4LF6E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf6E02
4WUDA 1XNQI 2E5LE 4JI3I 1Z0GA 4DV3I 1DARA 4UTGA 1H74A 1S4EA 4DV2I 1D6TA 3P1XA 1XHKA 1Z59A 4DR5I 3K1JA 4DV0I 1HNZE 2UUAE 2LTRA 4GKJE 1UHZA 1XMOE 2HFUA 1HR0E 3LTOA 1OJ4A 1YYOA 2VQFE 2V8PA 1T4OA 4XTJA 4DR2I 3C4BA 2DEIA 1YYKA 4M2ZA 2VQEE 4JI8I 1Z0VA 3J7Yp 4R1FA 4M30A 1MG7A 3OTOI 1NHIA 2YT4A 3ADGA 1N36E 4DU8A 4X66E 3V2UC 4DR7I 1H7UA 4MYTA 4YY3E 4DV7E 4DXLA 1O0WA 5L3JA 2UXBI 1J5EI 1IBLI 3QT8A 4DR3I 1RR9A 4LF4I 2X36A 4DR1E 3QT6A 2MDRA 2R3VA 2V34A 2V2VA 5A2QQ 2UU9I 4JI4I 1GQEA 1I94I 2E1RA 2OI2A 3T1HE 2ZM6I 3K17A 2DMYA 3PYEA 4PU9A 4DPYA 4FWDA 3J81Q 3T1YE 1B63A 4HACB 2DB2A 3ADJA 1FKAE 4DR4E 1EI1A 1ZBTA 5IWAE 1N33E 4FWHA 4LFAI 4NXNE 2UUCI 2UXDE 3JAMQ 4ED4A 1ZXNA 4JI1E 3PYGA 5GMDA 4B3ME 4P7AA 3D4JA 3HULA 4PRXA 2HKEA 2L3JA 4DPUA 3WU3A 1Z0TA 5BR8I 2KHXA 1XNQE 4OOGC 1ZM9A 4JI3E 3ZZUA 4DV3E 5FLXQ 4DUZI 1NHJA 5LL6R 4DV2E 4LF5I 4NXMI 1FWLA 4DR5E 4LF6I 4DV0E 3B78A 3GONA 2RS7A 3H4LA 2V2ZA 3J80Q 1UILA 5A2QC 2R42A 1FJGI 3V5RA 4WYQB 1N32I 1Z0EA 3WU6A 4DR2E 4B3TE 2NUGA 4UT4A 2UXCI 4JI8E 2XEXA 1XMQI 4JI6I 3OTOE 1ZXMA 1FNMA 1HNWI 2NA2A 4DR7E 2HK3A 3QT7A 4FW9A 5IT9Q 1K47A 4EMDA 1H72C 2L2MA 2A2CA 4K0KI 2UXBE 4JI0I 1J5EE 1IBLE 2LJHA 4DR3E 4LF9I 3JAMC 4LF4E 1X48A 4DKKA 2HHHI 1HNXI 1MX0A 2UU9E 3VYXA 4OX9I 4JI4E 1I94E 3QT5A 4LFCI 4USMA 1WHNA 3CWVA 4X65I 2ZM6E 5LMNI 5LMUI 1U2RA 1X49A 3ZZTA 1RQ0A 1H73A 4LF8I 3F0NA 4HXZA 5FLXC 4DV5I 4YHHI 4MYUA 4B3RI 1QZRA 1KIJA 3WU4A 2JY9A 2Q2EB 3J80C 3LNUA 4LFAE 2F4VI 4X62I 2N3HA 2UUCE 1ZM4A 1FI4A 4JI2I 2UUBI 2LUPB 1PVGA 4KQVA 4LF7I 4RPFA 4LFBI 2BV3A 4JI5I 1Z0CA 4M1KA 1KKHA 5BR8E 5IT9C 1WHQA 1NZ0A 2IHR1 4DUZE 1KTVA 4HYMA 4USKA 4LF5E 4NXME 1Z5CA 4PRVA 4JV5I 4KHPI 4LF6E 4GKKI 4URLA 3C4TA 1ZM2A 3Q1QA 2LJPA 1DI2A 1FJGE 1FWKA 1S16A 1IBKI 1N32E 4DV6I 4DV4I 1T4NA 2UXCE 1VISA 3HTXA 1XMQE 4JI6E 4DV1I 4X64I 1HNWE 1STUA 4FN5A 3VYYA 1Z5AA 2X7IA 2DEJA 1N34I 4K0KE 4JI0E 4WFTA 4LF9E 1N0UA 2B7TA 1RREA 3J81C 4WUBA 4B3MI 1X47A 4JG4A 4JI7I 2HHHE 4AQYI 1HNXE 4I3HA 1ZM3A 4OX9E 4DPXA 4DR6I 4LFCE 4DUYI 1IBMI 1Z0BA 4JYAI 2BM1A 2LBSB 4X65E 5LMNE 5LMUE 4LF8E 4HACA 1Z5BA 4DV5E 4YHHE 4B3RE 5GMEA 3LLHA 4B3SI 2J7KA 4ZVIA 3ADIA 2CPNA 1XNRI 1BKNA 1B62A 3J7AM 2F4VE 2VF3A 4HY1A 4X62E 1YYWA 2E5LI 4JI2E 2A2DA 4B3TI 2L2NA 4FWGA 2UUBE 4LF7E 2JVAA 1PKPA 4LFBE 2EFGA 5CFFE 4JI5E 1WUUA 2DIXA 4DU7A 1HNZI 2UUAI 2NUEA 4GKJI 1XMOI 1HR0I 1N0VC 2VQFI 2L3CA 4X8WA 1KVKA 2V2QA 3ADLA 1NHHA 1A6FA 2CZ9A 1YZ9A 2VQEI 4DPWA 4JV5E 4KHPE 4GKKE 2AJ4A 1Z0WA 1N36I 4X66I 1EA6A 3B8HA 3J7AG 4WUCA 2WW4A 1EKZA 2LTSA 3ZKDA 1IBKE 4YY3I 4DV6E 4DV7I 4DV4E 2NUFA 3ZZ0A 2N3GA 2B7VA 3PYFA 4DV1E 4DR1I 4X64E 3LPSA 2RTXA 2RS6A 1N34E 1UEKA 2L33A 2HFSA 1MU5A 4P52A 3ZKBA 2RSMA 3T1HI 2GS8A 3T1YI 3PYDA 4Z7YA 1RC7A 4JI7E 2LUQA 2BM0A 4AQYE 2EZ6A 4DR4I 4DR6E 4DUYE 1IBME 4JYAE 1J26A 1T4LB 2LRSA 2ZBKB 3ZM7A 5IWAI 1N33I 3B82A 3M6AA 4NXNI 1QU6A 2UXDI 1H7SA 4JI1I 4Z7CA 2NPFA 1ELOA 2B3TB 2HK2A 2L2KB 3WU5A 2ZITA 4B3SE 2HKJA 4DPTA 1XNRE 1PIEA
chains in the Genus database with same CATH superfamily
4BMJA 4IFDE 1JK1A 4WUDA 1XNQI 2MDGA 2E5LE 3KRNA 5ADZA 4JI3I 1Z0GA 3GLLA 4DV3I 4X9JA 1DARA 4AIMA 4UTGA 1H74A 1S4EA 4DV2I 3P76A 2EOJA 1L4SA 1D6TA 2JXPA 4BBYA 3P1XA 1XHKA 1Z59A 2FGGA 4MU1A 4DR5I 3K1JA 4O43A 4BA2A 2EN7A 3B4TA 4DV0I 1G2FC 1HNZE 2UUAE 4WPYA 2WNRA 3OMLA 2LTRA 3MHHC 1AH5A 1UHZA 2EN2A 2JWOA 1XMOE 4GKJE 1HR0E 2HFUA 4NHRA 2EOOA 4O5GA 3H1CA 3LTOA 1OJ4A 3EPKA 1YYOA 2VQFE 2O3ZA 2V8PA 1YPNA 1T4OA 2L8TA 2PNLA 4XTJA 2FV4B 4DR2I 3C4BA 4MU4A 2DEIA 2O1VA 1YYKA 4M2ZA 2CSHA 2YRKA 2VQEE 4JI8I 3UHMA 4LF7I 1Z0VA 2I9IA 1R6MA 2PO2B 3CDIA 3J7Yp 4R1FA 4M30A 1MG7A 2IOQA 1A1HA 1NHIA 2Z5CA 5KL2A 2YTOA 2YT4A 3ADGA 1N36E 1ZAAC 2J65A 4X66E 3V2UC 4DU8A 4DR7I 4GZNC 4GQUA 1H7UA 4MYTA 5LLQA 5C0XD 4YY3E 4DV7E 4DXLA 1O0WA 4P78A 5L3JA 2UXBI 1J5EI 1IBLI 2O1TA 3QT8A 2EJ4A 2NN6F 2EPPA 4DR3I 2EPLX 2F1DA 1ZU1A 1RR9A 4LF4I 2X36A 4ISAA 2M7QA 4DR1E 1USUA 3QT6A 2EMBA 4WSGA 2MDRA 4J8ZA 2R3VA 2V34A 1UBDC 2V2VA 3DJWA 1A1FA 5A2QQ 2UU9I 2EMYA 4JI4I 1GQEA 1EH6A 2E1RA 1I94I 2JEAA 2BBGA 2NN6C 2KOUA 2BA0G 2OI2A 1RHYA 2H36X 2Q8UA 4AM3A 2CT1A 3T1HE 4IFDA 2ZM6I 3K17A 2DMYA 2MKNA 3PYEA 2KONA 1NCSA 2V8QB 4FWDA 2YTQA 1SR9A 4WSPA 4PU9A 4DPYA 4AIDA 3J81Q 3T1YE 3Q6NA 1OYPA 1B63A 2YZTA 4IJDA 4TUIA 4HACB 2DB2A 2NN6B 1Y60A 2EMKA 3H09A 2WBUA 3ADJA 2EN4A 1FKAE 2LV2A 3JTZA 2BR2A 5C0XA 2YSOA 4DR4E 2GLIA 1EI1A 2EMCA 3VK6A 1ZBTA 2EOXA 4L5NC 1TF3A 2EM0A 2EM3A 2N8XA 5IWAE 1N33E 4FWHA 4LFAI 3ZOQB 4NXNE 3HXLA 4N3OA 4IZKB 2UUCI 2UXDE 4GEQB 3JAMQ 4ED4A 1ZXNA 4JI1E 3PYGA 4LPFA 5GMDA 4R2EA 2LO3A 5K36F 3HPZA 2K4VA 4B3ME 4P7AA 2EOZA 2IESA 3D4JA 3HULA 4MU0A 2WP8B 4PRXA 2YRMA 1X6FA 2HKEA 2L3JA 4DPUA 3AUZA 3WU3A 1A1LA 1Z0TA 5BR8I 2KHXA 2EL4A 2IERA 2EPUA 3F6GA 4NBQA 1XNQE 4OOGC 1ZM9A 4R2PA 4JI3E 4LCFA 1YHCA 3L00A 3ZZUA 2EOSA 5AE1A 4DV3E 5FLXQ 4DUZI 5LL6R 1NHJA 4BHCA 4DMIA 5AASA 4DV2E 4LF5I 4NXMI 2PNZB 2JEBB 4I8OA 1FWLA 4IS1C 2EPMX 4DR5E 4IZJB 4LF6I 2A25A 4DV0E 2EPOA 2NABA 2NN6D 3B78A 4FW5A 3GONA 2RS7A 2V2ZA 3H4LA 3J80Q 5A6JA 1UILA 2MKDA 1NEIA 5A2QC 1VI7A 5A6AA 2R42A 1FJGI 2EN3A 4WXDA 5TSEA 2V88A 4WYQB 2YRHA 1IMUA 4IS9A 1Z0EA 2YTIA 3V5RA 2DLQA 3WU6A 3IWBA 2EOMA 4DR2E 4B3TE 5AC4A 2NUGA 4UT4A 2UXCI 4JI8E 4F9CB 2XEXA 1E3HA 1GTKA 1XMQI 2VESA 4R2DA 2EPXA 4JI6I 3OTOE 1ZXMA 4TUGA 2RQLA 3ECRA 4KWYA 1FNMA 1HNWI 1WJPA 2NA2A 4FW7A 5C0XE 2EM5A 4OO1F 4DR7E 2HK3A 2C37A 3QT7A 4FW9A 2E1MA 5IT9Q 1K47A 2O1WA 5ELWA 4EMDA 1H72C 2EOYA 2L2MA 2A2CA 3PRYA 4K0KI 4M9VC 2UXBE 4JI0I 3THNA 1J5EE 1IBLE 4BC9A 2LJUA 2LJHA 2MC6A 3HQ1A 1UDSA 4DR3E 4F9BB 2ODRC 1SFEA 4LF9I 4OO1C 2M4IA 3JAMC 2EM6A 4RH8A 4LF4E 2NN6A 1X48A 4DKKA 5KL4A 3LMLA 1YSAC 2CVEA 2HHHI 1HNXI 2EM4A 2VRDA 1MX0A 1AAYA 2UU9E 3VYXA 4JI4E 1A1KA 1I94E 2C39A 3QT5A 2ELZA 4OX9I 4LFCI 4OO1B 2V87A 1T39A 4USMA 1WHNA 2E72A 3JU0A 1GZ6A 2JOXA 2YTEA 1BBOA 3P3CA 2V85A 3CWVA 4X65I 2ZM6E 4MLVA 5LMNI 5LMUI 1U2RA 2JE6A 1X49A 2EOEA 4F6MA 3ZZTA 1RQ0A 2L6MA 1H73A 3U1KA 4LF8I 2EOIA 3F0NA 4HXZA 5FLXC 4LCHA 3DD6A 4DV5I 1P42A 4YHHI 2PO0B 2D9HA 4MYUA 4B3RI 1QZRA 4WX9A 2PNMA 2EL5A 2GPIA 1KIJA 3WU4A 5EKWA 3KZZA 2JY9A 2Q2EB 3L7ZB 3J80C 3LNUA 2R1FA 1A1GA 1F2IG 2EM2A 1YUIA 4LFAE 2F4VI 3M7ND 2EN1A 1YFHA 4F2JC 2N3HA 4R2AA 2UUCE 2YTPA 4X62I 1UDNA 1FI4A 1ZM4A 5KL6A 4JI2I 1T38A 2EMXA 3P3EA 2UUBI 2LUPB 2ELYA 2VE7C 1PVGA 4BC7A 2AE8A 2JEBA 2PNZA 2EQ1A 4KQVA 4RPFA 5JEAF 4LFBI 2BV3A 2GHFA 2M9AA 4JI5I 5AE2A 2WZOA 1Z0CA 4F6NA 2VF1A 4BA2B 2CTDA 2EN6A 4R2SA 3M85D 1OYSA 4M1KA 5JEAD 2WNRB 2EMLA 2EM9A 4HEIA 1KKHA 5BR8E 2DMIA 5IT9C 1WHQA 2IOPA 1MGTA 2GQ0A 1BB8A 2ODRD 1NZ0A 4OO1D 5JEAC 5T6JA 2EN8A 2IHR1 5F3WA 4DUZE 2F8BA 1KTVA 4HYMA 3PS3A 2NN6E 4USKA 4LF5E 4MDTA 4NXME 1Z5CA 2BA1D 2EPRA 4PRVA 4JV5I 4KHPI 4LF6E 3VHTB 4GKKI 1TF6A 4URLA 4BHBA 2Z5CB 5JEAB 3C4TA 4OZEA 2CGEA 1ZM2A 1XXEA 3HPSA 1OYRA 3Q1QA 4U3BA 2LJPA 2C38B 1A1IA 1DI2A 3M7NG 4IFDF 1FJGE 1FWKA 1S16A 1IBKI 4BA1B 1DQ3A 4J3DA 1N32E 4DV6I 2O1UA 5K36C 2EMAA 1UDQA 4DV4I 4Q28A 4R03A 1ZR9A 2WBSA 1T4NA 2YTGA 2UXCE 1VISA 2L92A 1LLMC 3HTXA 1Y4SA 2YTNA 1XMQE 1WXRA 2PO2A 4JI6E 4DV1I 4X64I 1HNWE 1STUA 3HJCA 2EM7A 3EQ1A 4LTYA 5A6KA 3VYYA 2HGHA 4FN5A 5K36B 1Z5AA 2WCC3 4OKGA 2X7IA 2DEJA 2JR1A 2JYAA 4R2QA 2JPAA 4OO1A 1N34I 4ZYHA 4LU9A 4K0KE 4FW6A 1N32I 1PJTA 2LMZA 4MLQA 4JI0E 4FW4A 2EOFA 4IFDB 4WFTA 3MHSC 4M0VA 2GO4A 4LF9E 1N0UA 2B7TA 3F6HA 3J81C 1RREA 4WUBA 5A6BD 2PO0A 3FIGA 4B3MI 1X47A 4P7DA 3BIDA 4JG4A 4RHBB 4FK5C 4JI7I 4F9AB 1A1JA 2HHHE 4AQYI 1HNXE 4I3HA 2EPCA 1ZM3A 4OX9E 4DPXA 2LE2A 2B9DA 3C6MA 1EH7A 3BBGA 4Q35B 4F54A 2CG9A 4LFCE 3L7ZA 4U3DA 1Z0BA 4DUYI 1IBMI 4DR6I 4JYAI 2BM1A 2LBSB 1R6LA 4X65E 4R2RA 5LMNE 3THOB 5LMUE 1UN6B 2JT2A 2EMGA 5IV8B 3KWRA 1JK2A 3EPHA 4LF8E 2EMHA 1X6HA 3BGHA 1X6EA 2EE8A 1Z5BA 4HACA 4DV5E 3M85G 4YHHE 4O24A 5AC5A 1HK7A 2HC5A 3QG5C 4HTGA 1Z1BA 3RMPA 4B3RE 3LLHA 2EMWA 5GMEA 2DLKA 4B3SI 4O4KA 5DRQA 2J7KA 4ZVIA 4IZJD 1IQSA 3ADIA 2CPNA 5K36D 1E3PA 1XNRI 1BKNA 1B62A 3MSWA 3P3GA 2PO1B 3J7AM 2F4VE 2YU5A 2VF3A 2YWQA 4X62E 1YYWA 2BA1G 4HY1A 2EPAA 4IZKA 2JP9A 2E5LI 5A6BA 3EPLA 4JI2E 1ZBQA 2YSPA 2A2DA 4B3TI 3C6KA 2L2NA 4FWGA 4IFDD 2UUBE 2J7JA 2JVAA 1PKPA 4LF7E 2Z5BB 1G2DC 4LFBE 3U1YA 2EFGA 3EPJA 3DF6A 5CFFE 2PRTA 4R2CA 5KL5A 4JI5E 5EL9A 4N4RB 1WUUA 2LCEA 1X3CA 3K6QA 4KZSA 1P47A 2WP8A 5JEAA 2DIXA 1QNTA 3HKMA 1Y6ZA 4DU7A 4FW3A 1HNZI 2UUAI 2NUEA 4OO1E 4BS9A 3KZYA 2G7HA 2C38A 4GKJI 1XMOI 3M99B 1PDAA 1HR0I 4BA1A 2FTXB 2LT7A 2RPCA 1N0VC 3P06A 5DNLA 5DNXA 2VQFI 2DGCA 1B69A 1MEYC 2ADRA 4X8WA 4WXCA 2MC5A 3BF2A 2L3CA 3ADLA 1KVKA 1NHHA 1UDOA 1A6FA 2V2QA 2CZ9A 2EPNA 1YZ9A 2ENAA 1EH8A 4DPWA 2VQEI 4ZYDA 4JV5E 3OTOI 1N3GA 2HJJA 4KHPE 2GO3A 4IZJA 4GKKE 4ZYEA 4MU3A 5K36A 1YUJA 1USVA 1Z0WA 2AJ4A 3K85A 4LCGA 3CDJA 1N36I 3PS1A 4X66I 1EA6A 3J7AG 3B8HA 4WUCA 2WW4A 2C37B 1EKZA 2RSIA 3PS2A 2LTSA 5DNYA 3ZKDA 2JOBA 1IBKE 1DGCA 2EOHA 4YY3I 4DV6E 4DV7I 4NZVA 4DV4E 2NUFA 3GMEA 5IXMB 2I13A 2K7IA 2N3GA 3ZZ0A 1TN9A 3NZKA 2EQ0A 2B7VA 5DRRA 3PYFA 4DV1E 4DR1I 4X64E 3LPSA 2ENCA 1Y4UA 3IWDA 2Z5EA 1PJSA 2RTXA 1X5WA 2C39B 1YH8A 2RS6A 2EOQA 2V83A 4BCAA 1N34E 1UEKA 3Q6MA 3TQMA 4MQYA 2L33A 2HFSA 2DSYA 1MU5A 2YPNA 4P52A 3ZKBA 1Y5YA 2RSMA 3T1HI 2GS8A 5FWKA 2EMIA 2JE6B 5DROA 4L8NA 3T1YI 2EORA 3IWCA 3PYDA 1IQOA 1KYQA 4Z7YA 2EPZA 1KJKA 2V89A 2EWLA 5JEAE 2EMFA 1RC7A 4JI7E 5C0XF 2LUQA 5KL3A 2YTFA 2WBTA 3AV0A 4AQYE 2BM0A 4IFDC 2DRPA 2EZ6A 2EL6A 4DR4I 5AE3A 4DR6E 3GCMA 4DUYE 1IBME 4JYAE 1J26A 1T4LB 2JEAB 2LRSA 2LVHA 2PO1A 2ZBKB 2M1SA 2YTDA 2YU8A 4QNJA 3ZM7A 5IWAI 1N33I 3B82A 3M6AA 5DRPA 4NXNI 2EP3A 2EQ3A 1QU6A 2BA0D 4LOMA 2ENHA 4R8OA 4ZYGA 5C0XC 2UXDI 1H7SA 4JI1I 4Z7CA 2Z5BA 1WRJA 1PJQA 2NPFA 2EPKX 1ELOA 2B3TB 2R76A 2HK2A 5K36E 2BB8A 2L2KB 2EMZA 2ZITA 2YTJA 5A69A 5KL7A 3UK3C 4B3SE 2HKJA 3WU5A 4DPTA 1BBGA 2V86A 2BR2B 1RMDA 5C0XB 2EM8A 1XNRE 4QNKA 1PIEA
chains in the Genus database with same CATH topology
4BMJA 4WUDA 1XNQI 2E5LE 5ADZA 4JI3I 1Z0GA 4DV3I 1DARA 4UTGA 1H74A 1S4EA 4DV2I 1D6TA 4BBYA 3P1XA 1XHKA 1Z59A 2FGGA 4DR5I 3K1JA 4DV0I 1HNZE 2UUAE 4WPYA 3OMLA 2LTRA 4GKJE 1UHZA 2JWOA 1XMOE 2HFUA 1HR0E 3LTOA 1OJ4A 1YYOA 2VQFE 2V8PA 2L8TA 1T4OA 2PNLA 4XTJA 2FV4B 4DR2I 3C4BA 2DEIA 2O1VA 1YYKA 4M2ZA 2VQEE 4JI8I 1Z0VA 3J7Yp 4R1FA 4M30A 1MG7A 2IOQA 2Z5CA 1NHIA 3OTOI 2YT4A 3ADGA 1N36E 4DU8A 4X66E 3V2UC 4DR7I 1H7UA 4MYTA 4YY3E 4DV7E 4DXLA 1O0WA 4P78A 5L3JA 2UXBI 1J5EI 1IBLI 2O1TA 3QT8A 4DR3I 1RR9A 4LF4I 2X36A 2M7QA 4DR1E 1USUA 3QT6A 2MDRA 4J8ZA 2R3VA 2V34A 2V2VA 3DJWA 5A2QQ 2UU9I 4JI4I 1GQEA 1I94I 2E1RA 2KOUA 2OI2A 2H36X 3T1HE 2ZM6I 3K17A 2DMYA 3PYEA 2KONA 4PU9A 2V8QB 4FWDA 4DPYA 1SR9A 4WSPA 3J81Q 3T1YE 3Q6NA 1B63A 2YZTA 4HACB 4TUIA 2DB2A 3H09A 3ADJA 1FKAE 3JTZA 4DR4E 1EI1A 3VK6A 1ZBTA 4L5NC 5IWAE 1N33E 4FWHA 4LFAI 3ZOQB 4NXNE 3HXLA 4N3OA 4IZKB 2UUCI 2UXDE 4GEQB 3JAMQ 4ED4A 1ZXNA 4JI1E 3PYGA 5GMDA 3HPZA 2K4VA 4B3ME 4P7AA 3D4JA 3HULA 4PRXA 2HKEA 2L3JA 4DPUA 3AUZA 3WU3A 1Z0TA 5BR8I 2KHXA 3F6GA 1XNQE 4OOGC 1ZM9A 4JI3E 3ZZUA 5AE1A 4DV3E 5FLXQ 4DUZI 5LL6R 1NHJA 4DMIA 5AASA 4DV2E 4LF5I 4NXMI 4I8OA 1FWLA 4DR5E 4LF6I 4IZJB 4DV0E 3B78A 3GONA 2RS7A 2V2ZA 3H4LA 3J80Q 1UILA 5A2QC 2R42A 1FJGI 3V5RA 2V88A 4WYQB 1N32I 1Z0EA 3WU6A 3IWBA 4DR2E 4B3TE 2NUGA 4UT4A 2UXCI 4JI8E 4F9CB 2XEXA 1XMQI 4JI6I 3OTOE 1ZXMA 4TUGA 1FNMA 1HNWI 2NA2A 4DR7E 2HK3A 3QT7A 4FW9A 2E1MA 5IT9Q 1K47A 2O1WA 4EMDA 1H72C 2L2MA 2A2CA 3PRYA 4K0KI 2UXBE 4JI0I 1J5EE 1IBLE 4BC9A 2LJHA 2MC6A 3HQ1A 4DR3E 4F9BB 2ODRC 4LF9I 2M4IA 3JAMC 4LF4E 1X48A 4DKKA 3LMLA 2HHHI 1HNXI 1MX0A 2UU9E 3VYXA 4OX9I 4JI4E 1I94E 3QT5A 4LFCI 2V87A 4USMA 1WHNA 2JOXA 1GZ6A 3JU0A 2V85A 3CWVA 4X65I 2ZM6E 5LMNI 5LMUI 1U2RA 1X49A 3ZZTA 1RQ0A 2L6MA 1H73A 4LF8I 3F0NA 4HXZA 5FLXC 4DV5I 4YHHI 4MYUA 4B3RI 1QZRA 2PNMA 1KIJA 3WU4A 2JY9A 2Q2EB 3J80C 3LNUA 4LFAE 2F4VI 4X62I 2N3HA 2UUCE 1ZM4A 1FI4A 4JI2I 2UUBI 2LUPB 2VE7C 1PVGA 4KQVA 4BC7A 4LF7I 4RPFA 4LFBI 2BV3A 4JI5I 5AE2A 2WZOA 1Z0CA 2VF1A 4M1KA 1KKHA 5BR8E 5IT9C 1WHQA 2IOPA 2GQ0A 2ODRD 1NZ0A 5T6JA 2IHR1 5F3WA 4DUZE 2F8BA 1KTVA 4HYMA 4USKA 4LF5E 4NXME 1Z5CA 4PRVA 4JV5I 4KHPI 4LF6E 4GKKI 4URLA 2Z5CB 3C4TA 2CGEA 1ZM2A 3HPSA 3Q1QA 2LJPA 1DI2A 1FJGE 1FWKA 1S16A 1IBKI 1DQ3A 1N32E 4DV6I 2O1UA 4DV4I 4Q28A 4R03A 1T4NA 2UXCE 1VISA 2L92A 3HTXA 1Y4SA 1XMQE 1WXRA 4JI6E 4DV1I 4X64I 1HNWE 1STUA 3HJCA 4FN5A 4LTYA 3VYYA 1Z5AA 2X7IA 2DEJA 2JR1A 1N34I 4LU9A 4K0KE 2LMZA 4JI0E 4WFTA 4M0VA 4LF9E 1N0UA 2B7TA 3F6HA 3J81C 1RREA 4WUBA 3FIGA 4B3MI 1X47A 4P7DA 4JG4A 4JI7I 4F9AB 2HHHE 4AQYI 1HNXE 4I3HA 1ZM3A 4OX9E 4DPXA 2LE2A 2B9DA 4F54A 4DR6I 2CG9A 4LFCE 4DUYI 1IBMI 1Z0BA 4JYAI 2BM1A 2LBSB 4X65E 5LMNE 5LMUE 3KWRA 4LF8E 4HACA 1Z5BA 4DV5E 4YHHE 1HK7A 4B3RE 3RMPA 5GMEA 3LLHA 4B3SI 2J7KA 4ZVIA 4IZJD 3ADIA 2CPNA 1XNRI 1BKNA 1B62A 3MSWA 3J7AM 2F4VE 2VF3A 4HY1A 4X62E 1YYWA 4IZKA 2E5LI 4JI2E 1ZBQA 2A2DA 4B3TI 2L2NA 4FWGA 2UUBE 4LF7E 2JVAA 1PKPA 2Z5BB 4LFBE 2EFGA 3DF6A 5CFFE 4JI5E 1WUUA 3K6QA 4KZSA 2DIXA 1Y6ZA 4DU7A 1HNZI 2UUAI 2NUEA 4BS9A 2G7HA 4GKJI 1XMOI 1HR0I 2FTXB 3P06A 1N0VC 2VQFI 2L3CA 4X8WA 2MC5A 1KVKA 2V2QA 3ADLA 1NHHA 1A6FA 2CZ9A 1YZ9A 2VQEI 4DPWA 4JV5E 4KHPE 4IZJA 4GKKE 1USVA 1Z0WA 2AJ4A 3K85A 1N36I 4X66I 1EA6A 3J7AG 3B8HA 4WUCA 2WW4A 1EKZA 2LTSA 5DNYA 3ZKDA 2JOBA 1IBKE 4YY3I 4DV6E 4DV7I 4DV4E 2NUFA 3ZZ0A 2N3GA 2B7VA 3PYFA 4DV1E 4DR1I 4X64E 3LPSA 1Y4UA 3IWDA 2Z5EA 2RTXA 2RS6A 2V83A 4BCAA 1N34E 1UEKA 3Q6MA 2L33A 2HFSA 2DSYA 1MU5A 4P52A 3ZKBA 2RSMA 3T1HI 2GS8A 5FWKA 4L8NA 3T1YI 3IWCA 3PYDA 4Z7YA 2EWLA 2V89A 1RC7A 4JI7E 2LUQA 2BM0A 3AV0A 4AQYE 2EZ6A 4DR4I 5AE3A 4DR6E 4DUYE 1IBME 4JYAE 1J26A 1T4LB 2LRSA 2ZBKB 2M1SA 3ZM7A 5IWAI 1N33I 3B82A 3M6AA 4NXNI 1QU6A 4R8OA 2UXDI 1H7SA 4JI1I 4Z7CA 2Z5BA 2NPFA 1ELOA 2B3TB 2HK2A 2L2KB 3WU5A 2ZITA 4B3SE 2HKJA 4DPTA 2V86A 1XNRE 1PIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUD A;  1XNQ I;  2E5L E;  4JI3 I;  1Z0G A;  4DV3 I;  1DAR A;  4UTG A;  1H74 A;  1S4E A;  4DV2 I;  1D6T A;  3P1X A;  1XHK A;  1Z59 A;  4DR5 I;  3K1J A;  4DV0 I;  1HNZ E;  2UUA E;  2LTR A;  4GKJ E;  1UHZ A;  1XMO E;  2HFU A;  1HR0 E;  3LTO A;  1OJ4 A;  1YYO A;  2VQF E;  2V8P A;  1T4O A;  4XTJ A;  4DR2 I;  3C4B A;  2DEI A;  1YYK A;  4M2Z A;  2VQE E;  4JI8 I;  1Z0V A;  3J7Y p;  4R1F A;  4M30 A;  1MG7 A;  3OTO I;  1NHI A;  2YT4 A;  3ADG A;  1N36 E;  4DU8 A;  4X66 E;  3V2U C;  4DR7 I;  1H7U A;  4MYT A;  4YY3 E;  4DV7 E;  4DXL A;  1O0W A;  5L3J A;  2UXB I;  1J5E I;  1IBL I;  3QT8 A;  4DR3 I;  1RR9 A;  4LF4 I;  2X36 A;  4DR1 E;  3QT6 A;  2MDR A;  2R3V A;  2V34 A;  2V2V A;  5A2Q Q;  2UU9 I;  4JI4 I;  1GQE A;  1I94 I;  2E1R A;  2OI2 A;  3T1H E;  2ZM6 I;  3K17 A;  2DMY A;  3PYE A;  4PU9 A;  4DPY A;  4FWD A;  3J81 Q;  3T1Y E;  1B63 A;  4HAC B;  2DB2 A;  3ADJ A;  1FKA E;  4DR4 E;  1EI1 A;  1ZBT A;  5IWA E;  1N33 E;  4FWH A;  4LFA I;  4NXN E;  2UUC I;  2UXD E;  3JAM Q;  4ED4 A;  1ZXN A;  4JI1 E;  3PYG A;  5GMD A;  4B3M E;  4P7A A;  3D4J A;  3HUL A;  4PRX A;  2HKE A;  2L3J A;  4DPU A;  3WU3 A;  1Z0T A;  5BR8 I;  2KHX A;  1XNQ E;  4OOG C;  1ZM9 A;  4JI3 E;  3ZZU A;  4DV3 E;  5FLX Q;  4DUZ I;  1NHJ A;  5LL6 R;  4DV2 E;  4LF5 I;  4NXM I;  1FWL A;  4DR5 E;  4LF6 I;  4DV0 E;  3B78 A;  3GON A;  2RS7 A;  3H4L A;  2V2Z A;  3J80 Q;  1UIL A;  5A2Q C;  2R42 A;  1FJG I;  3V5R A;  4WYQ B;  1N32 I;  1Z0E A;  3WU6 A;  4DR2 E;  4B3T E;  2NUG A;  4UT4 A;  2UXC I;  4JI8 E;  2XEX A;  1XMQ I;  4JI6 I;  3OTO E;  1ZXM A;  1FNM A;  1HNW I;  2NA2 A;  4DR7 E;  2HK3 A;  3QT7 A;  4FW9 A;  5IT9 Q;  1K47 A;  4EMD A;  1H72 C;  2L2M A;  2A2C A;  4K0K I;  2UXB E;  4JI0 I;  1J5E E;  1IBL E;  2LJH A;  4DR3 E;  4LF9 I;  3JAM C;  4LF4 E;  1X48 A;  4DKK A;  2HHH I;  1HNX I;  1MX0 A;  2UU9 E;  3VYX A;  4OX9 I;  4JI4 E;  1I94 E;  3QT5 A;  4LFC I;  4USM A;  1WHN A;  3CWV A;  4X65 I;  2ZM6 E;  5LMN I;  5LMU I;  1U2R A;  1X49 A;  3ZZT A;  1RQ0 A;  1H73 A;  4LF8 I;  3F0N A;  4HXZ A;  5FLX C;  4DV5 I;  4YHH I;  4MYU A;  4B3R I;  1QZR A;  1KIJ A;  3WU4 A;  2JY9 A;  2Q2E B;  3J80 C;  3LNU A;  4LFA E;  2F4V I;  4X62 I;  2N3H A;  2UUC E;  1ZM4 A;  1FI4 A;  4JI2 I;  2UUB I;  2LUP B;  1PVG A;  4KQV A;  4LF7 I;  4RPF A;  4LFB I;  2BV3 A;  4JI5 I;  1Z0C A;  4M1K A;  1KKH A;  5BR8 E;  5IT9 C;  1WHQ A;  1NZ0 A;  2IHR 1;  4DUZ E;  1KTV A;  4HYM A;  4USK A;  4LF5 E;  4NXM E;  1Z5C A;  4PRV A;  4JV5 I;  4KHP I;  4LF6 E;  4GKK I;  4URL A;  3C4T A;  1ZM2 A;  3Q1Q A;  2LJP A;  1DI2 A;  1FJG E;  1FWK A;  1S16 A;  1IBK I;  1N32 E;  4DV6 I;  4DV4 I;  1T4N A;  2UXC E;  1VIS A;  3HTX A;  1XMQ E;  4JI6 E;  4DV1 I;  4X64 I;  1HNW E;  1STU A;  4FN5 A;  3VYY A;  1Z5A A;  2X7I A;  2DEJ A;  1N34 I;  4K0K E;  4JI0 E;  4WFT A;  4LF9 E;  1N0U A;  2B7T A;  1RRE A;  3J81 C;  4WUB A;  4B3M I;  1X47 A;  4JG4 A;  4JI7 I;  2HHH E;  4AQY I;  1HNX E;  4I3H A;  1ZM3 A;  4OX9 E;  4DPX A;  4DR6 I;  4LFC E;  4DUY I;  1IBM I;  1Z0B A;  4JYA I;  2BM1 A;  2LBS B;  4X65 E;  5LMN E;  5LMU E;  4LF8 E;  4HAC A;  1Z5B A;  4DV5 E;  4YHH E;  4B3R E;  5GME A;  3LLH A;  4B3S I;  2J7K A;  4ZVI A;  3ADI A;  2CPN A;  1XNR I;  1BKN A;  1B62 A;  3J7A M;  2F4V E;  2VF3 A;  4HY1 A;  4X62 E;  1YYW A;  2E5L I;  4JI2 E;  2A2D A;  4B3T I;  2L2N A;  4FWG A;  2UUB E;  4LF7 E;  2JVA A;  1PKP A;  4LFB E;  2EFG A;  5CFF E;  4JI5 E;  1WUU A;  2DIX A;  4DU7 A;  1HNZ I;  2UUA I;  2NUE A;  4GKJ I;  1XMO I;  1HR0 I;  1N0V C;  2VQF I;  2L3C A;  4X8W A;  1KVK A;  2V2Q A;  3ADL A;  1NHH A;  1A6F A;  2CZ9 A;  1YZ9 A;  2VQE I;  4DPW A;  4JV5 E;  4KHP E;  4GKK E;  2AJ4 A;  1Z0W A;  1N36 I;  4X66 I;  1EA6 A;  3B8H A;  3J7A G;  4WUC A;  2WW4 A;  1EKZ A;  2LTS A;  3ZKD A;  1IBK E;  4YY3 I;  4DV6 E;  4DV7 I;  4DV4 E;  2NUF A;  3ZZ0 A;  2N3G A;  2B7V A;  3PYF A;  4DV1 E;  4DR1 I;  4X64 E;  3LPS A;  2RTX A;  2RS6 A;  1N34 E;  1UEK A;  2L33 A;  2HFS A;  1MU5 A;  4P52 A;  3ZKB A;  2RSM A;  3T1H I;  2GS8 A;  3T1Y I;  3PYD A;  4Z7Y A;  1RC7 A;  4JI7 E;  2LUQ A;  2BM0 A;  4AQY E;  2EZ6 A;  4DR4 I;  4DR6 E;  4DUY E;  1IBM E;  4JYA E;  1J26 A;  1T4L B;  2LRS A;  2ZBK B;  3ZM7 A;  5IWA I;  1N33 I;  3B82 A;  3M6A A;  4NXN I;  1QU6 A;  2UXD I;  1H7S A;  4JI1 I;  4Z7C A;  2NPF A;  1ELO A;  2B3T B;  2HK2 A;  2L2K B;  3WU5 A;  2ZIT A;  4B3S E;  2HKJ A;  4DPT A;  1XNR E;  1PIE A; 
#chains in the Genus database with same CATH topology
 4BMJ A;  4IFD E;  1JK1 A;  4WUD A;  1XNQ I;  2MDG A;  2E5L E;  3KRN A;  5ADZ A;  4JI3 I;  1Z0G A;  3GLL A;  4DV3 I;  4X9J A;  1DAR A;  4AIM A;  4UTG A;  1H74 A;  1S4E A;  4DV2 I;  3P76 A;  2EOJ A;  1L4S A;  1D6T A;  2JXP A;  4BBY A;  3P1X A;  1XHK A;  1Z59 A;  2FGG A;  4MU1 A;  4DR5 I;  3K1J A;  4O43 A;  4BA2 A;  2EN7 A;  3B4T A;  4DV0 I;  1G2F C;  1HNZ E;  2UUA E;  4WPY A;  2WNR A;  3OML A;  2LTR A;  3MHH C;  1AH5 A;  1UHZ A;  2EN2 A;  2JWO A;  1XMO E;  4GKJ E;  1HR0 E;  2HFU A;  4NHR A;  2EOO A;  4O5G A;  3H1C A;  3LTO A;  1OJ4 A;  3EPK A;  1YYO A;  2VQF E;  2O3Z A;  2V8P A;  1YPN A;  1T4O A;  2L8T A;  2PNL A;  4XTJ A;  2FV4 B;  4DR2 I;  3C4B A;  4MU4 A;  2DEI A;  2O1V A;  1YYK A;  4M2Z A;  2CSH A;  2YRK A;  2VQE E;  4JI8 I;  3UHM A;  4LF7 I;  1Z0V A;  2I9I A;  1R6M A;  2PO2 B;  3CDI A;  3J7Y p;  4R1F A;  4M30 A;  1MG7 A;  2IOQ A;  1A1H A;  1NHI A;  2Z5C A;  5KL2 A;  2YTO A;  2YT4 A;  3ADG A;  1N36 E;  1ZAA C;  2J65 A;  4X66 E;  3V2U C;  4DU8 A;  4DR7 I;  4GZN C;  4GQU A;  1H7U A;  4MYT A;  5LLQ A;  5C0X D;  4YY3 E;  4DV7 E;  4DXL A;  1O0W A;  4P78 A;  5L3J A;  2UXB I;  1J5E I;  1IBL I;  2O1T A;  3QT8 A;  2EJ4 A;  2NN6 F;  2EPP A;  4DR3 I;  2EPL X;  2F1D A;  1ZU1 A;  1RR9 A;  4LF4 I;  2X36 A;  4ISA A;  2M7Q A;  4DR1 E;  1USU A;  3QT6 A;  2EMB A;  4WSG A;  2MDR A;  4J8Z A;  2R3V A;  2V34 A;  1UBD C;  2V2V A;  3DJW A;  1A1F A;  5A2Q Q;  2UU9 I;  2EMY A;  4JI4 I;  1GQE A;  1EH6 A;  2E1R A;  1I94 I;  2JEA A;  2BBG A;  2NN6 C;  2KOU A;  2BA0 G;  2OI2 A;  1RHY A;  2H36 X;  2Q8U A;  4AM3 A;  2CT1 A;  3T1H E;  4IFD A;  2ZM6 I;  3K17 A;  2DMY A;  2MKN A;  3PYE A;  2KON A;  1NCS A;  2V8Q B;  4FWD A;  2YTQ A;  1SR9 A;  4WSP A;  4PU9 A;  4DPY A;  4AID A;  3J81 Q;  3T1Y E;  3Q6N A;  1OYP A;  1B63 A;  2YZT A;  4IJD A;  4TUI A;  4HAC B;  2DB2 A;  2NN6 B;  1Y60 A;  2EMK A;  3H09 A;  2WBU A;  3ADJ A;  2EN4 A;  1FKA E;  2LV2 A;  3JTZ A;  2BR2 A;  5C0X A;  2YSO A;  4DR4 E;  2GLI A;  1EI1 A;  2EMC A;  3VK6 A;  1ZBT A;  2EOX A;  4L5N C;  1TF3 A;  2EM0 A;  2EM3 A;  2N8X A;  5IWA E;  1N33 E;  4FWH A;  4LFA I;  3ZOQ B;  4NXN E;  3HXL A;  4N3O A;  4IZK B;  2UUC I;  2UXD E;  4GEQ B;  3JAM Q;  4ED4 A;  1ZXN A;  4JI1 E;  3PYG A;  4LPF A;  5GMD A;  4R2E A;  2LO3 A;  5K36 F;  3HPZ A;  2K4V A;  4B3M E;  4P7A A;  2EOZ A;  2IES A;  3D4J A;  3HUL A;  4MU0 A;  2WP8 B;  4PRX A;  2YRM A;  1X6F A;  2HKE A;  2L3J A;  4DPU A;  3AUZ A;  3WU3 A;  1A1L A;  1Z0T A;  5BR8 I;  2KHX A;  2EL4 A;  2IER A;  2EPU A;  3F6G A;  4NBQ A;  1XNQ E;  4OOG C;  1ZM9 A;  4R2P A;  4JI3 E;  4LCF A;  1YHC A;  3L00 A;  3ZZU A;  2EOS A;  5AE1 A;  4DV3 E;  5FLX Q;  4DUZ I;  5LL6 R;  1NHJ A;  4BHC A;  4DMI A;  5AAS A;  4DV2 E;  4LF5 I;  4NXM I;  2PNZ B;  2JEB B;  4I8O A;  1FWL A;  4IS1 C;  2EPM X;  4DR5 E;  4IZJ B;  4LF6 I;  2A25 A;  4DV0 E;  2EPO A;  2NAB A;  2NN6 D;  3B78 A;  4FW5 A;  3GON A;  2RS7 A;  2V2Z A;  3H4L A;  3J80 Q;  5A6J A;  1UIL A;  2MKD A;  1NEI A;  5A2Q C;  1VI7 A;  5A6A A;  2R42 A;  1FJG I;  2EN3 A;  4WXD A;  5TSE A;  2V88 A;  4WYQ B;  2YRH A;  1IMU A;  4IS9 A;  1Z0E A;  2YTI A;  3V5R A;  2DLQ A;  3WU6 A;  3IWB A;  2EOM A;  4DR2 E;  4B3T E;  5AC4 A;  2NUG A;  4UT4 A;  2UXC I;  4JI8 E;  4F9C B;  2XEX A;  1E3H A;  1GTK A;  1XMQ I;  2VES A;  4R2D A;  2EPX A;  4JI6 I;  3OTO E;  1ZXM A;  4TUG A;  2RQL A;  3ECR A;  4KWY A;  1FNM A;  1HNW I;  1WJP A;  2NA2 A;  4FW7 A;  5C0X E;  2EM5 A;  4OO1 F;  4DR7 E;  2HK3 A;  2C37 A;  3QT7 A;  4FW9 A;  2E1M A;  5IT9 Q;  1K47 A;  2O1W A;  5ELW A;  4EMD A;  1H72 C;  2EOY A;  2L2M A;  2A2C A;  3PRY A;  4K0K I;  4M9V C;  2UXB E;  4JI0 I;  3THN A;  1J5E E;  1IBL E;  4BC9 A;  2LJU A;  2LJH A;  2MC6 A;  3HQ1 A;  1UDS A;  4DR3 E;  4F9B B;  2ODR C;  1SFE A;  4LF9 I;  4OO1 C;  2M4I A;  3JAM C;  2EM6 A;  4RH8 A;  4LF4 E;  2NN6 A;  1X48 A;  4DKK A;  5KL4 A;  3LML A;  1YSA C;  2CVE A;  2HHH I;  1HNX I;  2EM4 A;  2VRD A;  1MX0 A;  1AAY A;  2UU9 E;  3VYX A;  4JI4 E;  1A1K A;  1I94 E;  2C39 A;  3QT5 A;  2ELZ A;  4OX9 I;  4LFC I;  4OO1 B;  2V87 A;  1T39 A;  4USM A;  1WHN A;  2E72 A;  3JU0 A;  1GZ6 A;  2JOX A;  2YTE A;  1BBO A;  3P3C A;  2V85 A;  3CWV A;  4X65 I;  2ZM6 E;  4MLV A;  5LMN I;  5LMU I;  1U2R A;  2JE6 A;  1X49 A;  2EOE A;  4F6M A;  3ZZT A;  1RQ0 A;  2L6M A;  1H73 A;  3U1K A;  4LF8 I;  2EOI A;  3F0N A;  4HXZ A;  5FLX C;  4LCH A;  3DD6 A;  4DV5 I;  1P42 A;  4YHH I;  2PO0 B;  2D9H A;  4MYU A;  4B3R I;  1QZR A;  4WX9 A;  2PNM A;  2EL5 A;  2GPI A;  1KIJ A;  3WU4 A;  5EKW A;  3KZZ A;  2JY9 A;  2Q2E B;  3L7Z B;  3J80 C;  3LNU A;  2R1F A;  1A1G A;  1F2I G;  2EM2 A;  1YUI A;  4LFA E;  2F4V I;  3M7N D;  2EN1 A;  1YFH A;  4F2J C;  2N3H A;  4R2A A;  2UUC E;  2YTP A;  4X62 I;  1UDN A;  1FI4 A;  1ZM4 A;  5KL6 A;  4JI2 I;  1T38 A;  2EMX A;  3P3E A;  2UUB I;  2LUP B;  2ELY A;  2VE7 C;  1PVG A;  4BC7 A;  2AE8 A;  2JEB A;  2PNZ A;  2EQ1 A;  4KQV A;  4RPF A;  5JEA F;  4LFB I;  2BV3 A;  2GHF A;  2M9A A;  4JI5 I;  5AE2 A;  2WZO A;  1Z0C A;  4F6N A;  2VF1 A;  4BA2 B;  2CTD A;  2EN6 A;  4R2S A;  3M85 D;  1OYS A;  4M1K A;  5JEA D;  2WNR B;  2EML A;  2EM9 A;  4HEI A;  1KKH A;  5BR8 E;  2DMI A;  5IT9 C;  1WHQ A;  2IOP A;  1MGT A;  2GQ0 A;  1BB8 A;  2ODR D;  1NZ0 A;  4OO1 D;  5JEA C;  5T6J A;  2EN8 A;  2IHR 1;  5F3W A;  4DUZ E;  2F8B A;  1KTV A;  4HYM A;  3PS3 A;  2NN6 E;  4USK A;  4LF5 E;  4MDT A;  4NXM E;  1Z5C A;  2BA1 D;  2EPR A;  4PRV A;  4JV5 I;  4KHP I;  4LF6 E;  3VHT B;  4GKK I;  1TF6 A;  4URL A;  4BHB A;  2Z5C B;  5JEA B;  3C4T A;  4OZE A;  2CGE A;  1ZM2 A;  1XXE A;  3HPS A;  1OYR A;  3Q1Q A;  4U3B A;  2LJP A;  2C38 B;  1A1I A;  1DI2 A;  3M7N G;  4IFD F;  1FJG E;  1FWK A;  1S16 A;  1IBK I;  4BA1 B;  1DQ3 A;  4J3D A;  1N32 E;  4DV6 I;  2O1U A;  5K36 C;  2EMA A;  1UDQ A;  4DV4 I;  4Q28 A;  4R03 A;  1ZR9 A;  2WBS A;  1T4N A;  2YTG A;  2UXC E;  1VIS A;  2L92 A;  1LLM C;  3HTX A;  1Y4S A;  2YTN A;  1XMQ E;  1WXR A;  2PO2 A;  4JI6 E;  4DV1 I;  4X64 I;  1HNW E;  1STU A;  3HJC A;  2EM7 A;  3EQ1 A;  4LTY A;  5A6K A;  3VYY A;  2HGH A;  4FN5 A;  5K36 B;  1Z5A A;  2WCC 3;  4OKG A;  2X7I A;  2DEJ A;  2JR1 A;  2JYA A;  4R2Q A;  2JPA A;  4OO1 A;  1N34 I;  4ZYH A;  4LU9 A;  4K0K E;  4FW6 A;  1N32 I;  1PJT A;  2LMZ A;  4MLQ A;  4JI0 E;  4FW4 A;  2EOF A;  4IFD B;  4WFT A;  3MHS C;  4M0V A;  2GO4 A;  4LF9 E;  1N0U A;  2B7T A;  3F6H A;  3J81 C;  1RRE A;  4WUB A;  5A6B D;  2PO0 A;  3FIG A;  4B3M I;  1X47 A;  4P7D A;  3BID A;  4JG4 A;  4RHB B;  4FK5 C;  4JI7 I;  4F9A B;  1A1J A;  2HHH E;  4AQY I;  1HNX E;  4I3H A;  2EPC A;  1ZM3 A;  4OX9 E;  4DPX A;  2LE2 A;  2B9D A;  3C6M A;  1EH7 A;  3BBG A;  4Q35 B;  4F54 A;  2CG9 A;  4LFC E;  3L7Z A;  4U3D A;  1Z0B A;  4DUY I;  1IBM I;  4DR6 I;  4JYA I;  2BM1 A;  2LBS B;  1R6L A;  4X65 E;  4R2R A;  5LMN E;  3THO B;  5LMU E;  1UN6 B;  2JT2 A;  2EMG A;  5IV8 B;  3KWR A;  1JK2 A;  3EPH A;  4LF8 E;  2EMH A;  1X6H A;  3BGH A;  1X6E A;  2EE8 A;  1Z5B A;  4HAC A;  4DV5 E;  3M85 G;  4YHH E;  4O24 A;  5AC5 A;  1HK7 A;  2HC5 A;  3QG5 C;  4HTG A;  1Z1B A;  3RMP A;  4B3R E;  3LLH A;  2EMW A;  5GME A;  2DLK A;  4B3S I;  4O4K A;  5DRQ A;  2J7K A;  4ZVI A;  4IZJ D;  1IQS A;  3ADI A;  2CPN A;  5K36 D;  1E3P A;  1XNR I;  1BKN A;  1B62 A;  3MSW A;  3P3G A;  2PO1 B;  3J7A M;  2F4V E;  2YU5 A;  2VF3 A;  2YWQ A;  4X62 E;  1YYW A;  2BA1 G;  4HY1 A;  2EPA A;  4IZK A;  2JP9 A;  2E5L I;  5A6B A;  3EPL A;  4JI2 E;  1ZBQ A;  2YSP A;  2A2D A;  4B3T I;  3C6K A;  2L2N A;  4FWG A;  4IFD D;  2UUB E;  2J7J A;  2JVA A;  1PKP A;  4LF7 E;  2Z5B B;  1G2D C;  4LFB E;  3U1Y A;  2EFG A;  3EPJ A;  3DF6 A;  5CFF E;  2PRT A;  4R2C A;  5KL5 A;  4JI5 E;  5EL9 A;  4N4R B;  1WUU A;  2LCE A;  1X3C A;  3K6Q A;  4KZS A;  1P47 A;  2WP8 A;  5JEA A;  2DIX A;  1QNT A;  3HKM A;  1Y6Z A;  4DU7 A;  4FW3 A;  1HNZ I;  2UUA I;  2NUE A;  4OO1 E;  4BS9 A;  3KZY A;  2G7H A;  2C38 A;  4GKJ I;  1XMO I;  3M99 B;  1PDA A;  1HR0 I;  4BA1 A;  2FTX B;  2LT7 A;  2RPC A;  1N0V C;  3P06 A;  5DNL A;  5DNX A;  2VQF I;  2DGC A;  1B69 A;  1MEY C;  2ADR A;  4X8W A;  4WXC A;  2MC5 A;  3BF2 A;  2L3C A;  3ADL A;  1KVK A;  1NHH A;  1UDO A;  1A6F A;  2V2Q A;  2CZ9 A;  2EPN A;  1YZ9 A;  2ENA A;  1EH8 A;  4DPW A;  2VQE I;  4ZYD A;  4JV5 E;  3OTO I;  1N3G A;  2HJJ A;  4KHP E;  2GO3 A;  4IZJ A;  4GKK E;  4ZYE A;  4MU3 A;  5K36 A;  1YUJ A;  1USV A;  1Z0W A;  2AJ4 A;  3K85 A;  4LCG A;  3CDJ A;  1N36 I;  3PS1 A;  4X66 I;  1EA6 A;  3J7A G;  3B8H A;  4WUC A;  2WW4 A;  2C37 B;  1EKZ A;  2RSI A;  3PS2 A;  2LTS A;  5DNY A;  3ZKD A;  2JOB A;  1IBK E;  1DGC A;  2EOH A;  4YY3 I;  4DV6 E;  4DV7 I;  4NZV A;  4DV4 E;  2NUF A;  3GME A;  5IXM B;  2I13 A;  2K7I A;  2N3G A;  3ZZ0 A;  1TN9 A;  3NZK A;  2EQ0 A;  2B7V A;  5DRR A;  3PYF A;  4DV1 E;  4DR1 I;  4X64 E;  3LPS A;  2ENC A;  1Y4U A;  3IWD A;  2Z5E A;  1PJS A;  2RTX A;  1X5W A;  2C39 B;  1YH8 A;  2RS6 A;  2EOQ A;  2V83 A;  4BCA A;  1N34 E;  1UEK A;  3Q6M A;  3TQM A;  4MQY A;  2L33 A;  2HFS A;  2DSY A;  1MU5 A;  2YPN A;  4P52 A;  3ZKB A;  1Y5Y A;  2RSM A;  3T1H I;  2GS8 A;  5FWK A;  2EMI A;  2JE6 B;  5DRO A;  4L8N A;  3T1Y I;  2EOR A;  3IWC A;  3PYD A;  1IQO A;  1KYQ A;  4Z7Y A;  2EPZ A;  1KJK A;  2V89 A;  2EWL A;  5JEA E;  2EMF A;  1RC7 A;  4JI7 E;  5C0X F;  2LUQ A;  5KL3 A;  2YTF A;  2WBT A;  3AV0 A;  4AQY E;  2BM0 A;  4IFD C;  2DRP A;  2EZ6 A;  2EL6 A;  4DR4 I;  5AE3 A;  4DR6 E;  3GCM A;  4DUY E;  1IBM E;  4JYA E;  1J26 A;  1T4L B;  2JEA B;  2LRS A;  2LVH A;  2PO1 A;  2ZBK B;  2M1S A;  2YTD A;  2YU8 A;  4QNJ A;  3ZM7 A;  5IWA I;  1N33 I;  3B82 A;  3M6A A;  5DRP A;  4NXN I;  2EP3 A;  2EQ3 A;  1QU6 A;  2BA0 D;  4LOM A;  2ENH A;  4R8O A;  4ZYG A;  5C0X C;  2UXD I;  1H7S A;  4JI1 I;  4Z7C A;  2Z5B A;  1WRJ A;  1PJQ A;  2NPF A;  2EPK X;  1ELO A;  2B3T B;  2R76 A;  2HK2 A;  5K36 E;  2BB8 A;  2L2K B;  2EMZ A;  2ZIT A;  2YTJ A;  5A69 A;  5KL7 A;  3UK3 C;  4B3S E;  2HKJ A;  3WU5 A;  4DPT A;  1BBG A;  2V86 A;  2BR2 B;  1RMD A;  5C0X B;  2EM8 A;  1XNR E;  4QNK A;  1PIE A; 
#chains in the Genus database with same CATH homology
 4BMJ A;  4WUD A;  1XNQ I;  2E5L E;  5ADZ A;  4JI3 I;  1Z0G A;  4DV3 I;  1DAR A;  4UTG A;  1H74 A;  1S4E A;  4DV2 I;  1D6T A;  4BBY A;  3P1X A;  1XHK A;  1Z59 A;  2FGG A;  4DR5 I;  3K1J A;  4DV0 I;  1HNZ E;  2UUA E;  4WPY A;  3OML A;  2LTR A;  4GKJ E;  1UHZ A;  2JWO A;  1XMO E;  2HFU A;  1HR0 E;  3LTO A;  1OJ4 A;  1YYO A;  2VQF E;  2V8P A;  2L8T A;  1T4O A;  2PNL A;  4XTJ A;  2FV4 B;  4DR2 I;  3C4B A;  2DEI A;  2O1V A;  1YYK A;  4M2Z A;  2VQE E;  4JI8 I;  1Z0V A;  3J7Y p;  4R1F A;  4M30 A;  1MG7 A;  2IOQ A;  2Z5C A;  1NHI A;  3OTO I;  2YT4 A;  3ADG A;  1N36 E;  4DU8 A;  4X66 E;  3V2U C;  4DR7 I;  1H7U A;  4MYT A;  4YY3 E;  4DV7 E;  4DXL A;  1O0W A;  4P78 A;  5L3J A;  2UXB I;  1J5E I;  1IBL I;  2O1T A;  3QT8 A;  4DR3 I;  1RR9 A;  4LF4 I;  2X36 A;  2M7Q A;  4DR1 E;  1USU A;  3QT6 A;  2MDR A;  4J8Z A;  2R3V A;  2V34 A;  2V2V A;  3DJW A;  5A2Q Q;  2UU9 I;  4JI4 I;  1GQE A;  1I94 I;  2E1R A;  2KOU A;  2OI2 A;  2H36 X;  3T1H E;  2ZM6 I;  3K17 A;  2DMY A;  3PYE A;  2KON A;  4PU9 A;  2V8Q B;  4FWD A;  4DPY A;  1SR9 A;  4WSP A;  3J81 Q;  3T1Y E;  3Q6N A;  1B63 A;  2YZT A;  4HAC B;  4TUI A;  2DB2 A;  3H09 A;  3ADJ A;  1FKA E;  3JTZ A;  4DR4 E;  1EI1 A;  3VK6 A;  1ZBT A;  4L5N C;  5IWA E;  1N33 E;  4FWH A;  4LFA I;  3ZOQ B;  4NXN E;  3HXL A;  4N3O A;  4IZK B;  2UUC I;  2UXD E;  4GEQ B;  3JAM Q;  4ED4 A;  1ZXN A;  4JI1 E;  3PYG A;  5GMD A;  3HPZ A;  2K4V A;  4B3M E;  4P7A A;  3D4J A;  3HUL A;  4PRX A;  2HKE A;  2L3J A;  4DPU A;  3AUZ A;  3WU3 A;  1Z0T A;  5BR8 I;  2KHX A;  3F6G A;  1XNQ E;  4OOG C;  1ZM9 A;  4JI3 E;  3ZZU A;  5AE1 A;  4DV3 E;  5FLX Q;  4DUZ I;  5LL6 R;  1NHJ A;  4DMI A;  5AAS A;  4DV2 E;  4LF5 I;  4NXM I;  4I8O A;  1FWL A;  4DR5 E;  4LF6 I;  4IZJ B;  4DV0 E;  3B78 A;  3GON A;  2RS7 A;  2V2Z A;  3H4L A;  3J80 Q;  1UIL A;  5A2Q C;  2R42 A;  1FJG I;  3V5R A;  2V88 A;  4WYQ B;  1N32 I;  1Z0E A;  3WU6 A;  3IWB A;  4DR2 E;  4B3T E;  2NUG A;  4UT4 A;  2UXC I;  4JI8 E;  4F9C B;  2XEX A;  1XMQ I;  4JI6 I;  3OTO E;  1ZXM A;  4TUG A;  1FNM A;  1HNW I;  2NA2 A;  4DR7 E;  2HK3 A;  3QT7 A;  4FW9 A;  2E1M A;  5IT9 Q;  1K47 A;  2O1W A;  4EMD A;  1H72 C;  2L2M A;  2A2C A;  3PRY A;  4K0K I;  2UXB E;  4JI0 I;  1J5E E;  1IBL E;  4BC9 A;  2LJH A;  2MC6 A;  3HQ1 A;  4DR3 E;  4F9B B;  2ODR C;  4LF9 I;  2M4I A;  3JAM C;  4LF4 E;  1X48 A;  4DKK A;  3LML A;  2HHH I;  1HNX I;  1MX0 A;  2UU9 E;  3VYX A;  4OX9 I;  4JI4 E;  1I94 E;  3QT5 A;  4LFC I;  2V87 A;  4USM A;  1WHN A;  2JOX A;  1GZ6 A;  3JU0 A;  2V85 A;  3CWV A;  4X65 I;  2ZM6 E;  5LMN I;  5LMU I;  1U2R A;  1X49 A;  3ZZT A;  1RQ0 A;  2L6M A;  1H73 A;  4LF8 I;  3F0N A;  4HXZ A;  5FLX C;  4DV5 I;  4YHH I;  4MYU A;  4B3R I;  1QZR A;  2PNM A;  1KIJ A;  3WU4 A;  2JY9 A;  2Q2E B;  3J80 C;  3LNU A;  4LFA E;  2F4V I;  4X62 I;  2N3H A;  2UUC E;  1ZM4 A;  1FI4 A;  4JI2 I;  2UUB I;  2LUP B;  2VE7 C;  1PVG A;  4KQV A;  4BC7 A;  4LF7 I;  4RPF A;  4LFB I;  2BV3 A;  4JI5 I;  5AE2 A;  2WZO A;  1Z0C A;  2VF1 A;  4M1K A;  1KKH A;  5BR8 E;  5IT9 C;  1WHQ A;  2IOP A;  2GQ0 A;  2ODR D;  1NZ0 A;  5T6J A;  2IHR 1;  5F3W A;  4DUZ E;  2F8B A;  1KTV A;  4HYM A;  4USK A;  4LF5 E;  4NXM E;  1Z5C A;  4PRV A;  4JV5 I;  4KHP I;  4LF6 E;  4GKK I;  4URL A;  2Z5C B;  3C4T A;  2CGE A;  1ZM2 A;  3HPS A;  3Q1Q A;  2LJP A;  1DI2 A;  1FJG E;  1FWK A;  1S16 A;  1IBK I;  1DQ3 A;  1N32 E;  4DV6 I;  2O1U A;  4DV4 I;  4Q28 A;  4R03 A;  1T4N A;  2UXC E;  1VIS A;  2L92 A;  3HTX A;  1Y4S A;  1XMQ E;  1WXR A;  4JI6 E;  4DV1 I;  4X64 I;  1HNW E;  1STU A;  3HJC A;  4FN5 A;  4LTY A;  3VYY A;  1Z5A A;  2X7I A;  2DEJ A;  2JR1 A;  1N34 I;  4LU9 A;  4K0K E;  2LMZ A;  4JI0 E;  4WFT A;  4M0V A;  4LF9 E;  1N0U A;  2B7T A;  3F6H A;  3J81 C;  1RRE A;  4WUB A;  3FIG A;  4B3M I;  1X47 A;  4P7D A;  4JG4 A;  4JI7 I;  4F9A B;  2HHH E;  4AQY I;  1HNX E;  4I3H A;  1ZM3 A;  4OX9 E;  4DPX A;  2LE2 A;  2B9D A;  4F54 A;  4DR6 I;  2CG9 A;  4LFC E;  4DUY I;  1IBM I;  1Z0B A;  4JYA I;  2BM1 A;  2LBS B;  4X65 E;  5LMN E;  5LMU E;  3KWR A;  4LF8 E;  4HAC A;  1Z5B A;  4DV5 E;  4YHH E;  1HK7 A;  4B3R E;  3RMP A;  5GME A;  3LLH A;  4B3S I;  2J7K A;  4ZVI A;  4IZJ D;  3ADI A;  2CPN A;  1XNR I;  1BKN A;  1B62 A;  3MSW A;  3J7A M;  2F4V E;  2VF3 A;  4HY1 A;  4X62 E;  1YYW A;  4IZK A;  2E5L I;  4JI2 E;  1ZBQ A;  2A2D A;  4B3T I;  2L2N A;  4FWG A;  2UUB E;  4LF7 E;  2JVA A;  1PKP A;  2Z5B B;  4LFB E;  2EFG A;  3DF6 A;  5CFF E;  4JI5 E;  1WUU A;  3K6Q A;  4KZS A;  2DIX A;  1Y6Z A;  4DU7 A;  1HNZ I;  2UUA I;  2NUE A;  4BS9 A;  2G7H A;  4GKJ I;  1XMO I;  1HR0 I;  2FTX B;  3P06 A;  1N0V C;  2VQF I;  2L3C A;  4X8W A;  2MC5 A;  1KVK A;  2V2Q A;  3ADL A;  1NHH A;  1A6F A;  2CZ9 A;  1YZ9 A;  2VQE I;  4DPW A;  4JV5 E;  4KHP E;  4IZJ A;  4GKK E;  1USV A;  1Z0W A;  2AJ4 A;  3K85 A;  1N36 I;  4X66 I;  1EA6 A;  3J7A G;  3B8H A;  4WUC A;  2WW4 A;  1EKZ A;  2LTS A;  5DNY A;  3ZKD A;  2JOB A;  1IBK E;  4YY3 I;  4DV6 E;  4DV7 I;  4DV4 E;  2NUF A;  3ZZ0 A;  2N3G A;  2B7V A;  3PYF A;  4DV1 E;  4DR1 I;  4X64 E;  3LPS A;  1Y4U A;  3IWD A;  2Z5E A;  2RTX A;  2RS6 A;  2V83 A;  4BCA A;  1N34 E;  1UEK A;  3Q6M A;  2L33 A;  2HFS A;  2DSY A;  1MU5 A;  4P52 A;  3ZKB A;  2RSM A;  3T1H I;  2GS8 A;  5FWK A;  4L8N A;  3T1Y I;  3IWC A;  3PYD A;  4Z7Y A;  2EWL A;  2V89 A;  1RC7 A;  4JI7 E;  2LUQ A;  2BM0 A;  3AV0 A;  4AQY E;  2EZ6 A;  4DR4 I;  5AE3 A;  4DR6 E;  4DUY E;  1IBM E;  4JYA E;  1J26 A;  1T4L B;  2LRS A;  2ZBK B;  2M1S A;  3ZM7 A;  5IWA I;  1N33 I;  3B82 A;  3M6A A;  4NXN I;  1QU6 A;  4R8O A;  2UXD I;  1H7S A;  4JI1 I;  4Z7C A;  2Z5B A;  2NPF A;  1ELO A;  2B3T B;  2HK2 A;  2L2K B;  3WU5 A;  2ZIT A;  4B3S E;  2HKJ A;  4DPT A;  2V86 A;  1XNR E;  1PIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...