4LF6E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf6E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf6E02
1XMQI 4DV5E 5IT9Q 4B3SE 1FJGI 4DPWA 2DMYA 3PYFA 3HULA 1S16A 3VYYA 3J7Yp 4JI4E 4DPYA 3B82A 2LRSA 1DI2A 3QT6A 1EKZA 1Z0CA 5LMUE 4HXZA 4EMDA 1N0UA 2NUGA 1XNQI 4XTJA 2KHXA 4M2ZA 1YYWA 1MX0A 4URLA 3HTXA 2HKJA 3PYEA 5LL6R 2RSMA 3WU6A 4PU9A 2F4VE 4LF4E 1Z0WA 3LTOA 5LMNI 2UXDE 2X36A 5GMDA 4JI1I 1N33E 3J80C 4OX9I 2HHHI 1NHHA 4DUYE 4B3ME 2HFSA 4WUCA 1YZ9A 4DPTA 5IT9C 1Z0GA 1Z5BA 3LLHA 4B3TE 4JI0I 4DV7I 1H7UA 4JI6E 4MYTA 3M6AA 2UUCI 4X62E 4LF7E 1XNRI 4DR4E 1ZM3A 4AQYI 2UUAE 2L33A 4LF5I 3K17A 1MG7A 2CPNA 4YHHI 4LFCE 4P7AA 4YY3I 2RS7A 1ELOA 4JI3I 4K0KI 2DB2A 2UUBE 1N32E 4KHPE 3J7AG 2AJ4A 4DV3I 4USKA 2VQFI 4P52A 2B7TA 3PYGA 1NZ0A 1HR0E 1QU6A 1PKPA 3T1YE 3T1HI 4GKKE 2J7KA 1HNXI 3ADIA 4GKJI 3P1XA 3PYDA 4JI5I 1ZXNA 4JYAE 1HNZI 4LF6I 4JI7I 2ZM6I 4DKKA 2LTRA 1IBLE 3J81C 2IHR1 1N0VC 4B3RE 1KKHA 1STUA 4DV0I 5FLXQ 4DV2I 5IWAE 1UEKA 1Z59A 2WW4A 1XMOI 1J26A 4DV4E 1ZXMA 1MU5A 1Z5AA 4LFBI 2L3JA 1XMQE 2R3VA 1T4LB 1RR9A 4DR6I 1UILA 2EFGA 4DR1I 3JAMC 4PRVA 4JV5I 2X7IA 2HKEA 1PIEA 4JI2I 2UXBI 4NXNI 4WYQB 1XNQE 1X49A 4X65E 1IBMI 4DPUA 4DV1I 3QT8A 2UXCI 4JG4A 1FWKA 1N34I 1N36I 4DR5E 1T4NA 1FNMA 1H74A 2UU9I 4I3HA 4DV5I 1KTVA 4DV6I 4LFAI 4FWGA 3ZZTA 4FWDA 2HHHE 2L3CA 4JI4I 5GMEA 2L2NA 1WHNA 1Z0EA 2NA2A 4JI0E 2NPFA 1S4EA 2OI2A 4JI8I 2UUCE 4DUZE 4KQVA 1XNRE 4AQYE 1H7SA 2HFUA 2LJHA 2BV3A 1YYKA 1ZM9A 1WUUA 3ADGA 1Z0TA 1K47A 1OJ4A 3ZZ0A 4NXME 4OOGC 4PRXA 2HK2A 2F4VI 3ADJA 4JI3E 1H73A 1N33I 1KIJA 2LBSB 2Q2EB 2LTSA 4HY1A 3T1HE 2CZ9A 1RREA 2VQEE 3OTOE 1NHIA 4JI6I 4JI5E 1YYOA 4X62I 4LF7I 4JI7E 4UTGA 4LF9E 1HNWI 3D4JA 4LF8E 4DV0E 3WU5A 5BR8I 4X64E 4FN5A 1J5EI 1FWLA 1N32I 3F0NA 1DARA 3VYXA 4DU7A 4DR7E 2EZ6A 4DR3I 1IBKI 1I94E 4LFBE 4DR2E 4RPFA 4X66I 2R42A 1HR0I 1D6TA 4DR6E 2BM1A 5L3JA 1UHZA 1FKAE 1RQ0A 2VF3A 1FJGE 2BM0A 1T4OA 4DR1E 2N3GA 1FI4A 2XEXA 3CWVA 2DEIA 4NXNE 3QT7A 2L2MA 1KVKA 3V5RA 4DV4I 1XHKA 1N34E 1N36E 4M30A 4ZVIA 3V2UC 2LUPB 1QZRA 4DU8A 2RTXA 2V8PA 3WU4A 2UU9E 5CFFE 2RS6A 4DV6E 2E5LI 4LFAE 3B8HA 1X47A 5FLXC 2DIXA 5LMNE 4B3SI 4JI1E 2A2CA 2L2KB 4OX9E 4X8WA 2V2QA 4JI8E 2YT4A 1EA6A 2ZBKB 2ZITA 4X65I 5LMUI 2B3TB 3ZM7A 4DV7E 3J7AM 4DR5I 3H4LA 5A2QQ 4LF5E 1GQEA 1B63A 4YHHE 3C4TA 3K1JA 1A6FA 4YY3E 3WU3A 3C4BA 1BKNA 4LF4I 4K0KE 2UXDI 1Z0BA 1Z0VA 4WFTA 4DV3E 4Z7CA 2VQFE 4DUYI 4B3MI 2LJPA 2B7VA 3ZKBA 1NHJA 2V2VA 4USMA 3J81Q 4DUZI 4Z7YA 1H72C 1ZM2A 4B3TI 2LUQA 1HNXE 1U2RA 1Z5CA 4GKJE 1HNWE 1HNZE 4LF6E 2GS8A 4M1KA 1PVGA 4DR4I 4NXMI 2ZM6E 2UUAI 2MDRA 5BR8E 1J5EE 3QT5A 2JVAA 4LFCI 4FW9A 4UT4A 2N3HA 4HACB 4DR3E 3B78A 4ED4A 4DV2E 1IBKE 5A2QC 4X66E 1XMOE 2V34A 2UUBI 4KHPI 4MYUA 1WHQA 3ZKDA 2A2DA 1VISA 1ZM4A 3JAMQ 2NUFA 2VQEI 3LNUA 3OTOI 4WUBA 3T1YI 4GKKI 1RC7A 2JY9A 4HACA 4LF9I 4FWHA 4JYAI 1X48A 4WUDA 3LPSA 4LF8I 2V2ZA 4JV5E 3Q1QA 4R1FA 4DPXA 4X64I 1IBLI 4JI2E 2UXBE 4B3RI 4DR7I 1O0WA 1IBME 4HYMA 1I94I 5IWAI 2DEJA 4DXLA 4DR2I 4DV1E 3ADLA 3GONA 1B62A 2UXCE 2E1RA 1ZBTA 2E5LE 3J80Q 3ZZUA 2NUEA 1EI1A 2HK3A
chains in the Genus database with same CATH superfamily
4J3DA 4GEQB 1UN6B 1XMQI 3EPLA 4DV5E 5IT9Q 4B3SE 1FJGI 4DPWA 2DMYA 3PYFA 3C6KA 3HULA 1OYPA 3VYYA 1S16A 2GO4A 2DGCA 4F6MA 2EPCA 3HQ1A 3J7Yp 4JI4E 3P3EA 4DPYA 3B82A 2LRSA 3PS3A 4IFDB 1DI2A 3QT6A 1EKZA 2JP9A 2V89A 1Z0CA 1N3GA 2V8QB 4U3BA 2V86A 2VRDA 5LMUE 4HXZA 2EMKA 4O5GA 5TSEA 4EMDA 1N0UA 2M1SA 5T6JA 2NUGA 1UDQA 5IV8B 1XNQI 5JEAE 4XTJA 5KL7A 4F2JC 4MU3A 2NN6E 2KHXA 4NHRA 3KRNA 4BA2B 4M2ZA 3LMLA 1YYWA 1MX0A 4O4KA 2IOQA 4URLA 4IFDA 2A25A 3HTXA 2HKJA 1MGTA 5LL6R 3PYEA 2RSMA 2PNZB 3WU6A 2ODRD 2EOZA 4PU9A 2YPNA 3VHTB 4LF4E 2EN3A 2F4VE 2O1TA 1Z0WA 3LTOA 3PRYA 3U1KA 5LMNI 2UXDE 2X36A 1EH6A 5GMDA 4JI1I 4AIMA 1N33E 3J80C 4FW3A 4OX9I 4BMJA 2HHHI 1NHHA 2EM8A 4DUYE 4B3ME 2HFSA 2EM4A 2ENCA 1YZ9A 4WUCA 4MLQA 3B4TA 3EQ1A 2DLKA 5IT9C 1Z0GA 4DPTA 1TF6A 3CDIA 1Z5BA 2CTDA 1LLMC 3LLHA 2Z5BB 2C38B 2EMWA 2PNZA 4B3TE 4JI0I 5ADZA 1GZ6A 2Z5CB 4DV7I 4LCGA 4IFDC 2J7JA 4R2PA 1H7UA 4JI6E 2AE8A 1R6MA 4MYTA 3ZOQB 2EPRA 3M6AA 2EMFA 2UUCI 1ZR9A 2CSHA 4X62E 4LF7E 1IQOA 1XNRI 4DR4E 1ZM3A 2FGGA 2UUAE 2J65A 2ADRA 4IS9A 4AQYI 4RH8A 2L33A 4MU0A 4O43A 3K17A 1XXEA 4LF5I 1MG7A 2CPNA 4R2DA 2C39B 4YHHI 2LJUA 2GQ0A 2EMHA 4LFCE 2EPNA 4P7AA 3EPHA 2MC5A 4YY3I 2RS7A 1ELOA 4JI3I 2C38A 3DF6A 1WJPA 4K0KI 2DB2A 2UUBE 1N32E 3J7AG 4KHPE 2EM2A 5K36B 2AJ4A 4DV3I 4M9VC 2RSIA 4USKA 2VQFI 1KYQA 4GQUA 4L5NC 3P06A 4R2SA 4WXCA 2B7TA 1T39A 4M0VA 4P52A 5ELWA 3PYGA 3RMPA 1X6EA 3OMLA 1PJTA 1BBGA 1NZ0A 2FTXB 1HR0E 2C39A 1PJSA 1PKPA 1NCSA 1QU6A 4R8OA 3T1YE 3T1HI 2BB8A 4GKKE 2J7KA 2YRMA 1A1FA 1HNXI 1G2FC 3ADIA 4F6NA 5DRQA 4GKJI 1X3CA 2EE8A 3AUZA 3P1XA 2PNLA 3PYDA 1DGCA 5DNYA 4R2AA 4JYAE 1ZXNA 1HNZI 3KZZA 1TF3A 4FW6A 4JI5I 4LF6I 4IFDD 5K36A 4F9CB 4JI7I 2ZM6I 3L7ZB 4MQYA 1YPNA 4DKKA 5AE1A 2C37A 2LTRA 4BS9A 1WRJA 2MC6A 1IBLE 2ELZA 5AASA 1E3HA 3J81C 2IHR1 1N0VC 4I8OA 2EM0A 4B3RE 1KKHA 2EMIA 1STUA 4DV0I 1GTKA 5FLXQ 2I9IA 4TUGA 4DV2I 1AH5A 5IWAE 1UEKA 1Z59A 2EOIA 2EMXA 1WXRA 1ZU1A 1J26A 2WW4A 1UDSA 1XMOI 2PO1B 1QNTA 4DV4E 3U1YA 2EMLA 2D9HA 4LTYA 4AM3A 2RQLA 2HJJA 1ZXMA 1MU5A 4U3DA 1Z5AA 4LFBI 4IFDF 1Y4UA 3L7ZA 2L3JA 1XMQE 3KWRA 2R3VA 2B9DA 1T4LB 2EOJA 1RR9A 4DR6I 2LE2A 4ZYEA 1UILA 5K36C 2EOOA 4J8ZA 2LCEA 2MKDA 3HKMA 2EFGA 4NBQA 2EOSA 2BR2B 4QNJA 3H09A 2PO1A 4GZNC 4DR1I 3JAMC 1E3PA 1X5WA 4BC7A 2EMGA 4PRVA 3UK3C 4JV5I 2X7IA 3THNA 2H36X 5AE2A 2EPXA 2F8BA 5KL5A 2HKEA 2K4VA 2BA1G 2M9AA 1PIEA 5C0XB 3PS2A 4JI2I 4IZJB 2UXBI 4MLVA 4NXNI 4WYQB 2V87A 1XNQE 1X49A 4X65E 1IBMI 2JOBA 4DPUA 4DV1I 3QT8A 5DNLA 5DROA 4JG4A 2UXCI 1FWKA 2HK3A 2GLIA 2EOQA 1N34I 1N36I 5DRPA 4DR5E 1T4NA 3QG5C 4HTGA 4L8NA 1FNMA 2IESA 2YTJA 1H74A 3NZKA 1YUIA 2UU9I 4I3HA 2EQ0A 3M7NG 4DV5I 1KTVA 4DV6I 1YSAC 2BBGA 4FWGA 5C0XA 3L00A 4LFAI 4FW4A 3ZZTA 4FWDA 2HHHE 5K36D 2L3CA 5IXMB 2EOFA 4KZSA 4JI4I 2YSOA 4HEIA 4FK5C 5GMEA 2L2NA 4DMIA 2EPZA 2JYAA 2EPLX 1WHNA 3DJWA 2PO0B 2WBUA 4F9AB 4OZEA 2EMAA 1Z0EA 2NA2A 4BA2A 5KL2A 2E1MA 4JI0E 4R2QA 4AIDA 2YTNA 2NPFA 4LU9A 1S4EA 2OI2A 4JI8I 3C6MA 2O1VA 2UUCE 4DUZE 1Z1BA 4KQVA 4Q35B 1XNRE 4AQYE 1H7SA 2HFUA 5DRRA 4OO1B 4LCFA 2LJHA 2BV3A 1YYKA 1ZM9A 5K36F 5C0XC 2EMCA 1WUUA 3ADGA 1Z0TA 1K47A 1OJ4A 2HGHA 3GLLA 3ZZ0A 4NXME 2E72A 4OOGC 2HK2A 4PRXA 2PO0A 1SFEA 2F4VI 2EL6A 1TN9A 3ADJA 2EWLA 4WPYA 5AE3A 4JI3E 1H73A 2EOEA 2EOYA 4IZKB 2L8TA 1IMUA 2DLQA 4KWYA 1KIJA 2F1DA 1N33I 2EOHA 3HPSA 3MHSC 4Q28A 2Z5BA 1UDOA 4OO1A 1USVA 2DSYA 2ENAA 2Z5CA 2LBSB 1A1LA 1P42A 2JR1A 2Q2EB 4ISAA 2LTSA 2IERA 3T1HE 4F54A 1ZAAC 2CZ9A 4HY1A 4LOMA 1IQSA 4QNKA 2EPUA 1DQ3A 1RREA 2VQEE 3K85A 3Q6NA 3OTOE 1NHIA 2YWQA 2V88A 4JI6I 2O3ZA 3P3GA 4JI5E 4IFDE 2EM6A 4IZKA 2EN4A 2RPCA 1YYOA 1OYRA 4X62I 4LF7I 2PO2B 4JI7E 4N4RB 3KZYA 4UTGA 4LF9E 4BBYA 3BGHA 2JE6B 2YZTA 1HNWI 1L4SA 5JEAB 4MDTA 2EL5A 3THOB 3D4JA 1PJQA 2WNRB 1B69A 4LF8E 4MU1A 2JXPA 3FIGA 4WX9A 2NN6B 5C0XD 1X6FA 4DV0E 3WU5A 4OO1C 2EORA 5BR8I 4X64E 2JPAA 4FN5A 1J5EI 1A1JA 2GPIA 2JOXA 2NABA 2V85A 1FWLA 2BA1D 1N32I 3F0NA 1DARA 1RHYA 3GCMA 3VYXA 1UBDC 4DU7A 4DR7E 2EZ6A 2EN2A 1NEIA 2EPAA 3H1CA 4DR3I 1IBKI 1I94E 2JEAB 2O1UA 4LFBE 4DR2E 2PO2A 4RPFA 4ED4A 3UHMA 4X66I 2R42A 3MHHC 3GMEA 1HR0I 1D6TA 4DR6E 1Y5YA 5JEAA 3M99B 1JK1A 2BM1A 2CGEA 2EOMA 2NN6A 5EL9A 5L3JA 2YTGA 1UHZA 1FKAE 5C0XF 1RQ0A 2VF3A 3M85G 3AV0A 3M7ND 2JEBB 1FJGE 2BM0A 3BBGA 2GO3A 1T4OA 4DR1E 2EPMX 2N3GA 1FI4A 2XEXA 2JEAA 3CWVA 3P3CA 2DRPA 2HC5A 3IWDA 2DEIA 2LMZA 3Q6MA 2EMZA 4BHBA 4NXNE 3DD6A 3QT7A 4F9BB 4RHBB 2K7IA 2EM3A 4P78A 4FW5A 2YU8A 2L2MA 4BCAA 1KVKA 1ZBQA 2DMIA 2EL4A 5JEAC 4OO1D 3V5RA 4DV4I 1JK2A 2JEBA 1XHKA 1N34E 1N36E 2NN6C 4M30A 2EN8A 4ZVIA 3V2UC 2LUPB 1QZRA 4DU8A 2EJ4A 2RTXA 2V8PA 3WU4A 4BHCA 2UU9E 3IWCA 2BR2A 2EPKX 5CFFE 4ZYHA 2RS6A 4DV6E 2I13A 4LFAE 3B8HA 1X47A 5FLXC 4WSPA 2O1WA 2E5LI 2BA0G 5K36E 2EOXA 4R2EA 2LVHA 2KONA 2DIXA 1BBOA 3TQMA 5A6BD 3EPKA 5LMNE 2EPPA 2CT1A 2LO3A 4B3SI 4X9JA 4JI1E 2A2CA 2EN1A 2L2KB 4WSGA 4IZJA 4OO1F 4OX9E 4X8WA 2YTQA 3P76A 2V2QA 2EN7A 4BA1B 1UDNA 4OKGA 2ENHA 2WBSA 2PRTA 1A1HA 4JI8E 2YT4A 1MEYC 1EA6A 2ZBKB 4ZYDA 2ZITA 2MDGA 4X65I 2PNMA 1RMDA 5LMUI 2B3TB 3ZM7A 5KL4A 4DV7E 3J7AM 2VE7C 5F3WA 5A6AA 1R6LA 5JEAD 1Y6ZA 4LCHA 4DR5I 2EM7A 2L6MA 2EN6A 3ECRA 3H4LA 2NN6D 4LF5E 5A2QQ 3F6HA 4IJDA 1GQEA 1Y4SA 1B63A 5FWKA 4YHHE 2G7HA 2MKNA 3C4TA 3VK6A 4BA1A 3K1JA 2L92A 3HXLA 5AC4A 1KJKA 4YY3E 1A6FA 3WU3A 3C4BA 1BKNA 4LF4I 1HK7A 4K0KE 2YTFA 2JT2A 2UXDI 2CVEA 1Z0BA 1Y60A 1Z0VA 4WFTA 2EP3A 2YTDA 2YTEA 4DV3E 4Z7CA 1AAYA 2VQFE 2R1FA 4DUYI 5KL6A 4B3MI 4FW7A 2LJPA 1X6HA 2KOUA 2B7VA 5JEAF 3ZKBA 4ZYGA 1NHJA 2VF1A 4R2CA 2V2VA 3JU0A 5DNXA 2NN6F 1USUA 2YTPA 4USMA 3CDJA 4R03A 3J81Q 4Z7YA 4DUZI 2WBTA 1H72C 1P47A 1ZM2A 2JWOA 1PDAA 4B3TI 2LUQA 3F6GA 2LV2A 1HNXE 1U2RA 1Z5CA 3M85D 4GKJE 3K6QA 2YRKA 2GHFA 1HNWE 1HNZE 4LF6E 4P7DA 2GS8A 5C0XE 4M1KA 1PVGA 5KL3A 2M4IA 4BC9A 4NXMI 4O24A 5A6BA 2ZM6E 1YH8A 2MDRA 2UUAI 4DR4I 5BR8E 1J5EE 2YSPA 3QT5A 2EM5A 2JVAA 1A1IA 4NZVA 1BB8A 5EKWA 5AC5A 2YRHA 4LFCI 4FW9A 4UT4A 2EMYA 4IZJD 2N3HA 4HACB 4DR3E 1A1GA 3B78A 4MU4A 4DV2E 2YU5A 1F2IG 5A6JA 1IBKE 5A2QC 3MSWA 2C37B 2Z5EA 2YTOA 4X66E 1XMOE 2V34A 2UUBI 4KHPI 4MYUA 2FV4B 5A69A 1WHQA 2WP8B 2R76A 1VI7A 2EMBA 3ZKDA 2ELYA 2Q8UA 2A2DA 1VISA 1ZM4A 3HJCA 4R2RA 3JAMQ 2LT7A 2WZOA 2NUFA 2WCC3 2VQEI 2JE6A 3LNUA 2N8XA 1EH7A 4WXDA 3OTOI 4WUBA 3T1YI 1EH8A 2EM9A 2WNRA 2BA0D 3HPZA 3EPJA 3JTZA 4GKKI 1RC7A 2JY9A 4HACA 2YTIA 4LF9I 4IS1C 5A6KA 4FWHA 1SR9A 1YFHA 4JYAI 1X48A 1A1KA 2WP8A 4WUDA 3LPSA 4LF8I 2V2ZA 1YUJA 4JV5E 3Q1QA 4R1FA 4LPFA 4DPXA 4X64I 2M7QA 1IBLI 2EQ1A 4OO1E 1G2DC 3IWBA 4JI2E 2UXBE 4B3RI 4DR7I 2EPOA 1O0WA 1IBME 2EQ3A 4HYMA 3BIDA 1I94I 1T38A 5IWAI 2CG9A 2DEJA 4DXLA 4DR2I 4DV1E 3ADLA 3GONA 5LLQA 2VESA 1B62A 3BF2A 2UXCE 2E1RA 3PS1A 2ODRC 2V83A 1ZBTA 1YHCA 2E5LE 3J80Q 2IOPA 4N3OA 1OYSA 3ZZUA 2NUEA 1EI1A 4TUIA
chains in the Genus database with same CATH topology
4GEQB 1XMQI 4DV5E 5IT9Q 4B3SE 1FJGI 4DPWA 2DMYA 3PYFA 3HULA 1S16A 3VYYA 3HQ1A 3J7Yp 4JI4E 4DPYA 3B82A 2LRSA 1DI2A 3QT6A 1EKZA 2V89A 1Z0CA 2V8QB 2V86A 5LMUE 4HXZA 4EMDA 1N0UA 2M1SA 5T6JA 2NUGA 1XNQI 4XTJA 2KHXA 4M2ZA 3LMLA 1YYWA 1MX0A 2IOQA 4URLA 3HTXA 2HKJA 5LL6R 3PYEA 2RSMA 3WU6A 2ODRD 4PU9A 2F4VE 4LF4E 2O1TA 3PRYA 1Z0WA 3LTOA 5LMNI 2UXDE 2X36A 5GMDA 4JI1I 1N33E 3J80C 4OX9I 4BMJA 2HHHI 1NHHA 4DUYE 4B3ME 2HFSA 4WUCA 1YZ9A 5IT9C 4DPTA 1Z0GA 1Z5BA 3LLHA 2Z5BB 4B3TE 4JI0I 5ADZA 1GZ6A 2Z5CB 4DV7I 1H7UA 4JI6E 4MYTA 3ZOQB 3M6AA 2UUCI 4X62E 4LF7E 1XNRI 4DR4E 1ZM3A 2FGGA 2UUAE 4AQYI 2L33A 4LF5I 3K17A 1MG7A 2CPNA 4YHHI 2GQ0A 4LFCE 4P7AA 4YY3I 2MC5A 2RS7A 1ELOA 4JI3I 3DF6A 4K0KI 2DB2A 2UUBE 1N32E 3J7AG 4KHPE 2AJ4A 4DV3I 4USKA 2VQFI 4L5NC 3P06A 4P52A 2B7TA 4M0VA 3PYGA 3RMPA 3OMLA 1NZ0A 2FTXB 1HR0E 1PKPA 1QU6A 4R8OA 3T1YE 3T1HI 4GKKE 2J7KA 1HNXI 3ADIA 4GKJI 3AUZA 3P1XA 2PNLA 3PYDA 4JI5I 5DNYA 4JYAE 1ZXNA 1HNZI 4LF6I 4F9CB 4JI7I 2ZM6I 5AE1A 4DKKA 2LTRA 4BS9A 2MC6A 1IBLE 5AASA 3J81C 2IHR1 1N0VC 4I8OA 4B3RE 1KKHA 1STUA 4DV0I 5FLXQ 4TUGA 4DV2I 5IWAE 1UEKA 1Z59A 2WW4A 1WXRA 1J26A 1XMOI 4DV4E 4LTYA 1ZXMA 1MU5A 1Z5AA 4LFBI 1Y4UA 2L3JA 1XMQE 3KWRA 2R3VA 2B9DA 1T4LB 1RR9A 4DR6I 2LE2A 1UILA 4J8ZA 2EFGA 3H09A 4DR1I 3JAMC 4BC7A 4PRVA 4JV5I 2X7IA 2H36X 5AE2A 2F8BA 2HKEA 2K4VA 1PIEA 4JI2I 4IZJB 2UXBI 4NXNI 4WYQB 2V87A 1XNQE 1X49A 4X65E 1IBMI 2JOBA 4DPUA 4DV1I 3QT8A 2UXCI 4JG4A 1FWKA 2HK3A 1N34I 1N36I 4DR5E 1T4NA 4L8NA 1FNMA 1H74A 2UU9I 4I3HA 4DV5I 1KTVA 4DV6I 4LFAI 4FWGA 3ZZTA 4FWDA 2HHHE 2L3CA 4KZSA 4JI4I 5GMEA 2L2NA 4DMIA 1WHNA 3DJWA 4F9AB 1Z0EA 2NA2A 2E1MA 4JI0E 2NPFA 4LU9A 1S4EA 2OI2A 4JI8I 2O1VA 2UUCE 4DUZE 4KQVA 1XNRE 4AQYE 1H7SA 2HFUA 2LJHA 2BV3A 1YYKA 1ZM9A 1WUUA 3ADGA 1Z0TA 1K47A 1OJ4A 3ZZ0A 4NXME 4OOGC 4PRXA 2HK2A 2F4VI 3ADJA 2EWLA 4WPYA 5AE3A 4JI3E 1H73A 4IZKB 2L8TA 1N33I 1KIJA 3HPSA 4Q28A 2Z5BA 1USVA 2DSYA 2Z5CA 2LBSB 2JR1A 2Q2EB 2LTSA 4HY1A 3T1HE 4F54A 2CZ9A 1DQ3A 1RREA 2VQEE 3K85A 3Q6NA 3OTOE 1NHIA 2V88A 4JI6I 4JI5E 4IZKA 1YYOA 4X62I 4LF7I 4JI7E 4UTGA 4LF9E 4BBYA 2YZTA 1HNWI 3D4JA 4LF8E 3FIGA 4DV0E 3WU5A 5BR8I 4X64E 4FN5A 1J5EI 1FWLA 2JOXA 2V85A 1N32I 3F0NA 1DARA 3VYXA 4DU7A 4DR7E 2EZ6A 4DR3I 1IBKI 1I94E 2O1UA 4LFBE 4DR2E 4RPFA 4X66I 2R42A 1HR0I 1D6TA 4DR6E 2CGEA 2BM1A 5L3JA 1UHZA 1FKAE 1RQ0A 2VF3A 3AV0A 1FJGE 2BM0A 1T4OA 4DR1E 2N3GA 1FI4A 2XEXA 3CWVA 3IWDA 2DEIA 2LMZA 3Q6MA 4NXNE 3QT7A 4F9BB 4P78A 2L2MA 4BCAA 1KVKA 1ZBQA 3V5RA 4DV4I 1XHKA 1N34E 1N36E 4M30A 4ZVIA 3V2UC 2LUPB 1QZRA 4DU8A 2RTXA 2V8PA 3WU4A 2UU9E 3IWCA 5CFFE 2RS6A 4DV6E 2E5LI 4LFAE 3B8HA 1X47A 5FLXC 4WSPA 2O1WA 2KONA 2DIXA 5LMNE 4B3SI 4JI1E 2A2CA 2L2KB 4IZJA 4OX9E 4X8WA 2V2QA 4JI8E 2YT4A 1EA6A 2ZBKB 2ZITA 4X65I 2PNMA 5LMUI 2B3TB 3ZM7A 4DV7E 3J7AM 2VE7C 5F3WA 1Y6ZA 4DR5I 2L6MA 3H4LA 5A2QQ 4LF5E 3F6HA 1Y4SA 1GQEA 1B63A 5FWKA 4YHHE 2G7HA 3C4TA 3VK6A 3K1JA 2L92A 3HXLA 1A6FA 4YY3E 3WU3A 3C4BA 1BKNA 4LF4I 1HK7A 4K0KE 2UXDI 1Z0BA 1Z0VA 4WFTA 4DV3E 4Z7CA 2VQFE 4DUYI 4B3MI 2LJPA 2KOUA 2B7VA 3ZKBA 1NHJA 2VF1A 2V2VA 3JU0A 1USUA 4USMA 3J81Q 4R03A 4DUZI 4Z7YA 1H72C 1ZM2A 2JWOA 4B3TI 2LUQA 3F6GA 1HNXE 1U2RA 1Z5CA 4GKJE 3K6QA 1HNWE 1HNZE 4LF6E 4P7DA 2GS8A 4M1KA 1PVGA 2M4IA 4BC9A 4NXMI 2ZM6E 2UUAI 4DR4I 2MDRA 5BR8E 1J5EE 3QT5A 2JVAA 4LFCI 4FW9A 4UT4A 4IZJD 2N3HA 4HACB 4DR3E 3B78A 4ED4A 4DV2E 1IBKE 2Z5EA 5A2QC 3MSWA 4X66E 1XMOE 2V34A 2UUBI 4KHPI 4MYUA 2FV4B 1WHQA 3ZKDA 2A2DA 3HJCA 1VISA 1ZM4A 3JAMQ 2WZOA 2NUFA 2VQEI 3LNUA 3OTOI 4WUBA 3T1YI 3HPZA 3JTZA 4GKKI 1RC7A 2JY9A 4HACA 4LF9I 4FWHA 1SR9A 4JYAI 1X48A 4WUDA 3LPSA 4LF8I 2V2ZA 4JV5E 3Q1QA 4R1FA 4DPXA 4X64I 2M7QA 1IBLI 4JI2E 3IWBA 2UXBE 4B3RI 4DR7I 1O0WA 1IBME 4HYMA 1I94I 5IWAI 2CG9A 2DEJA 4DXLA 4DR2I 4DV1E 3ADLA 3GONA 1B62A 2UXCE 2E1RA 2ODRC 2V83A 1ZBTA 2E5LE 3J80Q 2IOPA 4N3OA 3ZZUA 2NUEA 1EI1A 4TUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ I;  4DV5 E;  5IT9 Q;  4B3S E;  1FJG I;  4DPW A;  2DMY A;  3PYF A;  3HUL A;  1S16 A;  3VYY A;  3J7Y p;  4JI4 E;  4DPY A;  3B82 A;  2LRS A;  1DI2 A;  3QT6 A;  1EKZ A;  1Z0C A;  5LMU E;  4HXZ A;  4EMD A;  1N0U A;  2NUG A;  1XNQ I;  4XTJ A;  2KHX A;  4M2Z A;  1YYW A;  1MX0 A;  4URL A;  3HTX A;  2HKJ A;  3PYE A;  5LL6 R;  2RSM A;  3WU6 A;  4PU9 A;  2F4V E;  4LF4 E;  1Z0W A;  3LTO A;  5LMN I;  2UXD E;  2X36 A;  5GMD A;  4JI1 I;  1N33 E;  3J80 C;  4OX9 I;  2HHH I;  1NHH A;  4DUY E;  4B3M E;  2HFS A;  4WUC A;  1YZ9 A;  4DPT A;  5IT9 C;  1Z0G A;  1Z5B A;  3LLH A;  4B3T E;  4JI0 I;  4DV7 I;  1H7U A;  4JI6 E;  4MYT A;  3M6A A;  2UUC I;  4X62 E;  4LF7 E;  1XNR I;  4DR4 E;  1ZM3 A;  4AQY I;  2UUA E;  2L33 A;  4LF5 I;  3K17 A;  1MG7 A;  2CPN A;  4YHH I;  4LFC E;  4P7A A;  4YY3 I;  2RS7 A;  1ELO A;  4JI3 I;  4K0K I;  2DB2 A;  2UUB E;  1N32 E;  4KHP E;  3J7A G;  2AJ4 A;  4DV3 I;  4USK A;  2VQF I;  4P52 A;  2B7T A;  3PYG A;  1NZ0 A;  1HR0 E;  1QU6 A;  1PKP A;  3T1Y E;  3T1H I;  4GKK E;  2J7K A;  1HNX I;  3ADI A;  4GKJ I;  3P1X A;  3PYD A;  4JI5 I;  1ZXN A;  4JYA E;  1HNZ I;  4LF6 I;  4JI7 I;  2ZM6 I;  4DKK A;  2LTR A;  1IBL E;  3J81 C;  2IHR 1;  1N0V C;  4B3R E;  1KKH A;  1STU A;  4DV0 I;  5FLX Q;  4DV2 I;  5IWA E;  1UEK A;  1Z59 A;  2WW4 A;  1XMO I;  1J26 A;  4DV4 E;  1ZXM A;  1MU5 A;  1Z5A A;  4LFB I;  2L3J A;  1XMQ E;  2R3V A;  1T4L B;  1RR9 A;  4DR6 I;  1UIL A;  2EFG A;  4DR1 I;  3JAM C;  4PRV A;  4JV5 I;  2X7I A;  2HKE A;  1PIE A;  4JI2 I;  2UXB I;  4NXN I;  4WYQ B;  1XNQ E;  1X49 A;  4X65 E;  1IBM I;  4DPU A;  4DV1 I;  3QT8 A;  2UXC I;  4JG4 A;  1FWK A;  1N34 I;  1N36 I;  4DR5 E;  1T4N A;  1FNM A;  1H74 A;  2UU9 I;  4I3H A;  4DV5 I;  1KTV A;  4DV6 I;  4LFA I;  4FWG A;  3ZZT A;  4FWD A;  2HHH E;  2L3C A;  4JI4 I;  5GME A;  2L2N A;  1WHN A;  1Z0E A;  2NA2 A;  4JI0 E;  2NPF A;  1S4E A;  2OI2 A;  4JI8 I;  2UUC E;  4DUZ E;  4KQV A;  1XNR E;  4AQY E;  1H7S A;  2HFU A;  2LJH A;  2BV3 A;  1YYK A;  1ZM9 A;  1WUU A;  3ADG A;  1Z0T A;  1K47 A;  1OJ4 A;  3ZZ0 A;  4NXM E;  4OOG C;  4PRX A;  2HK2 A;  2F4V I;  3ADJ A;  4JI3 E;  1H73 A;  1N33 I;  1KIJ A;  2LBS B;  2Q2E B;  2LTS A;  4HY1 A;  3T1H E;  2CZ9 A;  1RRE A;  2VQE E;  3OTO E;  1NHI A;  4JI6 I;  4JI5 E;  1YYO A;  4X62 I;  4LF7 I;  4JI7 E;  4UTG A;  4LF9 E;  1HNW I;  3D4J A;  4LF8 E;  4DV0 E;  3WU5 A;  5BR8 I;  4X64 E;  4FN5 A;  1J5E I;  1FWL A;  1N32 I;  3F0N A;  1DAR A;  3VYX A;  4DU7 A;  4DR7 E;  2EZ6 A;  4DR3 I;  1IBK I;  1I94 E;  4LFB E;  4DR2 E;  4RPF A;  4X66 I;  2R42 A;  1HR0 I;  1D6T A;  4DR6 E;  2BM1 A;  5L3J A;  1UHZ A;  1FKA E;  1RQ0 A;  2VF3 A;  1FJG E;  2BM0 A;  1T4O A;  4DR1 E;  2N3G A;  1FI4 A;  2XEX A;  3CWV A;  2DEI A;  4NXN E;  3QT7 A;  2L2M A;  1KVK A;  3V5R A;  4DV4 I;  1XHK A;  1N34 E;  1N36 E;  4M30 A;  4ZVI A;  3V2U C;  2LUP B;  1QZR A;  4DU8 A;  2RTX A;  2V8P A;  3WU4 A;  2UU9 E;  5CFF E;  2RS6 A;  4DV6 E;  2E5L I;  4LFA E;  3B8H A;  1X47 A;  5FLX C;  2DIX A;  5LMN E;  4B3S I;  4JI1 E;  2A2C A;  2L2K B;  4OX9 E;  4X8W A;  2V2Q A;  4JI8 E;  2YT4 A;  1EA6 A;  2ZBK B;  2ZIT A;  4X65 I;  5LMU I;  2B3T B;  3ZM7 A;  4DV7 E;  3J7A M;  4DR5 I;  3H4L A;  5A2Q Q;  4LF5 E;  1GQE A;  1B63 A;  4YHH E;  3C4T A;  3K1J A;  1A6F A;  4YY3 E;  3WU3 A;  3C4B A;  1BKN A;  4LF4 I;  4K0K E;  2UXD I;  1Z0B A;  1Z0V A;  4WFT A;  4DV3 E;  4Z7C A;  2VQF E;  4DUY I;  4B3M I;  2LJP A;  2B7V A;  3ZKB A;  1NHJ A;  2V2V A;  4USM A;  3J81 Q;  4DUZ I;  4Z7Y A;  1H72 C;  1ZM2 A;  4B3T I;  2LUQ A;  1HNX E;  1U2R A;  1Z5C A;  4GKJ E;  1HNW E;  1HNZ E;  4LF6 E;  2GS8 A;  4M1K A;  1PVG A;  4DR4 I;  4NXM I;  2ZM6 E;  2UUA I;  2MDR A;  5BR8 E;  1J5E E;  3QT5 A;  2JVA A;  4LFC I;  4FW9 A;  4UT4 A;  2N3H A;  4HAC B;  4DR3 E;  3B78 A;  4ED4 A;  4DV2 E;  1IBK E;  5A2Q C;  4X66 E;  1XMO E;  2V34 A;  2UUB I;  4KHP I;  4MYU A;  1WHQ A;  3ZKD A;  2A2D A;  1VIS A;  1ZM4 A;  3JAM Q;  2NUF A;  2VQE I;  3LNU A;  3OTO I;  4WUB A;  3T1Y I;  4GKK I;  1RC7 A;  2JY9 A;  4HAC A;  4LF9 I;  4FWH A;  4JYA I;  1X48 A;  4WUD A;  3LPS A;  4LF8 I;  2V2Z A;  4JV5 E;  3Q1Q A;  4R1F A;  4DPX A;  4X64 I;  1IBL I;  4JI2 E;  2UXB E;  4B3R I;  4DR7 I;  1O0W A;  1IBM E;  4HYM A;  1I94 I;  5IWA I;  2DEJ A;  4DXL A;  4DR2 I;  4DV1 E;  3ADL A;  3GON A;  1B62 A;  2UXC E;  2E1R A;  1ZBT A;  2E5L E;  3J80 Q;  3ZZU A;  2NUE A;  1EI1 A;  2HK3 A; 
#chains in the Genus database with same CATH topology
 4J3D A;  4GEQ B;  1UN6 B;  1XMQ I;  3EPL A;  4DV5 E;  5IT9 Q;  4B3S E;  1FJG I;  4DPW A;  2DMY A;  3PYF A;  3C6K A;  3HUL A;  1OYP A;  3VYY A;  1S16 A;  2GO4 A;  2DGC A;  4F6M A;  2EPC A;  3HQ1 A;  3J7Y p;  4JI4 E;  3P3E A;  4DPY A;  3B82 A;  2LRS A;  3PS3 A;  4IFD B;  1DI2 A;  3QT6 A;  1EKZ A;  2JP9 A;  2V89 A;  1Z0C A;  1N3G A;  2V8Q B;  4U3B A;  2V86 A;  2VRD A;  5LMU E;  4HXZ A;  2EMK A;  4O5G A;  5TSE A;  4EMD A;  1N0U A;  2M1S A;  5T6J A;  2NUG A;  1UDQ A;  5IV8 B;  1XNQ I;  5JEA E;  4XTJ A;  5KL7 A;  4F2J C;  4MU3 A;  2NN6 E;  2KHX A;  4NHR A;  3KRN A;  4BA2 B;  4M2Z A;  3LML A;  1YYW A;  1MX0 A;  4O4K A;  2IOQ A;  4URL A;  4IFD A;  2A25 A;  3HTX A;  2HKJ A;  1MGT A;  5LL6 R;  3PYE A;  2RSM A;  2PNZ B;  3WU6 A;  2ODR D;  2EOZ A;  4PU9 A;  2YPN A;  3VHT B;  4LF4 E;  2EN3 A;  2F4V E;  2O1T A;  1Z0W A;  3LTO A;  3PRY A;  3U1K A;  5LMN I;  2UXD E;  2X36 A;  1EH6 A;  5GMD A;  4JI1 I;  4AIM A;  1N33 E;  3J80 C;  4FW3 A;  4OX9 I;  4BMJ A;  2HHH I;  1NHH A;  2EM8 A;  4DUY E;  4B3M E;  2HFS A;  2EM4 A;  2ENC A;  1YZ9 A;  4WUC A;  4MLQ A;  3B4T A;  3EQ1 A;  2DLK A;  5IT9 C;  1Z0G A;  4DPT A;  1TF6 A;  3CDI A;  1Z5B A;  2CTD A;  1LLM C;  3LLH A;  2Z5B B;  2C38 B;  2EMW A;  2PNZ A;  4B3T E;  4JI0 I;  5ADZ A;  1GZ6 A;  2Z5C B;  4DV7 I;  4LCG A;  4IFD C;  2J7J A;  4R2P A;  1H7U A;  4JI6 E;  2AE8 A;  1R6M A;  4MYT A;  3ZOQ B;  2EPR A;  3M6A A;  2EMF A;  2UUC I;  1ZR9 A;  2CSH A;  4X62 E;  4LF7 E;  1IQO A;  1XNR I;  4DR4 E;  1ZM3 A;  2FGG A;  2UUA E;  2J65 A;  2ADR A;  4IS9 A;  4AQY I;  4RH8 A;  2L33 A;  4MU0 A;  4O43 A;  3K17 A;  1XXE A;  4LF5 I;  1MG7 A;  2CPN A;  4R2D A;  2C39 B;  4YHH I;  2LJU A;  2GQ0 A;  2EMH A;  4LFC E;  2EPN A;  4P7A A;  3EPH A;  2MC5 A;  4YY3 I;  2RS7 A;  1ELO A;  4JI3 I;  2C38 A;  3DF6 A;  1WJP A;  4K0K I;  2DB2 A;  2UUB E;  1N32 E;  3J7A G;  4KHP E;  2EM2 A;  5K36 B;  2AJ4 A;  4DV3 I;  4M9V C;  2RSI A;  4USK A;  2VQF I;  1KYQ A;  4GQU A;  4L5N C;  3P06 A;  4R2S A;  4WXC A;  2B7T A;  1T39 A;  4M0V A;  4P52 A;  5ELW A;  3PYG A;  3RMP A;  1X6E A;  3OML A;  1PJT A;  1BBG A;  1NZ0 A;  2FTX B;  1HR0 E;  2C39 A;  1PJS A;  1PKP A;  1NCS A;  1QU6 A;  4R8O A;  3T1Y E;  3T1H I;  2BB8 A;  4GKK E;  2J7K A;  2YRM A;  1A1F A;  1HNX I;  1G2F C;  3ADI A;  4F6N A;  5DRQ A;  4GKJ I;  1X3C A;  2EE8 A;  3AUZ A;  3P1X A;  2PNL A;  3PYD A;  1DGC A;  5DNY A;  4R2A A;  4JYA E;  1ZXN A;  1HNZ I;  3KZZ A;  1TF3 A;  4FW6 A;  4JI5 I;  4LF6 I;  4IFD D;  5K36 A;  4F9C B;  4JI7 I;  2ZM6 I;  3L7Z B;  4MQY A;  1YPN A;  4DKK A;  5AE1 A;  2C37 A;  2LTR A;  4BS9 A;  1WRJ A;  2MC6 A;  1IBL E;  2ELZ A;  5AAS A;  1E3H A;  3J81 C;  2IHR 1;  1N0V C;  4I8O A;  2EM0 A;  4B3R E;  1KKH A;  2EMI A;  1STU A;  4DV0 I;  1GTK A;  5FLX Q;  2I9I A;  4TUG A;  4DV2 I;  1AH5 A;  5IWA E;  1UEK A;  1Z59 A;  2EOI A;  2EMX A;  1WXR A;  1ZU1 A;  1J26 A;  2WW4 A;  1UDS A;  1XMO I;  2PO1 B;  1QNT A;  4DV4 E;  3U1Y A;  2EML A;  2D9H A;  4LTY A;  4AM3 A;  2RQL A;  2HJJ A;  1ZXM A;  1MU5 A;  4U3D A;  1Z5A A;  4LFB I;  4IFD F;  1Y4U A;  3L7Z A;  2L3J A;  1XMQ E;  3KWR A;  2R3V A;  2B9D A;  1T4L B;  2EOJ A;  1RR9 A;  4DR6 I;  2LE2 A;  4ZYE A;  1UIL A;  5K36 C;  2EOO A;  4J8Z A;  2LCE A;  2MKD A;  3HKM A;  2EFG A;  4NBQ A;  2EOS A;  2BR2 B;  4QNJ A;  3H09 A;  2PO1 A;  4GZN C;  4DR1 I;  3JAM C;  1E3P A;  1X5W A;  4BC7 A;  2EMG A;  4PRV A;  3UK3 C;  4JV5 I;  2X7I A;  3THN A;  2H36 X;  5AE2 A;  2EPX A;  2F8B A;  5KL5 A;  2HKE A;  2K4V A;  2BA1 G;  2M9A A;  1PIE A;  5C0X B;  3PS2 A;  4JI2 I;  4IZJ B;  2UXB I;  4MLV A;  4NXN I;  4WYQ B;  2V87 A;  1XNQ E;  1X49 A;  4X65 E;  1IBM I;  2JOB A;  4DPU A;  4DV1 I;  3QT8 A;  5DNL A;  5DRO A;  4JG4 A;  2UXC I;  1FWK A;  2HK3 A;  2GLI A;  2EOQ A;  1N34 I;  1N36 I;  5DRP A;  4DR5 E;  1T4N A;  3QG5 C;  4HTG A;  4L8N A;  1FNM A;  2IES A;  2YTJ A;  1H74 A;  3NZK A;  1YUI A;  2UU9 I;  4I3H A;  2EQ0 A;  3M7N G;  4DV5 I;  1KTV A;  4DV6 I;  1YSA C;  2BBG A;  4FWG A;  5C0X A;  3L00 A;  4LFA I;  4FW4 A;  3ZZT A;  4FWD A;  2HHH E;  5K36 D;  2L3C A;  5IXM B;  2EOF A;  4KZS A;  4JI4 I;  2YSO A;  4HEI A;  4FK5 C;  5GME A;  2L2N A;  4DMI A;  2EPZ A;  2JYA A;  2EPL X;  1WHN A;  3DJW A;  2PO0 B;  2WBU A;  4F9A B;  4OZE A;  2EMA A;  1Z0E A;  2NA2 A;  4BA2 A;  5KL2 A;  2E1M A;  4JI0 E;  4R2Q A;  4AID A;  2YTN A;  2NPF A;  4LU9 A;  1S4E A;  2OI2 A;  4JI8 I;  3C6M A;  2O1V A;  2UUC E;  4DUZ E;  1Z1B A;  4KQV A;  4Q35 B;  1XNR E;  4AQY E;  1H7S A;  2HFU A;  5DRR A;  4OO1 B;  4LCF A;  2LJH A;  2BV3 A;  1YYK A;  1ZM9 A;  5K36 F;  5C0X C;  2EMC A;  1WUU A;  3ADG A;  1Z0T A;  1K47 A;  1OJ4 A;  2HGH A;  3GLL A;  3ZZ0 A;  4NXM E;  2E72 A;  4OOG C;  2HK2 A;  4PRX A;  2PO0 A;  1SFE A;  2F4V I;  2EL6 A;  1TN9 A;  3ADJ A;  2EWL A;  4WPY A;  5AE3 A;  4JI3 E;  1H73 A;  2EOE A;  2EOY A;  4IZK B;  2L8T A;  1IMU A;  2DLQ A;  4KWY A;  1KIJ A;  2F1D A;  1N33 I;  2EOH A;  3HPS A;  3MHS C;  4Q28 A;  2Z5B A;  1UDO A;  4OO1 A;  1USV A;  2DSY A;  2ENA A;  2Z5C A;  2LBS B;  1A1L A;  1P42 A;  2JR1 A;  2Q2E B;  4ISA A;  2LTS A;  2IER A;  3T1H E;  4F54 A;  1ZAA C;  2CZ9 A;  4HY1 A;  4LOM A;  1IQS A;  4QNK A;  2EPU A;  1DQ3 A;  1RRE A;  2VQE E;  3K85 A;  3Q6N A;  3OTO E;  1NHI A;  2YWQ A;  2V88 A;  4JI6 I;  2O3Z A;  3P3G A;  4JI5 E;  4IFD E;  2EM6 A;  4IZK A;  2EN4 A;  2RPC A;  1YYO A;  1OYR A;  4X62 I;  4LF7 I;  2PO2 B;  4JI7 E;  4N4R B;  3KZY A;  4UTG A;  4LF9 E;  4BBY A;  3BGH A;  2JE6 B;  2YZT A;  1HNW I;  1L4S A;  5JEA B;  4MDT A;  2EL5 A;  3THO B;  3D4J A;  1PJQ A;  2WNR B;  1B69 A;  4LF8 E;  4MU1 A;  2JXP A;  3FIG A;  4WX9 A;  2NN6 B;  5C0X D;  1X6F A;  4DV0 E;  3WU5 A;  4OO1 C;  2EOR A;  5BR8 I;  4X64 E;  2JPA A;  4FN5 A;  1J5E I;  1A1J A;  2GPI A;  2JOX A;  2NAB A;  2V85 A;  1FWL A;  2BA1 D;  1N32 I;  3F0N A;  1DAR A;  1RHY A;  3GCM A;  3VYX A;  1UBD C;  4DU7 A;  4DR7 E;  2EZ6 A;  2EN2 A;  1NEI A;  2EPA A;  3H1C A;  4DR3 I;  1IBK I;  1I94 E;  2JEA B;  2O1U A;  4LFB E;  4DR2 E;  2PO2 A;  4RPF A;  4ED4 A;  3UHM A;  4X66 I;  2R42 A;  3MHH C;  3GME A;  1HR0 I;  1D6T A;  4DR6 E;  1Y5Y A;  5JEA A;  3M99 B;  1JK1 A;  2BM1 A;  2CGE A;  2EOM A;  2NN6 A;  5EL9 A;  5L3J A;  2YTG A;  1UHZ A;  1FKA E;  5C0X F;  1RQ0 A;  2VF3 A;  3M85 G;  3AV0 A;  3M7N D;  2JEB B;  1FJG E;  2BM0 A;  3BBG A;  2GO3 A;  1T4O A;  4DR1 E;  2EPM X;  2N3G A;  1FI4 A;  2XEX A;  2JEA A;  3CWV A;  3P3C A;  2DRP A;  2HC5 A;  3IWD A;  2DEI A;  2LMZ A;  3Q6M A;  2EMZ A;  4BHB A;  4NXN E;  3DD6 A;  3QT7 A;  4F9B B;  4RHB B;  2K7I A;  2EM3 A;  4P78 A;  4FW5 A;  2YU8 A;  2L2M A;  4BCA A;  1KVK A;  1ZBQ A;  2DMI A;  2EL4 A;  5JEA C;  4OO1 D;  3V5R A;  4DV4 I;  1JK2 A;  2JEB A;  1XHK A;  1N34 E;  1N36 E;  2NN6 C;  4M30 A;  2EN8 A;  4ZVI A;  3V2U C;  2LUP B;  1QZR A;  4DU8 A;  2EJ4 A;  2RTX A;  2V8P A;  3WU4 A;  4BHC A;  2UU9 E;  3IWC A;  2BR2 A;  2EPK X;  5CFF E;  4ZYH A;  2RS6 A;  4DV6 E;  2I13 A;  4LFA E;  3B8H A;  1X47 A;  5FLX C;  4WSP A;  2O1W A;  2E5L I;  2BA0 G;  5K36 E;  2EOX A;  4R2E A;  2LVH A;  2KON A;  2DIX A;  1BBO A;  3TQM A;  5A6B D;  3EPK A;  5LMN E;  2EPP A;  2CT1 A;  2LO3 A;  4B3S I;  4X9J A;  4JI1 E;  2A2C A;  2EN1 A;  2L2K B;  4WSG A;  4IZJ A;  4OO1 F;  4OX9 E;  4X8W A;  2YTQ A;  3P76 A;  2V2Q A;  2EN7 A;  4BA1 B;  1UDN A;  4OKG A;  2ENH A;  2WBS A;  2PRT A;  1A1H A;  4JI8 E;  2YT4 A;  1MEY C;  1EA6 A;  2ZBK B;  4ZYD A;  2ZIT A;  2MDG A;  4X65 I;  2PNM A;  1RMD A;  5LMU I;  2B3T B;  3ZM7 A;  5KL4 A;  4DV7 E;  3J7A M;  2VE7 C;  5F3W A;  5A6A A;  1R6L A;  5JEA D;  1Y6Z A;  4LCH A;  4DR5 I;  2EM7 A;  2L6M A;  2EN6 A;  3ECR A;  3H4L A;  2NN6 D;  4LF5 E;  5A2Q Q;  3F6H A;  4IJD A;  1GQE A;  1Y4S A;  1B63 A;  5FWK A;  4YHH E;  2G7H A;  2MKN A;  3C4T A;  3VK6 A;  4BA1 A;  3K1J A;  2L92 A;  3HXL A;  5AC4 A;  1KJK A;  4YY3 E;  1A6F A;  3WU3 A;  3C4B A;  1BKN A;  4LF4 I;  1HK7 A;  4K0K E;  2YTF A;  2JT2 A;  2UXD I;  2CVE A;  1Z0B A;  1Y60 A;  1Z0V A;  4WFT A;  2EP3 A;  2YTD A;  2YTE A;  4DV3 E;  4Z7C A;  1AAY A;  2VQF E;  2R1F A;  4DUY I;  5KL6 A;  4B3M I;  4FW7 A;  2LJP A;  1X6H A;  2KOU A;  2B7V A;  5JEA F;  3ZKB A;  4ZYG A;  1NHJ A;  2VF1 A;  4R2C A;  2V2V A;  3JU0 A;  5DNX A;  2NN6 F;  1USU A;  2YTP A;  4USM A;  3CDJ A;  4R03 A;  3J81 Q;  4Z7Y A;  4DUZ I;  2WBT A;  1H72 C;  1P47 A;  1ZM2 A;  2JWO A;  1PDA A;  4B3T I;  2LUQ A;  3F6G A;  2LV2 A;  1HNX E;  1U2R A;  1Z5C A;  3M85 D;  4GKJ E;  3K6Q A;  2YRK A;  2GHF A;  1HNW E;  1HNZ E;  4LF6 E;  4P7D A;  2GS8 A;  5C0X E;  4M1K A;  1PVG A;  5KL3 A;  2M4I A;  4BC9 A;  4NXM I;  4O24 A;  5A6B A;  2ZM6 E;  1YH8 A;  2MDR A;  2UUA I;  4DR4 I;  5BR8 E;  1J5E E;  2YSP A;  3QT5 A;  2EM5 A;  2JVA A;  1A1I A;  4NZV A;  1BB8 A;  5EKW A;  5AC5 A;  2YRH A;  4LFC I;  4FW9 A;  4UT4 A;  2EMY A;  4IZJ D;  2N3H A;  4HAC B;  4DR3 E;  1A1G A;  3B78 A;  4MU4 A;  4DV2 E;  2YU5 A;  1F2I G;  5A6J A;  1IBK E;  5A2Q C;  3MSW A;  2C37 B;  2Z5E A;  2YTO A;  4X66 E;  1XMO E;  2V34 A;  2UUB I;  4KHP I;  4MYU A;  2FV4 B;  5A69 A;  1WHQ A;  2WP8 B;  2R76 A;  1VI7 A;  2EMB A;  3ZKD A;  2ELY A;  2Q8U A;  2A2D A;  1VIS A;  1ZM4 A;  3HJC A;  4R2R A;  3JAM Q;  2LT7 A;  2WZO A;  2NUF A;  2WCC 3;  2VQE I;  2JE6 A;  3LNU A;  2N8X A;  1EH7 A;  4WXD A;  3OTO I;  4WUB A;  3T1Y I;  1EH8 A;  2EM9 A;  2WNR A;  2BA0 D;  3HPZ A;  3EPJ A;  3JTZ A;  4GKK I;  1RC7 A;  2JY9 A;  4HAC A;  2YTI A;  4LF9 I;  4IS1 C;  5A6K A;  4FWH A;  1SR9 A;  1YFH A;  4JYA I;  1X48 A;  1A1K A;  2WP8 A;  4WUD A;  3LPS A;  4LF8 I;  2V2Z A;  1YUJ A;  4JV5 E;  3Q1Q A;  4R1F A;  4LPF A;  4DPX A;  4X64 I;  2M7Q A;  1IBL I;  2EQ1 A;  4OO1 E;  1G2D C;  3IWB A;  4JI2 E;  2UXB E;  4B3R I;  4DR7 I;  2EPO A;  1O0W A;  1IBM E;  2EQ3 A;  4HYM A;  3BID A;  1I94 I;  1T38 A;  5IWA I;  2CG9 A;  2DEJ A;  4DXL A;  4DR2 I;  4DV1 E;  3ADL A;  3GON A;  5LLQ A;  2VES A;  1B62 A;  3BF2 A;  2UXC E;  2E1R A;  3PS1 A;  2ODR C;  2V83 A;  1ZBT A;  1YHC A;  2E5L E;  3J80 Q;  2IOP A;  4N3O A;  1OYS A;  3ZZU A;  2NUE A;  1EI1 A;  4TUI A; 
#chains in the Genus database with same CATH homology
 4GEQ B;  1XMQ I;  4DV5 E;  5IT9 Q;  4B3S E;  1FJG I;  4DPW A;  2DMY A;  3PYF A;  3HUL A;  1S16 A;  3VYY A;  3HQ1 A;  3J7Y p;  4JI4 E;  4DPY A;  3B82 A;  2LRS A;  1DI2 A;  3QT6 A;  1EKZ A;  2V89 A;  1Z0C A;  2V8Q B;  2V86 A;  5LMU E;  4HXZ A;  4EMD A;  1N0U A;  2M1S A;  5T6J A;  2NUG A;  1XNQ I;  4XTJ A;  2KHX A;  4M2Z A;  3LML A;  1YYW A;  1MX0 A;  2IOQ A;  4URL A;  3HTX A;  2HKJ A;  5LL6 R;  3PYE A;  2RSM A;  3WU6 A;  2ODR D;  4PU9 A;  2F4V E;  4LF4 E;  2O1T A;  3PRY A;  1Z0W A;  3LTO A;  5LMN I;  2UXD E;  2X36 A;  5GMD A;  4JI1 I;  1N33 E;  3J80 C;  4OX9 I;  4BMJ A;  2HHH I;  1NHH A;  4DUY E;  4B3M E;  2HFS A;  4WUC A;  1YZ9 A;  5IT9 C;  4DPT A;  1Z0G A;  1Z5B A;  3LLH A;  2Z5B B;  4B3T E;  4JI0 I;  5ADZ A;  1GZ6 A;  2Z5C B;  4DV7 I;  1H7U A;  4JI6 E;  4MYT A;  3ZOQ B;  3M6A A;  2UUC I;  4X62 E;  4LF7 E;  1XNR I;  4DR4 E;  1ZM3 A;  2FGG A;  2UUA E;  4AQY I;  2L33 A;  4LF5 I;  3K17 A;  1MG7 A;  2CPN A;  4YHH I;  2GQ0 A;  4LFC E;  4P7A A;  4YY3 I;  2MC5 A;  2RS7 A;  1ELO A;  4JI3 I;  3DF6 A;  4K0K I;  2DB2 A;  2UUB E;  1N32 E;  3J7A G;  4KHP E;  2AJ4 A;  4DV3 I;  4USK A;  2VQF I;  4L5N C;  3P06 A;  4P52 A;  2B7T A;  4M0V A;  3PYG A;  3RMP A;  3OML A;  1NZ0 A;  2FTX B;  1HR0 E;  1PKP A;  1QU6 A;  4R8O A;  3T1Y E;  3T1H I;  4GKK E;  2J7K A;  1HNX I;  3ADI A;  4GKJ I;  3AUZ A;  3P1X A;  2PNL A;  3PYD A;  4JI5 I;  5DNY A;  4JYA E;  1ZXN A;  1HNZ I;  4LF6 I;  4F9C B;  4JI7 I;  2ZM6 I;  5AE1 A;  4DKK A;  2LTR A;  4BS9 A;  2MC6 A;  1IBL E;  5AAS A;  3J81 C;  2IHR 1;  1N0V C;  4I8O A;  4B3R E;  1KKH A;  1STU A;  4DV0 I;  5FLX Q;  4TUG A;  4DV2 I;  5IWA E;  1UEK A;  1Z59 A;  2WW4 A;  1WXR A;  1J26 A;  1XMO I;  4DV4 E;  4LTY A;  1ZXM A;  1MU5 A;  1Z5A A;  4LFB I;  1Y4U A;  2L3J A;  1XMQ E;  3KWR A;  2R3V A;  2B9D A;  1T4L B;  1RR9 A;  4DR6 I;  2LE2 A;  1UIL A;  4J8Z A;  2EFG A;  3H09 A;  4DR1 I;  3JAM C;  4BC7 A;  4PRV A;  4JV5 I;  2X7I A;  2H36 X;  5AE2 A;  2F8B A;  2HKE A;  2K4V A;  1PIE A;  4JI2 I;  4IZJ B;  2UXB I;  4NXN I;  4WYQ B;  2V87 A;  1XNQ E;  1X49 A;  4X65 E;  1IBM I;  2JOB A;  4DPU A;  4DV1 I;  3QT8 A;  2UXC I;  4JG4 A;  1FWK A;  2HK3 A;  1N34 I;  1N36 I;  4DR5 E;  1T4N A;  4L8N A;  1FNM A;  1H74 A;  2UU9 I;  4I3H A;  4DV5 I;  1KTV A;  4DV6 I;  4LFA I;  4FWG A;  3ZZT A;  4FWD A;  2HHH E;  2L3C A;  4KZS A;  4JI4 I;  5GME A;  2L2N A;  4DMI A;  1WHN A;  3DJW A;  4F9A B;  1Z0E A;  2NA2 A;  2E1M A;  4JI0 E;  2NPF A;  4LU9 A;  1S4E A;  2OI2 A;  4JI8 I;  2O1V A;  2UUC E;  4DUZ E;  4KQV A;  1XNR E;  4AQY E;  1H7S A;  2HFU A;  2LJH A;  2BV3 A;  1YYK A;  1ZM9 A;  1WUU A;  3ADG A;  1Z0T A;  1K47 A;  1OJ4 A;  3ZZ0 A;  4NXM E;  4OOG C;  4PRX A;  2HK2 A;  2F4V I;  3ADJ A;  2EWL A;  4WPY A;  5AE3 A;  4JI3 E;  1H73 A;  4IZK B;  2L8T A;  1N33 I;  1KIJ A;  3HPS A;  4Q28 A;  2Z5B A;  1USV A;  2DSY A;  2Z5C A;  2LBS B;  2JR1 A;  2Q2E B;  2LTS A;  4HY1 A;  3T1H E;  4F54 A;  2CZ9 A;  1DQ3 A;  1RRE A;  2VQE E;  3K85 A;  3Q6N A;  3OTO E;  1NHI A;  2V88 A;  4JI6 I;  4JI5 E;  4IZK A;  1YYO A;  4X62 I;  4LF7 I;  4JI7 E;  4UTG A;  4LF9 E;  4BBY A;  2YZT A;  1HNW I;  3D4J A;  4LF8 E;  3FIG A;  4DV0 E;  3WU5 A;  5BR8 I;  4X64 E;  4FN5 A;  1J5E I;  1FWL A;  2JOX A;  2V85 A;  1N32 I;  3F0N A;  1DAR A;  3VYX A;  4DU7 A;  4DR7 E;  2EZ6 A;  4DR3 I;  1IBK I;  1I94 E;  2O1U A;  4LFB E;  4DR2 E;  4RPF A;  4X66 I;  2R42 A;  1HR0 I;  1D6T A;  4DR6 E;  2CGE A;  2BM1 A;  5L3J A;  1UHZ A;  1FKA E;  1RQ0 A;  2VF3 A;  3AV0 A;  1FJG E;  2BM0 A;  1T4O A;  4DR1 E;  2N3G A;  1FI4 A;  2XEX A;  3CWV A;  3IWD A;  2DEI A;  2LMZ A;  3Q6M A;  4NXN E;  3QT7 A;  4F9B B;  4P78 A;  2L2M A;  4BCA A;  1KVK A;  1ZBQ A;  3V5R A;  4DV4 I;  1XHK A;  1N34 E;  1N36 E;  4M30 A;  4ZVI A;  3V2U C;  2LUP B;  1QZR A;  4DU8 A;  2RTX A;  2V8P A;  3WU4 A;  2UU9 E;  3IWC A;  5CFF E;  2RS6 A;  4DV6 E;  2E5L I;  4LFA E;  3B8H A;  1X47 A;  5FLX C;  4WSP A;  2O1W A;  2KON A;  2DIX A;  5LMN E;  4B3S I;  4JI1 E;  2A2C A;  2L2K B;  4IZJ A;  4OX9 E;  4X8W A;  2V2Q A;  4JI8 E;  2YT4 A;  1EA6 A;  2ZBK B;  2ZIT A;  4X65 I;  2PNM A;  5LMU I;  2B3T B;  3ZM7 A;  4DV7 E;  3J7A M;  2VE7 C;  5F3W A;  1Y6Z A;  4DR5 I;  2L6M A;  3H4L A;  5A2Q Q;  4LF5 E;  3F6H A;  1Y4S A;  1GQE A;  1B63 A;  5FWK A;  4YHH E;  2G7H A;  3C4T A;  3VK6 A;  3K1J A;  2L92 A;  3HXL A;  1A6F A;  4YY3 E;  3WU3 A;  3C4B A;  1BKN A;  4LF4 I;  1HK7 A;  4K0K E;  2UXD I;  1Z0B A;  1Z0V A;  4WFT A;  4DV3 E;  4Z7C A;  2VQF E;  4DUY I;  4B3M I;  2LJP A;  2KOU A;  2B7V A;  3ZKB A;  1NHJ A;  2VF1 A;  2V2V A;  3JU0 A;  1USU A;  4USM A;  3J81 Q;  4R03 A;  4DUZ I;  4Z7Y A;  1H72 C;  1ZM2 A;  2JWO A;  4B3T I;  2LUQ A;  3F6G A;  1HNX E;  1U2R A;  1Z5C A;  4GKJ E;  3K6Q A;  1HNW E;  1HNZ E;  4LF6 E;  4P7D A;  2GS8 A;  4M1K A;  1PVG A;  2M4I A;  4BC9 A;  4NXM I;  2ZM6 E;  2UUA I;  4DR4 I;  2MDR A;  5BR8 E;  1J5E E;  3QT5 A;  2JVA A;  4LFC I;  4FW9 A;  4UT4 A;  4IZJ D;  2N3H A;  4HAC B;  4DR3 E;  3B78 A;  4ED4 A;  4DV2 E;  1IBK E;  2Z5E A;  5A2Q C;  3MSW A;  4X66 E;  1XMO E;  2V34 A;  2UUB I;  4KHP I;  4MYU A;  2FV4 B;  1WHQ A;  3ZKD A;  2A2D A;  3HJC A;  1VIS A;  1ZM4 A;  3JAM Q;  2WZO A;  2NUF A;  2VQE I;  3LNU A;  3OTO I;  4WUB A;  3T1Y I;  3HPZ A;  3JTZ A;  4GKK I;  1RC7 A;  2JY9 A;  4HAC A;  4LF9 I;  4FWH A;  1SR9 A;  4JYA I;  1X48 A;  4WUD A;  3LPS A;  4LF8 I;  2V2Z A;  4JV5 E;  3Q1Q A;  4R1F A;  4DPX A;  4X64 I;  2M7Q A;  1IBL I;  4JI2 E;  3IWB A;  2UXB E;  4B3R I;  4DR7 I;  1O0W A;  1IBM E;  4HYM A;  1I94 I;  5IWA I;  2CG9 A;  2DEJ A;  4DXL A;  4DR2 I;  4DV1 E;  3ADL A;  3GON A;  1B62 A;  2UXC E;  2E1R A;  2ODR C;  2V83 A;  1ZBT A;  2E5L E;  3J80 Q;  2IOP A;  4N3O A;  3ZZU A;  2NUE A;  1EI1 A;  4TUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...