4LF6E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf6E02
4B3SE 2YT4A 1Z5AA 4DV4E 2J7KA 5LL6R 4XTJA 1PKPA 4UTGA 1HNXE 4JI0E 2HFSA 2E1RA 4DR4E 1YZ9A 1BKNA 1A6FA 1UEKA 3ZZUA 3QT8A 4LF8I 2X7IA 4JYAI 1XMQI 1IBKE 1WHNA 5LMUE 2L3CA 1N34E 2UU9I 1N32I 4UT4A 4DV6E 1NZ0A 4LF9E 4X64E 3T1HI 2UU9E 1N34I 4R1FA 2GS8A 3PYGA 4DUYI 1WUUA 4B3RE 5GMEA 2DB2A 4DU8A 1XHKA 1N33I 2VQEI 4DR3I 1H73A 2WW4A 4RPFA 1YYWA 1Z5BA 1T4LB 4JI8E 2E5LE 1HNXI 4FWDA 4DV7I 4KHPE 1ZBTA 4LF4I 4DR4I 2UXDI 4JI6I 1UILA 2X36A 2BM0A 1UHZA 4DR7E 4LF7I 2A2DA 3VYYA 1YYKA 2N3HA 1ZXNA 3WU3A 4JV5E 4WUCA 2NA2A 1Z0VA 4JI4E 4JI0I 1DARA 2UXBE 4B3TE 3P1XA 1HR0I 2UXCI 1XNRE 2Q2EB 4HYMA 2R42A 4HXZA 3ADIA 4B3TI 1WHQA 1XMOI 4JI7E 3J81C 3ZKBA 5L3JA 1I94E 4JI3E 4B3ME 1IBMI 2V2QA 4USMA 4DUZE 2A2CA 4FWHA 1J26A 1IBLI 1X48A 3ADGA 1XNRI 3V5RA 4YY3I 4LFAI 4B3RI 1X49A 2F4VE 1J5EE 4DR5I 4DR2I 1H74A 4LF6E 1B63A 1T4NA 1RREA 4LFBI 1B62A 2VF3A 4NXNI 4GKJI 2LRSA 5BR8I 2RTXA 4K0KE 2L2KB 4JI8I 4DPUA 1FI4A 2VQFI 2HK3A 2HKEA 1Z0WA 1ZM9A 3K17A 2V8PA 1GQEA 2CPNA 2RS6A 2AJ4A 5IWAI 2L33A 4DR6E 1HNZI 2LBSB 5A2QQ 3PYFA 4K0KI 2LUPB 2NUEA 2DMYA 1XMOE 2B7TA 1PIEA 2VQFE 2UUBE 4DV3I 2RS7A 4X65I 4HY1A 4DPWA 2NUGA 1N32E 4LFBE 3QT7A 1RR9A 4DKKA 3QT6A 4LF8E 1EA6A 4LF9I 4DU7A 4PU9A 1KIJA 4DUZI 1I94I 4JI3I 4LF6I 1N36I 1S4EA 4NXME 4NXNE 4GKJE 4JI2I 2IHR1 3F0NA 4B3SI 2UUCI 4DV0E 4DV7E 2EZ6A 3QT5A 1Z0EA 2UUAE 2MDRA 3ZM7A 2ZM6E 2UUBI 4WFTA 4ZVIA 2F4VI 4X66I 1PVGA 4DV3E 2EFGA 3OTOI 2LTRA 2ZM6I 4LF5E 4DR1I 2JVAA 1Z0CA 3J7AG 3ZZTA 4X66E 1H7UA 5LMNI 2ZBKB 4JI1E 1FJGI 2UXDE 5CFFE 5IWAE 2HHHI 4HACA 2DEJA 3JAMC 5GMDA 3ZZ0A 1DI2A 1VISA 3HULA 4M1KA 3WU6A 1Z0TA 1X47A 3ADJA 4X62E 3LPSA 1HNWE 1RC7A 4DUYE 3PYDA 1S16A 4WUBA 1H72C 4WYQB 5FLXQ 1N33E 1QZRA 1NHIA 4P7AA 1KKHA 4DPXA 2HK2A 4GKKI 1FKAE 2NUFA 4JYAE 3J81Q 4LFCI 4USKA 4X62I 4WUDA 1H7SA 3ZKDA 2OI2A 3PYEA 4DR1E 1MG7A 4LF5I 4ED4A 4DV5E 3CWVA 3LNUA 4Z7YA 4M30A 4X64I 5BR8E 4DV0I 1MX0A 1MU5A 4JI1I 1FNMA 2N3GA 4DV4I 1HR0E 5A2QC 4DV1E 4PRXA 1XNQE 4YHHE 4HACB 1ZM3A 4YHHI 2L2NA 4JI4I 5FLXC 3J7Yp 4FWGA 1Z0BA 3B82A 1ZM2A 4LF4E 2BM1A 4DPTA 4KHPI 4DV2I 2DEIA 4X65E 1RQ0A 3M6AA 3LTOA 1N36E 1Z0GA 1Z5CA 1IBME 4B3MI 2KHXA 4M2ZA 4JI2E 4JI5I 2L3JA 4DPYA 4MYTA 1FWLA 1FWKA 1YYOA 4LFCE 4JI7I 4DXLA 3D4JA 2HKJA 2VQEE 3GONA 3T1YE 2UXCE 3J80Q 2UUCE 3JAMQ 3ADLA 4Z7CA 1EI1A 4DR7I 4KQVA 1T4OA 1XNQI 3Q1QA 1ZM4A 2LUQA 4JI6E 4EMDA 3C4TA 4DV6I 4AQYI 4JV5I 3HTXA 1Z59A 4YY3E 1NHHA 1STUA 4DV1I 1KTVA 2ZITA 4DR5E 4DR6I 4URLA 3V2UC 3J80C 4LF7E 2CZ9A 2B7VA 1FJGE 2XEXA 1ELOA 2B3TB 2LTSA 3OTOE 4X8WA 5LMNE 2HHHE 3C4BA 2NPFA 4AQYE 2LJHA 3T1YI 3K1JA 1D6TA 2E5LI 3B8HA 5IT9C 5LMUI 2HFUA 5IT9Q 1XMQE 1QU6A 4DV2E 4I3HA 1U2RA 1ZXMA 2V2ZA 4FW9A 4GKKE 1O0WA 4DR3E 4JG4A 3T1HE 1HNZE 2DIXA 1J5EI 1HNWI 4NXMI 2JY9A 4FN5A 3WU4A 3B78A 4OOGC 4DR2E 2BV3A 1KVKA 1IBLE 2LJPA 4LFAE 4PRVA 2UUAI 2V34A 4OX9E 1IBKI 2UXBI 3VYXA 4OX9I 3LLHA 1K47A 2L2MA 2R3VA 1OJ4A 2RSMA 4MYUA 4JI5E 3H4LA 4P52A 4DV5I 3WU5A 2V2VA 1EKZA 1N0UA 1NHJA 1N0VC 3J7AM
chains in the Genus database with same CATH superfamily
2WBTA 4IZJA 4IFDA 4R8OA 4B3SE 2YT4A 1F2IG 1Z5AA 4DV4E 2FGGA 1Y4SA 3M7NG 2FTXB 2BA1D 2NN6F 4R2RA 2J7KA 2L6MA 4FW6A 5C0XA 4Q35B 5LL6R 2CGEA 4XTJA 1PKPA 4UTGA 3F6HA 2EPUA 1HNXE 2I13A 4JI0E 4GQUA 4GZNC 2HFSA 2PO2A 2EQ3A 1YUIA 2CVEA 3CDIA 2EMLA 1JK1A 2E1RA 2IESA 4DR4E 1YZ9A 2EN8A 2R76A 1BKNA 1A6FA 1X6EA 1UEKA 3ZZUA 3QT8A 4LF8I 4P78A 2X7IA 4JYAI 1XMQI 1IBKE 1WHNA 4BS9A 3F6GA 4ISAA 4IFDF 2O1WA 2EPMX 2JOBA 2L3CA 5LMUE 1N34E 2UU9I 2O1TA 3EPHA 4MU4A 1N32I 4UT4A 2ADRA 4DV6E 1NZ0A 4LF9E 3THOB 4NHRA 2D9HA 4X64E 3T1HI 4MLVA 1T38A 2UU9E 1N34I 4R1FA 2GS8A 2WBUA 1WXRA 4BMJA 3MHHC 1YH8A 2F8BA 3PYGA 4DUYI 2EN3A 1WUUA 4LCGA 4B3RE 2V8QB 2DB2A 1P47A 5A6KA 1XHKA 4KWYA 5GMEA 4DU8A 4BBYA 1N33I 4MLQA 4BA1A 2PO0A 2VQEI 1A1KA 1DGCA 2L92A 1Y4UA 4DR3I 1H73A 1PJTA 2WW4A 3L00A 2EOEA 1USUA 4RPFA 1YYWA 1Z5BA 2NN6A 2CTDA 1T4LB 5JEAE 2YSOA 4JI8E 1TN9A 2PNZA 4OO1B 1X5WA 2E5LE 1HNXI 4FWDA 4DV7I 2VF1A 4F9AB 4OZEA 4GEQB 4IFDB 1QNTA 1R6MA 4KHPE 1ZBTA 4LF4I 2YTNA 2JR1A 3JU0A 4DR4I 3IWCA 2EM5A 2EPCA 4JI6I 2UXDI 1UILA 4AIDA 2EPRA 2MKDA 4BHCA 2EM2A 2LE2A 2EE8A 3RMPA 2LO3A 2X36A 4FW7A 2YRHA 2EMYA 1B69A 4X9JA 2BM0A 4R2DA 1UHZA 4DR7E 4LF7I 2A2DA 3VYYA 1YYKA 2N3HA 2PO2B 1Y5YA 3UHMA 1UDOA 4O24A 1ZXNA 4BHBA 2NN6E 3L7ZB 3WU3A 1X3CA 2LVHA 4F6NA 4JV5E 3HKMA 4WUCA 2NA2A 4FW5A 1Z0VA 4JI4E 2EN2A 3DF6A 2IOQA 2NN6C 5DRRA 2Z5CB 2EPLX 1OYPA 4JI0I 4AM3A 1DARA 4R03A 2UXBE 4B3TE 3P1XA 2EJ4A 1HR0I 2UXCI 3PRYA 1XNRE 1ZR9A 4TUGA 2Q2EB 4HYMA 2R42A 3DD6A 2YTFA 3EPJA 4HXZA 2ELYA 3ADIA 1WHQA 2EM6A 2YTGA 1XMOI 2M9AA 4B3TI 4JI7E 3J81C 4MU0A 2NN6D 5DRPA 1ZU1A 5A6BD 3ZKBA 5L3JA 3HXLA 1I94E 1SR9A 4B3ME 4JI3E 1IBMI 2V2QA 4USMA 1EH6A 4DUZE 4OO1C 2G7HA 2A2CA 4FWHA 2VESA 2JYAA 1J26A 1IBLI 1X48A 1ZBQA 2EMHA 1XXEA 2EOZA 3TQMA 5DNYA 3ADGA 4OO1A 1XNRI 3HQ1A 3LMLA 4R2PA 3V5RA 4YY3I 5KL7A 4LFAI 1E3PA 4B3RI 1X49A 2F4VE 1A1HA 1MGTA 1IQSA 4Q28A 1J5EE 4DR5I 2DGCA 2GQ0A 4DR2I 4OO1D 4WSGA 1H74A 4LF6E 1N3GA 2C39A 1B63A 1T4NA 1RREA 4LFBI 1B62A 2JXPA 2VF3A 4F2JC 2YTPA 1A1LA 3H09A 4NXNI 2LRSA 1YFHA 2RPCA 2RTXA 1T39A 1UDSA 5BR8I 2PNMA 2EM4A 2M1SA 4K0KE 4IZJD 2E72A 2O3ZA 2L2KB 4JI8I 5AASA 5A6BA 4DPUA 1FI4A 2EWLA 2VQFI 2HK3A 2HKEA 3GCMA 1Z0WA 5T6JA 1UBDC 1ZM9A 2EOIA 3FIGA 3K17A 4FW4A 2JEAA 3J7AM 2V8PA 1GQEA 1YUJA 4MU1A 2CPNA 1ZAAC 2RS6A 3AUZA 2EL6A 1VI7A 2EORA 2AJ4A 5IWAI 5JEAF 2WZOA 2L33A 4DR6E 1HNZI 2LBSB 5A2QQ 2K4VA 2EOMA 3QG5C 1UDQA 3PYFA 4K0KI 2LUPB 5C0XC 2LJUA 2NUEA 2DMYA 3M99B 3NZKA 1WJPA 1XMOE 2JT2A 2B7TA 1PIEA 2VQFE 2EPKX 2UUBE 3HPSA 5KL3A 4R2CA 4O4KA 5C0XB 4DV3I 1BB8A 2EQ0A 2RS7A 4X65I 5K36E 2CT1A 2DMIA 4F54A 2EM8A 4HY1A 4DPWA 3ECRA 2NUGA 4BC7A 1N32E 4LFBE 3QT7A 1Z1BA 1DQ3A 5K36F 1RR9A 2J7JA 4BCAA 1USVA 2DLKA 4DKKA 4F9BB 4LCFA 2PNLA 3QT6A 4LF8E 1EA6A 4U3BA 4LF9I 5AC4A 4DU7A 4PU9A 1KIJA 4DUZI 2ODRC 2EM3A 1I94I 4JI3I 4LF6I 1N36I 1PJSA 1S4EA 4WXCA 3M85D 2EMBA 1X6HA 4NXME 3KZZA 4NXNE 2JPAA 4GKJE 4JI2I 2IHR1 2KOUA 2IERA 3KZYA 3F0NA 1AAYA 2HJJA 4B3SI 4IJDA 2UUCI 2V88A 4DV0E 2ENAA 2EMAA 4DV7E 2EZ6A 2EOOA 3QT5A 4BC9A 4BA1B 2PO0B 3PS3A 1Z0EA 2UUAE 2MDRA 3ZM7A 2ZM6E 1P42A 2UUBI 4WFTA 5C0XD 3KWRA 2ENHA 1AH5A 4RHBB 5EL9A 2EQ1A 4ZVIA 2EMGA 5IXMB 4MDTA 5A6AA 2F4VI 1KYQA 3VHTB 1PVGA 4DV3E 2EFGA 5DRQA 4X66I 2IOPA 2NN6B 3OTOI 2LTRA 2JE6B 2ZM6I 4LF5E 1RMDA 2JVAA 4DR1I 2WP8A 1Z0CA 3J7AG 2EOSA 2YTQA 3EPKA 3ZZTA 4X66E 1H7UA 4IS9A 4IZKB 5LMNI 2ZBKB 5JEAD 2JWOA 2VE7C 2N8XA 4JI1E 1GZ6A 2EPOA 1FJGI 2V83A 2UXDE 5CFFE 1BBGA 5IWAE 2HHHI 3P3GA 4HACA 4WXDA 2ODRD 2R1FA 2EN1A 2DEJA 2EN7A 2BR2A 3JAMC 2JEBA 1X6FA 5KL4A 3ZOQB 5GMDA 2KONA 1DI2A 3ZZ0A 1VISA 1LLMC 3HULA 4M1KA 3WU6A 2ELZA 2C38A 2EMKA 2V89A 1Z0TA 1X47A 4QNKA 3ADJA 4X62E 1TF3A 2BA0D 3LPSA 2V87A 2VRDA 1HNWE 1RC7A 5KL2A 4DUYE 2YTDA 4LTYA 1YSAC 3PYDA 4DMIA 1S16A 4WUBA 1H72C 4WYQB 5FLXQ 2EPAA 3UK3C 3K85A 2JOXA 1N33E 3P06A 1A1JA 3PS1A 2C37A 2JP9A 1QZRA 1NHIA 3U1KA 4P7AA 2EL5A 4J8ZA 1KKHA 2V86A 2HK2A 4DPXA 3K6QA 4IFDE 2MC5A 5ELWA 4GKKI 3BF2A 1FKAE 2NUFA 4JYAE 3GMEA 2DLQA 4FW3A 3J81Q 2YPNA 4USKA 2EPZA 4LFCI 2EPPA 5C0XE 4X62I 4WUDA 5K36B 4J3DA 1H7SA 3ZKDA 2OI2A 3PYEA 2EMZA 4DR1E 4M9VC 1MG7A 4MU3A 1G2DC 4ED4A 4DV5E 2WP8B 3CWVA 4LF5I 3LNUA 4Z7YA 4M30A 2EOYA 1NEIA 4X64I 4BA2A 2MKNA 5BR8E 2BA0G 4IZKA 3HJCA 4DV0I 1NCSA 1MX0A 1PJQA 5KL5A 3THNA 4WX9A 3BGHA 2GO4A 3C6MA 4GKJI 2YTIA 4NZVA 3JTZA 1MU5A 2C39B 2EPNA 4IS1C 2N3GA 1FNMA 2B9DA 3Q6MA 4JI1I 5A2QC 1HR0E 4DV4I 4DV1E 4N3OA 4PRXA 1XNQE 4YHHE 4HACB 5EKWA 1SFEA 1ZM3A 4RH8A 2GLIA 4YHHI 2L2NA 4JI4I 5FLXC 2WNRA 1Y6ZA 2BR2B 5DNXA 3J7Yp 2YU8A 4FWGA 4LCHA 5JEAA 1Z0BA 4ZYEA 2MC6A 2RQLA 3B82A 4MQYA 3BIDA 4ZYGA 2M4IA 1ZM2A 1BBOA 2ENCA 4LF4E 2BM1A 2CG9A 4DPTA 4KHPI 2I9IA 1A1IA 2PO1A 4L8NA 4DV2I 2DEIA 2WBSA 4X65E 4R2EA 5A69A 1RQ0A 3M6AA 3EQ1A 3PS2A 1N36E 2AE8A 3LTOA 1Z0GA 2YRMA 1Z5CA 2O1VA 1IBME 5DNLA 4B3MI 2LMZA 5AE3A 3OMLA 5LLQA 2KHXA 4M2ZA 3MHSC 4JI2E 2C37B 4JI5I 2EOFA 4R2AA 5AE2A 2CSHA 3MSWA 4TUIA 4KZSA 5K36C 2L3JA 4DPYA 4MYTA 1FWKA 1FWLA 1YYOA 4LFCE 4JI7I 4HEIA 4LPFA 4DXLA 4R2SA 3D4JA 5ADZA 2HKJA 2VQEE 2Z5EA 3GONA 3T1YE 4NBQA 2UXCE 2RSIA 2EM7A 3BBGA 2BA1G 3J80Q 5IV8B 2UUCE 2DSYA 3JAMQ 1EH8A 2EOQA 3ADLA 2PRTA 2EMCA 1GTKA 2YWQA 3H1CA 4LOMA 2LT7A 2Z5BA 4ZYHA 4Z7CA 5JEAC 1EI1A 4DR7I 5AC5A 4IFDD 4KQVA 1T4OA 4WSPA 1XNQI 3P3CA 1E3HA 3Q1QA 2Q8UA 1ZM4A 3B4TA 2A25A 2LUQA 1YPNA 2WNRB 4JI6E 3L7ZA 3Q6NA 1PDAA 3C4TA 4QNJA 4EMDA 5JEAB 4DV6I 4AQYI 4JV5I 4OO1E 5F3WA 2L8TA 3HTXA 1Z59A 4O43A 4YY3E 1NHHA 1STUA 2GHFA 4DV1I 2BBGA 1KTVA 2ZITA 4O5GA 2Z5CA 4DR5E 4DR6I 3DJWA 4URLA 3V2UC 3J80C 4LF7E 2PO1B 2GPIA 2CZ9A 1EH7A 2B7VA 2EMFA 5KL6A 1FJGE 2JE6A 2YZTA 1UN6B 2EL4A 1ELOA 2XEXA 5C0XF 2B3TB 2LTSA 4P7DA 3OTOE 2HGHA 2F1DA 4X8WA 2YTOA 3IWDA 2EOJA 5LMNE 2HHHE 2HC5A 3C4BA 1A1FA 2NPFA 1OYRA 4IZJB 4AQYE 1KJKA 2LJHA 3GLLA 3T1YI 3K1JA 2LCEA 4F9CB 5K36D 1D6TA 2E5LI 2EOHA 5IT9C 3B8HA 4LU9A 5LMUI 2HFUA 2EN4A 5IT9Q 1XMQE 1QU6A 2EMIA 1A1GA 1RHYA 2E1MA 1WRJA 3C6KA 2EM0A 4M0VA 4DV2E 4I3HA 3KRNA 5FWKA 1U2RA 1ZXMA 2V2ZA 4FW9A 2EPXA 2EN6A 4R2QA 4ZYDA 4GKKE 2DRPA 1O0WA 2FV4B 4DR3E 4JG4A 2JEBB 2YTJA 4AIMA 3T1HE 1HNZE 2DIXA 1J5EI 2NABA 5DROA 2YU5A 2GO3A 4NXMI 2JY9A 1HNWI 4FN5A 4I8OA 3VK6A 2V85A 2C38B 3WU4A 3AV0A 3B78A 4OOGC 4DR2E 2BV3A 2Z5BB 2WCC3 1G2FC 3CDJA 4IFDC 2EMXA 1KVKA 1IBLE 1MEYC 2LV2A 2YTEA 4N4RB 2M7QA 1R6LA 4WPYA 2LJPA 4F6MA 4LFAE 1YHCA 4PRVA 3IWBA 1JK2A 2K7IA 2BB8A 2UUAI 2V34A 4OX9E 2EOXA 1IBKI 2UXBI 5A6JA 2YSPA 3EPLA 3U1YA 1L4SA 1TF6A 3VYXA 4OX9I 3LLHA 4OO1F 2H36X 1Y60A 1UDNA 4U3DA 2JEAB 1IQOA 1K47A 2L2MA 2MDGA 2EP3A 2RSMA 2YRKA 1IMUA 1OJ4A 2R3VA 4MYUA 4FK5C 1OYSA 4OKGA 4JI5E 3M7ND 5K36A 1HK7A 3H4LA 2O1UA 3P3EA 4P52A 4HTGA 5AE1A 3P76A 2V2VA 3WU5A 4L5NC 4DV5I 5TSEA 2PNZB 1EKZA 2EM9A 1N0UA 4BA2B 2J65A 1NHJA 1N0VC 3M85G 2EMWA 3HPZA
chains in the Genus database with same CATH topology
4IZJA 4R8OA 4B3SE 2YT4A 1Z5AA 4DV4E 2FGGA 1Y4SA 2FTXB 2J7KA 2L6MA 5LL6R 2CGEA 4XTJA 1PKPA 4UTGA 3F6HA 1HNXE 4JI0E 2HFSA 2E1RA 4DR4E 1YZ9A 1BKNA 1A6FA 1UEKA 3ZZUA 3QT8A 4LF8I 4P78A 2X7IA 4JYAI 1XMQI 1IBKE 1WHNA 4BS9A 3F6GA 2O1WA 2JOBA 5LMUE 2L3CA 1N34E 2UU9I 2O1TA 1N32I 4UT4A 4DV6E 1NZ0A 4LF9E 4X64E 3T1HI 2UU9E 1N34I 4R1FA 2GS8A 1WXRA 4BMJA 2F8BA 3PYGA 4DUYI 1WUUA 4B3RE 2V8QB 2DB2A 5GMEA 4DU8A 1XHKA 4BBYA 1N33I 2VQEI 2L92A 1Y4UA 4DR3I 1H73A 2WW4A 1USUA 4RPFA 1YYWA 1Z5BA 1T4LB 4JI8E 2E5LE 1HNXI 4FWDA 4DV7I 2VF1A 4F9AB 4GEQB 4KHPE 1ZBTA 4LF4I 4DR4I 2JR1A 3JU0A 3IWCA 2UXDI 4JI6I 1UILA 2LE2A 3RMPA 2X36A 2BM0A 1UHZA 4DR7E 4LF7I 2A2DA 3VYYA 1YYKA 2N3HA 1ZXNA 3WU3A 4JV5E 4WUCA 2NA2A 1Z0VA 4JI4E 3DF6A 2IOQA 2Z5CB 4JI0I 1DARA 4R03A 2UXBE 4B3TE 3P1XA 1HR0I 2UXCI 3PRYA 1XNRE 4TUGA 2Q2EB 4HYMA 2R42A 4HXZA 3ADIA 4B3TI 1WHQA 1XMOI 4JI7E 3J81C 3ZKBA 5L3JA 3HXLA 1I94E 1SR9A 4B3ME 4JI3E 1IBMI 2V2QA 4USMA 4DUZE 2G7HA 2A2CA 4FWHA 1J26A 1IBLI 1X48A 1ZBQA 5DNYA 3ADGA 1XNRI 3HQ1A 3LMLA 3V5RA 4YY3I 4LFAI 4B3RI 1X49A 2F4VE 4Q28A 1J5EE 4DR5I 2GQ0A 4DR2I 1H74A 4LF6E 1B63A 1T4NA 1RREA 4LFBI 1B62A 2VF3A 3H09A 4NXNI 2LRSA 4GKJI 5BR8I 2RTXA 2PNMA 2M1SA 4K0KE 4IZJD 2L2KB 4JI8I 5AASA 4DPUA 1FI4A 2EWLA 2VQFI 2HK3A 2HKEA 1Z0WA 5T6JA 1ZM9A 3FIGA 3K17A 2V8PA 1GQEA 2CPNA 2RS6A 3AUZA 2AJ4A 5IWAI 2WZOA 2L33A 4DR6E 1HNZI 2LBSB 5A2QQ 2K4VA 3PYFA 4K0KI 2LUPB 2NUEA 2DMYA 1XMOE 2B7TA 1PIEA 2VQFE 2UUBE 3HPSA 4DV3I 2RS7A 4X65I 4F54A 4HY1A 4DPWA 2NUGA 4BC7A 1N32E 4LFBE 3QT7A 1DQ3A 1RR9A 1USVA 4BCAA 4DKKA 4F9BB 2PNLA 3QT6A 4LF8E 1EA6A 4LF9I 4DU7A 4PU9A 1KIJA 4DUZI 2ODRC 1I94I 4JI3I 4LF6I 1N36I 1S4EA 4NXME 4NXNE 4GKJE 4JI2I 2IHR1 2KOUA 3F0NA 4B3SI 2UUCI 2V88A 4DV0E 4DV7E 2EZ6A 3QT5A 4BC9A 1Z0EA 2UUAE 2MDRA 3ZM7A 2ZM6E 2UUBI 4WFTA 3KWRA 4ZVIA 2F4VI 4X66I 1PVGA 4DV3E 2EFGA 2IOPA 3OTOI 2LTRA 2ZM6I 4LF5E 4DR1I 2JVAA 1Z0CA 3J7AG 3ZZTA 4X66E 1H7UA 4IZKB 5LMNI 2ZBKB 2JWOA 2VE7C 4JI1E 1GZ6A 1FJGI 2V83A 2UXDE 5CFFE 5IWAE 2HHHI 4HACA 2ODRD 2DEJA 3JAMC 5GMDA 3ZOQB 2KONA 1DI2A 3ZZ0A 1VISA 3HULA 4M1KA 3WU6A 2V89A 1Z0TA 1X47A 3ADJA 4X62E 3LPSA 2V87A 1HNWE 1RC7A 4DUYE 4LTYA 3PYDA 4DMIA 1S16A 4WUBA 1H72C 4WYQB 5FLXQ 3K85A 2JOXA 1N33E 3P06A 1QZRA 1NHIA 4P7AA 4J8ZA 1KKHA 2V86A 2HK2A 4DPXA 3K6QA 2MC5A 4GKKI 1FKAE 2NUFA 4JYAE 3J81Q 4LFCI 4USKA 4X62I 4WUDA 1H7SA 3ZKDA 2OI2A 3PYEA 4DR1E 1MG7A 4LF5I 4ED4A 4DV5E 3CWVA 3LNUA 4Z7YA 4M30A 4X64I 5BR8E 4IZKA 3HJCA 4DV0I 1MX0A 1MU5A 3JTZA 4JI1I 1FNMA 2N3GA 4DV4I 2B9DA 3Q6MA 5A2QC 1HR0E 4DV1E 4N3OA 4PRXA 1XNQE 4YHHE 4HACB 1ZM3A 4YHHI 2L2NA 4JI4I 5FLXC 1Y6ZA 3J7Yp 4FWGA 1Z0BA 2MC6A 3B82A 2M4IA 1ZM2A 4LF4E 2BM1A 2CG9A 4DPTA 4KHPI 4L8NA 4DV2I 2DEIA 4X65E 1RQ0A 3M6AA 1N36E 3LTOA 1Z0GA 1Z5CA 2O1VA 1IBME 4B3MI 2LMZA 5AE3A 3OMLA 2KHXA 4M2ZA 4JI2E 4JI5I 5AE2A 3MSWA 4TUIA 4KZSA 2L3JA 4DPYA 4MYTA 1FWLA 1FWKA 1YYOA 4LFCE 4JI7I 4DXLA 3D4JA 5ADZA 2HKJA 2VQEE 2Z5EA 3GONA 3T1YE 2UXCE 3J80Q 2UUCE 2DSYA 3JAMQ 3ADLA 2Z5BA 4Z7CA 1EI1A 4DR7I 4KQVA 1T4OA 4WSPA 1XNQI 3Q1QA 1ZM4A 2LUQA 4JI6E 3Q6NA 4EMDA 3C4TA 4DV6I 4AQYI 4JV5I 5F3WA 2L8TA 3HTXA 1Z59A 4YY3E 1NHHA 1STUA 4DV1I 1KTVA 2ZITA 2Z5CA 4DR5E 4DR6I 3DJWA 4URLA 3V2UC 3J80C 4LF7E 2CZ9A 2B7VA 1FJGE 2YZTA 2XEXA 1ELOA 2B3TB 2LTSA 4P7DA 3OTOE 4X8WA 3IWDA 5LMNE 2HHHE 3C4BA 2NPFA 4IZJB 4AQYE 2LJHA 3T1YI 3K1JA 4F9CB 1D6TA 2E5LI 5IT9C 3B8HA 5LMUI 4LU9A 2HFUA 5IT9Q 1XMQE 1QU6A 2E1MA 4DV2E 4M0VA 4I3HA 5FWKA 1U2RA 1ZXMA 2V2ZA 4FW9A 4GKKE 1O0WA 2FV4B 4DR3E 4JG4A 3T1HE 1HNZE 2DIXA 1J5EI 1HNWI 4NXMI 2JY9A 4FN5A 4I8OA 3VK6A 2V85A 3WU4A 3AV0A 3B78A 4OOGC 4DR2E 2BV3A 2Z5BB 1KVKA 1IBLE 2M7QA 2LJPA 4WPYA 4LFAE 4PRVA 3IWBA 2UUAI 2V34A 4OX9E 1IBKI 2UXBI 3VYXA 4OX9I 3LLHA 2H36X 1K47A 2L2MA 2R3VA 1OJ4A 2RSMA 4MYUA 4JI5E 1HK7A 3H4LA 2O1UA 4P52A 3WU5A 5AE1A 4DV5I 2V2VA 4L5NC 1EKZA 1N0UA 1NHJA 1N0VC 3J7AM 3HPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S E;  2YT4 A;  1Z5A A;  4DV4 E;  2J7K A;  5LL6 R;  4XTJ A;  1PKP A;  4UTG A;  1HNX E;  4JI0 E;  2HFS A;  2E1R A;  4DR4 E;  1YZ9 A;  1BKN A;  1A6F A;  1UEK A;  3ZZU A;  3QT8 A;  4LF8 I;  2X7I A;  4JYA I;  1XMQ I;  1IBK E;  1WHN A;  5LMU E;  2L3C A;  1N34 E;  2UU9 I;  1N32 I;  4UT4 A;  4DV6 E;  1NZ0 A;  4LF9 E;  4X64 E;  3T1H I;  2UU9 E;  1N34 I;  4R1F A;  2GS8 A;  3PYG A;  4DUY I;  1WUU A;  4B3R E;  5GME A;  2DB2 A;  4DU8 A;  1XHK A;  1N33 I;  2VQE I;  4DR3 I;  1H73 A;  2WW4 A;  4RPF A;  1YYW A;  1Z5B A;  1T4L B;  4JI8 E;  2E5L E;  1HNX I;  4FWD A;  4DV7 I;  4KHP E;  1ZBT A;  4LF4 I;  4DR4 I;  2UXD I;  4JI6 I;  1UIL A;  2X36 A;  2BM0 A;  1UHZ A;  4DR7 E;  4LF7 I;  2A2D A;  3VYY A;  1YYK A;  2N3H A;  1ZXN A;  3WU3 A;  4JV5 E;  4WUC A;  2NA2 A;  1Z0V A;  4JI4 E;  4JI0 I;  1DAR A;  2UXB E;  4B3T E;  3P1X A;  1HR0 I;  2UXC I;  1XNR E;  2Q2E B;  4HYM A;  2R42 A;  4HXZ A;  3ADI A;  4B3T I;  1WHQ A;  1XMO I;  4JI7 E;  3J81 C;  3ZKB A;  5L3J A;  1I94 E;  4JI3 E;  4B3M E;  1IBM I;  2V2Q A;  4USM A;  4DUZ E;  2A2C A;  4FWH A;  1J26 A;  1IBL I;  1X48 A;  3ADG A;  1XNR I;  3V5R A;  4YY3 I;  4LFA I;  4B3R I;  1X49 A;  2F4V E;  1J5E E;  4DR5 I;  4DR2 I;  1H74 A;  4LF6 E;  1B63 A;  1T4N A;  1RRE A;  4LFB I;  1B62 A;  2VF3 A;  4NXN I;  4GKJ I;  2LRS A;  5BR8 I;  2RTX A;  4K0K E;  2L2K B;  4JI8 I;  4DPU A;  1FI4 A;  2VQF I;  2HK3 A;  2HKE A;  1Z0W A;  1ZM9 A;  3K17 A;  2V8P A;  1GQE A;  2CPN A;  2RS6 A;  2AJ4 A;  5IWA I;  2L33 A;  4DR6 E;  1HNZ I;  2LBS B;  5A2Q Q;  3PYF A;  4K0K I;  2LUP B;  2NUE A;  2DMY A;  1XMO E;  2B7T A;  1PIE A;  2VQF E;  2UUB E;  4DV3 I;  2RS7 A;  4X65 I;  4HY1 A;  4DPW A;  2NUG A;  1N32 E;  4LFB E;  3QT7 A;  1RR9 A;  4DKK A;  3QT6 A;  4LF8 E;  1EA6 A;  4LF9 I;  4DU7 A;  4PU9 A;  1KIJ A;  4DUZ I;  1I94 I;  4JI3 I;  4LF6 I;  1N36 I;  1S4E A;  4NXM E;  4NXN E;  4GKJ E;  4JI2 I;  2IHR 1;  3F0N A;  4B3S I;  2UUC I;  4DV0 E;  4DV7 E;  2EZ6 A;  3QT5 A;  1Z0E A;  2UUA E;  2MDR A;  3ZM7 A;  2ZM6 E;  2UUB I;  4WFT A;  4ZVI A;  2F4V I;  4X66 I;  1PVG A;  4DV3 E;  2EFG A;  3OTO I;  2LTR A;  2ZM6 I;  4LF5 E;  4DR1 I;  2JVA A;  1Z0C A;  3J7A G;  3ZZT A;  4X66 E;  1H7U A;  5LMN I;  2ZBK B;  4JI1 E;  1FJG I;  2UXD E;  5CFF E;  5IWA E;  2HHH I;  4HAC A;  2DEJ A;  3JAM C;  5GMD A;  3ZZ0 A;  1DI2 A;  1VIS A;  3HUL A;  4M1K A;  3WU6 A;  1Z0T A;  1X47 A;  3ADJ A;  4X62 E;  3LPS A;  1HNW E;  1RC7 A;  4DUY E;  3PYD A;  1S16 A;  4WUB A;  1H72 C;  4WYQ B;  5FLX Q;  1N33 E;  1QZR A;  1NHI A;  4P7A A;  1KKH A;  4DPX A;  2HK2 A;  4GKK I;  1FKA E;  2NUF A;  4JYA E;  3J81 Q;  4LFC I;  4USK A;  4X62 I;  4WUD A;  1H7S A;  3ZKD A;  2OI2 A;  3PYE A;  4DR1 E;  1MG7 A;  4LF5 I;  4ED4 A;  4DV5 E;  3CWV A;  3LNU A;  4Z7Y A;  4M30 A;  4X64 I;  5BR8 E;  4DV0 I;  1MX0 A;  1MU5 A;  4JI1 I;  1FNM A;  2N3G A;  4DV4 I;  1HR0 E;  5A2Q C;  4DV1 E;  4PRX A;  1XNQ E;  4YHH E;  4HAC B;  1ZM3 A;  4YHH I;  2L2N A;  4JI4 I;  5FLX C;  3J7Y p;  4FWG A;  1Z0B A;  3B82 A;  1ZM2 A;  4LF4 E;  2BM1 A;  4DPT A;  4KHP I;  4DV2 I;  2DEI A;  4X65 E;  1RQ0 A;  3M6A A;  3LTO A;  1N36 E;  1Z0G A;  1Z5C A;  1IBM E;  4B3M I;  2KHX A;  4M2Z A;  4JI2 E;  4JI5 I;  2L3J A;  4DPY A;  4MYT A;  1FWL A;  1FWK A;  1YYO A;  4LFC E;  4JI7 I;  4DXL A;  3D4J A;  2HKJ A;  2VQE E;  3GON A;  3T1Y E;  2UXC E;  3J80 Q;  2UUC E;  3JAM Q;  3ADL A;  4Z7C A;  1EI1 A;  4DR7 I;  4KQV A;  1T4O A;  1XNQ I;  3Q1Q A;  1ZM4 A;  2LUQ A;  4JI6 E;  4EMD A;  3C4T A;  4DV6 I;  4AQY I;  4JV5 I;  3HTX A;  1Z59 A;  4YY3 E;  1NHH A;  1STU A;  4DV1 I;  1KTV A;  2ZIT A;  4DR5 E;  4DR6 I;  4URL A;  3V2U C;  3J80 C;  4LF7 E;  2CZ9 A;  2B7V A;  1FJG E;  2XEX A;  1ELO A;  2B3T B;  2LTS A;  3OTO E;  4X8W A;  5LMN E;  2HHH E;  3C4B A;  2NPF A;  4AQY E;  2LJH A;  3T1Y I;  3K1J A;  1D6T A;  2E5L I;  3B8H A;  5IT9 C;  5LMU I;  2HFU A;  5IT9 Q;  1XMQ E;  1QU6 A;  4DV2 E;  4I3H A;  1U2R A;  1ZXM A;  2V2Z A;  4FW9 A;  4GKK E;  1O0W A;  4DR3 E;  4JG4 A;  3T1H E;  1HNZ E;  2DIX A;  1J5E I;  1HNW I;  4NXM I;  2JY9 A;  4FN5 A;  3WU4 A;  3B78 A;  4OOG C;  4DR2 E;  2BV3 A;  1KVK A;  1IBL E;  2LJP A;  4LFA E;  4PRV A;  2UUA I;  2V34 A;  4OX9 E;  1IBK I;  2UXB I;  3VYX A;  4OX9 I;  3LLH A;  1K47 A;  2L2M A;  2R3V A;  1OJ4 A;  2RSM A;  4MYU A;  4JI5 E;  3H4L A;  4P52 A;  4DV5 I;  3WU5 A;  2V2V A;  1EKZ A;  1N0U A;  1NHJ A;  1N0V C;  3J7A M; 
#chains in the Genus database with same CATH topology
 2WBT A;  4IZJ A;  4IFD A;  4R8O A;  4B3S E;  2YT4 A;  1F2I G;  1Z5A A;  4DV4 E;  2FGG A;  1Y4S A;  3M7N G;  2FTX B;  2BA1 D;  2NN6 F;  4R2R A;  2J7K A;  2L6M A;  4FW6 A;  5C0X A;  4Q35 B;  5LL6 R;  2CGE A;  4XTJ A;  1PKP A;  4UTG A;  3F6H A;  2EPU A;  1HNX E;  2I13 A;  4JI0 E;  4GQU A;  4GZN C;  2HFS A;  2PO2 A;  2EQ3 A;  1YUI A;  2CVE A;  3CDI A;  2EML A;  1JK1 A;  2E1R A;  2IES A;  4DR4 E;  1YZ9 A;  2EN8 A;  2R76 A;  1BKN A;  1A6F A;  1X6E A;  1UEK A;  3ZZU A;  3QT8 A;  4LF8 I;  4P78 A;  2X7I A;  4JYA I;  1XMQ I;  1IBK E;  1WHN A;  4BS9 A;  3F6G A;  4ISA A;  4IFD F;  2O1W A;  2EPM X;  2JOB A;  2L3C A;  5LMU E;  1N34 E;  2UU9 I;  2O1T A;  3EPH A;  4MU4 A;  1N32 I;  4UT4 A;  2ADR A;  4DV6 E;  1NZ0 A;  4LF9 E;  3THO B;  4NHR A;  2D9H A;  4X64 E;  3T1H I;  4MLV A;  1T38 A;  2UU9 E;  1N34 I;  4R1F A;  2GS8 A;  2WBU A;  1WXR A;  4BMJ A;  3MHH C;  1YH8 A;  2F8B A;  3PYG A;  4DUY I;  2EN3 A;  1WUU A;  4LCG A;  4B3R E;  2V8Q B;  2DB2 A;  1P47 A;  5A6K A;  1XHK A;  4KWY A;  5GME A;  4DU8 A;  4BBY A;  1N33 I;  4MLQ A;  4BA1 A;  2PO0 A;  2VQE I;  1A1K A;  1DGC A;  2L92 A;  1Y4U A;  4DR3 I;  1H73 A;  1PJT A;  2WW4 A;  3L00 A;  2EOE A;  1USU A;  4RPF A;  1YYW A;  1Z5B A;  2NN6 A;  2CTD A;  1T4L B;  5JEA E;  2YSO A;  4JI8 E;  1TN9 A;  2PNZ A;  4OO1 B;  1X5W A;  2E5L E;  1HNX I;  4FWD A;  4DV7 I;  2VF1 A;  4F9A B;  4OZE A;  4GEQ B;  4IFD B;  1QNT A;  1R6M A;  4KHP E;  1ZBT A;  4LF4 I;  2YTN A;  2JR1 A;  3JU0 A;  4DR4 I;  3IWC A;  2EM5 A;  2EPC A;  4JI6 I;  2UXD I;  1UIL A;  4AID A;  2EPR A;  2MKD A;  4BHC A;  2EM2 A;  2LE2 A;  2EE8 A;  3RMP A;  2LO3 A;  2X36 A;  4FW7 A;  2YRH A;  2EMY A;  1B69 A;  4X9J A;  2BM0 A;  4R2D A;  1UHZ A;  4DR7 E;  4LF7 I;  2A2D A;  3VYY A;  1YYK A;  2N3H A;  2PO2 B;  1Y5Y A;  3UHM A;  1UDO A;  4O24 A;  1ZXN A;  4BHB A;  2NN6 E;  3L7Z B;  3WU3 A;  1X3C A;  2LVH A;  4F6N A;  4JV5 E;  3HKM A;  4WUC A;  2NA2 A;  4FW5 A;  1Z0V A;  4JI4 E;  2EN2 A;  3DF6 A;  2IOQ A;  2NN6 C;  5DRR A;  2Z5C B;  2EPL X;  1OYP A;  4JI0 I;  4AM3 A;  1DAR A;  4R03 A;  2UXB E;  4B3T E;  3P1X A;  2EJ4 A;  1HR0 I;  2UXC I;  3PRY A;  1XNR E;  1ZR9 A;  4TUG A;  2Q2E B;  4HYM A;  2R42 A;  3DD6 A;  2YTF A;  3EPJ A;  4HXZ A;  2ELY A;  3ADI A;  1WHQ A;  2EM6 A;  2YTG A;  1XMO I;  2M9A A;  4B3T I;  4JI7 E;  3J81 C;  4MU0 A;  2NN6 D;  5DRP A;  1ZU1 A;  5A6B D;  3ZKB A;  5L3J A;  3HXL A;  1I94 E;  1SR9 A;  4B3M E;  4JI3 E;  1IBM I;  2V2Q A;  4USM A;  1EH6 A;  4DUZ E;  4OO1 C;  2G7H A;  2A2C A;  4FWH A;  2VES A;  2JYA A;  1J26 A;  1IBL I;  1X48 A;  1ZBQ A;  2EMH A;  1XXE A;  2EOZ A;  3TQM A;  5DNY A;  3ADG A;  4OO1 A;  1XNR I;  3HQ1 A;  3LML A;  4R2P A;  3V5R A;  4YY3 I;  5KL7 A;  4LFA I;  1E3P A;  4B3R I;  1X49 A;  2F4V E;  1A1H A;  1MGT A;  1IQS A;  4Q28 A;  1J5E E;  4DR5 I;  2DGC A;  2GQ0 A;  4DR2 I;  4OO1 D;  4WSG A;  1H74 A;  4LF6 E;  1N3G A;  2C39 A;  1B63 A;  1T4N A;  1RRE A;  4LFB I;  1B62 A;  2JXP A;  2VF3 A;  4F2J C;  2YTP A;  1A1L A;  3H09 A;  4NXN I;  2LRS A;  1YFH A;  2RPC A;  2RTX A;  1T39 A;  1UDS A;  5BR8 I;  2PNM A;  2EM4 A;  2M1S A;  4K0K E;  4IZJ D;  2E72 A;  2O3Z A;  2L2K B;  4JI8 I;  5AAS A;  5A6B A;  4DPU A;  1FI4 A;  2EWL A;  2VQF I;  2HK3 A;  2HKE A;  3GCM A;  1Z0W A;  5T6J A;  1UBD C;  1ZM9 A;  2EOI A;  3FIG A;  3K17 A;  4FW4 A;  2JEA A;  3J7A M;  2V8P A;  1GQE A;  1YUJ A;  4MU1 A;  2CPN A;  1ZAA C;  2RS6 A;  3AUZ A;  2EL6 A;  1VI7 A;  2EOR A;  2AJ4 A;  5IWA I;  5JEA F;  2WZO A;  2L33 A;  4DR6 E;  1HNZ I;  2LBS B;  5A2Q Q;  2K4V A;  2EOM A;  3QG5 C;  1UDQ A;  3PYF A;  4K0K I;  2LUP B;  5C0X C;  2LJU A;  2NUE A;  2DMY A;  3M99 B;  3NZK A;  1WJP A;  1XMO E;  2JT2 A;  2B7T A;  1PIE A;  2VQF E;  2EPK X;  2UUB E;  3HPS A;  5KL3 A;  4R2C A;  4O4K A;  5C0X B;  4DV3 I;  1BB8 A;  2EQ0 A;  2RS7 A;  4X65 I;  5K36 E;  2CT1 A;  2DMI A;  4F54 A;  2EM8 A;  4HY1 A;  4DPW A;  3ECR A;  2NUG A;  4BC7 A;  1N32 E;  4LFB E;  3QT7 A;  1Z1B A;  1DQ3 A;  5K36 F;  1RR9 A;  2J7J A;  4BCA A;  1USV A;  2DLK A;  4DKK A;  4F9B B;  4LCF A;  2PNL A;  3QT6 A;  4LF8 E;  1EA6 A;  4U3B A;  4LF9 I;  5AC4 A;  4DU7 A;  4PU9 A;  1KIJ A;  4DUZ I;  2ODR C;  2EM3 A;  1I94 I;  4JI3 I;  4LF6 I;  1N36 I;  1PJS A;  1S4E A;  4WXC A;  3M85 D;  2EMB A;  1X6H A;  4NXM E;  3KZZ A;  4NXN E;  2JPA A;  4GKJ E;  4JI2 I;  2IHR 1;  2KOU A;  2IER A;  3KZY A;  3F0N A;  1AAY A;  2HJJ A;  4B3S I;  4IJD A;  2UUC I;  2V88 A;  4DV0 E;  2ENA A;  2EMA A;  4DV7 E;  2EZ6 A;  2EOO A;  3QT5 A;  4BC9 A;  4BA1 B;  2PO0 B;  3PS3 A;  1Z0E A;  2UUA E;  2MDR A;  3ZM7 A;  2ZM6 E;  1P42 A;  2UUB I;  4WFT A;  5C0X D;  3KWR A;  2ENH A;  1AH5 A;  4RHB B;  5EL9 A;  2EQ1 A;  4ZVI A;  2EMG A;  5IXM B;  4MDT A;  5A6A A;  2F4V I;  1KYQ A;  3VHT B;  1PVG A;  4DV3 E;  2EFG A;  5DRQ A;  4X66 I;  2IOP A;  2NN6 B;  3OTO I;  2LTR A;  2JE6 B;  2ZM6 I;  4LF5 E;  1RMD A;  2JVA A;  4DR1 I;  2WP8 A;  1Z0C A;  3J7A G;  2EOS A;  2YTQ A;  3EPK A;  3ZZT A;  4X66 E;  1H7U A;  4IS9 A;  4IZK B;  5LMN I;  2ZBK B;  5JEA D;  2JWO A;  2VE7 C;  2N8X A;  4JI1 E;  1GZ6 A;  2EPO A;  1FJG I;  2V83 A;  2UXD E;  5CFF E;  1BBG A;  5IWA E;  2HHH I;  3P3G A;  4HAC A;  4WXD A;  2ODR D;  2R1F A;  2EN1 A;  2DEJ A;  2EN7 A;  2BR2 A;  3JAM C;  2JEB A;  1X6F A;  5KL4 A;  3ZOQ B;  5GMD A;  2KON A;  1DI2 A;  3ZZ0 A;  1VIS A;  1LLM C;  3HUL A;  4M1K A;  3WU6 A;  2ELZ A;  2C38 A;  2EMK A;  2V89 A;  1Z0T A;  1X47 A;  4QNK A;  3ADJ A;  4X62 E;  1TF3 A;  2BA0 D;  3LPS A;  2V87 A;  2VRD A;  1HNW E;  1RC7 A;  5KL2 A;  4DUY E;  2YTD A;  4LTY A;  1YSA C;  3PYD A;  4DMI A;  1S16 A;  4WUB A;  1H72 C;  4WYQ B;  5FLX Q;  2EPA A;  3UK3 C;  3K85 A;  2JOX A;  1N33 E;  3P06 A;  1A1J A;  3PS1 A;  2C37 A;  2JP9 A;  1QZR A;  1NHI A;  3U1K A;  4P7A A;  2EL5 A;  4J8Z A;  1KKH A;  2V86 A;  2HK2 A;  4DPX A;  3K6Q A;  4IFD E;  2MC5 A;  5ELW A;  4GKK I;  3BF2 A;  1FKA E;  2NUF A;  4JYA E;  3GME A;  2DLQ A;  4FW3 A;  3J81 Q;  2YPN A;  4USK A;  2EPZ A;  4LFC I;  2EPP A;  5C0X E;  4X62 I;  4WUD A;  5K36 B;  4J3D A;  1H7S A;  3ZKD A;  2OI2 A;  3PYE A;  2EMZ A;  4DR1 E;  4M9V C;  1MG7 A;  4MU3 A;  1G2D C;  4ED4 A;  4DV5 E;  2WP8 B;  3CWV A;  4LF5 I;  3LNU A;  4Z7Y A;  4M30 A;  2EOY A;  1NEI A;  4X64 I;  4BA2 A;  2MKN A;  5BR8 E;  2BA0 G;  4IZK A;  3HJC A;  4DV0 I;  1NCS A;  1MX0 A;  1PJQ A;  5KL5 A;  3THN A;  4WX9 A;  3BGH A;  2GO4 A;  3C6M A;  4GKJ I;  2YTI A;  4NZV A;  3JTZ A;  1MU5 A;  2C39 B;  2EPN A;  4IS1 C;  2N3G A;  1FNM A;  2B9D A;  3Q6M A;  4JI1 I;  5A2Q C;  1HR0 E;  4DV4 I;  4DV1 E;  4N3O A;  4PRX A;  1XNQ E;  4YHH E;  4HAC B;  5EKW A;  1SFE A;  1ZM3 A;  4RH8 A;  2GLI A;  4YHH I;  2L2N A;  4JI4 I;  5FLX C;  2WNR A;  1Y6Z A;  2BR2 B;  5DNX A;  3J7Y p;  2YU8 A;  4FWG A;  4LCH A;  5JEA A;  1Z0B A;  4ZYE A;  2MC6 A;  2RQL A;  3B82 A;  4MQY A;  3BID A;  4ZYG A;  2M4I A;  1ZM2 A;  1BBO A;  2ENC A;  4LF4 E;  2BM1 A;  2CG9 A;  4DPT A;  4KHP I;  2I9I A;  1A1I A;  2PO1 A;  4L8N A;  4DV2 I;  2DEI A;  2WBS A;  4X65 E;  4R2E A;  5A69 A;  1RQ0 A;  3M6A A;  3EQ1 A;  3PS2 A;  1N36 E;  2AE8 A;  3LTO A;  1Z0G A;  2YRM A;  1Z5C A;  2O1V A;  1IBM E;  5DNL A;  4B3M I;  2LMZ A;  5AE3 A;  3OML A;  5LLQ A;  2KHX A;  4M2Z A;  3MHS C;  4JI2 E;  2C37 B;  4JI5 I;  2EOF A;  4R2A A;  5AE2 A;  2CSH A;  3MSW A;  4TUI A;  4KZS A;  5K36 C;  2L3J A;  4DPY A;  4MYT A;  1FWK A;  1FWL A;  1YYO A;  4LFC E;  4JI7 I;  4HEI A;  4LPF A;  4DXL A;  4R2S A;  3D4J A;  5ADZ A;  2HKJ A;  2VQE E;  2Z5E A;  3GON A;  3T1Y E;  4NBQ A;  2UXC E;  2RSI A;  2EM7 A;  3BBG A;  2BA1 G;  3J80 Q;  5IV8 B;  2UUC E;  2DSY A;  3JAM Q;  1EH8 A;  2EOQ A;  3ADL A;  2PRT A;  2EMC A;  1GTK A;  2YWQ A;  3H1C A;  4LOM A;  2LT7 A;  2Z5B A;  4ZYH A;  4Z7C A;  5JEA C;  1EI1 A;  4DR7 I;  5AC5 A;  4IFD D;  4KQV A;  1T4O A;  4WSP A;  1XNQ I;  3P3C A;  1E3H A;  3Q1Q A;  2Q8U A;  1ZM4 A;  3B4T A;  2A25 A;  2LUQ A;  1YPN A;  2WNR B;  4JI6 E;  3L7Z A;  3Q6N A;  1PDA A;  3C4T A;  4QNJ A;  4EMD A;  5JEA B;  4DV6 I;  4AQY I;  4JV5 I;  4OO1 E;  5F3W A;  2L8T A;  3HTX A;  1Z59 A;  4O43 A;  4YY3 E;  1NHH A;  1STU A;  2GHF A;  4DV1 I;  2BBG A;  1KTV A;  2ZIT A;  4O5G A;  2Z5C A;  4DR5 E;  4DR6 I;  3DJW A;  4URL A;  3V2U C;  3J80 C;  4LF7 E;  2PO1 B;  2GPI A;  2CZ9 A;  1EH7 A;  2B7V A;  2EMF A;  5KL6 A;  1FJG E;  2JE6 A;  2YZT A;  1UN6 B;  2EL4 A;  1ELO A;  2XEX A;  5C0X F;  2B3T B;  2LTS A;  4P7D A;  3OTO E;  2HGH A;  2F1D A;  4X8W A;  2YTO A;  3IWD A;  2EOJ A;  5LMN E;  2HHH E;  2HC5 A;  3C4B A;  1A1F A;  2NPF A;  1OYR A;  4IZJ B;  4AQY E;  1KJK A;  2LJH A;  3GLL A;  3T1Y I;  3K1J A;  2LCE A;  4F9C B;  5K36 D;  1D6T A;  2E5L I;  2EOH A;  5IT9 C;  3B8H A;  4LU9 A;  5LMU I;  2HFU A;  2EN4 A;  5IT9 Q;  1XMQ E;  1QU6 A;  2EMI A;  1A1G A;  1RHY A;  2E1M A;  1WRJ A;  3C6K A;  2EM0 A;  4M0V A;  4DV2 E;  4I3H A;  3KRN A;  5FWK A;  1U2R A;  1ZXM A;  2V2Z A;  4FW9 A;  2EPX A;  2EN6 A;  4R2Q A;  4ZYD A;  4GKK E;  2DRP A;  1O0W A;  2FV4 B;  4DR3 E;  4JG4 A;  2JEB B;  2YTJ A;  4AIM A;  3T1H E;  1HNZ E;  2DIX A;  1J5E I;  2NAB A;  5DRO A;  2YU5 A;  2GO3 A;  4NXM I;  2JY9 A;  1HNW I;  4FN5 A;  4I8O A;  3VK6 A;  2V85 A;  2C38 B;  3WU4 A;  3AV0 A;  3B78 A;  4OOG C;  4DR2 E;  2BV3 A;  2Z5B B;  2WCC 3;  1G2F C;  3CDJ A;  4IFD C;  2EMX A;  1KVK A;  1IBL E;  1MEY C;  2LV2 A;  2YTE A;  4N4R B;  2M7Q A;  1R6L A;  4WPY A;  2LJP A;  4F6M A;  4LFA E;  1YHC A;  4PRV A;  3IWB A;  1JK2 A;  2K7I A;  2BB8 A;  2UUA I;  2V34 A;  4OX9 E;  2EOX A;  1IBK I;  2UXB I;  5A6J A;  2YSP A;  3EPL A;  3U1Y A;  1L4S A;  1TF6 A;  3VYX A;  4OX9 I;  3LLH A;  4OO1 F;  2H36 X;  1Y60 A;  1UDN A;  4U3D A;  2JEA B;  1IQO A;  1K47 A;  2L2M A;  2MDG A;  2EP3 A;  2RSM A;  2YRK A;  1IMU A;  1OJ4 A;  2R3V A;  4MYU A;  4FK5 C;  1OYS A;  4OKG A;  4JI5 E;  3M7N D;  5K36 A;  1HK7 A;  3H4L A;  2O1U A;  3P3E A;  4P52 A;  4HTG A;  5AE1 A;  3P76 A;  2V2V A;  3WU5 A;  4L5N C;  4DV5 I;  5TSE A;  2PNZ B;  1EKZ A;  2EM9 A;  1N0U A;  4BA2 B;  2J65 A;  1NHJ A;  1N0V C;  3M85 G;  2EMW A;  3HPZ A; 
#chains in the Genus database with same CATH homology
 4IZJ A;  4R8O A;  4B3S E;  2YT4 A;  1Z5A A;  4DV4 E;  2FGG A;  1Y4S A;  2FTX B;  2J7K A;  2L6M A;  5LL6 R;  2CGE A;  4XTJ A;  1PKP A;  4UTG A;  3F6H A;  1HNX E;  4JI0 E;  2HFS A;  2E1R A;  4DR4 E;  1YZ9 A;  1BKN A;  1A6F A;  1UEK A;  3ZZU A;  3QT8 A;  4LF8 I;  4P78 A;  2X7I A;  4JYA I;  1XMQ I;  1IBK E;  1WHN A;  4BS9 A;  3F6G A;  2O1W A;  2JOB A;  5LMU E;  2L3C A;  1N34 E;  2UU9 I;  2O1T A;  1N32 I;  4UT4 A;  4DV6 E;  1NZ0 A;  4LF9 E;  4X64 E;  3T1H I;  2UU9 E;  1N34 I;  4R1F A;  2GS8 A;  1WXR A;  4BMJ A;  2F8B A;  3PYG A;  4DUY I;  1WUU A;  4B3R E;  2V8Q B;  2DB2 A;  5GME A;  4DU8 A;  1XHK A;  4BBY A;  1N33 I;  2VQE I;  2L92 A;  1Y4U A;  4DR3 I;  1H73 A;  2WW4 A;  1USU A;  4RPF A;  1YYW A;  1Z5B A;  1T4L B;  4JI8 E;  2E5L E;  1HNX I;  4FWD A;  4DV7 I;  2VF1 A;  4F9A B;  4GEQ B;  4KHP E;  1ZBT A;  4LF4 I;  4DR4 I;  2JR1 A;  3JU0 A;  3IWC A;  2UXD I;  4JI6 I;  1UIL A;  2LE2 A;  3RMP A;  2X36 A;  2BM0 A;  1UHZ A;  4DR7 E;  4LF7 I;  2A2D A;  3VYY A;  1YYK A;  2N3H A;  1ZXN A;  3WU3 A;  4JV5 E;  4WUC A;  2NA2 A;  1Z0V A;  4JI4 E;  3DF6 A;  2IOQ A;  2Z5C B;  4JI0 I;  1DAR A;  4R03 A;  2UXB E;  4B3T E;  3P1X A;  1HR0 I;  2UXC I;  3PRY A;  1XNR E;  4TUG A;  2Q2E B;  4HYM A;  2R42 A;  4HXZ A;  3ADI A;  4B3T I;  1WHQ A;  1XMO I;  4JI7 E;  3J81 C;  3ZKB A;  5L3J A;  3HXL A;  1I94 E;  1SR9 A;  4B3M E;  4JI3 E;  1IBM I;  2V2Q A;  4USM A;  4DUZ E;  2G7H A;  2A2C A;  4FWH A;  1J26 A;  1IBL I;  1X48 A;  1ZBQ A;  5DNY A;  3ADG A;  1XNR I;  3HQ1 A;  3LML A;  3V5R A;  4YY3 I;  4LFA I;  4B3R I;  1X49 A;  2F4V E;  4Q28 A;  1J5E E;  4DR5 I;  2GQ0 A;  4DR2 I;  1H74 A;  4LF6 E;  1B63 A;  1T4N A;  1RRE A;  4LFB I;  1B62 A;  2VF3 A;  3H09 A;  4NXN I;  2LRS A;  4GKJ I;  5BR8 I;  2RTX A;  2PNM A;  2M1S A;  4K0K E;  4IZJ D;  2L2K B;  4JI8 I;  5AAS A;  4DPU A;  1FI4 A;  2EWL A;  2VQF I;  2HK3 A;  2HKE A;  1Z0W A;  5T6J A;  1ZM9 A;  3FIG A;  3K17 A;  2V8P A;  1GQE A;  2CPN A;  2RS6 A;  3AUZ A;  2AJ4 A;  5IWA I;  2WZO A;  2L33 A;  4DR6 E;  1HNZ I;  2LBS B;  5A2Q Q;  2K4V A;  3PYF A;  4K0K I;  2LUP B;  2NUE A;  2DMY A;  1XMO E;  2B7T A;  1PIE A;  2VQF E;  2UUB E;  3HPS A;  4DV3 I;  2RS7 A;  4X65 I;  4F54 A;  4HY1 A;  4DPW A;  2NUG A;  4BC7 A;  1N32 E;  4LFB E;  3QT7 A;  1DQ3 A;  1RR9 A;  1USV A;  4BCA A;  4DKK A;  4F9B B;  2PNL A;  3QT6 A;  4LF8 E;  1EA6 A;  4LF9 I;  4DU7 A;  4PU9 A;  1KIJ A;  4DUZ I;  2ODR C;  1I94 I;  4JI3 I;  4LF6 I;  1N36 I;  1S4E A;  4NXM E;  4NXN E;  4GKJ E;  4JI2 I;  2IHR 1;  2KOU A;  3F0N A;  4B3S I;  2UUC I;  2V88 A;  4DV0 E;  4DV7 E;  2EZ6 A;  3QT5 A;  4BC9 A;  1Z0E A;  2UUA E;  2MDR A;  3ZM7 A;  2ZM6 E;  2UUB I;  4WFT A;  3KWR A;  4ZVI A;  2F4V I;  4X66 I;  1PVG A;  4DV3 E;  2EFG A;  2IOP A;  3OTO I;  2LTR A;  2ZM6 I;  4LF5 E;  4DR1 I;  2JVA A;  1Z0C A;  3J7A G;  3ZZT A;  4X66 E;  1H7U A;  4IZK B;  5LMN I;  2ZBK B;  2JWO A;  2VE7 C;  4JI1 E;  1GZ6 A;  1FJG I;  2V83 A;  2UXD E;  5CFF E;  5IWA E;  2HHH I;  4HAC A;  2ODR D;  2DEJ A;  3JAM C;  5GMD A;  3ZOQ B;  2KON A;  1DI2 A;  3ZZ0 A;  1VIS A;  3HUL A;  4M1K A;  3WU6 A;  2V89 A;  1Z0T A;  1X47 A;  3ADJ A;  4X62 E;  3LPS A;  2V87 A;  1HNW E;  1RC7 A;  4DUY E;  4LTY A;  3PYD A;  4DMI A;  1S16 A;  4WUB A;  1H72 C;  4WYQ B;  5FLX Q;  3K85 A;  2JOX A;  1N33 E;  3P06 A;  1QZR A;  1NHI A;  4P7A A;  4J8Z A;  1KKH A;  2V86 A;  2HK2 A;  4DPX A;  3K6Q A;  2MC5 A;  4GKK I;  1FKA E;  2NUF A;  4JYA E;  3J81 Q;  4LFC I;  4USK A;  4X62 I;  4WUD A;  1H7S A;  3ZKD A;  2OI2 A;  3PYE A;  4DR1 E;  1MG7 A;  4LF5 I;  4ED4 A;  4DV5 E;  3CWV A;  3LNU A;  4Z7Y A;  4M30 A;  4X64 I;  5BR8 E;  4IZK A;  3HJC A;  4DV0 I;  1MX0 A;  1MU5 A;  3JTZ A;  4JI1 I;  1FNM A;  2N3G A;  4DV4 I;  2B9D A;  3Q6M A;  5A2Q C;  1HR0 E;  4DV1 E;  4N3O A;  4PRX A;  1XNQ E;  4YHH E;  4HAC B;  1ZM3 A;  4YHH I;  2L2N A;  4JI4 I;  5FLX C;  1Y6Z A;  3J7Y p;  4FWG A;  1Z0B A;  2MC6 A;  3B82 A;  2M4I A;  1ZM2 A;  4LF4 E;  2BM1 A;  2CG9 A;  4DPT A;  4KHP I;  4L8N A;  4DV2 I;  2DEI A;  4X65 E;  1RQ0 A;  3M6A A;  1N36 E;  3LTO A;  1Z0G A;  1Z5C A;  2O1V A;  1IBM E;  4B3M I;  2LMZ A;  5AE3 A;  3OML A;  2KHX A;  4M2Z A;  4JI2 E;  4JI5 I;  5AE2 A;  3MSW A;  4TUI A;  4KZS A;  2L3J A;  4DPY A;  4MYT A;  1FWL A;  1FWK A;  1YYO A;  4LFC E;  4JI7 I;  4DXL A;  3D4J A;  5ADZ A;  2HKJ A;  2VQE E;  2Z5E A;  3GON A;  3T1Y E;  2UXC E;  3J80 Q;  2UUC E;  2DSY A;  3JAM Q;  3ADL A;  2Z5B A;  4Z7C A;  1EI1 A;  4DR7 I;  4KQV A;  1T4O A;  4WSP A;  1XNQ I;  3Q1Q A;  1ZM4 A;  2LUQ A;  4JI6 E;  3Q6N A;  4EMD A;  3C4T A;  4DV6 I;  4AQY I;  4JV5 I;  5F3W A;  2L8T A;  3HTX A;  1Z59 A;  4YY3 E;  1NHH A;  1STU A;  4DV1 I;  1KTV A;  2ZIT A;  2Z5C A;  4DR5 E;  4DR6 I;  3DJW A;  4URL A;  3V2U C;  3J80 C;  4LF7 E;  2CZ9 A;  2B7V A;  1FJG E;  2YZT A;  2XEX A;  1ELO A;  2B3T B;  2LTS A;  4P7D A;  3OTO E;  4X8W A;  3IWD A;  5LMN E;  2HHH E;  3C4B A;  2NPF A;  4IZJ B;  4AQY E;  2LJH A;  3T1Y I;  3K1J A;  4F9C B;  1D6T A;  2E5L I;  5IT9 C;  3B8H A;  5LMU I;  4LU9 A;  2HFU A;  5IT9 Q;  1XMQ E;  1QU6 A;  2E1M A;  4DV2 E;  4M0V A;  4I3H A;  5FWK A;  1U2R A;  1ZXM A;  2V2Z A;  4FW9 A;  4GKK E;  1O0W A;  2FV4 B;  4DR3 E;  4JG4 A;  3T1H E;  1HNZ E;  2DIX A;  1J5E I;  1HNW I;  4NXM I;  2JY9 A;  4FN5 A;  4I8O A;  3VK6 A;  2V85 A;  3WU4 A;  3AV0 A;  3B78 A;  4OOG C;  4DR2 E;  2BV3 A;  2Z5B B;  1KVK A;  1IBL E;  2M7Q A;  2LJP A;  4WPY A;  4LFA E;  4PRV A;  3IWB A;  2UUA I;  2V34 A;  4OX9 E;  1IBK I;  2UXB I;  3VYX A;  4OX9 I;  3LLH A;  2H36 X;  1K47 A;  2L2M A;  2R3V A;  1OJ4 A;  2RSM A;  4MYU A;  4JI5 E;  1HK7 A;  3H4L A;  2O1U A;  4P52 A;  3WU5 A;  5AE1 A;  4DV5 I;  2V2V A;  4L5N C;  1EKZ A;  1N0U A;  1NHJ A;  1N0V C;  3J7A M;  3HPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...