B 3EXCX 3KDOA 2MQOA 1FESA 2XI3A 3TVZA 5KG7A 4LOMA 4JI2E 2R2TA 1DTQA 2DH9A 1U26A 1PYTA 5L8RC 1WHWA 2F7VA 3IRXA 3JYTA 1IM6A 5ETRA 4RW7A 1YBUA 3VAMA 3T1YI 1RREA 1XHKA 1YJVA 2R4FA 2L08A 3K5LA 4ZKAA 5C0XF 1S49A 4I6AA 3CCWA 3N6MA 3UDCA 1LEOA 5KFOA 5L1KA 3A3OB 3GSIA 2DGQA 2Z5EA 1URRA 1PILA 2OPPB 3FDSA 4CP5A 2R2UA 2ZH6A 2HVEA 3MECA 2DR7A 3ZKBA 3C14B 1TKTB 4CO3A 4UOGA 5AE1A 4AQYF 2YWGA 4Q5VA 5B0GA 3CCMS 2MJUA 1Z2ZA 5DQGA 4B3RI 1NO8A 4OLPA 3JB9k 4CIOA 2XG8A 4LF6J 3H4LA 3LP1A 5LM7E 2OAUA 4USVA 3FVYA 2V6AA 2W9AA 4JI4E 1NEEA 5AT1B 1HQEA 1HW9A 3M2VB 5ETNA 2XQCA 2VFUA 5JEAE 1FXDA 1Q95G 1WEZA 3POTB 2V2KA 4CH1A 1JKHA 2F8EX 2RT3A 3NY0A 1E6YA 4OYXA 1UJ6A 3ET6A 4RWWA 2B4UA 3Q24A 1OMSA 4CO2A 4FXWA 1R6VA 4TYAA 3DLGA 4I7FB 4LF9F 3TJ8A 3V6DB 2RIJA 1QDUB 3J81U 2VASA 5KFCA 2UVWA 4LR7A 2CRLA 1D1UA 3U1YA 2F1DA 2LEAA 1BY9A 1U6ZA 3AA8A 4IQMA 4YP3A 1ZETA 1K0TA 2NQPA 5KFAA 2GS8A 2C2RA 3T6JA 2XI2A 3Q8QB 3MAQA 1VQ8S 1HD1A 3OQ2A 3T3FA 2LDYA 1VQNS 1SQEA 1GFWB 4QJVA 4UZCA 3X3UA 5B08A 2UXDJ 2RS2A 2WBMA 3SI8A 2OO4A 5IT9Y 1ULRA 4S0MA 2GQQA 7AT1B 3NNCA 2SXLA 3FNNA 1RTIA 1N5TA 2N4CA 2XZDB 3RB6A 4ZIWA 4FP9A 4MK8A 2XB2D 1VK3A 3LP2A 2H5EA 3OJSA 2W9CB 1D0EA 4ED5A 2AJQA 2ROEA 3CC2S 3MMBA 3MM6B 4KB7A 2YNFB 2B9YA 3RBZA 3RAQA 2CPHA 2Y9HA 4CWBA 5H9FK 4ZCMA 1H3DA 1X4GA 2B4VA 2KO1A 3BQ0A 2QEXS 3VHQA 4C8OA 1SKSA 1VLOA 1T3OA 4J9SA 2CJXB 2C2KB 2MDAA 2W2NP 3OR1B 4RR5A 1WTBA 2BA0D 2B3TB 4CYUA 2MQ8A 1F3FA 4QR2A 4MYUA 4LBHA 1GNKA 3EZUA 2LCWA 4K4TA 3DN9A 1IUJA 3HHDA 4RBUA 5L1IA 1V3RA 3DLEA 3CD0A 1K9MT 4RNMA 1H73A 3JAMY 4U95A 4ZVUB 2MZRA 4JV2A 2BE9B 3K57A 4K4XA 4P7VA 1WD6A 2W9BB 3ONQA 1TZ0A 2ZUGA 4OO1D 2GQ0A 3LP2B 3FRYA 1S7IA 3BO4A 4R1FA 4WBFA 2OEJA 4LR8A 2D9PA 2BUNA 2F3JA 4NLRA 4CT8A 4JB8B 4PPDA 3BSNA 2QZ8A 4DR5I 2V67A 4D3GA 5CXTA 1IBME 1SC4B 3MUVP 2PMHA 3B82A 1FWLA 4TXSA 2MY8A 5A8WB 1RYRA 4AIDA 3CCUS 3WIUA 3J80U 3TUPA 5AE3A 4Y6IA 3HT0A 2V69A 1SKUB 4B3OA 1P1LA 4URGA 4F2SA 4PU9A 3HHLB 3SCJE 4DCJB 2I38A 2JFKA 3PTWA 1ZM3A 4WKYA 3MMAA 4WE1A 4LF7E 3PX4A 3A3PB 3HSJA 3MWBA 3I0SA 3Q86A 4K7QA 4NYOA 4ZVTB 4DLEA 2IFXA 2NZCA 2XTJP 4E2FB 5KOWA 4B9LA 1FX4A 3N5FA 4UOCA 5BR8I 3UFCX 3GSDA 4PCQA 1YI2S 1AW0A 4WWSA 2HVHA 4R0EA 3EZOA 4I4BA 3EUNA 3H2VE 4C11A 1V3SA 5DLFA 5HQ8A 2M52A 4F8RA 2MHNA 4HT7A 1NDKA 3W1YC 1FJGF 3K59A 4MKYA 3C14A 3P45B 4F3QA 3CJ0A 3KMSA 2NREA 3BV8A 4DS4A 2R8GA 4GKKJ 2H1YA 4ES2A 1T8EA 3A8IA 1YRTA 2B7BB 4ZVFA 4F0MA 4Q43A 4ECRA 2VDIA 1O6XA 4CLUA 1NPKA 1Z59A 4LFCF 3M6UA 3K5OA 4HHJA 4QR1A 5CABA 3BSCA 2OD4A 1CG2A 1S1XA 2DH8A 5DS7A 2FC8A 1XWLA 3H5SA 4JYAE 1Z5CA 5F0WA 4NX9A 3LH2S 2GW8A 1FKPA 2OFHX 2XHCA 1OSDA 4L6V3 3SYZA 5EHHA 1DTQB 2DGXA 3QT5A 4MKAA 3HHNB 4U3DA 2Y8WA 4KHPJ 4JI3F 3LNUA 3KOAA 4MU4A 3E01B 1HNXE 3TYTA 1CJUA 3RZAA 4JI3J 2NN6E 2MKIA 5BYRA 1RAJA 1VHIA 5L38A 5CQGA 1B0PA 1SCJB 2ASLA 1HQUA 2FJWA 2UVVA 4IRCA 3TNVA 1RABB 3N4WA 4HI1A 1N32J 4OYAA 2C2NA 2F8MA 4A48A 1F5BA 4BC7A 5KG2A 1YH8A 1USVA 1TU0B 4LF9E 4EU0A 5F8HA 2AF6A 3RR7A 1EQ0A 5ETOA 3MEGA 1X5SA 4OYMA 1JLCA 3I4HX 3OTBA 4KYZA 4A47A 3OTOJ 1E6VA 3R1HA 2HHHF 1H0HB 1JK9B 3W3SA 1JX4A 4EBEA 2DGWA 4FW5A 1X0PA 1GXLA 1S6UA 2YWHA 3H20A 5D0HA 3PKMA 1OPIA 2KYZA 3CJQA 3TZXA 3KLHB 4ZA1A 3RW7A 4G3IA 3I32A 1TP7A 3QQCD 1L3UA 1R8HA 1KQGB 1SJ1A 2HFZA 2PE8A 4QIWD 2UUAE 4DPTA 1XBWA 5HO4A 4A46A 3K7RA 4ZJQA 3GIMA 1O8BA 4B3MI 4MIAA 2Z2MA 4IG3B 4ZHRB 5C0XE 2OMLA 1YRUA 1LKZA 2U1AA 4RPFA 4ZP9A 1VBKA 4DR7I 3WBZA 1REVA 1OYPA 3DLKA 3MEDB 1MMNA 1S1VA 1JLQA 3W65A 2ZNYA 4LF8J 2B4OA 2HHPA 2DR6A 3KLEA 1SH2A 1QAJA 2OPPA 5HVHA 2FJDB 2GQCA 4L72B 4DFKA 1U1QA 4MQYA 4NOHA 4LFAI 4DV1F 3OV7A 2MY7A 4LIRA 3V4MA 2WP8A 4CNYA 4ED2A 1KRPA 3CDUA 1ZXNA 2NXNA 4JP8A 3IMQJ 2NXCA 3U1LA 5LJ3Y 2ZH5A 4OKGA 2HNZB 3WDOA 4PRVA 1XEZA 1HBMA 2CJ9A 2DNNA 3UN5A 3J7AM 2DXFA 4USHA 4DZDA 5IQ6A 3K58A 1S1UB 2I6WA 2NXUA 3ICLA 3OT9A 3VQTA 3T1HF 4MMOA 4JI7I 2GHPA 1NHVA 3TX8A 5BYSA 1MW7A 1UW9A 2LKZA 3C15B 4OFZA 1NK0A 3MM8B 3G96A 1FRKA 2V5HG 2WB1D 3Q2TC 1TL3B 3G2XA 4F36A 4AL6A 2DHXA 3IXQA 3KHGA 5K14B 5KG5A 2AGPA 1X4DA 1Y4ZB 5E3QA 3HJCA 4GKKE 2YKOA 5KG0A 2CDQA 3GONA 3VVTA 4PRFA 1RA6A 1RU1A 4ZP8A 3CJKB 5L39A 1ZTWA 2EC2A 3HVTA 2Y0BB 2W4PA 4Y2IA 4DR6F 1KTQA 4U67Q 4YFUA 1SV5B 1CJVB 4QYZK 4DX6A 1KN6A 2J5AA 2JVRA 2IRYA 3H42A 2K3KA 2ZBCA 4O44B 5BXIA 1UEKA 3HSDA 4CLWA 5K8PA 4DR4J 4K4SA 1N33F 3HD2A 2QA4G 3PS1A 1XMOE 1RACB 1XNQI 1GMWD 5K36E 5B09A 1SUQA 1WF0A 4DPOA 2UUCJ 1N33J 4DV6E 4NLWA 1XMQE 3T6BA 4A8XA 3PW0A 3RR8A 3BN4A 2OHDA 5D3GB 2B51A 3QAEA 5E3CA 1C4CA 1OO0B 5D4OA 4JUZA 1AB8A 4A8WA 4ED7A 1XK8A 4IZJD 3D66A 2O67A 1S9EB 1Y10A 4J90A 5ETPA 5KG1A 3TP2A 4G1IA 4ECXA 4A8SA 2PI5A 1FFGB 4IKAA 5DDPC 2KXNB 4NZ7A 3KUGA 3P8BB 2WW4A 3QO9B 5DG7A 3HVRA 3K5MA 1RAEB 2CQ1A 3B4MA 3QZ8A 3CCSS 4DV2J 2H5IB 2XLIA 1FD8A 1UEVA 1N36J 4AXIA 1RT6A 3B54A 4ED8A 3QT8A 5DG8A 1YHQS 2ZOFA 2UVUA 2ZM6E 2OPRA 3O8WA 2KL8A 2HG4A 1JLFB 3DGPA 2E9RX 2PO2A 4OO1B 4EMDA 2FC9A 4KHPE 4B3SE 2QT7A 1XERA 3M8QA 4RUBA 5SZTA 5B0EA 3ZTRA 4ED6A 1RAGB 2NUHA 3PDNA 2DHAA 4K5RA 2FY1A 4YY3E 4DR3F 3K89A 3VVUA 2VQFI 2GQ2A 2P6SA 3W8PA 3M8ZA 3MFHA 4JI4J 1RLDA 2VJVA 1NHIA 4QU6A 4LFBE 3MPYA 4AE5A 2AJ2A 2JHEA 1IBMI 1UWBA 2GGPA 3G9CA 3MHYA 4XTJA 1JQGA 3BKFA 3ULHA 1WG1A 4DFPA 4URSA 4DL5A 4DL3A 2EG1A 2R8JA 3W64A 5H9EJ 1A0OB 1CQMA 2F9DA 2JLEA 3TJAA 1PSDA 2YKNB 5LSOA 2E9TA 3BDEA 3AJDA 4DV2I 1SL2A 1FKOB 3KLGA 3KK2B 4OO1A 2JX2A 4G1PA 1YJTA 4X65I 3FUYA 4OX9E 4O4GB 1CVJA 2BACA 4JI2I 2E66A 2DTJA 2IDLA 2KYXA 4BS2A 3GFZA 1EKSA 3CMQA 4TY8A 1AA1B 2CNNB 5KG3A 2AJ4A 2YQ0A 3N28A 1HHTP 5KFKA 1IR0A 2RHQB 3A8KA 2HHTA 5KFRA 1FA0A 2L41A 4O4GA 1KC8T 1WDTA 2AX1A 4OX9I 2F1FA 2DNMA 1UAWA 2LEPA 2LQJA 3I0RB 4FKYA 4M8LA 4ZVHA 1KIJA 2MJNA 2ZHOA 4OX6A 2G2OA 2AWZA 2XNQA 4FVMA 2IYIA 1RWNB 1B0TA 3FKBA 3J80C 1Z2LA 1VQYA 4FNIA 3R2DJ 1JLAB 3D9BA 3I0RA 4CLSA 3DU5A 5KFHA 1S97A 5CD4A 1TAQA 2OMOA 2V68A 4Y65A 3W62A 4NYZA 3PX6A 2JE6A 2E5LI 2C2OB 5IFMA 1GH8A 5K36C 1PKUA 2KJWA 5KAKA 2J8AA 3O2IA 3GV5B 1U1KA 1K0VA 1FTRA 2LYVA 2UUAJ 2EBGA 2CIMA 4C0HA 1UVIA 2JNJA 4U6PA 4NXNE 1FKOA 3JSYA 3MD3A 3PCOB 3KLGB 4G1QA 3KK2A 4F3OA 2PIIA 5M2RA 4WFZA 2HRUA 4LJMA 4IRDA 1UPPA 1OYSA 4FWDA 4NBQA 2QFJA 1WF2A 3K1JA 2C39B 2IVYA 4LRBA 3MM7A 3FK4A 2CPJA 3PYEA 1TELA 3I0SB 4EBDA 1F9HA 3AD7C 1YJRA 4UT4A 1T05A 1HHSA 3MR2A 3WC2A 2ZH7A 4F4YA 2H4WB 3SV3A 4LF8F 4B3RF 3NXZA 2NN6A 4MU1A 1T9VA 4RW4B 1IBLI 2L48A 3EGWB 5K36D 2UXCE 4M5MA 2FIUA 2HFVA 3L9ZA 3B4TA 2AJ1A 3D68A 3RB4A 1LQ9A 3LOUA 3NBPA 5FDLA 4TYBA 3T9ZA 1MU2B 2W24A 1FFSB 3HHKA 3GILA 3CVKA 3RBDA 2BKOA 2YH1A 4IR9A 3UD4P 1RU2A 2VPZB 3OL6A 4FW3A 1RHRB 2K1RB 5AXLA 2X3DA 2XS2A 1FRLA 2GVDA 2AZ3A 3MF5A 4F0KA 3KG1A 2ILYA 3CJSA 3MM9B 4XIUA 1Z5BA 3PW5A 2B5JB 1F0XA 2WSEC 3DM2B 2E7WA 4LFAJ 4MAKA 3CDWA 2AEJA 2HS3A 4KKOB 5D4LA 1SQFA 2VHGA 4BHQA 3PO5A 5KFZA 5A0YA 4RKUC 1S57A 4B3ME 5JMNA 2NYIA 4LCHA 1UKUA 1WC1A 4K4ZA 2EFOA 2AJ0A 3HKZD 4EYIB 2HNYB 2BBEA 1DURA 2HWIA 2ZD1A 3OR2B 2QMWA 2V4QA 3FJ2A 4B9MA 4X62E 4O3OA 2ZNZA 2L9DA 2CPFA 4OHZA 3CWJA 4IQXA 1C1BA 1RT1B 2X3GA 1TFWA 3BGLA 5K9FA 4DUYF 2UUBF 5J1EB 2W9CA 3PRBA 4Q2MA 2WSCC 2VF3A 2HZCA 1LXJA 3DRPB 1HBMB 2E29A 3PEHA 1QLNA 2HNZA 1SJ4P 4BCAA 5ETQA 5C7PA 3GFHA 1U8WA 2RJZA 1UJ5A 1JJHA 2BX6A 2LXUA 3ILIA 4M5DA 2P2CB 4DSKA 2MLXA 3KK1A 2WTFA 1VQ5S 4ILMA 4WP8A 2EC0A 4OO1F 3OVBA 4DQIA 2B7CB 2QIFA 3DHXA 1EETB 1HFEL 4NLQA 2LU2A 3KG0A 4Y2MA 4JI2J 1QTNB 1CPZA 2Y1LB 4MIBA 2KN4A 2BOAA 2DD8S 3Q8SB 2HHHE 1XR7A 5HANA 4ZOSA 3V5RA 2AQ4A 4ZLNA 4IFDE 4DR2F 4JI3I 3M4XA 1NJXA 3TR5A 3KG4A 1NHUA 3RB0A 1IQTA 3UE2A 2JOQA 1TL7B 3FMWA 3GB0A 2JEBB 4AIMA 3M2RA 4DEZA 2QX0A 3VAKA 3NGSA 5DGBA 5D78A 2V34A 3PNIA 4A4JA 1N6QB 1RR9A 3SCIE 1Y11A 4YQWA 2PO0B 3AD9C 5DNLA 1NMEB 1S5ZA 4DR3J 1S16A 2GMHA 2ZBRA 1NSKL 3QRRA 1JLQB 3F56A 4NLTA 3Q83A 3UWTA 2ZC4A 3TQEA 4EGLA 4F04B 2PA8D 3KDNA 1TV6B 2HLUA 2OPQA 5AXMA 5L1LA 1S0VA 3P3GA 3M30B 1N5YB 1M1KT 3M9OB 1KP6A 4B9NA 1Z0VA 2K7KA 2CG4A 5J1NA 4QBUA 2VFRA 1TK5A 5IT9U 2DNLA 5GAEI 3DLGB 4I7FA 4YHHJ 2R8KA 4JI0J 2C2EA 1QM9A 2KT2A 3OTOE 4J91A 2DNHA 4JI1E 2DRAA 2W4CA 3QMQA 1H98A 3CTRA 5A76A 1BC6A 1RT5A 5T14A 1Y6ZA 5CCMA 4QW8A 3PYFA 3IGNA 4ICLA 1XN9A 1OIAA 3LPSA 4P7TA 2PO1A 4N8NA 4C2MA 3NNHA 5T7LA 2OKQA 3KJQB 2FHMA 3HSGA 4ES1A 2VQEJ 4PUOA 1XNQE 1FDDA 3Q6NA 2J9DA 1TKXB 2V4RA 2VQEF 2ATLA 1T03B 1CJKA 1HW8A 2BJ9A 2QSWA 1FRHA 2VPWB 4C97A 2RUGA 1XNRI 4JI5F 2MZQA 3R5GA 2JH3A 2BKNA 2AV5A 4W4MA 3M6VA 1IR2A 1S1WB 3FSIA 4CO1A 4A8QA 4DV7I 4UTGA 4LFCE 3TVYA 3W2VA 4DV0F 2WVDA 4K4YA 4EBCA 1U1MA 2MZSA 2KM8B 4DV1I 1HNWF 3KHLA 3SDEB 2DXEA 4HEA9 2V8HA 2GJIA 5IQQA 3AAWB 3SSRA 1U02A 3ZKDA 2DR8A 1BUXA 3UNYA 2FVQA 2R7XA 4PABA 1BE4A 2IERA 2WVEA 2NPIA 1T9XA 3DDIA 4Q2LA 2D74B 2ZWOA 3UPFA 5KFNA 3JSBA 3JAMU 3E01A 4C8MA 5DRQA 1RT2A 4LBPA 4QIEA 4ZLLA 4DR3E 4OHXA 5KT4A 1ZZNA 3DU6A 3VZIA 3S7RA 2HHVA 4OZLA 1U4BA 1VBYA 1N5SA 3U1NA 2CQIA 4ICLB 1PJ7A 2K3IA 3KXDA 4IOBA 1DQ9A 1KS2A 1PYOB 2ROGA 4F25A 1D9AA 3GTYX 2RF2B 2LECA 3FSYA 1HBOA 2VDHA 4O0IA 1JNRB 5KFVA 2EKYA 3VZHA 2EBEA 2HHSA 2M70A 4FYXB 2R2RA 3IGVA 2QSFA 1CJKB 1IKXB 4IFYB 4OMFG 5M2PA 1TKXA 1T03A 4X64E 1NSPA 2GIFA 1LK7A 1S6OA 1T9WA 1U7LA 3GFYA 2DGOA 5C5JA 5FLXU 3IS9B 1F9FA 4UY85 2QMUB 4J3DA 2BRLA 1FDNA 3G71S 5T41A 4FPIA 2VH7A 2MXYA 4RW9B 5EDWA 3NGDA 4DV4J 2XWYA 1U47A 4ILLA 1FRXA 2Z5CA 5BR8F 3P5BP 1RYSA 3MTKA 1RTZA 1T95A 2KXFA 4HLBA 4O23A 2MKKA 2DCLA 1S6QA 2P9CA 4JYAJ 3QWUA 4NLSA 4YY3F 3CCRS 3VGVA 4PG7A 3NLCA 2GV1A 2YTCA 3GJSB 4N47A 1TL5A 2KFNA 2BMBA 4WE1B 4J9UE 2B56A 3QNWB 5HSPA 1MWQA 1Y5LB 1U0HB 2A2CA 2J8SA 4OV1A 1IBLJ 2ZH1A 2GO3A 2HQDA 2MLZA 3MCSA 3MMJA 3PR4A 5I3UA 3RYLA 1N36I 1H7UA 2ZM6F 1SB6A 2G9OA 2UU9F 2VG6A 3J7ZT 5AXKA 1NDLA 1K47A 4NXMF 3F44A 3NCPA 4K59A 4N56A 2PO0A 2MZ1A 5KG6A 2JEJA 3D3CJ 5LL6R 3FGVA 4AT1B 4MFBA 6FDRA 2PO4A 4TLRA 2NR0A 2RNEA 2VQFE 2UUCF 4WJBA 3WIVA 2VQFJ 4PEOA 3WHIA 3BB5A 5J1PA 4TQRA 4DL7A 3H98A 3LA0A 4R0JA 4LF4F 1H6KX 3BQ1A 2ASJA 1DARA 1EAYC 4MFBB 3SXLA 2WOMB 3Q8PB 2MB0B 3W5XA 4LF6F 2IM0A 3TJ9A 1EI1A 3PRVA 4C98A 4ZP6A 2BW7A 5IS2A 1TUVA 4PG8A 2HWHA 3M8SA 3LGHA 1PBUA 3LAKA 4R25A 3OR1A 4W92B 1TL4A 2UUWA 2VPXB 2KDOA 3M2UB 3MCNA 2VA3A 1DLOA 3P3EA 3PX0A 1N34J 3EVMA 3QFHA 4ZK7M 1HI8A 1Q82T 4PPZA 2J0SD 3BGOP 3HLUA 3N01A 4RLEA 3IWLA 2NLWA 4X65F 4J9NA 4LF1A 2NYHA 2EI5A 3GFXA 5J1EA 2RRAA 4ZPDA 4B9VA 4KO0A 2FYXA 3V6DA 2O3ZA 4HT5A 4J9OA 3KLIB 2Z0GA 2Y8YA 1YJUA 1X5TA 1R0BG 2RUSA 2FY8A 1H38A 2IVMA 2APOA 2GA7A 2ZD1B 3FCVA 3NKYA 4HXZA 2BEFA 4B3RJ 3DYAA 1AFIA 1RA7A 4ECZA 1HQEB 1QY7A 1WC4A 3BSAA 3IFEA 4K2JA 1MU2A 5KT7A 4LF6I 1Q53A 4OZ2A 2C3OA 3NBPB 1DBDA 2ZJPQ 1EKRA 3PS2A 2E1RA 3PXGa 1MNEA 3M9MB 2BZ2A 2NS1B 1J5OA 3MECB 1WC0A 8AT1B 3PYDA 5K20B 3T1YE 4LF6E 2ILZA 2B5JA 1YJ7A 4OV6A 5HMWA 2U2FA 3MM9A 2QA4S 5J2PA 3MOZA 2PT0A 1RAAB 3WU6A 1Z0TA 3UHMA 3MM7B 3ET6B 2FLOA 4NCAA 1ZAXA 4F50A 1XMQF 2NN6D 4USKA 3Q6MA 4B3TF 4AUKA 3TEGA 2K1RA 1Q16B 2LQBA 2MKYA 4H4KA 4WYLA 1D9FA 4DR3I 1J5EI 5IM0B 3MEKA 7FD1A 1FT8A 5AXNA 3OJUA 3NS7B 3D6HB 3DNCA 2CG8A 3I87A 4RW7B 4RNOA 2IHR1 3CCES 2XY5A 4DR2E 3GCXP 3DFEA 5HN0A 4DF4A 4QYZJ 3M85D 1NPRA 4N7TA 3KUHA 5DZ7A 4ES3A 4NLGA 1FI4A 3QGHA 3FEYB 3LGNA 3TUJC 3CO9A 2C1EB 3P76A 2H65B 5CYMB 2ZBPA 1Q8IA 2GZOA 3A12A 3N0VA 3H4BA 1Y3KA 3BREA 5DROA 5HQLA 2HVDA 5AJ3J 1UFWA 3MUMP 4JI7E 2D3ZA 1HNZJ 5IWAJ 4IFDD 2DHGA 1JLAA 2AYEA 3DOLA 3M6XA 3MPUB 5EX3A 3BH6B 2P5VA 3HF5A 3UDEA 4JV5J 4USJC 4N3OA 1RTDB 1G7CB 4IS9A 3JAMC 4BA2A 5JEAD 4LMZA 2E5LE 2XGQA 5C24A 2FJAB 1NZAA 3MGJA 2DEJA 4M5LA 4NLXA 4JI6E 2C42A 2XS7A 1X4BA 3J7Z5 2RH3A 4LF2A 4QWCA 4Y00A 4QW9A 3UCGA 2UVRA 2R9LA 4GKJJ 3NMRA 1HR0E 2EVZA 3PJWA 4J37A 4TY8B 1U45A 2GIRA 4WIQA 2ZBQA 3CXCR 4HVZA 4EUVA 1D3WA 5KFWA 2GMLA 1FDAA 3OW2R 2DY9A 4ZLPA 4USWA 2G1HA 1IJEB 1FEHA 3QGPA 1N36E 5ADZA 5JVHQ 3E8OA 2BQ3A 3D0HE 1RTJB 4Z7YA 5KFSA 2E5LF 5J2QA 1HBUA 3A8JA 4W98A 1G2EA 4YB7A 3BM7A 3BGRA 1AUDA 3I5BA 1SJ3P 4DV5E 3CIZA 1XNRE 2CFXA 4RO0A 4DR5F 1N4LA 2UXBI 3CJ8A 3WZ0A 3H5YA 3DHWC 3UN3A 1EARA 1NNDA 3N79A 3CJRA 4BA1A 4DR1J 3QLHB 1SIZA 1XTZA 3L3CA 2YBVA 4M1KA 2X1AA 1FFWB 3AY0A 1C1CB 2AP6A 1XIQA 3QFWA 3RUBL 2WW8A 4ED4A 5HK4A 2I0XA 2XMVA 1YHCA 3SQGA 3CB4A 3C6TA 5HROB 4NCGB 4ANCA 2HKJA 2WP8B 1G1XA 3MM5A 3CGIA 4LUBA 2UXCJ 5ITHA 1UVNA 1XQIA 2MYFA 4NASA 1NU4A 1L3VA 2J0QD 5GAEU 5HL7Q 2VESA 2EXUA 4MYTA 2VBXA 4C9DA 1USUA 2R42A 4F7VA 3GLJA 5IT9Q 3M8WA 5HLFB 4GKKI 3KHHA 1F2HA 2DHHA 3A1YG 4JI8F 5IXUA 3PM9A 4NRTA 1HNWE 1DTTA 1XR5A 4UOFA 2F4VF 3SMZA 2V8GA 4URQU 1RE1B 1S9EA 2IYGA 2YKMB 1WG4A 3TAMB 4WFNQ 4E0DA 1FERA 4XDDA 4I0WA 2DK2A 4LF4J 3PG9A 2VA2A 2G1DA 1BLUA 2B9EA 2CQDA 2JC1A 2V8VA 4NLDA 1NSQA 2YWKA 4DSLA 2BA1D 4BA1B 4JV5E 3CCTA 2Y3YA 1XNQF 1C1BB 1RT1A 4IZKB 1IXKA 2WAQD 1JLBA 3PY8A 2ZOMA 4WKRA 1HNWJ 3QJJA 2QLFB 2QYCA 1CQNA 3BBBA 5I3PA 4FBTA 2WONB 2VZ9A 3RRGA 1EJ7L 1WJ9A 5DM6Q 4H4OB 3OVAA 3MURP 2MTLA 2HZAA 3W8GA 6AT1B 4TU8A 1HWJA 5D0GA 1NHJA 3KLFB 1M5KC 3Q8YA 4MKBA 5D77A 1R8PA 1Y5NB 1CSJA 1PGZA 4NCBA 3J80Q 1PC5A 4KKOA 2IAJA 4FF4A 1APSA 1VS3A 1PYSB 2CNKB 3P3CA 5HBMB 2Q3PA 1FJCA 3D0IE 5HMXA 3PRYA 3S8SA 5FLXC 2W2MP 4UZBA 5DM7Q 3Q23A 1FHTA 4ZVGA 3TVKA 4ETZA 1UWAA 4TN2A 1VISA 4PZVA 4KBIA 1B99A 3TANA 4K50A 1XNRJ 1UMJA 1N8RT 3SDEA 4BA2B 4DV7J 2EW9A 5CZVA 4ZN1A 1RTDA 1QVFR 3KK3B 5EKWA 3GU0A 3OD2A 4BWMA 3HHLD 5GAHI 1KQSR 2Q43A 4KFBA 4KGZB 4LREA 2W4DA 2ZWPA 4QIGA 4CQ1A 1XMOJ 2R7TA 1B64A 1S1WA 1R8CA 5K14A 4ECWA 4DV4F 3Q1QA 1TUGB 1D9DA 1UETA 4BC9A 2B9WA 1RTHB 2PMZD 1YWXA 4FWHA 2H3EB 4DR7J 1N88A 3OBIA 4KHRA 2IJNA 3QPIA 5AE2A 1N5QA 3FZBA 5HJYA 1J5OB 3IBFB 1Y60A 2XHWA 1OY9A 3R5CA 2B0GA 3CT9A 1N32E 1FE0A 1NK7A 1ZPVA 4LF8I 4HACA 1RWOB 1IBCB 2PO1B 1NM2A 1M90T 2IA0A 4DSIA 2X51A 1UA1A 4G1QB 2CXEA 2XMMA 4JI6J 3GJQB 5JEAB 4NLPA 2PFDA 4KT0C 4DX5A 4I69A 1S4EA 1KQFB 3RAMA 2ZBIA 3RRHA 3A8EA 5LJ5Y 2I9SA 4CRJA 4DV4E 2LQ8A 1M1GA 5D4NA 3L7UA 1D8ZA 3VGSA 4O3QA 2X1FA 1AZSA 3SFUA 4JI7J 1TV6A 2JDJA 4NLVA 4WP3A 5AJ3F 4RUCA 1M5PC 1HNXJ 4I2PA 4K0KE 2C3MA 1J5EJ 1IQZA 1QSSA 3BKUA 2YNHA 2N82B 4LPFA 3JSMB 1VQ7S 3BDPA 4E98A 1T11A 3ILLA 4XAKA 5CHCB 1BMQB 2BKPA 3H0PA 2BM1A 1S10A 2J6UA 1H2VZ 4DJBA 4RUHA 5BYQA 1X7VA 3T5LA 4Q44A 2CZ9A 3KLHA 3O3LA 4JYAI 2OPSA 3FRZA 1D8YA 4KGMA 3KTQA 3P96A 2BXJA 1PKPA 2V8PA 1UZDA 1REGX 1QZRA 4KY3A 1DZ5A 4PXBA 3H2UB 1TTHB 5ETKA 2P6TA 3P4UB 3SIPB 4DLGA 4DBQA 1WOPA 4HH1A 1JLEA 5DDRC 3I5CA 3U02A 5K36A 4X64I 5SUHA 3M2UA 4NE9C 5A6WA 3IG1B 3EYZA 4XPEA 1VBZA 4GQUA 2CPIA 2I5JA 1W7WA 2M2BA 1VBXA 4DSJA 2LFVA 2KT3A 2DH7A 3KK1B 2BA1G 4DUZI 1U2CA 2AW0A 4X66I 3ISZA 4WXOA 1VQSA 4ZPVR 4ANDA 4DF8A 4LFCJ 2QLBB 2E1CA 3TA2A 3NCRA 3C66A 1RCXB 4B3RE 1U0HA 4HL9A 4LRAA 3QRQA 1HARA 3OL8A 3O5TB 2Z2LA 2GVZA 4F4AA 2E5HA 3CCQS 4LVOP 5ETSA 1G3OA 3HM9A 2VQEE 1VRUA 1XJWB 4DMZA 3DOMB 4WTOB 3PVXA 2FVPA 2NN6B 4J5OA 3DXBA 3I82A 1VLYA 1HWUA 3NNAA 1Z0GA 2RDJA 1RGVA 2YNIB 2KU7A 2JEAA 2CWKA 4ID5A 4L3KA 4RJVA 4C8YA 2VG6B 2JFDA 2PMWA 1MLAA 1HNVB 1IKYA 2IIHA 2BJ1A 3BR8A 3R9LA 3W5YA 3MR5A 5I3UB 1IM4A 3VF0B 1WI8A 2V63A 3O1LA 3VGUA 3C6UA 2HBQB 2WNRB 3EPGA 1C0UA 2QA2A 1M5SA 4NXMJ 4LF7F 3HVWA 1ZZFA 1NB2A 4NI2A 4QQBA 1MWZA 2QL7B 2RQMA 4C4WA 3IP0A 1RXOB 2BVZA 2VC1A 4O3RA 2HKEA 3OFHA 1TMMA 3OTDA 1YG0A 3MDFA 2GO4A 3L7ZB 2H5JB 2LMIA 3FEXB 3SFGA 2OTLS 2W01A 5FDLB 5MAOA 4P75A 4NXNF 2F8HA 2A3JA 2IC3A 2HAFA 3M9NB 4DSEA 2ZZMA 3KFWX 2RKIB 5B0DA 4ZVQB 1VC5A 2CQ4A 2EPIA 3R6GB 4ITSA 2J7UA 2CQCA 1NKEA 4WF9Q 4OX7A 3NAIA 1NSAA 5J2MA 1Y5YA 2V2ZA 2XYHB 1F6TA 1YZ7A 3C6UB 3KWMA 2B8QA 3JQMA 2DNYA 2FLLA 1UVJA 4LF9J 5LMUI 2RF2A 3DLEB 1RT7A 2FJXA 2JVOA 3D67A 2WVBA 3ILJA 2IRXA 2KHCA 1ELOA 4CI0B 1HBNB 1TK8A 4LFBI 1TFYA 3LPEA 3CMAS 2DGSA 2GO9A 2DVIA 1H74A 5BR8E 3CDJA 5HMZA 4JI3E 1U1PA 3RJMB 5A8RA 1R89A 2YNFA 1HNWI 1EZZB 2J9DE 3QATA 2YKAA 2EK1A 4OX9F 2B8PA 3GG1A 3BO2A 2PNZA 1YDLA 3ZC4A 4YHHE 4CH0S 4JI0E 2N7CA 2RE1A 3KUEA 3CC4S 4B9SA 3THTA 3DC2A 3PFOA 4EI2A 3J81Y 1FO1A 1F1BB 1RHJB 2RVJA 2Y1RI 2ZKTA 3FFIA 4JV5I 5F8NA 4QR0A 1ZA2B 1K1SA 2CQBA 3EM1A 4GMKA 2KFYA 5B7WA 3IAM9 2XLKA 2GJ2A 5EWEA 2ZDPA 3FMBA 3JQJA 4LFBF 3TX0A 1Z5AA 1X4FA 1V9OA 1X5OA 4L76A 2MZJA 2VBZA 4CM0A 4DFJA 2XS5A 4Q0BA 4LFAF 5KFXA 4C6AA 1R31A 4ZHRA 4GKJI 4C8KA 1HQ2A 2JT2A 1C4AA 4KHMA 3W61A 4DUTA 3T5KA 4X2BA 5CD4H 2G2ZA 2OPSB 1YIJS 3LAMA 2DNRA 1H2UX 2UU9J 1N6QA 1KNZA 3VAGA 1QJHA 4OO1C 3I56S 3G86A 5JJBA 1V6HA 3TAPA 3FBCA 5JEAC 4IG0A 4JV5F 2W7AA 2KTQA 3M30A 4JI1I 4DR6E 3O44A 5IWAF 1UWBB 2GGPB 3CD6S 1NH8A 2AKWB 4UY8T 3NS6A 4FWGA 4IOAQ 4FZVA 5L9XA 1HYSA 1TKDA 1EB0A 2DB1A 2YKPA 3IR5B 3H90A 4DR1I 3FC9A 2F4VE 1FVQA 3KJNB 3TO8A 1X31C 1E6YB 4PUOB 2KT5A 4ZP7A 3FFIB 1RWUA 1ZOTA 3FQLA 3O6QA 5DLGA 2KRRA 1LWFB 5JEAA 1ZM4A 2CZVC 3T19A 5F3ZA 5IV3A 4PWWA 5KFDA 4GRSA 3F0NA 2OFGX 2M8DB 2XC9A 1JLFA 3DGPB 4IFDF 2UXCI 4AD6A 1ZPWX 1B7FA 2A10A 2XMWA 4A8OA 3ITHA 3E2EA 4ALZA 5HATA 1VRTA 4FF1A 3ZZ0A 4Q0BB 6FD1A 1EP4B 3QIDA 3ZZZA 5KT3A 1H7WA 4JI2F 2YY3A 2HNYA 1C0TA 3OUYB 1G6BA 2JC0A 2WBRA 1S9GA 1GK8A 4GKKF 1MMDA 1WACA 3UNGC 1WF1A 1NKBA 2C3PA 3NAHA 4DR1F 1Z4UA 4YB5A 1YITS 4ZPAA 2NPFA 5KFGA 4DV1E 4DG1B 3KK3A 1RQ0A 4P2FA 3T5HA 4BDPA 3ENQA 4DR5E 3MAAB 2VB6A 1WKKA 3DRPA 2IESA 3EVOA 2POKA 2WONA 4Y2KA 4OI2A 1FE4A 4GC6A 1JJ4A 4B9UA 5C2GA 4ELUA 5K8OA 2ZJQQ 3MAHA 3T1HE 3N6NA 4FVCA 4DPXA 5KTQA 2F40A 2Y1IA 4IZJB 3M7ND 2IM2A 2EFGA 2RKIA 1BGXT 2GVDB 1T3NA 1U1RA 4OI0A 1S59A 1WOSA 3GV8B 2N3LA 3GYGA 3MR3A 1NZ0A 1JJCB 2PD1A 3CJKA 4RBVA 2XMAA 4DUZJ 1NK8A 2RMLA 2HK2A 3BQ2A 1YTYA 5EUHA 4YB1P 3WC0A 2ZJRQ 2VL1A 3D1HA 3HJFA 1DTTB 1K8AT 2AT1B 4A8FA 4AXJA 4V19J 2K2PA 2NZ4A 1R6LA 2HIQA 1QUVA 2BR2A 4TLQA 1SH0A 1T9UA 2AIRB 4OQJA 4PR6A 1JLBB 3EWGA 2IY5B 5I42A 4OX8A 2HQIA 2FVRA 3AFGA 4ZLJA 1WC3A 4FPRA 4X4SA 1VQKS 4DV3E 3QGGA 1Y9OA 1RUSA 3D6FB 4TNOA 4AFFA 1E3HA 1Z1ZA 2QL5B 4PWUA 4WU2A 3WQPA 4FW9A 5GAGI 2YNIA 2XCAA 2FHOB 1S76D 3HKMA 4JI0I 2ZE2B 3ZTOA 5CA5A 2V4JB 4IO1A 4ZVEA 1CBKA 5KFJA 2VOPA 4M5IA 5LMNF 5DETA 2V9KA 3G6VA 3QRPA 2DNZA 3CDIA 3NWRA 4B3SJ 3R5DA 4NZ0A 1GX6A 2CKWA 4P9SA 2Q66A 3MEEA 3BGUA 3GMGA 4JI8I 3G87A 1MN9A 4PKDB 1CS4A 2W9BA 2M8HA 2W2OP 2QA1A 3NMAA 2H54B 4HKQA 1IKYB 1HNVA 2OUGA 3LPYA 4IG3A 1S0MA 1MROA 2BABA 4JI8E 4DL2A 1RDRA 4Q45A 3OSPA 3LW5C 4ZDNA 5IC6B 4TU9A 2OH2A 5A2QQ 1X4EA 1UW4A 1NDCA 2B6AB 2EWHA 5KFLA 3ZTPA 3C3LA 4IFDB 2YPZA 3HHLC 3I5AA 2HFNA 2UXDF 3FBEA 2HNDA 4HR2A 4DV6J 3QLHA 2UUTA 3BO3A 1RKIA 1U1OA 4LF9I 4DV7F 1EQMA 1FJGE 2YH0A 1E6VB 1SXLA 3M7VA 4WYWA 5E33A 5KT2A 4DR5J 3Q2SC 3W66A 1Q79A 2BJ7A 3CDBA 3GP9A 3UR3C 3LF0A 4QNJA 2DHSA 2E7VA 2R7VA 2RRBA 4LFBJ 4I56A 4DU8A 1IKVB 2UUBI 3GJTB 1PJ6A 2LQ5A 3MUTP 1IKVA 3J7YI 1CULB 4CT9A 4YY3J 1PVGA 4NXME 1VFJA 2YNHB 2KG1A 1XC9A 5K36B 2GHWA 1S6PB 2Z8QA 4ED0A 4CLFA 2CQGA 2ACMA 2FHJA 3H2LA 4F3MA 4M95A 3I55S 1NPPA 4QNKA 3CJ4A 4P2MA 5E7OB 4OIXA 3BJYA 5D0EA 2XY7A 1G4CA 4WFXA 1HLWA 5KFPA 3D1QA 3W60A 5A8KB 1PAUB 3V6HA 4IFVB 2G4BA 4IFDA 3E51A 2YWFA 3MPWA 5E5NA 2D7SA 2YX4A 2I2YA 2ZZNA 4ECYA 2AJFE 3VAIA 4A8YA 2F4VJ 4DV4I 2E5IA 2W7PA 4HH0A 3ZZOA 2ZHAA 4WP9A 1HHQA 2D69A 1FEEA 2G0JA 1N0UA 1N32I 4I2PB 2MQMA 4LRFA 2EFQA 3M8PB 1FXRA 3IWXA 5EX0A 3WX8A 1AZSB 2QRRA 3FQKA 1TVRA 4RX6A 3CCLS 4X66F 2X1BA 1HI1A 2ZH8A 4OYZA 1MG7A 1VQPS 4NXNJ 2V0NA 3PIPQ 3T1AA 4U3BA 4DV5F 3M8PA 3ZZTA 4R8UA 4M94A 4O3SA 2QLWA 3HZEA 1WSVA 2AEFA 2MEWA 4CO5A 2VG7B 1TK0A 2CJKA 2PI4A 3GCMA 1D6TA 1AT1B 4IO9Q 2DT9A 1YRXA 2CADA 1B3TA 1P9QC 4ZVSB 4XO0A 3KYLA 2R8IA 5GMEA 3JYTB 1SJQA 4ISAA 4LR9A 2O01C 4ANEA 2H51B 2PC6A 2OGUA 3HK2A 5KFMA 4WU3A 3PHEA 5I42B 1N5VA 3AQPA 5H9EK 1ZH5A 4P6QA 3W2WA 4X66E 3D5MA 1RWPB 2BR2B 5K5MA 1VRQC 3CMES 5DGAA 4NEZA 2EK6A 4RW8A 3MD1A 5ETTA 3B6BA 2L9WA 1AYEA 4CCHA 1VGYA 1P9YA 4KFBB 3AXMA 2D3UA 3IBCB 5DJBA 5LOQA 4DV3F 3C2PA 4LF7I 5D3GA 1UJ4A 3PKYA 4BBYA 1ACMB 1F60B 1CC7A 2H4YB 1OPZA 4H4OA 3TUIC 1OQ6A 3DYAB 1R43A 2OSRA 4MH8A 4Y2CA 2YWEA 3OL7A 4F67A 4KHPF 4PRXA 2HGMA 1CLFA 2QO3A 3IO1A 3RBEA 1LWEA 4ECSA 2O1TA 3I31A 2BE2B 4AL7A 5GVQA 4LF5E 1B7YB 2DIVA 4IZKA 3KJVB 3MPVA 4PAAA 1BQMA 3W63A 4WFAQ 2PNMA 1WNEA 1Z0EA 2RQCA 1JLGB 4KGKA 2MPUA 3GR1A 2FZCB 2MSSA 5JEAF 2F5GA 4QOTA 2HHXA 1DLOB 4YHHI 2GMJA 1HMVB 1UEUA 1V5IB 4GO7X 3NZKA 2ABYA 1JXEA 3ZZUA 2I1RA 5KG4A 3OTOF 1TMJA 5L9NA 3MR6A 5LMUE 2LJPA 4J7CA 2EFVA 1U8SA 2Y1JA 2ADBA 2CQ2A 8RUCA 4KHPI 1LW2A 2ATCB 2GCFA 3NCQA 2Q79A 3OPKA 2ASYA 4LF5F 4H4MB 5KT5A 1KONA 1VIOA 1FK9A 2QLXA 4DV0J 1S77D 4X4PA 4DUYE 1HNZF 3JXOA 3MEEB 5IT9C 4OYIA 1S0OA 4DR4E 3AJ2A 3MZIA 2EKNA 4KR0B 2KH9A 3LWLA 3CSKA 4KPCA 1LWFA 4X62F 4P2XA 3R5BA 4RNHA 2Z57B 1RT4B 1PIEA 3TARA 3QSIA 1NJYA 2R3VA 1X9SA 2Z30B 2ZE2A 2FJEB 1UA0A 2JEFA 3WU5A 3T1HI 1IVZA 1O5JA 3CIMA 3Q8RB 3SSQA 4KV8A 2C28A 2B9XA 3UW1A 3P06A 3CNQP 4KH0B 5HLFA 5B0CA 3DLKB 3OLAA 1HWIA 2XSJB 4OJGA 5THWA 1Y5IB 3C16A 2IVFB 3CULA 2A2DA 2W1BA 1HBUB 4PXCA 3ZNUA 4X65E 4KQVA 2CWXA 2IPOB 4FYWB 3S1TA 2CYYA 1RP5A 1WOOA 5KFUA 4DI6A 2JLGA 5KFBA 3CE8A 3G82A 1HNZI 4LCGA 1FRMA 2YX1A 2GAHC 1NJWA 4RU9A 3H4DA 2K7JA 2Z5CB 2ZFHA 4JV0A 1C1CA 2HBYB 1L3TA 1H7SA 4UUXA 3LP1B 3D0GE 3VCDA 2HMIB 5EWGA 4DQQA 1T7PA 2BJ8A 1N33I 1NJZA 3PFEA 3TAQA 1NJIT 2HHWA 4IZJA 4O3NA 3N6LA 3HHEA 2ASDA 4DR7F 3ZXWA 3HFZB 4ECTA 3BN7A 2UUCI 1WHYA 2DISA 4ECVA 4YDDB 5C24B 3CDAA 3DLBA 4RU2A 2GJFA 3HKWA 3R8YA 1L5UA 1HBOB 4OZ1A 4ILRA 3TA0A 2MMYA 2XO6A 1TR0A 4EK2A 3VWSA 3GG0A 2R7QA 2CJAA 2IJRA 3CCZA 3ZNJ1 5DDOC 1FNOA 2W8KA 1S9GB 3UD5A 2XY6A 2AU0A 4MU0A 5ETMA 1HPZA 3OFGA 4K4VA 2CDRB 3BBCA 3KKFA 4P71A 4DUZF 2LA4A 3LANA 2D3O1 2BV3A 4G6VB 4PG6A 2IDEA 3VTIA 4CM2A 1U48A 4ER8A 5A2QC 1EP4A 2CNLB 2DNQA 3BZQA 1DAXA 4Q8FA 3ZTQA 3DD6A 4R5PB 2UXBJ 4JG4A 4IDKB 4Q7AA 4DL6A 2UV8A 2UUBJ 4F0HA 1HPZB 2VV5A 2GFFA 2E7XA 1T02A 3QGIA 2R7OA 2XMTA 4YY3I 5E41A 2HVZA 1R0CB 2ZVIA 1MU5A 1VK8A 1S1XB 2M7SA 4YEAA 2C22A 2VQFF 3HDSA 3DOLB 3M05A 4Z37A 1M5OC 4DR1E 2JLFA 2DBBA 2KRBA 3F73A 4FS2A 1S1TA 3V81B 5D4PA 5J2PB 1LK5A 2VC0A 2FJBB 3OFFA 3N5BA 1RCOB 4USUA 2HPUA 4ED3A 2JEGA 1XNQJ 1IBMJ 2IBKA 1NK5A 4GC7A 1RWVB 1KVJA 2Q1LA 2CG9A 5E3RA 2OPQB 4JV1A 4HDGA 4J9LA 3DRSA 4YDXA 4DL4A 1I94F 2XSFA 4FN5A 3EICA 4P52A 1DQAA 3ENWA 5T7LB 4QCLA 3A3NB 3EVWA 2RU3A 1U25A 1BQNA 1S72S 2HGLA 3D4JA 2CPDA 3GYNA 4DX7A 1NRKA 2CQHA 4P10A 1RB0A 5A8WA 1NK6A 1T94A 1W2IA 3NEKA 2DNOA 2NXEA 1RAHB 4ZVPB 4KC5A 4OYWA 5F41A 2E9ZA 1HL6A 2JZ5A 3AJ1A 1WKLA 2D1CA 3AB4B 1KD1T 4FKXA 4ZCLA 2GNKA 2QLJB 3NOGA 3R7BB 4ZPBA 3HFKA 4DQPA 1VC0A 4LF4I 1FK9B 1RISA 3MMAB 2ROPA 5FIIA 3Q0AA 4A8MP 4NYPA 2WNRA 1OYEA 3MR7A 4H4MA 4JI5E 1T9YA 3ETOA 5H1SV 1WORA 2VD3A 4ED1A 3EX7B 3P3DA 4UUWA 3I96A 1FKAE 4CDIA 2H9ZA 1AFJA 3UCZP 1RT3B 1M0SA 1SJRA 4ZPCA 4J9MA 4MDTA 5DQIA 5MLCV 4P72A 1U1LA 2UXCF 5FD1A 1XMOF 2F9JA 3R2CJ 3HVAA 3KNAA 1RT4A 2K8GA 2P8IA 3JSRA 3Q8VA 4OJHA 3SV4A 5HP1A 4KIAA 2WZ1A 3M2RB 2WOMA 4YR3A 2UXDE 1LW0B 2YPYA 4B3SI 3MM6A 1RJJA 2CQ0A 2VJUA 2LDIA 3RBXA 4B08A 3J81C 2LXIA 1SJFA 4JI8J 3MMCA 2C38B 1KLNA 3AXKA 3KJVA 1U1NA 1LW0A 1FDBA 4IYQA 2NXJA 4LF7J 3OR2A 4O0NA 4WUDA 2J76E 1NHKL 1U6FA 2RU9A 2HAIA 2YX7A 4EZ6A 2BJ3A 2HRTA 3U1MA 3VAJA 1MN7A 1RT3A 4NEYA 5C25B 4FYYB 5JXSA 4RBTA 1HMVA 2XULA 1VOMA 4F4KA 1WEXA 2PFFB 1XMOI 5ELWA 5LSRA 2HS0A 3IBWA 1R27B 5CCLA 2FDNA 4KRWA 4Y3CA 1XR6A 1LXNA 2OELA 4DV6I 1HK7A 4HTIA 4X62J 2V9WA 1W26A 1TKZB 1KOHA 4H54A 1RTIB 4DDFA 1JNZB 5IV4A 4DN0A 3P49B 1FNMA 2P9EA 4F2RA 1JKHB 3J7A1 5HP1B 2IC3B 4X4VA 1BWEA 3B8HA 1SIWB 1UPMB 4Q8EA 1RWXB 4IUFA 3VV2B 1HR0J 5A0YB 4ZJLA 2XGPA 3FBBA 1MSWD 1YJ9S 2HBZB 1FRJA 1CJTB 1X0FA 3GYXB 4ZCKA 3NP5A 2IMWP 3S6EA 4RW4A 1N34E 2CA9A 1C0UB 2HQ3A 3DM2A 4GO5X 5DRKA 1K1QA 2ZH3A 1FTCA 2E5LJ 2K06A 3B78A 4NA3A 2ZUAA 3BS9A 2HS4A 5B0FA 3M1VB 2R7RA 3DRRB 4DV2E 2BJDA 2PGCA 3BPDA 1AROP 2XMUA 2I8EA 1KWMA 3HD1A 1RI7A 3T1HJ 2CUYA 5J2NA 2IM3A 5LL6d 3GPAA 2ZBKB 4LFAE 3NG8A 1RBAA 4TKTA 2RRNA 2F4VI 3Q22A 1QSYA 2WK4A 3BGFA 4OLOA 2JRSA 3G4SS 3IS9A 4IH7A 3GIJA 3NS5A 4ZPWR 4DUYI 3K2YA 2GVZB 1IWAA 2DRDA 4K5SA 3VGTA 2J65A 2VFTA 1BHNA 2UUBE 1YLXA 1RTHA 3J80Y 4LSNB 4MIWA 4NZ6A 2X7IA 3PACA 4TQSA 1PG5B 1HD0A 4FNHA 4X4RA 2DPIA 5U47A 3I9ZA 3I9V9 2QJ3A 2IBOA 3JTOA 4ZPTR 3SBMA 4Y34A 7FDRA 1UTAA 3PRDA 8ATCB 2J0XA 4KTQA 3GQCA 2I5JB 1UVMA 4X4NA 1HKAA 5DZ6A 2Q2EB 3HT3A 4DR4F 2RDDA 3TW0A 3D3BJ 3CD5A 2JEIA 4IDKA 4QIVA 5A8KA 2YNGA 4PQUA 2FZKB 2DR5A 4GKJE 4WZQA 4K4UA 1SKRA 2VKRA 4LSLB 1FJ7A 1HNIB 1QVGR 2HZVA 3OXGA 3IN5A 1LWCA 2MHEA 4I2QA 4M5HA 3RB3A 1K73T 4OHYA 4FW4A 4L3NA 3IR7B 3PR5B 3K0JA 1Q8LA 2OTJS 4DS5A 3KNGA 2QL9B 2DYAA 3BF4A 3SCLE 3OSNA 3OLBA 3H40A 4N41A 3CPWR 5E3AA 3Q89A 3MXHP 2LQ9A 5B0AA 4RZRA 1RHYA 3HXMA 2KHDA 5IWAE 3FSXA 2VONA 4WZMA 4DV2F 1HI0P 3CWVA 4DR6I 1RHKB 4OI1A 1GX5A 3JSMA 4KAIA 4ZS6A 3UQSA 1ITPA 1Y3JA 4YS2A 3DI6B 5E3PA 2EFPA 1HIYA 3QIPB 4AM3A 3LQVA 2HK3A 3D6TB 1FWPA 3TUZC 2XO7A 4F02A 1D09B 4DR2J 2C2MB 4J9RA 2OI2A 3FCWA 4ZN3A 5A2QY 3D1OA 3W9HA 5F8GA 5F8MA 1HNXF 4KGVB 4ECQA 2FQQB 5IT0A 4WTYA 3E3XA 5HAOA 3UD3P 2AGOA 2JL9A 3G82B 4ZCIA 1S99A 9RUBA 3AODA 4FW7A 4I6WA 1U2RA 3CCJS 1P6TA 1TL7A 2CPXA 1KDNA 1Q5YA 2L3MA 4DPWA 2DEIA 2VOOA 2JEBA 5EL9A 3LO3A 3PJXA 1PO6A 1MROB 2CJBA 1PCAA 3MCMA 3K8VA 3QWPA 3QYYA 4C8NA 3DLHA 2VQEI 5G4DA 3IM9A 1I6JA 5EN1A 1V5VA 4DQSA 2KFZA 1XNRF 4CLZA 3K5NA 4OI4A 2HHHI 2DKOB 2R2SA 2DRBA 4LF5I 4DV0I 4KV8B 4OZ0A 3ZZYA 1FNXH 1DFDA 2F65A 3MM5B 4WFBQ 5G0RB 2N7YA 1KSPA 5GMKa 4QYRA 5LMUJ 1S9FA 2XBPA 3EGVA 2A6MA 4NLOA 2M9KA 4WFYA 3OTCA 3SQGB 3VR1A 1TL1B 4F26A 1F3VA 3G8SA 4NRUA 1SH3A 4WUCA 1VI7A 1KOOA 1B62A 1N32F 2BM0A 3HULA 4KSEB 1S7HA 1GTEA 3DMJA 1O0PA 4C0OC 2VG5B 1GMWA 1JXLA 5I3QA 4N76A 3CEDA 4O44A 4PWDA 1M5HA 3KHRA 2VFSA 4JBCA 1QD1A 2C3UA 4L75A 4WK3A 1IN0A 1RTJA 2HIYA 1KLMA 3QBCA 1J27A 5JUMA 1OSCA 5C42A 4DG1A 5KOXA 2BE7D 3T41A 3HPOA 4K0KJ 4M5DB 2QN6B 4X64F 3JTNA 5C42B 1XMQJ 4ZVIA 4RW8B 1U09A 2DNPA 4ZVOB 1R0AB 2HQGA 3KJFB 4AYBD 4MU3A 2UXBE 1KLMB 3LP0A 1TL3A 2DNKA 4DXLA 1BWVA 1ROFA 2UU9E 4U8YA 2GC8A 2L9NA 2P9GA 4CLKA 4DL0C 2QC3A 3HSZA 2MQPA 2CGEA 3C15A 2BE2A 1H7XA 1YVFA 1RAIB 4N8OA 1FCAA 1S1UA 2RHSB 2QFIA 4HDHA 1SV5A 3K5PA 1RKJA 4C8LA 3T9NA 4Y28C 2KZZA 3MPDA 3HVTB 3QAUA 5DNXA 2IA6A 3CW2C 2GO8A 3GZ7A 3PYGA 3UVJB 1BD6A 4DPYA 2KVQE 4DV1J 4R8UB 3HO1A 2J0WA 2LXFA 1ZM9A 4J9VA 4RW6B 1VHFA 5KT6A 1C0TB 3OUYA 1UVKA 3TWZA 1Q81T 1FVSA 2JWNA 2WB4A 3MCOA 5CYMA 1S1VB 5FLXQ 2MSTA 5RUBA 2DR9A 2AHOB 1NB7A 2O1UA 2MQQA 2WRMA 3P6YC 1RBOB 1VQ6S 1N33E 1GXTA 3QSYB 5F8IA 2RB7A 2X36A 1X4HA 2BA9A 2Z5BB 3V4IA 2YKQA 2HLTA 4ERDA 4LF5J 2LU1A 1F5AA 1I1GA 3C6TB 5HROA 4FYDA 2J6TA 2VG7A 1GTHA 4CH7A 3AOAA 1B4SA 5G0RA 2VUGA 2Q6CA 4CLLA 2BYCA 2Z58B 4USTA 2XMKA 4HY1A 1YKWA 2CJYB 4K4WA 1K44A 5K36F 1ZA1B 2E1MC 2FHKA 1EHWA 3M7NG 2J7KA 2NCKL 1TVRB 4DCPB 4URLA 3N9UC 3QIPA 2LEBA 4D3HA 1YSJA 1YJNS 2HRYA 3KLVA 1SC3B 2QE5A 2C39A 1RWWB 1I94E 2W2PP 3R5AA 4IG0B 2HSEB 3EDRB 4DFMA 3G6XA 1MMLA 2W2QP 1JWWA 3WU4A 1QAXA 1IBKE 1Y7PA 3BPSP 3RW6A 1JB0C 2HBRB 3ADAC 1JIHA 4OZ3A 1N34I 1CC8A 1OS5A 2GAGC 4DUYJ 1B63A 1WUUA 1HQUB 2IMOA 3US5A 2QGFB 2VPYB 4DHVA 1RSCA 3THPA 3W9IA 5HMYA 4KO0B 2BW2A 4ECUA 4UQGA 1R6MA 2C37A 2LLZA 3TI0A 2VICA 2JE6B 5DQHA 4M5GA 2PN6A 4B17A 2KJVA 1T0TV 3BR9A 3AOBA 4M5JA 1IBKJ 4IR1A 4CO0A 4P74A 2UUAI 2FGOA 3DI6A 4DOZA 4ZIVA 4K0KF 1IBMF 2XWXA 3BBFA 4DN9A 1CULA 5DRRA 4USMA 1N36F 1HA1A 3RG6A 4QU7A 4U7CA 1HBNA 2E1PA 3UDLA 2Z2YB 3LWMA 4UW2A 3ETMA 2A6OA 4EEYA 4K8RA 2XM3A 1RT7B 5C0XC 1JMTA 2A0FB 2DCUB 3CDEA 4QIFA 5F0UA 3SCKE 4EO6A 4F4ZA 4FYVB 4OHWA 1N34F 1KEKA 4X4TA 3UO0A 1U24A 4L73A 4U8VA 2D3OR 1PAEX 1W25A 2Z4PA 1S4FA 3OL9A 2E5JA 2WVCA 1KKHA 3L95X 1KTVA 3VQSA 5D6GA 2E44A 1X8DA 1X4CA 2UV8G 5A8RB 2Z2ZA 5BJRA 2YNGB 2BQUA 1WEYA 4PQUB 4RNNA 1SL1A 1UZHA 3B4DA 5D15A 2NN6F 3WU3A 1WKJA 2FZGB 3M8QB 4DR7E 1QAYA 2V4JA 1FKAF 5A2QU 2UUAF 1A6FA 2DO0A 2YKNA 2MKHA 2VODA 3L7ZA 2CQ3A 1RBLA 4LF4E 2ZC3A 4LQ9A 2DGTA 4ETXA 2UZAA 5KFQA 1OWXA 4PWDB 1I5OB 2KKHA 1ICEB 1R8BA 3AB2B 4UQTA 2MLYA 1RT6B 2WCXA 3PJ9A 3SEOA 4QPXA 1X9WA 3W7BA 3A4TA 3M1VA 4WK1A 3TOQA 2HFUA 1ZS6A 5L1JA 4I67A 1WC5A 1CS4B 3FCHA 3GWCA 4LSNA 4CNZA 5ETVA 3OVSA 5LMUF 1F9EB 1VQLS 4HTJA 3R6LB 3RU0A 2VFVA 3GIRA 4YMEA 2PDAA 4C8ZA 1Y4SA 1E3PA 2M0GB 5IWAI 1LWXA 1L3KA 3ELHA 2DO4A 2VBYA 2RILA 4Z2XA 5LSLA 4P73A 3GIKA 2AD9A 4H4KC 4IOCQ 2M3DA 3D28A 4ID5B 4J9PA 2GX8A 1KFDA 3D6MB 3HMJG 5GADI 4RUAA 4B02A 2OPRB 3EMTA 4FF2A 1ZBTA 3ZM7A 2YWWA 3ZZRA 1HR0I 2EEYA 2WSFC 2XMJA 4RL1A 1T05B 2B43A 3PO4A 3DRRA 2HURA 1RAFB 2MGZB 2KM8C 1UDQA 4IFYA 3DOKA 1QUPA 4MKVA 4Z7CA 1V3ZA 3R27A 3AQOA 2HHHJ 2AYGA 3PW7A 4AQYI 2KB2A 1J2VA 2E5GA 1FWKA 1RADB 2V2QA 2J9CA 3C46A 4G65A 4LQ3A 1Q0NA 1RWKB 1UCNA 3RTVA 3K8WA 3J7YU 2COLA 4F4XA 3SQOP 1X9MA 5HQMA 3M85G 4NLUA 1DRZA 5C25A 1U0SA 5F3TA 4CYUB 2GIQA 2ZVSA 1GQEA 3LGMA 1NDPA 2ZOGA 4LBIA 1SUQB 5CAAA 3DOMA 3VALA 1VRUB 3FEZA 1SI9A 1WTFA 4GVBA 3MM8A 4LRCA 4MTPA 4CTAB 2HQCA 4GKJF 1NK4A 2ZZTA 2AX0A 3EGZA 1VRTB 4C3LA 5EGYA 5DO2A 3ITHB 4C3MA 1JJ2R 5KFFA 1OY6A 3CCVS 4B3MF 5E2QA 2IM1A 1Z0BA 4V1Ak 4FF3A 4OYBA 3V6KA 1Q7YT 1BQXA 4ZITA 2X1GA 4ENOA 1RLCL 2W8LA 1KVIA 1WC6A 1Q78A 1RWMB 4Y2AA 3RGIA 3W9JA 4O4RA 1U2FA 2OIHA 1GMVA 4NXNI 3OHBA 3EE3A 1YGYA 3HX9A 3BYPA 3G8QA 4XDCA 4I64A 3J81j 4OZEA 3C19A 1SC6A 4JI1F 3TZZA 5LMNI 2FPHX 3HFVA 1WHVA 1FJGJ 2IRUA 3OXFA 4FDFA 1KVKA 1HYSB 4MK7A 4AL5A 1JLEB 3ISNC 4NA1A 3AHPA 5IOLA 1VQMS 1W2BR 4EZ9A 4DR4I 4F4WA 5LXYA 5I4MA 1DHMA 1OQ3A 3L09A 5D8HB 5C0XD 4TVAB 1IKWB 4O3PA 1UFLA 1Z0WA 2HFSA 5GAHU 2HYIB 2XLJA 9ATCB 2VU5A 1LNQA 3DKDA 2FB0A 1I94I 4WIIA 1VQOS 3L4BC 2QMXA 3POTA 1WDDA 2QV6A 1S12A 2G0CA 1VJQA 3H7HB 4P7AA 1R8AA 2AYBA 2D9OA 4PG4A 3R7SB 3ZO7A 3G6ES 2NUUG 3D54A 4JI0F 4WCEQ 3HI9A 4YHHF 2BDPA 1QAIA 1NZ8A 3MTJA 1Q5VA 4IRKA 2Y0SD 4MT1A 1IBLF 1EIYB 3MEDA 2HHUA 1REVB 1P8GA 1YK9A 2YQ1A 3BH7B 3CJ2A 4USIA 1P27B 2XYPB 4HYKA 1UDOA 5FWKA 2YVSA 3CJTA 3MI7X 2R7UA 2JJ4D 2DIUA 2DITA 2CJQA 3DRXA 3H25A 2A1BA 2ZHBA 3DLJA 2J6SA 2MZTA 4OJ1A 2UXBF 3H5XA 1NHHA 4DR2I 3HJVA 2RAQA 1WI6A 2FJVA 1FRIA 3LALA 2IOQA 2DNGA 4HHUA 4EFAC 1C2PA 1DJ0A 3UN2A 4DSFA 4PYAA 4I3HA 3M2VA 4OX9J 1MWYA 3PS3A 1IBKF 4JI4I 4JI5J 4M63A 2Z5BA 3D2WA 5LT5A 1S48A 5F9LA 1TAUA 1IKWA 4CLYA 1ZYQA 1KFSA 3DLLQ 1CJUB 3DRSB 1AXQA 1HNIA 3QJLA 3JAMQ 5DDQC 4CTAA 1ZAVA 2H48B 4B3SF 1JLCB 2EG2A 4GVBB 4GVLA 3OFEA 3L7PA 2CPYA 1FKPB 3D7SB 2FHJD 3HCXA 4OZNA 1DY3A 1N48A 1VDHA 4OI6A 1S1TB 2IAJB 3V81A 4YUDA 4I68A 4NL5A 2Z56B 1B0VA 1M5VC 2B4PA 2CPEA 2BR0A 4X65J 2Q6BA 3KLFA 2VKZG 2CQPA 2MKJA 3H8YA 2G13A 2DGVA 3U27A 1NH7A 3A13A 4DCOB 5B0BA 1YJWS 3IRXB 4KE5A 5F9NA 1R3NA 1JXVA 3KMQA 4ZJOA 1L3SA 4R5PA 3DOKB 3WX4A 1QE1A 4OYPA 4JI4F 2MGZA 2PNZB 4AQYE 3OHAA 1FJEB 4JOUA 3DGVA 3NGKA 2UP1A 1KHVA 2HEKA 2KVIA 4EWTA 4P2SA 4U96A 1VC6A 1URNA 4KGXB 5LMNE 1X60A 4DV6F 3UCUP 4WPAA 3C8YA 3LP0B 3SSSA 4E8UA 2FLNA 1VMBA 2ZEJA 1R0AA 4LSZB 3NRBA 1U6BA 2PSZA 4CLTA 1RT5B 4DV0E 5DRPA 2KXHA 1UFKA 1Y0HA 1X4AA 4OZ5A 1XMQI 1B70B 4QPTA 2FVCA 2HVIA 2C3YA 1SVDA 2ACYA 4I1TA 1GAOA 2N3OA 1Q8BA 5C2CA 2W7OA 2R7WA 1IBKI 1NCLA 4X4QA 5J2MB 1N5YA 3QT6A 5JVGQ 3C16B 2XSJA 5IC4B 3GR0A 1DQ8A 3TEHB 3DMJB 3OTEA 4FXDA 4YN3B 2O1VA 4LRDA 3G6YA 2OEKA 1T9TA 2RDIA 1FF2A 4B3TJ 4CZCA 2AZ1A 1EA6A 2JEAB 2BA0G 4C11B 1UDNA 4DV5I 3R7NB 2M88A 4DPUA 5HVGA 2UXDI 3QZ7A 1TUWA 3DCAA 1Q4RA 3ILOA 4PXEA 2RQ4A 2V50A 1SQGA 3V2UC 2V8DA 3ENVA 5HVFA 3MFIA 2ZM6J 1N0VC 3GE9A 4OJ3A 4NI2B 5GMDA 3BEGB 1YBTA 5CZXA 5K8MA 4AQYJ 4ELTA 3QT7A 3H59A 1KHWA 1WG5A 3NGTA 4PYDA 2MQNA 4QZVB 5KFTA 2ZKUA 4EO8A 4XPCA 2AEMA 2NSBA 3HHLA 2ZH9A 4FS1A 5CYQB 1LW2B 1TQLA 2F63A 4ELVA 4B3OB 1FX2A 3BGRB 3AH6A 4X64J 2NN6C 3M6WA 2A18A 3J7AG 4KJIA 4UOHA 2V2VA 1EETA 2O3DA 3IA0A 4A8KA 1SL0A 3K85A 3IRWP 3VAHA 3TZWA 3CC7S 2HWTA 5KFIA 4RNFA 4LF8E 4NCGA 1NXIA 2V94A 1OY8A 4KH1B 4X66J 3HZGA 4KPYA 1UDSA 1Y4UA 4DV3I 2OSQA 3AD8C 2C2DA 5A6PA 1JLGA 3OTOI 2XEXA 3EJMA 3FBFA 3EZ5A 2BRKA 2QYGA 3AA9A 2AMCB 3K17A 3P5TL 2ADCA 2C38A 4IFDC 2HGNA 1RHQB 1I94J 3PZPA 2FVSA 2WHOA 3H5UA 4UF4A 5GAGU 1LWEB 2YXLA 4C0BA 1IR1A 2MKSA 3IWNC 3PW2A 1YBAA 5J2QB 1VQ9S 1KBRA 1LV5A 2M4MA 2RS8A 3DRYA 1VJWA 1HWLA 3T1YJ 2BJEA 3QJPA 1A7GE 3R5JB 3IG1A 2D41A 2RSQA 4ZVRB 4W90B 1RAOA 1SBRA 2O1PA 1PJ5A 3EPIA 4NA2A 3V6JA 3PV8A 3EXYA 2O5DA 3Q8UA 1S79A 1GT8A 2HQFA 3CD7A 3MMBB 4LVNP 4XTTA 5HI7A 3RAXA 2CZ4A 5HJXA 1J5EE 4JYAF 3LTOA 4OZJA 3W2WB 4M5NA 2C37B 1BQMB 5BR8J 4WXWA 3THVA 4LIWA 2YQ3A 3R97A 1Q7LB 2N4DA 3OXLA 4ID8A 3EGNA 1CEZA 1XXEA 1Q1KA 2PEHA 3UI3A 2G2YA 3RRKA 3SZ2A 5IM0A 1NKCA 1FJGI 2DGUA 4DU7A 4HACB 1HNXI 1R6YA 3NGRA 5KFYA 4U9RA 2XYGB 4L74A 4NMLA 2CAJA 1X5PA 2PNLA 2UUCE 3R3TA 1A9NB 1GMUA 2BANA 4FBUA 4LFCI 4HHHA 5KFEA 3JS9A 4TY9A 4X4OA 2HHQA 5DG9A 1VCTA 1GXUA 2AE8A 5LXRA 4RW6A 2FD2A 4CLPA 2JSXA 2OD6A 2M5YA 2BANB 2O66A 1ZM2A 1WELA 2E1AA 1RHMB 1SPBP 4CO4A 5F8LA 1PC4A 4NWBA 1VQ4S 2C2ZB 3TRGA 1IJFB 3TZYA 4QWEA 1WWHA 2J9EA 4OHVA 3S01A 4HYMA 1SC1B 1I51B 2GHVC 3DDNA 5K8NA 4J9QA 3V4IB 4C48A 4LT6A 4U7UD 4BWJA 5J2NB 2KI2A 4XK8C 1Y00A 2OEMA 1MX0A 4N77A 4DV7E 3PHTA 2F4FA 1TKTA 3JTPA 4OI3A 1P42A 4MJKA 3IC1A 2EFNA 1SKWA 4JI6I 3CF5Q 4YR0A 5LMNJ 1ZTTA 3QO9A 1VYAA 5HBMA 3LUYA 4C7QA 3I4PA 2VIHA 5IT4A 2AGQA 2OJ3A 1CJTA 4DZ6A 4NXMI 1R7IA 2PEBA 1S6PA 2O1WA 3DDKA 3UVJA 1WSRA 3IAS9 1IBLE 3PEJA 1YZ6A 2LA6A 2HFOA 4RWXA 4J9KA 3W5ZA 4FW6A 1Q86T 4JI5I 3VAFA 1OYRA 2CVIA 3NWGA 1LFPA 2OLWA 4OYOA 4YB6A 3M32B 4IFVA 5M2UA 1QSLA 3X1LB 3FZ2A 1HWKA 3I6PA 1Q8KA 3IM8A 2G0IA 2ZDOA 3JQKA 3KLIA 3NGUA 4NLYA 4TU7A 1XMBA 1TKZA 2VG5A 4ATNA 3PW4A 1YQHA 3ENAA 2IJFA 4PXDA 4DX8H 4Y0FA 2KG0A 1GEHA 1UP1A 1N54B 3GV7B 2HMIA 5FJ4A 5CH7B 3U1KA 4X62I 2HNDB 1H72C 3AT1B 3ZZPA 1TL1A 3GIIA 3DXSX 2DPJA 2CPZA 3GCWP 5L3JA 1I3OB 3ZFVA 2XZTB 2DXDA 3J7AN 4QWBA 2KZMA 1VIXA 2XCPA 4N5SA 1NBEB 1NAQA 2RQKA 2WVFA 1U49A 1LOUA 1O51A 1P1TA 4B3MJ 3TA1A 5F8JA 3BKTA 4YR2A 4NMXA 1PBAA
chains in the Genus database with same CATH topology
3V5RA 1Z0CA 2HK3A 4JI3I 4GKJI 4DUZE 2OI2A 1ZXMA 2V34A 1RR9A 2IOPA 1U2RA 1IBKE 4DPWA 1XNQI 2DEIA 1S16A 2VQEI 4DV2I 4JI1I 3J81Q 4DR6E 3OTOI 4FWGA 4B3TI 2HHHI 1Z0VA 4LF5I 4DV0I 4DR1I 2F4VE 4JI1E 3OTOE 4FWHA 4JI6I 1Y6ZA 2ZM6I 3JAMQ 1ZM4A 4B3TE 2UU9I 3PYFA 4WUCA 3F0NA 3LPSA 2UXCI 1B62A 4WUBA 3HULA 2BM0A 3M6AA 3ZZ0A 1XNQE 1BKNA 1XNRI 2ZITA 4DV7I 4LFCE 4UTGA 4K0KI 2NPFA 4DV1I 4ZVIA 2UXBE 4DR5E 3ZKDA 5L3JA 1OJ4A 4DXLA 2UU9E 3T1HE 1HNZE 4DPXA 4IZJB 4DV1E 2CGEA 4DR3E 2EFGA 4JI2E 3T1YI 1NZ0A 1RREA 1XHKA 3PYGA 4DPYA 2HK2A 1ZM9A 2Z5EA 5FLXQ 4X64E 2O1UA 3ZKBA 1N33E 4DV3E 4B3RI 3H4LA 2X36A 4FW9A 2Z5BB 4JI4E 4JI0I 4YHHI 2Z5CA 4HY1A 4JI8I 2A2CA 2J7KA 4URLA 1N36I 1H7UA 1I94E 2GS8A 4JI8E 3WU4A 1K47A 5A2QQ 1N34I 1B63A 1WUUA 5LMNI 4LF9I 1FJGE 1DARA 1EI1A 2UUAI 2VQFE 2UUBI 4DU8A 4USMA 4NXME 4MYUA 4AQYE 1PVGA 1H73A 2GQ0A 1KKHA 1KTVA 4R1FA 4DR5I 4HXZA 3WU3A 4DR7E 1IBME 4LF6I 1A6FA 1FWLA 3B82A 4DV4I 4LF4E 1N0UA 2E1RA 3T1YE 4PU9A 4AQYI 4LF6E 3PYDA 2HFUA 1ZM3A 1MG7A 4LF7E 3Q6NA 1Y4SA 3WU6A 1Z0TA 3ZZTA 5IWAI 5BR8I 1D6TA 4USKA 3Q6MA 1J5EI 4DR3I 4LFAE 5GMEA 4DR2E 3ZM7A 1HR0I 1FI4A 4Z7CA 4X66E 1Z59A 1FWKA 2V2QA 4JI7E 4LF7I 4N3OA 3JAMC 1Z5CA 2E5LE 4PRXA 4JI6E 2DEJA 3QT5A 3LNUA 2O1TA 4LF5E 1HNXE 4IZKA 2PNMA 1HR0E 1Z0BA 1Z0EA 1USVA 1N36E 4LF9E 3ZZUA 4Z7YA 5LMUE 2LJPA 1KVKA 4DR4I 4DV5E 4KHPI 1XNRE 2UXBI 1Z0WA 2HFSA 4DUYE 5IT9C 4M1KA 4ED4A 4DR4E 1PIEA 2HKJA 1N32I 2R3VA 3T1HI 3WU5A 4P7AA 2UUAE 4DPTA 3P06A 4B3MI 4DR7I 4MYTA 4RPFA 1USUA 2R42A 5IT9Q 5FWKA 4GKKI 2A2DA 4X65E 4JYAE 1NHHA 4KQVA 1HNWE 4LFAI 4DR2I 2IOQA 1HNZI 4I3HA 2Z5CB 4PRVA 4JI4I 1H7SA 3J7AM 2Z5BA 1N33I 4JV5E 4JI7I 4IZKB 4IZJA 2UUCI 5LL6R 4GKKE 1NHJA 3HJCA 3GONA 3J80Q 1I94I 1IBKI 2BV3A 3PRYA 5A2QC 5FLXC 1UEKA 1XMOE 4JG4A 5LMNE 1VISA 1XMQE 4DV6E 4YY3I 2UUCE 1MU5A 4IZJD 4DV0E 4DR1E 1XMQI 3Q1QA 2WW4A 3QT6A 2CG9A 2ZM6E 3QT8A 1ZXNA 4P52A 2O1VA 4FN5A 4LF8I 1N32E 4HACA 1EA6A 3D4JA 4EMDA 4DV5I 2UXDI 4DPUA 4KHPE 4B3SE 3V2UC 1S4EA 1N0VC 5GMDA 4YY3E 2VQFI 4DV4E 4LF4I 3QT7A 1NHIA 4NXNI 4LFBE 4JI5E 1IBMI 4XTJA 4K0KE 3J7AG 2V2VA 3K85A 2BM1A 4LF8E 1Y4UA 2CZ9A 4DV3I 4X65I 4JYAI 2UXDE 4OX9E 4B3SI 4JI2I 2XEXA 1PKPA 3K17A 3J81C 2V8PA 1QZRA 2AJ4A 4OX9I 4NXNE 4X64I 1KIJA 4WUDA 3J80C 4DUZI 4X66I 1XMOI 4B3RE 1J5EE 2E5LI 3LTOA 4DV6I 1HK7A 1FNMA 2VQEE 3B8HA 1Z0GA 1FJGI 4FWDA 1HNXI 4DU7A 4HACB 3K1JA 2PNLA 3PYEA 4LFCI 4UT4A 1N34E 3B78A 1IBLI 4DV2E 2UXCE 1ZM2A 4HYMA 2HKEA 2ZBKB 2F4VI 1MX0A 4DV7E 4DUYI 1FKAE 1Z5BA 2UUBE 2V2ZA 2X7IA 4NXMI 5LMUI 2O1WA 1IBLE 1ELOA 4B3ME 4LFBI 4JI5I 2Q2EB 1H74A 5BR8E 4X62E 4JI3E 4GKJE 1HNWI 4YHHE 4JI0E 2VF3A 4X62I 1H72C 5IWAE 4JV5I 3CWVA 4DR6I 1Z5AA 2HHHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5R A;  1Z0C A;  2HK3 A;  4JI3 I;  4GKJ I;  4DUZ E;  2OI2 A;  1ZXM A;  2V34 A;  1RR9 A;  1U2R A;  1IBK E;  4DPW A;  1XNQ I;  2DEI A;  1S16 A;  2VQE I;  4DV2 I;  4JI1 I;  3J81 Q;  4DR6 E;  3OTO I;  4FWG A;  4B3T I;  2HHH I;  1Z0V A;  4LF5 I;  4DV0 I;  4DR1 I;  2F4V E;  4JI1 E;  3OTO E;  4FWH A;  4JI6 I;  2ZM6 I;  3JAM Q;  1ZM4 A;  4B3T E;  2UU9 I;  3PYF A;  4WUC A;  3F0N A;  3LPS A;  2UXC I;  1B62 A;  4WUB A;  3HUL A;  2BM0 A;  3M6A A;  3ZZ0 A;  1XNQ E;  1BKN A;  1XNR I;  2ZIT A;  4DV7 I;  4LFC E;  4UTG A;  4K0K I;  2NPF A;  4DV1 I;  4ZVI A;  2UXB E;  4DR5 E;  3ZKD A;  5L3J A;  1OJ4 A;  4DXL A;  2UU9 E;  3T1H E;  1HNZ E;  4DPX A;  4DV1 E;  4DR3 E;  2EFG A;  4JI2 E;  3T1Y I;  1NZ0 A;  1RRE A;  1XHK A;  3PYG A;  4DPY A;  2HK2 A;  1ZM9 A;  5FLX Q;  4X64 E;  3ZKB A;  1N33 E;  4DV3 E;  4B3R I;  3H4L A;  2X36 A;  4FW9 A;  4JI4 E;  4JI0 I;  4YHH I;  4HY1 A;  4JI8 I;  2A2C A;  2J7K A;  4URL A;  1N36 I;  1H7U A;  1I94 E;  2GS8 A;  4JI8 E;  3WU4 A;  1K47 A;  5A2Q Q;  1N34 I;  1B63 A;  1WUU A;  5LMN I;  4LF9 I;  1FJG E;  1DAR A;  1EI1 A;  2UUA I;  2VQF E;  2UUB I;  4DU8 A;  4USM A;  4NXM E;  4MYU A;  4AQY E;  1PVG A;  1H73 A;  1KKH A;  1KTV A;  4R1F A;  4DR5 I;  4HXZ A;  3WU3 A;  4DR7 E;  1IBM E;  4LF6 I;  1A6F A;  1FWL A;  3B82 A;  4DV4 I;  4LF4 E;  1N0U A;  2E1R A;  3T1Y E;  4PU9 A;  4AQY I;  4LF6 E;  3PYD A;  2HFU A;  1ZM3 A;  1MG7 A;  4LF7 E;  3WU6 A;  1Z0T A;  3ZZT A;  5IWA I;  5BR8 I;  1D6T A;  4USK A;  1J5E I;  4DR3 I;  4LFA E;  5GME A;  4DR2 E;  3ZM7 A;  1HR0 I;  1FI4 A;  4Z7C A;  4X66 E;  1Z59 A;  1FWK A;  2V2Q A;  4JI7 E;  4LF7 I;  3JAM C;  1Z5C A;  2E5L E;  4PRX A;  4JI6 E;  2DEJ A;  3QT5 A;  3LNU A;  4LF5 E;  1HNX E;  1HR0 E;  1Z0B A;  1Z0E A;  1N36 E;  4LF9 E;  3ZZU A;  4Z7Y A;  5LMU E;  2LJP A;  1KVK A;  4DR4 I;  4DV5 E;  4KHP I;  1XNR E;  2UXB I;  1Z0W A;  2HFS A;  4DUY E;  5IT9 C;  4M1K A;  4ED4 A;  4DR4 E;  1PIE A;  2HKJ A;  1N32 I;  2R3V A;  3T1H I;  3WU5 A;  4P7A A;  2UUA E;  4DPT A;  4B3M I;  4DR7 I;  4MYT A;  4RPF A;  2R42 A;  5IT9 Q;  4GKK I;  2A2D A;  4X65 E;  4JYA E;  1NHH A;  4KQV A;  1HNW E;  4LFA I;  4DR2 I;  1HNZ I;  4I3H A;  4PRV A;  4JI4 I;  1H7S A;  3J7A M;  1N33 I;  4JV5 E;  4JI7 I;  2UUC I;  5LL6 R;  4GKK E;  1NHJ A;  3GON A;  3J80 Q;  1I94 I;  1IBK I;  2BV3 A;  5A2Q C;  5FLX C;  1UEK A;  1XMO E;  4JG4 A;  5LMN E;  1VIS A;  1XMQ E;  4DV6 E;  4YY3 I;  2UUC E;  1MU5 A;  4DV0 E;  4DR1 E;  1XMQ I;  3Q1Q A;  2WW4 A;  3QT6 A;  2ZM6 E;  3QT8 A;  1N32 E;  1ZXN A;  4P52 A;  4FN5 A;  4LF8 I;  4HAC A;  1EA6 A;  3D4J A;  4EMD A;  4DV5 I;  2UXD I;  4DPU A;  4KHP E;  4B3S E;  3V2U C;  1S4E A;  1N0V C;  5GMD A;  4YY3 E;  2VQF I;  4DV4 E;  4LF4 I;  3QT7 A;  1NHI A;  4NXN I;  4LFB E;  4JI5 E;  1IBM I;  4XTJ A;  4K0K E;  3J7A G;  2V2V A;  2BM1 A;  4LF8 E;  2CZ9 A;  4DV3 I;  4X65 I;  4JYA I;  2UXD E;  4OX9 E;  4B3S I;  4JI2 I;  2XEX A;  1PKP A;  3K17 A;  3J81 C;  2V8P A;  1QZR A;  2AJ4 A;  4OX9 I;  4NXN E;  4X64 I;  1KIJ A;  4WUD A;  3J80 C;  4DUZ I;  4X66 I;  1XMO I;  4B3R E;  1J5E E;  2E5L I;  3LTO A;  4DV6 I;  1FNM A;  2VQE E;  3B8H A;  1Z0G A;  1FJG I;  4FWD A;  1HNX I;  4DU7 A;  4HAC B;  3K1J A;  3PYE A;  4LFC I;  4UT4 A;  1N34 E;  3B78 A;  1IBL I;  4DV2 E;  2UXC E;  1ZM2 A;  4HYM A;  2HKE A;  2ZBK B;  2F4V I;  1MX0 A;  4DV7 E;  4DUY I;  1FKA E;  1Z5B A;  2UUB E;  2V2Z A;  2X7I A;  4NXM I;  5LMU I;  1IBL E;  1ELO A;  4B3M E;  4LFB I;  4JI5 I;  2Q2E B;  1H74 A;  5BR8 E;  4X62 E;  4JI3 E;  4GKJ E;  1HNW I;  4YHH E;  4JI0 E;  2VF3 A;  4X62 I;  1H72 C;  5IWA E;  4JV5 I;  3CWV A;  4DR6 I;  1Z5A A;  2HHH E; 
#chains in the Genus database with same CATH topology
 3TQ1 A;  4I6Y A;  4PQA A;  1UL3 A;  2LP4 A;  1KQK A;  1Z0C A;  2R8H A;  4LCF A;  3MMC B;  2PA3 A;  1BXN A;  4JI6 F;  4QWD A;  4DUZ E;  2LVW A;  3CJ3 A;  4U7U K;  4PG5 A;  5CYJ A;  2FUG 9;  3BSO A;  3R1L A;  4X4U A;  1ZXM A;  4IH6 A;  1F5C A;  5C0X B;  3MOJ B;  2BOP A;  2IOP A;  4BLG A;  5E0O A;  2R7S A;  2B6A A;  4HI2 A;  1F2G A;  2YKM A;  1N56 A;  5C0X A;  3TAM A;  1IWG A;  4RW9 A;  2XNR A;  4JI7 F;  1ZAW A;  1AUS L;  2MQL A;  4M5K A;  4MK9 A;  3KLE B;  4EYH B;  3H1C A;  3J81 Q;  2CVE A;  2OP5 A;  3AOC A;  4OO1 E;  2DJW A;  5CYQ A;  2FGC A;  3M8R A;  3CO0 P;  2QG9 B;  1IKX A;  3ZTS A;  1A6L A;  4B3T I;  1VR6 A;  1J5E F;  2ALZ A;  1OYD A;  3U7J A;  1NLK L;  3HP6 A;  4DV5 J;  4QWA A;  3L7O A;  3M8Y A;  2FTR A;  2AYM A;  1NUE A;  1S6Q B;  3BYR A;  4C3K A;  1HR0 F;  2ZM6 I;  2ALY B;  3KRN A;  4X84 A;  2ZH4 A;  4B3T E;  2UU9 I;  5IZH A;  2FLP A;  1QTM A;  2HW3 A;  1S0N A;  1RHU B;  4KQZ A;  4K2X A;  1BQN B;  3UDV A;  4WUB A;  3G8T A;  5GAD U;  2QTW A;  1RK8 A;  1EX8 A;  3NOC A;  3PIO Q;  4LSL A;  3M6A A;  5ETL A;  4JI1 J;  3ISN D;  3T1Y F;  4YOE A;  1QE1 B;  2ZH2 A;  2RD5 C;  3MEG B;  2ERR A;  1UVL A;  5L46 A;  3T5J A;  2BQR A;  1NK9 A;  3M32 A;  2MKC A;  1FD2 A;  1BKN A;  2XZW A;  1CJV A;  3CJ5 A;  3CUN A;  2W25 A;  1M1H A;  4DWI A;  2ZIT A;  1YX2 A;  3MAA A;  4OL8 A;  3GLL A;  5D0R A;  2VBW A;  3UR0 A;  4DV3 J;  1WHX A;  1FXL A;  4K0K I;  3NL0 A;  1RZM A;  2DY1 A;  3W2V B;  4IH5 A;  5EWF A;  4DQR A;  2J7W A;  1H2T Z;  2NSC A;  1N52 B;  1LFW A;  2CNO B;  3EDQ B;  3GJR B;  4FXV A;  4ZMM A;  1OJ4 A;  4NPO A;  5FLX Y;  4B9T A;  4I2Q B;  4DR6 J;  1LWC B;  1KR4 A;  5H9F J;  2PO2 B;  3F41 A;  3GME A;  1HNZ E;  4V19 X;  1RT2 B;  3IR6 B;  3EXC X;  3KDO A;  2MQO A;  1FES A;  2XI3 A;  3TVZ A;  5KG7 A;  4LOM A;  4JI2 E;  2R2T A;  1DTQ A;  2DH9 A;  1U26 A;  1PYT A;  5L8R C;  1WHW A;  2F7V A;  3IRX A;  3JYT A;  1IM6 A;  5ETR A;  4RW7 A;  1YBU A;  3VAM A;  3T1Y I;  1RRE A;  1XHK A;  1YJV A;  2R4F A;  2L08 A;  3K5L A;  4ZKA A;  5C0X F;  1S49 A;  4I6A A;  3CCW A;  3N6M A;  3UDC A;  1LEO A;  5KFO A;  5L1K A;  3A3O B;  3GSI A;  2DGQ A;  2Z5E A;  1URR A;  1PIL A;  2OPP B;  3FDS A;  4CP5 A;  2R2U A;  2ZH6 A;  2HVE A;  3MEC A;  2DR7 A;  3ZKB A;  3C14 B;  1TKT B;  4CO3 A;  4UOG A;  5AE1 A;  4AQY F;  2YWG A;  4Q5V A;  5B0G A;  3CCM S;  2MJU A;  1Z2Z A;  5DQG A;  4B3R I;  1NO8 A;  4OLP A;  3JB9 k;  4CIO A;  2XG8 A;  4LF6 J;  3H4L A;  3LP1 A;  5LM7 E;  2OAU A;  4USV A;  3FVY A;  2V6A A;  2W9A A;  4JI4 E;  1NEE A;  5AT1 B;  1HQE A;  1HW9 A;  3M2V B;  5ETN A;  2XQC A;  2VFU A;  5JEA E;  1FXD A;  1Q95 G;  1WEZ A;  3POT B;  2V2K A;  4CH1 A;  1JKH A;  2F8E X;  2RT3 A;  3NY0 A;  1E6Y A;  4OYX A;  1UJ6 A;  3ET6 A;  4RWW A;  2B4U A;  3Q24 A;  1OMS A;  4CO2 A;  4FXW A;  1R6V A;  4TYA A;  3DLG A;  4I7F B;  4LF9 F;  3TJ8 A;  3V6D B;  2RIJ A;  1QDU B;  3J81 U;  2VAS A;  5KFC A;  2UVW A;  4LR7 A;  2CRL A;  1D1U A;  3U1Y A;  2F1D A;  2LEA A;  1BY9 A;  1U6Z A;  3AA8 A;  4IQM A;  4YP3 A;  1ZET A;  1K0T A;  2NQP A;  5KFA A;  2GS8 A;  2C2R A;  3T6J A;  2XI2 A;  3Q8Q B;  3MAQ A;  1VQ8 S;  1HD1 A;  3OQ2 A;  3T3F A;  2LDY A;  1VQN S;  1SQE A;  1GFW B;  4QJV A;  4UZC A;  3X3U A;  5B08 A;  2UXD J;  2RS2 A;  2WBM A;  3SI8 A;  2OO4 A;  5IT9 Y;  1ULR A;  4S0M A;  2GQQ A;  7AT1 B;  3NNC A;  2SXL A;  3FNN A;  1RTI A;  1N5T A;  2N4C A;  2XZD B;  3RB6 A;  4ZIW A;  4FP9 A;  4MK8 A;  2XB2 D;  1VK3 A;  3LP2 A;  2H5E A;  3OJS A;  2W9C B;  1D0E A;  4ED5 A;  2AJQ A;  2ROE A;  3CC2 S;  3MMB A;  3MM6 B;  4KB7 A;  2YNF B;  2B9Y A;  3RBZ A;  3RAQ A;  2CPH A;  2Y9H A;  4CWB A;  5H9F K;  4ZCM A;  1H3D A;  1X4G A;  2B4V A;  2KO1 A;  3BQ0 A;  2QEX S;  3VHQ A;  4C8O A;  1SKS A;  1VLO A;  1T3O A;  4J9S A;  2CJX B;  2C2K B;  2MDA A;  2W2N P;  3OR1 B;  4RR5 A;  1WTB A;  2BA0 D;  2B3T B;  4CYU A;  2MQ8 A;  1F3F A;  4QR2 A;  4MYU A;  4LBH A;  1GNK A;  3EZU A;  2LCW A;  4K4T A;  3DN9 A;  1IUJ A;  3HHD A;  4RBU A;  5L1I A;  1V3R A;  3DLE A;  3CD0 A;  1K9M T;  4RNM A;  1H73 A;  3JAM Y;  4U95 A;  4ZVU B;  2MZR A;  4JV2 A;  2BE9 B;  3K57 A;  4K4X A;  4P7V A;  1WD6 A;  2W9B B;  3ONQ A;  1TZ0 A;  2ZUG A;  4OO1 D;  2GQ0 A;  3LP2 B;  3FRY A;  1S7I A;  3BO4 A;  4R1F A;  4WBF A;  2OEJ A;  4LR8 A;  2D9P A;  2BUN A;  2F3J A;  4NLR A;  4CT8 A;  4JB8 B;  4PPD A;  3BSN A;  2QZ8 A;  4DR5 I;  2V67 A;  4D3G A;  5CXT A;  1IBM E;  1SC4 B;  3MUV P;  2PMH A;  3B82 A;  1FWL A;  4TXS A;  2MY8 A;  5A8W B;  1RYR A;  4AID A;  3CCU S;  3WIU A;  3J80 U;  3TUP A;  5AE3 A;  4Y6I A;  3HT0 A;  2V69 A;  1SKU B;  4B3O A;  1P1L A;  4URG A;  4F2S A;  4PU9 A;  3HHL B;  3SCJ E;  4DCJ B;  2I38 A;  2JFK A;  3PTW A;  1ZM3 A;  4WKY A;  3MMA A;  4WE1 A;  4LF7 E;  3PX4 A;  3A3P B;  3HSJ A;  3MWB A;  3I0S A;  3Q86 A;  4K7Q A;  4NYO A;  4ZVT B;  4DLE A;  2IFX A;  2NZC A;  2XTJ P;  4E2F B;  5KOW A;  4B9L A;  1FX4 A;  3N5F A;  4UOC A;  5BR8 I;  3UFC X;  3GSD A;  4PCQ A;  1YI2 S;  1AW0 A;  4WWS A;  2HVH A;  4R0E A;  3EZO A;  4I4B A;  3EUN A;  3H2V E;  4C11 A;  1V3S A;  5DLF A;  5HQ8 A;  2M52 A;  4F8R A;  2MHN A;  4HT7 A;  1NDK A;  3W1Y C;  1FJG F;  3K59 A;  4MKY A;  3C14 A;  3P45 B;  4F3Q A;  3CJ0 A;  3KMS A;  2NRE A;  3BV8 A;  4DS4 A;  2R8G A;  4GKK J;  2H1Y A;  4ES2 A;  1T8E A;  3A8I A;  1YRT A;  2B7B B;  4ZVF A;  4F0M A;  4Q43 A;  4ECR A;  2VDI A;  1O6X A;  4CLU A;  1NPK A;  1Z59 A;  4LFC F;  3M6U A;  3K5O A;  4HHJ A;  4QR1 A;  5CAB A;  3BSC A;  2OD4 A;  1CG2 A;  1S1X A;  2DH8 A;  5DS7 A;  2FC8 A;  1XWL A;  3H5S A;  4JYA E;  1Z5C A;  5F0W A;  4NX9 A;  3LH2 S;  2GW8 A;  1FKP A;  2OFH X;  2XHC A;  1OSD A;  4L6V 3;  3SYZ A;  5EHH A;  1DTQ B;  2DGX A;  3QT5 A;  4MKA A;  3HHN B;  4U3D A;  2Y8W A;  4KHP J;  4JI3 F;  3LNU A;  3KOA A;  4MU4 A;  3E01 B;  1HNX E;  3TYT A;  1CJU A;  3RZA A;  4JI3 J;  2NN6 E;  2MKI A;  5BYR A;  1RAJ A;  1VHI A;  5L38 A;  5CQG A;  1B0P A;  1SCJ B;  2ASL A;  1HQU A;  2FJW A;  2UVV A;  4IRC A;  3TNV A;  1RAB B;  3N4W A;  4HI1 A;  1N32 J;  4OYA A;  2C2N A;  2F8M A;  4A48 A;  1F5B A;  4BC7 A;  5KG2 A;  1YH8 A;  1USV A;  1TU0 B;  4LF9 E;  4EU0 A;  5F8H A;  2AF6 A;  3RR7 A;  1EQ0 A;  5ETO A;  3MEG A;  1X5S A;  4OYM A;  1JLC A;  3I4H X;  3OTB A;  4KYZ A;  4A47 A;  3OTO J;  1E6V A;  3R1H A;  2HHH F;  1H0H B;  1JK9 B;  3W3S A;  1JX4 A;  4EBE A;  2DGW A;  4FW5 A;  1X0P A;  1GXL A;  1S6U A;  2YWH A;  3H20 A;  5D0H A;  3PKM A;  1OPI A;  2KYZ A;  3CJQ A;  3TZX A;  3KLH B;  4ZA1 A;  3RW7 A;  4G3I A;  3I32 A;  1TP7 A;  3QQC D;  1L3U A;  1R8H A;  1KQG B;  1SJ1 A;  2HFZ A;  2PE8 A;  4QIW D;  2UUA E;  4DPT A;  1XBW A;  5HO4 A;  4A46 A;  3K7R A;  4ZJQ A;  3GIM A;  1O8B A;  4B3M I;  4MIA A;  2Z2M A;  4IG3 B;  4ZHR B;  5C0X E;  2OML A;  1YRU A;  1LKZ A;  2U1A A;  4RPF A;  4ZP9 A;  1VBK A;  4DR7 I;  3WBZ A;  1REV A;  1OYP A;  3DLK A;  3MED B;  1MMN A;  1S1V A;  1JLQ A;  3W65 A;  2ZNY A;  4LF8 J;  2B4O A;  2HHP A;  2DR6 A;  3KLE A;  1SH2 A;  1QAJ A;  2OPP A;  5HVH A;  2FJD B;  2GQC A;  4L72 B;  4DFK A;  1U1Q A;  4MQY A;  4NOH A;  4LFA I;  4DV1 F;  3OV7 A;  2MY7 A;  4LIR A;  3V4M A;  2WP8 A;  4CNY A;  4ED2 A;  1KRP A;  3CDU A;  1ZXN A;  2NXN A;  4JP8 A;  3IMQ J;  2NXC A;  3U1L A;  5LJ3 Y;  2ZH5 A;  4OKG A;  2HNZ B;  3WDO A;  4PRV A;  1XEZ A;  1HBM A;  2CJ9 A;  2DNN A;  3UN5 A;  3J7A M;  2DXF A;  4USH A;  4DZD A;  5IQ6 A;  3K58 A;  1S1U B;  2I6W A;  2NXU A;  3ICL A;  3OT9 A;  3VQT A;  3T1H F;  4MMO A;  4JI7 I;  2GHP A;  1NHV A;  3TX8 A;  5BYS A;  1MW7 A;  1UW9 A;  2LKZ A;  3C15 B;  4OFZ A;  1NK0 A;  3MM8 B;  3G96 A;  1FRK A;  2V5H G;  2WB1 D;  3Q2T C;  1TL3 B;  3G2X A;  4F36 A;  4AL6 A;  2DHX A;  3IXQ A;  3KHG A;  5K14 B;  5KG5 A;  2AGP A;  1X4D A;  1Y4Z B;  5E3Q A;  3HJC A;  4GKK E;  2YKO A;  5KG0 A;  2CDQ A;  3GON A;  3VVT A;  4PRF A;  1RA6 A;  1RU1 A;  4ZP8 A;  3CJK B;  5L39 A;  1ZTW A;  2EC2 A;  3HVT A;  2Y0B B;  2W4P A;  4Y2I A;  4DR6 F;  1KTQ A;  4U67 Q;  4YFU A;  1SV5 B;  1CJV B;  4QYZ K;  4DX6 A;  1KN6 A;  2J5A A;  2JVR A;  2IRY A;  3H42 A;  2K3K A;  2ZBC A;  4O44 B;  5BXI A;  1UEK A;  3HSD A;  4CLW A;  5K8P A;  4DR4 J;  4K4S A;  1N33 F;  3HD2 A;  2QA4 G;  3PS1 A;  1XMO E;  1RAC B;  1XNQ I;  1GMW D;  5K36 E;  5B09 A;  1SUQ A;  1WF0 A;  4DPO A;  2UUC J;  1N33 J;  4DV6 E;  4NLW A;  1XMQ E;  3T6B A;  4A8X A;  3PW0 A;  3RR8 A;  3BN4 A;  2OHD A;  5D3G B;  2B51 A;  3QAE A;  5E3C A;  1C4C A;  1OO0 B;  5D4O A;  4JUZ A;  1AB8 A;  4A8W A;  4ED7 A;  1XK8 A;  4IZJ D;  3D66 A;  2O67 A;  1S9E B;  1Y10 A;  4J90 A;  5ETP A;  5KG1 A;  3TP2 A;  4G1I A;  4ECX A;  4A8S A;  2PI5 A;  1FFG B;  4IKA A;  5DDP C;  2KXN B;  4NZ7 A;  3KUG A;  3P8B B;  2WW4 A;  3QO9 B;  5DG7 A;  3HVR A;  3K5M A;  1RAE B;  2CQ1 A;  3B4M A;  3QZ8 A;  3CCS S;  4DV2 J;  2H5I B;  2XLI A;  1FD8 A;  1UEV A;  1N36 J;  4AXI A;  1RT6 A;  3B54 A;  4ED8 A;  3QT8 A;  5DG8 A;  1YHQ S;  2ZOF A;  2UVU A;  2ZM6 E;  2OPR A;  3O8W A;  2KL8 A;  2HG4 A;  1JLF B;  3DGP A;  2E9R X;  2PO2 A;  4OO1 B;  4EMD A;  2FC9 A;  4KHP E;  4B3S E;  2QT7 A;  1XER A;  3M8Q A;  4RUB A;  5SZT A;  5B0E A;  3ZTR A;  4ED6 A;  1RAG B;  2NUH A;  3PDN A;  2DHA A;  4K5R A;  2FY1 A;  4YY3 E;  4DR3 F;  3K89 A;  3VVU A;  2VQF I;  2GQ2 A;  2P6S A;  3W8P A;  3M8Z A;  3MFH A;  4JI4 J;  1RLD A;  2VJV A;  1NHI A;  4QU6 A;  4LFB E;  3MPY A;  4AE5 A;  2AJ2 A;  2JHE A;  1IBM I;  1UWB A;  2GGP A;  3G9C A;  3MHY A;  4XTJ A;  1JQG A;  3BKF A;  3ULH A;  1WG1 A;  4DFP A;  4URS A;  4DL5 A;  4DL3 A;  2EG1 A;  2R8J A;  3W64 A;  5H9E J;  1A0O B;  1CQM A;  2F9D A;  2JLE A;  3TJA A;  1PSD A;  2YKN B;  5LSO A;  2E9T A;  3BDE A;  3AJD A;  4DV2 I;  1SL2 A;  1FKO B;  3KLG A;  3KK2 B;  4OO1 A;  2JX2 A;  4G1P A;  1YJT A;  4X65 I;  3FUY A;  4OX9 E;  4O4G B;  1CVJ A;  2BAC A;  4JI2 I;  2E66 A;  2DTJ A;  2IDL A;  2KYX A;  4BS2 A;  3GFZ A;  1EKS A;  3CMQ A;  4TY8 A;  1AA1 B;  2CNN B;  5KG3 A;  2AJ4 A;  2YQ0 A;  3N28 A;  1HHT P;  5KFK A;  1IR0 A;  2RHQ B;  3A8K A;  2HHT A;  5KFR A;  1FA0 A;  2L41 A;  4O4G A;  1KC8 T;  1WDT A;  2AX1 A