4JV5E

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4jv5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jv5E02
2LTSA 1OJ4A 4JI6E 1UEKA 3PYEA 4JI0E 3WU6A 2L2NA 4DR4I 2B7TA 1D6TA 3B8HA 4DV4I 1N34I 4JI2I 3QT6A 3V5RA 1Z0BA 4JYAI 3J7Yp 1KTVA 4PRVA 1QU6A 2NA2A 2A2DA 4DR2I 4OX9E 2UXDI 2JY9A 3T1HI 4DR6I 4DUZE 4JI4E 2LJPA 2HK2A 4X66I 5LMNI 4UT4A 4M30A 2A2CA 2LBSB 1DI2A 2VQEE 4YHHE 1H7SA 2HFUA 2V34A 1EKZA 4DKKA 1HNZE 1FWKA 4JI7E 4JI3I 4LFAE 2N3HA 4HXZA 1YYWA 4GKJE 1N33E 4FN5A 4FW9A 4DPYA 1IBME 2BV3A 3LPSA 4Z7YA 1Z0EA 4HY1A 4NXNE 1RR9A 4DR7E 4DR3E 4NXMI 2J7KA 2L2MA 2HFSA 1FNMA 1VISA 4DR1I 4DR5E 3D4JA 2E5LI 4GKKI 2V2ZA 1ZM4A 3CWVA 4DV7E 4LF7E 4HYMA 1N0UA 1H72C 1RC7A 3JAMQ 3HULA 1H7UA 3JAMC 4JV5E 1X47A 4JI6I 3J81C 2LRSA 2OI2A 4JI0I 3OTOE 4WUBA 2UXBE 3J7AM 1HNXE 1XNQE 2DB2A 1IBLE 2RS7A 4M1KA 1ZXMA 2NUGA 2V2QA 4OX9I 3F0NA 5BR8E 3QT5A 1B62A 2UUBI 5LL6R 1Z59A 4JI4I 3K1JA 4JI1E 5FLXQ 5LMUE 2L2KB 2ZM6E 4DV6E 1EI1A 2VF3A 2X7IA 5FLXC 4DPTA 4AQYI 1QZRA 4RPFA 4URLA 1GQEA 2RS6A 2F4VI 4GKJI 5A2QQ 2ZITA 1ZXNA 4LFBE 4B3SI 1IBMI 1T4NA 1Z0CA 4HACB 3M6AA 1Z0GA 4B3ME 4DV5I 3ADGA 4X64I 1J5EE 4X8WA 1KVKA 3LLHA 3ADIA 3PYFA 2HK3A 1RREA 4MYTA 2E1RA 1KIJA 2LJHA 4DPUA 2VQFI 4DV3E 3J7AG 4LF9E 1WHNA 3LTOA 4DV7I 1NHIA 4P52A 1YZ9A 4YY3I 2RTXA 5IWAE 1PKPA 4DV1I 4K0KE 2NPFA 4DPWA 4JI8I 4MYUA 3OTOI 3QT8A 2UUCE 1XNQI 2UXCI 1XNRI 1N36E 2UU9E 4B3TE 1IBLI 4DV0I 2KHXA 4LF4E 1HR0E 1N0VC 1HNWE 3B78A 5GMEA 2UUAE 2JVAA 1FJGI 3LNUA 2V8PA 1YYKA 4B3RE 2B3TB 1YYOA 2R3VA 1XMOE 1N32I 4FWDA 1I94I 4PU9A 4DV6I 4X65I 1O0WA 2BM0A 5L3JA 4JI5E 1S16A 1MU5A 4LF6E 4LF5E 4KHPI 4HACA 3H4LA 1STUA 2NUFA 3C4BA 4LF8E 4DUYE 1PIEA 1WHQA 4LFBI 4DV2I 2LUPB 3T1YI 3J81Q 4B3MI 1Z0TA 1Z5CA 3K17A 2HKJA 4DR4E 1NHHA 3ADJA 2L3JA 4DV4E 2NUEA 4DPXA 1N34E 4JI2E 4DV3I 3WU3A 1XMQE 4LF9I 4JYAE 4P7AA 4EMDA 4DR2E 2UXDE 1Z0WA 1ZM2A 4DR6E 3B82A 2EZ6A 4FWHA 4DUZI 1T4LB 1H73A 2L3CA 3QT7A 1FWLA 4X66E 1BKNA 1NHJA 2UUCI 2HHHE 2VQEI 4YHHI 1KKHA 1HNZI 4OOGC 4JI3E 4JI7I 1H74A 4LF4I 4LFAI 3VYYA 4DU8A 5GMDA 2UUAI 1N33I 1S4EA 4Z7CA 1NZ0A 3PYDA 4NXNI 3PYGA 4KQVA 1MG7A 4DR7I 1FI4A 4DR3I 4JI5I 5CFFE 2XEXA 2N3GA 4DR1E 4LF5I 4JG4A 1UILA 4DR5I 1XHKA 2BM1A 2E5LE 4DUYI 2EFGA 2LUQA 4WUDA 4LF7I 1WUUA 1ZM3A 5IT9C 3HTXA 4DXLA 1FKAE 4FWGA 4JV5I 1ZM9A 1RQ0A 2UXBI 1B63A 1HNXI 2X36A 2Q2EB 1XMQI 2RSMA 3V2UC 3Q1QA 1IBKE 3P1XA 1J26A 1U2RA 5BR8I 2UUBE 4X62E 1EA6A 4JI1I 5LMUI 2HHHI 2ZBKB 2ZM6I 1PVGA 4LFCE 4PRXA 4AQYE 2DIXA 4DU7A 3WU5A 1X49A 2DMYA 2F4VE 2IHR1 3ZZ0A 4USMA 3ADLA 2AJ4A 1ZBTA 1A6FA 4B3SE 2CZ9A 4USKA 3WU4A 4DV5E 4X64E 1J5EI 4M2ZA 3ZZUA 1DARA 1Z0VA 3ZM7A 3J80Q 2VQFE 2LTRA 1ELOA 1Z5AA 3J80C 4WFTA 2B7VA 2V2VA 3ZKBA 4YY3E 3T1HE 5IWAI 4DV1E 4K0KI 4JI8E 5LMNE 2UXCE 2MDRA 1XNRE 2WW4A 1T4OA 4R1FA 1N36I 2UU9I 4B3TI 4DV0E 3GONA 2YT4A 1IBKI 4I3HA 1UHZA 1HR0I 2HKEA 1HNWI 1Z5BA 2R42A 4X62I 4UTGA 3VYXA 4WYQB 1FJGE 4ED4A 1X48A 4B3RI 2GS8A 2DEJA 4WUCA 1N32E 1XMOI 2L33A 1I94E 4X65E 4LFCI 2CPNA 4ZVIA 4NXME 4XTJA 2DEIA 4LF6I 1K47A 4KHPE 3ZZTA 4GKKE 4LF8I 5IT9Q 4DV2E 5A2QC 3T1YE 3ZKDA 3C4TA 1MX0A
chains in the Genus database with same CATH superfamily
4N4RB 2LTSA 2WBTA 1OJ4A 2EOJA 4JI6E 2JT2A 2Z5EA 2MKDA 1UEKA 2EQ3A 2JR1A 3PYEA 4LCFA 4JI0E 3WU6A 2L2NA 2PNLA 2B7TA 2EM6A 4DR4I 2BB8A 4MLVA 3B8HA 2V87A 5C0XE 4DV4I 1D6TA 1GTKA 4BA1B 5KL2A 1N34I 4JI2I 3QT6A 4M0VA 1B69A 3V5RA 1Z0BA 4JYAI 3J7Yp 1A1GA 1KTVA 4N3OA 4PRVA 1QU6A 2NA2A 2YTGA 2WBUA 2A2DA 4DR2I 4OX9E 2UXDI 2JY9A 4U3DA 2EWLA 2EN3A 2YPNA 3T1HI 4O4KA 4DR6I 2VESA 4P7DA 5AE1A 2EPOA 4TUIA 4NHRA 4DUZE 1ZU1A 2YU8A 4JI4E 4F6NA 1USUA 2EOOA 2LJPA 3F6GA 5EKWA 3EPLA 2DMIA 2HK2A 4X66I 5LMNI 1BB8A 4M30A 4UT4A 4R2AA 2A2CA 3QG5C 2LBSB 1DI2A 4ISAA 2O1WA 2M9AA 2VQEE 4YHHE 2EOSA 2EPZA 4KWYA 1H7SA 1OYSA 2HFUA 2V34A 1EKZA 5K36B 4DKKA 2EN1A 1HNZE 4OO1A 1WXRA 1FWKA 2WNRA 4JI7E 2MDGA 4JI3I 4LFAE 2N3HA 2ENAA 1TN9A 4HXZA 2E72A 1YYWA 2V89A 1PJSA 3JU0A 2EN2A 3UK3C 4HEIA 4GKJE 4FW5A 2PNZB 2V83A 3M85D 1N33E 4FN5A 1UDQA 3DF6A 4FW9A 2DLQA 4DPYA 1DQ3A 4IS1C 1IBME 2BV3A 3LPSA 1Z0EA 4HY1A 2PO2B 4NXNE 3PS3A 4Z7YA 1RR9A 4WSGA 4I8OA 2Q8UA 2D9HA 2JOXA 4DR7E 1R6LA 4DR3E 3KWRA 2EPKX 4O5GA 2L2MA 2M1SA 2HGHA 2J7KA 4NXMI 2HFSA 5FWKA 2O1VA 1FNMA 1VISA 4DR1I 2EMYA 2M4IA 2IOQA 4DR5E 5IV8B 4U3BA 2JEAA 3D4JA 5JEAD 4RHBB 2E5LI 4GKKI 1X6HA 2RSIA 2V2ZA 1ZM4A 4MU1A 3CWVA 4DV7E 4LF7E 4HYMA 1N0UA 2YTDA 1H72C 1KYQA 1RC7A 2Z5CA 4NBQA 3JAMQ 3UHMA 3HULA 2YTIA 1H7UA 5LLQA 2KONA 2JE6B 3JAMC 4JV5E 1X47A 1UDOA 3J81C 3Q6MA 4JI6I 2LRSA 2RPCA 1YUIA 2OI2A 3P3GA 3ZOQB 4IJDA 3OTOE 1BBOA 2UXBE 4WUBA 4JI0I 3J7AM 1HNXE 1XNQE 2DB2A 2MC5A 1MEYC 2NN6A 1IBLE 2RS7A 3LMLA 4M1KA 1ZXMA 3F6HA 2EMFA 1E3HA 1XXEA 2AE8A 4F9CB 2K7IA 2NUGA 2V2QA 4OX9I 3F0NA 2C38B 1BBGA 5ADZA 5BR8E 2N8XA 2EOFA 3QT5A 1B62A 2UUBI 3EPKA 5LL6R 5K36A 5A6AA 1Z59A 2EM5A 2EOIA 2EM4A 3EPJA 2DGCA 4JI4I 4R2CA 2BA0D 2EOYA 3VHTB 2GO4A 3K1JA 1G2FC 4JI1E 5FLXQ 2WNRB 1Y4UA 5LMUE 2KOUA 4F9AB 2L2KB 2YU5A 4IZKA 5JEAB 2ZM6E 4DV6E 1A1KA 2GLIA 5FLXC 1EI1A 2VF3A 2X7IA 4IZJA 4DPTA 2NN6D 4AQYI 4MLQA 1QZRA 2VRDA 1T38A 2PO2A 1WRJA 4RPFA 4URLA 1GQEA 2EPRA 2RS6A 4BHCA 2F4VI 2EMAA 2ODRD 3FIGA 3THNA 4DMIA 4KZSA 4GKJI 5A2QQ 2ZITA 1ZXNA 1ZAAC 5C0XD 1MGTA 4AIDA 4LFBE 3NZKA 1TF3A 3BIDA 5KL6A 2K4VA 2M7QA 1IBMI 4B3SI 4IFDF 2EMHA 2JXPA 1T4NA 4GZNC 2YRKA 1Z0CA 2V88A 4HACB 1UDSA 4FW6A 3M6AA 4WSPA 2CT1A 4B3ME 1OYRA 1Z0GA 4DV5I 3ADGA 2I13A 4X64I 2JEAB 4IZJD 1J5EE 4X8WA 1KVKA 2EPLX 2LJUA 4MU4A 5A6BD 3LLHA 3ADIA 4L8NA 3PYFA 2HK3A 1RREA 2JE6A 3M7NG 5DNYA 2Z5CB 4MYTA 3DJWA 2E1RA 1KIJA 2LJHA 2BA1G 4DPUA 2VQFI 4DV3E 3J7AG 3KZYA 2GQ0A 4LF9E 2EOEA 2EPMX 1WHNA 3LTOA 2JWOA 4DV7I 1NHIA 4LOMA 4P52A 4AM3A 4R03A 2NABA 1YZ9A 4IFDE 2YTNA 4YY3I 1YH8A 2RTXA 2O1UA 1A1HA 5IWAE 3K85A 1PKPA 4DV1I 2EN4A 1Y60A 4K0KE 2NPFA 4DPWA 2NN6B 4LU9A 2C38A 4JI8I 4MYUA 3OTOI 3QT8A 1ZR9A 2UUCE 1XNQI 2UXCI 1XNRI 2EJ4A 1N36E 2UU9E 4B3TE 1IBLI 4MQYA 2BR2B 4DV0I 5C0XB 5KL4A 2EMZA 2KHXA 2CTDA 2VE7C 3B4TA 5AC5A 4LF4E 1UDNA 1HR0E 1YSAC 3MHSC 1USVA 5JEAA 1N0VC 4RH8A 1HNWE 5DROA 2LMZA 3B78A 1YUJA 5GMEA 2UUAE 2JVAA 2EM2A 3HPZA 3TQMA 3DD6A 1Y6ZA 3KRNA 4IZJB 4L5NC 1FJGI 1UBDC 3LNUA 1G2DC 1YYKA 2YRHA 2B3TB 1YYOA 4B3RE 1R6MA 1QNTA 2V8PA 1SR9A 2JOBA 1PJTA 5F3WA 1XMOE 2R3VA 1N32I 4FWDA 2PRTA 5DRRA 5DRQA 2EPPA 2YRMA 3C6MA 2GO3A 4PU9A 5EL9A 4DV6I 2EL6A 1O0WA 3MHHC 2BM0A 4JI5E 5L3JA 4X65I 1RHYA 1EH6A 1S16A 1T39A 2CG9A 1MU5A 1X6FA 4LF6E 4LF5E 2GPIA 4HACA 4KHPI 3H4LA 4BC7A 2EOMA 1STUA 2LO3A 2NUFA 3C4BA 4OO1C 4F9BB 4R2RA 4LF8E 4DUYE 4GEQB 1PIEA 4LPFA 1WHQA 2CGEA 4LFBI 2YSOA 4DV2I 2LUPB 2YWQA 3T1YI 4F2JC 1WJPA 3P76A 3VK6A 3J81Q 4J3DA 2EPUA 4O43A 1YPNA 4AIMA 3P3CA 4OZEA 3P3EA 4IS9A 4OO1F 3THOB 4B3MI 3M85G 1Z0TA 3HQ1A 2F1DA 1Z5CA 4MU3A 4LCGA 4LTYA 3K17A 2HKJA 4DR4E 2YTEA 4M9VC 2EOQA 1NHHA 3ADJA 3IWCA 2L3JA 2CSHA 4DV4E 2NUEA 4DPXA 1N34E 4JI2E 2EQ0A 4GQUA 4F54A 4DV3I 3WU3A 1XMQE 4LF9I 4JYAE 5A6JA 4P7AA 2A25A 4EMDA 3HXLA 2DSYA 4DR2E 1Y5YA 2UXDE 5AE3A 1Z0WA 1ZM2A 5A69A 2EMXA 4R2PA 4DR6E 2BR2A 3B82A 5C0XA 2EMKA 2EZ6A 4FWHA 4DUZI 4OO1E 4BMJA 1OYPA 1T4LB 1H73A 3U1KA 2YTOA 2V8QB 4ZYDA 2L3CA 3QT7A 1FWLA 4X66E 3CDIA 1BKNA 1IQSA 2LE2A 1NHJA 2UUCI 1AH5A 1YFHA 2HHHE 4MDTA 2VQEI 4YHHI 3AUZA 3EPHA 2WCC3 2YTJA 2ENCA 2ENHA 1KKHA 4OKGA 5ELWA 1VI7A 5A6BA 1HNZI 4OOGC 3CDJA 1L4SA 1I94I 4JI3E 4JI7I 1TF6A 1H74A 4LF4I 2NN6C 4LFAI 4IZKB 3VYYA 4DU8A 4BHBA 3BF2A 2YTQA 2EP3A 4TUGA 5GMDA 2UUAI 4FW3A 1N33I 1S4EA 4ZYGA 4Q28A 2I9IA 1NEIA 2B9DA 4Z7CA 3AV0A 2FGGA 5K36C 4MU0A 1NZ0A 3PYDA 4NXNI 2H36X 3M7ND 3K6QA 3PYGA 2EL5A 4KQVA 1EH8A 1MG7A 4DR7I 1FI4A 4IFDD 2WZOA 2DRPA 3PS1A 5CFFE 2PO0B 2XEXA 3GCMA 5DRPA 4DR3I 4JI5I 1X5WA 2BA0G 2JYAA 2N3GA 4P78A 4BC9A 4ZYHA 1UN6B 4DR1E 5T6JA 5K36F 4LF5I 2DLKA 4JG4A 1UILA 4R2SA 2F8BA 2RQLA 5DNXA 4ZYEA 1XHKA 4DR5I 2V86A 1IQOA 2BM1A 2JP9A 4Q35B 2E5LE 4DUYI 2EFGA 2ADRA 4WPYA 2EOHA 2YSPA 2LUQA 5IXMB 4WUDA 4LF7I 1WUUA 2PNMA 5IT9C 1ZM3A 5TSEA 3HTXA 2IESA 4DXLA 4WXDA 1FKAE 3P06A 4FWGA 2EMWA 4JV5I 1ZM9A 1P42A 1RQ0A 2E1MA 2LCEA 2IOPA 2YZTA 3BBGA 1Y4SA 2VF1A 2UXBI 1DGCA 1B63A 2O1TA 1HNXI 5K36E 2X36A 2EMLA 4R2EA 1IMUA 3HKMA 2FV4B 4BA2A 4BBYA 3GMEA 2Q2EB 4J8ZA 1XMQI 1JK2A 3BGHA 2RSMA 2EOZA 5DNLA 3V2UC 3Q1QA 1IBKE 1EH7A 3P1XA 1J26A 1U2RA 5BR8I 3PRYA 2UUBE 4X62E 3ECRA 1X6EA 5AASA 1SFEA 2ELZA 4IFDB 4FW7A 2L92A 4O24A 2JPAA 2LV2A 1A1JA 2LVHA 1EA6A 4JI1I 2EN7A 2J7JA 2EE8A 5LMUI 3JTZA 2HHHI 2ZBKB 2C39A 2ZM6I 1PVGA 1X3CA 2WBSA 4LFCE 4WXCA 4PRXA 4AQYE 2C37A 2DIXA 5KL5A 4DU7A 4HTGA 2R1FA 3WU5A 1X49A 2DMYA 2YTFA 2L8TA 2EM3A 5KL7A 2F4VE 2CVEA 2PO0A 3PS2A 1YHCA 2IHR1 3ZZ0A 2G7HA 2Z5BB 1KJKA 4USMA 3ADLA 2AJ4A 1ZBTA 1A6FA 2L6MA 5JEAC 4B3SE 2CZ9A 2JEBB 2FTXB 4USKA 2HC5A 1GZ6A 3WU4A 1AAYA 2EM8A 4X9JA 4DV5E 4X64E 3M99B 4NZVA 1PJQA 2PO1A 1J5EI 4M2ZA 3L7ZB 3ZZUA 5JEAF 2WP8A 2EORA 1DARA 1Z0VA 4OO1D 3KZZA 4F6MA 3ZM7A 1N3GA 2GHFA 3J80Q 3L00A 5AE2A 2VQFE 2LTRA 1ELOA 1Z5AA 2EPCA 2MC6A 4FK5C 3HJCA 4LCHA 3J80C 2EOXA 3IWBA 1PDAA 4WFTA 2B7VA 3HPSA 2MKNA 2IERA 2V2VA 3ZKBA 4BA1A 4YY3E 3T1HE 2EMGA 1LLMC 3U1YA 5KL3A 1A1IA 5IWAI 4DV1E 1P47A 1E3PA 4BCAA 4K0KI 4BA2B 1F2IG 4JI8E 5JEAE 2EN6A 2LT7A 2EPAA 5LMNE 2EMCA 1RMDA 2UXCE 2MDRA 1XNRE 4IFDA 2ELYA 2WW4A 1T4OA 4R1FA 1N36I 2UU9I 2R76A 1Z1BA 4B3TI 4QNJA 4BS9A 3H09A 4DV0E 3MSWA 3GONA 2YT4A 4QNKA 1IBKI 4I3HA 1UHZA 1HR0I 2HKEA 1HNWI 1Z5BA 2R42A 4X62I 4UTGA 3VYXA 2EMIA 2C39B 1ZBQA 2YTPA 3C6KA 4WYQB 3GLLA 2ODRC 4WX9A 1FJGE 4ED4A 2EM0A 1HK7A 1X48A 2BBGA 2C37B 4B3RI 2GS8A 2EQ1A 1A1LA 2DEJA 4OO1B 4WUCA 2NN6F 1N32E 5C0XC 1XMOI 2EMBA 2Z5BA 2PNZA 2L33A 1I94E 3H1CA 4R8OA 3OMLA 2BA1D 4X65E 2EN8A 2CPNA 1A1FA 4ZVIA 4LFCI 4NXME 2JEBA 4XTJA 3IWDA 2HJJA 4IFDC 2DEIA 4LF6I 1K47A 4KHPE 5A6KA 3ZZTA 5C0XF 2O3ZA 2EPXA 2EL4A 2EM7A 2EM9A 4GKKE 2J65A 3L7ZA 4FW4A 4LF8I 5K36D 5IT9Q 2EPNA 4R2DA 1NCSA 4DV2E 5A2QC 3RMPA 3T1YE 2PO1B 4R2QA 3Q6NA 1JK1A 2V85A 2NN6E 2WP8B 3EQ1A 5AC4A 3ZKDA 3C4TA 1MX0A
chains in the Genus database with same CATH topology
2LTSA 1OJ4A 4JI6E 2Z5EA 1UEKA 2JR1A 3PYEA 4JI0E 3WU6A 2L2NA 2PNLA 2B7TA 4DR4I 1D6TA 3B8HA 2V87A 4DV4I 1N34I 4JI2I 3QT6A 4M0VA 3V5RA 1Z0BA 4JYAI 3J7Yp 4N3OA 1KTVA 4PRVA 1QU6A 2NA2A 2A2DA 4DR2I 4OX9E 2UXDI 2JY9A 2EWLA 3T1HI 4DR6I 4P7DA 5AE1A 4TUIA 4DUZE 4JI4E 1USUA 2LJPA 3F6GA 2HK2A 4X66I 5LMNI 4UT4A 4M30A 2A2CA 2LBSB 1DI2A 2O1WA 2VQEE 4YHHE 1H7SA 2HFUA 2V34A 1EKZA 4DKKA 1HNZE 1WXRA 1FWKA 4JI7E 4JI3I 4LFAE 2N3HA 4HXZA 1YYWA 2V89A 3JU0A 4GKJE 2V83A 1N33E 4FN5A 4FW9A 3DF6A 4DPYA 1DQ3A 1IBME 2BV3A 3LPSA 4Z7YA 1Z0EA 4HY1A 4NXNE 1RR9A 4I8OA 2JOXA 4DR7E 4DR3E 3KWRA 4NXMI 2J7KA 2L2MA 2M1SA 2HFSA 5FWKA 2O1VA 1FNMA 1VISA 4DR1I 2M4IA 2IOQA 4DR5E 3D4JA 2E5LI 4GKKI 2V2ZA 1ZM4A 3CWVA 4DV7E 4LF7E 4HYMA 1N0UA 1H72C 1RC7A 2Z5CA 3JAMQ 3HULA 1H7UA 2KONA 3JAMC 4JV5E 1X47A 3Q6MA 3J81C 4JI6I 2LRSA 2OI2A 3ZOQB 4JI0I 3OTOE 4WUBA 2UXBE 3J7AM 1HNXE 1XNQE 2DB2A 2MC5A 1IBLE 2RS7A 3LMLA 4M1KA 1ZXMA 3F6HA 4F9CB 2NUGA 2V2QA 4OX9I 3F0NA 5ADZA 5BR8E 3QT5A 1B62A 2UUBI 5LL6R 1Z59A 4JI4I 3K1JA 4JI1E 5FLXQ 1Y4UA 5LMUE 2KOUA 4F9AB 2L2KB 2ZM6E 4DV6E 1EI1A 2VF3A 5FLXC 2X7IA 4IZJA 4DPTA 4AQYI 1QZRA 4RPFA 4URLA 1GQEA 2RS6A 2F4VI 2ODRD 3FIGA 4DMIA 4KZSA 4GKJI 5A2QQ 2ZITA 1ZXNA 4LFBE 4B3SI 2K4VA 2M7QA 1IBMI 1T4NA 1Z0CA 2V88A 4HACB 3M6AA 4WSPA 4B3ME 1Z0GA 4DV5I 3ADGA 4X64I 4IZJD 1J5EE 4X8WA 1KVKA 3LLHA 3ADIA 4L8NA 3PYFA 2HK3A 1RREA 5DNYA 2Z5CB 4MYTA 3DJWA 2E1RA 1KIJA 2LJHA 4DPUA 2VQFI 4DV3E 3J7AG 2GQ0A 4LF9E 1WHNA 3LTOA 2JWOA 4DV7I 1NHIA 4P52A 4R03A 1YZ9A 4YY3I 2RTXA 2O1UA 5IWAE 3K85A 1PKPA 4DV1I 4K0KE 2NPFA 4DPWA 4LU9A 4JI8I 4MYUA 3OTOI 3QT8A 2UUCE 1XNQI 2UXCI 1XNRI 1N36E 2UU9E 4B3TE 1IBLI 4DV0I 2KHXA 2VE7C 4LF4E 1HR0E 1USVA 1N0VC 1HNWE 2LMZA 3B78A 5GMEA 2UUAE 2JVAA 3HPZA 1Y6ZA 4IZJB 4L5NC 1FJGI 3LNUA 2V8PA 1YYKA 4B3RE 2B3TB 1YYOA 4IZKA 1SR9A 2JOBA 1XMOE 5F3WA 2R3VA 1N32I 4FWDA 1I94I 4PU9A 4DV6I 4X65I 1O0WA 2BM0A 5L3JA 4JI5E 1S16A 2CG9A 1MU5A 4LF6E 4LF5E 4KHPI 4HACA 3H4LA 4BC7A 1STUA 2NUFA 3C4BA 4F9BB 4LF8E 4DUYE 4GEQB 1PIEA 1WHQA 2CGEA 4LFBI 4DV2I 2LUPB 3T1YI 3VK6A 3J81Q 4B3MI 1Z0TA 3HQ1A 1Z5CA 4LTYA 3K17A 2HKJA 4DR4E 1NHHA 3ADJA 3IWCA 2L3JA 4DV4E 2NUEA 4DPXA 1N34E 4JI2E 4F54A 4DV3I 3WU3A 1XMQE 4LF9I 4JYAE 4P7AA 4EMDA 3HXLA 2DSYA 4DR2E 2UXDE 5AE3A 1Z0WA 1ZM2A 4DR6E 3B82A 2EZ6A 4FWHA 4DUZI 4BMJA 1T4LB 1H73A 2V8QB 2L3CA 3QT7A 1FWLA 4X66E 1BKNA 2LE2A 1NHJA 2UUCI 2HHHE 2VQEI 4YHHI 3AUZA 1KKHA 1HNZI 4OOGC 4JI3E 4JI7I 1H74A 4LF4I 4LFAI 4IZKB 3VYYA 4DU8A 5GMDA 4TUGA 2UUAI 1N33I 1S4EA 4Q28A 2B9DA 4Z7CA 3AV0A 2FGGA 1NZ0A 3PYDA 4NXNI 2H36X 3K6QA 3PYGA 4KQVA 1MG7A 4DR7I 1FI4A 2WZOA 4DR3I 4JI5I 5CFFE 2XEXA 2N3GA 4P78A 4BC9A 4DR1E 5T6JA 4LF5I 4JG4A 1UILA 4DR5I 2F8BA 1XHKA 2V86A 2BM1A 2E5LE 4DUYI 2EFGA 4WPYA 2LUQA 4WUDA 4LF7I 1WUUA 2PNMA 5IT9C 1ZM3A 3HTXA 4DXLA 1FKAE 3P06A 4FWGA 4JV5I 1ZM9A 1RQ0A 2E1MA 2IOPA 2YZTA 1Y4SA 2VF1A 2UXBI 1B63A 2O1TA 1HNXI 2X36A 2FV4B 4BBYA 2Q2EB 4J8ZA 1XMQI 2RSMA 3V2UC 3Q1QA 1IBKE 3P1XA 1J26A 1U2RA 5BR8I 3PRYA 2UUBE 4X62E 5AASA 2L92A 1EA6A 4JI1I 5LMUI 3JTZA 2HHHI 2ZBKB 2ZM6I 1PVGA 4LFCE 4PRXA 4AQYE 2DIXA 4DU7A 3WU5A 1X49A 2DMYA 2L8TA 2F4VE 2IHR1 3ZZ0A 2G7HA 2Z5BB 4USMA 3ADLA 2AJ4A 1ZBTA 1A6FA 2L6MA 4B3SE 2CZ9A 2FTXB 4USKA 1GZ6A 3WU4A 4DV5E 4X64E 1J5EI 4M2ZA 3ZZUA 1DARA 1Z0VA 3ZM7A 3J80Q 5AE2A 2VQFE 2LTRA 1ELOA 1Z5AA 2MC6A 3HJCA 3J80C 3IWBA 4WFTA 2B7VA 3HPSA 2V2VA 3ZKBA 4YY3E 3T1HE 5IWAI 4DV1E 4BCAA 4K0KI 4JI8E 5LMNE 2UXCE 2MDRA 1XNRE 2WW4A 1T4OA 4R1FA 1N36I 2UU9I 4B3TI 4BS9A 3H09A 4DV0E 3MSWA 3GONA 2YT4A 1IBKI 4I3HA 1UHZA 1HR0I 2HKEA 1HNWI 1Z5BA 2R42A 4X62I 4UTGA 3VYXA 1ZBQA 4WYQB 2ODRC 1FJGE 4ED4A 1HK7A 1X48A 4B3RI 2GS8A 2DEJA 4WUCA 1N32E 1XMOI 2Z5BA 2L33A 1I94E 4R8OA 3OMLA 4X65E 4LFCI 2CPNA 4ZVIA 4NXME 4XTJA 3IWDA 2DEIA 4LF6I 1K47A 4KHPE 3ZZTA 4GKKE 4LF8I 5IT9Q 4DV2E 5A2QC 3RMPA 3T1YE 3Q6NA 2V85A 3ZKDA 3C4TA 1MX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTS A;  1OJ4 A;  4JI6 E;  1UEK A;  3PYE A;  4JI0 E;  3WU6 A;  2L2N A;  4DR4 I;  2B7T A;  1D6T A;  3B8H A;  4DV4 I;  1N34 I;  4JI2 I;  3QT6 A;  3V5R A;  1Z0B A;  4JYA I;  3J7Y p;  1KTV A;  4PRV A;  1QU6 A;  2NA2 A;  2A2D A;  4DR2 I;  4OX9 E;  2UXD I;  2JY9 A;  3T1H I;  4DR6 I;  4DUZ E;  4JI4 E;  2LJP A;  2HK2 A;  4X66 I;  5LMN I;  4UT4 A;  4M30 A;  2A2C A;  2LBS B;  1DI2 A;  2VQE E;  4YHH E;  1H7S A;  2HFU A;  2V34 A;  1EKZ A;  4DKK A;  1HNZ E;  1FWK A;  4JI7 E;  4JI3 I;  4LFA E;  2N3H A;  4HXZ A;  1YYW A;  4GKJ E;  1N33 E;  4FN5 A;  4FW9 A;  4DPY A;  1IBM E;  2BV3 A;  3LPS A;  4Z7Y A;  1Z0E A;  4HY1 A;  4NXN E;  1RR9 A;  4DR7 E;  4DR3 E;  4NXM I;  2J7K A;  2L2M A;  2HFS A;  1FNM A;  1VIS A;  4DR1 I;  4DR5 E;  3D4J A;  2E5L I;  4GKK I;  2V2Z A;  1ZM4 A;  3CWV A;  4DV7 E;  4LF7 E;  4HYM A;  1N0U A;  1H72 C;  1RC7 A;  3JAM Q;  3HUL A;  1H7U A;  3JAM C;  4JV5 E;  1X47 A;  4JI6 I;  3J81 C;  2LRS A;  2OI2 A;  4JI0 I;  3OTO E;  4WUB A;  2UXB E;  3J7A M;  1HNX E;  1XNQ E;  2DB2 A;  1IBL E;  2RS7 A;  4M1K A;  1ZXM A;  2NUG A;  2V2Q A;  4OX9 I;  3F0N A;  5BR8 E;  3QT5 A;  1B62 A;  2UUB I;  5LL6 R;  1Z59 A;  4JI4 I;  3K1J A;  4JI1 E;  5FLX Q;  5LMU E;  2L2K B;  2ZM6 E;  4DV6 E;  1EI1 A;  2VF3 A;  2X7I A;  5FLX C;  4DPT A;  4AQY I;  1QZR A;  4RPF A;  4URL A;  1GQE A;  2RS6 A;  2F4V I;  4GKJ I;  5A2Q Q;  2ZIT A;  1ZXN A;  4LFB E;  4B3S I;  1IBM I;  1T4N A;  1Z0C A;  4HAC B;  3M6A A;  1Z0G A;  4B3M E;  4DV5 I;  3ADG A;  4X64 I;  1J5E E;  4X8W A;  1KVK A;  3LLH A;  3ADI A;  3PYF A;  2HK3 A;  1RRE A;  4MYT A;  2E1R A;  1KIJ A;  2LJH A;  4DPU A;  2VQF I;  4DV3 E;  3J7A G;  4LF9 E;  1WHN A;  3LTO A;  4DV7 I;  1NHI A;  4P52 A;  1YZ9 A;  4YY3 I;  2RTX A;  5IWA E;  1PKP A;  4DV1 I;  4K0K E;  2NPF A;  4DPW A;  4JI8 I;  4MYU A;  3OTO I;  3QT8 A;  2UUC E;  1XNQ I;  2UXC I;  1XNR I;  1N36 E;  2UU9 E;  4B3T E;  1IBL I;  4DV0 I;  2KHX A;  4LF4 E;  1HR0 E;  1N0V C;  1HNW E;  3B78 A;  5GME A;  2UUA E;  2JVA A;  1FJG I;  3LNU A;  2V8P A;  1YYK A;  4B3R E;  2B3T B;  1YYO A;  2R3V A;  1XMO E;  1N32 I;  4FWD A;  1I94 I;  4PU9 A;  4DV6 I;  4X65 I;  1O0W A;  2BM0 A;  5L3J A;  4JI5 E;  1S16 A;  1MU5 A;  4LF6 E;  4LF5 E;  4KHP I;  4HAC A;  3H4L A;  1STU A;  2NUF A;  3C4B A;  4LF8 E;  4DUY E;  1PIE A;  1WHQ A;  4LFB I;  4DV2 I;  2LUP B;  3T1Y I;  3J81 Q;  4B3M I;  1Z0T A;  1Z5C A;  3K17 A;  2HKJ A;  4DR4 E;  1NHH A;  3ADJ A;  2L3J A;  4DV4 E;  2NUE A;  4DPX A;  1N34 E;  4JI2 E;  4DV3 I;  3WU3 A;  1XMQ E;  4LF9 I;  4JYA E;  4P7A A;  4EMD A;  4DR2 E;  2UXD E;  1Z0W A;  1ZM2 A;  4DR6 E;  3B82 A;  2EZ6 A;  4FWH A;  4DUZ I;  1T4L B;  1H73 A;  2L3C A;  3QT7 A;  1FWL A;  4X66 E;  1BKN A;  1NHJ A;  2UUC I;  2HHH E;  2VQE I;  4YHH I;  1KKH A;  1HNZ I;  4OOG C;  4JI3 E;  4JI7 I;  1H74 A;  4LF4 I;  4LFA I;  3VYY A;  4DU8 A;  5GMD A;  2UUA I;  1N33 I;  1S4E A;  4Z7C A;  1NZ0 A;  3PYD A;  4NXN I;  3PYG A;  4KQV A;  1MG7 A;  4DR7 I;  1FI4 A;  4DR3 I;  4JI5 I;  5CFF E;  2XEX A;  2N3G A;  4DR1 E;  4LF5 I;  4JG4 A;  1UIL A;  4DR5 I;  1XHK A;  2BM1 A;  2E5L E;  4DUY I;  2EFG A;  2LUQ A;  4WUD A;  4LF7 I;  1WUU A;  1ZM3 A;  5IT9 C;  3HTX A;  4DXL A;  1FKA E;  4FWG A;  4JV5 I;  1ZM9 A;  1RQ0 A;  2UXB I;  1B63 A;  1HNX I;  2X36 A;  2Q2E B;  1XMQ I;  2RSM A;  3V2U C;  3Q1Q A;  1IBK E;  3P1X A;  1J26 A;  1U2R A;  5BR8 I;  2UUB E;  4X62 E;  1EA6 A;  4JI1 I;  5LMU I;  2HHH I;  2ZBK B;  2ZM6 I;  1PVG A;  4LFC E;  4PRX A;  4AQY E;  2DIX A;  4DU7 A;  3WU5 A;  1X49 A;  2DMY A;  2F4V E;  2IHR 1;  3ZZ0 A;  4USM A;  3ADL A;  2AJ4 A;  1ZBT A;  1A6F A;  4B3S E;  2CZ9 A;  4USK A;  3WU4 A;  4DV5 E;  4X64 E;  1J5E I;  4M2Z A;  3ZZU A;  1DAR A;  1Z0V A;  3ZM7 A;  3J80 Q;  2VQF E;  2LTR A;  1ELO A;  1Z5A A;  3J80 C;  4WFT A;  2B7V A;  2V2V A;  3ZKB A;  4YY3 E;  3T1H E;  5IWA I;  4DV1 E;  4K0K I;  4JI8 E;  5LMN E;  2UXC E;  2MDR A;  1XNR E;  2WW4 A;  1T4O A;  4R1F A;  1N36 I;  2UU9 I;  4B3T I;  4DV0 E;  3GON A;  2YT4 A;  1IBK I;  4I3H A;  1UHZ A;  1HR0 I;  2HKE A;  1HNW I;  1Z5B A;  2R42 A;  4X62 I;  4UTG A;  3VYX A;  4WYQ B;  1FJG E;  4ED4 A;  1X48 A;  4B3R I;  2GS8 A;  2DEJ A;  4WUC A;  1N32 E;  1XMO I;  2L33 A;  1I94 E;  4X65 E;  4LFC I;  2CPN A;  4ZVI A;  4NXM E;  4XTJ A;  2DEI A;  4LF6 I;  1K47 A;  4KHP E;  3ZZT A;  4GKK E;  4LF8 I;  5IT9 Q;  4DV2 E;  5A2Q C;  3T1Y E;  3ZKD A;  3C4T A;  1MX0 A; 
#chains in the Genus database with same CATH topology
 4N4R B;  2LTS A;  2WBT A;  1OJ4 A;  2EOJ A;  4JI6 E;  2JT2 A;  2Z5E A;  2MKD A;  1UEK A;  2EQ3 A;  2JR1 A;  3PYE A;  4LCF A;  4JI0 E;  3WU6 A;  2L2N A;  2PNL A;  2B7T A;  2EM6 A;  4DR4 I;  2BB8 A;  4MLV A;  3B8H A;  2V87 A;  5C0X E;  4DV4 I;  1D6T A;  1GTK A;  4BA1 B;  5KL2 A;  1N34 I;  4JI2 I;  3QT6 A;  4M0V A;  1B69 A;  3V5R A;  1Z0B A;  4JYA I;  3J7Y p;  1A1G A;  1KTV A;  4N3O A;  4PRV A;  1QU6 A;  2NA2 A;  2YTG A;  2WBU A;  2A2D A;  4DR2 I;  4OX9 E;  2UXD I;  2JY9 A;  4U3D A;  2EWL A;  2EN3 A;  2YPN A;  3T1H I;  4O4K A;  4DR6 I;  2VES A;  4P7D A;  5AE1 A;  2EPO A;  4TUI A;  4NHR A;  4DUZ E;  1ZU1 A;  2YU8 A;  4JI4 E;  4F6N A;  1USU A;  2EOO A;  2LJP A;  3F6G A;  5EKW A;  3EPL A;  2DMI A;  2HK2 A;  4X66 I;  5LMN I;  1BB8 A;  4M30 A;  4UT4 A;  4R2A A;  2A2C A;  3QG5 C;  2LBS B;  1DI2 A;  4ISA A;  2O1W A;  2M9A A;  2VQE E;  4YHH E;  2EOS A;  2EPZ A;  4KWY A;  1H7S A;  1OYS A;  2HFU A;  2V34 A;  1EKZ A;  5K36 B;  4DKK A;  2EN1 A;  1HNZ E;  4OO1 A;  1WXR A;  1FWK A;  2WNR A;  4JI7 E;  2MDG A;  4JI3 I;  4LFA E;  2N3H A;  2ENA A;  1TN9 A;  4HXZ A;  2E72 A;  1YYW A;  2V89 A;  1PJS A;  3JU0 A;  2EN2 A;  3UK3 C;  4HEI A;  4GKJ E;  4FW5 A;  2PNZ B;  2V83 A;  3M85 D;  1N33 E;  4FN5 A;  1UDQ A;  3DF6 A;  4FW9 A;  2DLQ A;  4DPY A;  1DQ3 A;  4IS1 C;  1IBM E;  2BV3 A;  3LPS A;  1Z0E A;  4HY1 A;  2PO2 B;  4NXN E;  3PS3 A;  4Z7Y A;  1RR9 A;  4WSG A;  4I8O A;  2Q8U A;  2D9H A;  2JOX A;  4DR7 E;  1R6L A;  4DR3 E;  3KWR A;  2EPK X;  4O5G A;  2L2M A;  2M1S A;  2HGH A;  2J7K A;  4NXM I;  2HFS A;  5FWK A;  2O1V A;  1FNM A;  1VIS A;  4DR1 I;  2EMY A;  2M4I A;  2IOQ A;  4DR5 E;  5IV8 B;  4U3B A;  2JEA A;  3D4J A;  5JEA D;  4RHB B;  2E5L I;  4GKK I;  1X6H A;  2RSI A;  2V2Z A;  1ZM4 A;  4MU1 A;  3CWV A;  4DV7 E;  4LF7 E;  4HYM A;  1N0U A;  2YTD A;  1H72 C;  1KYQ A;  1RC7 A;  2Z5C A;  4NBQ A;  3JAM Q;  3UHM A;  3HUL A;  2YTI A;  1H7U A;  5LLQ A;  2KON A;  2JE6 B;  3JAM C;  4JV5 E;  1X47 A;  1UDO A;  3J81 C;  3Q6M A;  4JI6 I;  2LRS A;  2RPC A;  1YUI A;  2OI2 A;  3P3G A;  3ZOQ B;  4IJD A;  3OTO E;  1BBO A;  2UXB E;  4WUB A;  4JI0 I;  3J7A M;  1HNX E;  1XNQ E;  2DB2 A;  2MC5 A;  1MEY C;  2NN6 A;  1IBL E;  2RS7 A;  3LML A;  4M1K A;  1ZXM A;  3F6H A;  2EMF A;  1E3H A;  1XXE A;  2AE8 A;  4F9C B;  2K7I A;  2NUG A;  2V2Q A;  4OX9 I;  3F0N A;  2C38 B;  1BBG A;  5ADZ A;  5BR8 E;  2N8X A;  2EOF A;  3QT5 A;  1B62 A;  2UUB I;  3EPK A;  5LL6 R;  5K36 A;  5A6A A;  1Z59 A;  2EM5 A;  2EOI A;  2EM4 A;  3EPJ A;  2DGC A;  4JI4 I;  4R2C A;  2BA0 D;  2EOY A;  3VHT B;  2GO4 A;  3K1J A;  1G2F C;  4JI1 E;  5FLX Q;  2WNR B;  1Y4U A;  5LMU E;  2KOU A;  4F9A B;  2L2K B;  2YU5 A;  4IZK A;  5JEA B;  2ZM6 E;  4DV6 E;  1A1K A;  2GLI A;  5FLX C;  1EI1 A;  2VF3 A;  2X7I A;  4IZJ A;  4DPT A;  2NN6 D;  4AQY I;  4MLQ A;  1QZR A;  2VRD A;  1T38 A;  2PO2 A;  1WRJ A;  4RPF A;  4URL A;  1GQE A;  2EPR A;  2RS6 A;  4BHC A;  2F4V I;  2EMA A;  2ODR D;  3FIG A;  3THN A;  4DMI A;  4KZS A;  4GKJ I;  5A2Q Q;  2ZIT A;  1ZXN A;  1ZAA C;  5C0X D;  1MGT A;  4AID A;  4LFB E;  3NZK A;  1TF3 A;  3BID A;  5KL6 A;  2K4V A;  2M7Q A;  1IBM I;  4B3S I;  4IFD F;  2EMH A;  2JXP A;  1T4N A;  4GZN C;  2YRK A;  1Z0C A;  2V88 A;  4HAC B;  1UDS A;  4FW6 A;  3M6A A;  4WSP A;  2CT1 A;  4B3M E;  1OYR A;  1Z0G A;  4DV5 I;  3ADG A;  2I13 A;  4X64 I;  2JEA B;  4IZJ D;  1J5E E;  4X8W A;  1KVK A;  2EPL X;  2LJU A;  4MU4 A;  5A6B D;  3LLH A;  3ADI A;  4L8N A;  3PYF A;  2HK3 A;  1RRE A;  2JE6 A;  3M7N G;  5DNY A;  2Z5C B;  4MYT A;  3DJW A;  2E1R A;  1KIJ A;  2LJH A;  2BA1 G;  4DPU A;  2VQF I;  4DV3 E;  3J7A G;  3KZY A;  2GQ0 A;  4LF9 E;  2EOE A;  2EPM X;  1WHN A;  3LTO A;  2JWO A;  4DV7 I;  1NHI A;  4LOM A;  4P52 A;  4AM3 A;  4R03 A;  2NAB A;  1YZ9 A;  4IFD E;  2YTN A;  4YY3 I;  1YH8 A;  2RTX A;  2O1U A;  1A1H A;  5IWA E;  3K85 A;  1PKP A;  4DV1 I;  2EN4 A;  1Y60 A;  4K0K E;  2NPF A;  4DPW A;  2NN6 B;  4LU9 A;  2C38 A;  4JI8 I;  4MYU A;  3OTO I;  3QT8 A;  1ZR9 A;  2UUC E;  1XNQ I;  2UXC I;  1XNR I;  2EJ4 A;  1N36 E;  2UU9 E;  4B3T E;  1IBL I;  4MQY A;  2BR2 B;  4DV0 I;  5C0X B;  5KL4 A;  2EMZ A;  2KHX A;  2CTD A;  2VE7 C;  3B4T A;  5AC5 A;  4LF4 E;  1UDN A;  1HR0 E;  1YSA C;  3MHS C;  1USV A;  5JEA A;  1N0V C;  4RH8 A;  1HNW E;  5DRO A;  2LMZ A;  3B78 A;  1YUJ A;  5GME A;  2UUA E;  2JVA A;  2EM2 A;  3HPZ A;  3TQM A;  3DD6 A;  1Y6Z A;  3KRN A;  4IZJ B;  4L5N C;  1FJG I;  1UBD C;  3LNU A;  1G2D C;  1YYK A;  2YRH A;  2B3T B;  1YYO A;  4B3R E;  1R6M A;  1QNT A;  2V8P A;  1SR9 A;  2JOB A;  1PJT A;  5F3W A;  1XMO E;  2R3V A;  1N32 I;  4FWD A;  2PRT A;  5DRR A;  5DRQ A;  2EPP A;  2YRM A;  3C6M A;  2GO3 A;  4PU9 A;  5EL9 A;  4DV6 I;  2EL6 A;  1O0W A;  3MHH C;  2BM0 A;  4JI5 E;  5L3J A;  4X65 I;  1RHY A;  1EH6 A;  1S16 A;  1T39 A;  2CG9 A;  1MU5 A;  1X6F A;  4LF6 E;  4LF5 E;  2GPI A;  4HAC A;  4KHP I;  3H4L A;  4BC7 A;  2EOM A;  1STU A;  2LO3 A;  2NUF A;  3C4B A;  4OO1 C;  4F9B B;  4R2R A;  4LF8 E;  4DUY E;  4GEQ B;  1PIE A;  4LPF A;  1WHQ A;  2CGE A;  4LFB I;  2YSO A;  4DV2 I;  2LUP B;  2YWQ A;  3T1Y I;  4F2J C;  1WJP A;  3P76 A;  3VK6 A;  3J81 Q;  4J3D A;  2EPU A;  4O43 A;  1YPN A;  4AIM A;  3P3C A;  4OZE A;  3P3E A;  4IS9 A;  4OO1 F;  3THO B;  4B3M I;  3M85 G;  1Z0T A;  3HQ1 A;  2F1D A;  1Z5C A;  4MU3 A;  4LCG A;  4LTY A;  3K17 A;  2HKJ A;  4DR4 E;  2YTE A;  4M9V C;  2EOQ A;  1NHH A;  3ADJ A;  3IWC A;  2L3J A;  2CSH A;  4DV4 E;  2NUE A;  4DPX A;  1N34 E;  4JI2 E;  2EQ0 A;  4GQU A;  4F54 A;  4DV3 I;  3WU3 A;  1XMQ E;  4LF9 I;  4JYA E;  5A6J A;  4P7A A;  2A25 A;  4EMD A;  3HXL A;  2DSY A;  4DR2 E;  1Y5Y A;  2UXD E;  5AE3 A;  1Z0W A;  1ZM2 A;  5A69 A;  2EMX A;  4R2P A;  4DR6 E;  2BR2 A;  3B82 A;  5C0X A;  2EMK A;  2EZ6 A;  4FWH A;  4DUZ I;  4OO1 E;  4BMJ A;  1OYP A;  1T4L B;  1H73 A;  3U1K A;  2YTO A;  2V8Q B;  4ZYD A;  2L3C A;  3QT7 A;  1FWL A;  4X66 E;  3CDI A;  1BKN A;  1IQS A;  2LE2 A;  1NHJ A;  2UUC I;  1AH5 A;  1YFH A;  2HHH E;  4MDT A;  2VQE I;  4YHH I;  3AUZ A;  3EPH A;  2WCC 3;  2YTJ A;  2ENC A;  2ENH A;  1KKH A;  4OKG A;  5ELW A;  1VI7 A;  5A6B A;  1HNZ I;  4OOG C;  3CDJ A;  1L4S A;  1I94 I;  4JI3 E;  4JI7 I;  1TF6 A;  1H74 A;  4LF4 I;  2NN6 C;  4LFA I;  4IZK B;  3VYY A;  4DU8 A;  4BHB A;  3BF2 A;  2YTQ A;  2EP3 A;  4TUG A;  5GMD A;  2UUA I;  4FW3 A;  1N33 I;  1S4E A;  4ZYG A;  4Q28 A;  2I9I A;  1NEI A;  2B9D A;  4Z7C A;  3AV0 A;  2FGG A;  5K36 C;  4MU0 A;  1NZ0 A;  3PYD A;  4NXN I;  2H36 X;  3M7N D;  3K6Q A;  3PYG A;  2EL5 A;  4KQV A;  1EH8 A;  1MG7 A;  4DR7 I;  1FI4 A;  4IFD D;  2WZO A;  2DRP A;  3PS1 A;  5CFF E;  2PO0 B;  2XEX A;  3GCM A;  5DRP A;  4DR3 I;  4JI5 I;  1X5W A;  2BA0 G;  2JYA A;  2N3G A;  4P78 A;  4BC9 A;  4ZYH A;  1UN6 B;  4DR1 E;  5T6J A;  5K36 F;  4LF5 I;  2DLK A;  4JG4 A;  1UIL A;  4R2S A;  2F8B A;  2RQL A;  5DNX A;  4ZYE A;  1XHK A;  4DR5 I;  2V86 A;  1IQO A;  2BM1 A;  2JP9 A;  4Q35 B;  2E5L E;  4DUY I;  2EFG A;  2ADR A;  4WPY A;  2EOH A;  2YSP A;  2LUQ A;  5IXM B;  4WUD A;  4LF7 I;  1WUU A;  2PNM A;  5IT9 C;  1ZM3 A;  5TSE A;  3HTX A;  2IES A;  4DXL A;  4WXD A;  1FKA E;  3P06 A;  4FWG A;  2EMW A;  4JV5 I;  1ZM9 A;  1P42 A;  1RQ0 A;  2E1M A;  2LCE A;  2IOP A;  2YZT A;  3BBG A;  1Y4S A;  2VF1 A;  2UXB I;  1DGC A;  1B63 A;  2O1T A;  1HNX I;  5K36 E;  2X36 A;  2EML A;  4R2E A;  1IMU A;  3HKM A;  2FV4 B;  4BA2 A;  4BBY A;  3GME A;  2Q2E B;  4J8Z A;  1XMQ I;  1JK2 A;  3BGH A;  2RSM A;  2EOZ A;  5DNL A;  3V2U C;  3Q1Q A;  1IBK E;  1EH7 A;  3P1X A;  1J26 A;  1U2R A;  5BR8 I;  3PRY A;  2UUB E;  4X62 E;  3ECR A;  1X6E A;  5AAS A;  1SFE A;  2ELZ A;  4IFD B;  4FW7 A;  2L92 A;  4O24 A;  2JPA A;  2LV2 A;  1A1J A;  2LVH A;  1EA6 A;  4JI1 I;  2EN7 A;  2J7J A;  2EE8 A;  5LMU I;  3JTZ A;  2HHH I;  2ZBK B;  2C39 A;  2ZM6 I;  1PVG A;  1X3C A;  2WBS A;  4LFC E;  4WXC A;  4PRX A;  4AQY E;  2C37 A;  2DIX A;  5KL5 A;  4DU7 A;  4HTG A;  2R1F A;  3WU5 A;  1X49 A;  2DMY A;  2YTF A;  2L8T A;  2EM3 A;  5KL7 A;  2F4V E;  2CVE A;  2PO0 A;  3PS2 A;  1YHC A;  2IHR 1;  3ZZ0 A;  2G7H A;  2Z5B B;  1KJK A;  4USM A;  3ADL A;  2AJ4 A;  1ZBT A;  1A6F A;  2L6M A;  5JEA C;  4B3S E;  2CZ9 A;  2JEB B;  2FTX B;  4USK A;  2HC5 A;  1GZ6 A;  3WU4 A;  1AAY A;  2EM8 A;  4X9J A;  4DV5 E;  4X64 E;  3M99 B;  4NZV A;  1PJQ A;  2PO1 A;  1J5E I;  4M2Z A;  3L7Z B;  3ZZU A;  5JEA F;  2WP8 A;  2EOR A;  1DAR A;  1Z0V A;  4OO1 D;  3KZZ A;  4F6M A;  3ZM7 A;  1N3G A;  2GHF A;  3J80 Q;  3L00 A;  5AE2 A;  2VQF E;  2LTR A;  1ELO A;  1Z5A A;  2EPC A;  2MC6 A;  4FK5 C;  3HJC A;  4LCH A;  3J80 C;  2EOX A;  3IWB A;  1PDA A;  4WFT A;  2B7V A;  3HPS A;  2MKN A;  2IER A;  2V2V A;  3ZKB A;  4BA1 A;  4YY3 E;  3T1H E;  2EMG A;  1LLM C;  3U1Y A;  5KL3 A;  1A1I A;  5IWA I;  4DV1 E;  1P47 A;  1E3P A;  4BCA A;  4K0K I;  4BA2 B;  1F2I G;  4JI8 E;  5JEA E;  2EN6 A;  2LT7 A;  2EPA A;  5LMN E;  2EMC A;  1RMD A;  2UXC E;  2MDR A;  1XNR E;  4IFD A;  2ELY A;  2WW4 A;  1T4O A;  4R1F A;  1N36 I;  2UU9 I;  2R76 A;  1Z1B A;  4B3T I;  4QNJ A;  4BS9 A;  3H09 A;  4DV0 E;  3MSW A;  3GON A;  2YT4 A;  4QNK A;  1IBK I;  4I3H A;  1UHZ A;  1HR0 I;  2HKE A;  1HNW I;  1Z5B A;  2R42 A;  4X62 I;  4UTG A;  3VYX A;  2EMI A;  2C39 B;  1ZBQ A;  2YTP A;  3C6K A;  4WYQ B;  3GLL A;  2ODR C;  4WX9 A;  1FJG E;  4ED4 A;  2EM0 A;  1HK7 A;  1X48 A;  2BBG A;  2C37 B;  4B3R I;  2GS8 A;  2EQ1 A;  1A1L A;  2DEJ A;  4OO1 B;  4WUC A;  2NN6 F;  1N32 E;  5C0X C;  1XMO I;  2EMB A;  2Z5B A;  2PNZ A;  2L33 A;  1I94 E;  3H1C A;  4R8O A;  3OML A;  2BA1 D;  4X65 E;  2EN8 A;  2CPN A;  1A1F A;  4ZVI A;  4LFC I;  4NXM E;  2JEB A;  4XTJ A;  3IWD A;  2HJJ A;  4IFD C;  2DEI A;  4LF6 I;  1K47 A;  4KHP E;  5A6K A;  3ZZT A;  5C0X F;  2O3Z A;  2EPX A;  2EL4 A;  2EM7 A;  2EM9 A;  4GKK E;  2J65 A;  3L7Z A;  4FW4 A;  4LF8 I;  5K36 D;  5IT9 Q;  2EPN A;  4R2D A;  1NCS A;  4DV2 E;  5A2Q C;  3RMP A;  3T1Y E;  2PO1 B;  4R2Q A;  3Q6N A;  1JK1 A;  2V85 A;  2NN6 E;  2WP8 B;  3EQ1 A;  5AC4 A;  3ZKD A;  3C4T A;  1MX0 A; 
#chains in the Genus database with same CATH homology
 2LTS A;  1OJ4 A;  4JI6 E;  2Z5E A;  1UEK A;  2JR1 A;  3PYE A;  4JI0 E;  3WU6 A;  2L2N A;  2PNL A;  2B7T A;  4DR4 I;  1D6T A;  3B8H A;  2V87 A;  4DV4 I;  1N34 I;  4JI2 I;  3QT6 A;  4M0V A;  3V5R A;  1Z0B A;  4JYA I;  3J7Y p;  4N3O A;  1KTV A;  4PRV A;  1QU6 A;  2NA2 A;  2A2D A;  4DR2 I;  4OX9 E;  2UXD I;  2JY9 A;  2EWL A;  3T1H I;  4DR6 I;  4P7D A;  5AE1 A;  4TUI A;  4DUZ E;  4JI4 E;  1USU A;  2LJP A;  3F6G A;  2HK2 A;  4X66 I;  5LMN I;  4UT4 A;  4M30 A;  2A2C A;  2LBS B;  1DI2 A;  2O1W A;  2VQE E;  4YHH E;  1H7S A;  2HFU A;  2V34 A;  1EKZ A;  4DKK A;  1HNZ E;  1WXR A;  1FWK A;  4JI7 E;  4JI3 I;  4LFA E;  2N3H A;  4HXZ A;  1YYW A;  2V89 A;  3JU0 A;  4GKJ E;  2V83 A;  1N33 E;  4FN5 A;  4FW9 A;  3DF6 A;  4DPY A;  1DQ3 A;  1IBM E;  2BV3 A;  3LPS A;  4Z7Y A;  1Z0E A;  4HY1 A;  4NXN E;  1RR9 A;  4I8O A;  2JOX A;  4DR7 E;  4DR3 E;  3KWR A;  4NXM I;  2J7K A;  2L2M A;  2M1S A;  2HFS A;  5FWK A;  2O1V A;  1FNM A;  1VIS A;  4DR1 I;  2M4I A;  2IOQ A;  4DR5 E;  3D4J A;  2E5L I;  4GKK I;  2V2Z A;  1ZM4 A;  3CWV A;  4DV7 E;  4LF7 E;  4HYM A;  1N0U A;  1H72 C;  1RC7 A;  2Z5C A;  3JAM Q;  3HUL A;  1H7U A;  2KON A;  3JAM C;  4JV5 E;  1X47 A;  3Q6M A;  3J81 C;  4JI6 I;  2LRS A;  2OI2 A;  3ZOQ B;  4JI0 I;  3OTO E;  4WUB A;  2UXB E;  3J7A M;  1HNX E;  1XNQ E;  2DB2 A;  2MC5 A;  1IBL E;  2RS7 A;  3LML A;  4M1K A;  1ZXM A;  3F6H A;  4F9C B;  2NUG A;  2V2Q A;  4OX9 I;  3F0N A;  5ADZ A;  5BR8 E;  3QT5 A;  1B62 A;  2UUB I;  5LL6 R;  1Z59 A;  4JI4 I;  3K1J A;  4JI1 E;  5FLX Q;  1Y4U A;  5LMU E;  2KOU A;  4F9A B;  2L2K B;  2ZM6 E;  4DV6 E;  1EI1 A;  2VF3 A;  5FLX C;  2X7I A;  4IZJ A;  4DPT A;  4AQY I;  1QZR A;  4RPF A;  4URL A;  1GQE A;  2RS6 A;  2F4V I;  2ODR D;  3FIG A;  4DMI A;  4KZS A;  4GKJ I;  5A2Q Q;  2ZIT A;  1ZXN A;  4LFB E;  4B3S I;  2K4V A;  2M7Q A;  1IBM I;  1T4N A;  1Z0C A;  2V88 A;  4HAC B;  3M6A A;  4WSP A;  4B3M E;  1Z0G A;  4DV5 I;  3ADG A;  4X64 I;  4IZJ D;  1J5E E;  4X8W A;  1KVK A;  3LLH A;  3ADI A;  4L8N A;  3PYF A;  2HK3 A;  1RRE A;  5DNY A;  2Z5C B;  4MYT A;  3DJW A;  2E1R A;  1KIJ A;  2LJH A;  4DPU A;  2VQF I;  4DV3 E;  3J7A G;  2GQ0 A;  4LF9 E;  1WHN A;  3LTO A;  2JWO A;  4DV7 I;  1NHI A;  4P52 A;  4R03 A;  1YZ9 A;  4YY3 I;  2RTX A;  2O1U A;  5IWA E;  3K85 A;  1PKP A;  4DV1 I;  4K0K E;  2NPF A;  4DPW A;  4LU9 A;  4JI8 I;  4MYU A;  3OTO I;  3QT8 A;  2UUC E;  1XNQ I;  2UXC I;  1XNR I;  1N36 E;  2UU9 E;  4B3T E;  1IBL I;  4DV0 I;  2KHX A;  2VE7 C;  4LF4 E;  1HR0 E;  1USV A;  1N0V C;  1HNW E;  2LMZ A;  3B78 A;  5GME A;  2UUA E;  2JVA A;  3HPZ A;  1Y6Z A;  4IZJ B;  4L5N C;  1FJG I;  3LNU A;  2V8P A;  1YYK A;  4B3R E;  2B3T B;  1YYO A;  4IZK A;  1SR9 A;  2JOB A;  1XMO E;  5F3W A;  2R3V A;  1N32 I;  4FWD A;  1I94 I;  4PU9 A;  4DV6 I;  4X65 I;  1O0W A;  2BM0 A;  5L3J A;  4JI5 E;  1S16 A;  2CG9 A;  1MU5 A;  4LF6 E;  4LF5 E;  4KHP I;  4HAC A;  3H4L A;  4BC7 A;  1STU A;  2NUF A;  3C4B A;  4F9B B;  4LF8 E;  4DUY E;  4GEQ B;  1PIE A;  1WHQ A;  2CGE A;  4LFB I;  4DV2 I;  2LUP B;  3T1Y I;  3VK6 A;  3J81 Q;  4B3M I;  1Z0T A;  3HQ1 A;  1Z5C A;  4LTY A;  3K17 A;  2HKJ A;  4DR4 E;  1NHH A;  3ADJ A;  3IWC A;  2L3J A;  4DV4 E;  2NUE A;  4DPX A;  1N34 E;  4JI2 E;  4F54 A;  4DV3 I;  3WU3 A;  1XMQ E;  4LF9 I;  4JYA E;  4P7A A;  4EMD A;  3HXL A;  2DSY A;  4DR2 E;  2UXD E;  5AE3 A;  1Z0W A;  1ZM2 A;  4DR6 E;  3B82 A;  2EZ6 A;  4FWH A;  4DUZ I;  4BMJ A;  1T4L B;  1H73 A;  2V8Q B;  2L3C A;  3QT7 A;  1FWL A;  4X66 E;  1BKN A;  2LE2 A;  1NHJ A;  2UUC I;  2HHH E;  2VQE I;  4YHH I;  3AUZ A;  1KKH A;  1HNZ I;  4OOG C;  4JI3 E;  4JI7 I;  1H74 A;  4LF4 I;  4LFA I;  4IZK B;  3VYY A;  4DU8 A;  5GMD A;  4TUG A;  2UUA I;  1N33 I;  1S4E A;  4Q28 A;  2B9D A;  4Z7C A;  3AV0 A;  2FGG A;  1NZ0 A;  3PYD A;  4NXN I;  2H36 X;  3K6Q A;  3PYG A;  4KQV A;  1MG7 A;  4DR7 I;  1FI4 A;  2WZO A;  4DR3 I;  4JI5 I;  5CFF E;  2XEX A;  2N3G A;  4P78 A;  4BC9 A;  4DR1 E;  5T6J A;  4LF5 I;  4JG4 A;  1UIL A;  4DR5 I;  2F8B A;  1XHK A;  2V86 A;  2BM1 A;  2E5L E;  4DUY I;  2EFG A;  4WPY A;  2LUQ A;  4WUD A;  4LF7 I;  1WUU A;  2PNM A;  5IT9 C;  1ZM3 A;  3HTX A;  4DXL A;  1FKA E;  3P06 A;  4FWG A;  4JV5 I;  1ZM9 A;  1RQ0 A;  2E1M A;  2IOP A;  2YZT A;  1Y4S A;  2VF1 A;  2UXB I;  1B63 A;  2O1T A;  1HNX I;  2X36 A;  2FV4 B;  4BBY A;  2Q2E B;  4J8Z A;  1XMQ I;  2RSM A;  3V2U C;  3Q1Q A;  1IBK E;  3P1X A;  1J26 A;  1U2R A;  5BR8 I;  3PRY A;  2UUB E;  4X62 E;  5AAS A;  2L92 A;  1EA6 A;  4JI1 I;  5LMU I;  3JTZ A;  2HHH I;  2ZBK B;  2ZM6 I;  1PVG A;  4LFC E;  4PRX A;  4AQY E;  2DIX A;  4DU7 A;  3WU5 A;  1X49 A;  2DMY A;  2L8T A;  2F4V E;  2IHR 1;  3ZZ0 A;  2G7H A;  2Z5B B;  4USM A;  3ADL A;  2AJ4 A;  1ZBT A;  1A6F A;  2L6M A;  4B3S E;  2CZ9 A;  2FTX B;  4USK A;  1GZ6 A;  3WU4 A;  4DV5 E;  4X64 E;  1J5E I;  4M2Z A;  3ZZU A;  1DAR A;  1Z0V A;  3ZM7 A;  3J80 Q;  5AE2 A;  2VQF E;  2LTR A;  1ELO A;  1Z5A A;  2MC6 A;  3HJC A;  3J80 C;  3IWB A;  4WFT A;  2B7V A;  3HPS A;  2V2V A;  3ZKB A;  4YY3 E;  3T1H E;  5IWA I;  4DV1 E;  4BCA A;  4K0K I;  4JI8 E;  5LMN E;  2UXC E;  2MDR A;  1XNR E;  2WW4 A;  1T4O A;  4R1F A;  1N36 I;  2UU9 I;  4B3T I;  4BS9 A;  3H09 A;  4DV0 E;  3MSW A;  3GON A;  2YT4 A;  1IBK I;  4I3H A;  1UHZ A;  1HR0 I;  2HKE A;  1HNW I;  1Z5B A;  2R42 A;  4X62 I;  4UTG A;  3VYX A;  1ZBQ A;  4WYQ B;  2ODR C;  1FJG E;  4ED4 A;  1HK7 A;  1X48 A;  4B3R I;  2GS8 A;  2DEJ A;  4WUC A;  1N32 E;  1XMO I;  2Z5B A;  2L33 A;  1I94 E;  4R8O A;  3OML A;  4X65 E;  4LFC I;  2CPN A;  4ZVI A;  4NXM E;  4XTJ A;  3IWD A;  2DEI A;  4LF6 I;  1K47 A;  4KHP E;  3ZZT A;  4GKK E;  4LF8 I;  5IT9 Q;  4DV2 E;  5A2Q C;  3RMP A;  3T1Y E;  3Q6N A;  2V85 A;  3ZKD A;  3C4T A;  1MX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...