1FKAE

Structure of functionally activated small ribosomal subunit at 3.3 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
157
structure length
157
Chain Sequence
b'MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1fkaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1fkaE02
1YZ9A 1PVGA 4PRXA 4LF8E 1HR0I 4M30A 4JI8E 2CZ9A 1HNWE 2L2MA 2UXBI 2OI2A 4WUDA 1UEKA 1XMQI 1WHQA 2X36A 3J81C 2UUBE 1O0WA 1XNQI 1YYOA 4JG4A 2LUQA 4DV5I 2L3CA 3VYXA 2B3TB 1WHNA 3D4JA 2NUFA 4M1KA 4LFCE 4AQYE 3ZKBA 4DV1E 2VF3A 4HY1A 1Z5BA 2LTRA 1IBLI 1H72C 4DR3E 1J5EI 3HULA 2GS8A 3LLHA 4KHPI 1XNRI 4JI6E 5BR8I 4X65E 4K0KE 1B63A 1ZM2A 2UXCE 1GQEA 3VYYA 4B3MI 1ZBTA 2BM1A 1Z0VA 1T4OA 1N34E 4WFTA 5CFFE 3PYEA 1XMOI 4DXLA 2MDRA 2HFUA 4X64I 3K1JA 2X7IA 1H7SA 2IHR1 2UUAI 2EFGA 5GMEA 5A2QQ 1H74A 1PIEA 1K47A 3V5RA 2L2NA 2YT4A 3T1YE 3WU3A 4LF8I 3QT6A 4JI8I 2BM0A 5IWAE 1HNWI 1UHZA 1A6FA 2ZBKB 1IBME 2F4VI 1WUUA 4GKJI 1B62A 4LF5E 1X48A 4DR2E 3M6AA 2UUBI 2DMYA 3WU4A 3LNUA 4Z7YA 4AQYI 4DV1I 1NHIA 1U2RA 5GMDA 1RREA 4LF4I 4YHHE 2DEJA 4DV0E 2XEXA 2Q2EB 1FKAE 4DV4E 2UU9E 3JAMQ 2HHHE 3ZZUA 4PU9A 2LTSA 2VQFE 3WU6A 4X65I 4RPFA 1BKNA 3ZZ0A 4K0KI 2WW4A 4ED4A 4WYQB 2UXCI 2B7VA 1EI1A 4JI2E 1FNMA 2ZM6E 1ZM9A 2EZ6A 3CWVA 2V8PA 4FWHA 4ZVIA 1N34I 3C4TA 2UUCE 4PRVA 2R3VA 1Z59A 2E1RA 4DU7A 4JI1E 4DR1E 3QT5A 3OTOE 4LFBE 3T1YI 4JI0E 3WU5A 1X47A 4DR6E 4DR4E 3PYDA 4DPWA 2HKJA 5IWAI 3J81Q 3C4BA 4JYAE 4OX9E 3LTOA 2J7KA 1T4NA 2L3JA 4WUCA 4P7AA 4DV7I 2V2QA 2LJHA 1N0UA 4DR2I 4DUZE 2R42A 4FN5A 2V2VA 2NPFA 4DV6E 1N32E 1RR9A 3J7AM 1T4LB 4YHHI 4DV0I 4X66I 4DV4I 1J26A 1ELOA 4FWDA 1ZM4A 1HNXE 3B78A 4LF7E 1DI2A 1X49A 2NA2A 4HXZA 3J7Yp 1FJGE 4JI2I 2ZM6I 1FI4A 4NXNE 1KKHA 1EKZA 2UUCI 3T1HI 4XTJA 1NZ0A 1YYKA 4JI1I 4DR1I 4JI7E 4LFBI 4DR7E 4JI0I 1RC7A 4B3SE 2HFSA 4I3HA 4DR6I 4DR4I 2HK2A 4DPTA 3ADIA 2VQEE 4OX9I 4LF9E 2NUEA 1HNZE 1DARA 1Z0GA 4DV2E 4USKA 4LFCI 4LF6E 1PKPA 1FWKA 2UXBE 3ADJA 4DUZI 1ZXNA 4DR3I 2DB2A 4DV6I 2CPNA 5L3JA 4DPYA 1N32I 1EA6A 1N36E 1IBKE 4JI6I 4UT4A 1UILA 4NXME 1S16A 2A2DA 1ZXMA 1HNXI 4MYUA 1Z5AA 3ZKDA 1S4EA 5FLXC 5LMNE 1N33E 4JV5E 1H7UA 2N3GA 4DV3E 1KVKA 2HKEA 1XNRE 1FJGI 4NXNI 4HACB 2RSMA 4B3TE 4DU8A 3J80C 1Z0TA 4LFAE 1NHHA 2RS6A 1STUA 4DR7I 1QU6A 2A2CA 3PYGA 4B3SI 2AJ4A 1IBMI 5IT9C 4LF5I 2VQEI 4LF9I 1RQ0A 1HNZI 4EMDA 4DV2I 1XHKA 4P52A 4LF6I 5LMUE 1YYWA 1MX0A 3HTXA 2F4VE 4GKJE 2HK3A 3ZM7A 2UU9I 2HHHI 2LUPB 1N36I 4DPXA 2B7TA 1IBKI 2VQFI 4UTGA 4MYTA 2N3HA 1I94E 4NXMI 1H73A 4DR5E 4YY3E 2UXDE 4GKKE 2DIXA 4X62E 4LF4E 1MG7A 2L2KB 2E5LE 5LMNI 4DPUA 1N33I 3H4LA 4JV5I 3GONA 4DV3I 3ADLA 5LL6R 3ADGA 4DUYE 4JI5E 2L33A 4B3TI 4B3RE 4DKKA 3B8HA 4LFAI 3PYFA 1N0VC 4KQVA 3ZZTA 1NHJA 4JI4E 3OTOI 1OJ4A 1KTVA 1QZRA 4X8WA 4JI3E 2NUGA 1VISA 4JYAI 4FW9A 4USMA 1MU5A 4M2ZA 2LJPA 5A2QC 3LPSA 1HR0E 1ZM3A 2RTXA 2V2ZA 5LMUI 2LBSB 1Z0WA 1XMQE 4DV7E 1XNQE 2KHXA 4DV5E 3B82A 3Q1QA 2JY9A 4HYMA 1I94I 4LF7I 5FLXQ 1IBLE 4URLA 4DR5I 4YY3I 2UXDI 1J5EE 2BV3A 4GKKI 3J7AG 4X62I 4KHPE 4X66E 2E5LI 2RS7A 5BR8E 1Z5CA 3J80Q 3V2UC 3JAMC 4DUYI 4JI5I 4B3RI 1Z0CA 4Z7CA 4R1FA 4B3ME 4OOGC 1FWLA 3K17A 1KIJA 4JI7I 1XMOE 4JI4I 2V34A 4X64E 1Z0EA 2DEIA 3QT8A 2JVAA 5IT9Q 1D6TA 1Z0BA 2UUAE 2LRSA 4JI3I 4WUBA 3T1HE 4FWGA 3P1XA 3F0NA 2ZITA 4HACA 3QT7A
chains in the Genus database with same CATH superfamily
1YZ9A 1PVGA 1HK7A 4PRXA 4LF8E 1HR0I 4M30A 4JI8E 2EMYA 2CZ9A 1HNWE 2L2MA 2H36X 2UXBI 2WP8A 3C6KA 2OI2A 4LPFA 4RHBB 3L7ZA 2YPNA 2BBGA 5AE2A 1TF3A 1UEKA 5KL6A 4WUDA 1XMQI 1WHQA 2LCEA 2X36A 3P06A 3J81C 2GO3A 2YU8A 2UUBE 1O0WA 1XNQI 1YYOA 2A25A 4JG4A 2EM3A 2LUQA 2V89A 2YTNA 2L3CA 3VYXA 1F2IG 1WHNA 2B3TB 2IERA 2NUFA 3D4JA 4M1KA 3M85D 4LFCE 2EOJA 4AQYE 2KONA 3ZKBA 4DV1E 2EN3A 2VF3A 4HY1A 1Z5BA 4BA1B 2JEAA 2YTGA 2LTRA 1IBLI 1H72C 1ZR9A 2ODRD 4DR3E 1J5EI 3HULA 2EPUA 2EMGA 1Z1BA 2BA0G 1YH8A 5KL7A 2GS8A 3LLHA 2B9DA 4KHPI 4LU9A 4WX9A 4GEQB 3HKMA 1XNRI 4JI6E 5BR8I 3VHTB 2EMLA 2IESA 3AUZA 4X65E 2K7IA 4K0KE 2C38A 1B63A 1Y5YA 4MDTA 1ZM2A 2C39A 2UXCE 4OKGA 4BA2A 2F8BA 3PS2A 5DNXA 1GQEA 3AV0A 3VYYA 4B3MI 1T38A 1UDQA 2WZOA 4AIMA 1ZBTA 2BM1A 1Z0VA 1T4OA 2EOZA 4BC7A 1N34E 1JK2A 4WFTA 5CFFE 3PYEA 1XMOI 2DSYA 5JEAF 4MU3A 1NCSA 4DXLA 2MDRA 4NBQA 2EMXA 2HFUA 2ENCA 2J7JA 4R2RA 2PO0A 2X7IA 3K1JA 4X64I 1H7SA 2IHR1 5AASA 2UUAI 5C0XA 2N8XA 3TQMA 2JOBA 2EFGA 5JEAA 5GMEA 5A2QQ 1H74A 1PIEA 1K47A 3U1YA 3V5RA 2DRPA 4MU1A 2L2NA 4AM3A 2V85A 1GTKA 2YT4A 2L6MA 3T1YE 2O1TA 5C0XC 4BC9A 3F6GA 5JEAC 1WRJA 3WU3A 4AIDA 1VI7A 5JEAE 3QT6A 4JI8I 2EOXA 4J8ZA 2BM0A 5EKWA 5IWAE 1HNWI 2Z5EA 1UHZA 1A6FA 2ZBKB 1IBME 2YU5A 3PRYA 1PJSA 2EMKA 1WUUA 2JEBB 5DRPA 2F4VI 4GKJI 4BMJA 1B62A 4M9VC 4LF5E 2EE8A 3VK6A 1X48A 4OO1B 4DR2E 4F54A 4ISAA 1IQOA 3M6AA 2UUBI 4P78A 3DF6A 2DMYA 3WU4A 3LNUA 4Z7YA 2EPCA 5K36A 2BA0D 2EMBA 4AQYI 4BS9A 2IOPA 4DV1I 4IS1C 4I8OA 3EQ1A 2RSIA 1NHIA 4O24A 1U2RA 1RREA 4J3DA 5GMDA 4LF4I 4YHHE 2DEJA 4DV0E 2XEXA 2Q2EB 1FKAE 2EL6A 4DV4E 2UU9E 2Z5BA 2Z5CA 2HHHE 3JAMQ 5K36C 3GCMA 3ZZUA 4PU9A 2C37A 1SFEA 5DNLA 2LTSA 2RQLA 5A6KA 4L5NC 2EPRA 2VQFE 3WU6A 3M7NG 4OO1F 3Q6MA 3HPSA 2RPCA 1KYQA 1BKNA 4RPFA 3ZZ0A 2YRHA 4X65I 2WW4A 4K0KI 4ED4A 4BBYA 2YZTA 1E3HA 5DROA 4WYQB 2UXCI 2PO2A 2MKNA 5A6BA 3P3GA 1EH6A 3IWDA 2B7VA 3BIDA 2EMWA 1ZAAC 5KL4A 1EI1A 1N3GA 4JI2E 2ZM6E 1FNMA 2PO1B 2HC5A 1ZM9A 4GZNC 2EZ6A 2V8PA 3CWVA 4FWHA 4ZVIA 1N34I 3C4TA 4R2DA 2UUCE 2EQ1A 4PRVA 3CDIA 2EQ3A 4F9CB 4R2PA 4OO1E 1DQ3A 2NABA 2R3VA 1Z59A 3H09A 2E1RA 4DV5I 2EOEA 2EM7A 4LCFA 1Y4SA 1Y6ZA 2BR2A 4DU7A 5K36D 2EM0A 2HGHA 1R6MA 4JI1E 2ELZA 4DR1E 3QT5A 4LCGA 2EN4A 2MDGA 3OTOE 2WBSA 3EPLA 2I13A 1IMUA 2V83A 4WXCA 4LFBE 3GLLA 3L7ZB 4JI0E 2EORA 4N3OA 3T1YI 3Q6NA 1AAYA 3WU5A 1X47A 2JT2A 5IXMB 4DR6E 4DR4E 3PYDA 4DPWA 2HKJA 4IZJD 5IWAI 3J81Q 3C4BA 4JYAE 4OX9E 1Y4UA 3HQ1A 4R2CA 3LTOA 2J7KA 1T4NA 3HXLA 2L3JA 2YTQA 2GLIA 1USVA 4U3BA 2CT1A 4WUCA 1L4SA 4P7AA 4DV7I 2O1WA 2V2QA 4LOMA 3THNA 2LJHA 1N0UA 3B4TA 1MEYC 4TUIA 4DR2I 4IFDF 2PRTA 2EJ4A 2GQ0A 1KJKA 2PNZB 4U3DA 4DUZE 2EP3A 2R42A 4FN5A 2EPAA 2V2VA 2NPFA 4IFDA 2NN6D 4F6MA 4DV6E 5AC4A 1N32E 1RR9A 3J7AM 1T4LB 2C38B 4YHHI 3ZOQB 3M7ND 2WNRB 4DV0I 2EOHA 3MHSC 2C39B 4X66I 2IOQA 1A1KA 4DV4I 1J26A 1ELOA 4FWDA 2EN2A 1ZM4A 1X6FA 3KWRA 1HNXE 4IFDE 4KZSA 3B78A 3HPZA 4LF7E 2EMCA 1DI2A 4MU0A 4IJDA 1UDNA 1AH5A 1DGCA 1YHCA 2EPNA 1X49A 2NA2A 2ENAA 5ELWA 4X9JA 3BBGA 4HXZA 2YTPA 4RH8A 3J7Yp 1FJGE 4JI2I 2ZM6I 1FI4A 4NXNE 1KKHA 4BA1A 5DNYA 1EKZA 2G7HA 2EM5A 1TN9A 2UUCI 3PS1A 3T1HI 4R2EA 4ZYEA 4XTJA 4WSPA 2MKDA 2R76A 1NZ0A 1YYKA 1A1FA 2YRMA 2GO4A 4JI1I 4DR1I 4JI7E 2JP9A 4TUGA 2KOUA 1G2FC 4LFBI 2GHFA 4DR7E 4JI0I 4Q35B 1RC7A 1TF6A 1UBDC 4B3SE 1ZU1A 1UDOA 4R2SA 2HFSA 2YTFA 4I3HA 5IV8B 4DR6I 2MC5A 5AE1A 2HK2A 4DR4I 2EPPA 4DPTA 3ADIA 5K36B 2VQEE 4OX9I 4LF9E 3JTZA 2NUEA 2FV4B 2EPKX 2ADRA 1PJQA 2EOSA 2YSPA 3ECRA 5A69A 3KZZA 1HNZE 1DARA 1Z0GA 4DV2E 2R1FA 4USKA 1PJTA 2YTIA 2EPXA 4F6NA 4LFCI 4DMIA 4LF6E 4O43A 4QNKA 2FTXB 1PKPA 1FWKA 2Z5BB 2JWOA 4ZYHA 2UXBE 3ADJA 2EM8A 2DMIA 4HTGA 4IZJB 4DUZI 3P3CA 1ZXNA 5AE3A 4DR3I 2DB2A 4DV6I 2CPNA 4MU4A 4DPYA 5L3JA 4Q28A 5C0XD 2JXPA 1N32I 4LTYA 4MQYA 5JEAD 1EA6A 1N36E 4NHRA 4FW5A 4WXDA 1IBKE 4JI6I 4UT4A 1UILA 3NZKA 4NXME 1S16A 2JEBA 2FGGA 1ZXMA 2A2DA 1HNXI 4ZYDA 4MYUA 2LV2A 3RMPA 1Z5AA 1IQSA 3UHMA 4OO1A 4F9BB 2NN6B 3ZKDA 4FW6A 2LO3A 1S4EA 5FLXC 1OYPA 5LMNE 1N33E 2V8QB 1R6LA 4JV5E 1H7UA 2EMHA 2N3GA 1UN6B 4DV3E 1KVKA 2HKEA 1XNRE 2YSOA 1FJGI 1EH7A 1MGTA 1WJPA 1Y60A 4NXNI 4HACB 2MC6A 2RSMA 4B3TE 4OO1C 4F9AB 3UK3C 4DU8A 2EL4A 2L92A 2I9IA 3J80C 1P47A 1EH8A 1BBOA 1Z0TA 3CDJA 4LFAE 2EPLX 4BHCA 2L8TA 1NHHA 2WP8B 2M7QA 1UDSA 1YUIA 2NN6F 5ADZA 2RS6A 2EM4A 2VESA 1STUA 2BB8A 2EMFA 2M9AA 1A1GA 1QU6A 2A2CA 3PYGA 2ENHA 2YTOA 4B3SI 4DR7I 4R2QA 4L8NA 2YTDA 4GQUA 2CTDA 2AJ4A 2JR1A 1IBMI 3EPKA 1GZ6A 5IT9C 2PO1A 2JE6A 2EPZA 2JOXA 4LF5I 2VQEI 4LF9I 1RQ0A 1E3PA 4M0VA 2JEAB 1HNZI 2D9HA 4EMDA 5A6BD 2BA1G 3BF2A 4DV2I 1XHKA 2EWLA 2GPIA 2JYAA 2M1SA 1OYRA 4P52A 4IZKA 1A1HA 4LF6I 5LMUE 5LLQA 2EPOA 3FIGA 1YYWA 1MX0A 3HTXA 5T6JA 2EMAA 4P7DA 2EOQA 2F4VE 1PDAA 4GKJE 2WCC3 2HK3A 2DLKA 4FK5C 3H1CA 5A6AA 3ZM7A 2LMZA 2O1VA 2WBTA 5DRRA 3THOB 1JK1A 2UU9I 4BA2B 4ZYGA 2HHHI 2EOFA 2LUPB 1T39A 1N36I 4DPXA 1P42A 1LLMC 2B7TA 2AE8A 2PNMA 4HEIA 1IBKI 4IS9A 2VQFI 4UTGA 4IFDC 4MYTA 2N3HA 1I94E 4R2AA 1H73A 4NXMI 1B69A 3EPJA 2EMIA 2LT7A 4DR5E 4YY3E 1A1LA 2UXDE 5AC5A 4GKKE 2PO0B 2DIXA 2EOYA 4X62E 2VRDA 4LF4E 1MG7A 3IWCA 2L2KB 3EPHA 5C0XB 2E5LE 5LMNI 2O3ZA 4DPUA 5JEAB 1N33I 3BGHA 4R03A 3H4LA 2PNZA 3OMLA 3GONA 4DV3I 2V88A 4JV5I 3ADLA 5LL6R 3ADGA 4DUYE 4JI5E 2L33A 4B3TI 4B3RE 3F6HA 5KL3A 4DKKA 2WNRA 2YRKA 2EQ0A 1A1JA 2EL5A 3KRNA 4O4KA 1YFHA 2EN7A 1A1IA 2YWQA 3B8HA 4LFAI 3PYFA 1N0VC 4KQVA 3ZZTA 4IFDD 3M99B 1NHJA 2V87A 4JI4E 3OTOI 4WPYA 4O5GA 2JPAA 5C0XF 2EN8A 2DLQA 1YSAC 1X3CA 1OJ4A 1KTVA 1QZRA 2EM6A 4X8WA 2LE2A 4JI3E 2NUGA 1BB8A 1VISA 2J65A 2CSHA 2BA1D 4JYAI 4LF8I 4FW9A 2PNLA 1ZBQA 4USMA 2LJUA 3C6MA 1MU5A 4M2ZA 2CGEA 2LJPA 2EOMA 2VE7C 5A2QC 3LPSA 4MLQA 4NZVA 2ELYA 1HR0E 1ZM3A 3K6QA 3U1KA 2RTXA 2Z5CB 5C0XE 3P3EA 2WBUA 2V2ZA 1X6EA 1OYSA 2C37B 2CVEA 5LMUI 4MLVA 2LBSB 3LMLA 1Z0WA 2VF1A 1XMQE 4F2JC 5EL9A 1WXRA 4FW4A 2EM2A 2EMZA 3L00A 4DV7E 1XNQE 2DGCA 5K36F 2KHXA 2PO2B 2YTJA 4DV5E 3GMEA 3B82A 1G2DC 3Q1QA 2JY9A 4HYMA 2EOIA 1YPNA 1RMDA 1I94I 4N4RB 4LF7I 5FLXQ 4WSGA 1IBLE 2EM9A 4URLA 1USUA 4LCHA 4DR5I 4YY3I 2UXDI 1J5EE 2BV3A 2EN6A 2EPMX 3J7AG 4X62I 2K4VA 3M85G 4GKKI 4QNJA 1X6HA 4KHPE 2HJJA 4X66E 3DJWA 2E5LI 4R8OA 2BR2B 2LVHA 2RS7A 3KZYA 2M4IA 5BR8E 1RHYA 1QNTA 1Z5CA 4FW3A 3J80Q 3V2UC 5K36E 3IWBA 4IZJA 2E1MA 4OZEA 3JAMC 5KL2A 2O1UA 4DUYI 4JI5I 4BHBA 4B3RI 1Z0CA 4Z7CA 4FW7A 4R1FA 4B3ME 3MHHC 5KL5A 4KWYA 4OOGC 3DD6A 2EOOA 1YUJA 1NEIA 3QG5C 1FWLA 2CG9A 3K17A 5DRQA 2E72A 1KIJA 4JI7I 1XMOE 3K85A 4JI4I 2JE6B 2V34A 2EN1A 2V86A 3P76A 1BBGA 4X64E 1Z0EA 2YTEA 2DEIA 3QT8A 2NN6A 2JVAA 5IT9Q 1D6TA 1SR9A 1Z0BA 3MSWA 2UUAE 2LRSA 4JI3I 3PS3A 4WUBA 4BCAA 3T1HE 3JU0A 5TSEA 3QT7A 3P1XA 4FWGA 3F0NA 4IZKB 1XXEA 1X5WA 2F1DA 2ZITA 2Q8UA 5F3WA 5A6JA 2ODRC 4HACA 4IFDB 4OO1D 2NN6C 2NN6E 5FWKA 3HJCA
chains in the Genus database with same CATH topology
1YZ9A 1PVGA 1HK7A 4PRXA 4LF8E 1HR0I 4M30A 4JI8E 2CZ9A 1HNWE 2L2MA 2H36X 2UXBI 2OI2A 5AE2A 1UEKA 4WUDA 1XMQI 1WHQA 2X36A 3P06A 3J81C 2UUBE 1O0WA 1XNQI 1YYOA 4JG4A 2LUQA 2V89A 2L3CA 4DV5I 3VYXA 1WHNA 2B3TB 3D4JA 2NUFA 4M1KA 4LFCE 4AQYE 3ZKBA 2KONA 4DV1E 2VF3A 4HY1A 1Z5BA 2LTRA 1IBLI 1H72C 2ODRD 4DR3E 1J5EI 3HULA 2GS8A 3LLHA 2B9DA 4KHPI 4LU9A 4GEQB 1XNRI 4JI6E 5BR8I 3AUZA 4X65E 4K0KE 1B63A 1ZM2A 2UXCE 2F8BA 1GQEA 3AV0A 3VYYA 4B3MI 2WZOA 1ZBTA 2BM1A 1Z0VA 1T4OA 4BC7A 1N34E 4WFTA 5CFFE 3PYEA 1XMOI 2DSYA 4DXLA 2MDRA 2HFUA 4X64I 3K1JA 2X7IA 1H7SA 2IHR1 5AASA 2UUAI 2JOBA 2EFGA 5GMEA 5A2QQ 1H74A 1PIEA 1K47A 3V5RA 2L2NA 2V85A 2YT4A 2L6MA 3T1YE 2O1TA 4BC9A 3F6GA 3WU3A 4LF8I 3QT6A 4JI8I 4J8ZA 2BM0A 5IWAE 1HNWI 2Z5EA 1UHZA 1A6FA 2ZBKB 1IBME 3PRYA 2F4VI 1WUUA 4GKJI 4BMJA 1B62A 4LF5E 3VK6A 1X48A 4DR2E 4F54A 3M6AA 2UUBI 4P78A 3DF6A 2DMYA 3WU4A 3LNUA 4Z7YA 4AQYI 4BS9A 2IOPA 4DV1I 4I8OA 1NHIA 1U2RA 5GMDA 1RREA 4LF4I 4YHHE 2DEJA 4DV0E 2XEXA 2Q2EB 1FKAE 4DV4E 2UU9E 2Z5BA 2Z5CA 2HHHE 3JAMQ 3ZZUA 4PU9A 2LTSA 2VQFE 4L5NC 3WU6A 3Q6MA 3HPSA 4RPFA 1BKNA 3ZZ0A 4X65I 4K0KI 2WW4A 4ED4A 4BBYA 2YZTA 4WYQB 2UXCI 3IWDA 2B7VA 1EI1A 4JI2E 1FNMA 2ZM6E 1ZM9A 2EZ6A 3CWVA 2V8PA 4FWHA 4ZVIA 1N34I 3C4TA 2UUCE 4PRVA 4F9CB 1DQ3A 2R3VA 1Z59A 3H09A 2E1RA 1Y4SA 1Y6ZA 4DU7A 4JI1E 4DR1E 3QT5A 3OTOE 2V83A 4LFBE 3T1YI 4JI0E 4N3OA 3Q6NA 3WU5A 1X47A 4DR6E 4DR4E 3PYDA 4DPWA 2HKJA 4IZJD 5IWAI 3J81Q 3C4BA 4JYAE 4OX9E 1Y4UA 3HQ1A 3LTOA 2J7KA 1T4NA 3HXLA 2L3JA 1USVA 4WUCA 4P7AA 4DV7I 2O1WA 2V2QA 2LJHA 1N0UA 4TUIA 4DR2I 2GQ0A 4DUZE 2R42A 4FN5A 2V2VA 2NPFA 4DV6E 1N32E 1RR9A 3J7AM 1T4LB 4YHHI 3ZOQB 4DV0I 4X66I 2IOQA 4DV4I 1J26A 1ELOA 4FWDA 1ZM4A 1HNXE 3KWRA 4KZSA 3B78A 3HPZA 4LF7E 1DI2A 1X49A 2NA2A 4HXZA 3J7Yp 1FJGE 4JI2I 2ZM6I 1FI4A 4NXNE 1KKHA 5DNYA 1EKZA 2G7HA 2UUCI 3T1HI 4XTJA 4WSPA 1NZ0A 1YYKA 4JI1I 4DR1I 4JI7E 4TUGA 2KOUA 4LFBI 4DR7E 4JI0I 1RC7A 4B3SE 2HFSA 4I3HA 4DR6I 2MC5A 5AE1A 2HK2A 4DR4I 4DPTA 3ADIA 2VQEE 4OX9I 4LF9E 3JTZA 2NUEA 2FV4B 1HNZE 1DARA 1Z0GA 4DV2E 4USKA 4LFCI 4DMIA 4LF6E 2FTXB 1PKPA 1FWKA 2Z5BB 2JWOA 2UXBE 3ADJA 4DUZI 4IZJB 1ZXNA 5AE3A 4DR3I 2DB2A 4DV6I 2CPNA 5L3JA 4DPYA 1N32I 4Q28A 4LTYA 1EA6A 1N36E 1IBKE 4JI6I 4UT4A 1UILA 4NXME 1S16A 2FGGA 1ZXMA 2A2DA 1HNXI 4MYUA 3RMPA 1Z5AA 4F9BB 3ZKDA 1S4EA 5FLXC 5LMNE 1N33E 2V8QB 4JV5E 1H7UA 2N3GA 4DV3E 1KVKA 2HKEA 1XNRE 1FJGI 4NXNI 4HACB 2MC6A 2RSMA 4B3TE 4F9AB 4DU8A 2L92A 3J80C 1Z0TA 4LFAE 2L8TA 1NHHA 2M7QA 5ADZA 2RS6A 1STUA 4DR7I 1QU6A 2A2CA 3PYGA 4B3SI 4L8NA 2AJ4A 2JR1A 1IBMI 1GZ6A 5IT9C 2JOXA 4LF5I 2VQEI 4LF9I 1RQ0A 4M0VA 1HNZI 4EMDA 4DV2I 1XHKA 2EWLA 2M1SA 4P52A 4IZKA 4LF6I 5LMUE 3FIGA 1YYWA 1MX0A 3HTXA 5T6JA 4P7DA 2F4VE 4GKJE 2HK3A 3ZM7A 2LMZA 2O1VA 2UU9I 2HHHI 2LUPB 1N36I 4DPXA 2B7TA 2PNMA 1IBKI 2VQFI 4UTGA 4MYTA 2N3HA 1I94E 4NXMI 1H73A 4DR5E 4YY3E 2UXDE 4GKKE 2DIXA 4X62E 4LF4E 1MG7A 3IWCA 2L2KB 2E5LE 5LMNI 4DPUA 1N33I 4R03A 3H4LA 4JV5I 3GONA 3OMLA 4DV3I 2V88A 3ADLA 5LL6R 3ADGA 4DUYE 4JI5E 2L33A 4B3TI 4B3RE 3F6HA 4DKKA 3B8HA 4LFAI 3PYFA 1N0VC 4KQVA 3ZZTA 1NHJA 2V87A 4JI4E 3OTOI 4WPYA 1OJ4A 1KTVA 1QZRA 4X8WA 2LE2A 4JI3E 2NUGA 1VISA 4JYAI 4FW9A 2PNLA 1ZBQA 4USMA 1MU5A 4M2ZA 2CGEA 2LJPA 2VE7C 5A2QC 3LPSA 1HR0E 1ZM3A 3K6QA 2RTXA 2Z5CB 2V2ZA 5LMUI 2LBSB 3LMLA 1Z0WA 2VF1A 1XMQE 1WXRA 4DV7E 1XNQE 2KHXA 4DV5E 3B82A 3Q1QA 2JY9A 4HYMA 1I94I 4LF7I 5FLXQ 1IBLE 4URLA 1USUA 4DR5I 4YY3I 2UXDI 1J5EE 2BV3A 4GKKI 3J7AG 4X62I 2K4VA 4KHPE 4X66E 2E5LI 3DJWA 4R8OA 2RS7A 5BR8E 2M4IA 1Z5CA 3J80Q 3V2UC 3IWBA 4IZJA 2E1MA 3JAMC 2O1UA 4DUYI 4JI5I 4B3RI 1Z0CA 4Z7CA 4R1FA 4B3ME 4OOGC 2CG9A 1FWLA 3K17A 1KIJA 4JI7I 1XMOE 3K85A 4JI4I 2V34A 2V86A 4X64E 1Z0EA 2DEIA 3QT8A 2JVAA 5IT9Q 1D6TA 1SR9A 1Z0BA 3MSWA 2UUAE 2LRSA 4JI3I 4WUBA 4BCAA 3T1HE 3JU0A 3P1XA 4FWGA 3F0NA 4IZKB 2ZITA 5F3WA 4HACA 2ODRC 3QT7A 5FWKA 3HJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZ9 A;  1PVG A;  4PRX A;  4LF8 E;  1HR0 I;  4M30 A;  4JI8 E;  2CZ9 A;  1HNW E;  2L2M A;  2UXB I;  2OI2 A;  4WUD A;  1UEK A;  1XMQ I;  1WHQ A;  2X36 A;  3J81 C;  2UUB E;  1O0W A;  1XNQ I;  1YYO A;  4JG4 A;  2LUQ A;  4DV5 I;  2L3C A;  3VYX A;  2B3T B;  1WHN A;  3D4J A;  2NUF A;  4M1K A;  4LFC E;  4AQY E;  3ZKB A;  4DV1 E;  2VF3 A;  4HY1 A;  1Z5B A;  2LTR A;  1IBL I;  1H72 C;  4DR3 E;  1J5E I;  3HUL A;  2GS8 A;  3LLH A;  4KHP I;  1XNR I;  4JI6 E;  5BR8 I;  4X65 E;  4K0K E;  1B63 A;  1ZM2 A;  2UXC E;  1GQE A;  3VYY A;  4B3M I;  1ZBT A;  2BM1 A;  1Z0V A;  1T4O A;  1N34 E;  4WFT A;  5CFF E;  3PYE A;  1XMO I;  4DXL A;  2MDR A;  2HFU A;  4X64 I;  3K1J A;  2X7I A;  1H7S A;  2IHR 1;  2UUA I;  2EFG A;  5GME A;  5A2Q Q;  1H74 A;  1PIE A;  1K47 A;  3V5R A;  2L2N A;  2YT4 A;  3T1Y E;  3WU3 A;  4LF8 I;  3QT6 A;  4JI8 I;  2BM0 A;  5IWA E;  1HNW I;  1UHZ A;  1A6F A;  2ZBK B;  1IBM E;  2F4V I;  1WUU A;  4GKJ I;  1B62 A;  4LF5 E;  1X48 A;  4DR2 E;  3M6A A;  2UUB I;  2DMY A;  3WU4 A;  3LNU A;  4Z7Y A;  4AQY I;  4DV1 I;  1NHI A;  1U2R A;  5GMD A;  1RRE A;  4LF4 I;  4YHH E;  2DEJ A;  4DV0 E;  2XEX A;  2Q2E B;  1FKA E;  4DV4 E;  2UU9 E;  3JAM Q;  2HHH E;  3ZZU A;  4PU9 A;  2LTS A;  2VQF E;  3WU6 A;  4X65 I;  4RPF A;  1BKN A;  3ZZ0 A;  4K0K I;  2WW4 A;  4ED4 A;  4WYQ B;  2UXC I;  2B7V A;  1EI1 A;  4JI2 E;  1FNM A;  2ZM6 E;  1ZM9 A;  2EZ6 A;  3CWV A;  2V8P A;  4FWH A;  4ZVI A;  1N34 I;  3C4T A;  2UUC E;  4PRV A;  2R3V A;  1Z59 A;  2E1R A;  4DU7 A;  4JI1 E;  4DR1 E;  3QT5 A;  3OTO E;  4LFB E;  3T1Y I;  4JI0 E;  3WU5 A;  1X47 A;  4DR6 E;  4DR4 E;  3PYD A;  4DPW A;  2HKJ A;  5IWA I;  3J81 Q;  3C4B A;  4JYA E;  4OX9 E;  3LTO A;  2J7K A;  1T4N A;  2L3J A;  4WUC A;  4P7A A;  4DV7 I;  2V2Q A;  2LJH A;  1N0U A;  4DR2 I;  4DUZ E;  2R42 A;  4FN5 A;  2V2V A;  2NPF A;  4DV6 E;  1N32 E;  1RR9 A;  3J7A M;  1T4L B;  4YHH I;  4DV0 I;  4X66 I;  4DV4 I;  1J26 A;  1ELO A;  4FWD A;  1ZM4 A;  1HNX E;  3B78 A;  4LF7 E;  1DI2 A;  1X49 A;  2NA2 A;  4HXZ A;  3J7Y p;  1FJG E;  4JI2 I;  2ZM6 I;  1FI4 A;  4NXN E;  1KKH A;  1EKZ A;  2UUC I;  3T1H I;  4XTJ A;  1NZ0 A;  1YYK A;  4JI1 I;  4DR1 I;  4JI7 E;  4LFB I;  4DR7 E;  4JI0 I;  1RC7 A;  4B3S E;  2HFS A;  4I3H A;  4DR6 I;  4DR4 I;  2HK2 A;  4DPT A;  3ADI A;  2VQE E;  4OX9 I;  4LF9 E;  2NUE A;  1HNZ E;  1DAR A;  1Z0G A;  4DV2 E;  4USK A;  4LFC I;  4LF6 E;  1PKP A;  1FWK A;  2UXB E;  3ADJ A;  4DUZ I;  1ZXN A;  4DR3 I;  2DB2 A;  4DV6 I;  2CPN A;  5L3J A;  4DPY A;  1N32 I;  1EA6 A;  1N36 E;  1IBK E;  4JI6 I;  4UT4 A;  1UIL A;  4NXM E;  1S16 A;  2A2D A;  1ZXM A;  1HNX I;  4MYU A;  1Z5A A;  3ZKD A;  1S4E A;  5FLX C;  5LMN E;  1N33 E;  4JV5 E;  1H7U A;  2N3G A;  4DV3 E;  1KVK A;  2HKE A;  1XNR E;  1FJG I;  4NXN I;  4HAC B;  2RSM A;  4B3T E;  4DU8 A;  3J80 C;  1Z0T A;  4LFA E;  1NHH A;  2RS6 A;  1STU A;  4DR7 I;  1QU6 A;  2A2C A;  3PYG A;  4B3S I;  2AJ4 A;  1IBM I;  5IT9 C;  4LF5 I;  2VQE I;  4LF9 I;  1RQ0 A;  1HNZ I;  4EMD A;  4DV2 I;  1XHK A;  4P52 A;  4LF6 I;  5LMU E;  1YYW A;  1MX0 A;  3HTX A;  2F4V E;  4GKJ E;  2HK3 A;  3ZM7 A;  2UU9 I;  2HHH I;  2LUP B;  1N36 I;  4DPX A;  2B7T A;  1IBK I;  2VQF I;  4UTG A;  4MYT A;  2N3H A;  1I94 E;  4NXM I;  1H73 A;  4DR5 E;  4YY3 E;  2UXD E;  4GKK E;  2DIX A;  4X62 E;  4LF4 E;  1MG7 A;  2L2K B;  2E5L E;  5LMN I;  4DPU A;  1N33 I;  3H4L A;  4JV5 I;  3GON A;  4DV3 I;  3ADL A;  5LL6 R;  3ADG A;  4DUY E;  4JI5 E;  2L33 A;  4B3T I;  4B3R E;  4DKK A;  3B8H A;  4LFA I;  3PYF A;  1N0V C;  4KQV A;  3ZZT A;  1NHJ A;  4JI4 E;  3OTO I;  1OJ4 A;  1KTV A;  1QZR A;  4X8W A;  4JI3 E;  2NUG A;  1VIS A;  4JYA I;  4FW9 A;  4USM A;  1MU5 A;  4M2Z A;  2LJP A;  5A2Q C;  3LPS A;  1HR0 E;  1ZM3 A;  2RTX A;  2V2Z A;  5LMU I;  2LBS B;  1Z0W A;  1XMQ E;  4DV7 E;  1XNQ E;  2KHX A;  4DV5 E;  3B82 A;  3Q1Q A;  2JY9 A;  4HYM A;  1I94 I;  4LF7 I;  5FLX Q;  1IBL E;  4URL A;  4DR5 I;  4YY3 I;  2UXD I;  1J5E E;  2BV3 A;  4GKK I;  3J7A G;  4X62 I;  4KHP E;  4X66 E;  2E5L I;  2RS7 A;  5BR8 E;  1Z5C A;  3J80 Q;  3V2U C;  3JAM C;  4DUY I;  4JI5 I;  4B3R I;  1Z0C A;  4Z7C A;  4R1F A;  4B3M E;  4OOG C;  1FWL A;  3K17 A;  1KIJ A;  4JI7 I;  1XMO E;  4JI4 I;  2V34 A;  4X64 E;  1Z0E A;  2DEI A;  3QT8 A;  2JVA A;  5IT9 Q;  1D6T A;  1Z0B A;  2UUA E;  2LRS A;  4JI3 I;  4WUB A;  3T1H E;  4FWG A;  3P1X A;  3F0N A;  2ZIT A;  4HAC A;  3QT7 A; 
#chains in the Genus database with same CATH topology
 1YZ9 A;  1PVG A;  1HK7 A;  4PRX A;  4LF8 E;  1HR0 I;  4M30 A;  4JI8 E;  2EMY A;  2CZ9 A;  1HNW E;  2L2M A;  2H36 X;  2UXB I;  2WP8 A;  3C6K A;  2OI2 A;  4LPF A;  4RHB B;  3L7Z A;  2YPN A;  2BBG A;  5AE2 A;  1TF3 A;  1UEK A;  5KL6 A;  4WUD A;  1XMQ I;  1WHQ A;  2LCE A;  2X36 A;  3P06 A;  3J81 C;  2GO3 A;  2YU8 A;  2UUB E;  1O0W A;  1XNQ I;  1YYO A;  2A25 A;  4JG4 A;  2EM3 A;  2LUQ A;  2V89 A;  2YTN A;  2L3C A;  3VYX A;  1F2I G;  1WHN A;  2B3T B;  2IER A;  2NUF A;  3D4J A;  4M1K A;  3M85 D;  4LFC E;  2EOJ A;  4AQY E;  2KON A;  3ZKB A;  4DV1 E;  2EN3 A;  2VF3 A;  4HY1 A;  1Z5B A;  4BA1 B;  2JEA A;  2YTG A;  2LTR A;  1IBL I;  1H72 C;  1ZR9 A;  2ODR D;  4DR3 E;  1J5E I;  3HUL A;  2EPU A;  2EMG A;  1Z1B A;  2BA0 G;  1YH8 A;  5KL7 A;  2GS8 A;  3LLH A;  2B9D A;  4KHP I;  4LU9 A;  4WX9 A;  4GEQ B;  3HKM A;  1XNR I;  4JI6 E;  5BR8 I;  3VHT B;  2EML A;  2IES A;  3AUZ A;  4X65 E;  2K7I A;  4K0K E;  2C38 A;  1B63 A;  1Y5Y A;  4MDT A;  1ZM2 A;  2C39 A;  2UXC E;  4OKG A;  4BA2 A;  2F8B A;  3PS2 A;  5DNX A;  1GQE A;  3AV0 A;  3VYY A;  4B3M I;  1T38 A;  1UDQ A;  2WZO A;  4AIM A;  1ZBT A;  2BM1 A;  1Z0V A;  1T4O A;  2EOZ A;  4BC7 A;  1N34 E;  1JK2 A;  4WFT A;  5CFF E;  3PYE A;  1XMO I;  2DSY A;  5JEA F;  4MU3 A;  1NCS A;  4DXL A;  2MDR A;  4NBQ A;  2EMX A;  2HFU A;  2ENC A;  2J7J A;  4R2R A;  2PO0 A;  2X7I A;  3K1J A;  4X64 I;  1H7S A;  2IHR 1;  5AAS A;  2UUA I;  5C0X A;  2N8X A;  3TQM A;  2JOB A;  2EFG A;  5JEA A;  5GME A;  5A2Q Q;  1H74 A;  1PIE A;  1K47 A;  3U1Y A;  3V5R A;  2DRP A;  4MU1 A;  2L2N A;  4AM3 A;  2V85 A;  1GTK A;  2YT4 A;  2L6M A;  3T1Y E;  2O1T A;  5C0X C;  4BC9 A;  3F6G A;  5JEA C;  1WRJ A;  3WU3 A;  4AID A;  1VI7 A;  5JEA E;  3QT6 A;  4JI8 I;  2EOX A;  4J8Z A;  2BM0 A;  5EKW A;  5IWA E;  1HNW I;  2Z5E A;  1UHZ A;  1A6F A;  2ZBK B;  1IBM E;  2YU5 A;  3PRY A;  1PJS A;  2EMK A;  1WUU A;  2JEB B;  5DRP A;  2F4V I;  4GKJ I;  4BMJ A;  1B62 A;  4M9V C;  4LF5 E;  2EE8 A;  3VK6 A;  1X48 A;  4OO1 B;  4DR2 E;  4F54 A;  4ISA A;  1IQO A;  3M6A A;  2UUB I;  4P78 A;  3DF6 A;  2DMY A;  3WU4 A;  3LNU A;  4Z7Y A;  2EPC A;  5K36 A;  2BA0 D;  2EMB A;  4AQY I;  4BS9 A;  2IOP A;  4DV1 I;  4IS1 C;  4I8O A;  3EQ1 A;  2RSI A;  1NHI A;  4O24 A;  1U2R A;  1RRE A;  4J3D A;  5GMD A;  4LF4 I;  4YHH E;  2DEJ A;  4DV0 E;  2XEX A;  2Q2E B;  1FKA E;  2EL6 A;  4DV4 E;  2UU9 E;  2Z5B A;  2Z5C A;  2HHH E;  3JAM Q;  5K36 C;  3GCM A;  3ZZU A;  4PU9 A;  2C37 A;  1SFE A;  5DNL A;  2LTS A;  2RQL A;  5A6K A;  4L5N C;  2EPR A;  2VQF E;  3WU6 A;  3M7N G;  4OO1 F;  3Q6M A;  3HPS A;  2RPC A;  1KYQ A;  1BKN A;  4RPF A;  3ZZ0 A;  2YRH A;  4X65 I;  2WW4 A;  4K0K I;  4ED4 A;  4BBY A;  2YZT A;  1E3H A;  5DRO A;  4WYQ B;  2UXC I;  2PO2 A;  2MKN A;  5A6B A;  3P3G A;  1EH6 A;  3IWD A;  2B7V A;  3BID A;  2EMW A;  1ZAA C;  5KL4 A;  1EI1 A;  1N3G A;  4JI2 E;  2ZM6 E;  1FNM A;  2PO1 B;  2HC5 A;  1ZM9 A;  4GZN C;  2EZ6 A;  2V8P A;  3CWV A;  4FWH A;  4ZVI A;  1N34 I;  3C4T A;  4R2D A;  2UUC E;  2EQ1 A;  4PRV A;  3CDI A;  2EQ3 A;  4F9C B;  4R2P A;  4OO1 E;  1DQ3 A;  2NAB A;  2R3V A;  1Z59 A;  3H09 A;  2E1R A;  4DV5 I;  2EOE A;  2EM7 A;  4LCF A;  1Y4S A;  1Y6Z A;  2BR2 A;  4DU7 A;  5K36 D;  2EM0 A;  2HGH A;  1R6M A;  4JI1 E;  2ELZ A;  4DR1 E;  3QT5 A;  4LCG A;  2EN4 A;  2MDG A;  3OTO E;  2WBS A;  3EPL A;  2I13 A;  1IMU A;  2V83 A;  4WXC A;  4LFB E;  3GLL A;  3L7Z B;  4JI0 E;  2EOR A;  4N3O A;  3T1Y I;  3Q6N A;  1AAY A;  3WU5 A;  1X47 A;  2JT2 A;  5IXM B;  4DR6 E;  4DR4 E;  3PYD A;  4DPW A;  2HKJ A;  4IZJ D;  5IWA I;  3J81 Q;  3C4B A;  4JYA E;  4OX9 E;  1Y4U A;  3HQ1 A;  4R2C A;  3LTO A;  2J7K A;  1T4N A;  3HXL A;  2L3J A;  2YTQ A;  2GLI A;  1USV A;  4U3B A;  2CT1 A;  4WUC A;  1L4S A;  4P7A A;  4DV7 I;  2O1W A;  2V2Q A;  4LOM A;  3THN A;  2LJH A;  1N0U A;  3B4T A;  1MEY C;  4TUI A;  4DR2 I;  4IFD F;  2PRT A;  2EJ4 A;  2GQ0 A;  1KJK A;  2PNZ B;  4U3D A;  4DUZ E;  2EP3 A;  2R42 A;  4FN5 A;  2EPA A;  2V2V A;  2NPF A;  4IFD A;  2NN6 D;  4F6M A;  4DV6 E;  5AC4 A;  1N32 E;  1RR9 A;  3J7A M;  1T4L B;  2C38 B;  4YHH I;  3ZOQ B;  3M7N D;  2WNR B;  4DV0 I;  2EOH A;  3MHS C;  2C39 B;  4X66 I;  2IOQ A;  1A1K A;  4DV4 I;  1J26 A;  1ELO A;  4FWD A;  2EN2 A;  1ZM4 A;  1X6F A;  3KWR A;  1HNX E;  4IFD E;  4KZS A;  3B78 A;  3HPZ A;  4LF7 E;  2EMC A;  1DI2 A;  4MU0 A;  4IJD A;  1UDN A;  1AH5 A;  1DGC A;  1YHC A;  2EPN A;  1X49 A;  2NA2 A;  2ENA A;  5ELW A;  4X9J A;  3BBG A;  4HXZ A;  2YTP A;  4RH8 A;  3J7Y p;  1FJG E;  4JI2 I;  2ZM6 I;  1FI4 A;  4NXN E;  1KKH A;  4BA1 A;  5DNY A;  1EKZ A;  2G7H A;  2EM5 A;  1TN9 A;  2UUC I;  3PS1 A;  3T1H I;  4R2E A;  4ZYE A;  4XTJ A;  4WSP A;  2MKD A;  2R76 A;  1NZ0 A;  1YYK A;  1A1F A;  2YRM A;  2GO4 A;  4JI1 I;  4DR1 I;  4JI7 E;  2JP9 A;  4TUG A;  2KOU A;  1G2F C;  4LFB I;  2GHF A;  4DR7 E;  4JI0 I;  4Q35 B;  1RC7 A;  1TF6 A;  1UBD C;  4B3S E;  1ZU1 A;  1UDO A;  4R2S A;  2HFS A;  2YTF A;  4I3H A;  5IV8 B;  4DR6 I;  2MC5 A;  5AE1 A;  2HK2 A;  4DR4 I;  2EPP A;  4DPT A;  3ADI A;  5K36 B;  2VQE E;  4OX9 I;  4LF9 E;  3JTZ A;  2NUE A;  2FV4 B;  2EPK X;  2ADR A;  1PJQ A;  2EOS A;  2YSP A;  3ECR A;  5A69 A;  3KZZ A;  1HNZ E;  1DAR A;  1Z0G A;  4DV2 E;  2R1F A;  4USK A;  1PJT A;  2YTI A;  2EPX A;  4F6N A;  4LFC I;  4DMI A;  4LF6 E;  4O43 A;  4QNK A;  2FTX B;  1PKP A;  1FWK A;  2Z5B B;  2JWO A;  4ZYH A;  2UXB E;  3ADJ A;  2EM8 A;  2DMI A;  4HTG A;  4IZJ B;  4DUZ I;  3P3C A;  1ZXN A;  5AE3 A;  4DR3 I;  2DB2 A;  4DV6 I;  2CPN A;  4MU4 A;  4DPY A;  5L3J A;  4Q28 A;  5C0X D;  2JXP A;  1N32 I;  4LTY A;  4MQY A;  5JEA D;  1EA6 A;  1N36 E;  4NHR A;  4FW5 A;  4WXD A;  1IBK E;  4JI6 I;  4UT4 A;  1UIL A;  3NZK A;  4NXM E;  1S16 A;  2JEB A;  2FGG A;  1ZXM A;  2A2D A;  1HNX I;  4ZYD A;  4MYU A;  2LV2 A;  3RMP A;  1Z5A A;  1IQS A;  3UHM A;  4OO1 A;  4F9B B;  2NN6 B;  3ZKD A;  4FW6 A;  2LO3 A;  1S4E A;  5FLX C;  1OYP A;  5LMN E;  1N33 E;  2V8Q B;  1R6L A;  4JV5 E;  1H7U A;  2EMH A;  2N3G A;  1UN6 B;  4DV3 E;  1KVK A;  2HKE A;  1XNR E;  2YSO A;  1FJG I;  1EH7 A;  1MGT A;  1WJP A;  1Y60 A;  4NXN I;  4HAC B;  2MC6 A;  2RSM A;  4B3T E;  4OO1 C;  4F9A B;  3UK3 C;  4DU8 A;  2EL4 A;  2L92 A;  2I9I A;  3J80 C;  1P47 A;  1EH8 A;  1BBO A;  1Z0T A;  3CDJ A;  4LFA E;  2EPL X;  4BHC A;  2L8T A;  1NHH A;  2WP8 B;  2M7Q A;  1UDS A;  1YUI A;  2NN6 F;  5ADZ A;  2RS6 A;  2EM4 A;  2VES A;  1STU A;  2BB8 A;  2EMF A;  2M9A A;  1A1G A;  1QU6 A;  2A2C A;  3PYG A;  2ENH A;  2YTO A;  4B3S I;  4DR7 I;  4R2Q A;  4L8N A;  2YTD A;  4GQU A;  2CTD A;  2AJ4 A;  2JR1 A;  1IBM I;  3EPK A;  1GZ6 A;  5IT9 C;  2PO1 A;  2JE6 A;  2EPZ A;  2JOX A;  4LF5 I;  2VQE I;  4LF9 I;  1RQ0 A;  1E3P A;  4M0V A;  2JEA B;  1HNZ I;  2D9H A;  4EMD A;  5A6B D;  2BA1 G;  3BF2 A;  4DV2 I;  1XHK A;  2EWL A;  2GPI A;  2JYA A;  2M1S A;  1OYR A;  4P52 A;  4IZK A;  1A1H A;  4LF6 I;  5LMU E;  5LLQ A;  2EPO A;  3FIG A;  1YYW A;  1MX0 A;  3HTX A;  5T6J A;  2EMA A;  4P7D A;  2EOQ A;  2F4V E;  1PDA A;  4GKJ E;  2WCC 3;  2HK3 A;  2DLK A;  4FK5 C;  3H1C A;  5A6A A;  3ZM7 A;  2LMZ A;  2O1V A;  2WBT A;  5DRR A;  3THO B;  1JK1 A;  2UU9 I;  4BA2 B;  4ZYG A;  2HHH I;  2EOF A;  2LUP B;  1T39 A;  1N36 I;  4DPX A;  1P42 A;  1LLM C;  2B7T A;  2AE8 A;  2PNM A;  4HEI A;  1IBK I;  4IS9 A;  2VQF I;  4UTG A;  4IFD C;  4MYT A;  2N3H A;  1I94 E;  4R2A A;  1H73 A;  4NXM I;  1B69 A;  3EPJ A;  2EMI A;  2LT7 A;  4DR5 E;  4YY3 E;  1A1L A;  2UXD E;  5AC5 A;  4GKK E;  2PO0 B;  2DIX A;  2EOY A;  4X62 E;  2VRD A;  4LF4 E;  1MG7 A;  3IWC A;  2L2K B;  3EPH A;  5C0X B;  2E5L E;  5LMN I;  2O3Z A;  4DPU A;  5JEA B;  1N33 I;  3BGH A;  4R03 A;  3H4L A;  2PNZ A;  3OML A;  3GON A;  4DV3 I;  2V88 A;  4JV5 I;  3ADL A;  5LL6 R;  3ADG A;  4DUY E;  4JI5 E;  2L33 A;  4B3T I;  4B3R E;  3F6H A;  5KL3 A;  4DKK A;  2WNR A;  2YRK A;  2EQ0 A;  1A1J A;  2EL5 A;  3KRN A;  4O4K A;  1YFH A;  2EN7 A;  1A1I A;  2YWQ A;  3B8H A;  4LFA I;  3PYF A;  1N0V C;  4KQV A;  3ZZT A;  4IFD D;  3M99 B;  1NHJ A;  2V87 A;  4JI4 E;  3OTO I;  4WPY A;  4O5G A;  2JPA A;  5C0X F;  2EN8 A;  2DLQ A;  1YSA C;  1X3C A;  1OJ4 A;  1KTV A;  1QZR A;  2EM6 A;  4X8W A;  2LE2 A;  4JI3 E;  2NUG A;  1BB8 A;  1VIS A;  2J65 A;  2CSH A;  2BA1 D;  4JYA I;  4LF8 I;  4FW9 A;  2PNL A;  1ZBQ A;  4USM A;  2LJU A;  3C6M A;  1MU5 A;  4M2Z A;  2CGE A;  2LJP A;  2EOM A;  2VE7 C;  5A2Q C;  3LPS A;  4MLQ A;  4NZV A;  2ELY A;  1HR0 E;  1ZM3 A;  3K6Q A;  3U1K A;  2RTX A;  2Z5C B;  5C0X E;  3P3E A;  2WBU A;  2V2Z A;  1X6E A;  1OYS A;  2C37 B;  2CVE A;  5LMU I;  4MLV A;  2LBS B;  3LML A;  1Z0W A;  2VF1 A;  1XMQ E;  4F2J C;  5EL9 A;  1WXR A;  4FW4 A;  2EM2 A;  2EMZ A;  3L00 A;  4DV7 E;  1XNQ E;  2DGC A;  5K36 F;  2KHX A;  2PO2 B;  2YTJ A;  4DV5 E;  3GME A;  3B82 A;  1G2D C;  3Q1Q A;  2JY9 A;  4HYM A;  2EOI A;  1YPN A;  1RMD A;  1I94 I;  4N4R B;  4LF7 I;  5FLX Q;  4WSG A;  1IBL E;  2EM9 A;  4URL A;  1USU A;  4LCH A;  4DR5 I;  4YY3 I;  2UXD I;  1J5E E;  2BV3 A;  2EN6 A;  2EPM X;  3J7A G;  4X62 I;  2K4V A;  3M85 G;  4GKK I;  4QNJ A;  1X6H A;  4KHP E;  2HJJ A;  4X66 E;  3DJW A;  2E5L I;  4R8O A;  2BR2 B;  2LVH A;  2RS7 A;  3KZY A;  2M4I A;  5BR8 E;  1RHY A;  1QNT A;  1Z5C A;  4FW3 A;  3J80 Q;  3V2U C;  5K36 E;  3IWB A;  4IZJ A;  2E1M A;  4OZE A;  3JAM C;  5KL2 A;  2O1U A;  4DUY I;  4JI5 I;  4BHB A;  4B3R I;  1Z0C A;  4Z7C A;  4FW7 A;  4R1F A;  4B3M E;  3MHH C;  5KL5 A;  4KWY A;  4OOG C;  3DD6 A;  2EOO A;  1YUJ A;  1NEI A;  3QG5 C;  1FWL A;  2CG9 A;  3K17 A;  5DRQ A;  2E72 A;  1KIJ A;  4JI7 I;  1XMO E;  3K85 A;  4JI4 I;  2JE6 B;  2V34 A;  2EN1 A;  2V86 A;  3P76 A;  1BBG A;  4X64 E;  1Z0E A;  2YTE A;  2DEI A;  3QT8 A;  2NN6 A;  2JVA A;  5IT9 Q;  1D6T A;  1SR9 A;  1Z0B A;  3MSW A;  2UUA E;  2LRS A;  4JI3 I;  3PS3 A;  4WUB A;  4BCA A;  3T1H E;  3JU0 A;  5TSE A;  3QT7 A;  3P1X A;  4FWG A;  3F0N A;  4IZK B;  1XXE A;  1X5W A;  2F1D A;  2ZIT A;  2Q8U A;  5F3W A;  5A6J A;  2ODR C;  4HAC A;  4IFD B;  4OO1 D;  2NN6 C;  2NN6 E;  5FWK A;  3HJC A; 
#chains in the Genus database with same CATH homology
 1YZ9 A;  1PVG A;  1HK7 A;  4PRX A;  4LF8 E;  1HR0 I;  4M30 A;  4JI8 E;  2CZ9 A;  1HNW E;  2L2M A;  2H36 X;  2UXB I;  2OI2 A;  5AE2 A;  1UEK A;  4WUD A;  1XMQ I;  1WHQ A;  2X36 A;  3P06 A;  3J81 C;  2UUB E;  1O0W A;  1XNQ I;  1YYO A;  4JG4 A;  2LUQ A;  2V89 A;  2L3C A;  4DV5 I;  3VYX A;  1WHN A;  2B3T B;  3D4J A;  2NUF A;  4M1K A;  4LFC E;  4AQY E;  3ZKB A;  2KON A;  4DV1 E;  2VF3 A;  4HY1 A;  1Z5B A;  2LTR A;  1IBL I;  1H72 C;  2ODR D;  4DR3 E;  1J5E I;  3HUL A;  2GS8 A;  3LLH A;  2B9D A;  4KHP I;  4LU9 A;  4GEQ B;  1XNR I;  4JI6 E;  5BR8 I;  3AUZ A;  4X65 E;  4K0K E;  1B63 A;  1ZM2 A;  2UXC E;  2F8B A;  1GQE A;  3AV0 A;  3VYY A;  4B3M I;  2WZO A;  1ZBT A;  2BM1 A;  1Z0V A;  1T4O A;  4BC7 A;  1N34 E;  4WFT A;  5CFF E;  3PYE A;  1XMO I;  2DSY A;  4DXL A;  2MDR A;  2HFU A;  4X64 I;  3K1J A;  2X7I A;  1H7S A;  2IHR 1;  5AAS A;  2UUA I;  2JOB A;  2EFG A;  5GME A;  5A2Q Q;  1H74 A;  1PIE A;  1K47 A;  3V5R A;  2L2N A;  2V85 A;  2YT4 A;  2L6M A;  3T1Y E;  2O1T A;  4BC9 A;  3F6G A;  3WU3 A;  4LF8 I;  3QT6 A;  4JI8 I;  4J8Z A;  2BM0 A;  5IWA E;  1HNW I;  2Z5E A;  1UHZ A;  1A6F A;  2ZBK B;  1IBM E;  3PRY A;  2F4V I;  1WUU A;  4GKJ I;  4BMJ A;  1B62 A;  4LF5 E;  3VK6 A;  1X48 A;  4DR2 E;  4F54 A;  3M6A A;  2UUB I;  4P78 A;  3DF6 A;  2DMY A;  3WU4 A;  3LNU A;  4Z7Y A;  4AQY I;  4BS9 A;  2IOP A;  4DV1 I;  4I8O A;  1NHI A;  1U2R A;  5GMD A;  1RRE A;  4LF4 I;  4YHH E;  2DEJ A;  4DV0 E;  2XEX A;  2Q2E B;  1FKA E;  4DV4 E;  2UU9 E;  2Z5B A;  2Z5C A;  2HHH E;  3JAM Q;  3ZZU A;  4PU9 A;  2LTS A;  2VQF E;  4L5N C;  3WU6 A;  3Q6M A;  3HPS A;  4RPF A;  1BKN A;  3ZZ0 A;  4X65 I;  4K0K I;  2WW4 A;  4ED4 A;  4BBY A;  2YZT A;  4WYQ B;  2UXC I;  3IWD A;  2B7V A;  1EI1 A;  4JI2 E;  1FNM A;  2ZM6 E;  1ZM9 A;  2EZ6 A;  3CWV A;  2V8P A;  4FWH A;  4ZVI A;  1N34 I;  3C4T A;  2UUC E;  4PRV A;  4F9C B;  1DQ3 A;  2R3V A;  1Z59 A;  3H09 A;  2E1R A;  1Y4S A;  1Y6Z A;  4DU7 A;  4JI1 E;  4DR1 E;  3QT5 A;  3OTO E;  2V83 A;  4LFB E;  3T1Y I;  4JI0 E;  4N3O A;  3Q6N A;  3WU5 A;  1X47 A;  4DR6 E;  4DR4 E;  3PYD A;  4DPW A;  2HKJ A;  4IZJ D;  5IWA I;  3J81 Q;  3C4B A;  4JYA E;  4OX9 E;  1Y4U A;  3HQ1 A;  3LTO A;  2J7K A;  1T4N A;  3HXL A;  2L3J A;  1USV A;  4WUC A;  4P7A A;  4DV7 I;  2O1W A;  2V2Q A;  2LJH A;  1N0U A;  4TUI A;  4DR2 I;  2GQ0 A;  4DUZ E;  2R42 A;  4FN5 A;  2V2V A;  2NPF A;  4DV6 E;  1N32 E;  1RR9 A;  3J7A M;  1T4L B;  4YHH I;  3ZOQ B;  4DV0 I;  4X66 I;  2IOQ A;  4DV4 I;  1J26 A;  1ELO A;  4FWD A;  1ZM4 A;  1HNX E;  3KWR A;  4KZS A;  3B78 A;  3HPZ A;  4LF7 E;  1DI2 A;  1X49 A;  2NA2 A;  4HXZ A;  3J7Y p;  1FJG E;  4JI2 I;  2ZM6 I;  1FI4 A;  4NXN E;  1KKH A;  5DNY A;  1EKZ A;  2G7H A;  2UUC I;  3T1H I;  4XTJ A;  4WSP A;  1NZ0 A;  1YYK A;  4JI1 I;  4DR1 I;  4JI7 E;  4TUG A;  2KOU A;  4LFB I;  4DR7 E;  4JI0 I;  1RC7 A;  4B3S E;  2HFS A;  4I3H A;  4DR6 I;  2MC5 A;  5AE1 A;  2HK2 A;  4DR4 I;  4DPT A;  3ADI A;  2VQE E;  4OX9 I;  4LF9 E;  3JTZ A;  2NUE A;  2FV4 B;  1HNZ E;  1DAR A;  1Z0G A;  4DV2 E;  4USK A;  4LFC I;  4DMI A;  4LF6 E;  2FTX B;  1PKP A;  1FWK A;  2Z5B B;  2JWO A;  2UXB E;  3ADJ A;  4DUZ I;  4IZJ B;  1ZXN A;  5AE3 A;  4DR3 I;  2DB2 A;  4DV6 I;  2CPN A;  5L3J A;  4DPY A;  1N32 I;  4Q28 A;  4LTY A;  1EA6 A;  1N36 E;  1IBK E;  4JI6 I;  4UT4 A;  1UIL A;  4NXM E;  1S16 A;  2FGG A;  1ZXM A;  2A2D A;  1HNX I;  4MYU A;  3RMP A;  1Z5A A;  4F9B B;  3ZKD A;  1S4E A;  5FLX C;  5LMN E;  1N33 E;  2V8Q B;  4JV5 E;  1H7U A;  2N3G A;  4DV3 E;  1KVK A;  2HKE A;  1XNR E;  1FJG I;  4NXN I;  4HAC B;  2MC6 A;  2RSM A;  4B3T E;  4F9A B;  4DU8 A;  2L92 A;  3J80 C;  1Z0T A;  4LFA E;  2L8T A;  1NHH A;  2M7Q A;  5ADZ A;  2RS6 A;  1STU A;  4DR7 I;  1QU6 A;  2A2C A;  3PYG A;  4B3S I;  4L8N A;  2AJ4 A;  2JR1 A;  1IBM I;  1GZ6 A;  5IT9 C;  2JOX A;  4LF5 I;  2VQE I;  4LF9 I;  1RQ0 A;  4M0V A;  1HNZ I;  4EMD A;  4DV2 I;  1XHK A;  2EWL A;  2M1S A;  4P52 A;  4IZK A;  4LF6 I;  5LMU E;  3FIG A;  1YYW A;  1MX0 A;  3HTX A;  5T6J A;  4P7D A;  2F4V E;  4GKJ E;  2HK3 A;  3ZM7 A;  2LMZ A;  2O1V A;  2UU9 I;  2HHH I;  2LUP B;  1N36 I;  4DPX A;  2B7T A;  2PNM A;  1IBK I;  2VQF I;  4UTG A;  4MYT A;  2N3H A;  1I94 E;  4NXM I;  1H73 A;  4DR5 E;  4YY3 E;  2UXD E;  4GKK E;  2DIX A;  4X62 E;  4LF4 E;  1MG7 A;  3IWC A;  2L2K B;  2E5L E;  5LMN I;  4DPU A;  1N33 I;  4R03 A;  3H4L A;  4JV5 I;  3GON A;  3OML A;  4DV3 I;  2V88 A;  3ADL A;  5LL6 R;  3ADG A;  4DUY E;  4JI5 E;  2L33 A;  4B3T I;  4B3R E;  3F6H A;  4DKK A;  3B8H A;  4LFA I;  3PYF A;  1N0V C;  4KQV A;  3ZZT A;  1NHJ A;  2V87 A;  4JI4 E;  3OTO I;  4WPY A;  1OJ4 A;  1KTV A;  1QZR A;  4X8W A;  2LE2 A;  4JI3 E;  2NUG A;  1VIS A;  4JYA I;  4FW9 A;  2PNL A;  1ZBQ A;  4USM A;  1MU5 A;  4M2Z A;  2CGE A;  2LJP A;  2VE7 C;  5A2Q C;  3LPS A;  1HR0 E;  1ZM3 A;  3K6Q A;  2RTX A;  2Z5C B;  2V2Z A;  5LMU I;  2LBS B;  3LML A;  1Z0W A;  2VF1 A;  1XMQ E;  1WXR A;  4DV7 E;  1XNQ E;  2KHX A;  4DV5 E;  3B82 A;  3Q1Q A;  2JY9 A;  4HYM A;  1I94 I;  4LF7 I;  5FLX Q;  1IBL E;  4URL A;  1USU A;  4DR5 I;  4YY3 I;  2UXD I;  1J5E E;  2BV3 A;  4GKK I;  3J7A G;  4X62 I;  2K4V A;  4KHP E;  4X66 E;  2E5L I;  3DJW A;  4R8O A;  2RS7 A;  5BR8 E;  2M4I A;  1Z5C A;  3J80 Q;  3V2U C;  3IWB A;  4IZJ A;  2E1M A;  3JAM C;  2O1U A;  4DUY I;  4JI5 I;  4B3R I;  1Z0C A;  4Z7C A;  4R1F A;  4B3M E;  4OOG C;  2CG9 A;  1FWL A;  3K17 A;  1KIJ A;  4JI7 I;  1XMO E;  3K85 A;  4JI4 I;  2V34 A;  2V86 A;  4X64 E;  1Z0E A;  2DEI A;  3QT8 A;  2JVA A;  5IT9 Q;  1D6T A;  1SR9 A;  1Z0B A;  3MSW A;  2UUA E;  2LRS A;  4JI3 I;  4WUB A;  4BCA A;  3T1H E;  3JU0 A;  3P1X A;  4FWG A;  3F0N A;  4IZK B;  2ZIT A;  5F3W A;  4HAC A;  2ODR C;  3QT7 A;  5FWK A;  3HJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...