4JV5E

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4jv5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jv5E02
2DEIA 3F0NA 4DPYA 1U2RA 4JI7I 2UU9I 1XMOE 5LMNE 1ZXNA 1HR0I 4K0KI 4DUYE 4UTGA 4LFAE 1YYWA 1UILA 4X65E 4LFCI 2R42A 4RPFA 4ZVIA 1N34E 2F4VE 4B3MI 2B3TB 2E5LE 3ADLA 4WYQB 1ZBTA 2HKJA 2WW4A 1IBLI 1B63A 1Z0EA 1QU6A 1Z5AA 2UUBE 5LMUE 1XHKA 2HFUA 4DPTA 2L2NA 1DI2A 4FWHA 4JI1E 2ZBKB 1YYOA 1ZM2A 2UUAI 4B3SE 1FJGE 2BM0A 4DXLA 3J80Q 4DV0I 4JI4I 3J80C 4LFBI 2ZITA 4LF9E 2VQEI 4DV3I 1BKNA 1N32I 4FWDA 2ZM6I 2EFGA 4DR6E 2OI2A 2UUCE 1YZ9A 2LJPA 4YHHI 3QT8A 2CZ9A 1XMOI 1HNWE 4P7AA 4NXMI 2XEXA 1FNMA 4OX9E 1EI1A 3VYXA 4JYAI 2NA2A 1T4LB 1X49A 1A6FA 1PKPA 4DUZI 4DV7E 4B3TE 1OJ4A 3LLHA 4DV6I 4MYUA 1O0WA 2L2KB 2DIXA 4LF7I 1NZ0A 4JI7E 4JI8I 3V2UC 4X8WA 2UU9E 3K17A 4JI1I 2B7TA 1HR0E 2VF3A 4K0KE 4MYTA 1FJGI 3ZKBA 4LFCE 4P52A 4LF9I 3PYEA 1FWLA 4HACB 4B3ME 1K47A 5FLXQ 5FLXC 4LF8I 2IHR1 2UUCI 2UXBI 4PRXA 1ZM3A 1IBLE 2AJ4A 2GS8A 1XMQI 3WU4A 4JV5I 2V8PA 2NUGA 2LTRA 1Z0BA 2UUAE 3C4BA 4DV0E 4LFBE 2DEJA 1FI4A 3J7AG 1Z5BA 3J7AM 2VQEE 4DV3E 1H72C 1H7UA 1N32E 2ZM6E 4X62I 3ZZUA 2UXCI 4YHHE 2NUEA 1XNRI 4KHPI 2X36A 4DV1I 1XNQI 4NXME 1N36I 4JI6I 1RR9A 4JYAE 4FN5A 2E1RA 4M1KA 5LL6R 3PYFA 4DUZE 1Z5CA 4DV6E 2L2MA 4AQYI 2NPFA 4PRVA 2KHXA 4LF7E 1Z0GA 4WUBA 2V2ZA 1Z59A 4JI8E 2L3JA 3P1XA 3ZKDA 4YY3I 1Z0TA 1WHNA 1STUA 1FKAE 1PVGA 3B8HA 3JAMQ 3JAMC 3J81Q 3WU3A 3J81C 1FWKA 1IBKI 5A2QQ 5A2QC 4LF8E 1X47A 3ADGA 2UXBE 2RS6A 3WU5A 4LF6I 4DR2E 1N0VC 1XMQE 4JV5E 4Z7CA 4M2ZA 4PU9A 1EA6A 4WUDA 3H4LA 2MDRA 2LJHA 2A2DA 5GMDA 1IBMI 1ZM9A 1H7SA 4LF5I 1MX0A 2VQFE 4DR1I 2V2VA 4X62E 2EZ6A 1WUUA 2UXCE 2J7KA 1XNRE 4KHPE 4Z7YA 4DV1E 1XNQE 2R3VA 3LPSA 2LTSA 2HFSA 1N36E 4JI6E 2DB2A 1VISA 1RREA 2RSMA 3ADJA 1RQ0A 2JY9A 2N3HA 2LRSA 4WUCA 1Z0WA 2LUPB 2BV3A 4DV4E 4AQYE 1T4NA 4JI3I 2A2CA 1D6TA 4DR2I 5BR8I 3T1YI 3Q1QA 4M30A 4X64I 4YY3E 4DR5I 4B3RE 2B7VA 1Z0VA 1I94I 1NHHA 2JVAA 3QT5A 4HACA 5IT9C 5IT9Q 1KVKA 4JI2E 2N3GA 1IBKE 1MG7A 3V5RA 2VQFI 2V2QA 1NHIA 2RS7A 2V34A 3PYGA 3T1HI 4HYMA 5IWAI 3VYYA 2RTXA 1S4EA 4LF6E 4DPUA 4DR4I 2Q2EB 1HNZI 3LTOA 5L3JA 4JI0E 4DU7A 4USMA 1UHZA 4HXZA 4XTJA 1IBME 4DV4I 1PIEA 4LF5E 4GKJI 4DV2I 4DR1E 2UXDI 1J5EI 1T4OA 1KTVA 3J7Yp 4DPWA 4I3HA 4DR7I 4B3RI 4DV5I 2LBSB 4LF4E 1HNXI 3HTXA 3D4JA 1B62A 4ED4A 4JI2I 3B82A 1UEKA 1KKHA 2X7IA 1EKZA 4DKKA 4DR3E 4JI3E 1S16A 4HY1A 5CFFE 4JI5I 1ELOA 5BR8E 4X66I 3T1YE 4NXNI 3CWVA 4WFTA 1N33E 1ZM4A 3ZZTA 4GKKI 1N0UA 4X64E 4DR5E 4JI0I 4DU8A 1H73A 2HK3A 2L3CA 1I94E 1Z0CA 1H74A 2YT4A 1QZRA 3ZM7A 1YYKA 2BM1A 5LMNI 3GONA 4DUYI 2HKEA 4LFAI 3C4TA 2L33A 4X65I 3T1HE 5IWAE 2CPNA 1N34I 1WHQA 1GQEA 4DR4E 2F4VI 4UT4A 1HNZE 4LF4I 3OTOE 2HHHE 2E5LI 1J26A 3ADIA 3QT6A 2NUFA 2UUBI 5LMUI 4FWGA 4GKJE 4DR3I 2DMYA 4DV2E 1MU5A 4USKA 4KQVA 2UXDE 4B3SI 3WU6A 1N33I 1DARA 1J5EE 4URLA 4DR7E 1X48A 1ZXMA 5GMEA 4DV5E 1RC7A 4DR6I 1HNXE 3K1JA 3LNUA 3M6AA 4DPXA 1HNWI 4R1FA 1KIJA 4EMDA 3B78A 2LUQA 4OX9I 1NHJA 3PYDA 4OOGC 4JI5E 2HK2A 4X66E 4DV7I 4B3TI 4NXNE 3OTOI 4GKKE 2HHHI 4JI4E 4JG4A 3QT7A 3ZZ0A 3HULA 4FW9A
chains in the Genus database with same CATH superfamily
2DEIA 1YSAC 3F0NA 4DPYA 3F6GA 1U2RA 4BS9A 2BA1D 4IFDD 5DRRA 4ISAA 3Q6MA 4JI7I 2EQ1A 2YTIA 2J65A 2M7QA 2UU9I 3B4TA 4RH8A 2EL4A 1XMOE 2EE8A 5LMNE 1ZXNA 1HR0I 4K0KI 4FW3A 5AASA 2DLKA 2EMLA 4DUYE 2B9DA 4IZJB 4LFAE 4WXDA 4ZYGA 1YYWA 1BB8A 1YH8A 4UTGA 1UILA 4X65E 4LFCI 2R42A 2RPCA 1UDOA 2YRMA 1Y60A 2EPOA 4BBYA 2IERA 4RPFA 4ZVIA 2PO1B 1N34E 2F4VE 1WRJA 2Z5BA 4B3MI 4Q28A 2VE7C 2L92A 2B3TB 2E5LE 1YHCA 2L8TA 3ADLA 2EN8A 2YWQA 2I13A 2EMWA 3C6MA 4WYQB 4AM3A 1ZBTA 2ELYA 5KL4A 1PJSA 2BBGA 2HKJA 2YTDA 2WW4A 1IBLI 1T38A 1B63A 1QU6A 1Z0EA 2UUBE 1Z5AA 2BA1G 4FW9A 5LMUE 2KONA 4P78A 3P06A 1XHKA 2WNRA 2HFUA 4DPTA 2ENHA 2L2NA 2Q8UA 1DI2A 2EPCA 2EOQA 1R6LA 4F6NA 4JI1E 4FWHA 2ZBKB 1EH7A 2EOHA 1YYOA 1GZ6A 5JEAE 1ZM2A 2ENCA 2UUAI 4B3SE 1FJGE 2BM0A 4DXLA 3IWBA 5JEAC 3P76A 3J80Q 4DV0I 3J80C 3THOB 2ZITA 4JI4I 4LFBI 3EPHA 3K85A 2EPUA 4LF9E 4R2AA 4NHRA 1QNTA 4R2SA 2VQEI 2E1MA 1EH8A 4DV3I 1BKNA 3GCMA 1N32I 4FWDA 2ZM6I 2GHFA 2EFGA 4DR6E 2OI2A 2CSHA 2UUCE 4TUGA 1YZ9A 2LJPA 4YHHI 3MSWA 1EH6A 3QT8A 2RSIA 4FK5C 1YFHA 2CZ9A 1XMOI 1HNWE 4P7AA 3UK3C 4IS1C 2DLQA 4NXMI 4IFDF 2DSYA 1A1KA 2D9HA 4BMJA 4R2CA 2XEXA 1F2IG 1FNMA 2PO2B 2F8BA 4OX9E 1EI1A 5IXMB 1ZR9A 2G7HA 2WBSA 3HQ1A 2WCC3 1JK2A 3VYXA 1IMUA 2JEBA 4FW6A 4IS9A 1NEIA 2NA2A 4LPFA 1T4LB 4JYAI 2EMHA 4I8OA 1X49A 1A6FA 2EMKA 1PKPA 4DUZI 5C0XD 4DV7E 4B3TE 2EWLA 1OJ4A 2EMYA 3LLHA 4DV6I 4MYUA 1O0WA 2EMCA 2C37B 4OZEA 2M1SA 2PNZA 2L2KB 3EPKA 4F9BB 4GEQB 3L7ZB 5C0XE 2BR2A 2DIXA 4BA1B 4LF7I 3HPSA 1NZ0A 4JI7E 4JI8I 3V2UC 4X8WA 4WSPA 4R2PA 2UU9E 3K17A 2JT2A 4JI1I 4IZKB 2B7TA 4J8ZA 1BBGA 2EMXA 2YU8A 1HR0E 2VF3A 4K0KE 1X6HA 1KYQA 4MYTA 5F3WA 2EL5A 2IOPA 1FJGI 4R2RA 2M4IA 2MDGA 3ZKBA 4F9AB 4LFCE 2V88A 2ODRD 5IV8B 4P52A 4LF9I 5DNLA 3PYEA 3IWDA 2C39B 1FWLA 4HACB 2EJ4A 4B3ME 1N3GA 1K47A 2MC5A 5FLXQ 5FLXC 2ADRA 2VRDA 2IHR1 2PRTA 5AC4A 1Y4SA 2UUCI 4LF8I 2UXBI 2WZOA 4IJDA 2O1VA 2LV2A 1ZM3A 2NN6F 4PRXA 4FW4A 2EN3A 2CT1A 1IBLE 3M85D 1PDAA 2EMAA 5KL6A 2AJ4A 2EPKX 2GS8A 4ZYHA 1XMQI 3WU4A 3F6HA 4F54A 4JV5I 4OO1D 1IQSA 2V8QB 2V8PA 4R2QA 5KL7A 2F1DA 2PNMA 2NUGA 2WP8A 5FWKA 2LTRA 1Z0BA 2EMIA 2UUAE 3C4BA 2V83A 4DV0E 4LFBE 3ECRA 2DEJA 1FI4A 1A1FA 5C0XF 1WXRA 3J7AG 2FTXB 1Z5BA 4GQUA 3J7AM 3BBGA 2VQEE 1UDNA 4DV3E 1H72C 1H7UA 1N32E 2IOQA 2R1FA 2ZM6E 5C0XB 2JPAA 4X62I 3ZZUA 2UXCI 5EKWA 2YTNA 4YHHE 3M99B 2NUEA 1XNRI 4LOMA 4KHPI 2YRHA 2X36A 4LCHA 4IFDB 4DV1I 5K36A 2EM9A 5AE3A 1XNQI 4NXME 3M85G 2LVHA 3MHSC 1N36I 4JI6I 4U3BA 3OMLA 4BA2A 3Q6NA 5A6JA 2EM6A 3BIDA 5KL5A 1Z1BA 1A1HA 4JYAE 5A6AA 3KWRA 2YU5A 1RR9A 5LL6R 1Y5YA 3IWCA 2E1RA 2V89A 4M1KA 3PYFA 2DMIA 4DUZE 1BBOA 1Z5CA 3M7ND 1A1JA 1YUIA 2JWOA 3GMEA 4O43A 4DV6E 2L2MA 4WXCA 3PS3A 2HGHA 4AQYI 3CDJA 2NPFA 2GQ0A 4X9JA 5DNXA 4PRVA 2KHXA 5JEAD 4LF7E 1Z0GA 4WUBA 2V2ZA 2I9IA 1Z59A 4IZJA 4JI8E 2L3JA 1E3HA 2WBTA 4LCGA 3P1XA 3ZKDA 4YY3I 1Z0TA 1WHNA 1DQ3A 1STUA 1FKAE 1PVGA 2EORA 2PO1A 4OO1F 2V87A 5A69A 3B8HA 4BC7A 3JAMQ 3JAMC 5KL2A 3VHTB 1SR9A 3BF2A 3WU3A 3J81C 3J81Q 1X3CA 4OO1B 3M7NG 1FWKA 1IBKI 1ZAAC 1UBDC 4ZYDA 1TN9A 1MEYC 2NABA 1YUJA 4LTYA 5A2QQ 5A2QC 4MU3A 4LF8E 1X47A 2EPXA 3ADGA 3CDIA 2UXBE 2RS6A 4N3OA 2YTQA 2H36X 2LE2A 3ZOQB 3WU5A 2Z5EA 4DR2E 4LF6I 1R6MA 3TQMA 4P7DA 1N0VC 1XMQE 4R2EA 1YPNA 4MQYA 4JV5E 4Z7CA 2EOIA 2CVEA 1IQOA 1G2DC 2JEAA 2M9AA 4M2ZA 4PU9A 2YTOA 3DF6A 2C38B 5ADZA 1EA6A 2EOMA 4WUDA 3H4LA 4R8OA 2MDRA 1USVA 2BA0D 2CG9A 2LJHA 2A2DA 5K36D 5GMDA 3H09A 1IBMI 1X6FA 2MKNA 1ZM9A 1H7SA 2EN2A 4FW5A 4O4KA 2EOSA 1MX0A 3AUZA 4LF5I 4BC9A 2VQFE 1G2FC 4DR1I 4KZSA 2IESA 4TUIA 2V2VA 4X62E 2EZ6A 1WUUA 2UXCE 4M0VA 2ELZA 2J7KA 1USUA 1XNRE 2EM7A 2FV4B 5AE1A 4KHPE 2NN6C 2R76A 2PO2A 4FN5A 5JEAF 4Z7YA 1TF3A 4IFDA 4DV1E 5K36C 1XNQE 2R3VA 3LPSA 2LTSA 4BHCA 2HFSA 5JEAB 1MGTA 1N36E 3KZYA 1AAYA 4JI6E 2DB2A 1VISA 4AIDA 2EM2A 1RREA 2RSMA 3GLLA 3P3CA 3ADJA 2EOFA 1RQ0A 2LJUA 2C37A 2JY9A 2O1UA 4IZJD 2EPLX 2N3HA 1A1LA 2BA0G 5K36E 2LRSA 1OYPA 4WUCA 3L7ZA 4RHBB 1Z0WA 2LUPB 2BV3A 4BA1A 4LU9A 2JXPA 4DV4E 4AQYE 3QG5C 1T4NA 4JI3I 2A2CA 1D6TA 2N8XA 1VI7A 2ENAA 4N4RB 4IZKA 4DR2I 4MDTA 2RQLA 5BR8I 2EMFA 2EN4A 4MLQA 5AE2A 3T1YI 1WJPA 3Q1QA 3RMPA 2LMZA 4M30A 5LLQA 5DRQA 4X64I 4YY3E 4DR5I 2EP3A 2EOEA 2JOXA 3DJWA 2MC6A 4B3RE 3LMLA 2B7VA 3C6KA 1Z0VA 2JE6A 2C39A 1I94I 4F6MA 2EOJA 2JVAA 1NHHA 5IT9C 3QT5A 4HACA 2VF1A 1KVKA 2PO0B 5IT9Q 2LCEA 4JI2E 3PS2A 1DGCA 2N3GA 2EMZA 1IBKE 1Y4UA 1MG7A 3V5RA 2VQFI 4GZNC 2YTPA 2CTDA 2YSPA 1B69A 2V2QA 2Z5CA 1NHIA 2EPAA 2RS7A 2V34A 4BHBA 4R2DA 1E3PA 3PYGA 2K7IA 2NN6A 3T1HI 4HYMA 2K4VA 3VYYA 5IWAI 2RTXA 4WX9A 2EOOA 1UDQA 1S4EA 4LF6E 4DPUA 2YTEA 4DR4I 2Q2EB 1HNZI 1HNWI 1X5WA 4L8NA 2O1TA 3LTOA 2EPRA 3KZZA 4WSGA 5L3JA 4JI0E 2Z5BB 3THNA 2EM4A 2EN6A 4DU7A 2EM8A 3FIGA 4USMA 3UHMA 1OYSA 2JR1A 4KWYA 1UHZA 5DNYA 1GTKA 2EN1A 1OYRA 5C0XA 4HXZA 4F2JC 1IBME 4XTJA 4DV4I 4MU4A 1PIEA 2EPNA 4LF5E 4MLVA 1ZU1A 4GKJI 2EPZA 4M9VC 2EOXA 2V85A 4DV2I 2FGGA 2YTFA 4DR1E 1X6EA 2WNRB 3HKMA 2UXDI 2HJJA 5A6BA 4IFDE 3HXLA 1J5EI 1T4OA 2CGEA 1KTVA 3J7Yp 4IFDC 4DPWA 1RMDA 4HEIA 4I3HA 1LLMC 4DR7I 4B3RI 2EMGA 4DV5I 1A1IA 5KL3A 2LBSB 4LF4E 1AH5A 1HNXI 2LT7A 3HTXA 3D4JA 1B62A 4ED4A 4JI2I 3P3GA 5DRPA 3DD6A 3B82A 2O1WA 1T39A 1XXEA 5TSEA 1UEKA 1SFEA 4R03A 2KOUA 1KKHA 2HC5A 2YTGA 2X7IA 2V86A 4F9CB 1EKZA 4DKKA 4DR3E 4JI3E 1S16A 4HY1A 5CFFE 2E72A 4JI5I 1ELOA 5BR8E 2JEBB 4X66I 4BA2B 3T1YE 2YPNA 4NXNI 3CWVA 4WFTA 1N33E 1ZM4A 3ZZTA 4GKKI 1N0UA 2JEAB 2JYAA 4X64E 2GPIA 4DR5E 3PS1A 4JI0I 4DU8A 1H73A 2BB8A 2HK3A 2L6MA 2L3CA 4OO1A 1UN6B 1I94E 1L4SA 1H74A 2YT4A 1Z0CA 2NN6D 2PNZB 2MKDA 3AV0A 1QZRA 2WBUA 4QNKA 1NCSA 1UDSA 2EM3A 5EL9A 2EPPA 3ZM7A 2BR2B 5ELWA 4BCAA 1YYKA 2BM1A 4OKGA 5LMNI 2A25A 2YZTA 3L00A 3GONA 1PJTA 1P42A 4L5NC 2HKEA 3H1CA 3C4TA 2EPMX 2NN6E 4DUYI 4LFAI 2L33A 3U1YA 4X65I 3KRNA 3T1HE 3EPLA 5IWAE 1ZBQA 2CPNA 2J7JA 1N34I 1WHQA 2EQ3A 1GQEA 2LO3A 5A6KA 3MHHC 4DR4E 2F4VI 4UT4A 1HNZE 4LF4I 2EN7A 3BGHA 3OTOE 2C38A 2HHHE 2E5LI 1J26A 2VESA 3HPZA 2DGCA 4LCFA 2YRKA 2EM5A 4DMIA 2AE8A 3ADIA 1KJKA 3K6QA 5A6BD 3QT6A 2GO3A 2YSOA 4WPYA 4U3DA 2GLIA 2NUFA 2UUBI 5C0XC 5LMUI 2O3ZA 2EL6A 4FWGA 4ZYEA 5DROA 4GKJE 4DR3I 4MU1A 2DMYA 2EOZA 1A1GA 4DV2E 2EMBA 1MU5A 4USKA 4KQVA 2UXDE 4B3SI 3WU6A 3P3EA 1DARA 1N33I 1J5EE 5JEAA 1JK1A 2WP8B 4O5GA 4O24A 2PNLA 4URLA 1PJQA 2GO4A 2YTJA 4HTGA 1X48A 1P47A 4DR7E 1ZXMA 2JE6B 5GMEA 4DV5E 1RC7A 4DR6I 1HNXE 3K1JA 3VK6A 3LNUA 3M6AA 3JU0A 4NZVA 2Z5CB 4DPXA 4R1FA 2ODRC 2JP9A 1KIJA 4EMDA 3NZKA 3B78A 5T6JA 2LUQA 5K36F 3JTZA 1TF6A 2NN6B 2EQ0A 1NHJA 4OX9I 2EM0A 4Q35B 3PYDA 5K36B 3U1KA 1Y6ZA 4NBQA 4OOGC 3PRYA 4MU0A 2JOBA 4JI5E 2HK2A 4J3DA 5AC5A 4X66E 4DV7I 4B3TI 4NXNE 3OTOI 4GKKE 2HHHI 4JI4E 4JG4A 3QT7A 2DRPA 1HK7A 2EOYA 3HJCA 4AIMA 4QNJA 1RHYA 4OO1E 2PO0A 3ZZ0A 3HULA 3EQ1A 4FW7A 3EPJA 4OO1C
chains in the Genus database with same CATH topology
2DEIA 3F0NA 4DPYA 3F6GA 1U2RA 4BS9A 3Q6MA 4JI7I 2M7QA 2UU9I 1XMOE 5LMNE 1ZXNA 1HR0I 4IZJB 5AASA 4K0KI 4DUYE 2B9DA 4UTGA 4LFAE 1YYWA 1UILA 4X65E 4LFCI 2R42A 4RPFA 4ZVIA 4BBYA 1N34E 2F4VE 2Z5BA 4B3MI 4Q28A 2VE7C 2L92A 2B3TB 2E5LE 2L8TA 3ADLA 4WYQB 1ZBTA 2HKJA 2WW4A 1IBLI 1B63A 1Z0EA 1QU6A 1Z5AA 2UUBE 5LMUE 2KONA 4P78A 3P06A 1XHKA 2HFUA 4DPTA 2L2NA 1DI2A 4FWHA 4JI1E 2ZBKB 1YYOA 1GZ6A 1ZM2A 2UUAI 4B3SE 1FJGE 2BM0A 4DXLA 3IWBA 3J80Q 4DV0I 4JI4I 3J80C 4LFBI 2ZITA 3K85A 4LF9E 2VQEI 2E1MA 4DV3I 1BKNA 1N32I 4FWDA 2ZM6I 2EFGA 4DR6E 2OI2A 2UUCE 4TUGA 1YZ9A 2LJPA 4YHHI 3MSWA 3QT8A 2CZ9A 1XMOI 1HNWE 4P7AA 4NXMI 2DSYA 4BMJA 2XEXA 1FNMA 2F8BA 4OX9E 1EI1A 2G7HA 3VYXA 3HQ1A 4JYAI 2NA2A 1T4LB 4I8OA 1X49A 1A6FA 1PKPA 4DUZI 4DV7E 4B3TE 2EWLA 1OJ4A 3LLHA 4DV6I 4MYUA 1O0WA 2M1SA 2L2KB 4F9BB 4GEQB 2DIXA 4LF7I 3HPSA 1NZ0A 4JI7E 4JI8I 3V2UC 4X8WA 4WSPA 2UU9E 3K17A 4JI1I 4IZKB 2B7TA 4J8ZA 1HR0E 2VF3A 4K0KE 4MYTA 5F3WA 2IOPA 1FJGI 2M4IA 3ZKBA 4F9AB 4LFCE 2V88A 2ODRD 4P52A 4LF9I 3PYEA 3IWDA 1FWLA 4HACB 4B3ME 1K47A 2MC5A 5FLXQ 5FLXC 4LF8I 2IHR1 1Y4SA 2UUCI 2UXBI 2WZOA 2O1VA 4PRXA 1ZM3A 1IBLE 2AJ4A 2GS8A 1XMQI 3WU4A 3F6HA 4F54A 4JV5I 2V8PA 2V8QB 2PNMA 2NUGA 5FWKA 2LTRA 1Z0BA 2UUAE 3C4BA 2V83A 4DV0E 4LFBE 2DEJA 1FI4A 1WXRA 3J7AG 2FTXB 1Z5BA 3J7AM 2VQEE 4DV3E 1H72C 1H7UA 1N32E 2IOQA 2ZM6E 4X62I 3ZZUA 2UXCI 4YHHE 2NUEA 1XNRI 4KHPI 2X36A 4DV1I 5AE3A 1XNQI 4NXME 1N36I 4JI6I 3OMLA 3Q6NA 1RR9A 4JYAE 4FN5A 2E1RA 3KWRA 4M1KA 5LL6R 3IWCA 2V89A 3PYFA 4DUZE 1Z5CA 2JWOA 4DV6E 2L2MA 4AQYI 2NPFA 2GQ0A 4PRVA 2KHXA 4LF7E 1Z0GA 4WUBA 2V2ZA 1Z59A 4IZJA 4JI8E 2L3JA 3P1XA 3ZKDA 4YY3I 1Z0TA 1WHNA 1DQ3A 1STUA 1FKAE 1PVGA 2V87A 3B8HA 4BC7A 3JAMQ 3JAMC 1SR9A 3WU3A 3J81Q 3J81C 1FWKA 1IBKI 4LTYA 5A2QQ 5A2QC 4LF8E 1X47A 3ADGA 2UXBE 2RS6A 4N3OA 2H36X 2LE2A 3ZOQB 3WU5A 2Z5EA 4DR2E 4LF6I 1N0VC 4P7DA 1XMQE 4JV5E 4Z7CA 4M2ZA 4PU9A 3DF6A 5ADZA 1EA6A 4WUDA 3H4LA 4R8OA 2MDRA 1USVA 2CG9A 2LJHA 2A2DA 5GMDA 3H09A 1IBMI 1ZM9A 1H7SA 4LF5I 1MX0A 3AUZA 4BC9A 2VQFE 4DR1I 4KZSA 2V2VA 4TUIA 4X62E 2EZ6A 1WUUA 2UXCE 4M0VA 2J7KA 1USUA 1XNRE 2FV4B 5AE1A 4KHPE 4Z7YA 4DV1E 1XNQE 2R3VA 3LPSA 2LTSA 2HFSA 1N36E 4JI6E 2DB2A 1VISA 1RREA 2RSMA 3ADJA 1RQ0A 2JY9A 2O1UA 4IZJD 2N3HA 2LRSA 4WUCA 1Z0WA 2LUPB 2BV3A 4LU9A 4DV4E 4AQYE 1T4NA 4JI3I 2A2CA 1D6TA 4IZKA 4DR2I 5BR8I 3T1YI 5AE2A 3Q1QA 3RMPA 2LMZA 4M30A 4X64I 4YY3E 4DR5I 2JOXA 3DJWA 2MC6A 4B3RE 3LMLA 2B7VA 1Z0VA 1I94I 1NHHA 2JVAA 3QT5A 5IT9C 4HACA 5IT9Q 2VF1A 1KVKA 4JI2E 2N3GA 1IBKE 1Y4UA 1MG7A 3V5RA 2VQFI 2V2QA 2Z5CA 1NHIA 2RS7A 2V34A 3PYGA 3T1HI 4HYMA 2K4VA 3VYYA 5IWAI 2RTXA 1S4EA 4LF6E 4DPUA 4DR4I 2Q2EB 1HNZI 4L8NA 2O1TA 3LTOA 5L3JA 4JI0E 2Z5BB 4DU7A 4USMA 3FIGA 2JR1A 1UHZA 5DNYA 4HXZA 4XTJA 1IBME 4DV4I 1PIEA 4LF5E 4GKJI 4DV2I 2V85A 2FGGA 4DR1E 2UXDI 3HXLA 1J5EI 1T4OA 2CGEA 1KTVA 3J7Yp 4DPWA 4I3HA 4DR7I 4B3RI 4DV5I 2LBSB 4LF4E 1HNXI 3HTXA 3D4JA 1B62A 4ED4A 4JI2I 3B82A 2O1WA 1UEKA 4R03A 2KOUA 1KKHA 2X7IA 2V86A 4F9CB 1EKZA 4DKKA 4DR3E 4JI3E 1S16A 4HY1A 5CFFE 4JI5I 1ELOA 5BR8E 4X66I 3T1YE 4NXNI 3CWVA 4WFTA 1N33E 1ZM4A 3ZZTA 4GKKI 1N0UA 4X64E 4DR5E 4JI0I 4DU8A 1H73A 2HK3A 2L6MA 2L3CA 1I94E 1Z0CA 1H74A 2YT4A 3AV0A 1QZRA 3ZM7A 4BCAA 1YYKA 2BM1A 5LMNI 3GONA 2YZTA 4DUYI 4L5NC 2HKEA 4LFAI 3C4TA 2L33A 4X65I 3T1HE 5IWAE 1ZBQA 2CPNA 1N34I 1WHQA 1GQEA 4DR4E 2F4VI 4UT4A 1HNZE 4LF4I 3OTOE 2HHHE 2E5LI 1J26A 3HPZA 4DMIA 3ADIA 3K6QA 3QT6A 4WPYA 2NUFA 2UUBI 5LMUI 4FWGA 4GKJE 4DR3I 2DMYA 4DV2E 1MU5A 4USKA 4KQVA 2UXDE 4B3SI 3WU6A 1N33I 1DARA 1J5EE 2PNLA 4URLA 4DR7E 1X48A 1ZXMA 5GMEA 4DV5E 1RC7A 4DR6I 1HNXE 3K1JA 3VK6A 3LNUA 3M6AA 3JU0A 2Z5CB 4DPXA 4R1FA 2ODRC 1KIJA 4EMDA 1HNWI 3B78A 5T6JA 2LUQA 3JTZA 4OX9I 1NHJA 3PYDA 1Y6ZA 4OOGC 3PRYA 2JOBA 4JI5E 2HK2A 4X66E 4DV7I 4B3TI 4NXNE 3OTOI 4GKKE 2HHHI 4JI4E 4JG4A 3QT7A 1HK7A 3HJCA 3ZZ0A 3HULA 4FW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DEI A;  3F0N A;  4DPY A;  1U2R A;  4JI7 I;  2UU9 I;  1XMO E;  5LMN E;  1ZXN A;  1HR0 I;  4K0K I;  4DUY E;  4UTG A;  4LFA E;  1YYW A;  1UIL A;  4X65 E;  4LFC I;  2R42 A;  4RPF A;  4ZVI A;  1N34 E;  2F4V E;  4B3M I;  2B3T B;  2E5L E;  3ADL A;  4WYQ B;  1ZBT A;  2HKJ A;  2WW4 A;  1IBL I;  1B63 A;  1Z0E A;  1QU6 A;  1Z5A A;  2UUB E;  5LMU E;  1XHK A;  2HFU A;  4DPT A;  2L2N A;  1DI2 A;  4FWH A;  4JI1 E;  2ZBK B;  1YYO A;  1ZM2 A;  2UUA I;  4B3S E;  1FJG E;  2BM0 A;  4DXL A;  3J80 Q;  4DV0 I;  4JI4 I;  3J80 C;  4LFB I;  2ZIT A;  4LF9 E;  2VQE I;  4DV3 I;  1BKN A;  1N32 I;  4FWD A;  2ZM6 I;  2EFG A;  4DR6 E;  2OI2 A;  2UUC E;  1YZ9 A;  2LJP A;  4YHH I;  3QT8 A;  2CZ9 A;  1XMO I;  1HNW E;  4P7A A;  4NXM I;  2XEX A;  1FNM A;  4OX9 E;  1EI1 A;  3VYX A;  4JYA I;  2NA2 A;  1T4L B;  1X49 A;  1A6F A;  1PKP A;  4DUZ I;  4DV7 E;  4B3T E;  1OJ4 A;  3LLH A;  4DV6 I;  4MYU A;  1O0W A;  2L2K B;  2DIX A;  4LF7 I;  1NZ0 A;  4JI7 E;  4JI8 I;  3V2U C;  4X8W A;  2UU9 E;  3K17 A;  4JI1 I;  2B7T A;  1HR0 E;  2VF3 A;  4K0K E;  4MYT A;  1FJG I;  3ZKB A;  4LFC E;  4P52 A;  4LF9 I;  3PYE A;  1FWL A;  4HAC B;  4B3M E;  1K47 A;  5FLX Q;  5FLX C;  4LF8 I;  2IHR 1;  2UUC I;  2UXB I;  4PRX A;  1ZM3 A;  1IBL E;  2AJ4 A;  2GS8 A;  1XMQ I;  3WU4 A;  4JV5 I;  2V8P A;  2NUG A;  2LTR A;  1Z0B A;  2UUA E;  3C4B A;  4DV0 E;  4LFB E;  2DEJ A;  1FI4 A;  3J7A G;  1Z5B A;  3J7A M;  2VQE E;  4DV3 E;  1H72 C;  1H7U A;  1N32 E;  2ZM6 E;  4X62 I;  3ZZU A;  2UXC I;  4YHH E;  2NUE A;  1XNR I;  4KHP I;  2X36 A;  4DV1 I;  1XNQ I;  4NXM E;  1N36 I;  4JI6 I;  1RR9 A;  4JYA E;  4FN5 A;  2E1R A;  4M1K A;  5LL6 R;  3PYF A;  4DUZ E;  1Z5C A;  4DV6 E;  2L2M A;  4AQY I;  2NPF A;  4PRV A;  2KHX A;  4LF7 E;  1Z0G A;  4WUB A;  2V2Z A;  1Z59 A;  4JI8 E;  2L3J A;  3P1X A;  3ZKD A;  4YY3 I;  1Z0T A;  1WHN A;  1STU A;  1FKA E;  1PVG A;  3B8H A;  3JAM Q;  3JAM C;  3J81 Q;  3WU3 A;  3J81 C;  1FWK A;  1IBK I;  5A2Q Q;  5A2Q C;  4LF8 E;  1X47 A;  3ADG A;  2UXB E;  2RS6 A;  3WU5 A;  4LF6 I;  4DR2 E;  1N0V C;  1XMQ E;  4JV5 E;  4Z7C A;  4M2Z A;  4PU9 A;  1EA6 A;  4WUD A;  3H4L A;  2MDR A;  2LJH A;  2A2D A;  5GMD A;  1IBM I;  1ZM9 A;  1H7S A;  4LF5 I;  1MX0 A;  2VQF E;  4DR1 I;  2V2V A;  4X62 E;  2EZ6 A;  1WUU A;  2UXC E;  2J7K A;  1XNR E;  4KHP E;  4Z7Y A;  4DV1 E;  1XNQ E;  2R3V A;  3LPS A;  2LTS A;  2HFS A;  1N36 E;  4JI6 E;  2DB2 A;  1VIS A;  1RRE A;  2RSM A;  3ADJ A;  1RQ0 A;  2JY9 A;  2N3H A;  2LRS A;  4WUC A;  1Z0W A;  2LUP B;  2BV3 A;  4DV4 E;  4AQY E;  1T4N A;  4JI3 I;  2A2C A;  1D6T A;  4DR2 I;  5BR8 I;  3T1Y I;  3Q1Q A;  4M30 A;  4X64 I;  4YY3 E;  4DR5 I;  4B3R E;  2B7V A;  1Z0V A;  1I94 I;  1NHH A;  2JVA A;  3QT5 A;  4HAC A;  5IT9 C;  5IT9 Q;  1KVK A;  4JI2 E;  2N3G A;  1IBK E;  1MG7 A;  3V5R A;  2VQF I;  2V2Q A;  1NHI A;  2RS7 A;  2V34 A;  3PYG A;  3T1H I;  4HYM A;  5IWA I;  3VYY A;  2RTX A;  1S4E A;  4LF6 E;  4DPU A;  4DR4 I;  2Q2E B;  1HNZ I;  3LTO A;  5L3J A;  4JI0 E;  4DU7 A;  4USM A;  1UHZ A;  4HXZ A;  4XTJ A;  1IBM E;  4DV4 I;  1PIE A;  4LF5 E;  4GKJ I;  4DV2 I;  4DR1 E;  2UXD I;  1J5E I;  1T4O A;  1KTV A;  3J7Y p;  4DPW A;  4I3H A;  4DR7 I;  4B3R I;  4DV5 I;  2LBS B;  4LF4 E;  1HNX I;  3HTX A;  3D4J A;  1B62 A;  4ED4 A;  4JI2 I;  3B82 A;  1UEK A;  1KKH A;  2X7I A;  1EKZ A;  4DKK A;  4DR3 E;  4JI3 E;  1S16 A;  4HY1 A;  5CFF E;  4JI5 I;  1ELO A;  5BR8 E;  4X66 I;  3T1Y E;  4NXN I;  3CWV A;  4WFT A;  1N33 E;  1ZM4 A;  3ZZT A;  4GKK I;  1N0U A;  4X64 E;  4DR5 E;  4JI0 I;  4DU8 A;  1H73 A;  2HK3 A;  2L3C A;  1I94 E;  1Z0C A;  1H74 A;  2YT4 A;  1QZR A;  3ZM7 A;  1YYK A;  2BM1 A;  5LMN I;  3GON A;  4DUY I;  2HKE A;  4LFA I;  3C4T A;  2L33 A;  4X65 I;  3T1H E;  5IWA E;  2CPN A;  1N34 I;  1WHQ A;  1GQE A;  4DR4 E;  2F4V I;  4UT4 A;  1HNZ E;  4LF4 I;  3OTO E;  2HHH E;  2E5L I;  1J26 A;  3ADI A;  3QT6 A;  2NUF A;  2UUB I;  5LMU I;  4FWG A;  4GKJ E;  4DR3 I;  2DMY A;  4DV2 E;  1MU5 A;  4USK A;  4KQV A;  2UXD E;  4B3S I;  3WU6 A;  1N33 I;  1DAR A;  1J5E E;  4URL A;  4DR7 E;  1X48 A;  1ZXM A;  5GME A;  4DV5 E;  1RC7 A;  4DR6 I;  1HNX E;  3K1J A;  3LNU A;  3M6A A;  4DPX A;  1HNW I;  4R1F A;  1KIJ A;  4EMD A;  3B78 A;  2LUQ A;  4OX9 I;  1NHJ A;  3PYD A;  4OOG C;  4JI5 E;  2HK2 A;  4X66 E;  4DV7 I;  4B3T I;  4NXN E;  3OTO I;  4GKK E;  2HHH I;  4JI4 E;  4JG4 A;  3QT7 A;  3ZZ0 A;  3HUL A;  4FW9 A; 
#chains in the Genus database with same CATH topology
 2DEI A;  1YSA C;  3F0N A;  4DPY A;  3F6G A;  1U2R A;  4BS9 A;  2BA1 D;  4IFD D;  5DRR A;  4ISA A;  3Q6M A;  4JI7 I;  2EQ1 A;  2YTI A;  2J65 A;  2M7Q A;  2UU9 I;  3B4T A;  4RH8 A;  2EL4 A;  1XMO E;  2EE8 A;  5LMN E;  1ZXN A;  1HR0 I;  4K0K I;  4FW3 A;  5AAS A;  2DLK A;  2EML A;  4DUY E;  2B9D A;  4IZJ B;  4LFA E;  4WXD A;  4ZYG A;  1YYW A;  1BB8 A;  1YH8 A;  4UTG A;  1UIL A;  4X65 E;  4LFC I;  2R42 A;  2RPC A;  1UDO A;  2YRM A;  1Y60 A;  2EPO A;  4BBY A;  2IER A;  4RPF A;  4ZVI A;  2PO1 B;  1N34 E;  2F4V E;  1WRJ A;  2Z5B A;  4B3M I;  4Q28 A;  2VE7 C;  2L92 A;  2B3T B;  2E5L E;  1YHC A;  2L8T A;  3ADL A;  2EN8 A;  2YWQ A;  2I13 A;  2EMW A;  3C6M A;  4WYQ B;  4AM3 A;  1ZBT A;  2ELY A;  5KL4 A;  1PJS A;  2BBG A;  2HKJ A;  2YTD A;  2WW4 A;  1IBL I;  1T38 A;  1B63 A;  1QU6 A;  1Z0E A;  2UUB E;  1Z5A A;  2BA1 G;  4FW9 A;  5LMU E;  2KON A;  4P78 A;  3P06 A;  1XHK A;  2WNR A;  2HFU A;  4DPT A;  2ENH A;  2L2N A;  2Q8U A;  1DI2 A;  2EPC A;  2EOQ A;  1R6L A;  4F6N A;  4JI1 E;  4FWH A;  2ZBK B;  1EH7 A;  2EOH A;  1YYO A;  1GZ6 A;  5JEA E;  1ZM2 A;  2ENC A;  2UUA I;  4B3S E;  1FJG E;  2BM0 A;  4DXL A;  3IWB A;  5JEA C;  3P76 A;  3J80 Q;  4DV0 I;  3J80 C;  3THO B;  2ZIT A;  4JI4 I;  4LFB I;  3EPH A;  3K85 A;  2EPU A;  4LF9 E;  4R2A A;  4NHR A;  1QNT A;  4R2S A;  2VQE I;  2E1M A;  1EH8 A;  4DV3 I;  1BKN A;  3GCM A;  1N32 I;  4FWD A;  2ZM6 I;  2GHF A;  2EFG A;  4DR6 E;  2OI2 A;  2CSH A;  2UUC E;  4TUG A;  1YZ9 A;  2LJP A;  4YHH I;  3MSW A;  1EH6 A;  3QT8 A;  2RSI A;  4FK5 C;  1YFH A;  2CZ9 A;  1XMO I;  1HNW E;  4P7A A;  3UK3 C;  4IS1 C;  2DLQ A;  4NXM I;  4IFD F;  2DSY A;  1A1K A;  2D9H A;  4BMJ A;  4R2C A;  2XEX A;  1F2I G;  1FNM A;  2PO2 B;  2F8B A;  4OX9 E;  1EI1 A;  5IXM B;  1ZR9 A;  2G7H A;  2WBS A;  3HQ1 A;  2WCC 3;  1JK2 A;  3VYX A;  1IMU A;  2JEB A;  4FW6 A;  4IS9 A;  1NEI A;  2NA2 A;  4LPF A;  1T4L B;  4JYA I;  2EMH A;  4I8O A;  1X49 A;  1A6F A;  2EMK A;  1PKP A;  4DUZ I;  5C0X D;  4DV7 E;  4B3T E;  2EWL A;  1OJ4 A;  2EMY A;  3LLH A;  4DV6 I;  4MYU A;  1O0W A;  2EMC A;  2C37 B;  4OZE A;  2M1S A;  2PNZ A;  2L2K B;  3EPK A;  4F9B B;  4GEQ B;  3L7Z B;  5C0X E;  2BR2 A;  2DIX A;  4BA1 B;  4LF7 I;  3HPS A;  1NZ0 A;  4JI7 E;  4JI8 I;  3V2U C;  4X8W A;  4WSP A;  4R2P A;  2UU9 E;  3K17 A;  2JT2 A;  4JI1 I;  4IZK B;  2B7T A;  4J8Z A;  1BBG A;  2EMX A;  2YU8 A;  1HR0 E;  2VF3 A;  4K0K E;  1X6H A;  1KYQ A;  4MYT A;  5F3W A;  2EL5 A;  2IOP A;  1FJG I;  4R2R A;  2M4I A;  2MDG A;  3ZKB A;  4F9A B;  4LFC E;  2V88 A;  2ODR D;  5IV8 B;  4P52 A;  4LF9 I;  5DNL A;  3PYE A;  3IWD A;  2C39 B;  1FWL A;  4HAC B;  2EJ4 A;  4B3M E;  1N3G A;  1K47 A;  2MC5 A;  5FLX Q;  5FLX C;  2ADR A;  2VRD A;  2IHR 1;  2PRT A;  5AC4 A;  1Y4S A;  2UUC I;  4LF8 I;  2UXB I;  2WZO A;  4IJD A;  2O1V A;  2LV2 A;  1ZM3 A;  2NN6 F;  4PRX A;  4FW4 A;  2EN3 A;  2CT1 A;  1IBL E;  3M85 D;  1PDA A;  2EMA A;  5KL6 A;  2AJ4 A;  2EPK X;  2GS8 A;  4ZYH A;  1XMQ I;  3WU4 A;  3F6H A;  4F54 A;  4JV5 I;  4OO1 D;  1IQS A;  2V8Q B;  2V8P A;  4R2Q A;  5KL7 A;  2F1D A;  2PNM A;  2NUG A;  2WP8 A;  5FWK A;  2LTR A;  1Z0B A;  2EMI A;  2UUA E;  3C4B A;  2V83 A;  4DV0 E;  4LFB E;  3ECR A;  2DEJ A;  1FI4 A;  1A1F A;  5C0X F;  1WXR A;  3J7A G;  2FTX B;  1Z5B A;  4GQU A;  3J7A M;  3BBG A;  2VQE E;  1UDN A;  4DV3 E;  1H72 C;  1H7U A;  1N32 E;  2IOQ A;  2R1F A;  2ZM6 E;  5C0X B;  2JPA A;  4X62 I;  3ZZU A;  2UXC I;  5EKW A;  2YTN A;  4YHH E;  3M99 B;  2NUE A;  1XNR I;  4LOM A;  4KHP I;  2YRH A;  2X36 A;  4LCH A;  4IFD B;  4DV1 I;  5K36 A;  2EM9 A;  5AE3 A;  1XNQ I;  4NXM E;  3M85 G;  2LVH A;  3MHS C;  1N36 I;  4JI6 I;  4U3B A;  3OML A;  4BA2 A;  3Q6N A;  5A6J A;  2EM6 A;  3BID A;  5KL5 A;  1Z1B A;  1A1H A;  4JYA E;  5A6A A;  3KWR A;  2YU5 A;  1RR9 A;  5LL6 R;  1Y5Y A;  3IWC A;  2E1R A;  2V89 A;  4M1K A;  3PYF A;  2DMI A;  4DUZ E;  1BBO A;  1Z5C A;  3M7N D;  1A1J A;  1YUI A;  2JWO A;  3GME A;  4O43 A;  4DV6 E;  2L2M A;  4WXC A;  3PS3 A;  2HGH A;  4AQY I;  3CDJ A;  2NPF A;  2GQ0 A;  4X9J A;  5DNX A;  4PRV A;  2KHX A;  5JEA D;  4LF7 E;  1Z0G A;  4WUB A;  2V2Z A;  2I9I A;  1Z59 A;  4IZJ A;  4JI8 E;  2L3J A;  1E3H A;  2WBT A;  4LCG A;  3P1X A;  3ZKD A;  4YY3 I;  1Z0T A;  1WHN A;  1DQ3 A;  1STU A;  1FKA E;  1PVG A;  2EOR A;  2PO1 A;  4OO1 F;  2V87 A;  5A69 A;  3B8H A;  4BC7 A;  3JAM Q;  3JAM C;  5KL2 A;  3VHT B;  1SR9 A;  3BF2 A;  3WU3 A;  3J81 C;  3J81 Q;  1X3C A;  4OO1 B;  3M7N G;  1FWK A;  1IBK I;  1ZAA C;  1UBD C;  4ZYD A;  1TN9 A;  1MEY C;  2NAB A;  1YUJ A;  4LTY A;  5A2Q Q;  5A2Q C;  4MU3 A;  4LF8 E;  1X47 A;  2EPX A;  3ADG A;  3CDI A;  2UXB E;  2RS6 A;  4N3O A;  2YTQ A;  2H36 X;  2LE2 A;  3ZOQ B;  3WU5 A;  2Z5E A;  4DR2 E;  4LF6 I;  1R6M A;  3TQM A;  4P7D A;  1N0V C;  1XMQ E;  4R2E A;  1YPN A;  4MQY A;  4JV5 E;  4Z7C A;  2EOI A;  2CVE A;  1IQO A;  1G2D C;  2JEA A;  2M9A A;  4M2Z A;  4PU9 A;  2YTO A;  3DF6 A;  2C38 B;  5ADZ A;  1EA6 A;  2EOM A;  4WUD A;  3H4L A;  4R8O A;  2MDR A;  1USV A;  2BA0 D;  2CG9 A;  2LJH A;  2A2D A;  5K36 D;  5GMD A;  3H09 A;  1IBM I;  1X6F A;  2MKN A;  1ZM9 A;  1H7S A;  2EN2 A;  4FW5 A;  4O4K A;  2EOS A;  1MX0 A;  3AUZ A;  4LF5 I;  4BC9 A;  2VQF E;  1G2F C;  4DR1 I;  4KZS A;  2IES A;  4TUI A;  2V2V A;  4X62 E;  2EZ6 A;  1WUU A;  2UXC E;  4M0V A;  2ELZ A;  2J7K A;  1USU A;  1XNR E;  2EM7 A;  2FV4 B;  5AE1 A;  4KHP E;  2NN6 C;  2R76 A;  2PO2 A;  4FN5 A;  5JEA F;  4Z7Y A;  1TF3 A;  4IFD A;  4DV1 E;  5K36 C;  1XNQ E;  2R3V A;  3LPS A;  2LTS A;  4BHC A;  2HFS A;  5JEA B;  1MGT A;  1N36 E;  3KZY A;  1AAY A;  4JI6 E;  2DB2 A;  1VIS A;  4AID A;  2EM2 A;  1RRE A;  2RSM A;  3GLL A;  3P3C A;  3ADJ A;  2EOF A;  1RQ0 A;  2LJU A;  2C37 A;  2JY9 A;  2O1U A;  4IZJ D;  2EPL X;  2N3H A;  1A1L A;  2BA0 G;  5K36 E;  2LRS A;  1OYP A;  4WUC A;  3L7Z A;  4RHB B;  1Z0W A;  2LUP B;  2BV3 A;  4BA1 A;  4LU9 A;  2JXP A;  4DV4 E;  4AQY E;  3QG5 C;  1T4N A;  4JI3 I;  2A2C A;  1D6T A;  2N8X A;  1VI7 A;  2ENA A;  4N4R B;  4IZK A;  4DR2 I;  4MDT A;  2RQL A;  5BR8 I;  2EMF A;  2EN4 A;  4MLQ A;  5AE2 A;  3T1Y I;  1WJP A;  3Q1Q A;  3RMP A;  2LMZ A;  4M30 A;  5LLQ A;  5DRQ A;  4X64 I;  4YY3 E;  4DR5 I;  2EP3 A;  2EOE A;  2JOX A;  3DJW A;  2MC6 A;  4B3R E;  3LML A;  2B7V A;  3C6K A;  1Z0V A;  2JE6 A;  2C39 A;  1I94 I;  4F6M A;  2EOJ A;  2JVA A;  1NHH A;  5IT9 C;  3QT5 A;  4HAC A;  2VF1 A;  1KVK A;  2PO0 B;  5IT9 Q;  2LCE A;  4JI2 E;  3PS2 A;  1DGC A;  2N3G A;  2EMZ A;  1IBK E;  1Y4U A;  1MG7 A;  3V5R A;  2VQF I;  4GZN C;  2YTP A;  2CTD A;  2YSP A;  1B69 A;  2V2Q A;  2Z5C A;  1NHI A;  2EPA A;  2RS7 A;  2V34 A;  4BHB A;  4R2D A;  1E3P A;  3PYG A;  2K7I A;  2NN6 A;  3T1H I;  4HYM A;  2K4V A;  3VYY A;  5IWA I;  2RTX A;  4WX9 A;  2EOO A;  1UDQ A;  1S4E A;  4LF6 E;  4DPU A;  2YTE A;  4DR4 I;  2Q2E B;  1HNZ I;  1HNW I;  1X5W A;  4L8N A;  2O1T A;  3LTO A;  2EPR A;  3KZZ A;  4WSG A;  5L3J A;  4JI0 E;  2Z5B B;  3THN A;  2EM4 A;  2EN6 A;  4DU7 A;  2EM8 A;  3FIG A;  4USM A;  3UHM A;  1OYS A;  2JR1 A;  4KWY A;  1UHZ A;  5DNY A;  1GTK A;  2EN1 A;  1OYR A;  5C0X A;  4HXZ A;  4F2J C;  1IBM E;  4XTJ A;  4DV4 I;  4MU4 A;  1PIE A;  2EPN A;  4LF5 E;  4MLV A;  1ZU1 A;  4GKJ I;  2EPZ A;  4M9V C;  2EOX A;  2V85 A;  4DV2 I;  2FGG A;  2YTF A;  4DR1 E;  1X6E A;  2WNR B;  3HKM A;  2UXD I;  2HJJ A;  5A6B A;  4IFD E;  3HXL A;  1J5E I;  1T4O A;  2CGE A;  1KTV A;  3J7Y p;  4IFD C;  4DPW A;  1RMD A;  4HEI A;  4I3H A;  1LLM C;  4DR7 I;  4B3R I;  2EMG A;  4DV5 I;  1A1I A;  5KL3 A;  2LBS B;  4LF4 E;  1AH5 A;  1HNX I;  2LT7 A;  3HTX A;  3D4J A;  1B62 A;  4ED4 A;  4JI2 I;  3P3G A;  5DRP A;  3DD6 A;  3B82 A;  2O1W A;  1T39 A;  1XXE A;  5TSE A;  1UEK A;  1SFE A;  4R03 A;  2KOU A;  1KKH A;  2HC5 A;  2YTG A;  2X7I A;  2V86 A;  4F9C B;  1EKZ A;  4DKK A;  4DR3 E;  4JI3 E;  1S16 A;  4HY1 A;  5CFF E;  2E72 A;  4JI5 I;  1ELO A;  5BR8 E;  2JEB B;  4X66 I;  4BA2 B;  3T1Y E;  2YPN A;  4NXN I;  3CWV A;  4WFT A;  1N33 E;  1ZM4 A;  3ZZT A;  4GKK I;  1N0U A;  2JEA B;  2JYA A;  4X64 E;  2GPI A;  4DR5 E;  3PS1 A;  4JI0 I;  4DU8 A;  1H73 A;  2BB8 A;  2HK3 A;  2L6M A;  2L3C A;  4OO1 A;  1UN6 B;  1I94 E;  1L4S A;  1H74 A;  2YT4 A;  1Z0C A;  2NN6 D;  2PNZ B;  2MKD A;  3AV0 A;  1QZR A;  2WBU A;  4QNK A;  1NCS A;  1UDS A;  2EM3 A;  5EL9 A;  2EPP A;  3ZM7 A;  2BR2 B;  5ELW A;  4BCA A;  1YYK A;  2BM1 A;  4OKG A;  5LMN I;  2A25 A;  2YZT A;  3L00 A;  3GON A;  1PJT A;  1P42 A;  4L5N C;  2HKE A;  3H1C A;  3C4T A;  2EPM X;  2NN6 E;  4DUY I;  4LFA I;  2L33 A;  3U1Y A;  4X65 I;  3KRN A;  3T1H E;  3EPL A;  5IWA E;  1ZBQ A;  2CPN A;  2J7J A;  1N34 I;  1WHQ A;  2EQ3 A;  1GQE A;  2LO3 A;  5A6K A;  3MHH C;  4DR4 E;  2F4V I;  4UT4 A;  1HNZ E;  4LF4 I;  2EN7 A;  3BGH A;  3OTO E;  2C38 A;  2HHH E;  2E5L I;  1J26 A;  2VES A;  3HPZ A;  2DGC A;  4LCF A;  2YRK A;  2EM5 A;  4DMI A;  2AE8 A;  3ADI A;  1KJK A;  3K6Q A;  5A6B D;  3QT6 A;  2GO3 A;  2YSO A;  4WPY A;  4U3D A;  2GLI A;  2NUF A;  2UUB I;  5C0X C;  5LMU I;  2O3Z A;  2EL6 A;  4FWG A;  4ZYE A;  5DRO A;  4GKJ E;  4DR3 I;  4MU1 A;  2DMY A;  2EOZ A;  1A1G A;  4DV2 E;  2EMB A;  1MU5 A;  4USK A;  4KQV A;  2UXD E;  4B3S I;  3WU6 A;  3P3E A;  1DAR A;  1N33 I;  1J5E E;  5JEA A;  1JK1 A;  2WP8 B;  4O5G A;  4O24 A;  2PNL A;  4URL A;  1PJQ A;  2GO4 A;  2YTJ A;  4HTG A;  1X48 A;  1P47 A;  4DR7 E;  1ZXM A;  2JE6 B;  5GME A;  4DV5 E;  1RC7 A;  4DR6 I;  1HNX E;  3K1J A;  3VK6 A;  3LNU A;  3M6A A;  3JU0 A;  4NZV A;  2Z5C B;  4DPX A;  4R1F A;  2ODR C;  2JP9 A;  1KIJ A;  4EMD A;  3NZK A;  3B78 A;  5T6J A;  2LUQ A;  5K36 F;  3JTZ A;  1TF6 A;  2NN6 B;  2EQ0 A;  1NHJ A;  4OX9 I;  2EM0 A;  4Q35 B;  3PYD A;  5K36 B;  3U1K A;  1Y6Z A;  4NBQ A;  4OOG C;  3PRY A;  4MU0 A;  2JOB A;  4JI5 E;  2HK2 A;  4J3D A;  5AC5 A;  4X66 E;  4DV7 I;  4B3T I;  4NXN E;  3OTO I;  4GKK E;  2HHH I;  4JI4 E;  4JG4 A;  3QT7 A;  2DRP A;  1HK7 A;  2EOY A;  3HJC A;  4AIM A;  4QNJ A;  1RHY A;  4OO1 E;  2PO0 A;  3ZZ0 A;  3HUL A;  3EQ1 A;  4FW7 A;  3EPJ A;  4OO1 C; 
#chains in the Genus database with same CATH homology
 2DEI A;  3F0N A;  4DPY A;  3F6G A;  1U2R A;  4BS9 A;  3Q6M A;  4JI7 I;  2M7Q A;  2UU9 I;  1XMO E;  5LMN E;  1ZXN A;  1HR0 I;  4IZJ B;  5AAS A;  4K0K I;  4DUY E;  2B9D A;  4UTG A;  4LFA E;  1YYW A;  1UIL A;  4X65 E;  4LFC I;  2R42 A;  4RPF A;  4ZVI A;  4BBY A;  1N34 E;  2F4V E;  2Z5B A;  4B3M I;  4Q28 A;  2VE7 C;  2L92 A;  2B3T B;  2E5L E;  2L8T A;  3ADL A;  4WYQ B;  1ZBT A;  2HKJ A;  2WW4 A;  1IBL I;  1B63 A;  1Z0E A;  1QU6 A;  1Z5A A;  2UUB E;  5LMU E;  2KON A;  4P78 A;  3P06 A;  1XHK A;  2HFU A;  4DPT A;  2L2N A;  1DI2 A;  4FWH A;  4JI1 E;  2ZBK B;  1YYO A;  1GZ6 A;  1ZM2 A;  2UUA I;  4B3S E;  1FJG E;  2BM0 A;  4DXL A;  3IWB A;  3J80 Q;  4DV0 I;  4JI4 I;  3J80 C;  4LFB I;  2ZIT A;  3K85 A;  4LF9 E;  2VQE I;  2E1M A;  4DV3 I;  1BKN A;  1N32 I;  4FWD A;  2ZM6 I;  2EFG A;  4DR6 E;  2OI2 A;  2UUC E;  4TUG A;  1YZ9 A;  2LJP A;  4YHH I;  3MSW A;  3QT8 A;  2CZ9 A;  1XMO I;  1HNW E;  4P7A A;  4NXM I;  2DSY A;  4BMJ A;  2XEX A;  1FNM A;  2F8B A;  4OX9 E;  1EI1 A;  2G7H A;  3VYX A;  3HQ1 A;  4JYA I;  2NA2 A;  1T4L B;  4I8O A;  1X49 A;  1A6F A;  1PKP A;  4DUZ I;  4DV7 E;  4B3T E;  2EWL A;  1OJ4 A;  3LLH A;  4DV6 I;  4MYU A;  1O0W A;  2M1S A;  2L2K B;  4F9B B;  4GEQ B;  2DIX A;  4LF7 I;  3HPS A;  1NZ0 A;  4JI7 E;  4JI8 I;  3V2U C;  4X8W A;  4WSP A;  2UU9 E;  3K17 A;  4JI1 I;  4IZK B;  2B7T A;  4J8Z A;  1HR0 E;  2VF3 A;  4K0K E;  4MYT A;  5F3W A;  2IOP A;  1FJG I;  2M4I A;  3ZKB A;  4F9A B;  4LFC E;  2V88 A;  2ODR D;  4P52 A;  4LF9 I;  3PYE A;  3IWD A;  1FWL A;  4HAC B;  4B3M E;  1K47 A;  2MC5 A;  5FLX Q;  5FLX C;  4LF8 I;  2IHR 1;  1Y4S A;  2UUC I;  2UXB I;  2WZO A;  2O1V A;  4PRX A;  1ZM3 A;  1IBL E;  2AJ4 A;  2GS8 A;  1XMQ I;  3WU4 A;  3F6H A;  4F54 A;  4JV5 I;  2V8P A;  2V8Q B;  2PNM A;  2NUG A;  5FWK A;  2LTR A;  1Z0B A;  2UUA E;  3C4B A;  2V83 A;  4DV0 E;  4LFB E;  2DEJ A;  1FI4 A;  1WXR A;  3J7A G;  2FTX B;  1Z5B A;  3J7A M;  2VQE E;  4DV3 E;  1H72 C;  1H7U A;  1N32 E;  2IOQ A;  2ZM6 E;  4X62 I;  3ZZU A;  2UXC I;  4YHH E;  2NUE A;  1XNR I;  4KHP I;  2X36 A;  4DV1 I;  5AE3 A;  1XNQ I;  4NXM E;  1N36 I;  4JI6 I;  3OML A;  3Q6N A;  1RR9 A;  4JYA E;  4FN5 A;  2E1R A;  3KWR A;  4M1K A;  5LL6 R;  3IWC A;  2V89 A;  3PYF A;  4DUZ E;  1Z5C A;  2JWO A;  4DV6 E;  2L2M A;  4AQY I;  2NPF A;  2GQ0 A;  4PRV A;  2KHX A;  4LF7 E;  1Z0G A;  4WUB A;  2V2Z A;  1Z59 A;  4IZJ A;  4JI8 E;  2L3J A;  3P1X A;  3ZKD A;  4YY3 I;  1Z0T A;  1WHN A;  1DQ3 A;  1STU A;  1FKA E;  1PVG A;  2V87 A;  3B8H A;  4BC7 A;  3JAM Q;  3JAM C;  1SR9 A;  3WU3 A;  3J81 Q;  3J81 C;  1FWK A;  1IBK I;  4LTY A;  5A2Q Q;  5A2Q C;  4LF8 E;  1X47 A;  3ADG A;  2UXB E;  2RS6 A;  4N3O A;  2H36 X;  2LE2 A;  3ZOQ B;  3WU5 A;  2Z5E A;  4DR2 E;  4LF6 I;  1N0V C;  4P7D A;  1XMQ E;  4JV5 E;  4Z7C A;  4M2Z A;  4PU9 A;  3DF6 A;  5ADZ A;  1EA6 A;  4WUD A;  3H4L A;  4R8O A;  2MDR A;  1USV A;  2CG9 A;  2LJH A;  2A2D A;  5GMD A;  3H09 A;  1IBM I;  1ZM9 A;  1H7S A;  4LF5 I;  1MX0 A;  3AUZ A;  4BC9 A;  2VQF E;  4DR1 I;  4KZS A;  2V2V A;  4TUI A;  4X62 E;  2EZ6 A;  1WUU A;  2UXC E;  4M0V A;  2J7K A;  1USU A;  1XNR E;  2FV4 B;  5AE1 A;  4KHP E;  4Z7Y A;  4DV1 E;  1XNQ E;  2R3V A;  3LPS A;  2LTS A;  2HFS A;  1N36 E;  4JI6 E;  2DB2 A;  1VIS A;  1RRE A;  2RSM A;  3ADJ A;  1RQ0 A;  2JY9 A;  2O1U A;  4IZJ D;  2N3H A;  2LRS A;  4WUC A;  1Z0W A;  2LUP B;  2BV3 A;  4LU9 A;  4DV4 E;  4AQY E;  1T4N A;  4JI3 I;  2A2C A;  1D6T A;  4IZK A;  4DR2 I;  5BR8 I;  3T1Y I;  5AE2 A;  3Q1Q A;  3RMP A;  2LMZ A;  4M30 A;  4X64 I;  4YY3 E;  4DR5 I;  2JOX A;  3DJW A;  2MC6 A;  4B3R E;  3LML A;  2B7V A;  1Z0V A;  1I94 I;  1NHH A;  2JVA A;  3QT5 A;  5IT9 C;  4HAC A;  5IT9 Q;  2VF1 A;  1KVK A;  4JI2 E;  2N3G A;  1IBK E;  1Y4U A;  1MG7 A;  3V5R A;  2VQF I;  2V2Q A;  2Z5C A;  1NHI A;  2RS7 A;  2V34 A;  3PYG A;  3T1H I;  4HYM A;  2K4V A;  3VYY A;  5IWA I;  2RTX A;  1S4E A;  4LF6 E;  4DPU A;  4DR4 I;  2Q2E B;  1HNZ I;  4L8N A;  2O1T A;  3LTO A;  5L3J A;  4JI0 E;  2Z5B B;  4DU7 A;  4USM A;  3FIG A;  2JR1 A;  1UHZ A;  5DNY A;  4HXZ A;  4XTJ A;  1IBM E;  4DV4 I;  1PIE A;  4LF5 E;  4GKJ I;  4DV2 I;  2V85 A;  2FGG A;  4DR1 E;  2UXD I;  3HXL A;  1J5E I;  1T4O A;  2CGE A;  1KTV A;  3J7Y p;  4DPW A;  4I3H A;  4DR7 I;  4B3R I;  4DV5 I;  2LBS B;  4LF4 E;  1HNX I;  3HTX A;  3D4J A;  1B62 A;  4ED4 A;  4JI2 I;  3B82 A;  2O1W A;  1UEK A;  4R03 A;  2KOU A;  1KKH A;  2X7I A;  2V86 A;  4F9C B;  1EKZ A;  4DKK A;  4DR3 E;  4JI3 E;  1S16 A;  4HY1 A;  5CFF E;  4JI5 I;  1ELO A;  5BR8 E;  4X66 I;  3T1Y E;  4NXN I;  3CWV A;  4WFT A;  1N33 E;  1ZM4 A;  3ZZT A;  4GKK I;  1N0U A;  4X64 E;  4DR5 E;  4JI0 I;  4DU8 A;  1H73 A;  2HK3 A;  2L6M A;  2L3C A;  1I94 E;  1Z0C A;  1H74 A;  2YT4 A;  3AV0 A;  1QZR A;  3ZM7 A;  4BCA A;  1YYK A;  2BM1 A;  5LMN I;  3GON A;  2YZT A;  4DUY I;  4L5N C;  2HKE A;  4LFA I;  3C4T A;  2L33 A;  4X65 I;  3T1H E;  5IWA E;  1ZBQ A;  2CPN A;  1N34 I;  1WHQ A;  1GQE A;  4DR4 E;  2F4V I;  4UT4 A;  1HNZ E;  4LF4 I;  3OTO E;  2HHH E;  2E5L I;  1J26 A;  3HPZ A;  4DMI A;  3ADI A;  3K6Q A;  3QT6 A;  4WPY A;  2NUF A;  2UUB I;  5LMU I;  4FWG A;  4GKJ E;  4DR3 I;  2DMY A;  4DV2 E;  1MU5 A;  4USK A;  4KQV A;  2UXD E;  4B3S I;  3WU6 A;  1N33 I;  1DAR A;  1J5E E;  2PNL A;  4URL A;  4DR7 E;  1X48 A;  1ZXM A;  5GME A;  4DV5 E;  1RC7 A;  4DR6 I;  1HNX E;  3K1J A;  3VK6 A;  3LNU A;  3M6A A;  3JU0 A;  2Z5C B;  4DPX A;  4R1F A;  2ODR C;  1KIJ A;  4EMD A;  1HNW I;  3B78 A;  5T6J A;  2LUQ A;  3JTZ A;  4OX9 I;  1NHJ A;  3PYD A;  1Y6Z A;  4OOG C;  3PRY A;  2JOB A;  4JI5 E;  2HK2 A;  4X66 E;  4DV7 I;  4B3T I;  4NXN E;  3OTO I;  4GKK E;  2HHH I;  4JI4 E;  4JG4 A;  3QT7 A;  1HK7 A;  3HJC A;  3ZZ0 A;  3HUL A;  4FW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...