4JV5E

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4jv5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jv5E02
2VQEE 2CZ9A 3H4LA 4LFBE 4JG4A 2LTSA 4B3MI 3WU3A 3ZZUA 1I94E 2EZ6A 4LFAE 2E1RA 4LF6I 4JI8E 1WUUA 2VQFE 4NXNE 4B3TE 3J7AM 1ZXMA 1MU5A 4DPYA 1FJGE 4DR7E 1EKZA 2V2VA 1XNQI 4UTGA 1YYOA 1ZBTA 4DPXA 4KHPI 2RS6A 3B82A 1ZM9A 5LL6R 4DV2I 1OJ4A 4MYUA 2UU9I 1Z5CA 4JI7E 4LF5E 4DR4I 1UEKA 1HNZI 1YYKA 1D6TA 4DPWA 1IBKI 3J80Q 3J7AG 4DR3E 2KHXA 4JI4I 4LF4E 3ZKBA 5L3JA 3HTXA 1X49A 4DR5E 4DUZE 4DV5I 4GKKE 2F4VE 4JI1I 4FWGA 2A2DA 3J80C 4DUYI 1A6FA 4OOGC 4AQYI 1N0VC 4DV3I 1H7SA 3JAMQ 3VYXA 3C4TA 4B3ME 4X62I 1N36I 5IT9Q 1S4EA 1IBME 4LF6E 1ZM3A 4EMDA 2B7TA 1HNXI 4HY1A 2HHHI 4URLA 3JAMC 4JI5I 3J81Q 1XNQE 2ZITA 2NA2A 4KHPE 2RS7A 4B3SI 4UT4A 3ADGA 4I3HA 4DV2E 1KKHA 1QZRA 2UU9E 1Z5BA 3V2UC 4DR4E 1ZM4A 1IBLI 1Z0GA 3M6AA 1HNZE 3PYFA 1YYWA 1H7UA 2LUQA 4DV7I 1IBKE 3PYDA 2UXDI 2UXCI 3HULA 4DU8A 2LTRA 1MX0A 3WU4A 4ED4A 5CFFE 3ZZTA 4JI4E 1B62A 4DV5E 4DV4E 4JI1E 1Z0VA 4DUYE 1XHKA 2XEXA 4NXMI 2J7KA 1WHQA 4DV3E 2BM1A 3QT6A 1H73A 2V2QA 4X62E 1N36E 1STUA 4DV6I 1EA6A 5LMUI 2UUAI 1N32I 2UXBE 4JI0I 4WYQB 1HNXE 3P1XA 2HHHE 1EI1A 2LBSB 5BR8I 2IHR1 2JY9A 4Z7YA 4DR6I 2A2CA 4JI5E 4DXLA 5FLXQ 3ZKDA 3WU6A 4B3SE 1UILA 4LF7I 4YY3I 4JV5I 1O0WA 4USMA 1BKNA 1N33I 1XNRI 4PRVA 1IBLE 1FKAE 4P7AA 3T1YI 2N3GA 2UUCI 2HKJA 4FWDA 2UXDE 4USKA 2UXCE 4FN5A 4GKJI 5LMNI 1T4NA 4R1FA 4DPTA 4MYTA 4K0KI 1Z0BA 1YZ9A 1NZ0A 4WFTA 1N0UA 4DU7A 4NXME 4X8WA 3OTOI 4YHHI 4DKKA 3K17A 4DV6E 4WUBA 5LMUE 2UUAE 1N32E 2NPFA 1U2RA 4JI0E 4M1KA 2LUPB 2BM0A 3K1JA 5BR8E 2ZBKB 2ZM6I 4DR6E 1VISA 2UUBI 1Z5AA 1X47A 4LFCI 4LF7E 4YY3E 2V34A 4JV5E 3B78A 1N33E 4DV0I 1XNRE 4DR1I 4X65I 5IT9C 4JI6I 2JVAA 4WUCA 3T1YE 3WU5A 2UUCE 2L3JA 4FWHA 1H74A 4GKJE 1Z0TA 5LMNE 2CPNA 4KQVA 4K0KE 3QT5A 3J81C 3LPSA 1KVKA 4B3RI 4X66I 3QT8A 1ZM2A 1NHHA 1N34I 2L3CA 3PYEA 3LLHA 3OTOE 2LJPA 1K47A 1S16A 1RC7A 1T4OA 4X64I 2BV3A 1FJGI 1T4LB 1KIJA 2L33A 2V8PA 4WUDA 3PYGA 2N3HA 4AQYE 2NUGA 1KTVA 2R3VA 4FW9A 2ZM6E 2UUBE 4RPFA 2WW4A 4JI2I 2HK3A 4LFCE 3ADJA 3LTOA 1HNWI 2DIXA 4DR1E 3ADIA 1J26A 4X65E 2L2MA 4JI6E 4DR5I 1B63A 4PRXA 2X7IA 1XMOI 4HACB 2B3TB 5FLXC 2B7VA 4DV7E 2NUEA 4B3RE 1RR9A 4X66E 1ELOA 1N34E 2RTXA 4M30A 1IBMI 2RSMA 1Z0CA 1NHIA 3CWVA 4X64E 1GQEA 3ADLA 1WHNA 4DPUA 2AJ4A 4HACA 4OX9I 1PKPA 2HFUA 2GS8A 2VF3A 2E5LI 2YT4A 4HXZA 2LRSA 4JI2E 1UHZA 1HR0I 1FNMA 2MDRA 4DR2I 1RREA 3C4BA 1HNWE 2R42A 4LF8I 4LF9I 1PIEA 4HYMA 1X48A 1J5EI 3D4JA 3Q1QA 3J7Yp 5IWAI 4DV4I 2L2NA 1XMQI 1Z0WA 1XMOE 2DEIA 4JYAI 2HK2A 2HFSA 3T1HI 4DV1I 1NHJA 1Z59A 1FI4A 1FWKA 1PVGA 4XTJA 5A2QQ 4JI3I 2X36A 2UXBI 2Q2EB 2VQEI 3ZZ0A 1QU6A 3F0NA 4P52A 4M2ZA 4LFBI 5GMEA 4OX9E 5GMDA 3VYYA 2NUFA 1I94I 1ZXNA 4LFAI 4JI8I 2VQFI 2L2KB 5A2QC 2DMYA 4YHHE 4NXNI 4B3TI 2E5LE 3ZM7A 1MG7A 1DARA 2DB2A 1HR0E 4DR7I 4DR2E 2DEJA 3LNUA 4LF8E 3V5RA 3QT7A 2HKEA 3GONA 4LF9E 3B8HA 4JI7I 4LF5I 1J5EE 1FWLA 4ZVIA 4Z7CA 5IWAE 1XMQE 4DV0E 4PU9A 4DR3I 1Z0EA 1RQ0A 4JYAE 2EFGA 3T1HE 2V2ZA 4LF4I 4DV1E 2LJHA 4DUZI 4GKKI 1H72C 2OI2A 2F4VI 1DI2A 4JI3E
chains in the Genus database with same CATH superfamily
2DRPA 3HPZA 3NZKA 5C0XC 2O1TA 3EPJA 2YPNA 2VQEE 4R2RA 2HGHA 1P42A 3DJWA 2CZ9A 2EMIA 3H4LA 2BA0G 2FGGA 4LFBE 4JG4A 2LTSA 2YSOA 4M0VA 4B3MI 3WU3A 4BA1B 1BBOA 3MHHC 4MU3A 3ZZUA 1I94E 1YSAC 4LFAE 2EZ6A 2E1RA 4LF6I 5KL2A 4JI8E 1WUUA 3H09A 2EP3A 2VQFE 1MEYC 4NXNE 4B3TE 1X6EA 3J7AM 2YTFA 3CDJA 1ZXMA 2EOIA 1MU5A 4U3DA 2B9DA 4DPYA 1FJGE 4DR7E 2EOQA 1EKZA 1SR9A 1E3HA 2KOUA 2EOOA 2V2VA 1JK2A 1R6LA 1XNQI 4Q28A 1YYOA 1ZBTA 4UTGA 3KWRA 4DPXA 4KHPI 1F2IG 2RS6A 4NHRA 3B82A 2EMFA 4BA1A 2G7HA 2CGEA 2J65A 1EH8A 4R2AA 1ZM9A 5LL6R 4DV2I 1NCSA 2RQLA 1OJ4A 2RPCA 1GTKA 2IOPA 4MYUA 4IZJD 4P7DA 5T6JA 1BB8A 1Z5CA 4JI7E 2JEBB 4F6MA 2UU9I 4LF5E 3BF2A 4DR4I 2WBSA 3U1YA 1UEKA 4OO1C 2EQ0A 4MQYA 3IWCA 1HNZI 1YYKA 1USUA 3VK6A 1D6TA 4FW4A 2EMKA 2M1SA 4DPWA 2GLIA 1IBKI 3J80Q 3J7AG 4DR3E 1YPNA 2KHXA 2PO2B 4ZYEA 4IZKB 2GQ0A 4JI4I 3KZYA 4LF4E 3ZKBA 5L3JA 5C0XD 3HTXA 1X49A 4DR5E 4WSGA 2EPAA 4DUZE 4DV5I 2NN6E 4GKKE 2JEBA 5DROA 1OYPA 2F4VE 3HPSA 2EOEA 4JI1I 2VF1A 4FK5C 2YRKA 4FWGA 1TN9A 2EPOA 2A2DA 3J80C 4DUYI 1A6FA 2CT1A 2LMZA 4P78A 2BB8A 4OOGC 1R6MA 4AQYI 4AIDA 2DLKA 2EMWA 1H7SA 1N0VC 3JAMQ 4DV3I 3VYXA 2EMHA 4BC7A 2PO2A 3C4TA 4B3ME 2BA1G 4X62I 1N36I 5IT9Q 1Z1BA 1YUIA 1S4EA 4FW7A 4IZKA 2EMGA 5KL5A 4KZSA 1IBME 4LF6E 3M7ND 1ZM3A 4LCGA 4EMDA 2B7TA 4F6NA 1HNXI 2L8TA 1MGTA 1P47A 2CSHA 1ZU1A 4HY1A 2HHHI 2YTDA 4URLA 3JAMC 2YTGA 1T39A 1G2FC 4JI5I 1Y60A 4GQUA 3J81Q 1XNQE 2ZITA 2NA2A 4KHPE 1OYSA 2RS7A 4BMJA 4B3SI 3UHMA 3P76A 5KL4A 4UT4A 5C0XE 2JWOA 3ADGA 2NN6F 1WRJA 1X6FA 4WSPA 4I3HA 4DV2E 1TF6A 1WXRA 2EM0A 2EL4A 5LLQA 1KKHA 2NN6B 1QZRA 2UU9E 4R2CA 2YTOA 2L6MA 4BHCA 1Z5BA 3V2UC 4DR4E 1ZM4A 1IBLI 1G2DC 1Z0GA 3M6AA 5FWKA 1HNZE 3PYFA 1YYWA 1KJKA 4ZYGA 2LUQA 1H7UA 4DV7I 1SFEA 1A1LA 1RHYA 1IBKE 2FV4B 3PYDA 5F3WA 5AE1A 2UXDI 3HULA 2UXCI 2YZTA 4DU8A 4LU9A 3HJCA 2LTRA 2PRTA 2EMCA 1MX0A 3WU4A 4ED4A 5CFFE 3ZZTA 4JI4E 4WPYA 1B62A 2MC5A 5K36C 4DV5E 2EN1A 3JU0A 2NN6A 2ENCA 2YTIA 2EMZA 4DV4E 4IJDA 4JI1E 4FW3A 1Z0VA 4DUYE 4RH8A 1XHKA 2XEXA 4NXMI 5C0XF 4U3BA 2J7KA 1WHQA 4DV3E 2BM1A 3H1CA 3QT6A 4OO1E 2GPIA 1UN6B 1H73A 2V2QA 2H36X 4X62E 2F8BA 1N36E 1STUA 5C0XB 4DV6I 3MHSC 3THOB 1EA6A 1XXEA 4QNJA 3U1KA 5LMUI 4WX9A 1ZAAC 3Q6MA 2UUAI 1N32I 2UXBE 1N3GA 5KL7A 4JI0I 2PO1B 2YTJA 2EOYA 2N8XA 3K6QA 4WYQB 1HNXE 2BA0D 2JYAA 3P1XA 2HHHE 3EPHA 2LBSB 1EI1A 5BR8I 2IHR1 2JY9A 1T38A 4Z7YA 4DR6I 2A2CA 3ZOQB 4JI5E 4DXLA 5FLXQ 2EOXA 3ZKDA 3WU6A 4B3SE 3P06A 1UILA 2EPXA 2JP9A 4LF7I 4YY3I 2O1WA 2IOQA 4JV5I 5C0XA 2EOZA 5IXMB 1AAYA 3PS3A 5DNXA 1Y4SA 2NN6D 4BC9A 1NEIA 1O0WA 4USMA 1BKNA 2GO4A 1EH6A 1N33I 2YRHA 1XNRI 2PO1A 2DGCA 4PRVA 2YWQA 1IBLE 2VESA 3THNA 4DMIA 1FKAE 4P7AA 2ELYA 3HKMA 2L92A 5DRPA 3T1YI 2N3GA 1X3CA 2EN6A 1UDQA 2GO3A 2UUCI 4R2SA 2HKJA 4FWDA 2UXDE 4USKA 2UXCE 4FN5A 4GKJI 4OO1B 2ADRA 3M85G 5LMNI 1T4NA 2EQ1A 4R1FA 4DPTA 2YU8A 4MYTA 1UBDC 2LT7A 2DSYA 5AASA 4K0KI 2JOXA 1Z0BA 4IFDC 4R2PA 1LLMC 4R03A 5AE3A 1WJPA 1X5WA 2MDGA 1YZ9A 2LE2A 2BBGA 2JR1A 5AE2A 5A6BD 4WFTA 1N0UA 1NZ0A 1YHCA 5ELWA 4NXME 5TSEA 4DU7A 4X8WA 1E3PA 2C37B 3OTOI 4YHHI 2YSPA 4DKKA 2Z5BB 4NZVA 4OO1A 5A6JA 1HK7A 4DV6E 3K17A 4WUBA 5LMUE 2UUAE 2EPRA 1N32E 2E1MA 2VRDA 2NPFA 4RHBB 4ZYHA 4JI0E 1U2RA 4M1KA 3PRYA 3RMPA 2LUPB 2EMAA 2EPPA 1B69A 2BM0A 3K1JA 5BR8E 3AUZA 2EM5A 4MLQA 2ZBKB 2BA1D 2YTQA 4O5GA 5A6AA 4DR6E 2IERA 3EQ1A 2ZM6I 1VISA 2UUBI 5K36E 1Z5AA 2C37A 5JEAC 4BBYA 2JE6B 1X47A 3HQ1A 2Z5BA 4LFCI 3EPLA 4LF7E 4YY3E 2V34A 4JV5E 3B78A 1IQSA 1USVA 2BR2A 2O3ZA 3TQMA 3K85A 1Y6ZA 3Q6NA 5EL9A 2NABA 4OZEA 4LPFA 2EORA 4O24A 2PNMA 1N33E 4DV0I 1XNRE 4DR1I 2EM2A 4X65I 1PJQA 5KL6A 2EN3A 5IT9C 4JI6I 2JVAA 4BA2A 4WUCA 2ODRC 2WBTA 4WXCA 3T1YE 2RSIA 2V8QB 3WU5A 2UUCE 2L3JA 2GHFA 4FWHA 4OO1D 4R8OA 2O1VA 1H74A 2JE6A 4GKJE 2EWLA 2ENAA 4F2JC 3IWBA 2DMIA 5LMNE 2CPNA 1ZR9A 1Z0TA 2EJ4A 4KQVA 3J81C 4K0KE 3QT5A 4R2EA 3LPSA 1KVKA 5K36F 4B3RI 2J7JA 2EPKX 4X66I 3QT8A 2O1UA 2YTNA 1ZM2A 1NHHA 1N34I 2L3CA 3IWDA 5K36B 3P3GA 3PYEA 3LLHA 3OTOE 2LJPA 1K47A 5A69A 1S16A 1RC7A 1T4OA 5AC4A 4X64I 1UDNA 4F54A 2V86A 5IV8B 3VHTB 2EMXA 1UDOA 2BV3A 2F1DA 1FJGI 4HTGA 1T4LB 1KIJA 1PDAA 2CTDA 2E72A 2L33A 2YRMA 2EE8A 2V8PA 4WUDA 3ECRA 5KL3A 3EPKA 3PYGA 2N3HA 2I9IA 2M4IA 4AQYE 2NUGA 1KTVA 2R3VA 2EMBA 3HXLA 5DNYA 4FW9A 2EM9A 2EOSA 2ZM6E 4LCFA 5K36A 2UUBE 4X9JA 2JT2A 4RPFA 2JOBA 2WW4A 4JI2I 4IFDE 2HK3A 2PNZB 4LFCE 4LOMA 3OMLA 4AM3A 3ADJA 2MKNA 4N3OA 3LTOA 2K7IA 2ODRD 2DIXA 1HNWI 2EPMX 1QNTA 2ENHA 3GMEA 2Q8UA 4HEIA 4DR1E 3ADIA 1J26A 4X65E 2PO0B 2L2MA 5A6BA 4JI6E 2HC5A 3P3CA 4DR5I 2EM6A 1B63A 4PRXA 3F6HA 3UK3C 2PNZA 2EPUA 2X7IA 4F9AB 4FW5A 4OKGA 2WNRB 2LJUA 4BS9A 1XMOI 2EN2A 4HACB 2B3TB 3KZZA 4R2DA 1JK1A 2JPAA 5JEAE 2EN4A 5FLXC 4ISAA 2B7VA 3C6MA 4DV7E 4KWYA 2ELZA 2NUEA 4B3RE 1RR9A 2PO0A 4OO1F 4X66E 4IFDF 5K36D 1VI7A 1ELOA 1N34E 1L4SA 4MU0A 3BIDA 2RTXA 4M30A 3M85D 3F6GA 4TUGA 2EN7A 2RSMA 4F9BB 1IBMI 4IFDB 1Z0CA 4J3DA 1NHIA 2LV2A 3CWVA 2PNLA 4X64E 1A1HA 1YFHA 3QG5C 1GQEA 1A1IA 3ADLA 2WNRA 1WHNA 3KRNA 1DGCA 4DPUA 1IQOA 3FIGA 5A6KA 2WZOA 2AJ4A 4HACA 4OX9I 1PJSA 1PKPA 2LVHA 2HFUA 2FTXB 3GLLA 2GS8A 2JEAB 4MU1A 4IS1C 2VF3A 4O4KA 2M9AA 2E5LI 2V85A 2YT4A 5AC5A 4HXZA 2EN8A 2LRSA 5DNLA 4JI2E 2BR2B 4IFDA 4L5NC 1EH7A 1UHZA 1HR0I 4R2QA 1FNMA 5JEAF 2MDRA 4DR2I 1RREA 4IS9A 3C4BA 3DF6A 4I8OA 1HNWE 5JEAB 2EMLA 2R42A 4LF8I 1TF3A 2WCC3 2C38B 4F9CB 4LF9I 5DRRA 2JEAA 1PIEA 3CDIA 2EOMA 4HYMA 1X48A 1ZBQA 1OYRA 4NBQA 3BBGA 1J5EI 3D4JA 3Q1QA 4BA2B 3J7Yp 2V89A 5IWAI 2L2NA 4DV4I 1XMQI 1A1KA 2R1FA 1XMOE 5ADZA 1Z0WA 2DEIA 2KONA 3JTZA 2EPNA 4JYAI 5JEAA 2HK2A 3P3EA 2WBUA 2HFSA 3T1HI 4DV1I 4WXDA 2Z5EA 1NHJA 1Z59A 2C38A 4MDTA 1FI4A 3PS2A 3AV0A 1FWKA 1PVGA 4L8NA 4IFDD 2V87A 3MSWA 2EOFA 2VE7C 2CG9A 4XTJA 5A2QQ 4JI3I 1Y4UA 2X36A 2UXBI 4BHBA 1YH8A 3M7NG 1GZ6A 2LO3A 2Q2EB 2VQEI 2I13A 2C39B 1DQ3A 2JXPA 2MC6A 3ZZ0A 1QU6A 3F0NA 4P52A 4M2ZA 4AIMA 4LFBI 2EMYA 5GMEA 3DD6A 2DLQA 1BBGA 3B4TA 4OX9E 2EPZA 3L00A 1X6HA 2Z5CB 3VYYA 1RMDA 2NUFA 5GMDA 2IESA 1I94I 1ZXNA 4LFAI 3PS1A 4GEQB 2M7QA 4JI8I 2VQFI 2L2KB 5A2QC 2WP8B 2DMYA 4YHHE 3L7ZB 4NXNI 4B3TI 2E5LE 3ZM7A 4MU4A 2EOHA 4LCHA 1MG7A 1A1GA 2DB2A 1DARA 1HR0E 1A1JA 4DR7I 1KYQA 3M99B 2R76A 5EKWA 4DR2E 2HJJA 2C39A 2DEJA 5JEAD 4ZYDA 2EM3A 2NN6C 3LNUA 1IMUA 2V83A 3BGHA 2EOJA 4LF8E 2V88A 3V5RA 2EPCA 4TUIA 2Z5CA 2EQ3A 2EL5A 3QT7A 2YTEA 1Y5YA 2HKEA 3GONA 2K4VA 2EM4A 4LF9E 2EM7A 2WP8A 2MKDA 4GZNC 3B8HA 3L7ZA 4JI7I 2YTPA 4LF5I 4IZJB 3C6KA 2EPLX 1J5EE 1FWLA 4QNKA 4Q35B 4M9VC 4BCAA 4ZVIA 4Z7CA 5IWAE 2CVEA 1XMQE 4DV0E 4PU9A 2AE8A 3LMLA 5DRQA 4J8ZA 2A25A 4DR3I 1Z0EA 1AH5A 1RQ0A 4JYAE 2EL6A 1YUJA 2EFGA 3T1HE 4MLVA 2V2ZA 3GCMA 4DV1E 4LF4I 2LJHA 1A1FA 2YU5A 1PJTA 2D9HA 4DUZI 2LCEA 1UDSA 1H72C 4GKKI 2OI2A 2F4VI 2EM8A 4LTYA 4N4RB 4IZJA 4FW6A 1DI2A 4O43A 4JI3E
chains in the Genus database with same CATH topology
3HPZA 2O1TA 2VQEE 2CZ9A 3DJWA 3H4LA 2FGGA 4LFBE 4JG4A 2LTSA 4M0VA 4B3MI 3WU3A 3ZZUA 1I94E 2EZ6A 4LFAE 2E1RA 4LF6I 4JI8E 1WUUA 3H09A 2VQFE 4NXNE 4B3TE 3J7AM 1ZXMA 1MU5A 2B9DA 4DPYA 1FJGE 4DR7E 1EKZA 1SR9A 2KOUA 2V2VA 1XNQI 4Q28A 1YYOA 1ZBTA 4UTGA 3KWRA 4DPXA 4KHPI 2RS6A 3B82A 2G7HA 2CGEA 1ZM9A 5LL6R 4DV2I 1OJ4A 2IOPA 4MYUA 4IZJD 4P7DA 5T6JA 2UU9I 1Z5CA 4JI7E 4LF5E 4DR4I 1UEKA 3IWCA 1HNZI 1YYKA 1USUA 3VK6A 1D6TA 2M1SA 4DPWA 1IBKI 3J80Q 3J7AG 4DR3E 2KHXA 4IZKB 2GQ0A 4JI4I 4LF4E 3ZKBA 5L3JA 3HTXA 1X49A 4DR5E 4DUZE 4DV5I 4GKKE 2F4VE 3HPSA 4JI1I 2VF1A 4FWGA 2A2DA 3J80C 4DUYI 1A6FA 2LMZA 4P78A 4OOGC 4AQYI 1N0VC 4DV3I 1H7SA 3JAMQ 3VYXA 4BC7A 3C4TA 4B3ME 4X62I 1N36I 5IT9Q 4IZKA 1S4EA 4KZSA 1IBME 4LF6E 1ZM3A 4EMDA 2B7TA 1HNXI 2L8TA 4HY1A 2HHHI 4URLA 3JAMC 4JI5I 3J81Q 1XNQE 2ZITA 2NA2A 4KHPE 2RS7A 4BMJA 4B3SI 4UT4A 2JWOA 3ADGA 4WSPA 4I3HA 4DV2E 1WXRA 1KKHA 1QZRA 2UU9E 1Z5BA 2L6MA 3V2UC 4DR4E 1ZM4A 1IBLI 1Z0GA 3M6AA 5FWKA 1HNZE 3PYFA 1YYWA 1H7UA 2LUQA 4DV7I 1IBKE 2FV4B 3PYDA 5F3WA 5AE1A 2UXDI 3HULA 2UXCI 2YZTA 4DU8A 4LU9A 3HJCA 2LTRA 1MX0A 3WU4A 4ED4A 5CFFE 3ZZTA 4JI4E 4WPYA 1B62A 2MC5A 4DV5E 3JU0A 4DV4E 4JI1E 1Z0VA 4DUYE 1XHKA 2XEXA 4NXMI 2J7KA 1WHQA 4DV3E 2BM1A 3QT6A 1H73A 2V2QA 2H36X 4X62E 2F8BA 1N36E 1STUA 4DV6I 1EA6A 5LMUI 2UUAI 3Q6MA 1N32I 2UXBE 4JI0I 3K6QA 4WYQB 1HNXE 3P1XA 2HHHE 1EI1A 2LBSB 5BR8I 2IHR1 2JY9A 4Z7YA 4DR6I 2A2CA 3ZOQB 4JI5E 4DXLA 5FLXQ 3ZKDA 3WU6A 4B3SE 3P06A 1UILA 4LF7I 4YY3I 2O1WA 2IOQA 4JV5I 1Y4SA 4BC9A 1O0WA 4USMA 1BKNA 1N33I 1XNRI 4PRVA 1IBLE 4DMIA 1FKAE 4P7AA 2L92A 3T1YI 2N3GA 2UUCI 2HKJA 4FWDA 2UXDE 4USKA 2UXCE 4FN5A 4GKJI 5LMNI 1T4NA 4R1FA 4DPTA 4MYTA 4K0KI 2DSYA 5AASA 2JOXA 1Z0BA 4R03A 5AE3A 1YZ9A 2LE2A 2JR1A 5AE2A 1NZ0A 4WFTA 1N0UA 4DU7A 4NXME 4X8WA 3OTOI 4YHHI 4DKKA 2Z5BB 1HK7A 4DV6E 3K17A 4WUBA 5LMUE 2UUAE 1N32E 2E1MA 2NPFA 1U2RA 4JI0E 4M1KA 3PRYA 3RMPA 2LUPB 2BM0A 3K1JA 5BR8E 3AUZA 2ZBKB 2ZM6I 4DR6E 1VISA 2UUBI 1Z5AA 4BBYA 1X47A 3HQ1A 2Z5BA 4LFCI 4LF7E 4YY3E 2V34A 4JV5E 3B78A 1USVA 3K85A 1Y6ZA 3Q6NA 2PNMA 1N33E 4DV0I 1XNRE 4DR1I 4X65I 5IT9C 4JI6I 2JVAA 4WUCA 2ODRC 3T1YE 2V8QB 3WU5A 2UUCE 2L3JA 4FWHA 4R8OA 2O1VA 1H74A 4GKJE 2EWLA 3IWBA 1Z0TA 5LMNE 2CPNA 4KQVA 3J81C 4K0KE 3QT5A 3LPSA 1KVKA 4B3RI 4X66I 3QT8A 2O1UA 1ZM2A 1NHHA 1N34I 2L3CA 3IWDA 3PYEA 3LLHA 3OTOE 2LJPA 1K47A 1S16A 1RC7A 1T4OA 4X64I 4F54A 2V86A 2BV3A 1FJGI 1T4LB 1KIJA 2L33A 2V8PA 4WUDA 3PYGA 2N3HA 2M4IA 4AQYE 2NUGA 1KTVA 2R3VA 3HXLA 5DNYA 4FW9A 2ZM6E 2UUBE 4RPFA 2JOBA 2WW4A 4JI2I 2HK3A 4LFCE 3OMLA 3ADJA 4N3OA 3LTOA 2ODRD 2DIXA 1HNWI 4DR1E 3ADIA 1J26A 4X65E 2L2MA 4JI6E 4DR5I 1B63A 4PRXA 3F6HA 2X7IA 4F9AB 4BS9A 1XMOI 4HACB 2B3TB 5FLXC 2B7VA 4DV7E 2NUEA 4B3RE 1RR9A 4X66E 1ELOA 1N34E 2RTXA 4M30A 3F6GA 4TUGA 4F9BB 2RSMA 1IBMI 1Z0CA 1NHIA 3CWVA 2PNLA 4X64E 1GQEA 3ADLA 1WHNA 4DPUA 3FIGA 2WZOA 2AJ4A 4HACA 4OX9I 1PKPA 2HFUA 2FTXB 2GS8A 2VF3A 2E5LI 2V85A 2YT4A 4HXZA 2LRSA 4JI2E 4L5NC 1UHZA 1HR0I 1FNMA 2MDRA 4DR2I 1RREA 3C4BA 3DF6A 4I8OA 1HNWE 2R42A 4LF8I 4F9CB 4LF9I 1PIEA 4HYMA 1X48A 1ZBQA 1J5EI 3D4JA 3Q1QA 3J7Yp 2V89A 5IWAI 2L2NA 4DV4I 1XMQI 1Z0WA 1XMOE 5ADZA 2DEIA 2KONA 3JTZA 4JYAI 2HK2A 2HFSA 3T1HI 4DV1I 2Z5EA 1NHJA 1Z59A 1FI4A 3AV0A 1FWKA 1PVGA 4L8NA 2V87A 3MSWA 2CG9A 2VE7C 4XTJA 5A2QQ 4JI3I 1Y4UA 2X36A 2UXBI 1GZ6A 2Q2EB 2VQEI 1DQ3A 3ZZ0A 2MC6A 1QU6A 3F0NA 4P52A 4M2ZA 4LFBI 5GMEA 4OX9E 5GMDA 2Z5CB 3VYYA 2NUFA 1I94I 1ZXNA 4LFAI 4GEQB 2M7QA 4JI8I 2VQFI 2L2KB 5A2QC 2DMYA 4YHHE 4NXNI 4B3TI 2E5LE 3ZM7A 1MG7A 1DARA 2DB2A 1HR0E 4DR7I 4DR2E 2DEJA 3LNUA 2V83A 4LF8E 2V88A 3V5RA 4TUIA 2Z5CA 3QT7A 2HKEA 3GONA 2K4VA 4LF9E 3B8HA 4JI7I 4LF5I 4IZJB 1J5EE 1FWLA 4BCAA 4ZVIA 4Z7CA 5IWAE 1XMQE 4DV0E 4PU9A 3LMLA 4DR3I 4J8ZA 1Z0EA 1RQ0A 4JYAE 2EFGA 3T1HE 2V2ZA 4LF4I 4DV1E 2LJHA 4DUZI 4GKKI 1H72C 2OI2A 2F4VI 4LTYA 4IZJA 1DI2A 4JI3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE E;  2CZ9 A;  3H4L A;  4LFB E;  4JG4 A;  2LTS A;  4B3M I;  3WU3 A;  3ZZU A;  1I94 E;  2EZ6 A;  4LFA E;  2E1R A;  4LF6 I;  4JI8 E;  1WUU A;  2VQF E;  4NXN E;  4B3T E;  3J7A M;  1ZXM A;  1MU5 A;  4DPY A;  1FJG E;  4DR7 E;  1EKZ A;  2V2V A;  1XNQ I;  4UTG A;  1YYO A;  1ZBT A;  4DPX A;  4KHP I;  2RS6 A;  3B82 A;  1ZM9 A;  5LL6 R;  4DV2 I;  1OJ4 A;  4MYU A;  2UU9 I;  1Z5C A;  4JI7 E;  4LF5 E;  4DR4 I;  1UEK A;  1HNZ I;  1YYK A;  1D6T A;  4DPW A;  1IBK I;  3J80 Q;  3J7A G;  4DR3 E;  2KHX A;  4JI4 I;  4LF4 E;  3ZKB A;  5L3J A;  3HTX A;  1X49 A;  4DR5 E;  4DUZ E;  4DV5 I;  4GKK E;  2F4V E;  4JI1 I;  4FWG A;  2A2D A;  3J80 C;  4DUY I;  1A6F A;  4OOG C;  4AQY I;  1N0V C;  4DV3 I;  1H7S A;  3JAM Q;  3VYX A;  3C4T A;  4B3M E;  4X62 I;  1N36 I;  5IT9 Q;  1S4E A;  1IBM E;  4LF6 E;  1ZM3 A;  4EMD A;  2B7T A;  1HNX I;  4HY1 A;  2HHH I;  4URL A;  3JAM C;  4JI5 I;  3J81 Q;  1XNQ E;  2ZIT A;  2NA2 A;  4KHP E;  2RS7 A;  4B3S I;  4UT4 A;  3ADG A;  4I3H A;  4DV2 E;  1KKH A;  1QZR A;  2UU9 E;  1Z5B A;  3V2U C;  4DR4 E;  1ZM4 A;  1IBL I;  1Z0G A;  3M6A A;  1HNZ E;  3PYF A;  1YYW A;  1H7U A;  2LUQ A;  4DV7 I;  1IBK E;  3PYD A;  2UXD I;  2UXC I;  3HUL A;  4DU8 A;  2LTR A;  1MX0 A;  3WU4 A;  4ED4 A;  5CFF E;  3ZZT A;  4JI4 E;  1B62 A;  4DV5 E;  4DV4 E;  4JI1 E;  1Z0V A;  4DUY E;  1XHK A;  2XEX A;  4NXM I;  2J7K A;  1WHQ A;  4DV3 E;  2BM1 A;  3QT6 A;  1H73 A;  2V2Q A;  4X62 E;  1N36 E;  1STU A;  4DV6 I;  1EA6 A;  5LMU I;  2UUA I;  1N32 I;  2UXB E;  4JI0 I;  4WYQ B;  1HNX E;  3P1X A;  2HHH E;  1EI1 A;  2LBS B;  5BR8 I;  2IHR 1;  2JY9 A;  4Z7Y A;  4DR6 I;  2A2C A;  4JI5 E;  4DXL A;  5FLX Q;  3ZKD A;  3WU6 A;  4B3S E;  1UIL A;  4LF7 I;  4YY3 I;  4JV5 I;  1O0W A;  4USM A;  1BKN A;  1N33 I;  1XNR I;  4PRV A;  1IBL E;  1FKA E;  4P7A A;  3T1Y I;  2N3G A;  2UUC I;  2HKJ A;  4FWD A;  2UXD E;  4USK A;  2UXC E;  4FN5 A;  4GKJ I;  5LMN I;  1T4N A;  4R1F A;  4DPT A;  4MYT A;  4K0K I;  1Z0B A;  1YZ9 A;  1NZ0 A;  4WFT A;  1N0U A;  4DU7 A;  4NXM E;  4X8W A;  3OTO I;  4YHH I;  4DKK A;  3K17 A;  4DV6 E;  4WUB A;  5LMU E;  2UUA E;  1N32 E;  2NPF A;  1U2R A;  4JI0 E;  4M1K A;  2LUP B;  2BM0 A;  3K1J A;  5BR8 E;  2ZBK B;  2ZM6 I;  4DR6 E;  1VIS A;  2UUB I;  1Z5A A;  1X47 A;  4LFC I;  4LF7 E;  4YY3 E;  2V34 A;  4JV5 E;  3B78 A;  1N33 E;  4DV0 I;  1XNR E;  4DR1 I;  4X65 I;  5IT9 C;  4JI6 I;  2JVA A;  4WUC A;  3T1Y E;  3WU5 A;  2UUC E;  2L3J A;  4FWH A;  1H74 A;  4GKJ E;  1Z0T A;  5LMN E;  2CPN A;  4KQV A;  4K0K E;  3QT5 A;  3J81 C;  3LPS A;  1KVK A;  4B3R I;  4X66 I;  3QT8 A;  1ZM2 A;  1NHH A;  1N34 I;  2L3C A;  3PYE A;  3LLH A;  3OTO E;  2LJP A;  1K47 A;  1S16 A;  1RC7 A;  1T4O A;  4X64 I;  2BV3 A;  1FJG I;  1T4L B;  1KIJ A;  2L33 A;  2V8P A;  4WUD A;  3PYG A;  2N3H A;  4AQY E;  2NUG A;  1KTV A;  2R3V A;  4FW9 A;  2ZM6 E;  2UUB E;  4RPF A;  2WW4 A;  4JI2 I;  2HK3 A;  4LFC E;  3ADJ A;  3LTO A;  1HNW I;  2DIX A;  4DR1 E;  3ADI A;  1J26 A;  4X65 E;  2L2M A;  4JI6 E;  4DR5 I;  1B63 A;  4PRX A;  2X7I A;  1XMO I;  4HAC B;  2B3T B;  5FLX C;  2B7V A;  4DV7 E;  2NUE A;  4B3R E;  1RR9 A;  4X66 E;  1ELO A;  1N34 E;  2RTX A;  4M30 A;  1IBM I;  2RSM A;  1Z0C A;  1NHI A;  3CWV A;  4X64 E;  1GQE A;  3ADL A;  1WHN A;  4DPU A;  2AJ4 A;  4HAC A;  4OX9 I;  1PKP A;  2HFU A;  2GS8 A;  2VF3 A;  2E5L I;  2YT4 A;  4HXZ A;  2LRS A;  4JI2 E;  1UHZ A;  1HR0 I;  1FNM A;  2MDR A;  4DR2 I;  1RRE A;  3C4B A;  1HNW E;  2R42 A;  4LF8 I;  4LF9 I;  1PIE A;  4HYM A;  1X48 A;  1J5E I;  3D4J A;  3Q1Q A;  3J7Y p;  5IWA I;  4DV4 I;  2L2N A;  1XMQ I;  1Z0W A;  1XMO E;  2DEI A;  4JYA I;  2HK2 A;  2HFS A;  3T1H I;  4DV1 I;  1NHJ A;  1Z59 A;  1FI4 A;  1FWK A;  1PVG A;  4XTJ A;  5A2Q Q;  4JI3 I;  2X36 A;  2UXB I;  2Q2E B;  2VQE I;  3ZZ0 A;  1QU6 A;  3F0N A;  4P52 A;  4M2Z A;  4LFB I;  5GME A;  4OX9 E;  5GMD A;  3VYY A;  2NUF A;  1I94 I;  1ZXN A;  4LFA I;  4JI8 I;  2VQF I;  2L2K B;  5A2Q C;  2DMY A;  4YHH E;  4NXN I;  4B3T I;  2E5L E;  3ZM7 A;  1MG7 A;  1DAR A;  2DB2 A;  1HR0 E;  4DR7 I;  4DR2 E;  2DEJ A;  3LNU A;  4LF8 E;  3V5R A;  3QT7 A;  2HKE A;  3GON A;  4LF9 E;  3B8H A;  4JI7 I;  4LF5 I;  1J5E E;  1FWL A;  4ZVI A;  4Z7C A;  5IWA E;  1XMQ E;  4DV0 E;  4PU9 A;  4DR3 I;  1Z0E A;  1RQ0 A;  4JYA E;  2EFG A;  3T1H E;  2V2Z A;  4LF4 I;  4DV1 E;  2LJH A;  4DUZ I;  4GKK I;  1H72 C;  2OI2 A;  2F4V I;  1DI2 A;  4JI3 E; 
#chains in the Genus database with same CATH topology
 2DRP A;  3HPZ A;  3NZK A;  5C0X C;  2O1T A;  3EPJ A;  2YPN A;  2VQE E;  4R2R A;  2HGH A;  1P42 A;  3DJW A;  2CZ9 A;  2EMI A;  3H4L A;  2BA0 G;  2FGG A;  4LFB E;  4JG4 A;  2LTS A;  2YSO A;  4M0V A;  4B3M I;  3WU3 A;  4BA1 B;  1BBO A;  3MHH C;  4MU3 A;  3ZZU A;  1I94 E;  1YSA C;  4LFA E;  2EZ6 A;  2E1R A;  4LF6 I;  5KL2 A;  4JI8 E;  1WUU A;  3H09 A;  2EP3 A;  2VQF E;  1MEY C;  4NXN E;  4B3T E;  1X6E A;  3J7A M;  2YTF A;  3CDJ A;  1ZXM A;  2EOI A;  1MU5 A;  4U3D A;  2B9D A;  4DPY A;  1FJG E;  4DR7 E;  2EOQ A;  1EKZ A;  1SR9 A;  1E3H A;  2KOU A;  2EOO A;  2V2V A;  1JK2 A;  1R6L A;  1XNQ I;  4Q28 A;  1YYO A;  1ZBT A;  4UTG A;  3KWR A;  4DPX A;  4KHP I;  1F2I G;  2RS6 A;  4NHR A;  3B82 A;  2EMF A;  4BA1 A;  2G7H A;  2CGE A;  2J65 A;  1EH8 A;  4R2A A;  1ZM9 A;  5LL6 R;  4DV2 I;  1NCS A;  2RQL A;  1OJ4 A;  2RPC A;  1GTK A;  2IOP A;  4MYU A;  4IZJ D;  4P7D A;  5T6J A;  1BB8 A;  1Z5C A;  4JI7 E;  2JEB B;  4F6M A;  2UU9 I;  4LF5 E;  3BF2 A;  4DR4 I;  2WBS A;  3U1Y A;  1UEK A;  4OO1 C;  2EQ0 A;  4MQY A;  3IWC A;  1HNZ I;  1YYK A;  1USU A;  3VK6 A;  1D6T A;  4FW4 A;  2EMK A;  2M1S A;  4DPW A;  2GLI A;  1IBK I;  3J80 Q;  3J7A G;  4DR3 E;  1YPN A;  2KHX A;  2PO2 B;  4ZYE A;  4IZK B;  2GQ0 A;  4JI4 I;  3KZY A;  4LF4 E;  3ZKB A;  5L3J A;  5C0X D;  3HTX A;  1X49 A;  4DR5 E;  4WSG A;  2EPA A;  4DUZ E;  4DV5 I;  2NN6 E;  4GKK E;  2JEB A;  5DRO A;  1OYP A;  2F4V E;  3HPS A;  2EOE A;  4JI1 I;  2VF1 A;  4FK5 C;  2YRK A;  4FWG A;  1TN9 A;  2EPO A;  2A2D A;  3J80 C;  4DUY I;  1A6F A;  2CT1 A;  2LMZ A;  4P78 A;  2BB8 A;  4OOG C;  1R6M A;  4AQY I;  4AID A;  2DLK A;  2EMW A;  1H7S A;  1N0V C;  3JAM Q;  4DV3 I;  3VYX A;  2EMH A;  4BC7 A;  2PO2 A;  3C4T A;  4B3M E;  2BA1 G;  4X62 I;  1N36 I;  5IT9 Q;  1Z1B A;  1YUI A;  1S4E A;  4FW7 A;  4IZK A;  2EMG A;  5KL5 A;  4KZS A;  1IBM E;  4LF6 E;  3M7N D;  1ZM3 A;  4LCG A;  4EMD A;  2B7T A;  4F6N A;  1HNX I;  2L8T A;  1MGT A;  1P47 A;  2CSH A;  1ZU1 A;  4HY1 A;  2HHH I;  2YTD A;  4URL A;  3JAM C;  2YTG A;  1T39 A;  1G2F C;  4JI5 I;  1Y60 A;  4GQU A;  3J81 Q;  1XNQ E;  2ZIT A;  2NA2 A;  4KHP E;  1OYS A;  2RS7 A;  4BMJ A;  4B3S I;  3UHM A;  3P76 A;  5KL4 A;  4UT4 A;  5C0X E;  2JWO A;  3ADG A;  2NN6 F;  1WRJ A;  1X6F A;  4WSP A;  4I3H A;  4DV2 E;  1TF6 A;  1WXR A;  2EM0 A;  2EL4 A;  5LLQ A;  1KKH A;  2NN6 B;  1QZR A;  2UU9 E;  4R2C A;  2YTO A;  2L6M A;  4BHC A;  1Z5B A;  3V2U C;  4DR4 E;  1ZM4 A;  1IBL I;  1G2D C;  1Z0G A;  3M6A A;  5FWK A;  1HNZ E;  3PYF A;  1YYW A;  1KJK A;  4ZYG A;  2LUQ A;  1H7U A;  4DV7 I;  1SFE A;  1A1L A;  1RHY A;  1IBK E;  2FV4 B;  3PYD A;  5F3W A;  5AE1 A;  2UXD I;  3HUL A;  2UXC I;  2YZT A;  4DU8 A;  4LU9 A;  3HJC A;  2LTR A;  2PRT A;  2EMC A;  1MX0 A;  3WU4 A;  4ED4 A;  5CFF E;  3ZZT A;  4JI4 E;  4WPY A;  1B62 A;  2MC5 A;  5K36 C;  4DV5 E;  2EN1 A;  3JU0 A;  2NN6 A;  2ENC A;  2YTI A;  2EMZ A;  4DV4 E;  4IJD A;  4JI1 E;  4FW3 A;  1Z0V A;  4DUY E;  4RH8 A;  1XHK A;  2XEX A;  4NXM I;  5C0X F;  4U3B A;  2J7K A;  1WHQ A;  4DV3 E;  2BM1 A;  3H1C A;  3QT6 A;  4OO1 E;  2GPI A;  1UN6 B;  1H73 A;  2V2Q A;  2H36 X;  4X62 E;  2F8B A;  1N36 E;  1STU A;  5C0X B;  4DV6 I;  3MHS C;  3THO B;  1EA6 A;  1XXE A;  4QNJ A;  3U1K A;  5LMU I;  4WX9 A;  1ZAA C;  3Q6M A;  2UUA I;  1N32 I;  2UXB E;  1N3G A;  5KL7 A;  4JI0 I;  2PO1 B;  2YTJ A;  2EOY A;  2N8X A;  3K6Q A;  4WYQ B;  1HNX E;  2BA0 D;  2JYA A;  3P1X A;  2HHH E;  3EPH A;  2LBS B;  1EI1 A;  5BR8 I;  2IHR 1;  2JY9 A;  1T38 A;  4Z7Y A;  4DR6 I;  2A2C A;  3ZOQ B;  4JI5 E;  4DXL A;  5FLX Q;  2EOX A;  3ZKD A;  3WU6 A;  4B3S E;  3P06 A;  1UIL A;  2EPX A;  2JP9 A;  4LF7 I;  4YY3 I;  2O1W A;  2IOQ A;  4JV5 I;  5C0X A;  2EOZ A;  5IXM B;  1AAY A;  3PS3 A;  5DNX A;  1Y4S A;  2NN6 D;  4BC9 A;  1NEI A;  1O0W A;  4USM A;  1BKN A;  2GO4 A;  1EH6 A;  1N33 I;  2YRH A;  1XNR I;  2PO1 A;  2DGC A;  4PRV A;  2YWQ A;  1IBL E;  2VES A;  3THN A;  4DMI A;  1FKA E;  4P7A A;  2ELY A;  3HKM A;  2L92 A;  5DRP A;  3T1Y I;  2N3G A;  1X3C A;  2EN6 A;  1UDQ A;  2GO3 A;  2UUC I;  4R2S A;  2HKJ A;  4FWD A;  2UXD E;  4USK A;  2UXC E;  4FN5 A;  4GKJ I;  4OO1 B;  2ADR A;  3M85 G;  5LMN I;  1T4N A;  2EQ1 A;  4R1F A;  4DPT A;  2YU8 A;  4MYT A;  1UBD C;  2LT7 A;  2DSY A;  5AAS A;  4K0K I;  2JOX A;  1Z0B A;  4IFD C;  4R2P A;  1LLM C;  4R03 A;  5AE3 A;  1WJP A;  1X5W A;  2MDG A;  1YZ9 A;  2LE2 A;  2BBG A;  2JR1 A;  5AE2 A;  5A6B D;  4WFT A;  1N0U A;  1NZ0 A;  1YHC A;  5ELW A;  4NXM E;  5TSE A;  4DU7 A;  4X8W A;  1E3P A;  2C37 B;  3OTO I;  4YHH I;  2YSP A;  4DKK A;  2Z5B B;  4NZV A;  4OO1 A;  5A6J A;  1HK7 A;  4DV6 E;  3K17 A;  4WUB A;  5LMU E;  2UUA E;  2EPR A;  1N32 E;  2E1M A;  2VRD A;  2NPF A;  4RHB B;  4ZYH A;  4JI0 E;  1U2R A;  4M1K A;  3PRY A;  3RMP A;  2LUP B;  2EMA A;  2EPP A;  1B69 A;  2BM0 A;  3K1J A;  5BR8 E;  3AUZ A;  2EM5 A;  4MLQ A;  2ZBK B;  2BA1 D;  2YTQ A;  4O5G A;  5A6A A;  4DR6 E;  2IER A;  3EQ1 A;  2ZM6 I;  1VIS A;  2UUB I;  5K36 E;  1Z5A A;  2C37 A;  5JEA C;  4BBY A;  2JE6 B;  1X47 A;  3HQ1 A;  2Z5B A;  4LFC I;  3EPL A;  4LF7 E;  4YY3 E;  2V34 A;  4JV5 E;  3B78 A;  1IQS A;  1USV A;  2BR2 A;  2O3Z A;  3TQM A;  3K85 A;  1Y6Z A;  3Q6N A;  5EL9 A;  2NAB A;  4OZE A;  4LPF A;  2EOR A;  4O24 A;  2PNM A;  1N33 E;  4DV0 I;  1XNR E;  4DR1 I;  2EM2 A;  4X65 I;  1PJQ A;  5KL6 A;  2EN3 A;  5IT9 C;  4JI6 I;  2JVA A;  4BA2 A;  4WUC A;  2ODR C;  2WBT A;  4WXC A;  3T1Y E;  2RSI A;  2V8Q B;  3WU5 A;  2UUC E;  2L3J A;  2GHF A;  4FWH A;  4OO1 D;  4R8O A;  2O1V A;  1H74 A;  2JE6 A;  4GKJ E;  2EWL A;  2ENA A;  4F2J C;  3IWB A;  2DMI A;  5LMN E;  2CPN A;  1ZR9 A;  1Z0T A;  2EJ4 A;  4KQV A;  3J81 C;  4K0K E;  3QT5 A;  4R2E A;  3LPS A;  1KVK A;  5K36 F;  4B3R I;  2J7J A;  2EPK X;  4X66 I;  3QT8 A;  2O1U A;  2YTN A;  1ZM2 A;  1NHH A;  1N34 I;  2L3C A;  3IWD A;  5K36 B;  3P3G A;  3PYE A;  3LLH A;  3OTO E;  2LJP A;  1K47 A;  5A69 A;  1S16 A;  1RC7 A;  1T4O A;  5AC4 A;  4X64 I;  1UDN A;  4F54 A;  2V86 A;  5IV8 B;  3VHT B;  2EMX A;  1UDO A;  2BV3 A;  2F1D A;  1FJG I;  4HTG A;  1T4L B;  1KIJ A;  1PDA A;  2CTD A;  2E72 A;  2L33 A;  2YRM A;  2EE8 A;  2V8P A;  4WUD A;  3ECR A;  5KL3 A;  3EPK A;  3PYG A;  2N3H A;  2I9I A;  2M4I A;  4AQY E;  2NUG A;  1KTV A;  2R3V A;  2EMB A;  3HXL A;  5DNY A;  4FW9 A;  2EM9 A;  2EOS A;  2ZM6 E;  4LCF A;  5K36 A;  2UUB E;  4X9J A;  2JT2 A;  4RPF A;  2JOB A;  2WW4 A;  4JI2 I;  4IFD E;  2HK3 A;  2PNZ B;  4LFC E;  4LOM A;  3OML A;  4AM3 A;  3ADJ A;  2MKN A;  4N3O A;  3LTO A;  2K7I A;  2ODR D;  2DIX A;  1HNW I;  2EPM X;  1QNT A;  2ENH A;  3GME A;  2Q8U A;  4HEI A;  4DR1 E;  3ADI A;  1J26 A;  4X65 E;  2PO0 B;  2L2M A;  5A6B A;  4JI6 E;  2HC5 A;  3P3C A;  4DR5 I;  2EM6 A;  1B63 A;  4PRX A;  3F6H A;  3UK3 C;  2PNZ A;  2EPU A;  2X7I A;  4F9A B;  4FW5 A;  4OKG A;  2WNR B;  2LJU A;  4BS9 A;  1XMO I;  2EN2 A;  4HAC B;  2B3T B;  3KZZ A;  4R2D A;  1JK1 A;  2JPA A;  5JEA E;  2EN4 A;  5FLX C;  4ISA A;  2B7V A;  3C6M A;  4DV7 E;  4KWY A;  2ELZ A;  2NUE A;  4B3R E;  1RR9 A;  2PO0 A;  4OO1 F;  4X66 E;  4IFD F;  5K36 D;  1VI7 A;  1ELO A;  1N34 E;  1L4S A;  4MU0 A;  3BID A;  2RTX A;  4M30 A;  3M85 D;  3F6G A;  4TUG A;  2EN7 A;  2RSM A;  4F9B B;  1IBM I;  4IFD B;  1Z0C A;  4J3D A;  1NHI A;  2LV2 A;  3CWV A;  2PNL A;  4X64 E;  1A1H A;  1YFH A;  3QG5 C;  1GQE A;  1A1I A;  3ADL A;  2WNR A;  1WHN A;  3KRN A;  1DGC A;  4DPU A;  1IQO A;  3FIG A;  5A6K A;  2WZO A;  2AJ4 A;  4HAC A;  4OX9 I;  1PJS A;  1PKP A;  2LVH A;  2HFU A;  2FTX B;  3GLL A;  2GS8 A;  2JEA B;  4MU1 A;  4IS1 C;  2VF3 A;  4O4K A;  2M9A A;  2E5L I;  2V85 A;  2YT4 A;  5AC5 A;  4HXZ A;  2EN8 A;  2LRS A;  5DNL A;  4JI2 E;  2BR2 B;  4IFD A;  4L5N C;  1EH7 A;  1UHZ A;  1HR0 I;  4R2Q A;  1FNM A;  5JEA F;  2MDR A;  4DR2 I;  1RRE A;  4IS9 A;  3C4B A;  3DF6 A;  4I8O A;  1HNW E;  5JEA B;  2EML A;  2R42 A;  4LF8 I;  1TF3 A;  2WCC 3;  2C38 B;  4F9C B;  4LF9 I;  5DRR A;  2JEA A;  1PIE A;  3CDI A;  2EOM A;  4HYM A;  1X48 A;  1ZBQ A;  1OYR A;  4NBQ A;  3BBG A;  1J5E I;  3D4J A;  3Q1Q A;  4BA2 B;  3J7Y p;  2V89 A;  5IWA I;  2L2N A;  4DV4 I;  1XMQ I;  1A1K A;  2R1F A;  1XMO E;  5ADZ A;  1Z0W A;  2DEI A;  2KON A;  3JTZ A;  2EPN A;  4JYA I;  5JEA A;  2HK2 A;  3P3E A;  2WBU A;  2HFS A;  3T1H I;  4DV1 I;  4WXD A;  2Z5E A;  1NHJ A;  1Z59 A;  2C38 A;  4MDT A;  1FI4 A;  3PS2 A;  3AV0 A;  1FWK A;  1PVG A;  4L8N A;  4IFD D;  2V87 A;  3MSW A;  2EOF A;  2VE7 C;  2CG9 A;  4XTJ A;  5A2Q Q;  4JI3 I;  1Y4U A;  2X36 A;  2UXB I;  4BHB A;  1YH8 A;  3M7N G;  1GZ6 A;  2LO3 A;  2Q2E B;  2VQE I;  2I13 A;  2C39 B;  1DQ3 A;  2JXP A;  2MC6 A;  3ZZ0 A;  1QU6 A;  3F0N A;  4P52 A;  4M2Z A;  4AIM A;  4LFB I;  2EMY A;  5GME A;  3DD6 A;  2DLQ A;  1BBG A;  3B4T A;  4OX9 E;  2EPZ A;  3L00 A;  1X6H A;  2Z5C B;  3VYY A;  1RMD A;  2NUF A;  5GMD A;  2IES A;  1I94 I;  1ZXN A;  4LFA I;  3PS1 A;  4GEQ B;  2M7Q A;  4JI8 I;  2VQF I;  2L2K B;  5A2Q C;  2WP8 B;  2DMY A;  4YHH E;  3L7Z B;  4NXN I;  4B3T I;  2E5L E;  3ZM7 A;  4MU4 A;  2EOH A;  4LCH A;  1MG7 A;  1A1G A;  2DB2 A;  1DAR A;  1HR0 E;  1A1J A;  4DR7 I;  1KYQ A;  3M99 B;  2R76 A;  5EKW A;  4DR2 E;  2HJJ A;  2C39 A;  2DEJ A;  5JEA D;  4ZYD A;  2EM3 A;  2NN6 C;  3LNU A;  1IMU A;  2V83 A;  3BGH A;  2EOJ A;  4LF8 E;  2V88 A;  3V5R A;  2EPC A;  4TUI A;  2Z5C A;  2EQ3 A;  2EL5 A;  3QT7 A;  2YTE A;  1Y5Y A;  2HKE A;  3GON A;  2K4V A;  2EM4 A;  4LF9 E;  2EM7 A;  2WP8 A;  2MKD A;  4GZN C;  3B8H A;  3L7Z A;  4JI7 I;  2YTP A;  4LF5 I;  4IZJ B;  3C6K A;  2EPL X;  1J5E E;  1FWL A;  4QNK A;  4Q35 B;  4M9V C;  4BCA A;  4ZVI A;  4Z7C A;  5IWA E;  2CVE A;  1XMQ E;  4DV0 E;  4PU9 A;  2AE8 A;  3LML A;  5DRQ A;  4J8Z A;  2A25 A;  4DR3 I;  1Z0E A;  1AH5 A;  1RQ0 A;  4JYA E;  2EL6 A;  1YUJ A;  2EFG A;  3T1H E;  4MLV A;  2V2Z A;  3GCM A;  4DV1 E;  4LF4 I;  2LJH A;  1A1F A;  2YU5 A;  1PJT A;  2D9H A;  4DUZ I;  2LCE A;  1UDS A;  1H72 C;  4GKK I;  2OI2 A;  2F4V I;  2EM8 A;  4LTY A;  4N4R B;  4IZJ A;  4FW6 A;  1DI2 A;  4O43 A;  4JI3 E; 
#chains in the Genus database with same CATH homology
 3HPZ A;  2O1T A;  2VQE E;  2CZ9 A;  3DJW A;  3H4L A;  2FGG A;  4LFB E;  4JG4 A;  2LTS A;  4M0V A;  4B3M I;  3WU3 A;  3ZZU A;  1I94 E;  2EZ6 A;  4LFA E;  2E1R A;  4LF6 I;  4JI8 E;  1WUU A;  3H09 A;  2VQF E;  4NXN E;  4B3T E;  3J7A M;  1ZXM A;  1MU5 A;  2B9D A;  4DPY A;  1FJG E;  4DR7 E;  1EKZ A;  1SR9 A;  2KOU A;  2V2V A;  1XNQ I;  4Q28 A;  1YYO A;  1ZBT A;  4UTG A;  3KWR A;  4DPX A;  4KHP I;  2RS6 A;  3B82 A;  2G7H A;  2CGE A;  1ZM9 A;  5LL6 R;  4DV2 I;  1OJ4 A;  2IOP A;  4MYU A;  4IZJ D;  4P7D A;  5T6J A;  2UU9 I;  1Z5C A;  4JI7 E;  4LF5 E;  4DR4 I;  1UEK A;  3IWC A;  1HNZ I;  1YYK A;  1USU A;  3VK6 A;  1D6T A;  2M1S A;  4DPW A;  1IBK I;  3J80 Q;  3J7A G;  4DR3 E;  2KHX A;  4IZK B;  2GQ0 A;  4JI4 I;  4LF4 E;  3ZKB A;  5L3J A;  3HTX A;  1X49 A;  4DR5 E;  4DUZ E;  4DV5 I;  4GKK E;  2F4V E;  3HPS A;  4JI1 I;  2VF1 A;  4FWG A;  2A2D A;  3J80 C;  4DUY I;  1A6F A;  2LMZ A;  4P78 A;  4OOG C;  4AQY I;  1N0V C;  4DV3 I;  1H7S A;  3JAM Q;  3VYX A;  4BC7 A;  3C4T A;  4B3M E;  4X62 I;  1N36 I;  5IT9 Q;  4IZK A;  1S4E A;  4KZS A;  1IBM E;  4LF6 E;  1ZM3 A;  4EMD A;  2B7T A;  1HNX I;  2L8T A;  4HY1 A;  2HHH I;  4URL A;  3JAM C;  4JI5 I;  3J81 Q;  1XNQ E;  2ZIT A;  2NA2 A;  4KHP E;  2RS7 A;  4BMJ A;  4B3S I;  4UT4 A;  2JWO A;  3ADG A;  4WSP A;  4I3H A;  4DV2 E;  1WXR A;  1KKH A;  1QZR A;  2UU9 E;  1Z5B A;  2L6M A;  3V2U C;  4DR4 E;  1ZM4 A;  1IBL I;  1Z0G A;  3M6A A;  5FWK A;  1HNZ E;  3PYF A;  1YYW A;  1H7U A;  2LUQ A;  4DV7 I;  1IBK E;  2FV4 B;  3PYD A;  5F3W A;  5AE1 A;  2UXD I;  3HUL A;  2UXC I;  2YZT A;  4DU8 A;  4LU9 A;  3HJC A;  2LTR A;  1MX0 A;  3WU4 A;  4ED4 A;  5CFF E;  3ZZT A;  4JI4 E;  4WPY A;  1B62 A;  2MC5 A;  4DV5 E;  3JU0 A;  4DV4 E;  4JI1 E;  1Z0V A;  4DUY E;  1XHK A;  2XEX A;  4NXM I;  2J7K A;  1WHQ A;  4DV3 E;  2BM1 A;  3QT6 A;  1H73 A;  2V2Q A;  2H36 X;  4X62 E;  2F8B A;  1N36 E;  1STU A;  4DV6 I;  1EA6 A;  5LMU I;  2UUA I;  3Q6M A;  1N32 I;  2UXB E;  4JI0 I;  3K6Q A;  4WYQ B;  1HNX E;  3P1X A;  2HHH E;  1EI1 A;  2LBS B;  5BR8 I;  2IHR 1;  2JY9 A;  4Z7Y A;  4DR6 I;  2A2C A;  3ZOQ B;  4JI5 E;  4DXL A;  5FLX Q;  3ZKD A;  3WU6 A;  4B3S E;  3P06 A;  1UIL A;  4LF7 I;  4YY3 I;  2O1W A;  2IOQ A;  4JV5 I;  1Y4S A;  4BC9 A;  1O0W A;  4USM A;  1BKN A;  1N33 I;  1XNR I;  4PRV A;  1IBL E;  4DMI A;  1FKA E;  4P7A A;  2L92 A;  3T1Y I;  2N3G A;  2UUC I;  2HKJ A;  4FWD A;  2UXD E;  4USK A;  2UXC E;  4FN5 A;  4GKJ I;  5LMN I;  1T4N A;  4R1F A;  4DPT A;  4MYT A;  4K0K I;  2DSY A;  5AAS A;  2JOX A;  1Z0B A;  4R03 A;  5AE3 A;  1YZ9 A;  2LE2 A;  2JR1 A;  5AE2 A;  1NZ0 A;  4WFT A;  1N0U A;  4DU7 A;  4NXM E;  4X8W A;  3OTO I;  4YHH I;  4DKK A;  2Z5B B;  1HK7 A;  4DV6 E;  3K17 A;  4WUB A;  5LMU E;  2UUA E;  1N32 E;  2E1M A;  2NPF A;  1U2R A;  4JI0 E;  4M1K A;  3PRY A;  3RMP A;  2LUP B;  2BM0 A;  3K1J A;  5BR8 E;  3AUZ A;  2ZBK B;  2ZM6 I;  4DR6 E;  1VIS A;  2UUB I;  1Z5A A;  4BBY A;  1X47 A;  3HQ1 A;  2Z5B A;  4LFC I;  4LF7 E;  4YY3 E;  2V34 A;  4JV5 E;  3B78 A;  1USV A;  3K85 A;  1Y6Z A;  3Q6N A;  2PNM A;  1N33 E;  4DV0 I;  1XNR E;  4DR1 I;  4X65 I;  5IT9 C;  4JI6 I;  2JVA A;  4WUC A;  2ODR C;  3T1Y E;  2V8Q B;  3WU5 A;  2UUC E;  2L3J A;  4FWH A;  4R8O A;  2O1V A;  1H74 A;  4GKJ E;  2EWL A;  3IWB A;  1Z0T A;  5LMN E;  2CPN A;  4KQV A;  3J81 C;  4K0K E;  3QT5 A;  3LPS A;  1KVK A;  4B3R I;  4X66 I;  3QT8 A;  2O1U A;  1ZM2 A;  1NHH A;  1N34 I;  2L3C A;  3IWD A;  3PYE A;  3LLH A;  3OTO E;  2LJP A;  1K47 A;  1S16 A;  1RC7 A;  1T4O A;  4X64 I;  4F54 A;  2V86 A;  2BV3 A;  1FJG I;  1T4L B;  1KIJ A;  2L33 A;  2V8P A;  4WUD A;  3PYG A;  2N3H A;  2M4I A;  4AQY E;  2NUG A;  1KTV A;  2R3V A;  3HXL A;  5DNY A;  4FW9 A;  2ZM6 E;  2UUB E;  4RPF A;  2JOB A;  2WW4 A;  4JI2 I;  2HK3 A;  4LFC E;  3OML A;  3ADJ A;  4N3O A;  3LTO A;  2ODR D;  2DIX A;  1HNW I;  4DR1 E;  3ADI A;  1J26 A;  4X65 E;  2L2M A;  4JI6 E;  4DR5 I;  1B63 A;  4PRX A;  3F6H A;  2X7I A;  4F9A B;  4BS9 A;  1XMO I;  4HAC B;  2B3T B;  5FLX C;  2B7V A;  4DV7 E;  2NUE A;  4B3R E;  1RR9 A;  4X66 E;  1ELO A;  1N34 E;  2RTX A;  4M30 A;  3F6G A;  4TUG A;  4F9B B;  2RSM A;  1IBM I;  1Z0C A;  1NHI A;  3CWV A;  2PNL A;  4X64 E;  1GQE A;  3ADL A;  1WHN A;  4DPU A;  3FIG A;  2WZO A;  2AJ4 A;  4HAC A;  4OX9 I;  1PKP A;  2HFU A;  2FTX B;  2GS8 A;  2VF3 A;  2E5L I;  2V85 A;  2YT4 A;  4HXZ A;  2LRS A;  4JI2 E;  4L5N C;  1UHZ A;  1HR0 I;  1FNM A;  2MDR A;  4DR2 I;  1RRE A;  3C4B A;  3DF6 A;  4I8O A;  1HNW E;  2R42 A;  4LF8 I;  4F9C B;  4LF9 I;  1PIE A;  4HYM A;  1X48 A;  1ZBQ A;  1J5E I;  3D4J A;  3Q1Q A;  3J7Y p;  2V89 A;  5IWA I;  2L2N A;  4DV4 I;  1XMQ I;  1Z0W A;  1XMO E;  5ADZ A;  2DEI A;  2KON A;  3JTZ A;  4JYA I;  2HK2 A;  2HFS A;  3T1H I;  4DV1 I;  2Z5E A;  1NHJ A;  1Z59 A;  1FI4 A;  3AV0 A;  1FWK A;  1PVG A;  4L8N A;  2V87 A;  3MSW A;  2CG9 A;  2VE7 C;  4XTJ A;  5A2Q Q;  4JI3 I;  1Y4U A;  2X36 A;  2UXB I;  1GZ6 A;  2Q2E B;  2VQE I;  1DQ3 A;  3ZZ0 A;  2MC6 A;  1QU6 A;  3F0N A;  4P52 A;  4M2Z A;  4LFB I;  5GME A;  4OX9 E;  5GMD A;  2Z5C B;  3VYY A;  2NUF A;  1I94 I;  1ZXN A;  4LFA I;  4GEQ B;  2M7Q A;  4JI8 I;  2VQF I;  2L2K B;  5A2Q C;  2DMY A;  4YHH E;  4NXN I;  4B3T I;  2E5L E;  3ZM7 A;  1MG7 A;  1DAR A;  2DB2 A;  1HR0 E;  4DR7 I;  4DR2 E;  2DEJ A;  3LNU A;  2V83 A;  4LF8 E;  2V88 A;  3V5R A;  4TUI A;  2Z5C A;  3QT7 A;  2HKE A;  3GON A;  2K4V A;  4LF9 E;  3B8H A;  4JI7 I;  4LF5 I;  4IZJ B;  1J5E E;  1FWL A;  4BCA A;  4ZVI A;  4Z7C A;  5IWA E;  1XMQ E;  4DV0 E;  4PU9 A;  3LML A;  4DR3 I;  4J8Z A;  1Z0E A;  1RQ0 A;  4JYA E;  2EFG A;  3T1H E;  2V2Z A;  4LF4 I;  4DV1 E;  2LJH A;  4DUZ I;  4GKK I;  1H72 C;  2OI2 A;  2F4V I;  4LTY A;  4IZJ A;  1DI2 A;  4JI3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...