1Z0TA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative protease La homolog type
publication title Pathological crystallography: case studies of several unusual macromolecular crystals.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 52
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0tA00
1WUUA 4LF6E 5LMNI 1QZRA 2E1RA 2F4VI 4JI5E 4JI7I 4X65I 2ZBKB 1S4EA 1NHIA 2J7KA 4X64E 4LF4E 2V8PA 1PIEA 1KTVA 4XTJA 4GKJE 4WUDA 4GKKE 4DV1I 4LFBI 4B3TI 1ZM2A 3J7AG 4DV4E 2ZM6I 4LF8I 1XMQE 2EFGA 4JI4I 4Z7YA 4AQYI 1K47A 4DV2I 1XNRI 4UTGA 3OTOE 2HFUA 2A2CA 3T1YI 4DPUA 1IBME 1FWLA 2UU9I 4OX9E 4K0KE 3WU6A 1HNXE 1XMOI 4LF7I 4WUBA 4USKA 4LF5I 4NXNE 1ZXMA 1N32E 2UXDE 4JI0I 3T1HI 1J5EE 1MG7A 3H4LA 1Z0GA 4KHPI 4JV5I 4B3SI 4PU9A 3B8HA 3WU3A 4P52A 4DXLA 2BV3A 3F0NA 5BR8E 4DV5E 1N33I 4JI3I 4DV6I 4DR1E 2ZITA 4B3RE 2VQEI 3J7AM 2UUAI 4DV0I 2UXCE 2VQFI 1N36I 5IWAE 3QT7A 4JG4A 1IBLE 4LFAE 1D6TA 5L3JA 4DUYE 2HKJA 4LF9E 4DV3I 1IBKI 4DR7E 5IT9Q 4DU8A 2HHHI 2XEXA 1ZM3A 4Z7CA 4YHHE 5GMDA 1HR0E 1MX0A 3LPSA 4JI6E 1FWKA 1HNWI 2VF3A 4DUZE 4HACB 3V5RA 5A2QQ 3PYEA 4YY3I 1FI4A 4B3MI 4JYAE 1B62A 1NHJA 2UUCE 2UXBI 3D4JA 3K1JA 5IT9C 1OJ4A 5LMUE 4JI8I 1S16A 4MYTA 2E5LE 1Z5AA 4DPYA 2UUBE 4EMDA 4LF6I 4X66E 4JI5I 3ZKDA 1H73A 4MYUA 5A2QC 1XNQE 1U2RA 3ZZUA 4JI1I 4X64I 4DV7E 1RREA 3LTOA 4LF4I 1Z0EA 1H74A 3WU4A 4GKJI 4GKKI 4FWDA 4RPFA 4DR4E 1Z0VA 3ZKBA 4DV4I 2LJPA 3V2UC 1XMQI 4LFCE 1KIJA 4HACA 4JV5E 3M6AA 1PVGA 4DR6E 2NPFA 4NXME 4DR3E 3OTOI 2DEJA 1IBMI 1FNMA 1FKAE 1HNZE 4X62E 4DR2E 2R3VA 1FJGE 2HK3A 4ZVIA 5LL6R 4K0KI 1N33E 1EI1A 1ZM4A 1HNXI 4HY1A 4FW9A 1I94E 3PYDA 4R1FA 4FN5A 1XHKA 4NXNI 2R42A 1N32I 2UXDI 5FLXQ 1EA6A 1J5EI 2Q2EB 4ED4A 4JI2E 1Z0WA 1ELOA 2WW4A 4DR5E 4DU7A 1N34E 1KVKA 3J80Q 1H72C 2BM1A 1NHHA 5LMNE 3PYGA 5BR8I 2F4VE 4DV5I 4JI7E 4X65E 1N0UA 4P7AA 4DR1I 4B3RI 5FLXC 2OI2A 2UXCI 3CWVA 2A2DA 1DARA 2HKEA 5IWAI 1IBLI 4LFAI 3J80C 1MU5A 4DV1E 1Z0BA 4LFBE 4B3TE 2HFSA 4LF9I 2ZM6E 4LF8E 1Z5CA 4DR7I 4JI4E 1BKNA 4AQYE 3Q1QA 3ZM7A 4DV2E 3B82A 1XNRE 3T1YE 4FWGA 2UU9E 1Z0TA 4URLA 4YHHI 2DEIA 4JI1E 3JAMQ 4WUCA 1XMOE 1HR0I 4LF7E 4JI6I 1ZXNA 4DUZI 4LF5E 1B63A 3HULA 2GS8A 1VISA 4DPXA 4JI0E 4JYAI 3T1HE 2UUCI 5LMUI 4PRXA 2E5LI 2V2VA 2HK2A 2UUBI 2V2QA 4KHPE 1H7SA 3JAMC 4X66I 4B3SE 1Z0CA 4HYMA 1ZM9A 1PKPA 4DPWA 3J81Q 4DPTA 4OX9I 1XNQI 4JI3E 4DV7I 4DV6E 4USMA 2VQEE 4UT4A 1KKHA 3ZZ0A 2UUAE 2V2ZA 4DV0E 3GONA 3QT8A 2VQFE 4DR4I 4M1KA 1N36E 3K17A 4KQVA 3QT6A 4LFCI 5GMEA 4DR6I 3QT5A 4NXMI 4DR3I 2AJ4A 4DV3E 3J81C 3WU5A 4X62I 4DR2I 1IBKE 1HNZI 1FJGI 2HHHE 3PYFA 2BM0A 2V34A 1I94I 1H7UA 1HNWE 1RR9A 1UEKA 1Z59A 1NZ0A 2CZ9A 2X7IA 4YY3E 4FWHA 4JI2I 4PRVA 3ZZTA 4B3ME 2UXBE 4HXZA 4JI8E 1N0VC 3B78A 4DR5I 1N34I 1Z5BA 4I3HA 2X36A 4DUYI 1A6FA 3LNUA
chains in the Genus database with same CATH superfamily
1WUUA 4LF6E 5LMNI 1QZRA 2E1RA 2F4VI 4JI5E 4QNJA 4JI7I 4X65I 2ZBKB 3M7NG 1S4EA 4OZEA 4OO1E 1NHIA 1RHYA 2J7KA 4X64E 4IS9A 4LF4E 2V8PA 1PIEA 1KTVA 2BA1D 4XTJA 4MU3A 4GKJE 4WUDA 3GCMA 3PS2A 4GKKE 4DV1I 4LFBI 5K36C 3M85D 4B3TI 1ZM2A 3J7AG 3U1KA 4DV4E 2ZM6I 4LF8I 1XMQE 2EFGA 5DRQA 4JI4I 4Z7YA 4AQYI 1K47A 4DV2I 2WNRB 1XNRI 4UTGA 5JEAF 3OTOE 2HFUA 2A2CA 2CVEA 5C0XE 4DPUA 3T1YI 1IBME 1FWLA 2UU9I 1UDNA 4MU4A 4OX9E 4K0KE 4OKGA 3WU6A 2O1WA 5JEAA 1HNXE 1XMOI 1Y4UA 4BA2B 1OYSA 4LF7I 2O3ZA 2C38A 2PO1A 1HK7A 4WUBA 4USKA 2BR2B 4LF5I 4NXNE 1ZXMA 3H1CA 1N32E 2UXDE 3Q6MA 2BA0G 4JI0I 3T1HI 2Z5CB 1J5EE 3PS3A 4IZJB 1MG7A 3H4LA 3PS1A 1Z0GA 5JEAD 4KHPI 4JV5I 4B3SI 4PU9A 4FW5A 3B8HA 3WU3A 4P52A 4DXLA 4LCHA 2BV3A 3PRYA 3F0NA 5BR8E 2NN6F 4DV5E 1N33I 4JI3I 4DV6I 4DR1E 2ZITA 4B3RE 2VQEI 3J7AM 2WNRA 2NN6C 2UUAI 5K36B 4QNKA 4DV0I 2UXCE 2VQFI 4ISAA 2GO3A 1N36I 3P06A 5IWAE 4N3OA 3QT7A 4JG4A 4BA2A 1IBLE 4LFAE 1OYPA 2BR2A 1D6TA 5L3JA 1XXEA 4DUYE 2HKJA 4LF9E 4DV3I 2VESA 4AIMA 2GO4A 1IBKI 4DR7E 5IT9Q 4DU8A 4AIDA 2HHHI 2Z5CA 3P3EA 2NN6D 2XEXA 2PNZB 1ZM3A 2O1UA 2F1DA 4IZJA 4Z7CA 1Y4SA 4YHHE 5GMDA 4MU0A 1HR0E 1MX0A 3LPSA 4JI6E 1FWKA 1HNWI 2VF3A 4DUZE 4HACB 3V5RA 3Q6NA 2GQ0A 5A2QQ 3PYEA 4YY3I 4LPFA 1E3HA 1FI4A 5K36F 4B3MI 4JYAE 4AM3A 1B62A 1NHJA 2UUCE 2UXBI 3D4JA 3K1JA 1VI7A 1OJ4A 5IT9C 5LMUE 4JI8I 1S16A 1R6LA 4MYTA 5K36A 4IZJD 2E5LE 1Z5AA 3HKMA 4DPYA 2UUBE 4EMDA 1UDQA 4LF6I 4X66E 4U3DA 4JI5I 3K85A 3ZKDA 1H73A 2NN6B 4MYUA 5A2QC 1XNQE 1U2RA 3ZZUA 4JI1I 4X64I 1Y60A 4DV7E 1RREA 2Z5BB 3LTOA 4LF4I 1Z0EA 1H74A 2PNZA 3WU4A 4GKJI 3CDIA 5K36D 4IFDF 4GKKI 1OYRA 4FWDA 4RPFA 4DR4E 2JT2A 2Z5EA 1Z0VA 3ZKBA 4DV4I 2LJPA 3V2UC 4IFDC 2PNMA 1XMQI 4LFCE 1KIJA 4HACA 4JV5E 3M7ND 3M6AA 1PVGA 4DR6E 2NPFA 4NXME 4DR3E 1R6MA 5ELWA 3OTOI 2DEJA 1IBMI 1FNMA 1FKAE 1HNZE 4X62E 4DR2E 2R3VA 1FJGE 2HK3A 3GMEA 4ZVIA 5LL6R 4K0KI 1N33E 1EI1A 1ZM4A 4OO1C 1HNXI 4HY1A 4FW9A 2JEBB 4MDTA 1I94E 3PYDA 1YH8A 4R1FA 4FN5A 1XHKA 4NXNI 2R42A 4IFDD 3P3CA 4IZKB 5DNLA 1N32I 2UXDI 2NN6A 1USVA 5FLXQ 1EA6A 1J5EI 4FW4A 2Q2EB 4ED4A 4JI2E 3UHMA 2C37B 1Z0WA 2Z5BA 1ELOA 2WW4A 5K36E 3P3GA 1P42A 5C0XC 4DR5E 2BA1G 4DU7A 1KVKA 1N34E 3J80Q 1H72C 2BM1A 2PO0B 3M85G 1NHHA 5LMNE 3PYGA 5BR8I 2F4VE 4DV5I 4JI7E 5DRPA 4X65E 1N0UA 4P7AA 1USUA 4DR1I 4B3RI 5FLXC 5JEAE 3P76A 2IESA 2OI2A 2IERA 2WP8B 2UXCI 3L7ZB 3CWVA 4IFDB 2A2DA 5EL9A 3NZKA 1DARA 2HKEA 5IWAI 2JEBA 2CGEA 1IBLI 4LFAI 2AE8A 3J80C 1UDOA 1MU5A 5DRRA 1Z0BA 4DV1E 2JEAB 4LFBE 4B3TE 2HFSA 2O1TA 1Y6ZA 4IZKA 4LF9I 3KRNA 2ZM6E 4LF8E 1Z5CA 4OO1B 4DR7I 4JI4E 1BKNA 4AQYE 3Q1QA 4LOMA 4LCGA 5FWKA 3ZM7A 4DV2E 3B82A 2IOPA 4NBQA 1XNRE 2PO2B 3T1YE 2C37A 4FWGA 2UU9E 1Z0TA 4URLA 1Y5YA 4YHHI 2DEIA 1UDSA 3JAMQ 4JI1E 4WUCA 5EKWA 1XMOE 3DD6A 1HR0I 5DNXA 4LF7E 4JI6I 1ZXNA 4DUZI 2PO0A 2J65A 4LF5E 5DROA 1B63A 2JE6B 3HULA 2GS8A 2NN6E 1VISA 4DPXA 4JI0E 5C0XB 2C39B 4JYAI 2IOQA 3T1HE 2UUCI 5LMUI 2WP8A 3GLLA 4PRXA 2E5LI 2V2VA 2HK2A 3L7ZA 4IFDA 2UUBI 2V2QA 4KHPE 2O1VA 1H7SA 3JAMC 4X66I 4B3SE 5JEAC 1Z0CA 4J3DA 4HYMA 3HJCA 2JEAA 1ZM9A 1PKPA 4DPWA 1YHCA 4OO1F 3J81Q 4DPTA 4OX9I 4BA1B 1XNQI 4JI3E 4OO1A 4DV7I 4DV6E 4USMA 2VQEE 4UT4A 1KKHA 2PO2A 3ZZ0A 2UUAE 4FW6A 2V2ZA 4DV0E 3GONA 3QT8A 2VQFE 4DR4I 4M1KA 1N36E 3K17A 4KQVA 3QT6A 4LFCI 4MQYA 5GMEA 4DR6I 3QT5A 4NXMI 2JE6A 5C0XF 4DR3I 2AJ4A 4DV3E 3J81C 2PNLA 3WU5A 4X62I 4DR2I 5C0XA 1IBKE 1HNZI 4OO1D 2C39A 1FJGI 2HHHE 4U3BA 3PYFA 2BM0A 2V34A 4FW3A 1I94I 1H7UA 2BA0D 3CDJA 1E3PA 3B4TA 1HNWE 1RR9A 4GQUA 1UEKA 1Z59A 4MU1A 3U1YA 1NZ0A 2CZ9A 2X7IA 4YY3E 4FW7A 4BA1A 4FWHA 4LCFA 4JI2I 4PRVA 3ZZTA 5C0XD 4B3ME 2UXBE 4HXZA 2CG9A 5JEAB 4JI8E 1N0VC 3B78A 4DR5I 1N34I 1Z5BA 4I3HA 4IFDE 2X36A 4DUYI 2C38B 2PO1B 1A6FA 3LNUA
chains in the Genus database with same CATH topology
1WUUA 4LF6E 5LMNI 1QZRA 2E1RA 2F4VI 4JI5E 4JI7I 4X65I 2ZBKB 1S4EA 1NHIA 2J7KA 4X64E 4LF4E 2V8PA 1PIEA 1KTVA 4XTJA 4GKJE 4WUDA 4GKKE 4DV1I 4LFBI 4B3TI 1ZM2A 3J7AG 4DV4E 2ZM6I 4LF8I 1XMQE 2EFGA 4JI4I 4Z7YA 4AQYI 1K47A 4DV2I 1XNRI 4UTGA 3OTOE 2HFUA 2A2CA 3T1YI 4DPUA 1IBME 1FWLA 2UU9I 4OX9E 4K0KE 3WU6A 2O1WA 1HNXE 1XMOI 1Y4UA 4LF7I 1HK7A 4WUBA 4USKA 4LF5I 4NXNE 1ZXMA 1N32E 2UXDE 3Q6MA 4JI0I 3T1HI 2Z5CB 1J5EE 4IZJB 1MG7A 3H4LA 1Z0GA 4KHPI 4JV5I 4B3SI 4PU9A 3B8HA 3WU3A 4P52A 4DXLA 2BV3A 3PRYA 3F0NA 5BR8E 4DV5E 1N33I 4JI3I 4DV6I 4DR1E 2ZITA 4B3RE 2VQEI 3J7AM 2UUAI 4DV0I 2UXCE 2VQFI 1N36I 3P06A 5IWAE 4N3OA 3QT7A 4JG4A 1IBLE 4LFAE 1D6TA 5L3JA 4DUYE 2HKJA 4LF9E 4DV3I 1IBKI 4DR7E 5IT9Q 4DU8A 2HHHI 2Z5CA 2XEXA 1ZM3A 2O1UA 4IZJA 4Z7CA 1Y4SA 4YHHE 5GMDA 1HR0E 1MX0A 3LPSA 4JI6E 1FWKA 1HNWI 2VF3A 4DUZE 4HACB 3V5RA 3Q6NA 2GQ0A 5A2QQ 3PYEA 4YY3I 1FI4A 4B3MI 4JYAE 1B62A 1NHJA 2UUCE 2UXBI 3D4JA 3K1JA 5IT9C 1OJ4A 5LMUE 4JI8I 1S16A 4MYTA 4IZJD 2E5LE 1Z5AA 4DPYA 2UUBE 4EMDA 4LF6I 4X66E 4JI5I 3K85A 3ZKDA 1H73A 4MYUA 5A2QC 1XNQE 1U2RA 3ZZUA 4JI1I 4X64I 4DV7E 1RREA 2Z5BB 3LTOA 4LF4I 1Z0EA 1H74A 3WU4A 4GKJI 4GKKI 4FWDA 4RPFA 4DR4E 2Z5EA 1Z0VA 3ZKBA 4DV4I 2LJPA 3V2UC 2PNMA 1XMQI 4LFCE 1KIJA 4HACA 4JV5E 3M6AA 1PVGA 4DR6E 2NPFA 4NXME 4DR3E 3OTOI 2DEJA 1IBMI 1FNMA 1FKAE 1HNZE 4X62E 4DR2E 2R3VA 1FJGE 2HK3A 4ZVIA 5LL6R 4K0KI 1N33E 1EI1A 1ZM4A 1HNXI 4HY1A 4FW9A 1I94E 3PYDA 4R1FA 4FN5A 1XHKA 4NXNI 2R42A 4IZKB 1N32I 2UXDI 1USVA 5FLXQ 1EA6A 1J5EI 2Q2EB 4ED4A 4JI2E 1Z0WA 2Z5BA 1ELOA 2WW4A 4DR5E 4DU7A 1N34E 1KVKA 3J80Q 1H72C 2BM1A 1NHHA 5LMNE 3PYGA 5BR8I 2F4VE 4DV5I 4JI7E 4X65E 1N0UA 4P7AA 1USUA 4DR1I 4B3RI 5FLXC 2OI2A 2UXCI 3CWVA 2A2DA 1DARA 2HKEA 5IWAI 2CGEA 1IBLI 4LFAI 3J80C 1MU5A 4DV1E 1Z0BA 4LFBE 4B3TE 2HFSA 2O1TA 1Y6ZA 4IZKA 4LF9I 2ZM6E 4LF8E 1Z5CA 4DR7I 4JI4E 1BKNA 4AQYE 3Q1QA 5FWKA 3ZM7A 4DV2E 3B82A 2IOPA 1XNRE 3T1YE 4FWGA 2UU9E 1Z0TA 4URLA 4YHHI 2DEIA 4JI1E 3JAMQ 4WUCA 1XMOE 1HR0I 4LF7E 4JI6I 1ZXNA 4DUZI 4LF5E 1B63A 3HULA 2GS8A 1VISA 4DPXA 4JI0E 4JYAI 2IOQA 3T1HE 2UUCI 5LMUI 4PRXA 2E5LI 2V2VA 2HK2A 2UUBI 2V2QA 4KHPE 2O1VA 1H7SA 3JAMC 4X66I 4B3SE 1Z0CA 4HYMA 3HJCA 1ZM9A 1PKPA 4DPWA 3J81Q 4DPTA 4OX9I 1XNQI 4JI3E 4DV7I 4DV6E 4USMA 2VQEE 4UT4A 1KKHA 3ZZ0A 2UUAE 2V2ZA 4DV0E 3GONA 3QT8A 2VQFE 4DR4I 4M1KA 1N36E 3K17A 4KQVA 3QT6A 4LFCI 5GMEA 4DR6I 3QT5A 4NXMI 4DR3I 2AJ4A 4DV3E 3J81C 2PNLA 3WU5A 4X62I 4DR2I 1IBKE 1HNZI 1FJGI 2HHHE 3PYFA 2BM0A 2V34A 1I94I 1H7UA 1HNWE 1RR9A 1UEKA 1Z59A 1NZ0A 2CZ9A 2X7IA 4YY3E 4FWHA 4JI2I 4PRVA 3ZZTA 4B3ME 2UXBE 4HXZA 2CG9A 4JI8E 1N0VC 3B78A 4DR5I 1N34I 1Z5BA 4I3HA 2X36A 4DUYI 1A6FA 3LNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUU A;  4LF6 E;  5LMN I;  1QZR A;  2E1R A;  2F4V I;  4JI5 E;  4JI7 I;  4X65 I;  2ZBK B;  1S4E A;  1NHI A;  2J7K A;  4X64 E;  4LF4 E;  2V8P A;  1PIE A;  1KTV A;  4XTJ A;  4GKJ E;  4WUD A;  4GKK E;  4DV1 I;  4LFB I;  4B3T I;  1ZM2 A;  3J7A G;  4DV4 E;  2ZM6 I;  4LF8 I;  1XMQ E;  2EFG A;  4JI4 I;  4Z7Y A;  4AQY I;  1K47 A;  4DV2 I;  1XNR I;  4UTG A;  3OTO E;  2HFU A;  2A2C A;  3T1Y I;  4DPU A;  1IBM E;  1FWL A;  2UU9 I;  4OX9 E;  4K0K E;  3WU6 A;  1HNX E;  1XMO I;  4LF7 I;  4WUB A;  4USK A;  4LF5 I;  4NXN E;  1ZXM A;  1N32 E;  2UXD E;  4JI0 I;  3T1H I;  1J5E E;  1MG7 A;  3H4L A;  1Z0G A;  4KHP I;  4JV5 I;  4B3S I;  4PU9 A;  3B8H A;  3WU3 A;  4P52 A;  4DXL A;  2BV3 A;  3F0N A;  5BR8 E;  4DV5 E;  1N33 I;  4JI3 I;  4DV6 I;  4DR1 E;  2ZIT A;  4B3R E;  2VQE I;  3J7A M;  2UUA I;  4DV0 I;  2UXC E;  2VQF I;  1N36 I;  5IWA E;  3QT7 A;  4JG4 A;  1IBL E;  4LFA E;  1D6T A;  5L3J A;  4DUY E;  2HKJ A;  4LF9 E;  4DV3 I;  1IBK I;  4DR7 E;  5IT9 Q;  4DU8 A;  2HHH I;  2XEX A;  1ZM3 A;  4Z7C A;  4YHH E;  5GMD A;  1HR0 E;  1MX0 A;  3LPS A;  4JI6 E;  1FWK A;  1HNW I;  2VF3 A;  4DUZ E;  4HAC B;  3V5R A;  5A2Q Q;  3PYE A;  4YY3 I;  1FI4 A;  4B3M I;  4JYA E;  1B62 A;  1NHJ A;  2UUC E;  2UXB I;  3D4J A;  3K1J A;  5IT9 C;  1OJ4 A;  5LMU E;  4JI8 I;  1S16 A;  4MYT A;  2E5L E;  1Z5A A;  4DPY A;  2UUB E;  4EMD A;  4LF6 I;  4X66 E;  4JI5 I;  3ZKD A;  1H73 A;  4MYU A;  5A2Q C;  1XNQ E;  1U2R A;  3ZZU A;  4JI1 I;  4X64 I;  4DV7 E;  1RRE A;  3LTO A;  4LF4 I;  1Z0E A;  1H74 A;  3WU4 A;  4GKJ I;  4GKK I;  4FWD A;  4RPF A;  4DR4 E;  1Z0V A;  3ZKB A;  4DV4 I;  2LJP A;  3V2U C;  1XMQ I;  4LFC E;  1KIJ A;  4HAC A;  4JV5 E;  3M6A A;  1PVG A;  4DR6 E;  2NPF A;  4NXM E;  4DR3 E;  3OTO I;  2DEJ A;  1IBM I;  1FNM A;  1FKA E;  1HNZ E;  4X62 E;  4DR2 E;  2R3V A;  1FJG E;  2HK3 A;  4ZVI A;  5LL6 R;  4K0K I;  1N33 E;  1EI1 A;  1ZM4 A;  1HNX I;  4HY1 A;  4FW9 A;  1I94 E;  3PYD A;  4R1F A;  4FN5 A;  1XHK A;  4NXN I;  2R42 A;  1N32 I;  2UXD I;  5FLX Q;  1EA6 A;  1J5E I;  2Q2E B;  4ED4 A;  4JI2 E;  1Z0W A;  1ELO A;  2WW4 A;  4DR5 E;  4DU7 A;  1N34 E;  1KVK A;  3J80 Q;  1H72 C;  2BM1 A;  1NHH A;  5LMN E;  3PYG A;  5BR8 I;  2F4V E;  4DV5 I;  4JI7 E;  4X65 E;  1N0U A;  4P7A A;  4DR1 I;  4B3R I;  5FLX C;  2OI2 A;  2UXC I;  3CWV A;  2A2D A;  1DAR A;  2HKE A;  5IWA I;  1IBL I;  4LFA I;  3J80 C;  1MU5 A;  4DV1 E;  1Z0B A;  4LFB E;  4B3T E;  2HFS A;  4LF9 I;  2ZM6 E;  4LF8 E;  1Z5C A;  4DR7 I;  4JI4 E;  1BKN A;  4AQY E;  3Q1Q A;  3ZM7 A;  4DV2 E;  3B82 A;  1XNR E;  3T1Y E;  4FWG A;  2UU9 E;  1Z0T A;  4URL A;  4YHH I;  2DEI A;  4JI1 E;  3JAM Q;  4WUC A;  1XMO E;  1HR0 I;  4LF7 E;  4JI6 I;  1ZXN A;  4DUZ I;  4LF5 E;  1B63 A;  3HUL A;  2GS8 A;  1VIS A;  4DPX A;  4JI0 E;  4JYA I;  3T1H E;  2UUC I;  5LMU I;  4PRX A;  2E5L I;  2V2V A;  2HK2 A;  2UUB I;  2V2Q A;  4KHP E;  1H7S A;  3JAM C;  4X66 I;  4B3S E;  1Z0C A;  4HYM A;  1ZM9 A;  1PKP A;  4DPW A;  3J81 Q;  4DPT A;  4OX9 I;  1XNQ I;  4JI3 E;  4DV7 I;  4DV6 E;  4USM A;  2VQE E;  4UT4 A;  1KKH A;  3ZZ0 A;  2UUA E;  2V2Z A;  4DV0 E;  3GON A;  3QT8 A;  2VQF E;  4DR4 I;  4M1K A;  1N36 E;  3K17 A;  4KQV A;  3QT6 A;  4LFC I;  5GME A;  4DR6 I;  3QT5 A;  4NXM I;  4DR3 I;  2AJ4 A;  4DV3 E;  3J81 C;  3WU5 A;  4X62 I;  4DR2 I;  1IBK E;  1HNZ I;  1FJG I;  2HHH E;  3PYF A;  2BM0 A;  2V34 A;  1I94 I;  1H7U A;  1HNW E;  1RR9 A;  1UEK A;  1Z59 A;  1NZ0 A;  2CZ9 A;  2X7I A;  4YY3 E;  4FWH A;  4JI2 I;  4PRV A;  3ZZT A;  4B3M E;  2UXB E;  4HXZ A;  4JI8 E;  1N0V C;  3B78 A;  4DR5 I;  1N34 I;  1Z5B A;  4I3H A;  2X36 A;  4DUY I;  1A6F A;  3LNU A; 
#chains in the Genus database with same CATH topology
 1WUU A;  4LF6 E;  5LMN I;  1QZR A;  2E1R A;  2F4V I;  4JI5 E;  4QNJ A;  4JI7 I;  4X65 I;  2ZBK B;  3M7N G;  1S4E A;  4OZE A;  4OO1 E;  1NHI A;  1RHY A;  2J7K A;  4X64 E;  4IS9 A;  4LF4 E;  2V8P A;  1PIE A;  1KTV A;  2BA1 D;  4XTJ A;  4MU3 A;  4GKJ E;  4WUD A;  3GCM A;  3PS2 A;  4GKK E;  4DV1 I;  4LFB I;  5K36 C;  3M85 D;  4B3T I;  1ZM2 A;  3J7A G;  3U1K A;  4DV4 E;  2ZM6 I;  4LF8 I;  1XMQ E;  2EFG A;  5DRQ A;  4JI4 I;  4Z7Y A;  4AQY I;  1K47 A;  4DV2 I;  2WNR B;  1XNR I;  4UTG A;  5JEA F;  3OTO E;  2HFU A;  2A2C A;  2CVE A;  5C0X E;  4DPU A;  3T1Y I;  1IBM E;  1FWL A;  2UU9 I;  1UDN A;  4MU4 A;  4OX9 E;  4K0K E;  4OKG A;  3WU6 A;  2O1W A;  5JEA A;  1HNX E;  1XMO I;  1Y4U A;  4BA2 B;  1OYS A;  4LF7 I;  2O3Z A;  2C38 A;  2PO1 A;  1HK7 A;  4WUB A;  4USK A;  2BR2 B;  4LF5 I;  4NXN E;  1ZXM A;  3H1C A;  1N32 E;  2UXD E;  3Q6M A;  2BA0 G;  4JI0 I;  3T1H I;  2Z5C B;  1J5E E;  3PS3 A;  4IZJ B;  1MG7 A;  3H4L A;  3PS1 A;  1Z0G A;  5JEA D;  4KHP I;  4JV5 I;  4B3S I;  4PU9 A;  4FW5 A;  3B8H A;  3WU3 A;  4P52 A;  4DXL A;  4LCH A;  2BV3 A;  3PRY A;  3F0N A;  5BR8 E;  2NN6 F;  4DV5 E;  1N33 I;  4JI3 I;  4DV6 I;  4DR1 E;  2ZIT A;  4B3R E;  2VQE I;  3J7A M;  2WNR A;  2NN6 C;  2UUA I;  5K36 B;  4QNK A;  4DV0 I;  2UXC E;  2VQF I;  4ISA A;  2GO3 A;  1N36 I;  3P06 A;  5IWA E;  4N3O A;  3QT7 A;  4JG4 A;  4BA2 A;  1IBL E;  4LFA E;  1OYP A;  2BR2 A;  1D6T A;  5L3J A;  1XXE A;  4DUY E;  2HKJ A;  4LF9 E;  4DV3 I;  2VES A;  4AIM A;  2GO4 A;  1IBK I;  4DR7 E;  5IT9 Q;  4DU8 A;  4AID A;  2HHH I;  2Z5C A;  3P3E A;  2NN6 D;  2XEX A;  2PNZ B;  1ZM3 A;  2O1U A;  2F1D A;  4IZJ A;  4Z7C A;  1Y4S A;  4YHH E;  5GMD A;  4MU0 A;  1HR0 E;  1MX0 A;  3LPS A;  4JI6 E;  1FWK A;  1HNW I;  2VF3 A;  4DUZ E;  4HAC B;  3V5R A;  3Q6N A;  2GQ0 A;  5A2Q Q;  3PYE A;  4YY3 I;  4LPF A;  1E3H A;  1FI4 A;  5K36 F;  4B3M I;  4JYA E;  4AM3 A;  1B62 A;  1NHJ A;  2UUC E;  2UXB I;  3D4J A;  3K1J A;  1VI7 A;  1OJ4 A;  5IT9 C;  5LMU E;  4JI8 I;  1S16 A;  1R6L A;  4MYT A;  5K36 A;  4IZJ D;  2E5L E;  1Z5A A;  3HKM A;  4DPY A;  2UUB E;  4EMD A;  1UDQ A;  4LF6 I;  4X66 E;  4U3D A;  4JI5 I;  3K85 A;  3ZKD A;  1H73 A;  2NN6 B;  4MYU A;  5A2Q C;  1XNQ E;  1U2R A;  3ZZU A;  4JI1 I;  4X64 I;  1Y60 A;  4DV7 E;  1RRE A;  2Z5B B;  3LTO A;  4LF4 I;  1Z0E A;  1H74 A;  2PNZ A;  3WU4 A;  4GKJ I;  3CDI A;  5K36 D;  4IFD F;  4GKK I;  1OYR A;  4FWD A;  4RPF A;  4DR4 E;  2JT2 A;  2Z5E A;  1Z0V A;  3ZKB A;  4DV4 I;  2LJP A;  3V2U C;  4IFD C;  2PNM A;  1XMQ I;  4LFC E;  1KIJ A;  4HAC A;  4JV5 E;  3M7N D;  3M6A A;  1PVG A;  4DR6 E;  2NPF A;  4NXM E;  4DR3 E;  1R6M A;  5ELW A;  3OTO I;  2DEJ A;  1IBM I;  1FNM A;  1FKA E;  1HNZ E;  4X62 E;  4DR2 E;  2R3V A;  1FJG E;  2HK3 A;  3GME A;  4ZVI A;  5LL6 R;  4K0K I;  1N33 E;  1EI1 A;  1ZM4 A;  4OO1 C;  1HNX I;  4HY1 A;  4FW9 A;  2JEB B;  4MDT A;  1I94 E;  3PYD A;  1YH8 A;  4R1F A;  4FN5 A;  1XHK A;  4NXN I;  2R42 A;  4IFD D;  3P3C A;  4IZK B;  5DNL A;  1N32 I;  2UXD I;  2NN6 A;  1USV A;  5FLX Q;  1EA6 A;  1J5E I;  4FW4 A;  2Q2E B;  4ED4 A;  4JI2 E;  3UHM A;  2C37 B;  1Z0W A;  2Z5B A;  1ELO A;  2WW4 A;  5K36 E;  3P3G A;  1P42 A;  5C0X C;  4DR5 E;  2BA1 G;  4DU7 A;  1KVK A;  1N34 E;  3J80 Q;  1H72 C;  2BM1 A;  2PO0 B;  3M85 G;  1NHH A;  5LMN E;  3PYG A;  5BR8 I;  2F4V E;  4DV5 I;  4JI7 E;  5DRP A;  4X65 E;  1N0U A;  4P7A A;  1USU A;  4DR1 I;  4B3R I;  5FLX C;  5JEA E;  3P76 A;  2IES A;  2OI2 A;  2IER A;  2WP8 B;  2UXC I;  3L7Z B;  3CWV A;  4IFD B;  2A2D A;  5EL9 A;  3NZK A;  1DAR A;  2HKE A;  5IWA I;  2JEB A;  2CGE A;  1IBL I;  4LFA I;  2AE8 A;  3J80 C;  1UDO A;  1MU5 A;  5DRR A;  1Z0B A;  4DV1 E;  2JEA B;  4LFB E;  4B3T E;  2HFS A;  2O1T A;  1Y6Z A;  4IZK A;  4LF9 I;  3KRN A;  2ZM6 E;  4LF8 E;  1Z5C A;  4OO1 B;  4DR7 I;  4JI4 E;  1BKN A;  4AQY E;  3Q1Q A;  4LOM A;  4LCG A;  5FWK A;  3ZM7 A;  4DV2 E;  3B82 A;  2IOP A;  4NBQ A;  1XNR E;  2PO2 B;  3T1Y E;  2C37 A;  4FWG A;  2UU9 E;  1Z0T A;  4URL A;  1Y5Y A;  4YHH I;  2DEI A;  1UDS A;  3JAM Q;  4JI1 E;  4WUC A;  5EKW A;  1XMO E;  3DD6 A;  1HR0 I;  5DNX A;  4LF7 E;  4JI6 I;  1ZXN A;  4DUZ I;  2PO0 A;  2J65 A;  4LF5 E;  5DRO A;  1B63 A;  2JE6 B;  3HUL A;  2GS8 A;  2NN6 E;  1VIS A;  4DPX A;  4JI0 E;  5C0X B;  2C39 B;  4JYA I;  2IOQ A;  3T1H E;  2UUC I;  5LMU I;  2WP8 A;  3GLL A;  4PRX A;  2E5L I;  2V2V A;  2HK2 A;  3L7Z A;  4IFD A;  2UUB I;  2V2Q A;  4KHP E;  2O1V A;  1H7S A;  3JAM C;  4X66 I;  4B3S E;  5JEA C;  1Z0C A;  4J3D A;  4HYM A;  3HJC A;  2JEA A;  1ZM9 A;  1PKP A;  4DPW A;  1YHC A;  4OO1 F;  3J81 Q;  4DPT A;  4OX9 I;  4BA1 B;  1XNQ I;  4JI3 E;  4OO1 A;  4DV7 I;  4DV6 E;  4USM A;  2VQE E;  4UT4 A;  1KKH A;  2PO2 A;  3ZZ0 A;  2UUA E;  4FW6 A;  2V2Z A;  4DV0 E;  3GON A;  3QT8 A;  2VQF E;  4DR4 I;  4M1K A;  1N36 E;  3K17 A;  4KQV A;  3QT6 A;  4LFC I;  4MQY A;  5GME A;  4DR6 I;  3QT5 A;  4NXM I;  2JE6 A;  5C0X F;  4DR3 I;  2AJ4 A;  4DV3 E;  3J81 C;  2PNL A;  3WU5 A;  4X62 I;  4DR2 I;  5C0X A;  1IBK E;  1HNZ I;  4OO1 D;  2C39 A;  1FJG I;  2HHH E;  4U3B A;  3PYF A;  2BM0 A;  2V34 A;  4FW3 A;  1I94 I;  1H7U A;  2BA0 D;  3CDJ A;  1E3P A;  3B4T A;  1HNW E;  1RR9 A;  4GQU A;  1UEK A;  1Z59 A;  4MU1 A;  3U1Y A;  1NZ0 A;  2CZ9 A;  2X7I A;  4YY3 E;  4FW7 A;  4BA1 A;  4FWH A;  4LCF A;  4JI2 I;  4PRV A;  3ZZT A;  5C0X D;  4B3M E;  2UXB E;  4HXZ A;  2CG9 A;  5JEA B;  4JI8 E;  1N0V C;  3B78 A;  4DR5 I;  1N34 I;  1Z5B A;  4I3H A;  4IFD E;  2X36 A;  4DUY I;  2C38 B;  2PO1 B;  1A6F A;  3LNU A; 
#chains in the Genus database with same CATH homology
 1WUU A;  4LF6 E;  5LMN I;  1QZR A;  2E1R A;  2F4V I;  4JI5 E;  4JI7 I;  4X65 I;  2ZBK B;  1S4E A;  1NHI A;  2J7K A;  4X64 E;  4LF4 E;  2V8P A;  1PIE A;  1KTV A;  4XTJ A;  4GKJ E;  4WUD A;  4GKK E;  4DV1 I;  4LFB I;  4B3T I;  1ZM2 A;  3J7A G;  4DV4 E;  2ZM6 I;  4LF8 I;  1XMQ E;  2EFG A;  4JI4 I;  4Z7Y A;  4AQY I;  1K47 A;  4DV2 I;  1XNR I;  4UTG A;  3OTO E;  2HFU A;  2A2C A;  3T1Y I;  4DPU A;  1IBM E;  1FWL A;  2UU9 I;  4OX9 E;  4K0K E;  3WU6 A;  2O1W A;  1HNX E;  1XMO I;  1Y4U A;  4LF7 I;  1HK7 A;  4WUB A;  4USK A;  4LF5 I;  4NXN E;  1ZXM A;  1N32 E;  2UXD E;  3Q6M A;  4JI0 I;  3T1H I;  2Z5C B;  1J5E E;  4IZJ B;  1MG7 A;  3H4L A;  1Z0G A;  4KHP I;  4JV5 I;  4B3S I;  4PU9 A;  3B8H A;  3WU3 A;  4P52 A;  4DXL A;  2BV3 A;  3PRY A;  3F0N A;  5BR8 E;  4DV5 E;  1N33 I;  4JI3 I;  4DV6 I;  4DR1 E;  2ZIT A;  4B3R E;  2VQE I;  3J7A M;  2UUA I;  4DV0 I;  2UXC E;  2VQF I;  1N36 I;  3P06 A;  5IWA E;  4N3O A;  3QT7 A;  4JG4 A;  1IBL E;  4LFA E;  1D6T A;  5L3J A;  4DUY E;  2HKJ A;  4LF9 E;  4DV3 I;  1IBK I;  4DR7 E;  5IT9 Q;  4DU8 A;  2HHH I;  2Z5C A;  2XEX A;  1ZM3 A;  2O1U A;  4IZJ A;  4Z7C A;  1Y4S A;  4YHH E;  5GMD A;  1HR0 E;  1MX0 A;  3LPS A;  4JI6 E;  1FWK A;  1HNW I;  2VF3 A;  4DUZ E;  4HAC B;  3V5R A;  3Q6N A;  2GQ0 A;  5A2Q Q;  3PYE A;  4YY3 I;  1FI4 A;  4B3M I;  4JYA E;  1B62 A;  1NHJ A;  2UUC E;  2UXB I;  3D4J A;  3K1J A;  5IT9 C;  1OJ4 A;  5LMU E;  4JI8 I;  1S16 A;  4MYT A;  4IZJ D;  2E5L E;  1Z5A A;  4DPY A;  2UUB E;  4EMD A;  4LF6 I;  4X66 E;  4JI5 I;  3K85 A;  3ZKD A;  1H73 A;  4MYU A;  5A2Q C;  1XNQ E;  1U2R A;  3ZZU A;  4JI1 I;  4X64 I;  4DV7 E;  1RRE A;  2Z5B B;  3LTO A;  4LF4 I;  1Z0E A;  1H74 A;  3WU4 A;  4GKJ I;  4GKK I;  4FWD A;  4RPF A;  4DR4 E;  2Z5E A;  1Z0V A;  3ZKB A;  4DV4 I;  2LJP A;  3V2U C;  2PNM A;  1XMQ I;  4LFC E;  1KIJ A;  4HAC A;  4JV5 E;  3M6A A;  1PVG A;  4DR6 E;  2NPF A;  4NXM E;  4DR3 E;  3OTO I;  2DEJ A;  1IBM I;  1FNM A;  1FKA E;  1HNZ E;  4X62 E;  4DR2 E;  2R3V A;  1FJG E;  2HK3 A;  4ZVI A;  5LL6 R;  4K0K I;  1N33 E;  1EI1 A;  1ZM4 A;  1HNX I;  4HY1 A;  4FW9 A;  1I94 E;  3PYD A;  4R1F A;  4FN5 A;  1XHK A;  4NXN I;  2R42 A;  4IZK B;  1N32 I;  2UXD I;  1USV A;  5FLX Q;  1EA6 A;  1J5E I;  2Q2E B;  4ED4 A;  4JI2 E;  1Z0W A;  2Z5B A;  1ELO A;  2WW4 A;  4DR5 E;  4DU7 A;  1N34 E;  1KVK A;  3J80 Q;  1H72 C;  2BM1 A;  1NHH A;  5LMN E;  3PYG A;  5BR8 I;  2F4V E;  4DV5 I;  4JI7 E;  4X65 E;  1N0U A;  4P7A A;  1USU A;  4DR1 I;  4B3R I;  5FLX C;  2OI2 A;  2UXC I;  3CWV A;  2A2D A;  1DAR A;  2HKE A;  5IWA I;  2CGE A;  1IBL I;  4LFA I;  3J80 C;  1MU5 A;  4DV1 E;  1Z0B A;  4LFB E;  4B3T E;  2HFS A;  2O1T A;  1Y6Z A;  4IZK A;  4LF9 I;  2ZM6 E;  4LF8 E;  1Z5C A;  4DR7 I;  4JI4 E;  1BKN A;  4AQY E;  3Q1Q A;  5FWK A;  3ZM7 A;  4DV2 E;  3B82 A;  2IOP A;  1XNR E;  3T1Y E;  4FWG A;  2UU9 E;  1Z0T A;  4URL A;  4YHH I;  2DEI A;  4JI1 E;  3JAM Q;  4WUC A;  1XMO E;  1HR0 I;  4LF7 E;  4JI6 I;  1ZXN A;  4DUZ I;  4LF5 E;  1B63 A;  3HUL A;  2GS8 A;  1VIS A;  4DPX A;  4JI0 E;  4JYA I;  2IOQ A;  3T1H E;  2UUC I;  5LMU I;  4PRX A;  2E5L I;  2V2V A;  2HK2 A;  2UUB I;  2V2Q A;  4KHP E;  2O1V A;  1H7S A;  3JAM C;  4X66 I;  4B3S E;  1Z0C A;  4HYM A;  3HJC A;  1ZM9 A;  1PKP A;  4DPW A;  3J81 Q;  4DPT A;  4OX9 I;  1XNQ I;  4JI3 E;  4DV7 I;  4DV6 E;  4USM A;  2VQE E;  4UT4 A;  1KKH A;  3ZZ0 A;  2UUA E;  2V2Z A;  4DV0 E;  3GON A;  3QT8 A;  2VQF E;  4DR4 I;  4M1K A;  1N36 E;  3K17 A;  4KQV A;  3QT6 A;  4LFC I;  5GME A;  4DR6 I;  3QT5 A;  4NXM I;  4DR3 I;  2AJ4 A;  4DV3 E;  3J81 C;  2PNL A;  3WU5 A;  4X62 I;  4DR2 I;  1IBK E;  1HNZ I;  1FJG I;  2HHH E;  3PYF A;  2BM0 A;  2V34 A;  1I94 I;  1H7U A;  1HNW E;  1RR9 A;  1UEK A;  1Z59 A;  1NZ0 A;  2CZ9 A;  2X7I A;  4YY3 E;  4FWH A;  4JI2 I;  4PRV A;  3ZZT A;  4B3M E;  2UXB E;  4HXZ A;  2CG9 A;  4JI8 E;  1N0V C;  3B78 A;  4DR5 I;  1N34 I;  1Z5B A;  4I3H A;  2X36 A;  4DUY I;  1A6F A;  3LNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...