1Z0TA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Pathological crystallography: case studies of several unusual macromolecular crystals.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 52
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0tA00
5IWAI 5FLXQ 3T1YE 4GKKI 4DXLA 2AJ4A 1H7UA 3ZKBA 4HXZA 3B82A 2XEXA 4JI5E 4LF7E 4DR4I 4LFAE 4DV0E 3HULA 4LF4E 1B63A 4NXNI 4DPTA 2V2ZA 3WU6A 1IBLI 4JI2E 4GKJI 5LMUI 3PYGA 3CWVA 1XNQI 4X64I 4B3RE 3QT6A 2WW4A 1MX0A 1Z5BA 3J80Q 4DR3E 2V34A 4LF8I 4NXME 2VQEE 4HYMA 2ZM6E 4DUYE 2UXDE 1EA6A 3J80C 1NHHA 1ZM9A 4JI6E 1FJGE 1PVGA 4USKA 1KTVA 4HACB 1I94E 1ZM3A 1N0UA 2UU9I 2HKJA 1N34E 2BV3A 2A2CA 4FWGA 1ZM2A 4FWDA 2UXBI 3Q1QA 1FWKA 2VF3A 4FW9A 4K0KE 4LF9E 1N33I 2BM1A 1H7SA 1HNZE 1WUUA 3PYEA 2HHHE 4JI3E 1J5EI 4R1FA 1HR0E 4LFBI 4UT4A 1RR9A 3OTOE 1QZRA 4PRXA 4PRVA 2E5LE 4JV5I 4ZVIA 1N36E 2V8PA 1IBKI 4DR1E 3QT5A 1MU5A 5LL6R 4DR5I 1Z59A 4DV6I 3LPSA 4KHPI 4PU9A 4JI8E 2R42A 4EMDA 4DR7E 1ZXMA 2UXCE 2VQFE 3T1YI 3B8HA 3M6AA 2HK2A 4WUBA 2R3VA 1KIJA 1XMOE 2LJPA 4ED4A 4JI5I 2ZITA 4LF7I 4LFAI 4JG4A 5FLXC 4DV0I 3K17A 4JYAE 3D4JA 3V2UC 4LF4I 4DPXA 5GMEA 3J7AM 1Z5AA 4JI2I 3V5RA 4B3TE 1XNRE 1D6TA 2ZBKB 4DV5E 1U2RA 4DPUA 2OI2A 1N32E 4B3RI 1UEKA 4MYTA 2X36A 4B3SE 1FI4A 4DR3I 3QT8A 4NXMI 2VQEI 2ZM6I 4JI4E 4DUYI 2UXDI 3K1JA 2HK3A 3PYFA 4JI6I 1FJGI 4Z7CA 4MYUA 4DV7E 5L3JA 1I94I 1HNXE 4DV1E 1N34I 4DUZE 5LMNE 1H73A 4JI7E 1DARA 4DR2E 4YY3E 4X65E 4K0KI 4LF9I 5GMDA 4B3ME 1S16A 1Z0GA 4USMA 3PYDA 2UUCE 4LF5E 1HNZI 2HHHI 4JI3I 1HNWE 4DPWA 2HFSA 2V2VA 1HR0I 3OTOI 2F4VE 1IBME 4HY1A 2E5LI 4YHHE 1N36I 2J7KA 4DR1I 2EFGA 3JAMQ 4LF6E 1Z5CA 4Z7YA 4LFCE 3B78A 4M1KA 1K47A 1KKHA 3JAMC 4JI8I 4AQYE 1Z0BA 2BM0A 1XMQE 3J7AG 4DR7I 3WU5A 2V2QA 1Z0TA 1ZXNA 3H4LA 5A2QQ 2UXCI 2VQFI 4UTGA 2NPFA 3T1HE 5A2QC 4DV2E 1XMOI 4DU8A 1NHJA 1MG7A 4X66E 4JYAI 4DV3E 5BR8E 2HKEA 2Q2EB 1ZM4A 4XTJA 4B3TI 1XNRI 4DV5I 4X62E 4JI0E 5IT9Q 1ELOA 4P52A 1N32I 4JI1E 2E1RA 5IT9C 4B3SI 1PKPA 4KQVA 1FKAE 2UUAE 1NHIA 3ZZUA 4I3HA 4JI4I 4FWHA 4DV4E 4OX9E 4DR6E 2UUBE 3WU4A 5IWAE 1RREA 4GKKE 1OJ4A 4DV7I 2A2DA 1BKNA 1HNXI 3LTOA 4DV1I 4DUZI 5LMNI 4JI7I 4DR4E 3QT7A 4DR2I 4YY3I 1XHKA 3GONA 2GS8A 4DPYA 4NXNE 1IBLE 4GKJE 1A6FA 4X65I 4B3MI 5LMUE 2UUCI 4LF5I 1XNQE 4X64E 1Z0WA 1HNWI 4HACA 4LF8E 1Z0EA 2F4VI 1IBMI 2DEIA 3F0NA 1H74A 4YHHI 1PIEA 3ZZTA 1NZ0A 4URLA 1VISA 4LF6I 2UU9E 4LFCI 2HFUA 4WUDA 4AQYI 1XMQI 1FNMA 2UXBE 4WUCA 3ZKDA 1Z0VA 1KVKA 3T1HI 1N33E 3ZZ0A 4DV2I 1S4EA 1J5EE 3J81Q 3LNUA 4X66I 3WU3A 4LFBE 3J81C 4DV3I 5BR8I 2CZ9A 4JV5E 1IBKE 4X62I 4P7AA 1B62A 4JI0I 4DR5E 4DU7A 1N0VC 2DEJA 4JI1I 4DV6E 1H72C 3ZM7A 4KHPE 1Z0CA 2UUAI 1EI1A 4DV4I 4RPFA 4OX9I 4DR6I 2UUBI 4FN5A 1FWLA 2X7IA
chains in the Genus database with same CATH superfamily
2PNLA 5IWAI 2C38B 5FLXQ 3T1YE 4GKKI 4DXLA 2CG9A 3L7ZB 2AJ4A 4OZEA 5EKWA 2Z5EA 1H7UA 3ZKBA 4HXZA 4OO1A 3B82A 2XEXA 5JEAE 1E3PA 2PO1B 4JI5E 4IZKA 4LF7E 4DR4I 4LFAE 4DV0E 3HULA 3DD6A 4LF4E 2PO2A 1B63A 4NXNI 4DPTA 3UHMA 5DNLA 2V2ZA 3WU6A 1IBLI 1Y60A 4JI2E 4GKJI 2O3ZA 4MU3A 5LMUI 3PYGA 4IZJD 3CWVA 1XNQI 4X64I 4B3RE 3QT6A 2WW4A 1MX0A 4AIMA 1Z5BA 3J80Q 4DR3E 2V34A 4LF8I 4NXME 3M7NG 2VQEE 4HYMA 5JEAD 2ZM6E 4DUYE 4J3DA 2UXDE 1EA6A 3J80C 2F1DA 1NHHA 1ZM9A 2GO3A 4JI6E 1FJGE 1PVGA 4USKA 5K36E 4IZJB 1KTVA 4HACB 2JEBB 1I94E 1ZM3A 4U3DA 1N0UA 2UU9I 2HKJA 1N34E 2BV3A 2A2CA 2J65A 4FWGA 5JEAB 1ZM2A 4FWDA 2UXBI 2BA0D 4AIDA 5DRPA 3Q1QA 1FWKA 2VF3A 4FW9A 1Y4UA 2JT2A 4K0KE 4LF9E 1N33I 2PO0A 5C0XE 2BM1A 1H7SA 1HNZE 5EL9A 1WUUA 2NN6E 3PYEA 2HHHE 4JI3E 1J5EI 2C39B 4R1FA 1HR0E 4LCHA 5K36D 4LFBI 4UT4A 1RR9A 3OTOE 1QZRA 4PRXA 4PRVA 2IOPA 1USVA 4OO1E 2O1VA 2E5LE 4JV5I 4ZVIA 1N36E 2NN6C 2V8PA 4DR1E 1IBKI 3QT5A 1MU5A 2Z5BA 5LL6R 1UDNA 4DR5I 3M85D 5JEAF 1Z59A 2JE6B 4DV6I 4IFDC 3LPSA 5C0XD 4KHPI 5K36B 4LOMA 4PU9A 4JI8E 2NN6D 2R42A 4EMDA 4DR7E 1ZXMA 2Z5CB 3PS3A 2VQFE 2UXCE 3T1YI 3B8HA 4OO1D 3M6AA 2HK2A 3PRYA 4GQUA 2JEAB 4WUBA 2R3VA 1KIJA 1Y5YA 1XMOE 2BA1D 2LJPA 4ED4A 4JI5I 2ZITA 5C0XB 5DROA 4LF7I 4LFAI 2NN6B 4JG4A 4MU1A 5FLXC 3K85A 4DV0I 3K17A 4IFDA 4JYAE 5DRRA 3U1KA 3D4JA 3V2UC 4LF4I 4DPXA 5GMEA 3J7AM 1Z5AA 4JI2I 3V5RA 4B3TE 3B4TA 1XNRE 2ZBKB 4DV5E 4OO1B 1D6TA 3P3GA 1U2RA 4DPUA 5K36F 2C37A 2OI2A 1RHYA 4IZKB 2IOQA 2WNRA 1N32E 4B3RI 1UEKA 4MYTA 2X36A 2O1TA 2PO2B 4B3SE 1FI4A 4DR3I 3QT8A 4LPFA 4NXMI 2VQEI 2ZM6I 4JI4E 4DUYI 3H1CA 5DRQA 4FW7A 2UXDI 3K1JA 2HK3A 2IESA 1UDQA 2CGEA 3PYFA 2AE8A 4JI6I 1FJGI 4Z7CA 4MYUA 4OKGA 4DV7E 5C0XF 5L3JA 2NN6F 1I94I 1HNXE 4DV1E 1OYRA 1N34I 4DUZE 5LMNE 1H73A 2BA0G 4JI7E 4FW3A 3GMEA 1DARA 4DR2E 4YY3E 4OO1F 1R6LA 3GCMA 4X65E 4K0KI 4LF9I 5GMDA 1S16A 4B3ME 1Z0GA 4USMA 3PYDA 2UUCE 4LCGA 4LF5E 1HNZI 2GO4A 2HHHI 4JI3I 1HNWE 4DPWA 2HFSA 2V2VA 1HR0I 2BR2A 4FW6A 3OTOI 4N3OA 2F4VE 1IBME 1OYSA 1P42A 4HY1A 2E5LI 4YHHE 1N36I 2PO0B 2J7KA 3M85G 4ISAA 1UDSA 4DR1I 2EFGA 4IFDE 4QNKA 3JAMQ 4LF6E 1Z5CA 4Z7YA 4BA1A 1E3HA 4LFCE 2PNZA 3B78A 4M1KA 1K47A 1KKHA 3JAMC 2O1UA 4JI8I 4AQYE 1Z0BA 4BA2A 2BM0A 1XMQE 3GLLA 5DNXA 3J7AG 2WP8A 4DR7I 3Q6NA 3WU5A 2V2QA 1Z0TA 1ZXNA 3H4LA 5A2QQ 2UXCI 2Z5BB 2VQFI 4UTGA 2NPFA 2BA1G 1OYPA 3T1HE 5A2QC 4DV2E 1XMOI 2GQ0A 3P06A 4DU8A 4IFDD 1NHJA 1MG7A 4X66E 4JYAI 3NZKA 4DV3E 5BR8E 2HKEA 2Q2EB 1ZM4A 4XTJA 4AM3A 1Y6ZA 4B3TI 4QNJA 1XNRI 4MU4A 4DV5I 4X62E 4MQYA 4JI0E 2C38A 5IT9Q 1ELOA 4P52A 1N32I 4JI1E 4IFDB 2E1RA 5IT9C 4B3SI 3L7ZA 1PKPA 4KQVA 1FKAE 2UUAE 1UDOA 1HK7A 1NHIA 3ZZUA 4I3HA 4JI4I 4FWHA 2PO1A 4DV4E 4OX9E 4DR6E 2UUBE 4FW5A 3WU4A 5IWAE 2C37B 1RREA 4U3BA 3P3EA 2WNRB 4FW4A 1OJ4A 4GKKE 4DV7I 3U1YA 2A2DA 1BKNA 1HNXI 3LTOA 4DV1I 4DUZI 5LMNI 3HJCA 4JI7I 4DR4E 3QT7A 5JEAC 4DR2I 4YY3I 1XHKA 3GONA 2GS8A 4DPYA 4NXNE 4MU0A 2VESA 1IBLE 4GKJE 1A6FA 4X65I 4IFDF 1USUA 4B3MI 5LMUE 2UUCI 4LF5I 1XNQE 4X64E 1Z0WA 2O1WA 1HNWI 4LCFA 4IZJA 4HACA 2JEBA 1R6MA 4LF8E 1Z0EA 2F4VI 1IBMI 1VI7A 2IERA 2DEIA 3F0NA 1H74A 4YHHI 1PIEA 3ZZTA 5JEAA 3M7ND 5ELWA 1NZ0A 4URLA 1VISA 2BR2B 4LF6I 3CDIA 2UU9E 4LFCI 2HFUA 5K36C 4WUDA 4AQYI 2C39A 4MDTA 1XMQI 1YH8A 1FNMA 2UXBE 4WUCA 3ZKDA 1Z0VA 1KVKA 4BA1B 3T1HI 1N33E 3ZZ0A 2PNZB 5FWKA 4DV2I 1S4EA 1J5EE 4BA2B 3J81Q 3KRNA 3PS2A 5C0XC 1XXEA 2WP8B 3LNUA 4X66I 3WU3A 4LFBE 3P76A 2JE6A 3PS1A 2PNMA 3J81C 4DV3I 5BR8I 5K36A 1Y4SA 2CZ9A 4IS9A 4JV5E 3CDJA 4NBQA 4OO1C 1IBKE 4X62I 4P7AA 2Z5CA 1B62A 4JI0I 3HKMA 3Q6MA 4DR5E 4DU7A 1N0VC 1YHCA 2DEJA 4JI1I 4DV6E 2CVEA 3P3CA 1H72C 3ZM7A 4KHPE 2JEAA 1Z0CA 2UUAI 1EI1A 4DV4I 4RPFA 5C0XA 4OX9I 2UUBI 4DR6I 4FN5A 1FWLA 2X7IA 2NN6A
chains in the Genus database with same CATH topology
2PNLA 5IWAI 5FLXQ 3T1YE 4GKKI 4DXLA 2CG9A 2AJ4A 2Z5EA 1H7UA 3ZKBA 4HXZA 3B82A 2XEXA 4JI5E 4IZKA 4LF7E 4DR4I 4LFAE 4DV0E 3HULA 4LF4E 1B63A 4NXNI 4DPTA 2V2ZA 3WU6A 1IBLI 4JI2E 4GKJI 5LMUI 3PYGA 4IZJD 3CWVA 1XNQI 4X64I 4B3RE 3QT6A 2WW4A 1MX0A 1Z5BA 3J80Q 4DR3E 2V34A 4LF8I 4NXME 2VQEE 4HYMA 2ZM6E 4DUYE 2UXDE 1EA6A 3J80C 1NHHA 1ZM9A 4JI6E 1FJGE 1PVGA 4USKA 4IZJB 1KTVA 4HACB 1I94E 1ZM3A 1N0UA 2UU9I 2HKJA 1N34E 2BV3A 2A2CA 4FWGA 1ZM2A 4FWDA 2UXBI 3Q1QA 1FWKA 2VF3A 4FW9A 1Y4UA 4K0KE 4LF9E 1N33I 2BM1A 1H7SA 1HNZE 1WUUA 3PYEA 2HHHE 4JI3E 1J5EI 4R1FA 1HR0E 4LFBI 4UT4A 1RR9A 3OTOE 1QZRA 4PRXA 4PRVA 2IOPA 1USVA 2O1VA 2E5LE 4JV5I 4ZVIA 1N36E 2V8PA 4DR1E 1IBKI 3QT5A 1MU5A 2Z5BA 5LL6R 4DR5I 1Z59A 4DV6I 3LPSA 4KHPI 4PU9A 4JI8E 2R42A 4EMDA 4DR7E 1ZXMA 2Z5CB 2UXCE 2VQFE 3T1YI 3B8HA 3M6AA 2HK2A 3PRYA 4WUBA 2R3VA 1KIJA 1XMOE 2LJPA 4ED4A 4JI5I 2ZITA 4LF7I 4LFAI 4JG4A 5FLXC 3K85A 4DV0I 3K17A 4JYAE 3D4JA 3V2UC 4LF4I 4DPXA 5GMEA 3J7AM 1Z5AA 4JI2I 3V5RA 4B3TE 1XNRE 1D6TA 2ZBKB 4DV5E 1U2RA 4DPUA 2OI2A 4IZKB 2IOQA 1N32E 4B3RI 1UEKA 4MYTA 2X36A 2O1TA 4B3SE 1FI4A 4DR3I 3QT8A 4NXMI 2VQEI 2ZM6I 4JI4E 4DUYI 2UXDI 3K1JA 2HK3A 2CGEA 3PYFA 4JI6I 1FJGI 4Z7CA 4MYUA 4DV7E 5L3JA 1I94I 1HNXE 4DV1E 1N34I 4DUZE 5LMNE 1H73A 4JI7E 1DARA 4DR2E 4YY3E 4X65E 4K0KI 4LF9I 5GMDA 1S16A 4B3ME 1Z0GA 4USMA 3PYDA 2UUCE 4LF5E 1HNZI 2HHHI 4JI3I 1HNWE 4DPWA 2HFSA 2V2VA 1HR0I 3OTOI 4N3OA 2F4VE 1IBME 4HY1A 2E5LI 4YHHE 1N36I 2J7KA 4DR1I 2EFGA 3JAMQ 4LF6E 1Z5CA 4Z7YA 4LFCE 3B78A 4M1KA 1K47A 1KKHA 3JAMC 2O1UA 4JI8I 4AQYE 1Z0BA 2BM0A 1XMQE 3J7AG 4DR7I 3Q6NA 3WU5A 2V2QA 1Z0TA 1ZXNA 3H4LA 5A2QQ 2UXCI 2Z5BB 2VQFI 4UTGA 2NPFA 3T1HE 5A2QC 4DV2E 1XMOI 2GQ0A 3P06A 4DU8A 1NHJA 1MG7A 4X66E 4JYAI 4DV3E 5BR8E 2HKEA 2Q2EB 1ZM4A 4XTJA 1Y6ZA 4B3TI 1XNRI 4DV5I 4X62E 4JI0E 5IT9Q 1ELOA 4P52A 1N32I 4JI1E 2E1RA 5IT9C 4B3SI 1PKPA 4KQVA 1FKAE 2UUAE 1HK7A 1NHIA 3ZZUA 4I3HA 4JI4I 4FWHA 4DV4E 4OX9E 4DR6E 2UUBE 3WU4A 5IWAE 1RREA 4GKKE 1OJ4A 4DV7I 2A2DA 1BKNA 1HNXI 3LTOA 4DV1I 4DUZI 5LMNI 3HJCA 4JI7I 4DR4E 3QT7A 4DR2I 4YY3I 1XHKA 3GONA 2GS8A 4DPYA 4NXNE 1IBLE 4GKJE 1A6FA 4X65I 1USUA 4B3MI 5LMUE 2UUCI 4LF5I 1XNQE 4X64E 1Z0WA 2O1WA 1HNWI 4IZJA 4HACA 4LF8E 1Z0EA 2F4VI 1IBMI 2DEIA 3F0NA 1H74A 4YHHI 1PIEA 3ZZTA 1NZ0A 4URLA 1VISA 4LF6I 2UU9E 4LFCI 2HFUA 4WUDA 4AQYI 1XMQI 1FNMA 2UXBE 4WUCA 3ZKDA 1Z0VA 1KVKA 3T1HI 1N33E 3ZZ0A 5FWKA 4DV2I 1S4EA 1J5EE 3J81Q 3LNUA 4X66I 3WU3A 4LFBE 2PNMA 3J81C 4DV3I 5BR8I 1Y4SA 2CZ9A 4JV5E 1IBKE 4X62I 4P7AA 2Z5CA 1B62A 4JI0I 3Q6MA 4DR5E 4DU7A 1N0VC 2DEJA 4JI1I 4DV6E 1H72C 3ZM7A 4KHPE 1Z0CA 2UUAI 1EI1A 4DV4I 4RPFA 4OX9I 4DR6I 2UUBI 4FN5A 1FWLA 2X7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA I;  5FLX Q;  3T1Y E;  4GKK I;  4DXL A;  2AJ4 A;  1H7U A;  3ZKB A;  4HXZ A;  3B82 A;  2XEX A;  4JI5 E;  4LF7 E;  4DR4 I;  4LFA E;  4DV0 E;  3HUL A;  4LF4 E;  1B63 A;  4NXN I;  4DPT A;  2V2Z A;  3WU6 A;  1IBL I;  4JI2 E;  4GKJ I;  5LMU I;  3PYG A;  3CWV A;  1XNQ I;  4X64 I;  4B3R E;  3QT6 A;  2WW4 A;  1MX0 A;  1Z5B A;  3J80 Q;  4DR3 E;  2V34 A;  4LF8 I;  4NXM E;  2VQE E;  4HYM A;  2ZM6 E;  4DUY E;  2UXD E;  1EA6 A;  3J80 C;  1NHH A;  1ZM9 A;  4JI6 E;  1FJG E;  1PVG A;  4USK A;  1KTV A;  4HAC B;  1I94 E;  1ZM3 A;  1N0U A;  2UU9 I;  2HKJ A;  1N34 E;  2BV3 A;  2A2C A;  4FWG A;  1ZM2 A;  4FWD A;  2UXB I;  3Q1Q A;  1FWK A;  2VF3 A;  4FW9 A;  4K0K E;  4LF9 E;  1N33 I;  2BM1 A;  1H7S A;  1HNZ E;  1WUU A;  3PYE A;  2HHH E;  4JI3 E;  1J5E I;  4R1F A;  1HR0 E;  4LFB I;  4UT4 A;  1RR9 A;  3OTO E;  1QZR A;  4PRX A;  4PRV A;  2E5L E;  4JV5 I;  4ZVI A;  1N36 E;  2V8P A;  1IBK I;  4DR1 E;  3QT5 A;  1MU5 A;  5LL6 R;  4DR5 I;  1Z59 A;  4DV6 I;  3LPS A;  4KHP I;  4PU9 A;  4JI8 E;  2R42 A;  4EMD A;  4DR7 E;  1ZXM A;  2UXC E;  2VQF E;  3T1Y I;  3B8H A;  3M6A A;  2HK2 A;  4WUB A;  2R3V A;  1KIJ A;  1XMO E;  2LJP A;  4ED4 A;  4JI5 I;  2ZIT A;  4LF7 I;  4LFA I;  4JG4 A;  5FLX C;  4DV0 I;  3K17 A;  4JYA E;  3D4J A;  3V2U C;  4LF4 I;  4DPX A;  5GME A;  3J7A M;  1Z5A A;  4JI2 I;  3V5R A;  4B3T E;  1XNR E;  1D6T A;  2ZBK B;  4DV5 E;  1U2R A;  4DPU A;  2OI2 A;  1N32 E;  4B3R I;  1UEK A;  4MYT A;  2X36 A;  4B3S E;  1FI4 A;  4DR3 I;  3QT8 A;  4NXM I;  2VQE I;  2ZM6 I;  4JI4 E;  4DUY I;  2UXD I;  3K1J A;  2HK3 A;  3PYF A;  4JI6 I;  1FJG I;  4Z7C A;  4MYU A;  4DV7 E;  5L3J A;  1I94 I;  1HNX E;  4DV1 E;  1N34 I;  4DUZ E;  5LMN E;  1H73 A;  4JI7 E;  1DAR A;  4DR2 E;  4YY3 E;  4X65 E;  4K0K I;  4LF9 I;  5GMD A;  4B3M E;  1S16 A;  1Z0G A;  4USM A;  3PYD A;  2UUC E;  4LF5 E;  1HNZ I;  2HHH I;  4JI3 I;  1HNW E;  4DPW A;  2HFS A;  2V2V A;  1HR0 I;  3OTO I;  2F4V E;  1IBM E;  4HY1 A;  2E5L I;  4YHH E;  1N36 I;  2J7K A;  4DR1 I;  2EFG A;  3JAM Q;  4LF6 E;  1Z5C A;  4Z7Y A;  4LFC E;  3B78 A;  4M1K A;  1K47 A;  1KKH A;  3JAM C;  4JI8 I;  4AQY E;  1Z0B A;  2BM0 A;  1XMQ E;  3J7A G;  4DR7 I;  3WU5 A;  2V2Q A;  1Z0T A;  1ZXN A;  3H4L A;  5A2Q Q;  2UXC I;  2VQF I;  4UTG A;  2NPF A;  3T1H E;  5A2Q C;  4DV2 E;  1XMO I;  4DU8 A;  1NHJ A;  1MG7 A;  4X66 E;  4JYA I;  4DV3 E;  5BR8 E;  2HKE A;  2Q2E B;  1ZM4 A;  4XTJ A;  4B3T I;  1XNR I;  4DV5 I;  4X62 E;  4JI0 E;  5IT9 Q;  1ELO A;  4P52 A;  1N32 I;  4JI1 E;  2E1R A;  5IT9 C;  4B3S I;  1PKP A;  4KQV A;  1FKA E;  2UUA E;  1NHI A;  3ZZU A;  4I3H A;  4JI4 I;  4FWH A;  4DV4 E;  4OX9 E;  4DR6 E;  2UUB E;  3WU4 A;  5IWA E;  1RRE A;  4GKK E;  1OJ4 A;  4DV7 I;  2A2D A;  1BKN A;  1HNX I;  3LTO A;  4DV1 I;  4DUZ I;  5LMN I;  4JI7 I;  4DR4 E;  3QT7 A;  4DR2 I;  4YY3 I;  1XHK A;  3GON A;  2GS8 A;  4DPY A;  4NXN E;  1IBL E;  4GKJ E;  1A6F A;  4X65 I;  4B3M I;  5LMU E;  2UUC I;  4LF5 I;  1XNQ E;  4X64 E;  1Z0W A;  1HNW I;  4HAC A;  4LF8 E;  1Z0E A;  2F4V I;  1IBM I;  2DEI A;  3F0N A;  1H74 A;  4YHH I;  1PIE A;  3ZZT A;  1NZ0 A;  4URL A;  1VIS A;  4LF6 I;  2UU9 E;  4LFC I;  2HFU A;  4WUD A;  4AQY I;  1XMQ I;  1FNM A;  2UXB E;  4WUC A;  3ZKD A;  1Z0V A;  1KVK A;  3T1H I;  1N33 E;  3ZZ0 A;  4DV2 I;  1S4E A;  1J5E E;  3J81 Q;  3LNU A;  4X66 I;  3WU3 A;  4LFB E;  3J81 C;  4DV3 I;  5BR8 I;  2CZ9 A;  4JV5 E;  1IBK E;  4X62 I;  4P7A A;  1B62 A;  4JI0 I;  4DR5 E;  4DU7 A;  1N0V C;  2DEJ A;  4JI1 I;  4DV6 E;  1H72 C;  3ZM7 A;  4KHP E;  1Z0C A;  2UUA I;  1EI1 A;  4DV4 I;  4RPF A;  4OX9 I;  4DR6 I;  2UUB I;  4FN5 A;  1FWL A;  2X7I A; 
#chains in the Genus database with same CATH topology
 2PNL A;  5IWA I;  2C38 B;  5FLX Q;  3T1Y E;  4GKK I;  4DXL A;  2CG9 A;  3L7Z B;  2AJ4 A;  4OZE A;  5EKW A;  2Z5E A;  1H7U A;  3ZKB A;  4HXZ A;  4OO1 A;  3B82 A;  2XEX A;  5JEA E;  1E3P A;  2PO1 B;  4JI5 E;  4IZK A;  4LF7 E;  4DR4 I;  4LFA E;  4DV0 E;  3HUL A;  3DD6 A;  4LF4 E;  2PO2 A;  1B63 A;  4NXN I;  4DPT A;  3UHM A;  5DNL A;  2V2Z A;  3WU6 A;  1IBL I;  1Y60 A;  4JI2 E;  4GKJ I;  2O3Z A;  4MU3 A;  5LMU I;  3PYG A;  4IZJ D;  3CWV A;  1XNQ I;  4X64 I;  4B3R E;  3QT6 A;  2WW4 A;  1MX0 A;  4AIM A;  1Z5B A;  3J80 Q;  4DR3 E;  2V34 A;  4LF8 I;  4NXM E;  3M7N G;  2VQE E;  4HYM A;  5JEA D;  2ZM6 E;  4DUY E;  4J3D A;  2UXD E;  1EA6 A;  3J80 C;  2F1D A;  1NHH A;  1ZM9 A;  2GO3 A;  4JI6 E;  1FJG E;  1PVG A;  4USK A;  5K36 E;  4IZJ B;  1KTV A;  4HAC B;  2JEB B;  1I94 E;  1ZM3 A;  4U3D A;  1N0U A;  2UU9 I;  2HKJ A;  1N34 E;  2BV3 A;  2A2C A;  2J65 A;  4FWG A;  5JEA B;  1ZM2 A;  4FWD A;  2UXB I;  2BA0 D;  4AID A;  5DRP A;  3Q1Q A;  1FWK A;  2VF3 A;  4FW9 A;  1Y4U A;  2JT2 A;  4K0K E;  4LF9 E;  1N33 I;  2PO0 A;  5C0X E;  2BM1 A;  1H7S A;  1HNZ E;  5EL9 A;  1WUU A;  2NN6 E;  3PYE A;  2HHH E;  4JI3 E;  1J5E I;  2C39 B;  4R1F A;  1HR0 E;  4LCH A;  5K36 D;  4LFB I;  4UT4 A;  1RR9 A;  3OTO E;  1QZR A;  4PRX A;  4PRV A;  2IOP A;  1USV A;  4OO1 E;  2O1V A;  2E5L E;  4JV5 I;  4ZVI A;  1N36 E;  2NN6 C;  2V8P A;  4DR1 E;  1IBK I;  3QT5 A;  1MU5 A;  2Z5B A;  5LL6 R;  1UDN A;  4DR5 I;  3M85 D;  5JEA F;  1Z59 A;  2JE6 B;  4DV6 I;  4IFD C;  3LPS A;  5C0X D;  4KHP I;  5K36 B;  4LOM A;  4PU9 A;  4JI8 E;  2NN6 D;  2R42 A;  4EMD A;  4DR7 E;  1ZXM A;  2Z5C B;  3PS3 A;  2VQF E;  2UXC E;  3T1Y I;  3B8H A;  4OO1 D;  3M6A A;  2HK2 A;  3PRY A;  4GQU A;  2JEA B;  4WUB A;  2R3V A;  1KIJ A;  1Y5Y A;  1XMO E;  2BA1 D;  2LJP A;  4ED4 A;  4JI5 I;  2ZIT A;  5C0X B;  5DRO A;  4LF7 I;  4LFA I;  2NN6 B;  4JG4 A;  4MU1 A;  5FLX C;  3K85 A;  4DV0 I;  3K17 A;  4IFD A;  4JYA E;  5DRR A;  3U1K A;  3D4J A;  3V2U C;  4LF4 I;  4DPX A;  5GME A;  3J7A M;  1Z5A A;  4JI2 I;  3V5R A;  4B3T E;  3B4T A;  1XNR E;  2ZBK B;  4DV5 E;  4OO1 B;  1D6T A;  3P3G A;  1U2R A;  4DPU A;  5K36 F;  2C37 A;  2OI2 A;  1RHY A;  4IZK B;  2IOQ A;  2WNR A;  1N32 E;  4B3R I;  1UEK A;  4MYT A;  2X36 A;  2O1T A;  2PO2 B;  4B3S E;  1FI4 A;  4DR3 I;  3QT8 A;  4LPF A;  4NXM I;  2VQE I;  2ZM6 I;  4JI4 E;  4DUY I;  3H1C A;  5DRQ A;  4FW7 A;  2UXD I;  3K1J A;  2HK3 A;  2IES A;  1UDQ A;  2CGE A;  3PYF A;  2AE8 A;  4JI6 I;  1FJG I;  4Z7C A;  4MYU A;  4OKG A;  4DV7 E;  5C0X F;  5L3J A;  2NN6 F;  1I94 I;  1HNX E;  4DV1 E;  1OYR A;  1N34 I;  4DUZ E;  5LMN E;  1H73 A;  2BA0 G;  4JI7 E;  4FW3 A;  3GME A;  1DAR A;  4DR2 E;  4YY3 E;  4OO1 F;  1R6L A;  3GCM A;  4X65 E;  4K0K I;  4LF9 I;  5GMD A;  1S16 A;  4B3M E;  1Z0G A;  4USM A;  3PYD A;  2UUC E;  4LCG A;  4LF5 E;  1HNZ I;  2GO4 A;  2HHH I;  4JI3 I;  1HNW E;  4DPW A;  2HFS A;  2V2V A;  1HR0 I;  2BR2 A;  4FW6 A;  3OTO I;  4N3O A;  2F4V E;  1IBM E;  1OYS A;  1P42 A;  4HY1 A;  2E5L I;  4YHH E;  1N36 I;  2PO0 B;  2J7K A;  3M85 G;  4ISA A;  1UDS A;  4DR1 I;  2EFG A;  4IFD E;  4QNK A;  3JAM Q;  4LF6 E;  1Z5C A;  4Z7Y A;  4BA1 A;  1E3H A;  4LFC E;  2PNZ A;  3B78 A;  4M1K A;  1K47 A;  1KKH A;  3JAM C;  2O1U A;  4JI8 I;  4AQY E;  1Z0B A;  4BA2 A;  2BM0 A;  1XMQ E;  3GLL A;  5DNX A;  3J7A G;  2WP8 A;  4DR7 I;  3Q6N A;  3WU5 A;  2V2Q A;  1Z0T A;  1ZXN A;  3H4L A;  5A2Q Q;  2UXC I;  2Z5B B;  2VQF I;  4UTG A;  2NPF A;  2BA1 G;  1OYP A;  3T1H E;  5A2Q C;  4DV2 E;  1XMO I;  2GQ0 A;  3P06 A;  4DU8 A;  4IFD D;  1NHJ A;  1MG7 A;  4X66 E;  4JYA I;  3NZK A;  4DV3 E;  5BR8 E;  2HKE A;  2Q2E B;  1ZM4 A;  4XTJ A;  4AM3 A;  1Y6Z A;  4B3T I;  4QNJ A;  1XNR I;  4MU4 A;  4DV5 I;  4X62 E;  4MQY A;  4JI0 E;  2C38 A;  5IT9 Q;  1ELO A;  4P52 A;  1N32 I;  4JI1 E;  4IFD B;  2E1R A;  5IT9 C;  4B3S I;  3L7Z A;  1PKP A;  4KQV A;  1FKA E;  2UUA E;  1UDO A;  1HK7 A;  1NHI A;  3ZZU A;  4I3H A;  4JI4 I;  4FWH A;  2PO1 A;  4DV4 E;  4OX9 E;  4DR6 E;  2UUB E;  4FW5 A;  3WU4 A;  5IWA E;  2C37 B;  1RRE A;  4U3B A;  3P3E A;  2WNR B;  4FW4 A;  1OJ4 A;  4GKK E;  4DV7 I;  3U1Y A;  2A2D A;  1BKN A;  1HNX I;  3LTO A;  4DV1 I;  4DUZ I;  5LMN I;  3HJC A;  4JI7 I;  4DR4 E;  3QT7 A;  5JEA C;  4DR2 I;  4YY3 I;  1XHK A;  3GON A;  2GS8 A;  4DPY A;  4NXN E;  4MU0 A;  2VES A;  1IBL E;  4GKJ E;  1A6F A;  4X65 I;  4IFD F;  1USU A;  4B3M I;  5LMU E;  2UUC I;  4LF5 I;  1XNQ E;  4X64 E;  1Z0W A;  2O1W A;  1HNW I;  4LCF A;  4IZJ A;  4HAC A;  2JEB A;  1R6M A;  4LF8 E;  1Z0E A;  2F4V I;  1IBM I;  1VI7 A;  2IER A;  2DEI A;  3F0N A;  1H74 A;  4YHH I;  1PIE A;  3ZZT A;  5JEA A;  3M7N D;  5ELW A;  1NZ0 A;  4URL A;  1VIS A;  2BR2 B;  4LF6 I;  3CDI A;  2UU9 E;  4LFC I;  2HFU A;  5K36 C;  4WUD A;  4AQY I;  2C39 A;  4MDT A;  1XMQ I;  1YH8 A;  1FNM A;  2UXB E;  4WUC A;  3ZKD A;  1Z0V A;  1KVK A;  4BA1 B;  3T1H I;  1N33 E;  3ZZ0 A;  2PNZ B;  5FWK A;  4DV2 I;  1S4E A;  1J5E E;  4BA2 B;  3J81 Q;  3KRN A;  3PS2 A;  5C0X C;  1XXE A;  2WP8 B;  3LNU A;  4X66 I;  3WU3 A;  4LFB E;  3P76 A;  2JE6 A;  3PS1 A;  2PNM A;  3J81 C;  4DV3 I;  5BR8 I;  5K36 A;  1Y4S A;  2CZ9 A;  4IS9 A;  4JV5 E;  3CDJ A;  4NBQ A;  4OO1 C;  1IBK E;  4X62 I;  4P7A A;  2Z5C A;  1B62 A;  4JI0 I;  3HKM A;  3Q6M A;  4DR5 E;  4DU7 A;  1N0V C;  1YHC A;  2DEJ A;  4JI1 I;  4DV6 E;  2CVE A;  3P3C A;  1H72 C;  3ZM7 A;  4KHP E;  2JEA A;  1Z0C A;  2UUA I;  1EI1 A;  4DV4 I;  4RPF A;  5C0X A;  4OX9 I;  2UUB I;  4DR6 I;  4FN5 A;  1FWL A;  2X7I A;  2NN6 A; 
#chains in the Genus database with same CATH homology
 2PNL A;  5IWA I;  5FLX Q;  3T1Y E;  4GKK I;  4DXL A;  2CG9 A;  2AJ4 A;  2Z5E A;  1H7U A;  3ZKB A;  4HXZ A;  3B82 A;  2XEX A;  4JI5 E;  4IZK A;  4LF7 E;  4DR4 I;  4LFA E;  4DV0 E;  3HUL A;  4LF4 E;  1B63 A;  4NXN I;  4DPT A;  2V2Z A;  3WU6 A;  1IBL I;  4JI2 E;  4GKJ I;  5LMU I;  3PYG A;  4IZJ D;  3CWV A;  1XNQ I;  4X64 I;  4B3R E;  3QT6 A;  2WW4 A;  1MX0 A;  1Z5B A;  3J80 Q;  4DR3 E;  2V34 A;  4LF8 I;  4NXM E;  2VQE E;  4HYM A;  2ZM6 E;  4DUY E;  2UXD E;  1EA6 A;  3J80 C;  1NHH A;  1ZM9 A;  4JI6 E;  1FJG E;  1PVG A;  4USK A;  4IZJ B;  1KTV A;  4HAC B;  1I94 E;  1ZM3 A;  1N0U A;  2UU9 I;  2HKJ A;  1N34 E;  2BV3 A;  2A2C A;  4FWG A;  1ZM2 A;  4FWD A;  2UXB I;  3Q1Q A;  1FWK A;  2VF3 A;  4FW9 A;  1Y4U A;  4K0K E;  4LF9 E;  1N33 I;  2BM1 A;  1H7S A;  1HNZ E;  1WUU A;  3PYE A;  2HHH E;  4JI3 E;  1J5E I;  4R1F A;  1HR0 E;  4LFB I;  4UT4 A;  1RR9 A;  3OTO E;  1QZR A;  4PRX A;  4PRV A;  2IOP A;  1USV A;  2O1V A;  2E5L E;  4JV5 I;  4ZVI A;  1N36 E;  2V8P A;  4DR1 E;  1IBK I;  3QT5 A;  1MU5 A;  2Z5B A;  5LL6 R;  4DR5 I;  1Z59 A;  4DV6 I;  3LPS A;  4KHP I;  4PU9 A;  4JI8 E;  2R42 A;  4EMD A;  4DR7 E;  1ZXM A;  2Z5C B;  2UXC E;  2VQF E;  3T1Y I;  3B8H A;  3M6A A;  2HK2 A;  3PRY A;  4WUB A;  2R3V A;  1KIJ A;  1XMO E;  2LJP A;  4ED4 A;  4JI5 I;  2ZIT A;  4LF7 I;  4LFA I;  4JG4 A;  5FLX C;  3K85 A;  4DV0 I;  3K17 A;  4JYA E;  3D4J A;  3V2U C;  4LF4 I;  4DPX A;  5GME A;  3J7A M;  1Z5A A;  4JI2 I;  3V5R A;  4B3T E;  1XNR E;  1D6T A;  2ZBK B;  4DV5 E;  1U2R A;  4DPU A;  2OI2 A;  4IZK B;  2IOQ A;  1N32 E;  4B3R I;  1UEK A;  4MYT A;  2X36 A;  2O1T A;  4B3S E;  1FI4 A;  4DR3 I;  3QT8 A;  4NXM I;  2VQE I;  2ZM6 I;  4JI4 E;  4DUY I;  2UXD I;  3K1J A;  2HK3 A;  2CGE A;  3PYF A;  4JI6 I;  1FJG I;  4Z7C A;  4MYU A;  4DV7 E;  5L3J A;  1I94 I;  1HNX E;  4DV1 E;  1N34 I;  4DUZ E;  5LMN E;  1H73 A;  4JI7 E;  1DAR A;  4DR2 E;  4YY3 E;  4X65 E;  4K0K I;  4LF9 I;  5GMD A;  1S16 A;  4B3M E;  1Z0G A;  4USM A;  3PYD A;  2UUC E;  4LF5 E;  1HNZ I;  2HHH I;  4JI3 I;  1HNW E;  4DPW A;  2HFS A;  2V2V A;  1HR0 I;  3OTO I;  4N3O A;  2F4V E;  1IBM E;  4HY1 A;  2E5L I;  4YHH E;  1N36 I;  2J7K A;  4DR1 I;  2EFG A;  3JAM Q;  4LF6 E;  1Z5C A;  4Z7Y A;  4LFC E;  3B78 A;  4M1K A;  1K47 A;  1KKH A;  3JAM C;  2O1U A;  4JI8 I;  4AQY E;  1Z0B A;  2BM0 A;  1XMQ E;  3J7A G;  4DR7 I;  3Q6N A;  3WU5 A;  2V2Q A;  1Z0T A;  1ZXN A;  3H4L A;  5A2Q Q;  2UXC I;  2Z5B B;  2VQF I;  4UTG A;  2NPF A;  3T1H E;  5A2Q C;  4DV2 E;  1XMO I;  2GQ0 A;  3P06 A;  4DU8 A;  1NHJ A;  1MG7 A;  4X66 E;  4JYA I;  4DV3 E;  5BR8 E;  2HKE A;  2Q2E B;  1ZM4 A;  4XTJ A;  1Y6Z A;  4B3T I;  1XNR I;  4DV5 I;  4X62 E;  4JI0 E;  5IT9 Q;  1ELO A;  4P52 A;  1N32 I;  4JI1 E;  2E1R A;  5IT9 C;  4B3S I;  1PKP A;  4KQV A;  1FKA E;  2UUA E;  1HK7 A;  1NHI A;  3ZZU A;  4I3H A;  4JI4 I;  4FWH A;  4DV4 E;  4OX9 E;  4DR6 E;  2UUB E;  3WU4 A;  5IWA E;  1RRE A;  4GKK E;  1OJ4 A;  4DV7 I;  2A2D A;  1BKN A;  1HNX I;  3LTO A;  4DV1 I;  4DUZ I;  5LMN I;  3HJC A;  4JI7 I;  4DR4 E;  3QT7 A;  4DR2 I;  4YY3 I;  1XHK A;  3GON A;  2GS8 A;  4DPY A;  4NXN E;  1IBL E;  4GKJ E;  1A6F A;  4X65 I;  1USU A;  4B3M I;  5LMU E;  2UUC I;  4LF5 I;  1XNQ E;  4X64 E;  1Z0W A;  2O1W A;  1HNW I;  4IZJ A;  4HAC A;  4LF8 E;  1Z0E A;  2F4V I;  1IBM I;  2DEI A;  3F0N A;  1H74 A;  4YHH I;  1PIE A;  3ZZT A;  1NZ0 A;  4URL A;  1VIS A;  4LF6 I;  2UU9 E;  4LFC I;  2HFU A;  4WUD A;  4AQY I;  1XMQ I;  1FNM A;  2UXB E;  4WUC A;  3ZKD A;  1Z0V A;  1KVK A;  3T1H I;  1N33 E;  3ZZ0 A;  5FWK A;  4DV2 I;  1S4E A;  1J5E E;  3J81 Q;  3LNU A;  4X66 I;  3WU3 A;  4LFB E;  2PNM A;  3J81 C;  4DV3 I;  5BR8 I;  1Y4S A;  2CZ9 A;  4JV5 E;  1IBK E;  4X62 I;  4P7A A;  2Z5C A;  1B62 A;  4JI0 I;  3Q6M A;  4DR5 E;  4DU7 A;  1N0V C;  2DEJ A;  4JI1 I;  4DV6 E;  1H72 C;  3ZM7 A;  4KHP E;  1Z0C A;  2UUA I;  1EI1 A;  4DV4 I;  4RPF A;  4OX9 I;  4DR6 I;  2UUB I;  4FN5 A;  1FWL A;  2X7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...