1FKAE

Structure of functionally activated small ribosomal subunit at 3.3 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
157
structure length
157
Chain Sequence
MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution.
pubmed doi rcsb
total genus 23
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1fkaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1fkaE02
2OI2A 2UXCE 2UUCI 1YYOA 1PKPA 5IT9C 1FJGE 5LMUI 1N34I 1J26A 3OTOI 4NXMI 4JG4A 1EA6A 1NHJA 4ZVIA 4DUYI 2N3GA 2UUAI 2V2QA 1N33I 3LLHA 4DU7A 1NZ0A 4LF8I 5LMUE 3K1JA 4DR1I 1T4OA 1KTVA 4URLA 2L3JA 4DUYE 4HXZA 2DEIA 4DV3I 4DV1I 3QT5A 2R3VA 1XHKA 1UILA 3J81C 4JI1I 1YYKA 1NHIA 3JAMC 2MDRA 1S16A 2LJPA 4HACA 3J7Yp 1WHNA 1HNXE 1YYWA 1H72C 4DUZI 1UEKA 2LTRA 4X66I 4X64E 3PYEA 4LF4I 3HTXA 4WYQB 1EKZA 2JVAA 2UU9I 1HNZI 2B7TA 2LUQA 1OJ4A 4FWGA 4JI2E 2HFSA 1ZM2A 3K17A 4KHPE 1XNRE 3QT6A 4DR2I 2UUBE 1FWLA 1Z0TA 4DV2I 4DV7I 4NXNI 2RTXA 3JAMQ 2KHXA 4JI7I 5BR8I 2N3HA 4DR2E 3F0NA 2F4VE 2GS8A 3D4JA 3T1HE 4USKA 4DR3I 4DPUA 1I94I 4GKJE 3Q1QA 4DXLA 1Z0BA 2A2CA 1J5EI 3ADGA 2WW4A 2HK3A 2VQFE 3C4TA 2L2NA 4B3TE 5A2QC 1WHQA 4DU8A 2VQEE 4UTGA 1HNWE 4MYTA 3ZZTA 4JI5E 4X8WA 2UXCI 2LUPB 2B7VA 4DR4E 1Z5AA 4LFBE 4LFCE 1N0UA 5LMNE 2E5LE 1H73A 1STUA 5IWAE 1FJGI 2RS7A 4FW9A 4M1KA 2DEJA 4LF5E 4K0KI 4JI3E 1X48A 3ZM7A 3CWVA 4P7AA 4M30A 4LF6E 1VISA 3ZZUA 4B3ME 1ZM9A 4EMDA 4WFTA 1B62A 3T1YE 1FKAE 4K0KE 4FN5A 2L2KB 3VYXA 2NPFA 4DKKA 1RR9A 1ELOA 2UXDE 1S4EA 1WUUA 4DR7I 3J7AG 1U2RA 4DV5E 2ZITA 2EZ6A 2NUGA 4USMA 1RC7A 2DMYA 4GKKE 1HNXI 2B3TB 4DR7E 2J7KA 4KQVA 1BKNA 1N32E 4X64I 1XMOE 5IT9Q 1Z0GA 4R1FA 1N36I 3LNUA 4DV6E 2LTSA 4DPWA 2NA2A 2EFGA 4DR5I 2HFUA 1FNMA 4PRXA 2ZM6E 4FWDA 1XNQI 4JI2I 1N36E 4KHPI 1XNRI 2BV3A 5GMDA 1X47A 3PYDA 2UUBI 4DR5E 1H74A 1Z0VA 3HULA 2V8PA 1PVGA 3PYGA 4DV4E 4DPYA 2CPNA 1XNQE 3J80C 1MX0A 2UXBE 2F4VI 4JYAE 3T1HI 2AJ4A 1H7UA 2VF3A 3WU5A 3J81Q 4GKJI 2HHHE 1MG7A 3LPSA 2L3CA 2R42A 4LF9E 4WUDA 4DV0E 2LJHA 2VQFI 4JI8E 4B3TI 1K47A 2HK2A 5GMEA 2BM0A 2VQEI 4LFAE 5L3JA 1HNWI 3V2UC 4JI0E 4JI4E 1RQ0A 4P52A 4LF7E 4X65E 3ZKDA 4JI5I 5FLXC 1FWKA 4DR4I 4LFBI 4LFCI 5LL6R 5LMNI 2LBSB 2E5LI 5IWAI 4LF5I 4FWHA 2HKJA 4X62E 1IBLE 4JI3I 2Q2EB 4JV5E 4LF6I 4YY3E 4I3HA 5CFFE 3B8HA 4B3MI 4JI6E 3T1YI 3ZZ0A 4AQYE 2BM1A 4HYMA 1O0WA 4DR6E 1HR0E 2A2DA 4B3RE 3WU6A 1A6FA 1Z0EA 2UXDI 2V2VA 3PYFA 4DPTA 3ZKBA 2CZ9A 4DV5I 4YHHE 1FI4A 5A2QQ 4OX9E 1Z0WA 2JY9A 2RSMA 1IBKE 1Z5CA 1Z0CA 4GKKI 2L2MA 1X49A 1PIEA 1N32I 1XMOI 2NUEA 3WU4A 4UT4A 1D6TA 4DV6I 2UUCE 1QZRA 2ZM6I 2E1RA 3QT7A 3H4LA 1YZ9A 4HY1A 1N34E 3OTOE 1ZBTA 1ZXMA 2DB2A 4NXME 1T4LB 2IHR1 4XTJA 2DIXA 2UUAE 1Z5BA 1N33E 3QT8A 2ZBKB 1B63A 3J7AM 4LF8E 2XEXA 2YT4A 4DV4I 4DR1E 3VYYA 2UXBI 4JYAI 2NUFA 1IBMI 4OOGC 2HHHI 2LRSA 4DPXA 4DV3E 4DV1E 4M2ZA 4PRVA 1H7SA 3LTOA 1KVKA 4RPFA 1EI1A 4LF9I 4DV0I 2V2ZA 4JI8I 1N0VC 2X7IA 1IBME 4JI1E 1T4NA 4LFAI 3B82A 4MYUA 4JI0I 4JI4I 1QU6A 1DARA 4LF7I 4X65I 4DUZE 4X66E 4WUBA 4LF4E 1RREA 3ADIA 2X36A 1Z59A 4HACB 2UU9E 1HNZE 4X62I 3GONA 1IBLI 1KIJA 4JV5I 1ZM4A 2V34A 4YY3I 3J80Q 4JI6I 4AQYI 3ADLA 4DV2E 3ADJA 2RS6A 4DV7E 1UHZA 4NXNE 2L33A 1DI2A 1MU5A 4Z7CA 1HR0I 4DR6I 4B3SI 1GQEA 4B3RI 2HKEA 4JI7E 5BR8E 1ZXNA 3V5RA 3WU3A 1XMQI 3P1XA 4DR3E 4YHHI 1I94E 4Z7YA 3B78A 4OX9I 4B3SE 1IBKI 4ED4A 3C4BA 1J5EE 4PU9A 3M6AA 1XMQE 5FLXQ 1NHHA 4WUCA 1ZM3A 1KKHA
chains in the Genus database with same CATH superfamily
3JU0A 2OI2A 2JPAA 1DQ3A 1SFEA 3C6KA 3DF6A 2UXCE 2C37B 2UUCI 1YYOA 1PKPA 2EM2A 2EOZA 4J3DA 5IT9C 3IWDA 1FJGE 5LMUI 2EN4A 1N34I 1J26A 3OTOI 2EMZA 4NXMI 4JG4A 2EM0A 2IERA 2CSHA 1EA6A 2LE2A 1NHJA 4ZVIA 4DUYI 2N3GA 2UUAI 1PDAA 2V2QA 2EPKX 3LLHA 4R2SA 4DU7A 1N33I 1NZ0A 2WNRB 4LF8I 3PS2A 3AV0A 1AAYA 2PO2B 5LMUE 2V83A 3K1JA 4DR1I 1T4OA 4R03A 1JK2A 5A6BA 1KTVA 2HC5A 2ENCA 5A6AA 2Z5BB 4URLA 5JEAA 2YTDA 4WPYA 2EMXA 2L3JA 4DUYE 4HXZA 1YUIA 3THNA 4OO1B 2DEIA 1SR9A 4NBQA 4OKGA 1X3CA 4MU4A 4DV3I 2JE6A 2YTQA 2DLQA 3C6MA 4ZYEA 5K36F 2E72A 1ZU1A 4DV1I 2BA1D 3RMPA 3QT5A 3MHHC 2R3VA 2WBSA 4IZJA 2O1WA 1XHKA 1UILA 1OYSA 1Y6ZA 5EKWA 3J81C 2EL6A 3P76A 4JI1I 1YYKA 2JEBB 1NHIA 3JAMC 2MDRA 1S16A 2LJPA 2YRMA 2L6MA 3HKMA 4OO1E 4IJDA 1YHCA 2PNLA 2GO4A 4FW5A 4HACA 2LCEA 1WHNA 3J7Yp 4R2DA 1HNXE 2VESA 4QNKA 1OYPA 4BHCA 2EOSA 1YYWA 4O43A 2EOQA 1H72C 2IESA 2ODRC 1BB8A 1UEKA 4DUZI 2LTRA 4X66I 4X64E 3PYEA 4F6MA 2EN7A 3L7ZB 3F6HA 4KZSA 4LF4I 3HTXA 3EPHA 1WJPA 3EPJA 5ELWA 4N4RB 4WYQB 2EL4A 1EKZA 2G7HA 2BBGA 2JVAA 3EPKA 2UU9I 4F54A 1HNZI 2BR2B 4LPFA 5C0XC 1NEIA 2DRPA 2RPCA 4U3DA 1ZAAC 4IFDA 2ADRA 2B7TA 4FW6A 2LUQA 5KL4A 1OJ4A 4R2EA 2C38A 4DMIA 4FWGA 4R2PA 4JI2E 2JOXA 2M4IA 2HFSA 2V88A 4M0VA 2MDGA 1LLMC 1ZM2A 2EPUA 4KHPE 2YTPA 1XNRE 3K17A 3QT6A 1UDOA 3QT7A 5JEAF 4DR2I 3OMLA 2EOHA 1MGTA 3MSWA 2UUBE 2NN6A 1FWLA 1Z0TA 3GLLA 4DV2I 4DV7I 2N8XA 4NXNI 2DGCA 2RTXA 2EM8A 1R6LA 3JAMQ 2MC6A 2KHXA 2EOYA 2M9AA 4JI7I 2EQ1A 2CVEA 5IXMB 2LJUA 4F9AB 1PJQA 5BR8I 2N3HA 2EP3A 5DNXA 1YPNA 4DR2E 2MKNA 2F4VE 2GS8A 1XXEA 3D4JA 3T1HE 3F0NA 3M85D 4USKA 4LCGA 4DR3I 4DPUA 1A1HA 2YRKA 1I94I 4GKJE 1OYRA 2PO0B 3Q1QA 1X6EA 4BC9A 2HGHA 4DXLA 1UDQA 1Z0BA 5KL2A 2A2CA 1J5EI 4BS9A 3QG5C 4IFDD 3ADGA 2WW4A 2HK3A 2JOBA 2VQFE 3HJCA 2ENAA 3C4TA 2L2NA 4P7DA 4B3TE 5A2QC 2EM4A 3GMEA 1WHQA 4LCFA 2YSPA 4DU8A 2LV2A 2J65A 3VK6A 2VQEE 4O5GA 1USVA 4UTGA 1HNWE 4LCHA 2PRTA 1EH8A 4IFDF 4BC7A 4WX9A 4MYTA 3ZZTA 4JI5E 4X8WA 2UXCI 5AASA 2LUPB 2B7VA 2YZTA 2O3ZA 4DR4E 1Z5AA 4LFBE 1N3GA 4LFCE 1N0UA 5LMNE 2DMIA 2WNRA 2E5LE 1X6FA 1H73A 5LLQA 1STUA 2EMAA 5IWAE 1T38A 2PO2A 1FJGI 2RS7A 4BCAA 5KL3A 4FW9A 2NN6F 2DEJA 4M1KA 4LF5E 3EPLA 4K0KI 5DRPA 2EMBA 4JI3E 5C0XE 2Z5BA 1X48A 3ZM7A 4R2AA 1Y4UA 4ISAA 3CWVA 4P7AA 4M30A 3KZZA 4LF6E 1YH8A 4OO1A 1VISA 3ZZUA 4B3ME 1ZM9A 1WRJA 4EMDA 5AE3A 3PS1A 4GQUA 3THOB 4WFTA 4IS1C 1B62A 3T1YE 3HPSA 2V8QB 1FKAE 3UHMA 1UN6B 4K0KE 2I9IA 2R76A 1USUA 4FN5A 2BA0D 2L2KB 2EM7A 3VYXA 5KL5A 2NPFA 3CDJA 4DKKA 1HK7A 3Q6MA 1RR9A 1ELOA 1UDNA 2JEBA 2YU8A 2UXDE 2EMLA 3K85A 1S4EA 1WUUA 2EN2A 2YTOA 4DR7I 2O1VA 1TN9A 5K36D 3J7AG 1U2RA 4DV5E 2EL5A 2EN1A 2ZITA 4BA1B 3AUZA 5KL6A 2EZ6A 2NUGA 2CG9A 4USMA 3BGHA 1RC7A 2E1MA 2EPAA 2IOQA 3M7ND 2DMYA 4GKKE 1HNXI 2KONA 4LF9I 2B3TB 4DR7E 2BR2A 2J7KA 2EPCA 2YSOA 2O1UA 4KQVA 1BKNA 5KL7A 2I13A 2EOEA 1N32E 2Q8UA 1ZBQA 4X64I 1XMOE 5DRQA 2JT2A 5IT9Q 4F6NA 1Z0GA 1KJKA 2GLIA 4R1FA 2EPOA 1N36I 1EH6A 2EMFA 4DV6E 3LNUA 4I8OA 2H36X 4WXCA 2EMWA 2PO1B 2LTSA 4DPWA 2NA2A 2WP8A 2EFGA 4DR5I 2YTNA 2YTGA 1JK1A 2EQ0A 2HFUA 1FNMA 3HPZA 1B69A 4PRXA 2ZM6E 4FWDA 1XNQI 4JI2I 2DSYA 2EOJA 2GPIA 1N36E 3KRNA 5A6BD 2LT7A 2L8TA 2BV3A 5GMDA 1XNRI 1X47A 4KHPI 2JEAA 3Q6NA 5JEAD 3PYDA 2UUBI 4DR5E 2EORA 4Q28A 1H74A 3KWRA 1Z0VA 3HULA 1IMUA 2V8PA 2PNMA 3TQMA 1PVGA 3BF2A 4FW3A 4QNJA 3PYGA 1X5WA 2FGGA 4DV4E 4DPYA 1PJTA 2CPNA 2V89A 3J80C 4ZYDA 1XNQE 2WCC3 1MX0A 4BMJA 4X9JA 2UXBE 2F4VI 4JYAE 4IZJD 3T1HI 2JWOA 2AJ4A 2O1TA 2FTXB 1YFHA 2K7IA 1H7UA 4TUIA 3MHSC 2VF3A 3WU5A 3J81Q 4GKJI 2HHHE 2JE6B 2CTDA 1MG7A 1PJSA 1R6MA 4J8ZA 5FWKA 4L5NC 3LPSA 4GZNC 2L3CA 5C0XA 4BHBA 2R42A 4LF9E 4WUDA 4DV0E 2LJHA 4TUGA 2VQFI 4JI8E 4B3TI 1AH5A 2EMKA 4L8NA 2RQLA 2EMHA 1K47A 2HK2A 2BM0A 5GMEA 2VQEI 5A69A 4LFAE 1P47A 2MKDA 5L3JA 1Y60A 2EOFA 2CT1A 1QNTA 2YTFA 3V2UC 1HNWI 4N3OA 4JI0E 4JI4E 1RQ0A 4P52A 3PRYA 3U1KA 4AM3A 3L00A 2EJ4A 4WSGA 4X65E 4LF7E 3ZKDA 4JI5I 5FLXC 2C37A 1FWKA 2EMCA 1YSAC 4DR4I 1TF3A 4LFBI 4LFCI 5LL6R 5LMNI 2LBSB 2E5LI 4Q35B 2RSIA 5A6KA 4P78A 5IWAI 2JYAA 2EM6A 2MC5A 4LF5I 4FWHA 2ENHA 2HKJA 2NN6D 4X62E 1IBLE 4MU1A 3BBGA 5ADZA 4JI3I 4IFDB 4R8OA 5K36C 4R2QA 1X6HA 2Q2EB 1T39A 2C38B 2EMYA 1F2IG 4JV5E 4GEQB 2EN8A 4LF6I 1A1GA 2YRHA 4YY3E 4I3HA 5CFFE 3B8HA 4B3MI 4RH8A 4JI6E 4NZVA 5C0XD 2EN6A 4IS9A 3T1YI 3ZZ0A 4AQYE 2NN6B 2BM1A 3M7NG 5TSEA 1L4SA 2Z5CB 4HYMA 3IWBA 4BA1A 1O0WA 2FV4B 3ZOQB 4F2JC 1HR0E 4DR6E 2LVHA 5EL9A 2B9DA 2M7QA 2A2DA 5A6JA 4B3RE 2BA1G 2C39B 2GQ0A 2EN3A 1A6FA 3CDIA 1Z0EA 3WU6A 2UXDI 5C0XF 2V2VA 3P3GA 3PYFA 2YWQA 1ZR9A 1YUJA 2YU5A 4IZKB 4DPTA 4AIDA 2EOOA 3ZKBA 2CZ9A 4DV5I 4U3BA 5AE1A 4YHHE 1FI4A 2BB8A 2CGEA 5A2QQ 2YTEA 4FK5C 4MLVA 2GO3A 4OX9E 1Z0WA 2JY9A 2RSMA 1IBKE 1WXRA 2J7JA 4RHBB 1G2FC 1Z0CA 1Z5CA 4GKKI 1IQSA 2L2MA 1X49A 2EQ3A 4BA2B 3IWCA 2R1FA 1A1KA 1PIEA 4FW7A 2PNZB 2PO1A 1A1LA 2ELYA 2F8BA 2EMGA 2EOIA 1TF6A 3GCMA 4OZEA 5JEAC 4MU3A 2EE8A 1N32I 4LU9A 1XMOI 3L7ZA 2NUEA 3WU4A 4UT4A 2KOUA 2EPRA 2EPLX 2V85A 1D6TA 4DV6I 1BBGA 2WBTA 5DROA 3HXLA 2VF1A 2L92A 5K36B 4O4KA 2UUCE 1QZRA 5DRRA 4F9CB 4OO1D 3DD6A 2V87A 3FIGA 2ZM6I 4O24A 5DNYA 3UK3C 1RHYA 1YZ9A 2V86A 2E1RA 2Z5EA 3H4LA 1N34E 4HY1A 3OTOE 1ZBTA 1BBOA 1ZXMA 2DB2A 4NXME 1T4LB 2IHR1 1A1FA 2AE8A 2JP9A 1GZ6A 4XTJA 2DIXA 1GTKA 2UUAE 5K36E 1Z5BA 1N33E 3H09A 3QT8A 4OO1F 2ZBKB 1B63A 3J7AM 4LF8E 2LO3A 2XEXA 3M85G 2YT4A 3ECRA 4FW4A 4DV4I 2EOMA 3HQ1A 2JR1A 1KYQA 4DR1E 3VYYA 2EM9A 2EOXA 5DNLA 2UXBI 3EQ1A 1Z1BA 4JYAI 3P06A 4IFDC 2NUFA 1IBMI 1E3HA 4MU0A 4OOGC 2HHHI 2LRSA 4DPXA 2PO0A 4DV3E 2VRDA 4WSPA 3P3CA 3VHTB 4HEIA 4DV1E 4M2ZA 4PRVA 2NABA 1H7SA 3LTOA 1KVKA 1UDSA 4RPFA 2A25A 1EI1A 2EM3A 1VI7A 2NN6C 1UBDC 2V2ZA 4JI8I 5JEAB 1N0VC 4MLQA 2X7IA 4DV0I 1IBME 4JI1E 1Y4SA 1T4NA 5AC5A 3K6QA 4LFAI 2EM5A 4F9BB 3B82A 5IV8B 4MYUA 4JI0I 4JI4I 1QU6A 4ZYHA 2WBUA 1DARA 4LF7I 4X65I 4DUZE 5AC4A 1MEYC 4IZJB 2JXPA 4X66E 4WUBA 4R2RA 5JEAE 2WZOA 4LF4E 1RREA 3ADIA 4M9VC 2X36A 4KWYA 3LMLA 1Z59A 4HACB 2UU9E 2EPZA 1HNZE 3PS3A 2EWLA 2WP8B 4X62I 3GONA 1IBLI 1P42A 2Z5CA 2EMIA 2YTJA 1KIJA 2VE7C 1DGCA 1RMDA 4JV5I 1E3PA 2ELZA 4LTYA 1ZM4A 2V34A 4MDTA 2C39A 4YY3I 5AE2A 2BA0G 3J80Q 4ZYGA 3H1CA 4JI6I 2D9HA 2JEAB 2ODRD 1A1JA 4IZKA 4AIMA 4AQYI 3ADLA 4BBYA 2IOPA 2K4VA 3M99B 4DV2E 3ADJA 2RS6A 4DV7E 1UHZA 4NXNE 2L33A 1DI2A 5T6JA 1MU5A 4Z7CA 1HR0I 4DR6I 4B3SI 1GQEA 3BIDA 3B4TA 4B3RI 2HKEA 4JI7E 5BR8E 1ZXNA 1NCSA 3V5RA 3WU3A 1XMQI 2YPNA 4BA2A 3P1XA 2PNZA 1IQOA 4DR3E 4YHHI 1I94E 1G2DC 4R2CA 4IFDE 4Z7YA 2F1DA 3B78A 2EPPA 4B3SE 1IBKI 3F6GA 4OX9I 2EPMX 3NZKA 4OO1C 3JTZA 1Y5YA 3C4BA 1J5EE 3P3EA 4WXDA 4PU9A 3M6AA 3U1YA 4ED4A 5C0XB 4HTGA 1XMQE 5F3WA 2EPXA 3KZYA 2EPNA 5K36A 2HJJA 2LMZA 5FLXQ 1NHHA 2YTIA 2NN6E 4WUCA 4NHRA 2DLKA 1KKHA 1ZM3A 3DJWA 4LOMA 1EH7A 2M1SA 4MQYA 1A1IA 2GHFA
chains in the Genus database with same CATH topology
3JU0A 2OI2A 1DQ3A 3DF6A 2UXCE 2UUCI 1YYOA 1PKPA 5IT9C 3IWDA 1FJGE 5LMUI 1N34I 1J26A 3OTOI 4NXMI 4JG4A 1EA6A 1NHJA 2LE2A 4ZVIA 4DUYI 2N3GA 2UUAI 2V2QA 1N33I 3LLHA 4DU7A 1NZ0A 4LF8I 3AV0A 5LMUE 2V83A 3K1JA 4DR1I 1T4OA 4R03A 1KTVA 4URLA 2Z5BB 4WPYA 2L3JA 4DUYE 4HXZA 2DEIA 1SR9A 4DV3I 4DV1I 3RMPA 3QT5A 2R3VA 4IZJA 2O1WA 1XHKA 1UILA 1Y6ZA 3J81C 4JI1I 1YYKA 1NHIA 3JAMC 2MDRA 1S16A 2LJPA 2L6MA 2PNLA 4HACA 1WHNA 3J7Yp 1HNXE 1YYWA 1H72C 4DUZI 2ODRC 1UEKA 2LTRA 4X66I 4X64E 3PYEA 4LF4I 3F6HA 4KZSA 3HTXA 4WYQB 1EKZA 2G7HA 2JVAA 2UU9I 4F54A 1HNZI 2B7TA 2LUQA 1OJ4A 4DMIA 4FWGA 4JI2E 2JOXA 2M4IA 2HFSA 2V88A 4M0VA 1ZM2A 3K17A 4KHPE 1XNRE 3QT6A 4DR2I 3OMLA 3MSWA 2UUBE 1FWLA 1Z0TA 4DV2I 4DV7I 4NXNI 2RTXA 3JAMQ 2MC6A 2KHXA 4JI7I 5BR8I 4F9AB 2N3HA 4DR2E 3F0NA 2F4VE 2GS8A 3D4JA 3T1HE 4USKA 4DR3I 4DPUA 1I94I 4GKJE 3Q1QA 4BC9A 4DXLA 1Z0BA 2A2CA 1J5EI 4BS9A 3ADGA 2WW4A 2HK3A 2JOBA 2VQFE 3HJCA 3C4TA 2L2NA 4P7DA 4B3TE 5A2QC 1WHQA 4DU8A 3VK6A 2VQEE 1USVA 4UTGA 1HNWE 4BC7A 4MYTA 3ZZTA 4JI5E 4X8WA 2UXCI 5AASA 2LUPB 2B7VA 2YZTA 4DR4E 1Z5AA 4LFBE 4LFCE 1N0UA 5LMNE 2E5LE 1H73A 1STUA 5IWAE 1FJGI 2RS7A 4BCAA 4FW9A 4M1KA 2DEJA 4LF5E 4K0KI 4JI3E 2Z5BA 1X48A 3ZM7A 1Y4UA 3CWVA 4P7AA 4M30A 4LF6E 1VISA 3ZZUA 4B3ME 1ZM9A 4EMDA 5AE3A 4WFTA 1B62A 3T1YE 3HPSA 2V8QB 1FKAE 4K0KE 1USUA 4FN5A 2L2KB 3VYXA 2NPFA 4DKKA 1HK7A 3Q6MA 1RR9A 1ELOA 2UXDE 3K85A 1S4EA 1WUUA 4DR7I 2O1VA 3J7AG 1U2RA 4DV5E 2ZITA 3AUZA 2EZ6A 2NUGA 2CG9A 4USMA 1RC7A 2E1MA 2IOQA 2DMYA 4GKKE 1HNXI 2KONA 2B3TB 4DR7E 2J7KA 2O1UA 4KQVA 1BKNA 1N32E 4X64I 1ZBQA 1XMOE 5IT9Q 1Z0GA 4R1FA 1N36I 3LNUA 4DV6E 4I8OA 2H36X 2LTSA 4DPWA 2NA2A 2EFGA 4DR5I 2HFUA 1FNMA 3HPZA 4PRXA 2ZM6E 4FWDA 1XNQI 4JI2I 2DSYA 1N36E 4KHPI 1XNRI 2L8TA 2BV3A 5GMDA 1X47A 3Q6NA 3PYDA 2UUBI 4DR5E 4Q28A 1H74A 3KWRA 1Z0VA 3HULA 2V8PA 2PNMA 1PVGA 3PYGA 2FGGA 4DV4E 4DPYA 2CPNA 2V89A 3J80C 1XNQE 1MX0A 4BMJA 2UXBE 2F4VI 4JYAE 4IZJD 3T1HI 2JWOA 2AJ4A 2O1TA 2FTXB 1H7UA 4TUIA 2VF3A 3WU5A 3J81Q 4GKJI 2HHHE 1MG7A 5FWKA 4J8ZA 4L5NC 3LPSA 2L3CA 2R42A 4LF9E 4WUDA 4DV0E 2LJHA 4TUGA 2VQFI 4JI8E 4B3TI 4L8NA 1K47A 2HK2A 5GMEA 2BM0A 2VQEI 4LFAE 5L3JA 1HNWI 3V2UC 4N3OA 4JI0E 4JI4E 1RQ0A 4P52A 3PRYA 4LF7E 4X65E 3ZKDA 4JI5I 5FLXC 1FWKA 4DR4I 4LFBI 4LFCI 5LL6R 5LMNI 2LBSB 2E5LI 5IWAI 4P78A 2MC5A 4LF5I 4FWHA 2HKJA 4X62E 1IBLE 5ADZA 4JI3I 4R8OA 2Q2EB 4JV5E 4GEQB 4LF6I 4YY3E 4I3HA 5CFFE 3B8HA 4B3MI 4JI6E 3T1YI 3ZZ0A 4AQYE 2BM1A 2Z5CB 4HYMA 3IWBA 1O0WA 2FV4B 3ZOQB 4DR6E 1HR0E 2B9DA 2M7QA 2A2DA 4B3RE 2GQ0A 3WU6A 1A6FA 1Z0EA 2UXDI 2V2VA 3PYFA 4DPTA 4IZKB 3ZKBA 2CZ9A 4DV5I 5AE1A 4YHHE 1FI4A 2CGEA 5A2QQ 4OX9E 1Z0WA 2JY9A 2RSMA 1IBKE 1WXRA 1Z5CA 1Z0CA 4GKKI 2L2MA 1X49A 3IWCA 1PIEA 2F8BA 1N32I 4LU9A 1XMOI 2NUEA 3WU4A 4UT4A 2KOUA 2V85A 1D6TA 4DV6I 3HXLA 2VF1A 2L92A 2UUCE 1QZRA 4F9CB 2V87A 3FIGA 2ZM6I 5DNYA 2E1RA 2Z5EA 3H4LA 1YZ9A 2V86A 3QT7A 4HY1A 1N34E 3OTOE 1ZBTA 1ZXMA 2DB2A 4NXME 1T4LB 2IHR1 1GZ6A 4XTJA 2DIXA 2UUAE 1Z5BA 1N33E 3H09A 3QT8A 2ZBKB 1B63A 3J7AM 4LF8E 2XEXA 2YT4A 4DV4I 3HQ1A 2JR1A 4DR1E 3VYYA 2UXBI 4JYAI 3P06A 2NUFA 1IBMI 4OOGC 2HHHI 2LRSA 4DPXA 4DV3E 4WSPA 4DV1E 4M2ZA 4PRVA 1H7SA 3LTOA 1KVKA 4RPFA 1EI1A 4LF9I 4DV0I 2V2ZA 4JI8I 1N0VC 2X7IA 1IBME 4JI1E 1Y4SA 1T4NA 3K6QA 4LFAI 4F9BB 3B82A 4MYUA 4JI0I 4JI4I 1QU6A 1DARA 4LF7I 4X65I 4DUZE 4IZJB 4X66E 4WUBA 2WZOA 4LF4E 1RREA 3ADIA 2X36A 3LMLA 1Z59A 4HACB 2UU9E 1HNZE 2EWLA 4X62I 3GONA 1IBLI 2Z5CA 1KIJA 2VE7C 4JV5I 1ZM4A 2V34A 4LTYA 4YY3I 5AE2A 3J80Q 4JI6I 2ODRD 4IZKA 4AQYI 3ADLA 4BBYA 2IOPA 2K4VA 4DV2E 3ADJA 2RS6A 4DV7E 1UHZA 4NXNE 2L33A 1DI2A 5T6JA 1MU5A 4Z7CA 1HR0I 4DR6I 4B3SI 1GQEA 4B3RI 2HKEA 4JI7E 5BR8E 1ZXNA 3V5RA 3WU3A 1XMQI 3P1XA 4DR3E 4YHHI 1I94E 4Z7YA 3B78A 4OX9I 4B3SE 1IBKI 3F6GA 3JTZA 4ED4A 3C4BA 1J5EE 4PU9A 3M6AA 1XMQE 5F3WA 5FLXQ 2LMZA 1NHHA 4WUCA 1ZM3A 1KKHA 3DJWA 2M1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI2 A;  2UXC E;  2UUC I;  1YYO A;  1PKP A;  5IT9 C;  1FJG E;  5LMU I;  1N34 I;  1J26 A;  3OTO I;  4NXM I;  4JG4 A;  1EA6 A;  1NHJ A;  4ZVI A;  4DUY I;  2N3G A;  2UUA I;  2V2Q A;  1N33 I;  3LLH A;  4DU7 A;  1NZ0 A;  4LF8 I;  5LMU E;  3K1J A;  4DR1 I;  1T4O A;  1KTV A;  4URL A;  2L3J A;  4DUY E;  4HXZ A;  2DEI A;  4DV3 I;  4DV1 I;  3QT5 A;  2R3V A;  1XHK A;  1UIL A;  3J81 C;  4JI1 I;  1YYK A;  1NHI A;  3JAM C;  2MDR A;  1S16 A;  2LJP A;  4HAC A;  3J7Y p;  1WHN A;  1HNX E;  1YYW A;  1H72 C;  4DUZ I;  1UEK A;  2LTR A;  4X66 I;  4X64 E;  3PYE A;  4LF4 I;  3HTX A;  4WYQ B;  1EKZ A;  2JVA A;  2UU9 I;  1HNZ I;  2B7T A;  2LUQ A;  1OJ4 A;  4FWG A;  4JI2 E;  2HFS A;  1ZM2 A;  3K17 A;  4KHP E;  1XNR E;  3QT6 A;  4DR2 I;  2UUB E;  1FWL A;  1Z0T A;  4DV2 I;  4DV7 I;  4NXN I;  2RTX A;  3JAM Q;  2KHX A;  4JI7 I;  5BR8 I;  2N3H A;  4DR2 E;  3F0N A;  2F4V E;  2GS8 A;  3D4J A;  3T1H E;  4USK A;  4DR3 I;  4DPU A;  1I94 I;  4GKJ E;  3Q1Q A;  4DXL A;  1Z0B A;  2A2C A;  1J5E I;  3ADG A;  2WW4 A;  2HK3 A;  2VQF E;  3C4T A;  2L2N A;  4B3T E;  5A2Q C;  1WHQ A;  4DU8 A;  2VQE E;  4UTG A;  1HNW E;  4MYT A;  3ZZT A;  4JI5 E;  4X8W A;  2UXC I;  2LUP B;  2B7V A;  4DR4 E;  1Z5A A;  4LFB E;  4LFC E;  1N0U A;  5LMN E;  2E5L E;  1H73 A;  1STU A;  5IWA E;  1FJG I;  2RS7 A;  4FW9 A;  4M1K A;  2DEJ A;  4LF5 E;  4K0K I;  4JI3 E;  1X48 A;  3ZM7 A;  3CWV A;  4P7A A;  4M30 A;  4LF6 E;  1VIS A;  3ZZU A;  4B3M E;  1ZM9 A;  4EMD A;  4WFT A;  1B62 A;  3T1Y E;  1FKA E;  4K0K E;  4FN5 A;  2L2K B;  3VYX A;  2NPF A;  4DKK A;  1RR9 A;  1ELO A;  2UXD E;  1S4E A;  1WUU A;  4DR7 I;  3J7A G;  1U2R A;  4DV5 E;  2ZIT A;  2EZ6 A;  2NUG A;  4USM A;  1RC7 A;  2DMY A;  4GKK E;  1HNX I;  2B3T B;  4DR7 E;  2J7K A;  4KQV A;  1BKN A;  1N32 E;  4X64 I;  1XMO E;  5IT9 Q;  1Z0G A;  4R1F A;  1N36 I;  3LNU A;  4DV6 E;  2LTS A;  4DPW A;  2NA2 A;  2EFG A;  4DR5 I;  2HFU A;  1FNM A;  4PRX A;  2ZM6 E;  4FWD A;  1XNQ I;  4JI2 I;  1N36 E;  4KHP I;  1XNR I;  2BV3 A;  5GMD A;  1X47 A;  3PYD A;  2UUB I;  4DR5 E;  1H74 A;  1Z0V A;  3HUL A;  2V8P A;  1PVG A;  3PYG A;  4DV4 E;  4DPY A;  2CPN A;  1XNQ E;  3J80 C;  1MX0 A;  2UXB E;  2F4V I;  4JYA E;  3T1H I;  2AJ4 A;  1H7U A;  2VF3 A;  3WU5 A;  3J81 Q;  4GKJ I;  2HHH E;  1MG7 A;  3LPS A;  2L3C A;  2R42 A;  4LF9 E;  4WUD A;  4DV0 E;  2LJH A;  2VQF I;  4JI8 E;  4B3T I;  1K47 A;  2HK2 A;  5GME A;  2BM0 A;  2VQE I;  4LFA E;  5L3J A;  1HNW I;  3V2U C;  4JI0 E;  4JI4 E;  1RQ0 A;  4P52 A;  4LF7 E;  4X65 E;  3ZKD A;  4JI5 I;  5FLX C;  1FWK A;  4DR4 I;  4LFB I;  4LFC I;  5LL6 R;  5LMN I;  2LBS B;  2E5L I;  5IWA I;  4LF5 I;  4FWH A;  2HKJ A;  4X62 E;  1IBL E;  4JI3 I;  2Q2E B;  4JV5 E;  4LF6 I;  4YY3 E;  4I3H A;  5CFF E;  3B8H A;  4B3M I;  4JI6 E;  3T1Y I;  3ZZ0 A;  4AQY E;  2BM1 A;  4HYM A;  1O0W A;  4DR6 E;  1HR0 E;  2A2D A;  4B3R E;  3WU6 A;  1A6F A;  1Z0E A;  2UXD I;  2V2V A;  3PYF A;  4DPT A;  3ZKB A;  2CZ9 A;  4DV5 I;  4YHH E;  1FI4 A;  5A2Q Q;  4OX9 E;  1Z0W A;  2JY9 A;  2RSM A;  1IBK E;  1Z5C A;  1Z0C A;  4GKK I;  2L2M A;  1X49 A;  1PIE A;  1N32 I;  1XMO I;  2NUE A;  3WU4 A;  4UT4 A;  1D6T A;  4DV6 I;  2UUC E;  1QZR A;  2ZM6 I;  2E1R A;  3QT7 A;  3H4L A;  1YZ9 A;  4HY1 A;  1N34 E;  3OTO E;  1ZBT A;  1ZXM A;  2DB2 A;  4NXM E;  1T4L B;  2IHR 1;  4XTJ A;  2DIX A;  2UUA E;  1Z5B A;  1N33 E;  3QT8 A;  2ZBK B;  1B63 A;  3J7A M;  4LF8 E;  2XEX A;  2YT4 A;  4DV4 I;  4DR1 E;  3VYY A;  2UXB I;  4JYA I;  2NUF A;  1IBM I;  4OOG C;  2HHH I;  2LRS A;  4DPX A;  4DV3 E;  4DV1 E;  4M2Z A;  4PRV A;  1H7S A;  3LTO A;  1KVK A;  4RPF A;  1EI1 A;  4LF9 I;  4DV0 I;  2V2Z A;  4JI8 I;  1N0V C;  2X7I A;  1IBM E;  4JI1 E;  1T4N A;  4LFA I;  3B82 A;  4MYU A;  4JI0 I;  4JI4 I;  1QU6 A;  1DAR A;  4LF7 I;  4X65 I;  4DUZ E;  4X66 E;  4WUB A;  4LF4 E;  1RRE A;  3ADI A;  2X36 A;  1Z59 A;  4HAC B;  2UU9 E;  1HNZ E;  4X62 I;  3GON A;  1IBL I;  1KIJ A;  4JV5 I;  1ZM4 A;  2V34 A;  4YY3 I;  3J80 Q;  4JI6 I;  4AQY I;  3ADL A;  4DV2 E;  3ADJ A;  2RS6 A;  4DV7 E;  1UHZ A;  4NXN E;  2L33 A;  1DI2 A;  1MU5 A;  4Z7C A;  1HR0 I;  4DR6 I;  4B3S I;  1GQE A;  4B3R I;  2HKE A;  4JI7 E;  5BR8 E;  1ZXN A;  3V5R A;  3WU3 A;  1XMQ I;  3P1X A;  4DR3 E;  4YHH I;  1I94 E;  4Z7Y A;  3B78 A;  4OX9 I;  4B3S E;  1IBK I;  4ED4 A;  3C4B A;  1J5E E;  4PU9 A;  3M6A A;  1XMQ E;  5FLX Q;  1NHH A;  4WUC A;  1ZM3 A;  1KKH A; 
#chains in the Genus database with same CATH topology
 3JU0 A;  2OI2 A;  2JPA A;  1DQ3 A;  1SFE A;  3C6K A;  3DF6 A;  2UXC E;  2C37 B;  2UUC I;  1YYO A;  1PKP A;  2EM2 A;  2EOZ A;  4J3D A;  5IT9 C;  3IWD A;  1FJG E;  5LMU I;  2EN4 A;  1N34 I;  1J26 A;  3OTO I;  2EMZ A;  4NXM I;  4JG4 A;  2EM0 A;  2IER A;  2CSH A;  1EA6 A;  2LE2 A;  1NHJ A;  4ZVI A;  4DUY I;  2N3G A;  2UUA I;  1PDA A;  2V2Q A;  2EPK X;  3LLH A;  4R2S A;  4DU7 A;  1N33 I;  1NZ0 A;  2WNR B;  4LF8 I;  3PS2 A;  3AV0 A;  1AAY A;  2PO2 B;  5LMU E;  2V83 A;  3K1J A;  4DR1 I;  1T4O A;  4R03 A;  1JK2 A;  5A6B A;  1KTV A;  2HC5 A;  2ENC A;  5A6A A;  2Z5B B;  4URL A;  5JEA A;  2YTD A;  4WPY A;  2EMX A;  2L3J A;  4DUY E;  4HXZ A;  1YUI A;  3THN A;  4OO1 B;  2DEI A;  1SR9 A;  4NBQ A;  4OKG A;  1X3C A;  4MU4 A;  4DV3 I;  2JE6 A;  2YTQ A;  2DLQ A;  3C6M A;  4ZYE A;  5K36 F;  2E72 A;  1ZU1 A;  4DV1 I;  2BA1 D;  3RMP A;  3QT5 A;  3MHH C;  2R3V A;  2WBS A;  4IZJ A;  2O1W A;  1XHK A;  1UIL A;  1OYS A;  1Y6Z A;  5EKW A;  3J81 C;  2EL6 A;  3P76 A;  4JI1 I;  1YYK A;  2JEB B;  1NHI A;  3JAM C;  2MDR A;  1S16 A;  2LJP A;  2YRM A;  2L6M A;  3HKM A;  4OO1 E;  4IJD A;  1YHC A;  2PNL A;  2GO4 A;  4FW5 A;  4HAC A;  2LCE A;  1WHN A;  3J7Y p;  4R2D A;  1HNX E;  2VES A;  4QNK A;  1OYP A;  4BHC A;  2EOS A;  1YYW A;  4O43 A;  2EOQ A;  1H72 C;  2IES A;  2ODR C;  1BB8 A;  1UEK A;  4DUZ I;  2LTR A;  4X66 I;  4X64 E;  3PYE A;  4F6M A;  2EN7 A;  3L7Z B;  3F6H A;  4KZS A;  4LF4 I;  3HTX A;  3EPH A;  1WJP A;  3EPJ A;  5ELW A;  4N4R B;  4WYQ B;  2EL4 A;  1EKZ A;  2G7H A;  2BBG A;  2JVA A;  3EPK A;  2UU9 I;  4F54 A;  1HNZ I;  2BR2 B;  4LPF A;  5C0X C;  1NEI A;  2DRP A;  2RPC A;  4U3D A;  1ZAA C;  4IFD A;  2ADR A;  2B7T A;  4FW6 A;  2LUQ A;  5KL4 A;  1OJ4 A;  4R2E A;  2C38 A;  4DMI A;  4FWG A;  4R2P A;  4JI2 E;  2JOX A;  2M4I A;  2HFS A;  2V88 A;  4M0V A;  2MDG A;  1LLM C;  1ZM2 A;  2EPU A;  4KHP E;  2YTP A;  1XNR E;  3K17 A;  3QT6 A;  1UDO A;  3QT7 A;  5JEA F;  4DR2 I;  3OML A;  2EOH A;  1MGT A;  3MSW A;  2UUB E;  2NN6 A;  1FWL A;  1Z0T A;  3GLL A;  4DV2 I;  4DV7 I;  2N8X A;  4NXN I;  2DGC A;  2RTX A;  2EM8 A;  1R6L A;  3JAM Q;  2MC6 A;  2KHX A;  2EOY A;  2M9A A;  4JI7 I;  2EQ1 A;  2CVE A;  5IXM B;  2LJU A;  4F9A B;  1PJQ A;  5BR8 I;  2N3H A;  2EP3 A;  5DNX A;  1YPN A;  4DR2 E;  2MKN A;  2F4V E;  2GS8 A;  1XXE A;  3D4J A;  3T1H E;  3F0N A;  3M85 D;  4USK A;  4LCG A;  4DR3 I;  4DPU A;  1A1H A;  2YRK A;  1I94 I;  4GKJ E;  1OYR A;  2PO0 B;  3Q1Q A;  1X6E A;  4BC9 A;  2HGH A;  4DXL A;  1UDQ A;  1Z0B A;  5KL2 A;  2A2C A;  1J5E I;  4BS9 A;  3QG5 C;  4IFD D;  3ADG A;  2WW4 A;  2HK3 A;  2JOB A;  2VQF E;  3HJC A;  2ENA A;  3C4T A;  2L2N A;  4P7D A;  4B3T E;  5A2Q C;  2EM4 A;  3GME A;  1WHQ A;  4LCF A;  2YSP A;  4DU8 A;  2LV2 A;  2J65 A;  3VK6 A;  2VQE E;  4O5G A;  1USV A;  4UTG A;  1HNW E;  4LCH A;  2PRT A;  1EH8 A;  4IFD F;  4BC7 A;  4WX9 A;  4MYT A;  3ZZT A;  4JI5 E;  4X8W A;  2UXC I;  5AAS A;  2LUP B;  2B7V A;  2YZT A;  2O3Z A;  4DR4 E;  1Z5A A;  4LFB E;  1N3G A;  4LFC E;  1N0U A;  5LMN E;  2DMI A;  2WNR A;  2E5L E;  1X6F A;  1H73 A;  5LLQ A;  1STU A;  2EMA A;  5IWA E;  1T38 A;  2PO2 A;  1FJG I;  2RS7 A;  4BCA A;  5KL3 A;  4FW9 A;  2NN6 F;  2DEJ A;  4M1K A;  4LF5 E;  3EPL A;  4K0K I;  5DRP A;  2EMB A;  4JI3 E;  5C0X E;  2Z5B A;  1X48 A;  3ZM7 A;  4R2A A;  1Y4U A;  4ISA A;  3CWV A;  4P7A A;  4M30 A;  3KZZ A;  4LF6 E;  1YH8 A;  4OO1 A;  1VIS A;  3ZZU A;  4B3M E;  1ZM9 A;  1WRJ A;  4EMD A;  5AE3 A;  3PS1 A;  4GQU A;  3THO B;  4WFT A;  4IS1 C;  1B62 A;  3T1Y E;  3HPS A;  2V8Q B;  1FKA E;  3UHM A;  1UN6 B;  4K0K E;  2I9I A;  2R76 A;  1USU A;  4FN5 A;  2BA0 D;  2L2K B;  2EM7 A;  3VYX A;  5KL5 A;  2NPF A;  3CDJ A;  4DKK A;  1HK7 A;  3Q6M A;  1RR9 A;  1ELO A;  1UDN A;  2JEB A;  2YU8 A;  2UXD E;  2EML A;  3K85 A;  1S4E A;  1WUU A;  2EN2 A;  2YTO A;  4DR7 I;  2O1V A;  1TN9 A;  5K36 D;  3J7A G;  1U2R A;  4DV5 E;  2EL5 A;  2EN1 A;  2ZIT A;  4BA1 B;  3AUZ A;  5KL6 A;  2EZ6 A;  2NUG A;  2CG9 A;  4USM A;  3BGH A;  1RC7 A;  2E1M A;  2EPA A;  2IOQ A;  3M7N D;  2DMY A;  4GKK E;  1HNX I;  2KON A;  4LF9 I;  2B3T B;  4DR7 E;  2BR2 A;  2J7K A;  2EPC A;  2YSO A;  2O1U A;  4KQV A;  1BKN A;  5KL7 A;  2I13 A;  2EOE A;  1N32 E;  2Q8U A;  1ZBQ A;  4X64 I;  1XMO E;  5DRQ A;  2JT2 A;  5IT9 Q;  4F6N A;  1Z0G A;  1KJK A;  2GLI A;  4R1F A;  2EPO A;  1N36 I;  1EH6 A;  2EMF A;  4DV6 E;  3LNU A;  4I8O A;  2H36 X;  4WXC A;  2EMW A;  2PO1 B;  2LTS A;  4DPW A;  2NA2 A;  2WP8 A;  2EFG A;  4DR5 I;  2YTN A;  2YTG A;  1JK1 A;  2EQ0 A;  2HFU A;  1FNM A;  3HPZ A;  1B69 A;  4PRX A;  2ZM6 E;  4FWD A;  1XNQ I;  4JI2 I;  2DSY A;  2EOJ A;  2GPI A;  1N36 E;  3KRN A;  5A6B D;  2LT7 A;  2L8T A;  2BV3 A;  5GMD A;  1XNR I;  1X47 A;  4KHP I;  2JEA A;  3Q6N A;  5JEA D;  3PYD A;  2UUB I;  4DR5 E;  2EOR A;  4Q28 A;  1H74 A;  3KWR A;  1Z0V A;  3HUL A;  1IMU A;  2V8P A;  2PNM A;  3TQM A;  1PVG A;  3BF2 A;  4FW3 A;  4QNJ A;  3PYG A;  1X5W A;  2FGG A;  4DV4 E;  4DPY A;  1PJT A;  2CPN A;  2V89 A;  3J80 C;  4ZYD A;  1XNQ E;  2WCC 3;  1MX0 A;  4BMJ A;  4X9J A;  2UXB E;  2F4V I;  4JYA E;  4IZJ D;  3T1H I;  2JWO A;  2AJ4 A;  2O1T A;  2FTX B;  1YFH A;  2K7I A;  1H7U A;  4TUI A;  3MHS C;  2VF3 A;  3WU5 A;  3J81 Q;  4GKJ I;  2HHH E;  2JE6 B;  2CTD A;  1MG7 A;  1PJS A;  1R6M A;  4J8Z A;  5FWK A;  4L5N C;  3LPS A;  4GZN C;  2L3C A;  5C0X A;  4BHB A;  2R42 A;  4LF9 E;  4WUD A;  4DV0 E;  2LJH A;  4TUG A;  2VQF I;  4JI8 E;  4B3T I;  1AH5 A;  2EMK A;  4L8N A;  2RQL A;  2EMH A;  1K47 A;  2HK2 A;  2BM0 A;  5GME A;  2VQE I;  5A69 A;  4LFA E;  1P47 A;  2MKD A;  5L3J A;  1Y60 A;  2EOF A;  2CT1 A;  1QNT A;  2YTF A;  3V2U C;  1HNW I;  4N3O A;  4JI0 E;  4JI4 E;  1RQ0 A;  4P52 A;  3PRY A;  3U1K A;  4AM3 A;  3L00 A;  2EJ4 A;  4WSG A;  4X65 E;  4LF7 E;  3ZKD A;  4JI5 I;  5FLX C;  2C37 A;  1FWK A;  2EMC A;  1YSA C;  4DR4 I;  1TF3 A;  4LFB I;  4LFC I;  5LL6 R;  5LMN I;  2LBS B;  2E5L I;  4Q35 B;  2RSI A;  5A6K A;  4P78 A;  5IWA I;  2JYA A;  2EM6 A;  2MC5 A;  4LF5 I;  4FWH A;  2ENH A;  2HKJ A;  2NN6 D;  4X62 E;  1IBL E;  4MU1 A;  3BBG A;  5ADZ A;  4JI3 I;  4IFD B;  4R8O A;  5K36 C;  4R2Q A;  1X6H A;  2Q2E B;  1T39 A;  2C38 B;  2EMY A;  1F2I G;  4JV5 E;  4GEQ B;  2EN8 A;  4LF6 I;  1A1G A;  2YRH A;  4YY3 E;  4I3H A;  5CFF E;  3B8H A;  4B3M I;  4RH8 A;  4JI6 E;  4NZV A;  5C0X D;  2EN6 A;  4IS9 A;  3T1Y I;  3ZZ0 A;  4AQY E;  2NN6 B;  2BM1 A;  3M7N G;  5TSE A;  1L4S A;  2Z5C B;  4HYM A;  3IWB A;  4BA1 A;  1O0W A;  2FV4 B;  3ZOQ B;  4F2J C;  1HR0 E;  4DR6 E;  2LVH A;  5EL9 A;  2B9D A;  2M7Q A;  2A2D A;  5A6J A;  4B3R E;  2BA1 G;  2C39 B;  2GQ0 A;  2EN3 A;  1A6F A;  3CDI A;  1Z0E A;  3WU6 A;  2UXD I;  5C0X F;  2V2V A;  3P3G A;  3PYF A;  2YWQ A;  1ZR9 A;  1YUJ A;  2YU5 A;  4IZK B;  4DPT A;  4AID A;  2EOO A;  3ZKB A;  2CZ9 A;  4DV5 I;  4U3B A;  5AE1 A;  4YHH E;  1FI4 A;  2BB8 A;  2CGE A;  5A2Q Q;  2YTE A;  4FK5 C;  4MLV A;  2GO3 A;  4OX9 E;  1Z0W A;  2JY9 A;  2RSM A;  1IBK E;  1WXR A;  2J7J A;  4RHB B;  1G2F C;  1Z0C A;  1Z5C A;  4GKK I;  1IQS A;  2L2M A;  1X49 A;  2EQ3 A;  4BA2 B;  3IWC A;  2R1F A;  1A1K A;  1PIE A;  4FW7 A;  2PNZ B;  2PO1 A;  1A1L A;  2ELY A;  2F8B A;  2EMG A;  2EOI A;  1TF6 A;  3GCM A;  4OZE A;  5JEA C;  4MU3 A;  2EE8 A;  1N32 I;  4LU9 A;  1XMO I;  3L7Z A;  2NUE A;  3WU4 A;  4UT4 A;  2KOU A;  2EPR A;  2EPL X;  2V85 A;  1D6T A;  4DV6 I;  1BBG A;  2WBT A;  5DRO A;  3HXL A;  2VF1 A;  2L92 A;  5K36 B;  4O4K A;  2UUC E;  1QZR A;  5DRR A;  4F9C B;  4OO1 D;  3DD6 A;  2V87 A;  3FIG A;  2ZM6 I;  4O24 A;  5DNY A;  3UK3 C;  1RHY A;  1YZ9 A;  2V86 A;  2E1R A;  2Z5E A;  3H4L A;  1N34 E;  4HY1 A;  3OTO E;  1ZBT A;  1BBO A;  1ZXM A;  2DB2 A;  4NXM E;  1T4L B;  2IHR 1;  1A1F A;  2AE8 A;  2JP9 A;  1GZ6 A;  4XTJ A;  2DIX A;  1GTK A;  2UUA E;  5K36 E;  1Z5B A;  1N33 E;  3H09 A;  3QT8 A;  4OO1 F;  2ZBK B;  1B63 A;  3J7A M;  4LF8 E;  2LO3 A;  2XEX A;  3M85 G;  2YT4 A;  3ECR A;  4FW4 A;  4DV4 I;  2EOM A;  3HQ1 A;  2JR1 A;  1KYQ A;  4DR1 E;  3VYY A;  2EM9 A;  2EOX A;  5DNL A;  2UXB I;  3EQ1 A;  1Z1B A;  4JYA I;  3P06 A;  4IFD C;  2NUF A;  1IBM I;  1E3H A;  4MU0 A;  4OOG C;  2HHH I;  2LRS A;  4DPX A;  2PO0 A;  4DV3 E;  2VRD A;  4WSP A;  3P3C A;  3VHT B;  4HEI A;  4DV1 E;  4M2Z A;  4PRV A;  2NAB A;  1H7S A;  3LTO A;  1KVK A;  1UDS A;  4RPF A;  2A25 A;  1EI1 A;  2EM3 A;  1VI7 A;  2NN6 C;  1UBD C;  2V2Z A;  4JI8 I;  5JEA B;  1N0V C;  4MLQ A;  2X7I A;  4DV0 I;  1IBM E;  4JI1 E;  1Y4S A;  1T4N A;  5AC5 A;  3K6Q A;  4LFA I;  2EM5 A;  4F9B B;  3B82 A;  5IV8 B;  4MYU A;  4JI0 I;  4JI4 I;  1QU6 A;  4ZYH A;  2WBU A;  1DAR A;  4LF7 I;  4X65 I;  4DUZ E;  5AC4 A;  1MEY C;  4IZJ B;  2JXP A;  4X66 E;  4WUB A;  4R2R A;  5JEA E;  2WZO A;  4LF4 E;  1RRE A;  3ADI A;  4M9V C;  2X36 A;  4KWY A;  3LML A;  1Z59 A;  4HAC B;  2UU9 E;  2EPZ A;  1HNZ E;  3PS3 A;  2EWL A;  2WP8 B;  4X62 I;  3GON A;  1IBL I;  1P42 A;  2Z5C A;  2EMI A;  2YTJ A;  1KIJ A;  2VE7 C;  1DGC A;  1RMD A;  4JV5 I;  1E3P A;  2ELZ A;  4LTY A;  1ZM4 A;  2V34 A;  4MDT A;  2C39 A;  4YY3 I;  5AE2 A;  2BA0 G;  3J80 Q;  4ZYG A;  3H1C A;  4JI6 I;  2D9H A;  2JEA B;  2ODR D;  1A1J A;  4IZK A;  4AIM A;  4AQY I;  3ADL A;  4BBY A;  2IOP A;  2K4V A;  3M99 B;  4DV2 E;  3ADJ A;  2RS6 A;  4DV7 E;  1UHZ A;  4NXN E;  2L33 A;  1DI2 A;  5T6J A;  1MU5 A;  4Z7C A;  1HR0 I;  4DR6 I;  4B3S I;  1GQE A;  3BID A;  3B4T A;  4B3R I;  2HKE A;  4JI7 E;  5BR8 E;  1ZXN A;  1NCS A;  3V5R A;  3WU3 A;  1XMQ I;  2YPN A;  4BA2 A;  3P1X A;  2PNZ A;  1IQO A;  4DR3 E;  4YHH I;  1I94 E;  1G2D C;  4R2C A;  4IFD E;  4Z7Y A;  2F1D A;  3B78 A;  2EPP A;  4B3S E;  1IBK I;  3F6G A;  4OX9 I;  2EPM X;  3NZK A;  4OO1 C;  3JTZ A;  1Y5Y A;  3C4B A;  1J5E E;  3P3E A;  4WXD A;  4PU9 A;  3M6A A;  3U1Y A;  4ED4 A;  5C0X B;  4HTG A;  1XMQ E;  5F3W A;  2EPX A;  3KZY A;  2EPN A;  5K36 A;  2HJJ A;  2LMZ A;  5FLX Q;  1NHH A;  2YTI A;  2NN6 E;  4WUC A;  4NHR A;  2DLK A;  1KKH A;  1ZM3 A;  3DJW A;  4LOM A;  1EH7 A;  2M1S A;  4MQY A;  1A1I A;  2GHF A; 
#chains in the Genus database with same CATH homology
 3JU0 A;  2OI2 A;  1DQ3 A;  3DF6 A;  2UXC E;  2UUC I;  1YYO A;  1PKP A;  5IT9 C;  3IWD A;  1FJG E;  5LMU I;  1N34 I;  1J26 A;  3OTO I;  4NXM I;  4JG4 A;  1EA6 A;  1NHJ A;  2LE2 A;  4ZVI A;  4DUY I;  2N3G A;  2UUA I;  2V2Q A;  1N33 I;  3LLH A;  4DU7 A;  1NZ0 A;  4LF8 I;  3AV0 A;  5LMU E;  2V83 A;  3K1J A;  4DR1 I;  1T4O A;  4R03 A;  1KTV A;  4URL A;  2Z5B B;  4WPY A;  2L3J A;  4DUY E;  4HXZ A;  2DEI A;  1SR9 A;  4DV3 I;  4DV1 I;  3RMP A;  3QT5 A;  2R3V A;  4IZJ A;  2O1W A;  1XHK A;  1UIL A;  1Y6Z A;  3J81 C;  4JI1 I;  1YYK A;  1NHI A;  3JAM C;  2MDR A;  1S16 A;  2LJP A;  2L6M A;  2PNL A;  4HAC A;  1WHN A;  3J7Y p;  1HNX E;  1YYW A;  1H72 C;  4DUZ I;  2ODR C;  1UEK A;  2LTR A;  4X66 I;  4X64 E;  3PYE A;  4LF4 I;  3F6H A;  4KZS A;  3HTX A;  4WYQ B;  1EKZ A;  2G7H A;  2JVA A;  2UU9 I;  4F54 A;  1HNZ I;  2B7T A;  2LUQ A;  1OJ4 A;  4DMI A;  4FWG A;  4JI2 E;  2JOX A;  2M4I A;  2HFS A;  2V88 A;  4M0V A;  1ZM2 A;  3K17 A;  4KHP E;  1XNR E;  3QT6 A;  4DR2 I;  3OML A;  3MSW A;  2UUB E;  1FWL A;  1Z0T A;  4DV2 I;  4DV7 I;  4NXN I;  2RTX A;  3JAM Q;  2MC6 A;  2KHX A;  4JI7 I;  5BR8 I;  4F9A B;  2N3H A;  4DR2 E;  3F0N A;  2F4V E;  2GS8 A;  3D4J A;  3T1H E;  4USK A;  4DR3 I;  4DPU A;  1I94 I;  4GKJ E;  3Q1Q A;  4BC9 A;  4DXL A;  1Z0B A;  2A2C A;  1J5E I;  4BS9 A;  3ADG A;  2WW4 A;  2HK3 A;  2JOB A;  2VQF E;  3HJC A;  3C4T A;  2L2N A;  4P7D A;  4B3T E;  5A2Q C;  1WHQ A;  4DU8 A;  3VK6 A;  2VQE E;  1USV A;  4UTG A;  1HNW E;  4BC7 A;  4MYT A;  3ZZT A;  4JI5 E;  4X8W A;  2UXC I;  5AAS A;  2LUP B;  2B7V A;  2YZT A;  4DR4 E;  1Z5A A;  4LFB E;  4LFC E;  1N0U A;  5LMN E;  2E5L E;  1H73 A;  1STU A;  5IWA E;  1FJG I;  2RS7 A;  4BCA A;  4FW9 A;  4M1K A;  2DEJ A;  4LF5 E;  4K0K I;  4JI3 E;  2Z5B A;  1X48 A;  3ZM7 A;  1Y4U A;  3CWV A;  4P7A A;  4M30 A;  4LF6 E;  1VIS A;  3ZZU A;  4B3M E;  1ZM9 A;  4EMD A;  5AE3 A;  4WFT A;  1B62 A;  3T1Y E;  3HPS A;  2V8Q B;  1FKA E;  4K0K E;  1USU A;  4FN5 A;  2L2K B;  3VYX A;  2NPF A;  4DKK A;  1HK7 A;  3Q6M A;  1RR9 A;  1ELO A;  2UXD E;  3K85 A;  1S4E A;  1WUU A;  4DR7 I;  2O1V A;  3J7A G;  1U2R A;  4DV5 E;  2ZIT A;  3AUZ A;  2EZ6 A;  2NUG A;  2CG9 A;  4USM A;  1RC7 A;  2E1M A;  2IOQ A;  2DMY A;  4GKK E;  1HNX I;  2KON A;  2B3T B;  4DR7 E;  2J7K A;  2O1U A;  4KQV A;  1BKN A;  1N32 E;  4X64 I;  1ZBQ A;  1XMO E;  5IT9 Q;  1Z0G A;  4R1F A;  1N36 I;  3LNU A;  4DV6 E;  4I8O A;  2H36 X;  2LTS A;  4DPW A;  2NA2 A;  2EFG A;  4DR5 I;  2HFU A;  1FNM A;  3HPZ A;  4PRX A;  2ZM6 E;  4FWD A;  1XNQ I;  4JI2 I;  2DSY A;  1N36 E;  4KHP I;  1XNR I;  2L8T A;  2BV3 A;  5GMD A;  1X47 A;  3Q6N A;  3PYD A;  2UUB I;  4DR5 E;  4Q28 A;  1H74 A;  3KWR A;  1Z0V A;  3HUL A;  2V8P A;  2PNM A;  1PVG A;  3PYG A;  2FGG A;  4DV4 E;  4DPY A;  2CPN A;  2V89 A;  3J80 C;  1XNQ E;  1MX0 A;  4BMJ A;  2UXB E;  2F4V I;  4JYA E;  4IZJ D;  3T1H I;  2JWO A;  2AJ4 A;  2O1T A;  2FTX B;  1H7U A;  4TUI A;  2VF3 A;  3WU5 A;  3J81 Q;  4GKJ I;  2HHH E;  1MG7 A;  5FWK A;  4J8Z A;  4L5N C;  3LPS A;  2L3C A;  2R42 A;  4LF9 E;  4WUD A;  4DV0 E;  2LJH A;  4TUG A;  2VQF I;  4JI8 E;  4B3T I;  4L8N A;  1K47 A;  2HK2 A;  5GME A;  2BM0 A;  2VQE I;  4LFA E;  5L3J A;  1HNW I;  3V2U C;  4N3O A;  4JI0 E;  4JI4 E;  1RQ0 A;  4P52 A;  3PRY A;  4LF7 E;  4X65 E;  3ZKD A;  4JI5 I;  5FLX C;  1FWK A;  4DR4 I;  4LFB I;  4LFC I;  5LL6 R;  5LMN I;  2LBS B;  2E5L I;  5IWA I;  4P78 A;  2MC5 A;  4LF5 I;  4FWH A;  2HKJ A;  4X62 E;  1IBL E;  5ADZ A;  4JI3 I;  4R8O A;  2Q2E B;  4JV5 E;  4GEQ B;  4LF6 I;  4YY3 E;  4I3H A;  5CFF E;  3B8H A;  4B3M I;  4JI6 E;  3T1Y I;  3ZZ0 A;  4AQY E;  2BM1 A;  2Z5C B;  4HYM A;  3IWB A;  1O0W A;  2FV4 B;  3ZOQ B;  4DR6 E;  1HR0 E;  2B9D A;  2M7Q A;  2A2D A;  4B3R E;  2GQ0 A;  3WU6 A;  1A6F A;  1Z0E A;  2UXD I;  2V2V A;  3PYF A;  4DPT A;  4IZK B;  3ZKB A;  2CZ9 A;  4DV5 I;  5AE1 A;  4YHH E;  1FI4 A;  2CGE A;  5A2Q Q;  4OX9 E;  1Z0W A;  2JY9 A;  2RSM A;  1IBK E;  1WXR A;  1Z5C A;  1Z0C A;  4GKK I;  2L2M A;  1X49 A;  3IWC A;  1PIE A;  2F8B A;  1N32 I;  4LU9 A;  1XMO I;  2NUE A;  3WU4 A;  4UT4 A;  2KOU A;  2V85 A;  1D6T A;  4DV6 I;  3HXL A;  2VF1 A;  2L92 A;  2UUC E;  1QZR A;  4F9C B;  2V87 A;  3FIG A;  2ZM6 I;  5DNY A;  2E1R A;  2Z5E A;  3H4L A;  1YZ9 A;  2V86 A;  3QT7 A;  4HY1 A;  1N34 E;  3OTO E;  1ZBT A;  1ZXM A;  2DB2 A;  4NXM E;  1T4L B;  2IHR 1;  1GZ6 A;  4XTJ A;  2DIX A;  2UUA E;  1Z5B A;  1N33 E;  3H09 A;  3QT8 A;  2ZBK B;  1B63 A;  3J7A M;  4LF8 E;  2XEX A;  2YT4 A;  4DV4 I;  3HQ1 A;  2JR1 A;  4DR1 E;  3VYY A;  2UXB I;  4JYA I;  3P06 A;  2NUF A;  1IBM I;  4OOG C;  2HHH I;  2LRS A;  4DPX A;  4DV3 E;  4WSP A;  4DV1 E;  4M2Z A;  4PRV A;  1H7S A;  3LTO A;  1KVK A;  4RPF A;  1EI1 A;  4LF9 I;  4DV0 I;  2V2Z A;  4JI8 I;  1N0V C;  2X7I A;  1IBM E;  4JI1 E;  1Y4S A;  1T4N A;  3K6Q A;  4LFA I;  4F9B B;  3B82 A;  4MYU A;  4JI0 I;  4JI4 I;  1QU6 A;  1DAR A;  4LF7 I;  4X65 I;  4DUZ E;  4IZJ B;  4X66 E;  4WUB A;  2WZO A;  4LF4 E;  1RRE A;  3ADI A;  2X36 A;  3LML A;  1Z59 A;  4HAC B;  2UU9 E;  1HNZ E;  2EWL A;  4X62 I;  3GON A;  1IBL I;  2Z5C A;  1KIJ A;  2VE7 C;  4JV5 I;  1ZM4 A;  2V34 A;  4LTY A;  4YY3 I;  5AE2 A;  3J80 Q;  4JI6 I;  2ODR D;  4IZK A;  4AQY I;  3ADL A;  4BBY A;  2IOP A;  2K4V A;  4DV2 E;  3ADJ A;  2RS6 A;  4DV7 E;  1UHZ A;  4NXN E;  2L33 A;  1DI2 A;  5T6J A;  1MU5 A;  4Z7C A;  1HR0 I;  4DR6 I;  4B3S I;  1GQE A;  4B3R I;  2HKE A;  4JI7 E;  5BR8 E;  1ZXN A;  3V5R A;  3WU3 A;  1XMQ I;  3P1X A;  4DR3 E;  4YHH I;  1I94 E;  4Z7Y A;  3B78 A;  4OX9 I;  4B3S E;  1IBK I;  3F6G A;  3JTZ A;  4ED4 A;  3C4B A;  1J5E E;  4PU9 A;  3M6A A;  1XMQ E;  5F3W A;  5FLX Q;  2LMZ A;  1NHH A;  4WUC A;  1ZM3 A;  1KKH A;  3DJW A;  2M1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...