1FKAE

Structure of functionally activated small ribosomal subunit at 3.3 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
157
structure length
157
Chain Sequence
MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1fkaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1fkaE02
2L2KB 4LFAE 1XNRE 1WHQA 1GQEA 1N0UA 2ZBKB 3PYEA 4USMA 4RPFA 4EMDA 1N32I 4DPUA 4LF8E 3ADIA 4LF6I 4DR7E 4HYMA 1N0VC 3J7AM 2NUFA 4DR4I 5FLXQ 3V5RA 2R42A 4DR6E 2F4VE 3GONA 4LF4E 1NHJA 4X66I 2JY9A 4DV5I 1I94E 4X65E 3M6AA 2BV3A 3J81Q 1D6TA 1BKNA 1DI2A 4LF5E 5LL6R 4JI7I 4HXZA 1FWKA 1QZRA 4X8WA 3H4LA 1N32E 4LF6E 2V2QA 3VYYA 4DR4E 2XEXA 1WHNA 1FNMA 2Q2EB 4X66E 4JYAI 4DV5E 1NHHA 1XHKA 1U2RA 4JI7E 4WYQB 3F0NA 5A2QQ 4DR1I 5CFFE 4B3RI 2N3HA 4DV0I 3QT6A 1FJGI 4URLA 1Z59A 4XTJA 1Z5BA 1KIJA 1N34I 1FKAE 1UEKA 2N3GA 4DPWA 4JYAE 2AJ4A 1H74A 2UU9I 3WU5A 2EFGA 4HY1A 4DR5I 4JI0I 4PRVA 4DPXA 2HHHI 2UXCI 1NHIA 4DR1E 4B3RE 3T1YI 4DV0E 2ZM6I 1FJGE 4GKJI 1XNQI 2LJHA 2NUEA 1Z0BA 2L2MA 4DV2I 4DXLA 4DU8A 1N34E 4PU9A 3J80Q 5FLXC 4FW9A 3ZKDA 1PKPA 3B82A 2UU9E 2LRSA 1Z0WA 4FWGA 1YYKA 1WUUA 1X47A 1Z0EA 4DR5E 3J81C 4JI0E 1Z0TA 1KVKA 4WFTA 2HHHE 2DB2A 1EKZA 2NPFA 2UXCE 4B3MI 5IT9Q 2V34A 3T1YE 2ZM6E 4GKJE 2E1RA 1XNQE 5BR8I 1O0WA 2L33A 4DV2E 2NA2A 4LFBI 4KHPI 2DIXA 2V8PA 1UHZA 4NXMI 4M1KA 2V2VA 1EI1A 2MDRA 1RQ0A 4B3ME 3J7Yp 1RR9A 4WUDA 2E5LI 5A2QC 1ZXNA 1B63A 4DV7E 5BR8E 4B3SI 3LLHA 4GKKE 3C4BA 4P52A 4JG4A 3V2UC 4LFBE 2L3CA 4KHPE 4KQVA 2CPNA 4USKA 1PIEA 4NXME 3ZKBA 4DV6I 2DMYA 3LNUA 3PYGA 1S4EA 4ED4A 2JVAA 1ELOA 4ZVIA 4HACB 1XMQI 1UILA 2E5LE 1HNZI 2HFSA 1N36I 1XMOI 2LUPB 3K1JA 2L2NA 3WU6A 4B3SE 1H73A 1HR0I 1ZM3A 1T4LB 3C4TA 4OOGC 3J80C 2VQFI 3P1XA 1ZM2A 1VISA 2X7IA 2UUAI 1T4NA 4DV6E 2LJPA 4DR3I 4R1FA 2RS6A 1HNXI 1NZ0A 3K17A 4YHHI 4FWHA 1PVGA 3CWVA 2R3VA 1XMQE 4MYTA 4I3HA 1HNZE 4WUCA 5IT9C 1N36E 1XMOE 1J26A 4NXNI 5GMEA 4JI4I 2RSMA 1MG7A 3WU4A 4LF7I 2LTRA 1HR0E 2BM0A 2RTXA 2RS7A 4JI1I 2HK2A 4WUBA 3VYXA 4JV5I 2VQFE 1YYOA 1MX0A 2L3JA 3T1HI 1T4OA 2A2CA 3HTXA 2YT4A 3ZZUA 1OJ4A 2UUAE 1YZ9A 1EA6A 1K47A 2V2ZA 3ZZTA 4DR3E 1HNXE 2B7VA 4YHHE 3ZZ0A 2B7TA 1ZM9A 2UXDI 1ZXMA 3J7AG 1Z0GA 2UUBI 4JI2I 1FI4A 4NXNE 4JI4E 2DEIA 2NUGA 1STUA 4LF7E 4DV7I 3B78A 4PRXA 4DUZI 4JI1E 4GKKI 2WW4A 1X49A 3WU3A 1IBKI 4JV5E 1IBLI 4Z7CA 4OX9I 3T1HE 2HKJA 1IBMI 4FWDA 4DV3I 4DV1I 1N33I 3Q1QA 4MYUA 3PYFA 4DUYI 2UXDE 5GMDA 4B3TI 1J5EI 1Z5CA 4LF9I 3JAMQ 2UUBE 4JI2E 2LBSB 3ADLA 2GS8A 3PYDA 5LMNI 4DUZE 5L3JA 4JI5I 1IBKE 1IBLE 2BM1A 4OX9E 4DPTA 4K0KI 1IBME 1QU6A 2HFUA 4DV3E 4DV1E 1N33E 4JI6I 1Z5AA 3LPSA 4Z7YA 1Z0VA 2A2DA 1X48A 4DUYE 4FN5A 4B3TE 2IHR1 1J5EE 2UUCI 3HULA 1Z0CA 4P7AA 4LF9E 4AQYI 3QT8A 2KHXA 5LMNE 3ZM7A 3ADGA 2EZ6A 4JI5E 2X36A 3OTOI 4JI3I 4K0KE 4DU7A 1KTVA 4DV4I 4JI6E 1YYWA 4DKKA 4DR2I 1B62A 1RC7A 2VQEI 2UUCE 4M30A 4AQYE 4YY3I 4X64I 1RREA 1HNWI 5LMUI 3QT5A 2LUQA 1S16A 5IWAI 3QT7A 3OTOE 4JI3E 2J7KA 3D4JA 2DEJA 2ZITA 1H72C 4DV4E 1FWLA 4X62I 2HK3A 4LFCI 4JI8I 3ADJA 2LTSA 2UXBI 4DR2E 3LTOA 1DARA 2VQEE 1ZM4A 3B8HA 4YY3E 3JAMC 4X64E 4LFAI 1XNRI 1A6FA 1MU5A 1HNWE 2CZ9A 4UT4A 5LMUE 2VF3A 4LF8I 4DR7I 4M2ZA 5IWAE 1KKHA 4DR6I 2F4VI 4DPYA 2OI2A 4LF4I 1I94I 1ZBTA 4X65I 4HACA 4UTGA 4X62E 1H7SA 4JI8E 4LFCE 1H7UA 2B3TB 2UXBE 2HKEA 4LF5I
chains in the Genus database with same CATH superfamily
2JE6B 5A6BA 4OO1B 4LCGA 2L2KB 2YZTA 2NABA 4LFAE 1XNRE 2M4IA 2EQ1A 3U1KA 1WHQA 1GQEA 1N0UA 3PS3A 2ZBKB 3PYEA 4USMA 4RPFA 4EMDA 1N32I 4DPUA 4LF8E 3ADIA 2Z5BB 5C0XD 1DGCA 4DR7E 1N0VC 4HYMA 4LF6I 3J7AM 4GZNC 5F3WA 2NUFA 2YRMA 1MGTA 4DR4I 5C0XC 1SR9A 2IOQA 2BB8A 5FLXQ 2EMYA 3UK3C 2NN6D 4R2DA 2R42A 1HK7A 3V5RA 4DR6E 3PS2A 2F4VE 3GONA 3M85G 4LF4E 2LT7A 1NHJA 4X66I 2JY9A 4DV5I 1A1JA 4OKGA 1I94E 2YTPA 4X65E 2EMGA 3HPZA 3M6AA 2BV3A 3J81Q 5IXMB 1D6TA 1BKNA 1DI2A 4F54A 4LF5E 5LL6R 4JI7I 4TUIA 2LV2A 5JEAC 2ENAA 2YRKA 2WBSA 4HXZA 2J65A 2LMZA 2EMBA 1FWKA 1QZRA 4X8WA 2BR2A 3H4LA 1R6MA 5DNLA 4JV5I 3OMLA 2JEBB 4BC9A 5K36E 5K36C 3BBGA 1BB8A 1N32E 4LF6E 2V2QA 1G2DC 2EPMX 2GHFA 2M7QA 4R2SA 2EM2A 3VYYA 1A1FA 2IESA 4DR4E 2Z5CA 2XEXA 1WHNA 2I9IA 4NHRA 3AV0A 2BA1D 1FNMA 2Q2EB 1PJTA 4X66E 4JYAI 5K36A 4DV5E 1NHHA 4IZJB 2Z5EA 4O5GA 4LCFA 5JEAD 1XHKA 2VRDA 3P3CA 3IWDA 3HXLA 5KL3A 2C38A 1U2RA 2YU8A 4JI7E 2PO2B 1A1LA 4BA1B 5KL4A 3H09A 5KL5A 2JOXA 2EOOA 2EMKA 4WYQB 3F0NA 5A2QQ 4DR1I 5CFFE 4B3RI 2N3HA 2EM7A 4DV0I 3QT6A 5DRRA 2A25A 1FJGI 1UDSA 4F6NA 4URLA 3M85D 3NZKA 4IFDE 1Z59A 4XTJA 4FK5C 1Z5BA 2NN6B 1KIJA 3DJWA 4FW5A 3P76A 1N34I 1FKAE 1TF6A 2EOYA 1ZU1A 2EM8A 2HJJA 3BF2A 3BIDA 1UEKA 2N3GA 2FV4B 1Y4UA 4MQYA 4DPWA 4JYAE 2AJ4A 1H74A 2UU9I 3EPHA 1EH7A 4IJDA 2EMFA 1RMDA 2HC5A 4IFDA 3MHSC 2DRPA 1YHCA 3WU5A 2JEAB 1G2FC 3C6MA 1Y4SA 2EFGA 1YUJA 2O3ZA 4HY1A 4JI0I 4DR5I 2MKNA 4PRVA 2CT1A 4DPXA 2DMIA 2EOZA 5AE3A 2HHHI 2LVHA 2UXCI 2V86A 2EPRA 2PNZA 3M99B 1NHIA 3Q6NA 4DR1E 2ENHA 2VE7C 4B3RE 1AH5A 3T1YI 4DV0E 2EMIA 4IZKA 2ZM6I 2EM5A 2EPNA 1FJGE 1WJPA 1P42A 2WP8A 2M9AA 1XNQI 4GKJI 2LJHA 2NUEA 3AUZA 2WBTA 2L2MA 3MHHC 1Z0BA 4DV2I 5AE1A 4R2RA 4DXLA 4P78A 4DU8A 3KWRA 1N34E 5ADZA 4PU9A 3K6QA 3J80Q 4IS1C 1KYQA 5FLXC 4FW9A 2EPKX 3ZKDA 5FWKA 1PKPA 5JEAB 3B82A 2KONA 3FIGA 4J3DA 2MKDA 2UU9E 2LRSA 1Z0WA 4FWGA 1YYKA 4L8NA 3KRNA 1WUUA 2PO1B 1X47A 5K36B 1IQOA 1Z0EA 4DR5E 4OO1F 2DSYA 3J81C 4JI0E 1OYPA 2ENCA 2EOHA 1Z0TA 4IZJD 1KVKA 4NBQA 2ODRC 4WFTA 3L7ZA 2HHHE 2DB2A 1EKZA 1TF3A 4R2EA 2UXCE 2NPFA 2YTQA 4B3MI 2YTDA 1WRJA 4BA2A 5IT9Q 2V34A 2C39B 4M0VA 4N4RB 4FW7A 2GQ0A 3T1YE 3UHMA 3M7NG 2LO3A 2EN8A 2ZM6E 2M1SA 2LE2A 4GKJE 2E1RA 1XNQE 5BR8I 1O0WA 2L33A 3CDJA 2L8TA 4DV2E 5A6BD 1EH6A 2EOEA 2NA2A 2PO0A 2WNRA 2EPCA 1YFHA 5DNXA 3HJCA 4DMIA 4LFBI 1OYRA 4KHPI 2DIXA 2V8PA 1UHZA 2EWLA 3F6GA 2J7JA 1UDQA 4NXMI 2PNLA 4M1KA 5AC4A 4WPYA 4O4KA 2V2VA 1EI1A 4BCAA 1UDOA 2MDRA 3RMPA 1RQ0A 4QNJA 4B3ME 3EPJA 2CSHA 3J7Yp 1JK2A 1RR9A 4WUDA 2E5LI 2EMXA 4WSGA 5IV8B 1PDAA 5A2QC 2H36X 2EMHA 2YTJA 3DF6A 1B63A 1ZXNA 4MU3A 1EH8A 4DV7E 1SFEA 2PNZB 2EMLA 5BR8E 4B3SI 3LLHA 2V8QB 1YUIA 4GKKE 4IZKB 3C4BA 4P52A 1E3HA 2HGHA 4JG4A 2JPAA 2YTOA 3V2UC 4ZYGA 2B9DA 4LFBE 4HEIA 2YTGA 2L3CA 4KHPE 4LCHA 4KQVA 3GLLA 4R2QA 2CPNA 2CVEA 2JP9A 4USKA 1PIEA 2K4VA 2F1DA 4NXME 3ZKBA 3B4TA 2EQ3A 1USUA 3DD6A 4DV6I 2JWOA 5KL7A 4F6MA 3M7ND 2L6MA 4U3BA 2DMYA 3IWCA 3LNUA 3PYGA 1S4EA 4ED4A 2JVAA 2YPNA 2E1MA 1ELOA 2CG9A 3MSWA 2EOJA 4HACB 1PJSA 2EMZA 4ZYEA 5C0XF 1XMQI 2FTXB 5K36D 1UILA 4R2CA 1Y5YA 2E5LE 1HNZI 2FGGA 2RSIA 2HFSA 1N36I 2EM3A 2LUPB 4GQUA 3K1JA 1XMOI 2NN6F 4MLQA 2L2NA 3WU6A 4FW3A 2DLKA 4WXCA 4B3SE 1H73A 3JTZA 1HR0I 4OO1E 1ZM3A 2O1TA 5KL2A 1Z1BA 1T4LB 2EN7A 4IFDC 1A1GA 2EQ0A 1T39A 1UN6B 2YU5A 2V89A 3C4TA 4OOGC 5AASA 3J80C 1MEYC 2AE8A 2EM9A 2MC5A 2YRHA 2VQFI 2WNRB 3P1XA 1ZM2A 1VISA 2X7IA 5ELWA 2WCC3 1BBOA 3P3EA 1T4NA 2UUAI 4DV6E 1A1HA 2C37A 2LJPA 4DR3I 4R1FA 2RS6A 4OO1A 1HNXI 3L00A 1NZ0A 3K17A 2R1FA 3KZZA 2DGCA 2BA0G 4YHHI 4FWHA 1PVGA 3CWVA 1T38A 1KJKA 1XMQE 4Q35B 2R3VA 3Q6MA 4MYTA 4I3HA 3IWBA 1HNZE 2EM4A 4WUCA 5IT9C 1N36E 1WXRA 2Z5BA 1XMOE 4IFDD 1J26A 2YTIA 1X5WA 4NXNI 1A1KA 5GMEA 5KL6A 1IQSA 4R2PA 4JI4I 3C6KA 2RSMA 1MG7A 2EN1A 1L4SA 2YTEA 3WU4A 4LF7I 2BR2B 2LTRA 1HR0E 2BM0A 5JEAF 2RTXA 2RS7A 2EPXA 4LOMA 2PRTA 4JI1I 2HK2A 4WUBA 3VYXA 1E3PA 2EPPA 3KZYA 2VESA 2VQFE 2EPOA 1YYOA 1MX0A 2L3JA 2K7IA 1T4OA 3EQ1A 1Y6ZA 2GO4A 4AIMA 3T1HI 2A2CA 4Q28A 3HTXA 2YT4A 2Z5CB 3ZZUA 1OJ4A 2UUAE 1YZ9A 1EA6A 1K47A 1DQ3A 2V2ZA 3ZZTA 4ZVIA 4DR3E 4O24A 1A1IA 1HNXE 1F2IG 5DROA 2B7VA 4YHHE 4HTGA 3ZZ0A 2B7TA 4J8ZA 3ECRA 4AIDA 1ZM9A 2IERA 2UXDI 3J7AG 3BGHA 1ZXMA 1Z0GA 2C38B 2UUBI 4JI2I 1FI4A 2JOBA 4LPFA 4NXNE 4R03A 4BHBA 4JI4E 1QNTA 2DEIA 2JT2A 4ZYDA 2EOSA 3PS1A 2EM0A 2NUGA 4R8OA 3TQMA 1STUA 1RHYA 4LF7E 3P06A 4DV7I 2EL5A 2EMWA 3B78A 4PRXA 2EN6A 4DUZI 4R2AA 4JI1E 4GKKI 4IZJA 2WW4A 2YSPA 1X49A 3WU3A 1IBKI 4GEQB 2EOQA 2JXPA 5A69A 4JV5E 4Z7CA 3T1HE 2BA0D 4F9BB 5A6KA 5C0XE 4OX9I 2HKJA 2EE8A 2GPIA 2IOPA 2NN6E 1IBMI 2WBUA 4FWDA 4DV3I 2PO2A 4DV1I 1N33I 4BA1A 3K85A 2ODRD 3HKMA 1LLMC 2RQLA 3Q1QA 2R76A 4MYUA 2V85A 1PJQA 3PYFA 4OZEA 1IBLI 3U1YA 2YTNA 4DUYI 2UXDE 5GMDA 2ELYA 5C0XA 4B3TI 4IFDB 1J5EI 1Z5CA 4F9CB 4LF9I 3JAMQ 2UUBE 4JI2E 2NN6A 3H1CA 2LBSB 2RPCA 3ADLA 2GS8A 3PYDA 5DNYA 3EPLA 1GZ6A 5LMNI 2MC6A 2WZOA 4DUZE 5L3JA 4JI5I 3GCMA 2I13A 3PRYA 2CTDA 1IBKE 1IBLE 2BM1A 2G7HA 4OX9E 2WP8B 5EL9A 2JEAA 2PO1A 4KZSA 1JK1A 5AC5A 4DPTA 3ZOQB 2EMCA 4K0KI 4LU9A 1AAYA 1IBME 2EORA 3CDIA 1QU6A 2HFUA 4DV3E 4DV1E 1N33E 2GO3A 3JU0A 3LMLA 2KOUA 1NCSA 4WX9A 4JI6I 2PNMA 4F2JC 2EMAA 1Z5AA 5JEAE 3LPSA 4QNKA 4Z7YA 2V87A 1Z0VA 2A2DA 1X48A 4DUYE 2EJ4A 4B3TE 4FN5A 2IHR1 3HQ1A 1J5EE 2UUCI 2MDGA 3HULA 1Z0CA 4P7AA 4LF9E 5EKWA 4AQYI 4M9VC 4RHBB 2KHXA 3QT8A 2EN3A 5A6JA 1IMUA 3L7ZB 1ZAAC 4BC7A 2JYAA 4BA2B 5LMNE 3EPKA 2EPUA 1R6LA 3ADGA 3ZM7A 2EZ6A 5JEAA 4I8OA 4JI5E 4BHCA 3HPSA 1BBGA 2YSOA 4OO1C 2JR1A 1UBDC 4LTYA 4X9JA 1XXEA 2EPZA 4MDTA 2X36A 1B69A 2LJUA 3OTOI 4AM3A 4JI3I 4MU1A 2EL6A 4K0KE 4U3DA 4ISAA 2PO0B 4DU7A 1KTVA 2BBGA 4TUGA 4FW6A 3QG5C 4MU4A 4DV4I 4JI6E 1YYWA 2V88A 4DKKA 2C39A 2Q8UA 2JE6A 2EN4A 4DR2I 4NZVA 5DRQA 1B62A 2VF1A 2E72A 1RC7A 4L5NC 1GTKA 2VQEI 4WXDA 2UUCE 4KWYA 4M30A 4AQYE 5C0XB 2EN2A 4YY3I 4X64I 1RREA 4OO1D 1X6FA 2EOIA 5AE2A 4BBYA 1P47A 4N3OA 1HNWI 2EOFA 5LMUI 3QT5A 2LUQA 1YPNA 2L92A 1S16A 5IWAI 1VI7A 3P3GA 4MLVA 5A6AA 3QT7A 3OTOE 4JI3E 2J7KA 3D4JA 1ZBQA 2DEJA 5K36F 2N8XA 4F9AB 1ZR9A 2ZITA 1X6EA 3THOB 4BMJA 1H72C 4DV4E 1FWLA 4X62I 2HK3A 4LFCI 3THNA 3ADJA 4JI8I 4WSPA 2LTSA 2CGEA 4RH8A 2UXBI 2ADRA 3GMEA 4DR2E 2EP3A 3LTOA 2EPAA 1DARA 2O1WA 2D9HA 5LLQA 2VQEE 1ZM4A 2JEBA 3B8HA 2V83A 2O1UA 2YTFA 2EM6A 1Y60A 3JAMC 4YY3E 4X64E 1USVA 5DRPA 4LFAI 2ELZA 1XNRI 2EPLX 2GLIA 1A6FA 1MU5A 4FW4A 1HNWE 2CZ9A 4UT4A 5LMUE 2VF3A 4LF8I 3VHTB 1YH8A 4DR7I 2EOXA 4M2ZA 2F8BA 2LCEA 5IWAE 4MU0A 1KKHA 4IS9A 2YWQA 2EL4A 4P7DA 2EOMA 5TSEA 1NEIA 3VK6A 4DR6I 1TN9A 2F4VI 4DPYA 5T6JA 2OI2A 4LF4I 1X3CA 1N3GA 1I94I 1ZBTA 4X65I 1X6HA 4HACA 4BS9A 4IFDF 4UTGA 3F6HA 4X62E 4JI8E 4LFCE 1H7SA 1H7UA 1UDNA 2B3TB 2DLQA 2NN6C 4O43A 1OYSA 2UXBE 1YSAC 2BA1G 2HKEA 4LF5I 4ZYHA 2C37B 2O1VA
chains in the Genus database with same CATH topology
2L2KB 2YZTA 4LFAE 1XNRE 2M4IA 1WHQA 1GQEA 1N0UA 2ZBKB 3PYEA 4USMA 4RPFA 4EMDA 1N32I 4DPUA 4LF8E 3ADIA 2Z5BB 4LF6I 4DR7E 4HYMA 1N0VC 3J7AM 5F3WA 2NUFA 4DR4I 1SR9A 2IOQA 5FLXQ 3V5RA 2R42A 1HK7A 4DR6E 2F4VE 3GONA 4LF4E 1NHJA 4X66I 2JY9A 4DV5I 1I94E 4X65E 3HPZA 3M6AA 2BV3A 3J81Q 1D6TA 1BKNA 1DI2A 4F54A 4LF5E 5LL6R 4JI7I 4TUIA 4HXZA 2LMZA 1FWKA 1QZRA 4X8WA 3H4LA 3OMLA 4BC9A 1N32E 4LF6E 2V2QA 2M7QA 2Z5CA 3VYYA 4DR4E 2XEXA 1WHNA 3AV0A 1FNMA 2Q2EB 4X66E 4JYAI 4DV5E 1NHHA 4IZJB 2Z5EA 1XHKA 3IWDA 3HXLA 1U2RA 4JI7E 3H09A 2JOXA 4WYQB 3F0NA 5A2QQ 4DR1I 5CFFE 4B3RI 2N3HA 4DV0I 3QT6A 1FJGI 4URLA 1Z59A 4XTJA 1Z5BA 1KIJA 3DJWA 1N34I 1FKAE 1UEKA 2N3GA 2FV4B 1Y4UA 4DPWA 4JYAE 2AJ4A 1H74A 2UU9I 3WU5A 2EFGA 4HY1A 1Y4SA 4DR5I 4JI0I 4PRVA 4DPXA 5AE3A 2HHHI 2UXCI 2V86A 1NHIA 3Q6NA 4DR1E 2VE7C 4B3RE 3T1YI 4DV0E 4IZKA 2ZM6I 1FJGE 4GKJI 1XNQI 2LJHA 2NUEA 3AUZA 1Z0BA 2L2MA 4DV2I 5AE1A 4DXLA 4P78A 4DU8A 3KWRA 1N34E 5ADZA 4PU9A 3K6QA 3J80Q 5FLXC 4FW9A 3ZKDA 5FWKA 1PKPA 3B82A 2KONA 3FIGA 2UU9E 2LRSA 1Z0WA 4FWGA 1YYKA 4L8NA 1WUUA 1X47A 1Z0EA 4DR5E 2DSYA 3J81C 4JI0E 1Z0TA 4IZJD 1KVKA 2ODRC 4WFTA 2HHHE 2DB2A 1EKZA 2NPFA 2UXCE 4B3MI 5IT9Q 2V34A 4M0VA 2GQ0A 3T1YE 2ZM6E 2M1SA 2LE2A 4GKJE 2E1RA 1XNQE 5BR8I 1O0WA 2L33A 2L8TA 4DV2E 2NA2A 3HJCA 4DMIA 4LFBI 4KHPI 2DIXA 2V8PA 1UHZA 2EWLA 3F6GA 4NXMI 2PNLA 4M1KA 4WPYA 2V2VA 1EI1A 4BCAA 2MDRA 3RMPA 1RQ0A 4B3ME 3J7Yp 1RR9A 4WUDA 2E5LI 5A2QC 2H36X 1ZXNA 3DF6A 1B63A 4DV7E 5BR8E 4B3SI 3LLHA 2V8QB 4GKKE 4IZKB 3C4BA 4P52A 4JG4A 3V2UC 2B9DA 4LFBE 2L3CA 4KHPE 4KQVA 2CPNA 4USKA 1PIEA 2K4VA 4NXME 3ZKBA 1USUA 4DV6I 2JWOA 2L6MA 2DMYA 3IWCA 3LNUA 3PYGA 1S4EA 4ED4A 2JVAA 1ELOA 2E1MA 2CG9A 4ZVIA 3MSWA 4HACB 1XMQI 2FTXB 1UILA 2E5LE 1HNZI 2FGGA 2HFSA 1N36I 1XMOI 2LUPB 3K1JA 2L2NA 3WU6A 4B3SE 1H73A 3JTZA 1HR0I 1ZM3A 2O1TA 1T4LB 3C4TA 2V89A 4OOGC 3J80C 5AASA 2MC5A 2VQFI 3P1XA 1ZM2A 1VISA 2X7IA 2UUAI 1T4NA 4DV6E 2LJPA 4DR3I 4R1FA 2RS6A 1HNXI 1NZ0A 3K17A 4YHHI 4FWHA 1PVGA 3CWVA 2R3VA 1XMQE 3Q6MA 4MYTA 4I3HA 3IWBA 1HNZE 4WUCA 5IT9C 1N36E 1WXRA 2Z5BA 1XMOE 1J26A 4NXNI 5GMEA 4JI4I 2RSMA 1MG7A 3WU4A 4LF7I 2LTRA 1HR0E 2BM0A 2RTXA 2RS7A 4JI1I 2HK2A 4WUBA 3VYXA 4JV5I 2VQFE 1YYOA 1MX0A 2L3JA 1Y6ZA 1T4OA 3T1HI 2A2CA 4Q28A 3HTXA 2YT4A 2Z5CB 3ZZUA 1OJ4A 2UUAE 1YZ9A 1EA6A 1K47A 1DQ3A 2V2ZA 3ZZTA 4DR3E 1HNXE 2B7VA 4YHHE 3ZZ0A 2B7TA 4J8ZA 1ZM9A 2UXDI 3J7AG 1ZXMA 1Z0GA 2UUBI 4JI2I 1FI4A 2JOBA 4NXNE 4R03A 4JI4E 2DEIA 2NUGA 4R8OA 1STUA 4LF7E 3P06A 4DV7I 3B78A 4PRXA 4DUZI 4JI1E 4GKKI 4IZJA 2WW4A 1X49A 3WU3A 1IBKI 4GEQB 4JV5E 1IBLI 4Z7CA 4OX9I 3T1HE 4F9BB 2HKJA 2IOPA 1IBMI 4FWDA 4DV3I 4DV1I 1N33I 3K85A 2ODRD 3Q1QA 4MYUA 2V85A 3PYFA 4DUYI 2UXDE 5GMDA 4B3TI 1J5EI 1Z5CA 4F9CB 4LF9I 3JAMQ 2UUBE 4JI2E 2LBSB 3ADLA 2GS8A 3PYDA 5DNYA 1GZ6A 5LMNI 2MC6A 2WZOA 4DUZE 5L3JA 4JI5I 3PRYA 1IBKE 1IBLE 2BM1A 2G7HA 4OX9E 4KZSA 4DPTA 3ZOQB 4K0KI 4LU9A 1IBME 1QU6A 2HFUA 4DV3E 4DV1E 1N33E 3JU0A 3LMLA 2KOUA 4JI6I 2PNMA 1Z5AA 3LPSA 4Z7YA 2V87A 1Z0VA 2A2DA 1X48A 4DUYE 4FN5A 4B3TE 2IHR1 3HQ1A 1J5EE 2UUCI 3HULA 1Z0CA 4P7AA 4LF9E 4AQYI 3QT8A 2KHXA 4BC7A 5LMNE 3ZM7A 3ADGA 2EZ6A 4I8OA 4JI5E 3HPSA 2JR1A 4LTYA 2X36A 3OTOI 4JI3I 4K0KE 4DU7A 1KTVA 4TUGA 4DV4I 4JI6E 1YYWA 2V88A 4DKKA 4DR2I 1B62A 2VF1A 1RC7A 4L5NC 2VQEI 2UUCE 4M30A 4AQYE 4YY3I 4X64I 1RREA 5AE2A 4BBYA 4N3OA 1HNWI 5LMUI 3QT5A 2LUQA 2L92A 1S16A 5IWAI 3QT7A 3OTOE 4JI3E 2J7KA 3D4JA 1ZBQA 2DEJA 4F9AB 2ZITA 4BMJA 1H72C 4DV4E 1FWLA 4X62I 2HK3A 4LFCI 4JI8I 3ADJA 4WSPA 2LTSA 2CGEA 2UXBI 4DR2E 3LTOA 2O1WA 1DARA 2VQEE 1ZM4A 3B8HA 2V83A 2O1UA 3JAMC 4YY3E 4X64E 1USVA 4LFAI 1XNRI 1A6FA 1MU5A 1HNWE 2CZ9A 4UT4A 5LMUE 2VF3A 4LF8I 4DR7I 4M2ZA 2F8BA 5IWAE 1KKHA 4P7DA 3VK6A 4DR6I 2F4VI 4DPYA 5T6JA 2OI2A 4LF4I 1I94I 1ZBTA 4X65I 4HACA 4BS9A 4UTGA 3F6HA 4X62E 4JI8E 4LFCE 1H7SA 1H7UA 2B3TB 2UXBE 2HKEA 4LF5I 2O1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2K B;  4LFA E;  1XNR E;  1WHQ A;  1GQE A;  1N0U A;  2ZBK B;  3PYE A;  4USM A;  4RPF A;  4EMD A;  1N32 I;  4DPU A;  4LF8 E;  3ADI A;  4LF6 I;  4DR7 E;  4HYM A;  1N0V C;  3J7A M;  2NUF A;  4DR4 I;  5FLX Q;  3V5R A;  2R42 A;  4DR6 E;  2F4V E;  3GON A;  4LF4 E;  1NHJ A;  4X66 I;  2JY9 A;  4DV5 I;  1I94 E;  4X65 E;  3M6A A;  2BV3 A;  3J81 Q;  1D6T A;  1BKN A;  1DI2 A;  4LF5 E;  5LL6 R;  4JI7 I;  4HXZ A;  1FWK A;  1QZR A;  4X8W A;  3H4L A;  1N32 E;  4LF6 E;  2V2Q A;  3VYY A;  4DR4 E;  2XEX A;  1WHN A;  1FNM A;  2Q2E B;  4X66 E;  4JYA I;  4DV5 E;  1NHH A;  1XHK A;  1U2R A;  4JI7 E;  4WYQ B;  3F0N A;  5A2Q Q;  4DR1 I;  5CFF E;  4B3R I;  2N3H A;  4DV0 I;  3QT6 A;  1FJG I;  4URL A;  1Z59 A;  4XTJ A;  1Z5B A;  1KIJ A;  1N34 I;  1FKA E;  1UEK A;  2N3G A;  4DPW A;  4JYA E;  2AJ4 A;  1H74 A;  2UU9 I;  3WU5 A;  2EFG A;  4HY1 A;  4DR5 I;  4JI0 I;  4PRV A;  4DPX A;  2HHH I;  2UXC I;  1NHI A;  4DR1 E;  4B3R E;  3T1Y I;  4DV0 E;  2ZM6 I;  1FJG E;  4GKJ I;  1XNQ I;  2LJH A;  2NUE A;  1Z0B A;  2L2M A;  4DV2 I;  4DXL A;  4DU8 A;  1N34 E;  4PU9 A;  3J80 Q;  5FLX C;  4FW9 A;  3ZKD A;  1PKP A;  3B82 A;  2UU9 E;  2LRS A;  1Z0W A;  4FWG A;  1YYK A;  1WUU A;  1X47 A;  1Z0E A;  4DR5 E;  3J81 C;  4JI0 E;  1Z0T A;  1KVK A;  4WFT A;  2HHH E;  2DB2 A;  1EKZ A;  2NPF A;  2UXC E;  4B3M I;  5IT9 Q;  2V34 A;  3T1Y E;  2ZM6 E;  4GKJ E;  2E1R A;  1XNQ E;  5BR8 I;  1O0W A;  2L33 A;  4DV2 E;  2NA2 A;  4LFB I;  4KHP I;  2DIX A;  2V8P A;  1UHZ A;  4NXM I;  4M1K A;  2V2V A;  1EI1 A;  2MDR A;  1RQ0 A;  4B3M E;  3J7Y p;  1RR9 A;  4WUD A;  2E5L I;  5A2Q C;  1ZXN A;  1B63 A;  4DV7 E;  5BR8 E;  4B3S I;  3LLH A;  4GKK E;  3C4B A;  4P52 A;  4JG4 A;  3V2U C;  4LFB E;  2L3C A;  4KHP E;  4KQV A;  2CPN A;  4USK A;  1PIE A;  4NXM E;  3ZKB A;  4DV6 I;  2DMY A;  3LNU A;  3PYG A;  1S4E A;  4ED4 A;  2JVA A;  1ELO A;  4ZVI A;  4HAC B;  1XMQ I;  1UIL A;  2E5L E;  1HNZ I;  2HFS A;  1N36 I;  1XMO I;  2LUP B;  3K1J A;  2L2N A;  3WU6 A;  4B3S E;  1H73 A;  1HR0 I;  1ZM3 A;  1T4L B;  3C4T A;  4OOG C;  3J80 C;  2VQF I;  3P1X A;  1ZM2 A;  1VIS A;  2X7I A;  2UUA I;  1T4N A;  4DV6 E;  2LJP A;  4DR3 I;  4R1F A;  2RS6 A;  1HNX I;  1NZ0 A;  3K17 A;  4YHH I;  4FWH A;  1PVG A;  3CWV A;  2R3V A;  1XMQ E;  4MYT A;  4I3H A;  1HNZ E;  4WUC A;  5IT9 C;  1N36 E;  1XMO E;  1J26 A;  4NXN I;  5GME A;  4JI4 I;  2RSM A;  1MG7 A;  3WU4 A;  4LF7 I;  2LTR A;  1HR0 E;  2BM0 A;  2RTX A;  2RS7 A;  4JI1 I;  2HK2 A;  4WUB A;  3VYX A;  4JV5 I;  2VQF E;  1YYO A;  1MX0 A;  2L3J A;  3T1H I;  1T4O A;  2A2C A;  3HTX A;  2YT4 A;  3ZZU A;  1OJ4 A;  2UUA E;  1YZ9 A;  1EA6 A;  1K47 A;  2V2Z A;  3ZZT A;  4DR3 E;  1HNX E;  2B7V A;  4YHH E;  3ZZ0 A;  2B7T A;  1ZM9 A;  2UXD I;  1ZXM A;  3J7A G;  1Z0G A;  2UUB I;  4JI2 I;  1FI4 A;  4NXN E;  4JI4 E;  2DEI A;  2NUG A;  1STU A;  4LF7 E;  4DV7 I;  3B78 A;  4PRX A;  4DUZ I;  4JI1 E;  4GKK I;  2WW4 A;  1X49 A;  3WU3 A;  1IBK I;  4JV5 E;  1IBL I;  4Z7C A;  4OX9 I;  3T1H E;  2HKJ A;  1IBM I;  4FWD A;  4DV3 I;  4DV1 I;  1N33 I;  3Q1Q A;  4MYU A;  3PYF A;  4DUY I;  2UXD E;  5GMD A;  4B3T I;  1J5E I;  1Z5C A;  4LF9 I;  3JAM Q;  2UUB E;  4JI2 E;  2LBS B;  3ADL A;  2GS8 A;  3PYD A;  5LMN I;  4DUZ E;  5L3J A;  4JI5 I;  1IBK E;  1IBL E;  2BM1 A;  4OX9 E;  4DPT A;  4K0K I;  1IBM E;  1QU6 A;  2HFU A;  4DV3 E;  4DV1 E;  1N33 E;  4JI6 I;  1Z5A A;  3LPS A;  4Z7Y A;  1Z0V A;  2A2D A;  1X48 A;  4DUY E;  4FN5 A;  4B3T E;  2IHR 1;  1J5E E;  2UUC I;  3HUL A;  1Z0C A;  4P7A A;  4LF9 E;  4AQY I;  3QT8 A;  2KHX A;  5LMN E;  3ZM7 A;  3ADG A;  2EZ6 A;  4JI5 E;  2X36 A;  3OTO I;  4JI3 I;  4K0K E;  4DU7 A;  1KTV A;  4DV4 I;  4JI6 E;  1YYW A;  4DKK A;  4DR2 I;  1B62 A;  1RC7 A;  2VQE I;  2UUC E;  4M30 A;  4AQY E;  4YY3 I;  4X64 I;  1RRE A;  1HNW I;  5LMU I;  3QT5 A;  2LUQ A;  1S16 A;  5IWA I;  3QT7 A;  3OTO E;  4JI3 E;  2J7K A;  3D4J A;  2DEJ A;  2ZIT A;  1H72 C;  4DV4 E;  1FWL A;  4X62 I;  2HK3 A;  4LFC I;  4JI8 I;  3ADJ A;  2LTS A;  2UXB I;  4DR2 E;  3LTO A;  1DAR A;  2VQE E;  1ZM4 A;  3B8H A;  4YY3 E;  3JAM C;  4X64 E;  4LFA I;  1XNR I;  1A6F A;  1MU5 A;  1HNW E;  2CZ9 A;  4UT4 A;  5LMU E;  2VF3 A;  4LF8 I;  4DR7 I;  4M2Z A;  5IWA E;  1KKH A;  4DR6 I;  2F4V I;  4DPY A;  2OI2 A;  4LF4 I;  1I94 I;  1ZBT A;  4X65 I;  4HAC A;  4UTG A;  4X62 E;  1H7S A;  4JI8 E;  4LFC E;  1H7U A;  2B3T B;  2UXB E;  2HKE A;  4LF5 I; 
#chains in the Genus database with same CATH topology
 2JE6 B;  5A6B A;  4OO1 B;  4LCG A;  2L2K B;  2YZT A;  2NAB A;  4LFA E;  1XNR E;  2M4I A;  2EQ1 A;  3U1K A;  1WHQ A;  1GQE A;  1N0U A;  3PS3 A;  2ZBK B;  3PYE A;  4USM A;  4RPF A;  4EMD A;  1N32 I;  4DPU A;  4LF8 E;  3ADI A;  2Z5B B;  5C0X D;  1DGC A;  4DR7 E;  1N0V C;  4HYM A;  4LF6 I;  3J7A M;  4GZN C;  5F3W A;  2NUF A;  2YRM A;  1MGT A;  4DR4 I;  5C0X C;  1SR9 A;  2IOQ A;  2BB8 A;  5FLX Q;  2EMY A;  3UK3 C;  2NN6 D;  4R2D A;  2R42 A;  1HK7 A;  3V5R A;  4DR6 E;  3PS2 A;  2F4V E;  3GON A;  3M85 G;  4LF4 E;  2LT7 A;  1NHJ A;  4X66 I;  2JY9 A;  4DV5 I;  1A1J A;  4OKG A;  1I94 E;  2YTP A;  4X65 E;  2EMG A;  3HPZ A;  3M6A A;  2BV3 A;  3J81 Q;  5IXM B;  1D6T A;  1BKN A;  1DI2 A;  4F54 A;  4LF5 E;  5LL6 R;  4JI7 I;  4TUI A;  2LV2 A;  5JEA C;  2ENA A;  2YRK A;  2WBS A;  4HXZ A;  2J65 A;  2LMZ A;  2EMB A;  1FWK A;  1QZR A;  4X8W A;  2BR2 A;  3H4L A;  1R6M A;  5DNL A;  4JV5 I;  3OML A;  2JEB B;  4BC9 A;  5K36 E;  5K36 C;  3BBG A;  1BB8 A;  1N32 E;  4LF6 E;  2V2Q A;  1G2D C;  2EPM X;  2GHF A;  2M7Q A;  4R2S A;  2EM2 A;  3VYY A;  1A1F A;  2IES A;  4DR4 E;  2Z5C A;  2XEX A;  1WHN A;  2I9I A;  4NHR A;  3AV0 A;  2BA1 D;  1FNM A;  2Q2E B;  1PJT A;  4X66 E;  4JYA I;  5K36 A;  4DV5 E;  1NHH A;  4IZJ B;  2Z5E A;  4O5G A;  4LCF A;  5JEA D;  1XHK A;  2VRD A;  3P3C A;  3IWD A;  3HXL A;  5KL3 A;  2C38 A;  1U2R A;  2YU8 A;  4JI7 E;  2PO2 B;  1A1L A;  4BA1 B;  5KL4 A;  3H09 A;  5KL5 A;  2JOX A;  2EOO A;  2EMK A;  4WYQ B;  3F0N A;  5A2Q Q;  4DR1 I;  5CFF E;  4B3R I;  2N3H A;  2EM7 A;  4DV0 I;  3QT6 A;  5DRR A;  2A25 A;  1FJG I;  1UDS A;  4F6N A;  4URL A;  3M85 D;  3NZK A;  4IFD E;  1Z59 A;  4XTJ A;  4FK5 C;  1Z5B A;  2NN6 B;  1KIJ A;  3DJW A;  4FW5 A;  3P76 A;  1N34 I;  1FKA E;  1TF6 A;  2EOY A;  1ZU1 A;  2EM8 A;  2HJJ A;  3BF2 A;  3BID A;  1UEK A;  2N3G A;  2FV4 B;  1Y4U A;  4MQY A;  4DPW A;  4JYA E;  2AJ4 A;  1H74 A;  2UU9 I;  3EPH A;  1EH7 A;  4IJD A;  2EMF A;  1RMD A;  2HC5 A;  4IFD A;  3MHS C;  2DRP A;  1YHC A;  3WU5 A;  2JEA B;  1G2F C;  3C6M A;  1Y4S A;  2EFG A;  1YUJ A;  2O3Z A;  4HY1 A;  4JI0 I;  4DR5 I;  2MKN A;  4PRV A;  2CT1 A;  4DPX A;  2DMI A;  2EOZ A;  5AE3 A;  2HHH I;  2LVH A;  2UXC I;  2V86 A;  2EPR A;  2PNZ A;  3M99 B;  1NHI A;  3Q6N A;  4DR1 E;  2ENH A;  2VE7 C;  4B3R E;  1AH5 A;  3T1Y I;  4DV0 E;  2EMI A;  4IZK A;  2ZM6 I;  2EM5 A;  2EPN A;  1FJG E;  1WJP A;  1P42 A;  2WP8 A;  2M9A A;  1XNQ I;  4GKJ I;  2LJH A;  2NUE A;  3AUZ A;  2WBT A;  2L2M A;  3MHH C;  1Z0B A;  4DV2 I;  5AE1 A;  4R2R A;  4DXL A;  4P78 A;  4DU8 A;  3KWR A;  1N34 E;  5ADZ A;  4PU9 A;  3K6Q A;  3J80 Q;  4IS1 C;  1KYQ A;  5FLX C;  4FW9 A;  2EPK X;  3ZKD A;  5FWK A;  1PKP A;  5JEA B;  3B82 A;  2KON A;  3FIG A;  4J3D A;  2MKD A;  2UU9 E;  2LRS A;  1Z0W A;  4FWG A;  1YYK A;  4L8N A;  3KRN A;  1WUU A;  2PO1 B;  1X47 A;  5K36 B;  1IQO A;  1Z0E A;  4DR5 E;  4OO1 F;  2DSY A;  3J81 C;  4JI0 E;  1OYP A;  2ENC A;  2EOH A;  1Z0T A;  4IZJ D;  1KVK A;  4NBQ A;  2ODR C;  4WFT A;  3L7Z A;  2HHH E;  2DB2 A;  1EKZ A;  1TF3 A;  4R2E A;  2UXC E;  2NPF A;  2YTQ A;  4B3M I;  2YTD A;  1WRJ A;  4BA2 A;  5IT9 Q;  2V34 A;  2C39 B;  4M0V A;  4N4R B;  4FW7 A;  2GQ0 A;  3T1Y E;  3UHM A;  3M7N G;  2LO3 A;  2EN8 A;  2ZM6 E;  2M1S A;  2LE2 A;  4GKJ E;  2E1R A;  1XNQ E;  5BR8 I;  1O0W A;  2L33 A;  3CDJ A;  2L8T A;  4DV2 E;  5A6B D;  1EH6 A;  2EOE A;  2NA2 A;  2PO0 A;  2WNR A;  2EPC A;  1YFH A;  5DNX A;  3HJC A;  4DMI A;  4LFB I;  1OYR A;  4KHP I;  2DIX A;  2V8P A;  1UHZ A;  2EWL A;  3F6G A;  2J7J A;  1UDQ A;  4NXM I;  2PNL A;  4M1K A;  5AC4 A;  4WPY A;  4O4K A;  2V2V A;  1EI1 A;  4BCA A;  1UDO A;  2MDR A;  3RMP A;  1RQ0 A;  4QNJ A;  4B3M E;  3EPJ A;  2CSH A;  3J7Y p;  1JK2 A;  1RR9 A;  4WUD A;  2E5L I;  2EMX A;  4WSG A;  5IV8 B;  1PDA A;  5A2Q C;  2H36 X;  2EMH A;  2YTJ A;  3DF6 A;  1B63 A;  1ZXN A;  4MU3 A;  1EH8 A;  4DV7 E;  1SFE A;  2PNZ B;  2EML A;  5BR8 E;  4B3S I;  3LLH A;  2V8Q B;  1YUI A;  4GKK E;  4IZK B;  3C4B A;  4P52 A;  1E3H A;  2HGH A;  4JG4 A;  2JPA A;  2YTO A;  3V2U C;  4ZYG A;  2B9D A;  4LFB E;  4HEI A;  2YTG A;  2L3C A;  4KHP E;  4LCH A;  4KQV A;  3GLL A;  4R2Q A;  2CPN A;  2CVE A;  2JP9 A;  4USK A;  1PIE A;  2K4V A;  2F1D A;  4NXM E;  3ZKB A;  3B4T A;  2EQ3 A;  1USU A;  3DD6 A;  4DV6 I;  2JWO A;  5KL7 A;  4F6M A;  3M7N D;  2L6M A;  4U3B A;  2DMY A;  3IWC A;  3LNU A;  3PYG A;  1S4E A;  4ED4 A;  2JVA A;  2YPN A;  2E1M A;  1ELO A;  2CG9 A;  3MSW A;  2EOJ A;  4HAC B;  1PJS A;  2EMZ A;  4ZYE A;  5C0X F;  1XMQ I;  2FTX B;  5K36 D;  1UIL A;  4R2C A;  1Y5Y A;  2E5L E;  1HNZ I;  2FGG A;  2RSI A;  2HFS A;  1N36 I;  2EM3 A;  2LUP B;  4GQU A;  3K1J A;  1XMO I;  2NN6 F;  4MLQ A;  2L2N A;  3WU6 A;  4FW3 A;  2DLK A;  4WXC A;  4B3S E;  1H73 A;  3JTZ A;  1HR0 I;  4OO1 E;  1ZM3 A;  2O1T A;  5KL2 A;  1Z1B A;  1T4L B;  2EN7 A;  4IFD C;  1A1G A;  2EQ0 A;  1T39 A;  1UN6 B;  2YU5 A;  2V89 A;  3C4T A;  4OOG C;  5AAS A;  3J80 C;  1MEY C;  2AE8 A;  2EM9 A;  2MC5 A;  2YRH A;  2VQF I;  2WNR B;  3P1X A;  1ZM2 A;  1VIS A;  2X7I A;  5ELW A;  2WCC 3;  1BBO A;  3P3E A;  1T4N A;  2UUA I;  4DV6 E;  1A1H A;  2C37 A;  2LJP A;  4DR3 I;  4R1F A;  2RS6 A;  4OO1 A;  1HNX I;  3L00 A;  1NZ0 A;  3K17 A;  2R1F A;  3KZZ A;  2DGC A;  2BA0 G;  4YHH I;  4FWH A;  1PVG A;  3CWV A;  1T38 A;  1KJK A;  1XMQ E;  4Q35 B;  2R3V A;  3Q6M A;  4MYT A;  4I3H A;  3IWB A;  1HNZ E;  2EM4 A;  4WUC A;  5IT9 C;  1N36 E;  1WXR A;  2Z5B A;  1XMO E;  4IFD D;  1J26 A;  2YTI A;  1X5W A;  4NXN I;  1A1K A;  5GME A;  5KL6 A;  1IQS A;  4R2P A;  4JI4 I;  3C6K A;  2RSM A;  1MG7 A;  2EN1 A;  1L4S A;  2YTE A;  3WU4 A;  4LF7 I;  2BR2 B;  2LTR A;  1HR0 E;  2BM0 A;  5JEA F;  2RTX A;  2RS7 A;  2EPX A;  4LOM A;  2PRT A;  4JI1 I;  2HK2 A;  4WUB A;  3VYX A;  1E3P A;  2EPP A;  3KZY A;  2VES A;  2VQF E;  2EPO A;  1YYO A;  1MX0 A;  2L3J A;  2K7I A;  1T4O A;  3EQ1 A;  1Y6Z A;  2GO4 A;  4AIM A;  3T1H I;  2A2C A;  4Q28 A;  3HTX A;  2YT4 A;  2Z5C B;  3ZZU A;  1OJ4 A;  2UUA E;  1YZ9 A;  1EA6 A;  1K47 A;  1DQ3 A;  2V2Z A;  3ZZT A;  4ZVI A;  4DR3 E;  4O24 A;  1A1I A;  1HNX E;  1F2I G;  5DRO A;  2B7V A;  4YHH E;  4HTG A;  3ZZ0 A;  2B7T A;  4J8Z A;  3ECR A;  4AID A;  1ZM9 A;  2IER A;  2UXD I;  3J7A G;  3BGH A;  1ZXM A;  1Z0G A;  2C38 B;  2UUB I;  4JI2 I;  1FI4 A;  2JOB A;  4LPF A;  4NXN E;  4R03 A;  4BHB A;  4JI4 E;  1QNT A;  2DEI A;  2JT2 A;  4ZYD A;  2EOS A;  3PS1 A;  2EM0 A;  2NUG A;  4R8O A;  3TQM A;  1STU A;  1RHY A;  4LF7 E;  3P06 A;  4DV7 I;  2EL5 A;  2EMW A;  3B78 A;  4PRX A;  2EN6 A;  4DUZ I;  4R2A A;  4JI1 E;  4GKK I;  4IZJ A;  2WW4 A;  2YSP A;  1X49 A;  3WU3 A;  1IBK I;  4GEQ B;  2EOQ A;  2JXP A;  5A69 A;  4JV5 E;  4Z7C A;  3T1H E;  2BA0 D;  4F9B B;  5A6K A;  5C0X E;  4OX9 I;  2HKJ A;  2EE8 A;  2GPI A;  2IOP A;  2NN6 E;  1IBM I;  2WBU A;  4FWD A;  4DV3 I;  2PO2 A;  4DV1 I;  1N33 I;  4BA1 A;  3K85 A;  2ODR D;  3HKM A;  1LLM C;  2RQL A;  3Q1Q A;  2R76 A;  4MYU A;  2V85 A;  1PJQ A;  3PYF A;  4OZE A;  1IBL I;  3U1Y A;  2YTN A;  4DUY I;  2UXD E;  5GMD A;  2ELY A;  5C0X A;  4B3T I;  4IFD B;  1J5E I;  1Z5C A;  4F9C B;  4LF9 I;  3JAM Q;  2UUB E;  4JI2 E;  2NN6 A;  3H1C A;  2LBS B;  2RPC A;  3ADL A;  2GS8 A;  3PYD A;  5DNY A;  3EPL A;  1GZ6 A;  5LMN I;  2MC6 A;  2WZO A;  4DUZ E;  5L3J A;  4JI5 I;  3GCM A;  2I13 A;  3PRY A;  2CTD A;  1IBK E;  1IBL E;  2BM1 A;  2G7H A;  4OX9 E;  2WP8 B;  5EL9 A;  2JEA A;  2PO1 A;  4KZS A;  1JK1 A;  5AC5 A;  4DPT A;  3ZOQ B;  2EMC A;  4K0K I;  4LU9 A;  1AAY A;  1IBM E;  2EOR A;  3CDI A;  1QU6 A;  2HFU A;  4DV3 E;  4DV1 E;  1N33 E;  2GO3 A;  3JU0 A;  3LML A;  2KOU A;  1NCS A;  4WX9 A;  4JI6 I;  2PNM A;  4F2J C;  2EMA A;  1Z5A A;  5JEA E;  3LPS A;  4QNK A;  4Z7Y A;  2V87 A;  1Z0V A;  2A2D A;  1X48 A;  4DUY E;  2EJ4 A;  4B3T E;  4FN5 A;  2IHR 1;  3HQ1 A;  1J5E E;  2UUC I;  2MDG A;  3HUL A;  1Z0C A;  4P7A A;  4LF9 E;  5EKW A;  4AQY I;  4M9V C;  4RHB B;  2KHX A;  3QT8 A;  2EN3 A;  5A6J A;  1IMU A;  3L7Z B;  1ZAA C;  4BC7 A;  2JYA A;  4BA2 B;  5LMN E;  3EPK A;  2EPU A;  1R6L A;  3ADG A;  3ZM7 A;  2EZ6 A;  5JEA A;  4I8O A;  4JI5 E;  4BHC A;  3HPS A;  1BBG A;  2YSO A;  4OO1 C;  2JR1 A;  1UBD C;  4LTY A;  4X9J A;  1XXE A;  2EPZ A;  4MDT A;  2X36 A;  1B69 A;  2LJU A;  3OTO I;  4AM3 A;  4JI3 I;  4MU1 A;  2EL6 A;  4K0K E;  4U3D A;  4ISA A;  2PO0 B;  4DU7 A;  1KTV A;  2BBG A;  4TUG A;  4FW6 A;  3QG5 C;  4MU4 A;  4DV4 I;  4JI6 E;  1YYW A;  2V88 A;  4DKK A;  2C39 A;  2Q8U A;  2JE6 A;  2EN4 A;  4DR2 I;  4NZV A;  5DRQ A;  1B62 A;  2VF1 A;  2E72 A;  1RC7 A;  4L5N C;  1GTK A;  2VQE I;  4WXD A;  2UUC E;  4KWY A;  4M30 A;  4AQY E;  5C0X B;  2EN2 A;  4YY3 I;  4X64 I;  1RRE A;  4OO1 D;  1X6F A;  2EOI A;  5AE2 A;  4BBY A;  1P47 A;  4N3O A;  1HNW I;  2EOF A;  5LMU I;  3QT5 A;  2LUQ A;  1YPN A;  2L92 A;  1S16 A;  5IWA I;  1VI7 A;  3P3G A;  4MLV A;  5A6A A;  3QT7 A;  3OTO E;  4JI3 E;  2J7K A;  3D4J A;  1ZBQ A;  2DEJ A;  5K36 F;  2N8X A;  4F9A B;  1ZR9 A;  2ZIT A;  1X6E A;  3THO B;  4BMJ A;  1H72 C;  4DV4 E;  1FWL A;  4X62 I;  2HK3 A;  4LFC I;  3THN A;  3ADJ A;  4JI8 I;  4WSP A;  2LTS A;  2CGE A;  4RH8 A;  2UXB I;  2ADR A;  3GME A;  4DR2 E;  2EP3 A;  3LTO A;  2EPA A;  1DAR A;  2O1W A;  2D9H A;  5LLQ A;  2VQE E;  1ZM4 A;  2JEB A;  3B8H A;  2V83 A;  2O1U A;  2YTF A;  2EM6 A;  1Y60 A;  3JAM C;  4YY3 E;  4X64 E;  1USV A;  5DRP A;  4LFA I;  2ELZ A;  1XNR I;  2EPL X;  2GLI A;  1A6F A;  1MU5 A;  4FW4 A;  1HNW E;  2CZ9 A;  4UT4 A;  5LMU E;  2VF3 A;  4LF8 I;  3VHT B;  1YH8 A;  4DR7 I;  2EOX A;  4M2Z A;  2F8B A;  2LCE A;  5IWA E;  4MU0 A;  1KKH A;  4IS9 A;  2YWQ A;  2EL4 A;  4P7D A;  2EOM A;  5TSE A;  1NEI A;  3VK6 A;  4DR6 I;  1TN9 A;  2F4V I;  4DPY A;  5T6J A;  2OI2 A;  4LF4 I;  1X3C A;  1N3G A;  1I94 I;  1ZBT A;  4X65 I;  1X6H A;  4HAC A;  4BS9 A;  4IFD F;  4UTG A;  3F6H A;  4X62 E;  4JI8 E;  4LFC E;  1H7S A;  1H7U A;  1UDN A;  2B3T B;  2DLQ A;  2NN6 C;  4O43 A;  1OYS A;  2UXB E;  1YSA C;  2BA1 G;  2HKE A;  4LF5 I;  4ZYH A;  2C37 B;  2O1V A; 
#chains in the Genus database with same CATH homology
 2L2K B;  2YZT A;  4LFA E;  1XNR E;  2M4I A;  1WHQ A;  1GQE A;  1N0U A;  2ZBK B;  3PYE A;  4USM A;  4RPF A;  4EMD A;  1N32 I;  4DPU A;  4LF8 E;  3ADI A;  2Z5B B;  4LF6 I;  4DR7 E;  4HYM A;  1N0V C;  3J7A M;  5F3W A;  2NUF A;  4DR4 I;  1SR9 A;  2IOQ A;  5FLX Q;  3V5R A;  2R42 A;  1HK7 A;  4DR6 E;  2F4V E;  3GON A;  4LF4 E;  1NHJ A;  4X66 I;  2JY9 A;  4DV5 I;  1I94 E;  4X65 E;  3HPZ A;  3M6A A;  2BV3 A;  3J81 Q;  1D6T A;  1BKN A;  1DI2 A;  4F54 A;  4LF5 E;  5LL6 R;  4JI7 I;  4TUI A;  4HXZ A;  2LMZ A;  1FWK A;  1QZR A;  4X8W A;  3H4L A;  3OML A;  4BC9 A;  1N32 E;  4LF6 E;  2V2Q A;  2M7Q A;  2Z5C A;  3VYY A;  4DR4 E;  2XEX A;  1WHN A;  3AV0 A;  1FNM A;  2Q2E B;  4X66 E;  4JYA I;  4DV5 E;  1NHH A;  4IZJ B;  2Z5E A;  1XHK A;  3IWD A;  3HXL A;  1U2R A;  4JI7 E;  3H09 A;  2JOX A;  4WYQ B;  3F0N A;  5A2Q Q;  4DR1 I;  5CFF E;  4B3R I;  2N3H A;  4DV0 I;  3QT6 A;  1FJG I;  4URL A;  1Z59 A;  4XTJ A;  1Z5B A;  1KIJ A;  3DJW A;  1N34 I;  1FKA E;  1UEK A;  2N3G A;  2FV4 B;  1Y4U A;  4DPW A;  4JYA E;  2AJ4 A;  1H74 A;  2UU9 I;  3WU5 A;  2EFG A;  4HY1 A;  1Y4S A;  4DR5 I;  4JI0 I;  4PRV A;  4DPX A;  5AE3 A;  2HHH I;  2UXC I;  2V86 A;  1NHI A;  3Q6N A;  4DR1 E;  2VE7 C;  4B3R E;  3T1Y I;  4DV0 E;  4IZK A;  2ZM6 I;  1FJG E;  4GKJ I;  1XNQ I;  2LJH A;  2NUE A;  3AUZ A;  1Z0B A;  2L2M A;  4DV2 I;  5AE1 A;  4DXL A;  4P78 A;  4DU8 A;  3KWR A;  1N34 E;  5ADZ A;  4PU9 A;  3K6Q A;  3J80 Q;  5FLX C;  4FW9 A;  3ZKD A;  5FWK A;  1PKP A;  3B82 A;  2KON A;  3FIG A;  2UU9 E;  2LRS A;  1Z0W A;  4FWG A;  1YYK A;  4L8N A;  1WUU A;  1X47 A;  1Z0E A;  4DR5 E;  2DSY A;  3J81 C;  4JI0 E;  1Z0T A;  4IZJ D;  1KVK A;  2ODR C;  4WFT A;  2HHH E;  2DB2 A;  1EKZ A;  2NPF A;  2UXC E;  4B3M I;  5IT9 Q;  2V34 A;  4M0V A;  2GQ0 A;  3T1Y E;  2ZM6 E;  2M1S A;  2LE2 A;  4GKJ E;  2E1R A;  1XNQ E;  5BR8 I;  1O0W A;  2L33 A;  2L8T A;  4DV2 E;  2NA2 A;  3HJC A;  4DMI A;  4LFB I;  4KHP I;  2DIX A;  2V8P A;  1UHZ A;  2EWL A;  3F6G A;  4NXM I;  2PNL A;  4M1K A;  4WPY A;  2V2V A;  1EI1 A;  4BCA A;  2MDR A;  3RMP A;  1RQ0 A;  4B3M E;  3J7Y p;  1RR9 A;  4WUD A;  2E5L I;  5A2Q C;  2H36 X;  1ZXN A;  3DF6 A;  1B63 A;  4DV7 E;  5BR8 E;  4B3S I;  3LLH A;  2V8Q B;  4GKK E;  4IZK B;  3C4B A;  4P52 A;  4JG4 A;  3V2U C;  2B9D A;  4LFB E;  2L3C A;  4KHP E;  4KQV A;  2CPN A;  4USK A;  1PIE A;  2K4V A;  4NXM E;  3ZKB A;  1USU A;  4DV6 I;  2JWO A;  2L6M A;  2DMY A;  3IWC A;  3LNU A;  3PYG A;  1S4E A;  4ED4 A;  2JVA A;  1ELO A;  2E1M A;  2CG9 A;  4ZVI A;  3MSW A;  4HAC B;  1XMQ I;  2FTX B;  1UIL A;  2E5L E;  1HNZ I;  2FGG A;  2HFS A;  1N36 I;  1XMO I;  2LUP B;  3K1J A;  2L2N A;  3WU6 A;  4B3S E;  1H73 A;  3JTZ A;  1HR0 I;  1ZM3 A;  2O1T A;  1T4L B;  3C4T A;  2V89 A;  4OOG C;  3J80 C;  5AAS A;  2MC5 A;  2VQF I;  3P1X A;  1ZM2 A;  1VIS A;  2X7I A;  2UUA I;  1T4N A;  4DV6 E;  2LJP A;  4DR3 I;  4R1F A;  2RS6 A;  1HNX I;  1NZ0 A;  3K17 A;  4YHH I;  4FWH A;  1PVG A;  3CWV A;  2R3V A;  1XMQ E;  3Q6M A;  4MYT A;  4I3H A;  3IWB A;  1HNZ E;  4WUC A;  5IT9 C;  1N36 E;  1WXR A;  2Z5B A;  1XMO E;  1J26 A;  4NXN I;  5GME A;  4JI4 I;  2RSM A;  1MG7 A;  3WU4 A;  4LF7 I;  2LTR A;  1HR0 E;  2BM0 A;  2RTX A;  2RS7 A;  4JI1 I;  2HK2 A;  4WUB A;  3VYX A;  4JV5 I;  2VQF E;  1YYO A;  1MX0 A;  2L3J A;  1Y6Z A;  1T4O A;  3T1H I;  2A2C A;  4Q28 A;  3HTX A;  2YT4 A;  2Z5C B;  3ZZU A;  1OJ4 A;  2UUA E;  1YZ9 A;  1EA6 A;  1K47 A;  1DQ3 A;  2V2Z A;  3ZZT A;  4DR3 E;  1HNX E;  2B7V A;  4YHH E;  3ZZ0 A;  2B7T A;  4J8Z A;  1ZM9 A;  2UXD I;  3J7A G;  1ZXM A;  1Z0G A;  2UUB I;  4JI2 I;  1FI4 A;  2JOB A;  4NXN E;  4R03 A;  4JI4 E;  2DEI A;  2NUG A;  4R8O A;  1STU A;  4LF7 E;  3P06 A;  4DV7 I;  3B78 A;  4PRX A;  4DUZ I;  4JI1 E;  4GKK I;  4IZJ A;  2WW4 A;  1X49 A;  3WU3 A;  1IBK I;  4GEQ B;  4JV5 E;  1IBL I;  4Z7C A;  4OX9 I;  3T1H E;  4F9B B;  2HKJ A;  2IOP A;  1IBM I;  4FWD A;  4DV3 I;  4DV1 I;  1N33 I;  3K85 A;  2ODR D;  3Q1Q A;  4MYU A;  2V85 A;  3PYF A;  4DUY I;  2UXD E;  5GMD A;  4B3T I;  1J5E I;  1Z5C A;  4F9C B;  4LF9 I;  3JAM Q;  2UUB E;  4JI2 E;  2LBS B;  3ADL A;  2GS8 A;  3PYD A;  5DNY A;  1GZ6 A;  5LMN I;  2MC6 A;  2WZO A;  4DUZ E;  5L3J A;  4JI5 I;  3PRY A;  1IBK E;  1IBL E;  2BM1 A;  2G7H A;  4OX9 E;  4KZS A;  4DPT A;  3ZOQ B;  4K0K I;  4LU9 A;  1IBM E;  1QU6 A;  2HFU A;  4DV3 E;  4DV1 E;  1N33 E;  3JU0 A;  3LML A;  2KOU A;  4JI6 I;  2PNM A;  1Z5A A;  3LPS A;  4Z7Y A;  2V87 A;  1Z0V A;  2A2D A;  1X48 A;  4DUY E;  4FN5 A;  4B3T E;  2IHR 1;  3HQ1 A;  1J5E E;  2UUC I;  3HUL A;  1Z0C A;  4P7A A;  4LF9 E;  4AQY I;  3QT8 A;  2KHX A;  4BC7 A;  5LMN E;  3ZM7 A;  3ADG A;  2EZ6 A;  4I8O A;  4JI5 E;  3HPS A;  2JR1 A;  4LTY A;  2X36 A;  3OTO I;  4JI3 I;  4K0K E;  4DU7 A;  1KTV A;  4TUG A;  4DV4 I;  4JI6 E;  1YYW A;  2V88 A;  4DKK A;  4DR2 I;  1B62 A;  2VF1 A;  1RC7 A;  4L5N C;  2VQE I;  2UUC E;  4M30 A;  4AQY E;  4YY3 I;  4X64 I;  1RRE A;  5AE2 A;  4BBY A;  4N3O A;  1HNW I;  5LMU I;  3QT5 A;  2LUQ A;  2L92 A;  1S16 A;  5IWA I;  3QT7 A;  3OTO E;  4JI3 E;  2J7K A;  3D4J A;  1ZBQ A;  2DEJ A;  4F9A B;  2ZIT A;  4BMJ A;  1H72 C;  4DV4 E;  1FWL A;  4X62 I;  2HK3 A;  4LFC I;  4JI8 I;  3ADJ A;  4WSP A;  2LTS A;  2CGE A;  2UXB I;  4DR2 E;  3LTO A;  2O1W A;  1DAR A;  2VQE E;  1ZM4 A;  3B8H A;  2V83 A;  2O1U A;  3JAM C;  4YY3 E;  4X64 E;  1USV A;  4LFA I;  1XNR I;  1A6F A;  1MU5 A;  1HNW E;  2CZ9 A;  4UT4 A;  5LMU E;  2VF3 A;  4LF8 I;  4DR7 I;  4M2Z A;  2F8B A;  5IWA E;  1KKH A;  4P7D A;  3VK6 A;  4DR6 I;  2F4V I;  4DPY A;  5T6J A;  2OI2 A;  4LF4 I;  1I94 I;  1ZBT A;  4X65 I;  4HAC A;  4BS9 A;  4UTG A;  3F6H A;  4X62 E;  4JI8 E;  4LFC E;  1H7S A;  1H7U A;  2B3T B;  2UXB E;  2HKE A;  4LF5 I;  2O1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...