1FKAE

Structure of functionally activated small ribosomal subunit at 3.3 a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
157
structure length
157
Chain Sequence
MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 23
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1fkaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1fkaE02
4LFCE 2R3VA 4KHPE 2CZ9A 1UHZA 3ADGA 4DR4I 3PYGA 1O0WA 3ADJA 3J80Q 1YYOA 2UXDE 2L2KB 4X66I 3OTOE 1EI1A 4NXME 2JY9A 5CFFE 4LF6I 2L2NA 1ZBTA 4DKKA 4GKKI 1XNQI 1BKNA 4DV4E 1EKZA 2UUBI 2UU9I 3LPSA 3Q1QA 2UUAI 1RREA 4HACB 4KHPI 4DV0E 2NA2A 1H74A 4DR7E 1FI4A 2HHHI 2V2ZA 4PRVA 4AQYE 5FLXC 3QT6A 4LFAI 4B3SI 2L3CA 2CPNA 2J7KA 4DR7I 1EA6A 2ZBKB 1N33I 3VYYA 2HFUA 2HK2A 1FJGE 5A2QQ 4DPUA 3QT7A 3QT5A 4I3HA 4YHHE 1HR0I 3ADIA 2LUPB 1MG7A 4M2ZA 1FJGI 5FLXQ 2DMYA 1Z0EA 1T4OA 2UXBI 1N34I 3ZKBA 4KQVA 1Z0VA 1IBLI 1PKPA 1XMQI 1HNXI 2UUBE 4YY3I 2F4VI 4B3MI 2L33A 1ZM2A 4DR6I 1NHIA 2Q2EB 4JV5I 4JI1E 4X8WA 4DR1E 4K0KI 4FWGA 5IWAI 4JI5E 4LF5E 1Z0BA 4LFBI 1PIEA 3LTOA 3J81Q 4GKKE 1IBKI 4PU9A 1X48A 1Z0CA 3J81C 1RQ0A 1UILA 5IT9C 4JI0E 2NUGA 4JI6I 4URLA 1NHJA 5IT9Q 3WU5A 1FWKA 1RR9A 4GKJI 1ZM4A 2DEIA 1Z5CA 2X36A 4JI2E 3T1HI 3B78A 1FNMA 3ADLA 4USKA 5BR8E 1IBMI 2B3TB 1Z5AA 4NXNE 4LFCI 1Z0GA 1WHQA 2GS8A 2ZITA 1IBME 1Z59A 3VYXA 2KHXA 1Z0WA 2HK3A 3T1YE 2RTXA 2UUCI 1H7SA 1N36I 3ZM7A 1ELOA 1H72C 4DR3E 1IBKE 4ZVIA 1U2RA 4DUYE 4DV2E 1GQEA 2BM0A 3K17A 3LNUA 2A2DA 2RS6A 3HTXA 4DPXA 4OX9I 1Z5BA 4B3TE 4DUYI 4DV5I 4JV5E 4X65I 4X64I 1WHNA 1J5EI 1B63A 1KKHA 1RC7A 4OX9E 5IWAE 1DI2A 1PVGA 1VISA 4JYAE 4PRXA 4LF4I 2UXBE 3K1JA 1H73A 3PYEA 2ZM6I 4DV4I 4DV2I 2V34A 4HYMA 2VF3A 2MDRA 2YT4A 4DR5I 5LMUE 2N3HA 1HNXE 2VQFE 4JI3E 3B82A 1XMOI 4LF8E 4WUDA 4WUCA 4LF7I 4LF5I 4LFAE 3HULA 2VQFI 3D4JA 4JI3I 2V8PA 1KTVA 4DV7I 1HR0E 2F4VE 1S4EA 4M30A 2JVAA 4JI7I 2E5LI 2LJHA 4OOGC 5LMNE 4JI4E 1NHHA 4X66E 1STUA 4K0KE 4DR1I 4DXLA 2V2QA 3P1XA 2EFGA 4LF9I 2BV3A 4DV6E 1I94E 2L2MA 3J80C 5L3JA 4P7AA 5GMEA 2XEXA 4GKJE 4Z7YA 3T1YI 2A2CA 1ZM9A 2NPFA 2BM1A 4ED4A 2UU9E 1YYKA 4HXZA 1XMQE 1N34E 4JI1I 4B3RE 2DB2A 1YZ9A 1XMOE 1D6TA 4B3ME 2UUCE 1S16A 2LTRA 1QZRA 1ZXMA 1YYWA 4WFTA 1HNWI 2NUEA 1B62A 4Z7CA 4FWHA 4DR4E 3PYFA 2HKJA 4WUBA 4JI7E 1FWLA 3C4TA 1HNZI 4DR3I 4DUZE 4DR5E 4LF6E 4YHHI 5LMUI 4DU8A 4JI8I 3J7Yp 1J5EE 2LTSA 1Z0TA 1MX0A 3WU4A 1N33E 4MYUA 3H4LA 4DV0I 1XHKA 4DPTA 4X62I 5A2QC 4DR2I 2HHHE 1KIJA 2WW4A 1T4LB 1N0VC 4DR6E 2R42A 4UTGA 4EMDA 4B3RI 2ZM6E 1N0UA 3ZZ0A 2UXDI 5LL6R 4UT4A 4FWDA 2EZ6A 2UXCE 1X49A 4X65E 2RS7A 2LJPA 4DV3E 4LF9E 4DR2E 2NUFA 4DV6I 3OTOI 2HFSA 1DARA 4NXMI 1FKAE 4JI5I 2DEJA 4RPFA 3J7AM 2IHR1 1T4NA 4JI4I 3LLHA 2DIXA 4DV1E 2E5LE 3ZZUA 1KVKA 2B7VA 2VQEI 3V5RA 4USMA 3T1HE 3ZZTA 2AJ4A 4X62E 4JG4A 4FW9A 4XTJA 3WU3A 2LUQA 1HNZE 1X47A 2L3JA 2UUAE 4DPWA 4JYAI 1N32E 4B3SE 1H7UA 1XNRE 2E1RA 4JI6E 4M1KA 4R1FA 4DPYA 1OJ4A 4JI2I 4DV1I 2LBSB 2X7IA 4DV5E 2V2VA 3WU6A 1J26A 4LF4E 3QT8A 3PYDA 4FN5A 2RSMA 4JI0I 3V2UC 4AQYI 1MU5A 4X64E 3GONA 3JAMQ 3F0NA 3CWVA 2UXCI 3ZKDA 4YY3E 3C4BA 5GMDA 1QU6A 2VQEE 4DUZI 2HKEA 5LMNI 1WUUA 1ZM3A 1UEKA 2N3GA 4DU7A 1XNQE 1ZXNA 4P52A 1NZ0A 2B7TA 4HACA 1K47A 1N36E 3JAMC 4B3TI 4LFBE 5BR8I 1N32I 4MYTA 4DV7E 1XNRI 3B8HA 1IBLE 4HY1A 3M6AA 3J7AG 4LF7E 4LF8I 4NXNI 1HNWE 4WYQB 4JI8E 1A6FA 2OI2A 2LRSA 4DV3I 1I94I
chains in the Genus database with same CATH superfamily
4LFCE 2C37B 4KHPE 2R3VA 2V88A 3LMLA 2MKNA 2I13A 2EQ1A 1UHZA 2CG9A 2CGEA 2CZ9A 5K36A 2HC5A 3ADGA 4DR4I 3PYGA 1O0WA 3ADJA 3J80Q 4R2AA 1YYOA 2PO1B 2UXDE 2L2KB 4X66I 3BGHA 3OTOE 1EI1A 4NXME 3C6MA 2L92A 5AASA 1X5WA 2JY9A 1YFHA 5CFFE 4P7DA 4LF6I 2BB8A 2L2NA 1ZBTA 2ADRA 3HKMA 2WP8A 2V8QB 4DKKA 2C38B 5KL7A 4GKKI 3MHSC 3KZZA 2GHFA 5AE3A 1BKNA 5C0XD 1XNQI 4DV4E 1MEYC 2J65A 2WZOA 1EKZA 4LOMA 2UUBI 2YRMA 2UU9I 2YTQA 4F6NA 1BBOA 2PO1A 2VESA 5JEAD 4O4KA 3LPSA 3Q1QA 3KZYA 2WBUA 2YPNA 2UUAI 2EL6A 1RREA 2F1DA 4HACB 2JOBA 4IS9A 4KHPI 4DV0E 2NA2A 2YTDA 2JEAA 1H74A 1L4SA 2LT7A 2JP9A 4MU4A 4DR7E 1FI4A 2N8XA 2HHHI 3AUZA 2V2ZA 3Q6NA 4PRVA 1JK2A 5AC5A 4AQYE 3THOB 1DGCA 2V86A 2YTGA 5FLXC 4FK5C 2WCC3 2BA1G 3QT6A 4LFAI 4B3SI 2L3CA 2CPNA 2EM4A 3HPZA 2J7KA 4DR7I 1EH6A 2YTIA 1EA6A 2ZBKB 4MU1A 3VYYA 2HFUA 2HK2A 1N33I 1FJGE 3OMLA 5A2QQ 3C6KA 4DPUA 3K85A 4IFDF 3QT7A 3QT5A 3DJWA 4I3HA 4YHHE 3UK3C 4Q28A 3DF6A 1HR0I 3ADIA 2F8BA 2LUPB 2M4IA 2EPZA 1MG7A 2DSYA 4M2ZA 2EOSA 2EORA 1TN9A 1FJGI 3MSWA 5FLXQ 4F6MA 2DMYA 4TUIA 1Z0EA 2GQ0A 4O24A 1T4OA 2UXBI 3M85D 3ZKBA 1N34I 5F3WA 4KQVA 1Z0VA 5KL3A 1IBLI 1PKPA 2IERA 1XMQI 3IWDA 3IWBA 2MC6A 1HNXI 5JEAA 2UUBE 3VK6A 4YY3I 2F4VI 4B3MI 2NN6D 2JXPA 3P3GA 4U3BA 2EPKX 2L33A 2NN6F 1ZM2A 2PO0B 4DR6I 1NHIA 2CT1A 1Y60A 2Q2EB 4I8OA 2M9AA 4JV5I 1X6HA 4JI1E 1R6LA 2EJ4A 2EMHA 2DGCA 2L8TA 4X8WA 4HEIA 4WPYA 4DR1E 4K0KI 4FWGA 5EKWA 2G7HA 2O1UA 4MU0A 5IWAI 2EPNA 4JI5E 4LF5E 1Z0BA 4LFBI 4LPFA 1YH8A 1PIEA 4IZJD 3LTOA 3J81Q 2EM5A 4GKKE 2JR1A 1IBKI 4PU9A 2EMZA 1B69A 1X48A 1Z0CA 3FIGA 2LJUA 3J81C 1RQ0A 1UILA 5K36C 5IT9C 4BCAA 4JI0E 3THNA 2NUGA 4JI6I 1RMDA 4URLA 4TUGA 3B4TA 5C0XB 2EPMX 1NHJA 5A6JA 1VI7A 2L6MA 5ELWA 5IT9Q 4FW5A 1KJKA 2BR2B 2WNRB 3H1CA 4OO1E 3WU5A 2EM6A 2EPRA 4IFDC 1YPNA 1FWKA 3MHHC 2LE2A 1RR9A 2JE6B 3PRYA 3M85G 4GKJI 1RHYA 1ZM4A 2DEIA 4IZKB 5AE1A 1Z5CA 2EMGA 2CSHA 2X36A 2EM2A 4JI2E 2FGGA 1T38A 1ZR9A 2M1SA 4OKGA 2EOXA 3T1HI 3B78A 5DNYA 1E3PA 4LCFA 1FNMA 3ADLA 2NN6C 5BR8E 4USKA 5IV8B 1IBMI 3M7ND 4J3DA 3DD6A 2YTNA 2B3TB 4BHCA 2EN6A 4R8OA 1Z5AA 2MDGA 3KRNA 4NXNE 4LFCI 1Z0GA 1WHQA 5C0XE 2GS8A 4WSGA 2PO2B 2ZITA 2EOIA 1IBME 1Z59A 3VYXA 2KHXA 1Z0WA 2HK3A 4IZJA 3T1YE 5DRPA 4F9BB 2EE8A 2RTXA 2JYAA 3L7ZB 2UUCI 5KL5A 1H7SA 1N36I 1IQSA 2EM8A 4O43A 3ZM7A 1ELOA 4O5GA 1H72C 4DR3E 1IBKE 4ZVIA 5JEAE 1EH7A 3NZKA 2IESA 1U2RA 4DUYE 1GQEA 4DV2E 2BM0A 2EOEA 2EMKA 1P42A 3HPSA 4NBQA 4FW7A 3K17A 3LNUA 2LCEA 1T39A 2A2DA 2EOOA 2RS6A 2C39B 3HTXA 5DRRA 4DPXA 4OX9I 2WP8B 2E72A 2EPXA 1Z5BA 4B3TE 4ZYHA 4DUYI 4DV5I 4F2JC 4JV5E 4X65I 1E3HA 1GTKA 4X64I 1OYSA 1WHNA 1J5EI 1UDNA 2EOYA 2MKDA 1B63A 1KKHA 1RC7A 4OX9E 5IWAE 1DI2A 3GLLA 4IJDA 1PVGA 1VISA 4BA2A 4BBYA 4JYAE 2IOQA 4PRXA 2EOFA 4LF4I 2UXBE 3K1JA 5C0XA 1H73A 5T6JA 3HQ1A 3PYEA 2ZM6I 4DV2I 4DV4I 4F54A 4IFDB 5TSEA 2V83A 2V34A 1PJQA 4HYMA 3M7NG 1JK1A 3EPJA 3EPKA 2VF3A 2EMIA 2MDRA 2EMYA 2YT4A 4FW6A 1ZU1A 2D9HA 2FV4B 3P06A 2CVEA 4DR5I 2KOUA 4BA1A 5LMUE 2N3HA 1HNXE 2VQFE 4JI3E 3B82A 2YTEA 4QNKA 1OYRA 1USVA 2EPLX 3PS1A 4OO1A 1XMOI 2ELZA 4LF8E 2C37A 4U3DA 2PO2A 1SFEA 4WUDA 4WUCA 4LF7I 2BA0D 2V89A 2PNZB 4LF5I 4OO1D 2FTXB 4LFAE 2V87A 2ODRC 3HULA 2K7IA 3D4JA 2VQFI 2V8PA 4JI3I 2ENAA 1ZBQA 3EPLA 1PJTA 1KTVA 4DV7I 1HR0E 2F4VE 1S4EA 1NCSA 4BA1B 4M30A 2JVAA 2EN7A 2EL5A 1Y4SA 2BR2A 4JI7I 4RHBB 3CDIA 2E5LI 2LJHA 1IMUA 2EL4A 1A1GA 2JE6A 4LCGA 4OOGC 5LMNE 4JI4E 2YSPA 1NHHA 1UDSA 4X66E 1A1HA 1STUA 1LLMC 4K0KE 4DR1I 4DXLA 2V2QA 2EOHA 1TF3A 3P1XA 4LCHA 2EFGA 4LF9I 1IQOA 2BV3A 4DV6E 1Y5YA 1I94E 2WBSA 1WJPA 2L2MA 3J80C 5L3JA 5DNXA 4P7AA 2ENHA 2CTDA 2XEXA 4GKJE 4Z7YA 5GMEA 3T1YI 2A2CA 2R1FA 3EPHA 2NABA 1ZM9A 2NPFA 4J8ZA 2BM1A 4BMJA 2YTJA 2EM9A 2UU9E 4ED4A 1YYKA 1KYQA 3Q6MA 4HXZA 3UHMA 1N3GA 4F9CB 4X9JA 4WXCA 1XMQE 3M99B 1A1FA 1WXRA 2EMWA 4L5NC 1N34E 2EOJA 4B3RE 4JI1I 1UN6B 2DB2A 2LMZA 5A6AA 2RPCA 1YZ9A 1XMOE 3P3CA 2EN3A 3K6QA 1D6TA 4ZYDA 4B3ME 2ELYA 1F2IG 4FW4A 2UUCE 3F6HA 4R2PA 3GCMA 3RMPA 1S16A 3CDJA 2EN8A 1SR9A 2LTRA 4NHRA 3P3EA 1QZRA 1ZXMA 4HTGA 5A6BD 1YYWA 4WFTA 2IOPA 3VHTB 1A1IA 2JEBA 1HNWI 2NUEA 1B62A 4Z7CA 4FWHA 2PNLA 2EMBA 4DR4E 3PYFA 2HKJA 2EOMA 4KZSA 2EQ3A 1OYPA 2Z5BB 3PS2A 4JI7E 1FWLA 4WUBA 3C4TA 2K4VA 4DR3I 1HNZI 2HGHA 4DUZE 5KL2A 4DR5E 4LF6E 5DNLA 4YHHI 5LMUI 4DU8A 3F6GA 4JI8I 4AM3A 2JPAA 3J7Yp 2EMXA 1J5EE 2LTSA 1Z0TA 2EMCA 1MX0A 3WU4A 1N33E 2ODRD 4MYUA 3H4LA 4F9AB 2NN6A 2PRTA 2EQ0A 1YSAC 4DV0I 2EOQA 2H36X 4AIDA 1XHKA 3L7ZA 4L8NA 1MGTA 4DPTA 1QNTA 4X62I 5A2QC 1USUA 4WXDA 3P76A 4DR2I 2O1VA 2KONA 5JEAF 2HHHE 4IS1C 1KIJA 4ZYEA 2WW4A 2HJJA 1T4LB 2JT2A 1N0VC 4DR6E 2R42A 1AAYA 5IXMB 4ISAA 4UTGA 2EWLA 4EMDA 2YU8A 4R2CA 4B3RI 2ZM6E 3BF2A 2EPAA 1N0UA 3ZZ0A 4LTYA 2UXDI 4DMIA 2EOZA 5LL6R 2EP3A 2GLIA 1TF6A 4UT4A 2BA0G 3IWCA 2R76A 4FWDA 4AIMA 4BC7A 2EZ6A 2UXCE 1AH5A 1X49A 4N3OA 4IZKA 2O1TA 4X65E 1GZ6A 2RS7A 2PNZA 2EPUA 3TQMA 4BA2B 2LJPA 3ZOQB 2B9DA 4DV3E 4LF9E 1X6FA 4MQYA 5DRQA 4DR2E 2I9IA 2NUFA 3OTOI 4DV6I 2HFSA 1DARA 4NXMI 4OO1C 1FKAE 4LU9A 4JI5I 2M7QA 4IFDE 2BA1D 2DEJA 1DQ3A 2WBTA 5LLQA 1G2FC 4RPFA 2IHR1 1ZAAC 3J7AM 2VRDA 1T4NA 4JI4I 3LLHA 2DIXA 2EMLA 2YTPA 4DV1E 2E5LE 3ZZUA 1KVKA 1Y6ZA 2YTFA 2B7VA 2VQEI 2LO3A 5JEAC 4M9VC 3PS3A 3V5RA 4USMA 1EH8A 4GEQB 2GO3A 2AE8A 3T1HE 3ZZTA 5ADZA 3ECRA 2AJ4A 2DLQA 2Z5CB 2EMFA 1XXEA 4X62E 1NEIA 1A1JA 5A6KA 4FW9A 4GQUA 4JG4A 4XTJA 3WU3A 2LUQA 4BS9A 5C0XC 1X6EA 2YRHA 1A1LA 5A69A 2EPCA 1HNZE 3U1YA 2O1WA 1X47A 5KL4A 5JEAB 3BIDA 2GPIA 2NN6E 2L3JA 2UUAE 4DPWA 4JYAI 5A6BA 4OO1B 2LV2A 1N32E 4R2DA 2DRPA 4B3SE 1H7UA 5AC4A 1XNRE 5K36D 5KL6A 2E1RA 2YU5A 1WRJA 4JI6E 1YUJA 2LVHA 4M1KA 4R1FA 4DPYA 2JEAB 4WX9A 1OJ4A 2YZTA 4DV1I 4JI2I 2LBSB 1PDAA 2X7IA 4DV5E 3L00A 2DLKA 2EN1A 3KWRA 2V2VA 4QNJA 3WU6A 1Y4UA 1J26A 1A1KA 4LF4E 2YRKA 4Q35B 3QT8A 3PYDA 5K36E 2VE7C 4R03A 4IFDD 1HK7A 4FN5A 2EPPA 3BBGA 4MLVA 2RSMA 2C38A 4JI0I 3V2UC 4P78A 4M0VA 4WSPA 4IZJB 4AQYI 1MU5A 4IFDA 1YHCA 2EN4A 4X64E 3GONA 3JAMQ 3F0NA 5FWKA 4OO1F 3CWVA 2UXCI 3JTZA 1UDOA 2EPOA 4MLQA 2EM0A 1PJSA 2V85A 3ZKDA 3HJCA 4YY3E 3C4BA 1UBDC 1BB8A 5GMDA 1QU6A 2VQEE 2VF1A 4R2EA 4DUZI 2HKEA 2RSIA 4R2QA 1R6MA 2C39A 2JWOA 2Z5EA 5LMNI 2BBGA 1WUUA 1ZM3A 2O3ZA 2ENCA 2NN6B 1UEKA 2N3GA 4DU7A 2EM3A 3H09A 3GMEA 2YSOA 1XNQE 1ZXNA 2WNRA 2E1MA 3EQ1A 4P52A 1NZ0A 4R2SA 1YUIA 2B7TA 4HACA 2Q8UA 1K47A 4FW3A 5DROA 1N36E 3JAMC 4B3TI 5C0XF 3AV0A 4LFBE 5BR8I 1UDQA 1N32I 2DMIA 4MYTA 4DV7E 1XNRI 3B8HA 5AE2A 1IBLE 2YTOA 4R2RA 4HY1A 3M6AA 5EL9A 2A25A 3J7AG 2PO0A 2MC5A 4MU3A 4BC9A 2Z5CA 2EMAA 4LF7E 3U1KA 4RH8A 1P47A 1G2DC 2JEBB 4NXNI 4LF8I 5K36B 3JU0A 4GZNC 4N4RB 1BBGA 3HXLA 1HNWE 3QG5C 2JOXA 2Z5BA 4WYQB 2J7JA 4OZEA 4NZVA 4JI8E 2GO4A 5K36F 1A6FA 4BHBA 4KWYA 2EN2A 1Z1BA 2OI2A 2PNMA 2LRSA 2EM7A 2RQLA 2YWQA 4ZYGA 4MDTA 4DV3I 1X3CA 1I94I
chains in the Genus database with same CATH topology
4LFCE 2R3VA 4KHPE 2V88A 3LMLA 2CZ9A 1UHZA 2CG9A 2CGEA 3ADGA 4DR4I 3PYGA 1O0WA 3ADJA 3J80Q 1YYOA 2UXDE 2L2KB 4X66I 3OTOE 1EI1A 4NXME 2L92A 5AASA 2JY9A 5CFFE 4P7DA 4LF6I 2L2NA 1ZBTA 2V8QB 4DKKA 4GKKI 1XNQI 5AE3A 1BKNA 4DV4E 2WZOA 1EKZA 2UUBI 2UU9I 3LPSA 3Q1QA 2UUAI 1RREA 4HACB 2JOBA 4KHPI 4DV0E 2NA2A 1H74A 4DR7E 1FI4A 2HHHI 3AUZA 2V2ZA 3Q6NA 4PRVA 4AQYE 2V86A 5FLXC 3QT6A 4LFAI 4B3SI 2L3CA 2CPNA 3HPZA 2J7KA 4DR7I 1EA6A 2ZBKB 1N33I 3VYYA 2HFUA 2HK2A 1FJGE 3OMLA 5A2QQ 4DPUA 3K85A 3QT7A 3QT5A 3DJWA 4I3HA 4YHHE 4Q28A 3DF6A 1HR0I 3ADIA 2F8BA 2LUPB 2M4IA 1MG7A 2DSYA 4M2ZA 1FJGI 3MSWA 5FLXQ 2DMYA 4TUIA 1Z0EA 2GQ0A 1T4OA 2UXBI 1N34I 3ZKBA 5F3WA 4KQVA 1Z0VA 1IBLI 1PKPA 1XMQI 3IWDA 3IWBA 2MC6A 1HNXI 2UUBE 3VK6A 4YY3I 2F4VI 4B3MI 2L33A 1ZM2A 4DR6I 1NHIA 2Q2EB 4I8OA 4JV5I 4JI1E 2L8TA 4X8WA 4WPYA 4DR1E 4K0KI 4FWGA 2G7HA 2O1UA 5IWAI 4JI5E 4LF5E 1Z0BA 4LFBI 1PIEA 4IZJD 3LTOA 3J81Q 4GKKE 2JR1A 1IBKI 4PU9A 1X48A 1Z0CA 3FIGA 3J81C 1RQ0A 1UILA 5IT9C 4BCAA 4JI0E 2NUGA 4JI6I 4URLA 4TUGA 1NHJA 2L6MA 5IT9Q 3WU5A 1FWKA 1RR9A 2LE2A 4GKJI 3PRYA 1ZM4A 4IZKB 2DEIA 5AE1A 1Z5CA 2X36A 4JI2E 2FGGA 2M1SA 3T1HI 3B78A 5DNYA 1FNMA 3ADLA 4USKA 5BR8E 1IBMI 2B3TB 4R8OA 1Z5AA 4NXNE 4LFCI 1Z0GA 1WHQA 2GS8A 2ZITA 1IBME 1Z59A 3VYXA 2KHXA 1Z0WA 2HK3A 4IZJA 3T1YE 4F9BB 2RTXA 2UUCI 1H7SA 1N36I 3ZM7A 1ELOA 1H72C 4DR3E 1IBKE 4ZVIA 1U2RA 4DUYE 1GQEA 4DV2E 2BM0A 3HPSA 3K17A 3LNUA 2A2DA 2RS6A 3HTXA 4DPXA 4OX9I 1Z5BA 4B3TE 4DUYI 4DV5I 4JV5E 4X65I 4X64I 1WHNA 1J5EI 1B63A 1KKHA 1RC7A 4OX9E 5IWAE 1DI2A 1PVGA 1VISA 4BBYA 4JYAE 2IOQA 4PRXA 4LF4I 2UXBE 3K1JA 1H73A 5T6JA 3HQ1A 3PYEA 2ZM6I 4DV2I 4DV4I 4F54A 2V83A 2V34A 4HYMA 2VF3A 2MDRA 2YT4A 2FV4B 3P06A 4DR5I 2KOUA 5LMUE 2N3HA 1HNXE 2VQFE 4JI3E 3B82A 1USVA 1XMOI 4LF8E 4WUDA 4WUCA 4LF7I 2V89A 4LF5I 2FTXB 4LFAE 2V87A 2ODRC 3HULA 2VQFI 3D4JA 4JI3I 2V8PA 1ZBQA 1KTVA 4DV7I 1HR0E 2F4VE 1S4EA 4M30A 2JVAA 1Y4SA 4JI7I 2E5LI 2LJHA 4OOGC 5LMNE 4JI4E 1NHHA 4X66E 1STUA 4K0KE 4DR1I 4DXLA 2V2QA 3P1XA 2EFGA 4LF9I 2BV3A 4DV6E 1I94E 2L2MA 3J80C 5L3JA 4P7AA 5GMEA 2XEXA 4GKJE 4Z7YA 3T1YI 2A2CA 1ZM9A 2NPFA 4J8ZA 2BM1A 4BMJA 4ED4A 2UU9E 1YYKA 3Q6MA 4HXZA 4F9CB 1XMQE 1WXRA 4L5NC 1N34E 4JI1I 4B3RE 2DB2A 2LMZA 1YZ9A 1XMOE 3K6QA 1D6TA 4B3ME 2UUCE 3F6HA 3RMPA 1S16A 1SR9A 2LTRA 1QZRA 1ZXMA 1YYWA 4WFTA 2IOPA 1HNWI 2NUEA 1B62A 4Z7CA 4FWHA 2PNLA 4DR4E 3PYFA 2HKJA 4KZSA 2Z5BB 4WUBA 4JI7E 1FWLA 3C4TA 2K4VA 4DR3I 1HNZI 4DUZE 4DR5E 4LF6E 4YHHI 5LMUI 4DU8A 3F6GA 4JI8I 3J7Yp 1J5EE 2LTSA 1Z0TA 1MX0A 3WU4A 1N33E 2ODRD 4MYUA 3H4LA 4F9AB 4DV0I 2H36X 1XHKA 4L8NA 4DPTA 4X62I 5A2QC 1USUA 4DR2I 2O1VA 2KONA 2HHHE 1KIJA 2WW4A 1T4LB 1N0VC 4DR6E 2R42A 4UTGA 2EWLA 4EMDA 4B3RI 2ZM6E 1N0UA 3ZZ0A 4LTYA 2UXDI 4DMIA 5LL6R 4UT4A 3IWCA 4FWDA 4BC7A 2EZ6A 2UXCE 1X49A 4N3OA 4IZKA 2O1TA 4X65E 1GZ6A 2RS7A 2LJPA 2B9DA 3ZOQB 4DV3E 4LF9E 4DR2E 2NUFA 4DV6I 3OTOI 2HFSA 1DARA 4NXMI 1FKAE 4LU9A 4JI5I 2M7QA 2DEJA 1DQ3A 4RPFA 3J7AM 2IHR1 1T4NA 4JI4I 3LLHA 2DIXA 4DV1E 2E5LE 3ZZUA 1KVKA 1Y6ZA 2B7VA 2VQEI 3V5RA 4USMA 4GEQB 3T1HE 3ZZTA 5ADZA 2AJ4A 2Z5CB 4X62E 4JG4A 4FW9A 4XTJA 3WU3A 2LUQA 4BS9A 1HNZE 2O1WA 1X47A 2L3JA 2UUAE 4DPWA 4JYAI 1N32E 4B3SE 1H7UA 1XNRE 2E1RA 4JI6E 4M1KA 4R1FA 4DPYA 1OJ4A 4JI2I 2YZTA 4DV1I 2LBSB 2X7IA 4DV5E 3KWRA 2V2VA 3WU6A 1Y4UA 1J26A 4LF4E 3QT8A 3PYDA 2VE7C 4R03A 1HK7A 4FN5A 2RSMA 4JI0I 3V2UC 4P78A 4M0VA 4WSPA 4IZJB 4AQYI 1MU5A 4X64E 3GONA 3JAMQ 3F0NA 5FWKA 3CWVA 2UXCI 3JTZA 2V85A 3ZKDA 3HJCA 4YY3E 3C4BA 5GMDA 1QU6A 2VQEE 2VF1A 4DUZI 2HKEA 2Z5EA 2JWOA 5LMNI 1WUUA 1ZM3A 1UEKA 2N3GA 4DU7A 3H09A 1XNQE 1ZXNA 2E1MA 4P52A 1NZ0A 2B7TA 4HACA 1K47A 1N36E 3JAMC 4B3TI 3AV0A 4LFBE 5BR8I 1N32I 4MYTA 4DV7E 1XNRI 3B8HA 5AE2A 1IBLE 4HY1A 3M6AA 3J7AG 2MC5A 4BC9A 2Z5CA 4LF7E 4LF8I 4NXNI 3JU0A 3HXLA 1HNWE 2JOXA 2Z5BA 4WYQB 4JI8E 1A6FA 2OI2A 2PNMA 2LRSA 4DV3I 1I94I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC E;  2R3V A;  4KHP E;  2CZ9 A;  1UHZ A;  3ADG A;  4DR4 I;  3PYG A;  1O0W A;  3ADJ A;  3J80 Q;  1YYO A;  2UXD E;  2L2K B;  4X66 I;  3OTO E;  1EI1 A;  4NXM E;  2JY9 A;  5CFF E;  4LF6 I;  2L2N A;  1ZBT A;  4DKK A;  4GKK I;  1XNQ I;  1BKN A;  4DV4 E;  1EKZ A;  2UUB I;  2UU9 I;  3LPS A;  3Q1Q A;  2UUA I;  1RRE A;  4HAC B;  4KHP I;  4DV0 E;  2NA2 A;  1H74 A;  4DR7 E;  1FI4 A;  2HHH I;  2V2Z A;  4PRV A;  4AQY E;  5FLX C;  3QT6 A;  4LFA I;  4B3S I;  2L3C A;  2CPN A;  2J7K A;  4DR7 I;  1EA6 A;  2ZBK B;  1N33 I;  3VYY A;  2HFU A;  2HK2 A;  1FJG E;  5A2Q Q;  4DPU A;  3QT7 A;  3QT5 A;  4I3H A;  4YHH E;  1HR0 I;  3ADI A;  2LUP B;  1MG7 A;  4M2Z A;  1FJG I;  5FLX Q;  2DMY A;  1Z0E A;  1T4O A;  2UXB I;  1N34 I;  3ZKB A;  4KQV A;  1Z0V A;  1IBL I;  1PKP A;  1XMQ I;  1HNX I;  2UUB E;  4YY3 I;  2F4V I;  4B3M I;  2L33 A;  1ZM2 A;  4DR6 I;  1NHI A;  2Q2E B;  4JV5 I;  4JI1 E;  4X8W A;  4DR1 E;  4K0K I;  4FWG A;  5IWA I;  4JI5 E;  4LF5 E;  1Z0B A;  4LFB I;  1PIE A;  3LTO A;  3J81 Q;  4GKK E;  1IBK I;  4PU9 A;  1X48 A;  1Z0C A;  3J81 C;  1RQ0 A;  1UIL A;  5IT9 C;  4JI0 E;  2NUG A;  4JI6 I;  4URL A;  1NHJ A;  5IT9 Q;  3WU5 A;  1FWK A;  1RR9 A;  4GKJ I;  1ZM4 A;  2DEI A;  1Z5C A;  2X36 A;  4JI2 E;  3T1H I;  3B78 A;  1FNM A;  3ADL A;  4USK A;  5BR8 E;  1IBM I;  2B3T B;  1Z5A A;  4NXN E;  4LFC I;  1Z0G A;  1WHQ A;  2GS8 A;  2ZIT A;  1IBM E;  1Z59 A;  3VYX A;  2KHX A;  1Z0W A;  2HK3 A;  3T1Y E;  2RTX A;  2UUC I;  1H7S A;  1N36 I;  3ZM7 A;  1ELO A;  1H72 C;  4DR3 E;  1IBK E;  4ZVI A;  1U2R A;  4DUY E;  4DV2 E;  1GQE A;  2BM0 A;  3K17 A;  3LNU A;  2A2D A;  2RS6 A;  3HTX A;  4DPX A;  4OX9 I;  1Z5B A;  4B3T E;  4DUY I;  4DV5 I;  4JV5 E;  4X65 I;  4X64 I;  1WHN A;  1J5E I;  1B63 A;  1KKH A;  1RC7 A;  4OX9 E;  5IWA E;  1DI2 A;  1PVG A;  1VIS A;  4JYA E;  4PRX A;  4LF4 I;  2UXB E;  3K1J A;  1H73 A;  3PYE A;  2ZM6 I;  4DV4 I;  4DV2 I;  2V34 A;  4HYM A;  2VF3 A;  2MDR A;  2YT4 A;  4DR5 I;  5LMU E;  2N3H A;  1HNX E;  2VQF E;  4JI3 E;  3B82 A;  1XMO I;  4LF8 E;  4WUD A;  4WUC A;  4LF7 I;  4LF5 I;  4LFA E;  3HUL A;  2VQF I;  3D4J A;  4JI3 I;  2V8P A;  1KTV A;  4DV7 I;  1HR0 E;  2F4V E;  1S4E A;  4M30 A;  2JVA A;  4JI7 I;  2E5L I;  2LJH A;  4OOG C;  5LMN E;  4JI4 E;  1NHH A;  4X66 E;  1STU A;  4K0K E;  4DR1 I;  4DXL A;  2V2Q A;  3P1X A;  2EFG A;  4LF9 I;  2BV3 A;  4DV6 E;  1I94 E;  2L2M A;  3J80 C;  5L3J A;  4P7A A;  5GME A;  2XEX A;  4GKJ E;  4Z7Y A;  3T1Y I;  2A2C A;  1ZM9 A;  2NPF A;  2BM1 A;  4ED4 A;  2UU9 E;  1YYK A;  4HXZ A;  1XMQ E;  1N34 E;  4JI1 I;  4B3R E;  2DB2 A;  1YZ9 A;  1XMO E;  1D6T A;  4B3M E;  2UUC E;  1S16 A;  2LTR A;  1QZR A;  1ZXM A;  1YYW A;  4WFT A;  1HNW I;  2NUE A;  1B62 A;  4Z7C A;  4FWH A;  4DR4 E;  3PYF A;  2HKJ A;  4WUB A;  4JI7 E;  1FWL A;  3C4T A;  1HNZ I;  4DR3 I;  4DUZ E;  4DR5 E;  4LF6 E;  4YHH I;  5LMU I;  4DU8 A;  4JI8 I;  3J7Y p;  1J5E E;  2LTS A;  1Z0T A;  1MX0 A;  3WU4 A;  1N33 E;  4MYU A;  3H4L A;  4DV0 I;  1XHK A;  4DPT A;  4X62 I;  5A2Q C;  4DR2 I;  2HHH E;  1KIJ A;  2WW4 A;  1T4L B;  1N0V C;  4DR6 E;  2R42 A;  4UTG A;  4EMD A;  4B3R I;  2ZM6 E;  1N0U A;  3ZZ0 A;  2UXD I;  5LL6 R;  4UT4 A;  4FWD A;  2EZ6 A;  2UXC E;  1X49 A;  4X65 E;  2RS7 A;  2LJP A;  4DV3 E;  4LF9 E;  4DR2 E;  2NUF A;  4DV6 I;  3OTO I;  2HFS A;  1DAR A;  4NXM I;  1FKA E;  4JI5 I;  2DEJ A;  4RPF A;  3J7A M;  2IHR 1;  1T4N A;  4JI4 I;  3LLH A;  2DIX A;  4DV1 E;  2E5L E;  3ZZU A;  1KVK A;  2B7V A;  2VQE I;  3V5R A;  4USM A;  3T1H E;  3ZZT A;  2AJ4 A;  4X62 E;  4JG4 A;  4FW9 A;  4XTJ A;  3WU3 A;  2LUQ A;  1HNZ E;  1X47 A;  2L3J A;  2UUA E;  4DPW A;  4JYA I;  1N32 E;  4B3S E;  1H7U A;  1XNR E;  2E1R A;  4JI6 E;  4M1K A;  4R1F A;  4DPY A;  1OJ4 A;  4JI2 I;  4DV1 I;  2LBS B;  2X7I A;  4DV5 E;  2V2V A;  3WU6 A;  1J26 A;  4LF4 E;  3QT8 A;  3PYD A;  4FN5 A;  2RSM A;  4JI0 I;  3V2U C;  4AQY I;  1MU5 A;  4X64 E;  3GON A;  3JAM Q;  3F0N A;  3CWV A;  2UXC I;  3ZKD A;  4YY3 E;  3C4B A;  5GMD A;  1QU6 A;  2VQE E;  4DUZ I;  2HKE A;  5LMN I;  1WUU A;  1ZM3 A;  1UEK A;  2N3G A;  4DU7 A;  1XNQ E;  1ZXN A;  4P52 A;  1NZ0 A;  2B7T A;  4HAC A;  1K47 A;  1N36 E;  3JAM C;  4B3T I;  4LFB E;  5BR8 I;  1N32 I;  4MYT A;  4DV7 E;  1XNR I;  3B8H A;  1IBL E;  4HY1 A;  3M6A A;  3J7A G;  4LF7 E;  4LF8 I;  4NXN I;  1HNW E;  4WYQ B;  4JI8 E;  1A6F A;  2OI2 A;  2LRS A;  4DV3 I;  1I94 I; 
#chains in the Genus database with same CATH topology
 4LFC E;  2C37 B;  4KHP E;  2R3V A;  2V88 A;  3LML A;  2MKN A;  2I13 A;  2EQ1 A;  1UHZ A;  2CG9 A;  2CGE A;  2CZ9 A;  5K36 A;  2HC5 A;  3ADG A;  4DR4 I;  3PYG A;  1O0W A;  3ADJ A;  3J80 Q;  4R2A A;  1YYO A;  2PO1 B;  2UXD E;  2L2K B;  4X66 I;  3BGH A;  3OTO E;  1EI1 A;  4NXM E;  3C6M A;  2L92 A;  5AAS A;  1X5W A;  2JY9 A;  1YFH A;  5CFF E;  4P7D A;  4LF6 I;  2BB8 A;  2L2N A;  1ZBT A;  2ADR A;  3HKM A;  2WP8 A;  2V8Q B;  4DKK A;  2C38 B;  5KL7 A;  4GKK I;  3MHS C;  3KZZ A;  2GHF A;  5AE3 A;  1BKN A;  5C0X D;  1XNQ I;  4DV4 E;  1MEY C;  2J65 A;  2WZO A;  1EKZ A;  4LOM A;  2UUB I;  2YRM A;  2UU9 I;  2YTQ A;  4F6N A;  1BBO A;  2PO1 A;  2VES A;  5JEA D;  4O4K A;  3LPS A;  3Q1Q A;  3KZY A;  2WBU A;  2YPN A;  2UUA I;  2EL6 A;  1RRE A;  2F1D A;  4HAC B;  2JOB A;  4IS9 A;  4KHP I;  4DV0 E;  2NA2 A;  2YTD A;  2JEA A;  1H74 A;  1L4S A;  2LT7 A;  2JP9 A;  4MU4 A;  4DR7 E;  1FI4 A;  2N8X A;  2HHH I;  3AUZ A;  2V2Z A;  3Q6N A;  4PRV A;  1JK2 A;  5AC5 A;  4AQY E;  3THO B;  1DGC A;  2V86 A;  2YTG A;  5FLX C;  4FK5 C;  2WCC 3;  2BA1 G;  3QT6 A;  4LFA I;  4B3S I;  2L3C A;  2CPN A;  2EM4 A;  3HPZ A;  2J7K A;  4DR7 I;  1EH6 A;  2YTI A;  1EA6 A;  2ZBK B;  4MU1 A;  3VYY A;  2HFU A;  2HK2 A;  1N33 I;  1FJG E;  3OML A;  5A2Q Q;  3C6K A;  4DPU A;  3K85 A;  4IFD F;  3QT7 A;  3QT5 A;  3DJW A;  4I3H A;  4YHH E;  3UK3 C;  4Q28 A;  3DF6 A;  1HR0 I;  3ADI A;  2F8B A;  2LUP B;  2M4I A;  2EPZ A;  1MG7 A;  2DSY A;  4M2Z A;  2EOS A;  2EOR A;  1TN9 A;  1FJG I;  3MSW A;  5FLX Q;  4F6M A;  2DMY A;  4TUI A;  1Z0E A;  2GQ0 A;  4O24 A;  1T4O A;  2UXB I;  3M85 D;  3ZKB A;  1N34 I;  5F3W A;  4KQV A;  1Z0V A;  5KL3 A;  1IBL I;  1PKP A;  2IER A;  1XMQ I;  3IWD A;  3IWB A;  2MC6 A;  1HNX I;  5JEA A;  2UUB E;  3VK6 A;  4YY3 I;  2F4V I;  4B3M I;  2NN6 D;  2JXP A;  3P3G A;  4U3B A;  2EPK X;  2L33 A;  2NN6 F;  1ZM2 A;  2PO0 B;  4DR6 I;  1NHI A;  2CT1 A;  1Y60 A;  2Q2E B;  4I8O A;  2M9A A;  4JV5 I;  1X6H A;  4JI1 E;  1R6L A;  2EJ4 A;  2EMH A;  2DGC A;  2L8T A;  4X8W A;  4HEI A;  4WPY A;  4DR1 E;  4K0K I;  4FWG A;  5EKW A;  2G7H A;  2O1U A;  4MU0 A;  5IWA I;  2EPN A;  4JI5 E;  4LF5 E;  1Z0B A;  4LFB I;  4LPF A;  1YH8 A;  1PIE A;  4IZJ D;  3LTO A;  3J81 Q;  2EM5 A;  4GKK E;  2JR1 A;  1IBK I;  4PU9 A;  2EMZ A;  1B69 A;  1X48 A;  1Z0C A;  3FIG A;  2LJU A;  3J81 C;  1RQ0 A;  1UIL A;  5K36 C;  5IT9 C;  4BCA A;  4JI0 E;  3THN A;  2NUG A;  4JI6 I;  1RMD A;  4URL A;  4TUG A;  3B4T A;  5C0X B;  2EPM X;  1NHJ A;  5A6J A;  1VI7 A;  2L6M A;  5ELW A;  5IT9 Q;  4FW5 A;  1KJK A;  2BR2 B;  2WNR B;  3H1C A;  4OO1 E;  3WU5 A;  2EM6 A;  2EPR A;  4IFD C;  1YPN A;  1FWK A;  3MHH C;  2LE2 A;  1RR9 A;  2JE6 B;  3PRY A;  3M85 G;  4GKJ I;  1RHY A;  1ZM4 A;  2DEI A;  4IZK B;  5AE1 A;  1Z5C A;  2EMG A;  2CSH A;  2X36 A;  2EM2 A;  4JI2 E;  2FGG A;  1T38 A;  1ZR9 A;  2M1S A;  4OKG A;  2EOX A;  3T1H I;  3B78 A;  5DNY A;  1E3P A;  4LCF A;  1FNM A;  3ADL A;  2NN6 C;  5BR8 E;  4USK A;  5IV8 B;  1IBM I;  3M7N D;  4J3D A;  3DD6 A;  2YTN A;  2B3T B;  4BHC A;  2EN6 A;  4R8O A;  1Z5A A;  2MDG A;  3KRN A;  4NXN E;  4LFC I;  1Z0G A;  1WHQ A;  5C0X E;  2GS8 A;  4WSG A;  2PO2 B;  2ZIT A;  2EOI A;  1IBM E;  1Z59 A;  3VYX A;  2KHX A;  1Z0W A;  2HK3 A;  4IZJ A;  3T1Y E;  5DRP A;  4F9B B;  2EE8 A;  2RTX A;  2JYA A;  3L7Z B;  2UUC I;  5KL5 A;  1H7S A;  1N36 I;  1IQS A;  2EM8 A;  4O43 A;  3ZM7 A;  1ELO A;  4O5G A;  1H72 C;  4DR3 E;  1IBK E;  4ZVI A;  5JEA E;  1EH7 A;  3NZK A;  2IES A;  1U2R A;  4DUY E;  1GQE A;  4DV2 E;  2BM0 A;  2EOE A;  2EMK A;  1P42 A;  3HPS A;  4NBQ A;  4FW7 A;  3K17 A;  3LNU A;  2LCE A;  1T39 A;  2A2D A;  2EOO A;  2RS6 A;  2C39 B;  3HTX A;  5DRR A;  4DPX A;  4OX9 I;  2WP8 B;  2E72 A;  2EPX A;  1Z5B A;  4B3T E;  4ZYH A;  4DUY I;  4DV5 I;  4F2J C;  4JV5 E;  4X65 I;  1E3H A;  1GTK A;  4X64 I;  1OYS A;  1WHN A;  1J5E I;  1UDN A;  2EOY A;  2MKD A;  1B63 A;  1KKH A;  1RC7 A;  4OX9 E;  5IWA E;  1DI2 A;  3GLL A;  4IJD A;  1PVG A;  1VIS A;  4BA2 A;  4BBY A;  4JYA E;  2IOQ A;  4PRX A;  2EOF A;  4LF4 I;  2UXB E;  3K1J A;  5C0X A;  1H73 A;  5T6J A;  3HQ1 A;  3PYE A;  2ZM6 I;  4DV2 I;  4DV4 I;  4F54 A;  4IFD B;  5TSE A;  2V83 A;  2V34 A;  1PJQ A;  4HYM A;  3M7N G;  1JK1 A;  3EPJ A;  3EPK A;  2VF3 A;  2EMI A;  2MDR A;  2EMY A;  2YT4 A;  4FW6 A;  1ZU1 A;  2D9H A;  2FV4 B;  3P06 A;  2CVE A;  4DR5 I;  2KOU A;  4BA1 A;  5LMU E;  2N3H A;  1HNX E;  2VQF E;  4JI3 E;  3B82 A;  2YTE A;  4QNK A;  1OYR A;  1USV A;  2EPL X;  3PS1 A;  4OO1 A;  1XMO I;  2ELZ A;  4LF8 E;  2C37 A;  4U3D A;  2PO2 A;  1SFE A;  4WUD A;  4WUC A;  4LF7 I;  2BA0 D;  2V89 A;  2PNZ B;  4LF5 I;  4OO1 D;  2FTX B;  4LFA E;  2V87 A;  2ODR C;  3HUL A;  2K7I A;  3D4J A;  2VQF I;  2V8P A;  4JI3 I;  2ENA A;  1ZBQ A;  3EPL A;  1PJT A;  1KTV A;  4DV7 I;  1HR0 E;  2F4V E;  1S4E A;  1NCS A;  4BA1 B;  4M30 A;  2JVA A;  2EN7 A;  2EL5 A;  1Y4S A;  2BR2 A;  4JI7 I;  4RHB B;  3CDI A;  2E5L I;  2LJH A;  1IMU A;  2EL4 A;  1A1G A;  2JE6 A;  4LCG A;  4OOG C;  5LMN E;  4JI4 E;  2YSP A;  1NHH A;  1UDS A;  4X66 E;  1A1H A;  1STU A;  1LLM C;  4K0K E;  4DR1 I;  4DXL A;  2V2Q A;  2EOH A;  1TF3 A;  3P1X A;  4LCH A;  2EFG A;  4LF9 I;  1IQO A;  2BV3 A;  4DV6 E;  1Y5Y A;  1I94 E;  2WBS A;  1WJP A;  2L2M A;  3J80 C;  5L3J A;  5DNX A;  4P7A A;  2ENH A;  2CTD A;  2XEX A;  4GKJ E;  4Z7Y A;  5GME A;  3T1Y I;  2A2C A;  2R1F A;  3EPH A;  2NAB A;  1ZM9 A;  2NPF A;  4J8Z A;  2BM1 A;  4BMJ A;  2YTJ A;  2EM9 A;  2UU9 E;  4ED4 A;  1YYK A;  1KYQ A;  3Q6M A;  4HXZ A;  3UHM A;  1N3G A;  4F9C B;  4X9J A;  4WXC A;  1XMQ E;  3M99 B;  1A1F A;  1WXR A;  2EMW A;  4L5N C;  1N34 E;  2EOJ A;  4B3R E;  4JI1 I;  1UN6 B;  2DB2 A;  2LMZ A;  5A6A A;  2RPC A;  1YZ9 A;  1XMO E;  3P3C A;  2EN3 A;  3K6Q A;  1D6T A;  4ZYD A;  4B3M E;  2ELY A;  1F2I G;  4FW4 A;  2UUC E;  3F6H A;  4R2P A;  3GCM A;  3RMP A;  1S16 A;  3CDJ A;  2EN8 A;  1SR9 A;  2LTR A;  4NHR A;  3P3E A;  1QZR A;  1ZXM A;  4HTG A;  5A6B D;  1YYW A;  4WFT A;  2IOP A;  3VHT B;  1A1I A;  2JEB A;  1HNW I;  2NUE A;  1B62 A;  4Z7C A;  4FWH A;  2PNL A;  2EMB A;  4DR4 E;  3PYF A;  2HKJ A;  2EOM A;  4KZS A;  2EQ3 A;  1OYP A;  2Z5B B;  3PS2 A;  4JI7 E;  1FWL A;  4WUB A;  3C4T A;  2K4V A;  4DR3 I;  1HNZ I;  2HGH A;  4DUZ E;  5KL2 A;  4DR5 E;  4LF6 E;  5DNL A;  4YHH I;  5LMU I;  4DU8 A;  3F6G A;  4JI8 I;  4AM3 A;  2JPA A;  3J7Y p;  2EMX A;  1J5E E;  2LTS A;  1Z0T A;  2EMC A;  1MX0 A;  3WU4 A;  1N33 E;  2ODR D;  4MYU A;  3H4L A;  4F9A B;  2NN6 A;  2PRT A;  2EQ0 A;  1YSA C;  4DV0 I;  2EOQ A;  2H36 X;  4AID A;  1XHK A;  3L7Z A;  4L8N A;  1MGT A;  4DPT A;  1QNT A;  4X62 I;  5A2Q C;  1USU A;  4WXD A;  3P76 A;  4DR2 I;  2O1V A;  2KON A;  5JEA F;  2HHH E;  4IS1 C;  1KIJ A;  4ZYE A;  2WW4 A;  2HJJ A;  1T4L B;  2JT2 A;  1N0V C;  4DR6 E;  2R42 A;  1AAY A;  5IXM B;  4ISA A;  4UTG A;  2EWL A;  4EMD A;  2YU8 A;  4R2C A;  4B3R I;  2ZM6 E;  3BF2 A;  2EPA A;  1N0U A;  3ZZ0 A;  4LTY A;  2UXD I;  4DMI A;  2EOZ A;  5LL6 R;  2EP3 A;  2GLI A;  1TF6 A;  4UT4 A;  2BA0 G;  3IWC A;  2R76 A;  4FWD A;  4AIM A;  4BC7 A;  2EZ6 A;  2UXC E;  1AH5 A;  1X49 A;  4N3O A;  4IZK A;  2O1T A;  4X65 E;  1GZ6 A;  2RS7 A;  2PNZ A;  2EPU A;  3TQM A;  4BA2 B;  2LJP A;  3ZOQ B;  2B9D A;  4DV3 E;  4LF9 E;  1X6F A;  4MQY A;  5DRQ A;  4DR2 E;  2I9I A;  2NUF A;  3OTO I;  4DV6 I;  2HFS A;  1DAR A;  4NXM I;  4OO1 C;  1FKA E;  4LU9 A;  4JI5 I;  2M7Q A;  4IFD E;  2BA1 D;  2DEJ A;  1DQ3 A;  2WBT A;  5LLQ A;  1G2F C;  4RPF A;  2IHR 1;  1ZAA C;  3J7A M;  2VRD A;  1T4N A;  4JI4 I;  3LLH A;  2DIX A;  2EML A;  2YTP A;  4DV1 E;  2E5L E;  3ZZU A;  1KVK A;  1Y6Z A;  2YTF A;  2B7V A;  2VQE I;  2LO3 A;  5JEA C;  4M9V C;  3PS3 A;  3V5R A;  4USM A;  1EH8 A;  4GEQ B;  2GO3 A;  2AE8 A;  3T1H E;  3ZZT A;  5ADZ A;  3ECR A;  2AJ4 A;  2DLQ A;  2Z5C B;  2EMF A;  1XXE A;  4X62 E;  1NEI A;  1A1J A;  5A6K A;  4FW9 A;  4GQU A;  4JG4 A;  4XTJ A;  3WU3 A;  2LUQ A;  4BS9 A;  5C0X C;  1X6E A;  2YRH A;  1A1L A;  5A69 A;  2EPC A;  1HNZ E;  3U1Y A;  2O1W A;  1X47 A;  5KL4 A;  5JEA B;  3BID A;  2GPI A;  2NN6 E;  2L3J A;  2UUA E;  4DPW A;  4JYA I;  5A6B A;  4OO1 B;  2LV2 A;  1N32 E;  4R2D A;  2DRP A;  4B3S E;  1H7U A;  5AC4 A;  1XNR E;  5K36 D;  5KL6 A;  2E1R A;  2YU5 A;  1WRJ A;  4JI6 E;  1YUJ A;  2LVH A;  4M1K A;  4R1F A;  4DPY A;  2JEA B;  4WX9 A;  1OJ4 A;  2YZT A;  4DV1 I;  4JI2 I;  2LBS B;  1PDA A;  2X7I A;  4DV5 E;  3L00 A;  2DLK A;  2EN1 A;  3KWR A;  2V2V A;  4QNJ A;  3WU6 A;  1Y4U A;  1J26 A;  1A1K A;  4LF4 E;  2YRK A;  4Q35 B;  3QT8 A;  3PYD A;  5K36 E;  2VE7 C;  4R03 A;  4IFD D;  1HK7 A;  4FN5 A;  2EPP A;  3BBG A;  4MLV A;  2RSM A;  2C38 A;  4JI0 I;  3V2U C;  4P78 A;  4M0V A;  4WSP A;  4IZJ B;  4AQY I;  1MU5 A;  4IFD A;  1YHC A;  2EN4 A;  4X64 E;  3GON A;  3JAM Q;  3F0N A;  5FWK A;  4OO1 F;  3CWV A;  2UXC I;  3JTZ A;  1UDO A;  2EPO A;  4MLQ A;  2EM0 A;  1PJS A;  2V85 A;  3ZKD A;  3HJC A;  4YY3 E;  3C4B A;  1UBD C;  1BB8 A;  5GMD A;  1QU6 A;  2VQE E;  2VF1 A;  4R2E A;  4DUZ I;  2HKE A;  2RSI A;  4R2Q A;  1R6M A;  2C39 A;  2JWO A;  2Z5E A;  5LMN I;  2BBG A;  1WUU A;  1ZM3 A;  2O3Z A;  2ENC A;  2NN6 B;  1UEK A;  2N3G A;  4DU7 A;  2EM3 A;  3H09 A;  3GME A;  2YSO A;  1XNQ E;  1ZXN A;  2WNR A;  2E1M A;  3EQ1 A;  4P52 A;  1NZ0 A;  4R2S A;  1YUI A;  2B7T A;  4HAC A;  2Q8U A;  1K47 A;  4FW3 A;  5DRO A;  1N36 E;  3JAM C;  4B3T I;  5C0X F;  3AV0 A;  4LFB E;  5BR8 I;  1UDQ A;  1N32 I;  2DMI A;  4MYT A;  4DV7 E;  1XNR I;  3B8H A;  5AE2 A;  1IBL E;  2YTO A;  4R2R A;  4HY1 A;  3M6A A;  5EL9 A;  2A25 A;  3J7A G;  2PO0 A;  2MC5 A;  4MU3 A;  4BC9 A;  2Z5C A;  2EMA A;  4LF7 E;  3U1K A;  4RH8 A;  1P47 A;  1G2D C;  2JEB B;  4NXN I;  4LF8 I;  5K36 B;  3JU0 A;  4GZN C;  4N4R B;  1BBG A;  3HXL A;  1HNW E;  3QG5 C;  2JOX A;  2Z5B A;  4WYQ B;  2J7J A;  4OZE A;  4NZV A;  4JI8 E;  2GO4 A;  5K36 F;  1A6F A;  4BHB A;  4KWY A;  2EN2 A;  1Z1B A;  2OI2 A;  2PNM A;  2LRS A;  2EM7 A;  2RQL A;  2YWQ A;  4ZYG A;  4MDT A;  4DV3 I;  1X3C A;  1I94 I; 
#chains in the Genus database with same CATH homology
 4LFC E;  2R3V A;  4KHP E;  2V88 A;  3LML A;  2CZ9 A;  1UHZ A;  2CG9 A;  2CGE A;  3ADG A;  4DR4 I;  3PYG A;  1O0W A;  3ADJ A;  3J80 Q;  1YYO A;  2UXD E;  2L2K B;  4X66 I;  3OTO E;  1EI1 A;  4NXM E;  2L92 A;  5AAS A;  2JY9 A;  5CFF E;  4P7D A;  4LF6 I;  2L2N A;  1ZBT A;  2V8Q B;  4DKK A;  4GKK I;  1XNQ I;  5AE3 A;  1BKN A;  4DV4 E;  2WZO A;  1EKZ A;  2UUB I;  2UU9 I;  3LPS A;  3Q1Q A;  2UUA I;  1RRE A;  4HAC B;  2JOB A;  4KHP I;  4DV0 E;  2NA2 A;  1H74 A;  4DR7 E;  1FI4 A;  2HHH I;  3AUZ A;  2V2Z A;  3Q6N A;  4PRV A;  4AQY E;  2V86 A;  5FLX C;  3QT6 A;  4LFA I;  4B3S I;  2L3C A;  2CPN A;  3HPZ A;  2J7K A;  4DR7 I;  1EA6 A;  2ZBK B;  1N33 I;  3VYY A;  2HFU A;  2HK2 A;  1FJG E;  3OML A;  5A2Q Q;  4DPU A;  3K85 A;  3QT7 A;  3QT5 A;  3DJW A;  4I3H A;  4YHH E;  4Q28 A;  3DF6 A;  1HR0 I;  3ADI A;  2F8B A;  2LUP B;  2M4I A;  1MG7 A;  2DSY A;  4M2Z A;  1FJG I;  3MSW A;  5FLX Q;  2DMY A;  4TUI A;  1Z0E A;  2GQ0 A;  1T4O A;  2UXB I;  1N34 I;  3ZKB A;  5F3W A;  4KQV A;  1Z0V A;  1IBL I;  1PKP A;  1XMQ I;  3IWD A;  3IWB A;  2MC6 A;  1HNX I;  2UUB E;  3VK6 A;  4YY3 I;  2F4V I;  4B3M I;  2L33 A;  1ZM2 A;  4DR6 I;  1NHI A;  2Q2E B;  4I8O A;  4JV5 I;  4JI1 E;  2L8T A;  4X8W A;  4WPY A;  4DR1 E;  4K0K I;  4FWG A;  2G7H A;  2O1U A;  5IWA I;  4JI5 E;  4LF5 E;  1Z0B A;  4LFB I;  1PIE A;  4IZJ D;  3LTO A;  3J81 Q;  4GKK E;  2JR1 A;  1IBK I;  4PU9 A;  1X48 A;  1Z0C A;  3FIG A;  3J81 C;  1RQ0 A;  1UIL A;  5IT9 C;  4BCA A;  4JI0 E;  2NUG A;  4JI6 I;  4URL A;  4TUG A;  1NHJ A;  2L6M A;  5IT9 Q;  3WU5 A;  1FWK A;  1RR9 A;  2LE2 A;  4GKJ I;  3PRY A;  1ZM4 A;  4IZK B;  2DEI A;  5AE1 A;  1Z5C A;  2X36 A;  4JI2 E;  2FGG A;  2M1S A;  3T1H I;  3B78 A;  5DNY A;  1FNM A;  3ADL A;  4USK A;  5BR8 E;  1IBM I;  2B3T B;  4R8O A;  1Z5A A;  4NXN E;  4LFC I;  1Z0G A;  1WHQ A;  2GS8 A;  2ZIT A;  1IBM E;  1Z59 A;  3VYX A;  2KHX A;  1Z0W A;  2HK3 A;  4IZJ A;  3T1Y E;  4F9B B;  2RTX A;  2UUC I;  1H7S A;  1N36 I;  3ZM7 A;  1ELO A;  1H72 C;  4DR3 E;  1IBK E;  4ZVI A;  1U2R A;  4DUY E;  1GQE A;  4DV2 E;  2BM0 A;  3HPS A;  3K17 A;  3LNU A;  2A2D A;  2RS6 A;  3HTX A;  4DPX A;  4OX9 I;  1Z5B A;  4B3T E;  4DUY I;  4DV5 I;  4JV5 E;  4X65 I;  4X64 I;  1WHN A;  1J5E I;  1B63 A;  1KKH A;  1RC7 A;  4OX9 E;  5IWA E;  1DI2 A;  1PVG A;  1VIS A;  4BBY A;  4JYA E;  2IOQ A;  4PRX A;  4LF4 I;  2UXB E;  3K1J A;  1H73 A;  5T6J A;  3HQ1 A;  3PYE A;  2ZM6 I;  4DV2 I;  4DV4 I;  4F54 A;  2V83 A;  2V34 A;  4HYM A;  2VF3 A;  2MDR A;  2YT4 A;  2FV4 B;  3P06 A;  4DR5 I;  2KOU A;  5LMU E;  2N3H A;  1HNX E;  2VQF E;  4JI3 E;  3B82 A;  1USV A;  1XMO I;  4LF8 E;  4WUD A;  4WUC A;  4LF7 I;  2V89 A;  4LF5 I;  2FTX B;  4LFA E;  2V87 A;  2ODR C;  3HUL A;  2VQF I;  3D4J A;  4JI3 I;  2V8P A;  1ZBQ A;  1KTV A;  4DV7 I;  1HR0 E;  2F4V E;  1S4E A;  4M30 A;  2JVA A;  1Y4S A;  4JI7 I;  2E5L I;  2LJH A;  4OOG C;  5LMN E;  4JI4 E;  1NHH A;  4X66 E;  1STU A;  4K0K E;  4DR1 I;  4DXL A;  2V2Q A;  3P1X A;  2EFG A;  4LF9 I;  2BV3 A;  4DV6 E;  1I94 E;  2L2M A;  3J80 C;  5L3J A;  4P7A A;  5GME A;  2XEX A;  4GKJ E;  4Z7Y A;  3T1Y I;  2A2C A;  1ZM9 A;  2NPF A;  4J8Z A;  2BM1 A;  4BMJ A;  4ED4 A;  2UU9 E;  1YYK A;  3Q6M A;  4HXZ A;  4F9C B;  1XMQ E;  1WXR A;  4L5N C;  1N34 E;  4JI1 I;  4B3R E;  2DB2 A;  2LMZ A;  1YZ9 A;  1XMO E;  3K6Q A;  1D6T A;  4B3M E;  2UUC E;  3F6H A;  3RMP A;  1S16 A;  1SR9 A;  2LTR A;  1QZR A;  1ZXM A;  1YYW A;  4WFT A;  2IOP A;  1HNW I;  2NUE A;  1B62 A;  4Z7C A;  4FWH A;  2PNL A;  4DR4 E;  3PYF A;  2HKJ A;  4KZS A;  2Z5B B;  4WUB A;  4JI7 E;  1FWL A;  3C4T A;  2K4V A;  4DR3 I;  1HNZ I;  4DUZ E;  4DR5 E;  4LF6 E;  4YHH I;  5LMU I;  4DU8 A;  3F6G A;  4JI8 I;  3J7Y p;  1J5E E;  2LTS A;  1Z0T A;  1MX0 A;  3WU4 A;  1N33 E;  2ODR D;  4MYU A;  3H4L A;  4F9A B;  4DV0 I;  2H36 X;  1XHK A;  4L8N A;  4DPT A;  4X62 I;  5A2Q C;  1USU A;  4DR2 I;  2O1V A;  2KON A;  2HHH E;  1KIJ A;  2WW4 A;  1T4L B;  1N0V C;  4DR6 E;  2R42 A;  4UTG A;  2EWL A;  4EMD A;  4B3R I;  2ZM6 E;  1N0U A;  3ZZ0 A;  4LTY A;  2UXD I;  4DMI A;  5LL6 R;  4UT4 A;  3IWC A;  4FWD A;  4BC7 A;  2EZ6 A;  2UXC E;  1X49 A;  4N3O A;  4IZK A;  2O1T A;  4X65 E;  1GZ6 A;  2RS7 A;  2LJP A;  2B9D A;  3ZOQ B;  4DV3 E;  4LF9 E;  4DR2 E;  2NUF A;  4DV6 I;  3OTO I;  2HFS A;  1DAR A;  4NXM I;  1FKA E;  4LU9 A;  4JI5 I;  2M7Q A;  2DEJ A;  1DQ3 A;  4RPF A;  3J7A M;  2IHR 1;  1T4N A;  4JI4 I;  3LLH A;  2DIX A;  4DV1 E;  2E5L E;  3ZZU A;  1KVK A;  1Y6Z A;  2B7V A;  2VQE I;  3V5R A;  4USM A;  4GEQ B;  3T1H E;  3ZZT A;  5ADZ A;  2AJ4 A;  2Z5C B;  4X62 E;  4JG4 A;  4FW9 A;  4XTJ A;  3WU3 A;  2LUQ A;  4BS9 A;  1HNZ E;  2O1W A;  1X47 A;  2L3J A;  2UUA E;  4DPW A;  4JYA I;  1N32 E;  4B3S E;  1H7U A;  1XNR E;  2E1R A;  4JI6 E;  4M1K A;  4R1F A;  4DPY A;  1OJ4 A;  4JI2 I;  2YZT A;  4DV1 I;  2LBS B;  2X7I A;  4DV5 E;  3KWR A;  2V2V A;  3WU6 A;  1Y4U A;  1J26 A;  4LF4 E;  3QT8 A;  3PYD A;  2VE7 C;  4R03 A;  1HK7 A;  4FN5 A;  2RSM A;  4JI0 I;  3V2U C;  4P78 A;  4M0V A;  4WSP A;  4IZJ B;  4AQY I;  1MU5 A;  4X64 E;  3GON A;  3JAM Q;  3F0N A;  5FWK A;  3CWV A;  2UXC I;  3JTZ A;  2V85 A;  3ZKD A;  3HJC A;  4YY3 E;  3C4B A;  5GMD A;  1QU6 A;  2VQE E;  2VF1 A;  4DUZ I;  2HKE A;  2Z5E A;  2JWO A;  5LMN I;  1WUU A;  1ZM3 A;  1UEK A;  2N3G A;  4DU7 A;  3H09 A;  1XNQ E;  1ZXN A;  2E1M A;  4P52 A;  1NZ0 A;  2B7T A;  4HAC A;  1K47 A;  1N36 E;  3JAM C;  4B3T I;  3AV0 A;  4LFB E;  5BR8 I;  1N32 I;  4MYT A;  4DV7 E;  1XNR I;  3B8H A;  5AE2 A;  1IBL E;  4HY1 A;  3M6A A;  3J7A G;  2MC5 A;  4BC9 A;  2Z5C A;  4LF7 E;  4LF8 I;  4NXN I;  3JU0 A;  3HXL A;  1HNW E;  2JOX A;  2Z5B A;  4WYQ B;  4JI8 E;  1A6F A;  2OI2 A;  2PNM A;  2LRS A;  4DV3 I;  1I94 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...