4LF6E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf6E02
2V2VA 1B62A 4GKJI 2UUCE 1FI4A 4AQYI 4DUZE 3T1YE 1EKZA 4LFCE 3J7AG 2LUPB 4DV0I 4JI6I 1YYKA 2LTRA 2NPFA 2HFUA 3PYGA 3WU5A 1B63A 3Q1QA 4DR1I 2NUFA 4DPWA 3VYXA 1O0WA 1QZRA 2V2ZA 1Z5AA 2X7IA 1Z0WA 5LMNE 3J7Yp 4LF9E 4DR5I 4JI4E 1H73A 1PIEA 3ZZTA 4WUBA 1EA6A 1EI1A 4MYUA 1T4NA 4PRXA 2LBSB 3LNUA 1XMOI 4LF6E 4DV2E 1D6TA 4WFTA 1N0VC 2DMYA 1N32I 1DI2A 1X48A 3B82A 2L2KB 4DKKA 4JI5E 1PKPA 4UTGA 4DPXA 4JI8I 2HK2A 1XMQE 3CWVA 2F4VI 3PYFA 1N36I 4DR2I 4LF5I 4YHHE 3PYEA 4B3TI 3WU6A 1HR0E 2X36A 4JYAI 3GONA 2GS8A 4DV6E 4GKJE 1Z0CA 2Q2EB 1A6FA 1OJ4A 3B8HA 4B3SI 2B3TB 4DV0E 3ZKBA 1N34E 2L33A 4DR4E 1HNWE 4NXNI 4M30A 2E5LE 1I94E 1Z5CA 3WU3A 1YZ9A 4FW9A 5CFFE 2BM1A 4JG4A 2RSMA 5L3JA 2LUQA 3H4LA 2LRSA 2UXCE 2L2MA 5LMUI 1KTVA 1XMOE 3J80Q 4DV4I 4B3ME 2UUBE 1H74A 1NHIA 3K1JA 2VQEI 1ZXNA 3QT5A 3JAMQ 4USMA 2XEXA 3P1XA 5LL6R 4JI0I 1MG7A 2F4VE 4DR7I 1N36E 1Z59A 4X64I 1N33I 3QT8A 4YY3I 4XTJA 3VYYA 4OOGC 4MYTA 2ZBKB 2L3CA 4JI3I 1Z0EA 2V8PA 4X65E 1KKHA 3M6AA 4EMDA 1IBME 4RPFA 1HNZE 2DB2A 2CZ9A 1WHQA 2KHXA 2IHR1 4GKKI 1WUUA 3V2UC 1ZBTA 2A2CA 1FJGI 1FWLA 2ZM6E 1XNQI 4USKA 4DV3I 4JI7I 4B3RI 4DR3I 1H7UA 5IT9C 2R3VA 4JI1E 2NUEA 1XNRE 1Z0GA 1KIJA 4DV4E 4OX9E 5A2QQ 4LF8I 1NHJA 4KHPI 1YYOA 2UU9I 2VQEE 2JVAA 3J81C 2A2DA 4R1FA 1T4LB 3T1HE 4HYMA 2DIXA 4X64E 1N33E 2BV3A 5IWAE 2HHHI 1RREA 4LFBI 4NXMI 3HTXA 2UUAI 2L2NA 5FLXC 3QT6A 4WYQB 1T4OA 4JV5E 1HNXI 3ZKDA 2RS6A 4AQYE 4LF7I 5BR8I 2J7KA 4HACA 2L3JA 2JY9A 1ZXMA 3ADGA 4DV3E 4JI7E 1RQ0A 4JI6E 1BKNA 4DR3E 4X62I 1STUA 1Z5BA 2OI2A 1X47A 4DR1E 4DV1I 3WU4A 4KHPE 1PVGA 1J5EI 2UU9E 4DR5E 1MX0A 2EFGA 4DXLA 3J81Q 3K17A 4Z7CA 4DV7I 1H72C 1MU5A 2UUCI 2UXDI 2HHHE 4DUZI 3T1YI 1N32E 2ZITA 4JI2I 4URLA 1QU6A 4JI8E 2VF3A 2N3GA 4DR2E 4DV5I 4M2ZA 4LF5E 4B3TE 2LJPA 4UT4A 1XHKA 4P7AA 4JYAE 4FWDA 5LMNI 1YYWA 1X49A 4DU8A 4K0KI 4LF7E 1KVKA 4DPYA 1RC7A 4B3SE 3LTOA 1S16A 3D4JA 4X62E 4NXNE 1UEKA 1IBKI 4Z7YA 3C4TA 4DV1E 3OTOI 2UXBI 4FWHA 4JI5I 1DARA 1Z0TA 4DR6I 2DEJA 3J7AM 1U2RA 1NHHA 4YHHI 1J26A 5LMUE 2HKEA 4HXZA 2CPNA 4DV6I 4DV7E 2UXDE 4ED4A 3QT7A 4X66I 4JI2E 3ADJA 1N34I 4JI0E 4DR4I 1HNWI 4DR7E 2E5LI 2B7TA 4YY3E 1I94I 4LF4I 1S4EA 4DV5E 1GQEA 2AJ4A 4JI3E 4WUCA 2WW4A 4PU9A 1IBLI 1NZ0A 4M1KA 4K0KE 3LLHA 2EZ6A 3ZM7A 1VISA 4DUYI 2UXCI 2HKJA 3J80C 2VQFI 1FNMA 4GKKE 2MDRA 1IBKE 1WHNA 4B3MI 3JAMC 3LPSA 1Z0BA 2UUBI 3ZZUA 1FJGE 3ADIA 3B78A 3OTOE 2UXBE 1XNQE 2N3HA 4B3RE 2NUGA 4DR6E 1ELOA 3HULA 5IT9Q 2E1RA 3F0NA 4ZVIA 1N0UA 3ZZ0A 2V2QA 1ZM9A 4LF8E 4X65I 1IBMI 4LFAI 1HNZI 4X66E 1ZM3A 2R42A 5GMEA 2DEIA 4LF4E 4DPUA 4LFCI 4LFBE 2ZM6I 1IBLE 4NXME 2BM0A 4I3HA 2HK3A 2UUAE 4WUDA 1K47A 1Z0VA 4JI1I 4DU7A 4FWGA 1XNRI 4DUYE 4P52A 1FKAE 5A2QC 1FWKA 2VQFE 5FLXQ 3C4BA 4HY1A 3V5RA 2B7VA 4OX9I 2HFSA 2LJHA 1ZM2A 2RS7A 1HNXE 4LF9I 1ZM4A 5BR8E 4JI4I 3PYDA 4HACB 4DPTA 2LTSA 2V34A 3T1HI 1UILA 4LF6I 1UHZA 4DV2I 5IWAI 5GMDA 2YT4A 3ADLA 4LFAE 1J5EE 1XMQI 2RTXA 4KQVA 4PRVA 4X8WA 2NA2A 4FN5A 1H7SA 1HR0I 4JV5I 1RR9A
chains in the Genus database with same CATH superfamily
2V2VA 1B62A 2CT1A 4GKJI 1HK7A 2UUCE 1FI4A 4AQYI 4DUZE 3T1YE 2BA1G 2YTGA 3C6KA 1EKZA 2D9HA 3L7ZA 2EMYA 4LFCE 4IZJB 3J7AG 4FW5A 2C38B 2JEAA 2ELYA 2LUPB 4DV0I 4JI6I 1YYKA 1JK1A 2JYAA 5LLQA 2LTRA 2JE6A 2NPFA 2HJJA 4GEQB 1N3GA 2HFUA 1MGTA 4NZVA 2A25A 2YU8A 3MHSC 1T38A 4DMIA 4BBYA 1B63A 2EQ0A 1R6MA 1Y4SA 5AC4A 2EOHA 4P7DA 2NUFA 4DPWA 4DR1I 2EN8A 3Q1QA 3VYXA 1O0WA 4O4KA 1QZRA 1A1GA 1Z5AA 2V2ZA 2X7IA 2YU5A 4OO1F 4WXCA 1Z0WA 5LMNE 3M85D 3J7Yp 2JEBA 2PO0A 4FW4A 4LF9E 4F54A 4JI4E 1H73A 1PIEA 2BA0D 4DR5I 3ZZTA 1WRJA 1A1FA 4IZJD 2AE8A 3MHHC 4WUBA 1EA6A 1EI1A 4MYUA 1T4NA 3M99B 4HTGA 4PRXA 2LBSB 3LNUA 1XMOI 1X6HA 3FIGA 2EE8A 4DV2E 4LF6E 2LE2A 1D6TA 2KONA 4LCFA 4WFTA 1N0VC 1Y6ZA 2DMYA 3PRYA 4FK5C 1F2IG 1DI2A 1N32I 1X48A 2FV4B 1X6FA 2K4VA 3B82A 2L2KB 4DKKA 4JI5E 1PKPA 5IV8B 1B69A 4UTGA 4DPXA 4JI8I 2HK2A 1XMQE 2YTFA 2PRTA 4BA1A 3CWVA 2F4VI 5DRRA 2H36X 3PYFA 1N36I 2CTDA 4DR2I 2EOSA 2G7HA 5JEAA 4LF4I 4LF5I 4YHHE 3PYEA 5C0XA 1MEYC 3HPSA 3WU6A 1HR0E 4LPFA 2X36A 4B3TI 3P76A 2EMLA 4U3BA 2Z5BB 1R6LA 4JYAI 3GONA 1KJKA 4DV6E 1WJPA 2GS8A 4GKJE 1Z0CA 2Q2EB 1A6FA 1OJ4A 3B8HA 3Q6NA 2DRPA 3U1KA 4B3SI 2B3TB 5DNYA 3KRNA 4LU9A 4DV0E 2EMZA 3ZKBA 2EM9A 2L33A 1N34E 4DR4E 1HNWE 2BA1D 4NXNI 4M30A 2V85A 2E5LE 2E72A 1I94E 2EPKX 1Z5CA 2R1FA 3NZKA 1X3CA 1YZ9A 4FW9A 3WU3A 2PO1A 3M7ND 2NN6A 5CFFE 2BM1A 4JG4A 2RSMA 5DNXA 5L3JA 4F9BB 4MU3A 3DF6A 1AH5A 2LUQA 3OMLA 1NEIA 2EN4A 3H4LA 4ZYHA 2LRSA 1Z1BA 1YFHA 2UXCE 2I13A 2ODRC 1LLMC 2GLIA 2BA0G 5A6KA 1AAYA 2L2MA 5JEAF 1KTVA 1QNTA 5LMUI 5C0XF 1XMOE 3J80Q 4DV4I 4IFDD 2DLKA 4TUIA 4B3ME 2UUBE 1H74A 1NHIA 3K1JA 2VQEI 5ELWA 3BGHA 1ZXNA 2N8XA 2C39B 2CG9A 3QT5A 3JAMQ 4USMA 2JP9A 2XEXA 3P1XA 3TQMA 5LL6R 2LCEA 4JI0I 5K36D 1EH8A 1MG7A 1DGCA 2Q8UA 2F4VE 4DR7I 1N36E 1Z59A 5DROA 1UDQA 4X64I 3QT8A 4YY3I 1N33I 1EH7A 4WX9A 4XTJA 4O24A 3VYYA 4OOGC 1OYPA 2ZBKB 2L3CA 4MYTA 2EMGA 4JI3I 4OO1A 2V87A 3U1YA 2EM3A 2EQ1A 1Z0EA 2V8PA 2ENAA 2EOOA 4X65E 1KKHA 2GPIA 2PO2B 3M6AA 4EMDA 4F6MA 4O43A 4R03A 1IBME 4IS9A 4FW6A 3ZOQB 4RPFA 1HNZE 5A69A 2PNZB 2DB2A 2KOUA 2CZ9A 1TF3A 4ZYGA 1WHQA 4BHBA 1USVA 5A6BD 2KHXA 1PDAA 2ENHA 2IHR1 2LV2A 4IJDA 4L8NA 4Q28A 4R2DA 4GKKI 3P06A 1G2DC 2L6MA 2DGCA 1WUUA 3V2UC 4BCAA 4AIDA 3K6QA 1ZBTA 2A2CA 4LCGA 2ADRA 1FJGI 3JTZA 2EN3A 1FWLA 4QNKA 3BBGA 1YUIA 2MKDA 3HJCA 2PO1B 2ZM6E 1XNQI 4USKA 3IWCA 2IERA 4DV3I 2WNRB 4JI7I 4B3RI 4F2JC 4DR3I 1IQOA 1H7UA 5IT9C 3M7NG 2JR1A 4BC7A 2YTJA 1VI7A 2R3VA 4JI1E 2NUEA 1DQ3A 1XNRE 5DRQA 4TUGA 5KL4A 4AIMA 3VHTB 2EM7A 3F6GA 5ADZA 1Z0GA 1KIJA 2EOZA 2K7IA 2MC5A 4Q35B 5KL2A 2J65A 2CVEA 4DV4E 4OX9E 4IZKA 5A2QQ 4F6NA 1IBMI 3VK6A 1NHJA 4LF8I 4KHPI 4N4RB 2JOXA 1YYOA 2UU9I 2VQEE 1BBOA 1P42A 2JVAA 2MC6A 3J81C 4OKGA 2I9IA 2A2DA 4IFDA 4R1FA 1T4LB 2Z5EA 3T1HE 2WP8B 4HYMA 2DIXA 4X64E 2EN1A 1N33E 1OYRA 2BV3A 5IXMB 1JK2A 1Y4UA 4N3OA 4LTYA 3BIDA 4BA2A 5IWAE 2HHHI 4OZEA 1RREA 2DMIA 2YTOA 4GZNC 4OO1B 5K36A 4LFBI 2WZOA 2YTIA 4J3DA 4NXMI 3EQ1A 2FGGA 2EM5A 4M9VC 3HTXA 4BC9A 1ZBQA 2UUAI 1IQSA 1PJSA 4RHBB 2L2NA 4I8OA 1OYSA 3HQ1A 2ELZA 3KWRA 2BR2B 2YSOA 5FLXC 1YPNA 2YWQA 2EM6A 3QT6A 4O5GA 4WYQB 1T4OA 2V89A 1WXRA 4JV5E 4KWYA 2YTPA 2EM2A 2B9DA 3ZKDA 4F9AB 1HNXI 2RS6A 2HC5A 4AQYE 4LF7I 3L00A 4WPYA 2EL5A 2J7KA 4HACA 5BR8I 2L3JA 3UK3C 2JY9A 2JOBA 1ZXMA 3ADGA 2O1UA 3L7ZB 4DV3E 4JI7E 1RQ0A 5AE3A 4JI6E 4DR3E 1G2FC 1BKNA 1XXEA 2JEAB 2WBSA 2VESA 4X62I 1STUA 1YUJA 1Z5BA 3LMLA 2OI2A 4IFDF 2JE6B 4HEIA 2EOEA 1BBGA 4IS1C 1X47A 2Z5CA 4DR1E 1UDOA 4DV1I 1USUA 4M0VA 4MLVA 3WU4A 1KYQA 4KHPE 1PVGA 2EOYA 5TSEA 2VE7C 3PS1A 1J5EI 5K36F 2V83A 2C37A 4R8OA 2UU9E 4DR5E 1Y5YA 1MX0A 2JEBB 2PO0B 2EFGA 4FW7A 4J8ZA 4DXLA 3Q6MA 3C6MA 3EPKA 3GLLA 3J81Q 3K17A 2ENCA 2EL4A 1UDSA 3KZZA 2IOPA 1A1JA 1E3PA 4Z7CA 4DV7I 1H72C 1MU5A 3H1CA 2UUCI 2HHHE 1UN6B 2UXDI 2ODRD 4DUZI 1X5WA 3T1YI 4IZJA 2EM0A 3HXLA 1N32E 2ZITA 3F6HA 2C38A 4JI2I 2EMXA 3EPJA 1ZAAC 4URLA 3AV0A 4R2RA 1QU6A 4JI8E 2VF3A 2IOQA 5A6JA 3MSWA 2N3GA 2EOJA 1YH8A 4BA1B 2EOQA 5KL5A 4DR2E 4KZSA 4DV5I 4F9CB 4M2ZA 4LF5E 2EPRA 4B3TE 5JEAB 3EPLA 5C0XB 2LJPA 4MU1A 4UT4A 1XHKA 4P7AA 2EWLA 1BB8A 4JYAE 1EH6A 4X9JA 3PYGA 4FWDA 4BS9A 2YPNA 1YYWA 3B4TA 5LMNI 1X49A 2BB8A 2LVHA 3GCMA 4DU8A 4K0KI 4LF7E 2EPCA 1KVKA 4DPYA 1P47A 1RC7A 4B3SE 3LTOA 2CGEA 2DLQA 1S16A 3P3CA 4WXDA 3D4JA 5JEAE 5JEAC 4X62E 5KL6A 4NXNE 2WCC3 5C0XC 2EPPA 1UEKA 4MDTA 1L4SA 1IBKI 1PJQA 4Z7YA 3C4TA 1SR9A 4R2AA 2GO4A 1GTKA 3HPZA 4DV1E 4R2SA 3OTOI 2EQ3A 2UXBI 4FWHA 3PS2A 4JI5I 1DARA 2NN6B 3PS3A 2LMZA 1Z0TA 4DR6I 2DEJA 3J7AM 4NBQA 1U2RA 2O3ZA 1GZ6A 1ZU1A 2EMBA 2EPUA 2YRHA 1NHHA 4YHHI 1J26A 2Z5BA 5LMUE 2V88A 2HKEA 2YTNA 4HXZA 2CPNA 2LJUA 2NN6E 4DV7E 2JWOA 2NN6C 2UXDE 1UDNA 4ED4A 4DV6I 2EPMX 4P78A 2EL6A 4MU4A 1YHCA 3DD6A 3QT7A 4X66I 1A1LA 4MLQA 5EL9A 5FWKA 4JI2E 2EM8A 3P3EA 2EOIA 3ADJA 4WSPA 2YRKA 2GQ0A 4JI0E 2L92A 2NN6D 1N34I 4DR4I 1HNWI 2WBUA 4LFAI 2M9AA 4DR7E 2E5LI 2B7TA 4YY3E 2EMKA 1I94I 1S4EA 3AUZA 4DV5E 3H09A 1GQEA 2EPNA 2AJ4A 2EP3A 1ZR9A 2EORA 2V8QB 4JI3E 2CSHA 2EPZA 2JT2A 2EOMA 2LO3A 2WW4A 4WUCA 4R2EA 3WU5A 2L8TA 2GO3A 2EMIA 4PU9A 1TF6A 1IBLI 1NZ0A 2EPXA 4M1KA 3UHMA 1X6EA 2EPAA 5DNLA 4K0KE 4NHRA 3LLHA 2MDGA 2EZ6A 2GHFA 4ISAA 3ZM7A 2JXPA 2MKNA 2EMWA 1VISA 4DUYI 1Y60A 2UXCI 2HKJA 3KZYA 3J80C 2VQFI 1FNMA 4GKKE 4OO1E 4MQYA 4OO1C 2MDRA 1IBKE 1WHNA 4B3MI 3JAMC 5KL7A 1Z0BA 3LPSA 2UUBI 2C39A 3ZZUA 1FJGE 3ADIA 3GMEA 3B78A 5A6BA 4OO1D 3OTOE 2V86A 3ECRA 5AC5A 2UXBE 1XNQE 2N3HA 4B3RE 2NUGA 4DR6E 2HGHA 2YTEA 1E3HA 1ELOA 4LOMA 3QG5C 4GQUA 3HULA 1TN9A 4LCHA 5IT9Q 2E1RA 2J7JA 3F0NA 2YSPA 2YZTA 5AASA 2O1VA 4ZVIA 1N0UA 2F8BA 1T39A 2O1TA 2PO2A 3ZZ0A 2V2QA 2EMAA 1ZM9A 2LT7A 4LF8E 4X65I 5F3WA 4L5NC 2BBGA 2PNZA 4IZKB 1SFEA 4ZYEA 5A6AA 2O1WA 4R2PA 1HNZI 2M7QA 2EM4A 4RH8A 4X66E 1ZM3A 3THNA 1RMDA 4U3DA 2EPLX 2VF1A 2EN7A 2R42A 4BMJA 3K85A 4R2QA 5GMEA 2VRDA 2EOFA 4WSGA 4AM3A 5T6JA 3THOB 4BHCA 4R2CA 2DEIA 4ZYDA 4IFDB 2YRMA 2RQLA 4LF4E 1A1IA 2DSYA 2EOXA 3CDJA 4BA2B 2RPCA 2YTDA 3IWBA 4DPUA 2IESA 2WNRA 4LFCI 4LFBE 2PNLA 2ZM6I 1IBLE 4NXME 5K36B 2BM0A 4I3HA 2RSIA 1UBDC 3EPHA 2E1MA 2HK3A 2UUAE 4WUDA 4IFDE 1K47A 4IFDC 1Z0VA 3P3GA 4JI1I 4FWGA 4DU7A 1XNRI 4DUYE 2EJ4A 2PNMA 3M85G 2EPOA 5EKWA 4P52A 1YSAC 1FKAE 5A2QC 1FWKA 2VQFE 5FLXQ 3C4BA 1IMUA 4HY1A 3DJWA 2B7VA 3V5RA 4OX9I 4MU0A 1A1KA 2LJHA 3BF2A 2HFSA 1ZM2A 2EMCA 2RS7A 1HNXE 5K36E 5K36C 4LF9I 1ZM4A 5BR8E 4JI4I 2F1DA 3PYDA 4QNJA 4HACB 4DPTA 2LTSA 2V34A 2WP8A 2EN6A 5AE2A 3T1HI 2M4IA 5C0XE 1UILA 4LF6I 1UHZA 4FW3A 4DV2I 1NCSA 2WBTA 2EMHA 5GMDA 5IWAI 2YT4A 2EN2A 1PJTA 2Z5CB 3CDIA 5JEAD 2YTQA 5KL3A 5C0XD 2NABA 2FTXB 3ADLA 2R76A 3RMPA 1A1HA 2NN6F 4LFAE 5AE1A 1J5EE 3JU0A 2EMFA 2RTXA 2JPAA 2BR2A 1XMQI 2C37B 4KQVA 4PRVA 4X8WA 5DRPA 2NA2A 4FN5A 3HKMA 1H7SA 1HR0I 2M1SA 1RHYA 4JV5I 1RR9A 3IWDA
chains in the Genus database with same CATH topology
2V2VA 1B62A 4GKJI 1HK7A 2UUCE 1FI4A 4AQYI 4DUZE 3T1YE 1EKZA 4LFCE 4IZJB 3J7AG 2LUPB 4DV0I 4JI6I 1YYKA 2LTRA 2NPFA 4GEQB 2HFUA 3PYGA 3WU5A 1B63A 4DMIA 4BBYA 1Y4SA 3Q1QA 4DR1I 4P7DA 2NUFA 4DPWA 3VYXA 1O0WA 1QZRA 2V2ZA 1Z5AA 2X7IA 1Z0WA 5LMNE 3J7Yp 4LF9E 4F54A 4JI4E 1H73A 1PIEA 4DR5I 3ZZTA 4IZJD 4WUBA 1EA6A 1EI1A 4MYUA 1T4NA 4PRXA 2LBSB 3LNUA 1XMOI 3FIGA 4LF6E 4DV2E 1D6TA 2LE2A 2KONA 4WFTA 1N0VC 1Y6ZA 2DMYA 3PRYA 1DI2A 1N32I 1X48A 2FV4B 2K4VA 3B82A 2L2KB 4DKKA 4JI5E 1PKPA 4UTGA 4DPXA 4JI8I 2HK2A 1XMQE 3CWVA 2F4VI 2H36X 3PYFA 1N36I 4DR2I 2G7HA 4LF5I 4YHHE 3PYEA 4B3TI 3HPSA 3WU6A 1HR0E 2X36A 2Z5BB 4JYAI 3GONA 2GS8A 4DV6E 4GKJE 1Z0CA 2Q2EB 1A6FA 1OJ4A 3B8HA 3Q6NA 4B3SI 2B3TB 5DNYA 4LU9A 4DV0E 3ZKBA 1N34E 2L33A 4DR4E 1HNWE 4NXNI 4M30A 2V85A 2E5LE 1I94E 1Z5CA 3WU3A 1YZ9A 4FW9A 5CFFE 2BM1A 4JG4A 2RSMA 5L3JA 4F9BB 3DF6A 2LUQA 3OMLA 3H4LA 2LRSA 2UXCE 2ODRC 2L2MA 5LMUI 1KTVA 1XMOE 3J80Q 4DV4I 4TUIA 4B3ME 2UUBE 1H74A 1NHIA 3K1JA 2VQEI 1ZXNA 2CG9A 3QT5A 3JAMQ 4USMA 2XEXA 3P1XA 5LL6R 4JI0I 1MG7A 2F4VE 4DR7I 1N36E 1Z59A 4X64I 1N33I 3QT8A 4YY3I 4XTJA 3VYYA 4OOGC 4MYTA 2ZBKB 2L3CA 4JI3I 2V87A 1Z0EA 2V8PA 4X65E 1KKHA 3M6AA 4EMDA 1IBME 4R03A 3ZOQB 4RPFA 1HNZE 2DB2A 2KOUA 2CZ9A 1WHQA 1USVA 2KHXA 2IHR1 4L8NA 4Q28A 4GKKI 3P06A 2L6MA 1WUUA 3V2UC 4BCAA 3K6QA 1ZBTA 2A2CA 1FJGI 3JTZA 1FWLA 3HJCA 2ZM6E 1XNQI 4USKA 3IWCA 4DV3I 4JI7I 4B3RI 4DR3I 1H7UA 5IT9C 2JR1A 4BC7A 2R3VA 4JI1E 2NUEA 1DQ3A 1XNRE 4TUGA 3F6GA 5ADZA 1Z0GA 1KIJA 2MC5A 4DV4E 4OX9E 4IZKA 5A2QQ 4LF8I 3VK6A 1NHJA 4KHPI 2JOXA 1YYOA 2UU9I 2VQEE 2JVAA 2MC6A 3J81C 2A2DA 4R1FA 1T4LB 2Z5EA 3T1HE 4HYMA 2DIXA 4X64E 1N33E 2BV3A 4N3OA 1Y4UA 4LTYA 5IWAE 2HHHI 1RREA 4LFBI 2WZOA 4NXMI 2FGGA 3HTXA 4BC9A 1ZBQA 2UUAI 2L2NA 4I8OA 3HQ1A 3KWRA 5FLXC 3QT6A 4WYQB 1T4OA 2V89A 1WXRA 4JV5E 2B9DA 3ZKDA 4F9AB 1HNXI 2RS6A 4AQYE 4LF7I 4WPYA 5BR8I 2J7KA 4HACA 2L3JA 2JY9A 2JOBA 1ZXMA 3ADGA 2O1UA 4DV3E 4JI7E 1RQ0A 5AE3A 4JI6E 4DR3E 1BKNA 4X62I 1STUA 1Z5BA 2OI2A 3LMLA 1X47A 2Z5CA 4DR1E 4DV1I 1USUA 4M0VA 3WU4A 4KHPE 1PVGA 2VE7C 1J5EI 2V83A 4R8OA 2UU9E 4DR5E 1MX0A 2EFGA 4J8ZA 4DXLA 3Q6MA 3J81Q 3K17A 2IOPA 4Z7CA 4DV7I 1H72C 1MU5A 2UUCI 2UXDI 2HHHE 2ODRD 4DUZI 3T1YI 4IZJA 1N32E 3HXLA 2ZITA 3F6HA 4JI2I 4URLA 3AV0A 1QU6A 4JI8E 2VF3A 2IOQA 3MSWA 2N3GA 4DR2E 4KZSA 4DV5I 4F9CB 4M2ZA 4LF5E 4B3TE 2LJPA 4UT4A 1XHKA 4P7AA 2EWLA 4JYAE 4FWDA 4BS9A 5LMNI 1YYWA 1X49A 4DU8A 4K0KI 4LF7E 1KVKA 4DPYA 1RC7A 4B3SE 3LTOA 2CGEA 1S16A 3D4JA 4X62E 4NXNE 1UEKA 1IBKI 4Z7YA 3C4TA 1SR9A 3HPZA 4DV1E 3OTOI 2UXBI 4FWHA 4JI5I 1DARA 2LMZA 1Z0TA 4DR6I 2DEJA 3J7AM 1U2RA 1GZ6A 1NHHA 4YHHI 1J26A 2Z5BA 5LMUE 2V88A 2HKEA 4HXZA 2CPNA 4DV6I 4DV7E 2JWOA 2UXDE 4ED4A 4P78A 3QT7A 4X66I 5FWKA 4JI2E 3ADJA 4WSPA 2GQ0A 1N34I 4JI0E 2L92A 4DR4I 1HNWI 4DR7E 2E5LI 2B7TA 4YY3E 1I94I 4LF4I 1S4EA 3AUZA 4DV5E 3H09A 1GQEA 2AJ4A 4JI3E 2V8QB 4WUCA 2WW4A 2L8TA 4PU9A 1IBLI 1NZ0A 4M1KA 4K0KE 3LLHA 2EZ6A 3ZM7A 1VISA 4DUYI 2UXCI 2HKJA 3J80C 2VQFI 1FNMA 4GKKE 2MDRA 1IBKE 1WHNA 4B3MI 3JAMC 3LPSA 1Z0BA 2UUBI 3ZZUA 1FJGE 3ADIA 3B78A 3OTOE 2V86A 2UXBE 1XNQE 2N3HA 4B3RE 2NUGA 4DR6E 1ELOA 3HULA 5IT9Q 2E1RA 3F0NA 5AASA 2YZTA 2O1VA 4ZVIA 1N0UA 2F8BA 2O1TA 3ZZ0A 2V2QA 1ZM9A 4LF8E 4X65I 5F3WA 4L5NC 1IBMI 4IZKB 4LFAI 2O1WA 1HNZI 2M7QA 4X66E 1ZM3A 2VF1A 2R42A 4BMJA 3K85A 5GMEA 5T6JA 2DEIA 4LF4E 2DSYA 3IWBA 4DPUA 4LFCI 4LFBE 2PNLA 2ZM6I 1IBLE 4NXME 2BM0A 4I3HA 2E1MA 2HK3A 2UUAE 4WUDA 1K47A 1Z0VA 4JI1I 4DU7A 4FWGA 1XNRI 4DUYE 2PNMA 4P52A 1FKAE 5A2QC 1FWKA 2VQFE 5FLXQ 3C4BA 4HY1A 3DJWA 2B7VA 3V5RA 4OX9I 2HFSA 2LJHA 1ZM2A 2RS7A 1HNXE 4LF9I 1ZM4A 5BR8E 4JI4I 3PYDA 4HACB 4DPTA 2LTSA 2V34A 5AE2A 3T1HI 2M4IA 1UILA 4LF6I 1UHZA 4DV2I 5IWAI 5GMDA 2YT4A 2Z5CB 2FTXB 3ADLA 3RMPA 4LFAE 1J5EE 5AE1A 2RTXA 3JU0A 1XMQI 4KQVA 4PRVA 4X8WA 2NA2A 4FN5A 1H7SA 1HR0I 2M1SA 4JV5I 1RR9A 3IWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2V A;  1B62 A;  4GKJ I;  2UUC E;  1FI4 A;  4AQY I;  4DUZ E;  3T1Y E;  1EKZ A;  4LFC E;  3J7A G;  2LUP B;  4DV0 I;  4JI6 I;  1YYK A;  2LTR A;  2NPF A;  2HFU A;  3PYG A;  3WU5 A;  1B63 A;  3Q1Q A;  4DR1 I;  2NUF A;  4DPW A;  3VYX A;  1O0W A;  1QZR A;  2V2Z A;  1Z5A A;  2X7I A;  1Z0W A;  5LMN E;  3J7Y p;  4LF9 E;  4DR5 I;  4JI4 E;  1H73 A;  1PIE A;  3ZZT A;  4WUB A;  1EA6 A;  1EI1 A;  4MYU A;  1T4N A;  4PRX A;  2LBS B;  3LNU A;  1XMO I;  4LF6 E;  4DV2 E;  1D6T A;  4WFT A;  1N0V C;  2DMY A;  1N32 I;  1DI2 A;  1X48 A;  3B82 A;  2L2K B;  4DKK A;  4JI5 E;  1PKP A;  4UTG A;  4DPX A;  4JI8 I;  2HK2 A;  1XMQ E;  3CWV A;  2F4V I;  3PYF A;  1N36 I;  4DR2 I;  4LF5 I;  4YHH E;  3PYE A;  4B3T I;  3WU6 A;  1HR0 E;  2X36 A;  4JYA I;  3GON A;  2GS8 A;  4DV6 E;  4GKJ E;  1Z0C A;  2Q2E B;  1A6F A;  1OJ4 A;  3B8H A;  4B3S I;  2B3T B;  4DV0 E;  3ZKB A;  1N34 E;  2L33 A;  4DR4 E;  1HNW E;  4NXN I;  4M30 A;  2E5L E;  1I94 E;  1Z5C A;  3WU3 A;  1YZ9 A;  4FW9 A;  5CFF E;  2BM1 A;  4JG4 A;  2RSM A;  5L3J A;  2LUQ A;  3H4L A;  2LRS A;  2UXC E;  2L2M A;  5LMU I;  1KTV A;  1XMO E;  3J80 Q;  4DV4 I;  4B3M E;  2UUB E;  1H74 A;  1NHI A;  3K1J A;  2VQE I;  1ZXN A;  3QT5 A;  3JAM Q;  4USM A;  2XEX A;  3P1X A;  5LL6 R;  4JI0 I;  1MG7 A;  2F4V E;  4DR7 I;  1N36 E;  1Z59 A;  4X64 I;  1N33 I;  3QT8 A;  4YY3 I;  4XTJ A;  3VYY A;  4OOG C;  4MYT A;  2ZBK B;  2L3C A;  4JI3 I;  1Z0E A;  2V8P A;  4X65 E;  1KKH A;  3M6A A;  4EMD A;  1IBM E;  4RPF A;  1HNZ E;  2DB2 A;  2CZ9 A;  1WHQ A;  2KHX A;  2IHR 1;  4GKK I;  1WUU A;  3V2U C;  1ZBT A;  2A2C A;  1FJG I;  1FWL A;  2ZM6 E;  1XNQ I;  4USK A;  4DV3 I;  4JI7 I;  4B3R I;  4DR3 I;  1H7U A;  5IT9 C;  2R3V A;  4JI1 E;  2NUE A;  1XNR E;  1Z0G A;  1KIJ A;  4DV4 E;  4OX9 E;  5A2Q Q;  4LF8 I;  1NHJ A;  4KHP I;  1YYO A;  2UU9 I;  2VQE E;  2JVA A;  3J81 C;  2A2D A;  4R1F A;  1T4L B;  3T1H E;  4HYM A;  2DIX A;  4X64 E;  1N33 E;  2BV3 A;  5IWA E;  2HHH I;  1RRE A;  4LFB I;  4NXM I;  3HTX A;  2UUA I;  2L2N A;  5FLX C;  3QT6 A;  4WYQ B;  1T4O A;  4JV5 E;  1HNX I;  3ZKD A;  2RS6 A;  4AQY E;  4LF7 I;  5BR8 I;  2J7K A;  4HAC A;  2L3J A;  2JY9 A;  1ZXM A;  3ADG A;  4DV3 E;  4JI7 E;  1RQ0 A;  4JI6 E;  1BKN A;  4DR3 E;  4X62 I;  1STU A;  1Z5B A;  2OI2 A;  1X47 A;  4DR1 E;  4DV1 I;  3WU4 A;  4KHP E;  1PVG A;  1J5E I;  2UU9 E;  4DR5 E;  1MX0 A;  2EFG A;  4DXL A;  3J81 Q;  3K17 A;  4Z7C A;  4DV7 I;  1H72 C;  1MU5 A;  2UUC I;  2UXD I;  2HHH E;  4DUZ I;  3T1Y I;  1N32 E;  2ZIT A;  4JI2 I;  4URL A;  1QU6 A;  4JI8 E;  2VF3 A;  2N3G A;  4DR2 E;  4DV5 I;  4M2Z A;  4LF5 E;  4B3T E;  2LJP A;  4UT4 A;  1XHK A;  4P7A A;  4JYA E;  4FWD A;  5LMN I;  1YYW A;  1X49 A;  4DU8 A;  4K0K I;  4LF7 E;  1KVK A;  4DPY A;  1RC7 A;  4B3S E;  3LTO A;  1S16 A;  3D4J A;  4X62 E;  4NXN E;  1UEK A;  1IBK I;  4Z7Y A;  3C4T A;  4DV1 E;  3OTO I;  2UXB I;  4FWH A;  4JI5 I;  1DAR A;  1Z0T A;  4DR6 I;  2DEJ A;  3J7A M;  1U2R A;  1NHH A;  4YHH I;  1J26 A;  5LMU E;  2HKE A;  4HXZ A;  2CPN A;  4DV6 I;  4DV7 E;  2UXD E;  4ED4 A;  3QT7 A;  4X66 I;  4JI2 E;  3ADJ A;  1N34 I;  4JI0 E;  4DR4 I;  1HNW I;  4DR7 E;  2E5L I;  2B7T A;  4YY3 E;  1I94 I;  4LF4 I;  1S4E A;  4DV5 E;  1GQE A;  2AJ4 A;  4JI3 E;  4WUC A;  2WW4 A;  4PU9 A;  1IBL I;  1NZ0 A;  4M1K A;  4K0K E;  3LLH A;  2EZ6 A;  3ZM7 A;  1VIS A;  4DUY I;  2UXC I;  2HKJ A;  3J80 C;  2VQF I;  1FNM A;  4GKK E;  2MDR A;  1IBK E;  1WHN A;  4B3M I;  3JAM C;  3LPS A;  1Z0B A;  2UUB I;  3ZZU A;  1FJG E;  3ADI A;  3B78 A;  3OTO E;  2UXB E;  1XNQ E;  2N3H A;  4B3R E;  2NUG A;  4DR6 E;  1ELO A;  3HUL A;  5IT9 Q;  2E1R A;  3F0N A;  4ZVI A;  1N0U A;  3ZZ0 A;  2V2Q A;  1ZM9 A;  4LF8 E;  4X65 I;  1IBM I;  4LFA I;  1HNZ I;  4X66 E;  1ZM3 A;  2R42 A;  5GME A;  2DEI A;  4LF4 E;  4DPU A;  4LFC I;  4LFB E;  2ZM6 I;  1IBL E;  4NXM E;  2BM0 A;  4I3H A;  2HK3 A;  2UUA E;  4WUD A;  1K47 A;  1Z0V A;  4JI1 I;  4DU7 A;  4FWG A;  1XNR I;  4DUY E;  4P52 A;  1FKA E;  5A2Q C;  1FWK A;  2VQF E;  5FLX Q;  3C4B A;  4HY1 A;  3V5R A;  2B7V A;  4OX9 I;  2HFS A;  2LJH A;  1ZM2 A;  2RS7 A;  1HNX E;  4LF9 I;  1ZM4 A;  5BR8 E;  4JI4 I;  3PYD A;  4HAC B;  4DPT A;  2LTS A;  2V34 A;  3T1H I;  1UIL A;  4LF6 I;  1UHZ A;  4DV2 I;  5IWA I;  5GMD A;  2YT4 A;  3ADL A;  4LFA E;  1J5E E;  1XMQ I;  2RTX A;  4KQV A;  4PRV A;  4X8W A;  2NA2 A;  4FN5 A;  1H7S A;  1HR0 I;  4JV5 I;  1RR9 A; 
#chains in the Genus database with same CATH topology
 2V2V A;  1B62 A;  2CT1 A;  4GKJ I;  1HK7 A;  2UUC E;  1FI4 A;  4AQY I;  4DUZ E;  3T1Y E;  2BA1 G;  2YTG A;  3C6K A;  1EKZ A;  2D9H A;  3L7Z A;  2EMY A;  4LFC E;  4IZJ B;  3J7A G;  4FW5 A;  2C38 B;  2JEA A;  2ELY A;  2LUP B;  4DV0 I;  4JI6 I;  1YYK A;  1JK1 A;  2JYA A;  5LLQ A;  2LTR A;  2JE6 A;  2NPF A;  2HJJ A;  4GEQ B;  1N3G A;  2HFU A;  1MGT A;  4NZV A;  2A25 A;  2YU8 A;  3MHS C;  1T38 A;  4DMI A;  4BBY A;  1B63 A;  2EQ0 A;  1R6M A;  1Y4S A;  5AC4 A;  2EOH A;  4P7D A;  2NUF A;  4DPW A;  4DR1 I;  2EN8 A;  3Q1Q A;  3VYX A;  1O0W A;  4O4K A;  1QZR A;  1A1G A;  1Z5A A;  2V2Z A;  2X7I A;  2YU5 A;  4OO1 F;  4WXC A;  1Z0W A;  5LMN E;  3M85 D;  3J7Y p;  2JEB A;  2PO0 A;  4FW4 A;  4LF9 E;  4F54 A;  4JI4 E;  1H73 A;  1PIE A;  2BA0 D;  4DR5 I;  3ZZT A;  1WRJ A;  1A1F A;  4IZJ D;  2AE8 A;  3MHH C;  4WUB A;  1EA6 A;  1EI1 A;  4MYU A;  1T4N A;  3M99 B;  4HTG A;  4PRX A;  2LBS B;  3LNU A;  1XMO I;  1X6H A;  3FIG A;  2EE8 A;  4DV2 E;  4LF6 E;  2LE2 A;  1D6T A;  2KON A;  4LCF A;  4WFT A;  1N0V C;  1Y6Z A;  2DMY A;  3PRY A;  4FK5 C;  1F2I G;  1DI2 A;  1N32 I;  1X48 A;  2FV4 B;  1X6F A;  2K4V A;  3B82 A;  2L2K B;  4DKK A;  4JI5 E;  1PKP A;  5IV8 B;  1B69 A;  4UTG A;  4DPX A;  4JI8 I;  2HK2 A;  1XMQ E;  2YTF A;  2PRT A;  4BA1 A;  3CWV A;  2F4V I;  5DRR A;  2H36 X;  3PYF A;  1N36 I;  2CTD A;  4DR2 I;  2EOS A;  2G7H A;  5JEA A;  4LF4 I;  4LF5 I;  4YHH E;  3PYE A;  5C0X A;  1MEY C;  3HPS A;  3WU6 A;  1HR0 E;  4LPF A;  2X36 A;  4B3T I;  3P76 A;  2EML A;  4U3B A;  2Z5B B;  1R6L A;  4JYA I;  3GON A;  1KJK A;  4DV6 E;  1WJP A;  2GS8 A;  4GKJ E;  1Z0C A;  2Q2E B;  1A6F A;  1OJ4 A;  3B8H A;  3Q6N A;  2DRP A;  3U1K A;  4B3S I;  2B3T B;  5DNY A;  3KRN A;  4LU9 A;  4DV0 E;  2EMZ A;  3ZKB A;  2EM9 A;  2L33 A;  1N34 E;  4DR4 E;  1HNW E;  2BA1 D;  4NXN I;  4M30 A;  2V85 A;  2E5L E;  2E72 A;  1I94 E;  2EPK X;  1Z5C A;  2R1F A;  3NZK A;  1X3C A;  1YZ9 A;  4FW9 A;  3WU3 A;  2PO1 A;  3M7N D;  2NN6 A;  5CFF E;  2BM1 A;  4JG4 A;  2RSM A;  5DNX A;  5L3J A;  4F9B B;  4MU3 A;  3DF6 A;  1AH5 A;  2LUQ A;  3OML A;  1NEI A;  2EN4 A;  3H4L A;  4ZYH A;  2LRS A;  1Z1B A;  1YFH A;  2UXC E;  2I13 A;  2ODR C;  1LLM C;  2GLI A;  2BA0 G;  5A6K A;  1AAY A;  2L2M A;  5JEA F;  1KTV A;  1QNT A;  5LMU I;  5C0X F;  1XMO E;  3J80 Q;  4DV4 I;  4IFD D;  2DLK A;  4TUI A;  4B3M E;  2UUB E;  1H74 A;  1NHI A;  3K1J A;  2VQE I;  5ELW A;  3BGH A;  1ZXN A;  2N8X A;  2C39 B;  2CG9 A;  3QT5 A;  3JAM Q;  4USM A;  2JP9 A;  2XEX A;  3P1X A;  3TQM A;  5LL6 R;  2LCE A;  4JI0 I;  5K36 D;  1EH8 A;  1MG7 A;  1DGC A;  2Q8U A;  2F4V E;  4DR7 I;  1N36 E;  1Z59 A;  5DRO A;  1UDQ A;  4X64 I;  3QT8 A;  4YY3 I;  1N33 I;  1EH7 A;  4WX9 A;  4XTJ A;  4O24 A;  3VYY A;  4OOG C;  1OYP A;  2ZBK B;  2L3C A;  4MYT A;  2EMG A;  4JI3 I;  4OO1 A;  2V87 A;  3U1Y A;  2EM3 A;  2EQ1 A;  1Z0E A;  2V8P A;  2ENA A;  2EOO A;  4X65 E;  1KKH A;  2GPI A;  2PO2 B;  3M6A A;  4EMD A;  4F6M A;  4O43 A;  4R03 A;  1IBM E;  4IS9 A;  4FW6 A;  3ZOQ B;  4RPF A;  1HNZ E;  5A69 A;  2PNZ B;  2DB2 A;  2KOU A;  2CZ9 A;  1TF3 A;  4ZYG A;  1WHQ A;  4BHB A;  1USV A;  5A6B D;  2KHX A;  1PDA A;  2ENH A;  2IHR 1;  2LV2 A;  4IJD A;  4L8N A;  4Q28 A;  4R2D A;  4GKK I;  3P06 A;  1G2D C;  2L6M A;  2DGC A;  1WUU A;  3V2U C;  4BCA A;  4AID A;  3K6Q A;  1ZBT A;  2A2C A;  4LCG A;  2ADR A;  1FJG I;  3JTZ A;  2EN3 A;  1FWL A;  4QNK A;  3BBG A;  1YUI A;  2MKD A;  3HJC A;  2PO1 B;  2ZM6 E;  1XNQ I;  4USK A;  3IWC A;  2IER A;  4DV3 I;  2WNR B;  4JI7 I;  4B3R I;  4F2J C;  4DR3 I;  1IQO A;  1H7U A;  5IT9 C;  3M7N G;  2JR1 A;  4BC7 A;  2YTJ A;  1VI7 A;  2R3V A;  4JI1 E;  2NUE A;  1DQ3 A;  1XNR E;  5DRQ A;  4TUG A;  5KL4 A;  4AIM A;  3VHT B;  2EM7 A;  3F6G A;  5ADZ A;  1Z0G A;  1KIJ A;  2EOZ A;  2K7I A;  2MC5 A;  4Q35 B;  5KL2 A;  2J65 A;  2CVE A;  4DV4 E;  4OX9 E;  4IZK A;  5A2Q Q;  4F6N A;  1IBM I;  3VK6 A;  1NHJ A;  4LF8 I;  4KHP I;  4N4R B;  2JOX A;  1YYO A;  2UU9 I;  2VQE E;  1BBO A;  1P42 A;  2JVA A;  2MC6 A;  3J81 C;  4OKG A;  2I9I A;  2A2D A;  4IFD A;  4R1F A;  1T4L B;  2Z5E A;  3T1H E;  2WP8 B;  4HYM A;  2DIX A;  4X64 E;  2EN1 A;  1N33 E;  1OYR A;  2BV3 A;  5IXM B;  1JK2 A;  1Y4U A;  4N3O A;  4LTY A;  3BID A;  4BA2 A;  5IWA E;  2HHH I;  4OZE A;  1RRE A;  2DMI A;  2YTO A;  4GZN C;  4OO1 B;  5K36 A;  4LFB I;  2WZO A;  2YTI A;  4J3D A;  4NXM I;  3EQ1 A;  2FGG A;  2EM5 A;  4M9V C;  3HTX A;  4BC9 A;  1ZBQ A;  2UUA I;  1IQS A;  1PJS A;  4RHB B;  2L2N A;  4I8O A;  1OYS A;  3HQ1 A;  2ELZ A;  3KWR A;  2BR2 B;  2YSO A;  5FLX C;  1YPN A;  2YWQ A;  2EM6 A;  3QT6 A;  4O5G A;  4WYQ B;  1T4O A;  2V89 A;  1WXR A;  4JV5 E;  4KWY A;  2YTP A;  2EM2 A;  2B9D A;  3ZKD A;  4F9A B;  1HNX I;  2RS6 A;  2HC5 A;  4AQY E;  4LF7 I;  3L00 A;  4WPY A;  2EL5 A;  2J7K A;  4HAC A;  5BR8 I;  2L3J A;  3UK3 C;  2JY9 A;  2JOB A;  1ZXM A;  3ADG A;  2O1U A;  3L7Z B;  4DV3 E;  4JI7 E;  1RQ0 A;  5AE3 A;  4JI6 E;  4DR3 E;  1G2F C;  1BKN A;  1XXE A;  2JEA B;  2WBS A;  2VES A;  4X62 I;  1STU A;  1YUJ A;  1Z5B A;  3LML A;  2OI2 A;  4IFD F;  2JE6 B;  4HEI A;  2EOE A;  1BBG A;  4IS1 C;  1X47 A;  2Z5C A;  4DR1 E;  1UDO A;  4DV1 I;  1USU A;  4M0V A;  4MLV A;  3WU4 A;  1KYQ A;  4KHP E;  1PVG A;  2EOY A;  5TSE A;  2VE7 C;  3PS1 A;  1J5E I;  5K36 F;  2V83 A;  2C37 A;  4R8O A;  2UU9 E;  4DR5 E;  1Y5Y A;  1MX0 A;  2JEB B;  2PO0 B;  2EFG A;  4FW7 A;  4J8Z A;  4DXL A;  3Q6M A;  3C6M A;  3EPK A;  3GLL A;  3J81 Q;  3K17 A;  2ENC A;  2EL4 A;  1UDS A;  3KZZ A;  2IOP A;  1A1J A;  1E3P A;  4Z7C A;  4DV7 I;  1H72 C;  1MU5 A;  3H1C A;  2UUC I;  2HHH E;  1UN6 B;  2UXD I;  2ODR D;  4DUZ I;  1X5W A;  3T1Y I;  4IZJ A;  2EM0 A;  3HXL A;  1N32 E;  2ZIT A;  3F6H A;  2C38 A;  4JI2 I;  2EMX A;  3EPJ A;  1ZAA C;  4URL A;  3AV0 A;  4R2R A;  1QU6 A;  4JI8 E;  2VF3 A;  2IOQ A;  5A6J A;  3MSW A;  2N3G A;  2EOJ A;  1YH8 A;  4BA1 B;  2EOQ A;  5KL5 A;  4DR2 E;  4KZS A;  4DV5 I;  4F9C B;  4M2Z A;  4LF5 E;  2EPR A;  4B3T E;  5JEA B;  3EPL A;  5C0X B;  2LJP A;  4MU1 A;  4UT4 A;  1XHK A;  4P7A A;  2EWL A;  1BB8 A;  4JYA E;  1EH6 A;  4X9J A;  3PYG A;  4FWD A;  4BS9 A;  2YPN A;  1YYW A;  3B4T A;  5LMN I;  1X49 A;  2BB8 A;  2LVH A;  3GCM A;  4DU8 A;  4K0K I;  4LF7 E;  2EPC A;  1KVK A;  4DPY A;  1P47 A;  1RC7 A;  4B3S E;  3LTO A;  2CGE A;  2DLQ A;  1S16 A;  3P3C A;  4WXD A;  3D4J A;  5JEA E;  5JEA C;  4X62 E;  5KL6 A;  4NXN E;  2WCC 3;  5C0X C;  2EPP A;  1UEK A;  4MDT A;  1L4S A;  1IBK I;  1PJQ A;  4Z7Y A;  3C4T A;  1SR9 A;  4R2A A;  2GO4 A;  1GTK A;  3HPZ A;  4DV1 E;  4R2S A;  3OTO I;  2EQ3 A;  2UXB I;  4FWH A;  3PS2 A;  4JI5 I;  1DAR A;  2NN6 B;  3PS3 A;  2LMZ A;  1Z0T A;  4DR6 I;  2DEJ A;  3J7A M;  4NBQ A;  1U2R A;  2O3Z A;  1GZ6 A;  1ZU1 A;  2EMB A;  2EPU A;  2YRH A;  1NHH A;  4YHH I;  1J26 A;  2Z5B A;  5LMU E;  2V88 A;  2HKE A;  2YTN A;  4HXZ A;  2CPN A;  2LJU A;  2NN6 E;  4DV7 E;  2JWO A;  2NN6 C;  2UXD E;  1UDN A;  4ED4 A;  4DV6 I;  2EPM X;  4P78 A;  2EL6 A;  4MU4 A;  1YHC A;  3DD6 A;  3QT7 A;  4X66 I;  1A1L A;  4MLQ A;  5EL9 A;  5FWK A;  4JI2 E;  2EM8 A;  3P3E A;  2EOI A;  3ADJ A;  4WSP A;  2YRK A;  2GQ0 A;  4JI0 E;  2L92 A;  2NN6 D;  1N34 I;  4DR4 I;  1HNW I;  2WBU A;  4LFA I;  2M9A A;  4DR7 E;  2E5L I;  2B7T A;  4YY3 E;  2EMK A;  1I94 I;  1S4E A;  3AUZ A;  4DV5 E;  3H09 A;  1GQE A;  2EPN A;  2AJ4 A;  2EP3 A;  1ZR9 A;  2EOR A;  2V8Q B;  4JI3 E;  2CSH A;  2EPZ A;  2JT2 A;  2EOM A;  2LO3 A;  2WW4 A;  4WUC A;  4R2E A;  3WU5 A;  2L8T A;  2GO3 A;  2EMI A;  4PU9 A;  1TF6 A;  1IBL I;  1NZ0 A;  2EPX A;  4M1K A;  3UHM A;  1X6E A;  2EPA A;  5DNL A;  4K0K E;  4NHR A;  3LLH A;  2MDG A;  2EZ6 A;  2GHF A;  4ISA A;  3ZM7 A;  2JXP A;  2MKN A;  2EMW A;  1VIS A;  4DUY I;  1Y60 A;  2UXC I;  2HKJ A;  3KZY A;  3J80 C;  2VQF I;  1FNM A;  4GKK E;  4OO1 E;  4MQY A;  4OO1 C;  2MDR A;  1IBK E;  1WHN A;  4B3M I;  3JAM C;  5KL7 A;  1Z0B A;  3LPS A;  2UUB I;  2C39 A;  3ZZU A;  1FJG E;  3ADI A;  3GME A;  3B78 A;  5A6B A;  4OO1 D;  3OTO E;  2V86 A;  3ECR A;  5AC5 A;  2UXB E;  1XNQ E;  2N3H A;  4B3R E;  2NUG A;  4DR6 E;  2HGH A;  2YTE A;  1E3H A;  1ELO A;  4LOM A;  3QG5 C;  4GQU A;  3HUL A;  1TN9 A;  4LCH A;  5IT9 Q;  2E1R A;  2J7J A;  3F0N A;  2YSP A;  2YZT A;  5AAS A;  2O1V A;  4ZVI A;  1N0U A;  2F8B A;  1T39 A;  2O1T A;  2PO2 A;  3ZZ0 A;  2V2Q A;  2EMA A;  1ZM9 A;  2LT7 A;  4LF8 E;  4X65 I;  5F3W A;  4L5N C;  2BBG A;  2PNZ A;  4IZK B;  1SFE A;  4ZYE A;  5A6A A;  2O1W A;  4R2P A;  1HNZ I;  2M7Q A;  2EM4 A;  4RH8 A;  4X66 E;  1ZM3 A;  3THN A;  1RMD A;  4U3D A;  2EPL X;  2VF1 A;  2EN7 A;  2R42 A;  4BMJ A;  3K85 A;  4R2Q A;  5GME A;  2VRD A;  2EOF A;  4WSG A;  4AM3 A;  5T6J A;  3THO B;  4BHC A;  4R2C A;  2DEI A;  4ZYD A;  4IFD B;  2YRM A;  2RQL A;  4LF4 E;  1A1I A;  2DSY A;  2EOX A;  3CDJ A;  4BA2 B;  2RPC A;  2YTD A;  3IWB A;  4DPU A;  2IES A;  2WNR A;  4LFC I;  4LFB E;  2PNL A;  2ZM6 I;  1IBL E;  4NXM E;  5K36 B;  2BM0 A;  4I3H A;  2RSI A;  1UBD C;  3EPH A;  2E1M A;  2HK3 A;  2UUA E;  4WUD A;  4IFD E;  1K47 A;  4IFD C;  1Z0V A;  3P3G A;  4JI1 I;  4FWG A;  4DU7 A;  1XNR I;  4DUY E;  2EJ4 A;  2PNM A;  3M85 G;  2EPO A;  5EKW A;  4P52 A;  1YSA C;  1FKA E;  5A2Q C;  1FWK A;  2VQF E;  5FLX Q;  3C4B A;  1IMU A;  4HY1 A;  3DJW A;  2B7V A;  3V5R A;  4OX9 I;  4MU0 A;  1A1K A;  2LJH A;  3BF2 A;  2HFS A;  1ZM2 A;  2EMC A;  2RS7 A;  1HNX E;  5K36 E;  5K36 C;  4LF9 I;  1ZM4 A;  5BR8 E;  4JI4 I;  2F1D A;  3PYD A;  4QNJ A;  4HAC B;  4DPT A;  2LTS A;  2V34 A;  2WP8 A;  2EN6 A;  5AE2 A;  3T1H I;  2M4I A;  5C0X E;  1UIL A;  4LF6 I;  1UHZ A;  4FW3 A;  4DV2 I;  1NCS A;  2WBT A;  2EMH A;  5GMD A;  5IWA I;  2YT4 A;  2EN2 A;  1PJT A;  2Z5C B;  3CDI A;  5JEA D;  2YTQ A;  5KL3 A;  5C0X D;  2NAB A;  2FTX B;  3ADL A;  2R76 A;  3RMP A;  1A1H A;  2NN6 F;  4LFA E;  5AE1 A;  1J5E E;  3JU0 A;  2EMF A;  2RTX A;  2JPA A;  2BR2 A;  1XMQ I;  2C37 B;  4KQV A;  4PRV A;  4X8W A;  5DRP A;  2NA2 A;  4FN5 A;  3HKM A;  1H7S A;  1HR0 I;  2M1S A;  1RHY A;  4JV5 I;  1RR9 A;  3IWD A; 
#chains in the Genus database with same CATH homology
 2V2V A;  1B62 A;  4GKJ I;  1HK7 A;  2UUC E;  1FI4 A;  4AQY I;  4DUZ E;  3T1Y E;  1EKZ A;  4LFC E;  4IZJ B;  3J7A G;  2LUP B;  4DV0 I;  4JI6 I;  1YYK A;  2LTR A;  2NPF A;  4GEQ B;  2HFU A;  3PYG A;  3WU5 A;  1B63 A;  4DMI A;  4BBY A;  1Y4S A;  3Q1Q A;  4DR1 I;  4P7D A;  2NUF A;  4DPW A;  3VYX A;  1O0W A;  1QZR A;  2V2Z A;  1Z5A A;  2X7I A;  1Z0W A;  5LMN E;  3J7Y p;  4LF9 E;  4F54 A;  4JI4 E;  1H73 A;  1PIE A;  4DR5 I;  3ZZT A;  4IZJ D;  4WUB A;  1EA6 A;  1EI1 A;  4MYU A;  1T4N A;  4PRX A;  2LBS B;  3LNU A;  1XMO I;  3FIG A;  4LF6 E;  4DV2 E;  1D6T A;  2LE2 A;  2KON A;  4WFT A;  1N0V C;  1Y6Z A;  2DMY A;  3PRY A;  1DI2 A;  1N32 I;  1X48 A;  2FV4 B;  2K4V A;  3B82 A;  2L2K B;  4DKK A;  4JI5 E;  1PKP A;  4UTG A;  4DPX A;  4JI8 I;  2HK2 A;  1XMQ E;  3CWV A;  2F4V I;  2H36 X;  3PYF A;  1N36 I;  4DR2 I;  2G7H A;  4LF5 I;  4YHH E;  3PYE A;  4B3T I;  3HPS A;  3WU6 A;  1HR0 E;  2X36 A;  2Z5B B;  4JYA I;  3GON A;  2GS8 A;  4DV6 E;  4GKJ E;  1Z0C A;  2Q2E B;  1A6F A;  1OJ4 A;  3B8H A;  3Q6N A;  4B3S I;  2B3T B;  5DNY A;  4LU9 A;  4DV0 E;  3ZKB A;  1N34 E;  2L33 A;  4DR4 E;  1HNW E;  4NXN I;  4M30 A;  2V85 A;  2E5L E;  1I94 E;  1Z5C A;  3WU3 A;  1YZ9 A;  4FW9 A;  5CFF E;  2BM1 A;  4JG4 A;  2RSM A;  5L3J A;  4F9B B;  3DF6 A;  2LUQ A;  3OML A;  3H4L A;  2LRS A;  2UXC E;  2ODR C;  2L2M A;  5LMU I;  1KTV A;  1XMO E;  3J80 Q;  4DV4 I;  4TUI A;  4B3M E;  2UUB E;  1H74 A;  1NHI A;  3K1J A;  2VQE I;  1ZXN A;  2CG9 A;  3QT5 A;  3JAM Q;  4USM A;  2XEX A;  3P1X A;  5LL6 R;  4JI0 I;  1MG7 A;  2F4V E;  4DR7 I;  1N36 E;  1Z59 A;  4X64 I;  1N33 I;  3QT8 A;  4YY3 I;  4XTJ A;  3VYY A;  4OOG C;  4MYT A;  2ZBK B;  2L3C A;  4JI3 I;  2V87 A;  1Z0E A;  2V8P A;  4X65 E;  1KKH A;  3M6A A;  4EMD A;  1IBM E;  4R03 A;  3ZOQ B;  4RPF A;  1HNZ E;  2DB2 A;  2KOU A;  2CZ9 A;  1WHQ A;  1USV A;  2KHX A;  2IHR 1;  4L8N A;  4Q28 A;  4GKK I;  3P06 A;  2L6M A;  1WUU A;  3V2U C;  4BCA A;  3K6Q A;  1ZBT A;  2A2C A;  1FJG I;  3JTZ A;  1FWL A;  3HJC A;  2ZM6 E;  1XNQ I;  4USK A;  3IWC A;  4DV3 I;  4JI7 I;  4B3R I;  4DR3 I;  1H7U A;  5IT9 C;  2JR1 A;  4BC7 A;  2R3V A;  4JI1 E;  2NUE A;  1DQ3 A;  1XNR E;  4TUG A;  3F6G A;  5ADZ A;  1Z0G A;  1KIJ A;  2MC5 A;  4DV4 E;  4OX9 E;  4IZK A;  5A2Q Q;  4LF8 I;  3VK6 A;  1NHJ A;  4KHP I;  2JOX A;  1YYO A;  2UU9 I;  2VQE E;  2JVA A;  2MC6 A;  3J81 C;  2A2D A;  4R1F A;  1T4L B;  2Z5E A;  3T1H E;  4HYM A;  2DIX A;  4X64 E;  1N33 E;  2BV3 A;  4N3O A;  1Y4U A;  4LTY A;  5IWA E;  2HHH I;  1RRE A;  4LFB I;  2WZO A;  4NXM I;  2FGG A;  3HTX A;  4BC9 A;  1ZBQ A;  2UUA I;  2L2N A;  4I8O A;  3HQ1 A;  3KWR A;  5FLX C;  3QT6 A;  4WYQ B;  1T4O A;  2V89 A;  1WXR A;  4JV5 E;  2B9D A;  3ZKD A;  4F9A B;  1HNX I;  2RS6 A;  4AQY E;  4LF7 I;  4WPY A;  5BR8 I;  2J7K A;  4HAC A;  2L3J A;  2JY9 A;  2JOB A;  1ZXM A;  3ADG A;  2O1U A;  4DV3 E;  4JI7 E;  1RQ0 A;  5AE3 A;  4JI6 E;  4DR3 E;  1BKN A;  4X62 I;  1STU A;  1Z5B A;  2OI2 A;  3LML A;  1X47 A;  2Z5C A;  4DR1 E;  4DV1 I;  1USU A;  4M0V A;  3WU4 A;  4KHP E;  1PVG A;  2VE7 C;  1J5E I;  2V83 A;  4R8O A;  2UU9 E;  4DR5 E;  1MX0 A;  2EFG A;  4J8Z A;  4DXL A;  3Q6M A;  3J81 Q;  3K17 A;  2IOP A;  4Z7C A;  4DV7 I;  1H72 C;  1MU5 A;  2UUC I;  2UXD I;  2HHH E;  2ODR D;  4DUZ I;  3T1Y I;  4IZJ A;  1N32 E;  3HXL A;  2ZIT A;  3F6H A;  4JI2 I;  4URL A;  3AV0 A;  1QU6 A;  4JI8 E;  2VF3 A;  2IOQ A;  3MSW A;  2N3G A;  4DR2 E;  4KZS A;  4DV5 I;  4F9C B;  4M2Z A;  4LF5 E;  4B3T E;  2LJP A;  4UT4 A;  1XHK A;  4P7A A;  2EWL A;  4JYA E;  4FWD A;  4BS9 A;  5LMN I;  1YYW A;  1X49 A;  4DU8 A;  4K0K I;  4LF7 E;  1KVK A;  4DPY A;  1RC7 A;  4B3S E;  3LTO A;  2CGE A;  1S16 A;  3D4J A;  4X62 E;  4NXN E;  1UEK A;  1IBK I;  4Z7Y A;  3C4T A;  1SR9 A;  3HPZ A;  4DV1 E;  3OTO I;  2UXB I;  4FWH A;  4JI5 I;  1DAR A;  2LMZ A;  1Z0T A;  4DR6 I;  2DEJ A;  3J7A M;  1U2R A;  1GZ6 A;  1NHH A;  4YHH I;  1J26 A;  2Z5B A;  5LMU E;  2V88 A;  2HKE A;  4HXZ A;  2CPN A;  4DV6 I;  4DV7 E;  2JWO A;  2UXD E;  4ED4 A;  4P78 A;  3QT7 A;  4X66 I;  5FWK A;  4JI2 E;  3ADJ A;  4WSP A;  2GQ0 A;  1N34 I;  4JI0 E;  2L92 A;  4DR4 I;  1HNW I;  4DR7 E;  2E5L I;  2B7T A;  4YY3 E;  1I94 I;  4LF4 I;  1S4E A;  3AUZ A;  4DV5 E;  3H09 A;  1GQE A;  2AJ4 A;  4JI3 E;  2V8Q B;  4WUC A;  2WW4 A;  2L8T A;  4PU9 A;  1IBL I;  1NZ0 A;  4M1K A;  4K0K E;  3LLH A;  2EZ6 A;  3ZM7 A;  1VIS A;  4DUY I;  2UXC I;  2HKJ A;  3J80 C;  2VQF I;  1FNM A;  4GKK E;  2MDR A;  1IBK E;  1WHN A;  4B3M I;  3JAM C;  3LPS A;  1Z0B A;  2UUB I;  3ZZU A;  1FJG E;  3ADI A;  3B78 A;  3OTO E;  2V86 A;  2UXB E;  1XNQ E;  2N3H A;  4B3R E;  2NUG A;  4DR6 E;  1ELO A;  3HUL A;  5IT9 Q;  2E1R A;  3F0N A;  5AAS A;  2YZT A;  2O1V A;  4ZVI A;  1N0U A;  2F8B A;  2O1T A;  3ZZ0 A;  2V2Q A;  1ZM9 A;  4LF8 E;  4X65 I;  5F3W A;  4L5N C;  1IBM I;  4IZK B;  4LFA I;  2O1W A;  1HNZ I;  2M7Q A;  4X66 E;  1ZM3 A;  2VF1 A;  2R42 A;  4BMJ A;  3K85 A;  5GME A;  5T6J A;  2DEI A;  4LF4 E;  2DSY A;  3IWB A;  4DPU A;  4LFC I;  4LFB E;  2PNL A;  2ZM6 I;  1IBL E;  4NXM E;  2BM0 A;  4I3H A;  2E1M A;  2HK3 A;  2UUA E;  4WUD A;  1K47 A;  1Z0V A;  4JI1 I;  4DU7 A;  4FWG A;  1XNR I;  4DUY E;  2PNM A;  4P52 A;  1FKA E;  5A2Q C;  1FWK A;  2VQF E;  5FLX Q;  3C4B A;  4HY1 A;  3DJW A;  2B7V A;  3V5R A;  4OX9 I;  2HFS A;  2LJH A;  1ZM2 A;  2RS7 A;  1HNX E;  4LF9 I;  1ZM4 A;  5BR8 E;  4JI4 I;  3PYD A;  4HAC B;  4DPT A;  2LTS A;  2V34 A;  5AE2 A;  3T1H I;  2M4I A;  1UIL A;  4LF6 I;  1UHZ A;  4DV2 I;  5IWA I;  5GMD A;  2YT4 A;  2Z5C B;  2FTX B;  3ADL A;  3RMP A;  4LFA E;  1J5E E;  5AE1 A;  2RTX A;  3JU0 A;  1XMQ I;  4KQV A;  4PRV A;  4X8W A;  2NA2 A;  4FN5 A;  1H7S A;  1HR0 I;  2M1S A;  4JV5 I;  1RR9 A;  3IWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...