1Z0TA

Crystal structure of a. fulgidus lon proteolytic domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
195
Chain Sequence
KLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Pathological crystallography: case studies of several unusual macromolecular crystals.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 52
structure length 195
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0tA00
4DUZI 4R1FA 4DR3E 2UUCI 4DR6I 2DEIA 3GONA 2E5LE 4YHHI 3J7AG 4JV5I 3LNUA 5BR8I 4FWDA 4LF8E 4DV2E 4DV6I 1U2RA 2HHHE 1Z0WA 3CWVA 2UXDI 2V8PA 4ZVIA 2R3VA 4X65I 2A2DA 3ZKBA 2UUBE 4XTJA 1FWKA 4FW9A 4X62I 1IBKE 1XNRI 1MG7A 4JI6E 3K1JA 1XMQI 4DR7I 5LMUI 4HACB 4NXMI 1K47A 4MYUA 4DV1I 4Z7YA 1FJGI 2LJPA 2VQEI 1NHIA 1Z5AA 4GKJE 2Q2EB 3OTOE 4OX9I 4DU7A 3QT5A 4DV7I 2NPFA 4GKKE 1H7SA 4LF4I 2HK3A 4WUCA 3WU3A 4JI8I 3J7AM 1ELOA 3B8HA 4X66E 4DV0I 4B3SI 1MX0A 4B3MI 1HNZE 1N32I 4AQYI 4X64I 5L3JA 2WW4A 3ZKDA 1KVKA 1IBLE 1BKNA 4JI5E 4KHPE 4USMA 4B3TI 1FWLA 4DR3I 3JAMC 2ZM6E 2E5LI 4LF6E 2V2VA 2BV3A 1IBME 3Q1QA 1PKPA 3ZZUA 4DR5E 3T1HE 4I3HA 2VQFE 3QT8A 1QZRA 4LF8I 4LFAI 2F4VE 4PRXA 4UTGA 4K0KE 4FWHA 5FLXC 2HHHI 2UXBE 3T1YI 1RR9A 2DEJA 4YY3I 3QT7A 4DV5E 4PU9A 5IWAE 1Z0EA 3WU6A 1J5EE 4LF9E 2BM1A 2UUBI 4JYAE 4DV4E 4FWGA 2EFGA 1HNXE 4B3RE 3H4LA 2GS8A 2V2QA 2UU9I 4LF7E 3WU4A 1Z5CA 3LPSA 1XNQE 1ZM4A 4JI0I 4DU8A 4GKJI 1OJ4A 3J81C 4P7AA 1FI4A 4YHHE 5LMNI 4DV3I 4DPYA 4DR4I 2BM0A 1N34I 5BR8E 5A2QC 1XMOI 1H73A 4DV6E 4JI7I 4JI2E 1ZM2A 2HK2A 1H72C 3J80C 4Z7CA 4WUBA 2UXDE 1Z0BA 4LFCE 4DR2E 1S4EA 4JI3I 4JI5I 3V2UC 1XNRE 1NHJA 1ZXMA 2V2ZA 2ZBKB 4JI4I 4RPFA 4JI1E 1ZM3A 4PRVA 4DPXA 2ZM6I 4LF6I 3WU5A 4DR7E 1IBMI 5LMUE 1H74A 3T1HI 4LF5I 1S16A 2HKEA 4URLA 4NXME 4DV1E 1HR0I 4K0KI 2OI2A 2UXBI 2VF3A 4DPTA 1EA6A 3V5RA 3QT6A 3JAMQ 2HKJA 4DV5I 2J7KA 5IWAI 4JI8E 1J5EI 4HY1A 4DV4I 1B62A 4DV0E 1KTVA 1N36E 4KQVA 4DV2I 1N0VC 4B3ME 1N32E 4AQYE 1I94E 4LF7I 1H7UA 4X64E 5IT9C 5FLXQ 1NZ0A 1KKHA 1HNWE 4NXNE 1XNQI 1IBKI 4DR1E 1ZM9A 4LFBE 4JI6I 4B3TE 1PIEA 1VISA 1KIJA 1WUUA 1N33E 4DUYE 2UXCE 3PYEA 5GMDA 2UUAE 1PVGA 3B78A 4LFAE 4M1KA 3OTOI 4DUZE 4DXLA 2XEXA 4JI2I 3T1YE 2UUCE 4DR6E 4GKKI 1A6FA 4YY3E 3PYGA 4LFCI 3J81Q 4DR2I 1Z59A 4JV5E 1B63A 2HFSA 4X66I 1FNMA 2HFUA 3ZZTA 4JI1I 4WUDA 1HNZI 4MYTA 2UU9E 5A2QQ 1FKAE 2X7IA 4X65E 1EI1A 2ZITA 1IBLI 3J80Q 2E1RA 1Z0TA 4KHPI 4USKA 4X62E 4EMDA 3B82A 4JI0E 3M6AA 1XMQE 3F0NA 2X36A 1N0UA 3PYFA 4DR5I 5LMNE 4DV3E 2VQFI 3LTOA 2R42A 1FJGE 4DR4E 2F4VI 1DARA 1N34E 1N36I 3HULA 2VQEE 2AJ4A 4UT4A 1MU5A 4HXZA 1ZXNA 1XMOE 1UEKA 1I94I 4OX9E 4JI7E 2A2CA 4DV7E 1D6TA 4ED4A 4LF4E 3K17A 5GMEA 1Z0GA 4LF9I 1HNWI 4NXNI 4JYAI 4JI3E 4DPWA 4DR1I 1Z0VA 4B3SE 1Z0CA 3PYDA 4LFBI 1HNXI 3D4JA 4B3RI 2CZ9A 4JI4E 3ZZ0A 1N33I 3ZM7A 4DUYI 2UXCI 4LF5E 4HACA 2UUAI 5LL6R 4FN5A 4DPUA 5IT9Q 4P52A 1RREA 1Z5BA 1XHKA 4HYMA 2V34A 4JG4A 1NHHA 1HR0E
chains in the Genus database with same CATH superfamily
4DUZI 4R1FA 4DR3E 5DNLA 2IERA 2UUCI 4DR6I 4QNJA 2DEIA 4OKGA 3GONA 2E5LE 2PO1B 4YHHI 4OO1E 5FWKA 3J7AG 3P3GA 4JV5I 2IESA 3LNUA 5BR8I 4FWDA 4LF8E 1YHCA 5K36B 4FW5A 3P06A 4DV2E 4DV6I 2J65A 1U2RA 2NN6A 4MQYA 2HHHE 1Z0WA 3CWVA 2UXDI 3P76A 2V8PA 2Z5CA 4ZVIA 2R3VA 4X65I 2A2DA 3ZKBA 4IZJA 4XTJA 2UUBE 1FWKA 4FW9A 4X62I 1IBKE 4IFDB 3H1CA 1XNRI 1MG7A 4JI6E 3K1JA 2GO4A 4LCGA 4U3DA 5DROA 4AIDA 1XMQI 4DR7I 5LMUI 4HACB 2O3ZA 4NXMI 1K47A 4MYUA 4DV1I 4MU3A 4Z7YA 1FJGI 4U3BA 2LJPA 4OO1F 4MU4A 2VQEI 1NHIA 1Z5AA 4GKJE 2Q2EB 2CGEA 3PS3A 3OTOE 4OX9I 4DU7A 3QT5A 4DV7I 2NPFA 4GKKE 1H7SA 4LF4I 2HK3A 3PS1A 4WUCA 3WU3A 1E3PA 2BA0G 4JI8I 4OO1D 3J7AM 1ELOA 2BA0D 2PNMA 4ISAA 3B8HA 4FW4A 4X66E 4DV0I 4B3SI 2C37A 2NN6B 4MU1A 1MX0A 3U1KA 5C0XF 4B3MI 1HNZE 1N32I 4AQYI 2Z5CB 4X64I 5L3JA 2WW4A 3ZKDA 4IZJB 1KVKA 2CVEA 1IBLE 5C0XD 5DNXA 1Y4SA 1BKNA 3Q6MA 3P3CA 4JI5E 3GMEA 4KHPE 4USMA 4B3TI 1FWLA 4DR3I 5JEAE 3JAMC 4BA2A 2ZM6E 5C0XC 2E5LI 4LF6E 2O1TA 2V2VA 2BV3A 1IBME 3Q1QA 1PKPA 3ZZUA 4DR5E 3T1HE 4I3HA 2VQFE 3QT8A 1QZRA 2O1UA 4LF8I 4LFAI 2F4VE 3M7NG 4PRXA 2WNRA 4UTGA 4K0KE 4FWHA 5FLXC 2HHHI 2UXBE 3T1YI 1RR9A 2DEJA 2C39A 4YY3I 3QT7A 1P42A 4DV5E 4PU9A 2O1WA 5IWAE 1XXEA 1Z0EA 3P3EA 3WU6A 1J5EE 4LF9E 2JEAA 2C37B 2PNZB 2BM1A 2UUBI 4JYAE 4DV4E 4FWGA 2PO2A 2EFGA 1HNXE 4FW7A 4FW6A 4B3RE 3H4LA 2GS8A 2V2QA 2UU9I 4LF7E 4LCHA 2JE6A 2C38A 5JEAF 1Y5YA 4LPFA 1Z5CA 3WU4A 5C0XE 2VESA 3LPSA 4MDTA 4AIMA 2JT2A 3M85G 1XNQE 4BA2B 3M85D 3NZKA 1ZM4A 4JI0I 4DU8A 4GKJI 1OJ4A 5JEAD 3J81C 4P7AA 1FI4A 2IOPA 2BR2A 4YHHE 5LMNI 5DRQA 4DV3I 3B4TA 4IZKA 4DPYA 4DR4I 2WNRB 2BM0A 5JEAC 1N34I 4AM3A 5BR8E 5K36F 3K85A 5A2QC 2C39B 1Y6ZA 2AE8A 1XMOI 1H73A 4DV6E 1Y60A 4JI7I 1OYSA 4JI2E 1ZM2A 2HK2A 1USUA 1H72C 2Z5EA 3J80C 4Z7CA 4WUBA 2UXDE 2JEAB 1Z0BA 4LFCE 5K36D 4DR2E 1S4EA 4LOMA 2PO2B 4JI3I 4JI5I 4LCFA 4N3OA 4IFDF 2JEBA 3V2UC 1XNRE 1NHJA 1ZXMA 2V2ZA 2WP8A 2ZBKB 4RPFA 4JI4I 4JI1E 2JE6B 1ZM3A 4PRVA 4DPXA 2ZM6I 2C38B 5K36C 4LF6I 3WU5A 4DR7E 1IBMI 5LMUE 3L7ZA 1H74A 3T1HI 4LF5I 1S16A 2HKEA 4IFDD 4URLA 4NXME 4IS9A 3CDIA 4DV1E 2GQ0A 4MU0A 1UDQA 1HK7A 2O1VA 1HR0I 4OO1A 4K0KI 2OI2A 2UXBI 2VF3A 4IFDC 4DPTA 1EA6A 3V5RA 3QT6A 4IZKB 2HKJA 3JAMQ 2J7KA 4DV5I 5IWAI 4JI8E 2CG9A 3Q6NA 1J5EI 4HY1A 3U1YA 1E3HA 4DV4I 2NN6F 1B62A 4DV0E 1KTVA 1N36E 4KQVA 4DV2I 1N0VC 3M7ND 4B3ME 1N32E 4NBQA 4AQYE 5C0XA 1I94E 4LF7I 1H7UA 4X64E 5IT9C 5FLXQ 5DRPA 3UHMA 1NZ0A 1KKHA 2NN6D 5ELWA 5K36E 1YH8A 2JEBB 3PRYA 1HNWE 2BA1G 4NXNE 1XNQI 1IBKI 4DR1E 2BA1D 1ZM9A 3DD6A 4BA1A 4LFBE 1Y4UA 4JI6I 4B3TE 1UDOA 1PIEA 1VISA 2NN6C 3L7ZB 1KIJA 1WUUA 4IZJD 1N33E 4DUYE 2F1DA 2UXCE 3PYEA 4IFDE 5GMDA 2IOQA 2Z5BA 1OYPA 2UUAE 4OO1B 1PVGA 3B78A 4LFAE 1R6MA 4M1KA 3OTOI 1UDNA 3HJCA 4DUZE 3PS2A 4DXLA 2XEXA 4JI2I 3T1YE 2UUCE 4DR6E 4GKKI 1A6FA 4YY3E 3PYGA 5DRRA 4LFCI 3J81Q 4DR2I 1Z59A 4JV5E 1B63A 2HFSA 4X66I 1FNMA 3HKMA 5EL9A 2HFUA 5C0XB 3ZZTA 4JI1I 4WUDA 1HNZI 4MYTA 2UU9E 5A2QQ 1FKAE 2X7IA 2NN6E 4X65E 1EI1A 2ZITA 2GO3A 1IBLI 3J80Q 2E1RA 5JEAA 4BA1B 1Z0TA 4KHPI 4USKA 4X62E 2PO0A 4EMDA 5EKWA 3B82A 4FW3A 4JI0E 1RHYA 3M6AA 1XMQE 3F0NA 2X36A 1N0UA 3PYFA 2Z5BB 4DR5I 1R6LA 2PO1A 5LMNE 4DV3E 2VQFI 3LTOA 2R42A 1FJGE 4DR4E 2F4VI 3CDJA 1DARA 1N34E 1N36I 3HULA 2PNZA 1UDSA 2AJ4A 2VQEE 4UT4A 1MU5A 4HXZA 4GQUA 4OO1C 1ZXNA 4QNKA 1UEKA 1XMOE 1I94I 2BR2B 4OX9E 5K36A 4JI7E 2A2CA 4DV7E 1D6TA 4ED4A 4LF4E 3K17A 5GMEA 4OZEA 1Z0GA 4LF9I 1HNWI 4NXNI 4JYAI 4JI3E 2PNLA 4DPWA 4DR1I 1Z0VA 4B3SE 1Z0CA 3PYDA 4LFBI 3GLLA 1HNXI 3D4JA 4B3RI 2CZ9A 4JI4E 4IFDA 3ZZ0A 1N33I 3ZM7A 4DUYI 2UXCI 1VI7A 3KRNA 4J3DA 4LF5E 5JEAB 1OYRA 3GCMA 4HACA 2UUAI 2PO0B 5LL6R 1USVA 4FN5A 4DPUA 4P52A 5IT9Q 2WP8B 1RREA 1Z5BA 1XHKA 4HYMA 2V34A 4JG4A 1NHHA 1HR0E
chains in the Genus database with same CATH topology
4DUZI 4R1FA 4DR3E 2UUCI 4DR6I 2DEIA 3GONA 2E5LE 4YHHI 5FWKA 3J7AG 4JV5I 3LNUA 5BR8I 4FWDA 4LF8E 3P06A 4DV2E 4DV6I 1U2RA 2HHHE 1Z0WA 3CWVA 2UXDI 2V8PA 2Z5CA 4ZVIA 2R3VA 4X65I 2A2DA 3ZKBA 4IZJA 4XTJA 2UUBE 1FWKA 4FW9A 4X62I 1IBKE 1XNRI 1MG7A 4JI6E 3K1JA 1XMQI 4DR7I 5LMUI 4HACB 4NXMI 1K47A 4MYUA 4DV1I 4Z7YA 1FJGI 2LJPA 2VQEI 1NHIA 1Z5AA 4GKJE 2Q2EB 2CGEA 3OTOE 4OX9I 4DU7A 3QT5A 4DV7I 2NPFA 4GKKE 1H7SA 4LF4I 2HK3A 4WUCA 3WU3A 4JI8I 3J7AM 1ELOA 2PNMA 3B8HA 4X66E 4DV0I 4B3SI 1MX0A 4B3MI 1HNZE 1N32I 4AQYI 2Z5CB 4X64I 5L3JA 2WW4A 3ZKDA 4IZJB 1KVKA 1IBLE 1Y4SA 1BKNA 3Q6MA 4JI5E 4KHPE 4USMA 4B3TI 1FWLA 4DR3I 3JAMC 2ZM6E 2E5LI 4LF6E 2O1TA 2V2VA 2BV3A 1IBME 3Q1QA 1PKPA 3ZZUA 4DR5E 3T1HE 4I3HA 2VQFE 3QT8A 1QZRA 2O1UA 4LF8I 4LFAI 2F4VE 4PRXA 4UTGA 4K0KE 4FWHA 5FLXC 2HHHI 2UXBE 3T1YI 1RR9A 2DEJA 4YY3I 3QT7A 4DV5E 4PU9A 2O1WA 5IWAE 1Z0EA 3WU6A 1J5EE 4LF9E 2BM1A 2UUBI 4JYAE 4DV4E 4FWGA 2EFGA 1HNXE 4B3RE 3H4LA 2GS8A 2V2QA 2UU9I 4LF7E 3WU4A 1Z5CA 3LPSA 1XNQE 1ZM4A 4JI0I 4DU8A 4GKJI 1OJ4A 3J81C 4P7AA 1FI4A 2IOPA 4YHHE 5LMNI 4DV3I 4IZKA 4DPYA 4DR4I 2BM0A 1N34I 5BR8E 3K85A 5A2QC 1Y6ZA 1XMOI 1H73A 4DV6E 4JI7I 4JI2E 1ZM2A 2HK2A 1H72C 1USUA 2Z5EA 3J80C 4Z7CA 4WUBA 2UXDE 1Z0BA 4LFCE 4DR2E 1S4EA 4JI3I 4JI5I 4N3OA 3V2UC 1XNRE 1NHJA 1ZXMA 2V2ZA 2ZBKB 4JI4I 4RPFA 4JI1E 1ZM3A 4PRVA 4DPXA 2ZM6I 4LF6I 3WU5A 4DR7E 1IBMI 5LMUE 1H74A 3T1HI 4LF5I 1S16A 2HKEA 4URLA 4NXME 4DV1E 2GQ0A 1HK7A 2O1VA 1HR0I 4K0KI 2OI2A 2UXBI 2VF3A 4DPTA 1EA6A 3V5RA 3QT6A 4IZKB 2HKJA 3JAMQ 2J7KA 4DV5I 5IWAI 4JI8E 2CG9A 3Q6NA 1J5EI 4HY1A 4DV4I 1B62A 4DV0E 1KTVA 1N36E 4KQVA 4DV2I 1N0VC 4B3ME 1N32E 4AQYE 1I94E 4LF7I 1H7UA 4X64E 5IT9C 5FLXQ 1NZ0A 1KKHA 3PRYA 1HNWE 4NXNE 1XNQI 1IBKI 4DR1E 1ZM9A 4LFBE 1Y4UA 4JI6I 4B3TE 1PIEA 1VISA 1KIJA 1WUUA 4IZJD 1N33E 4DUYE 2UXCE 3PYEA 5GMDA 2IOQA 2Z5BA 2UUAE 1PVGA 3B78A 4LFAE 4M1KA 3OTOI 3HJCA 4DUZE 4DXLA 2XEXA 4JI2I 3T1YE 2UUCE 4DR6E 4GKKI 1A6FA 4YY3E 3PYGA 4LFCI 3J81Q 4DR2I 1Z59A 4JV5E 1B63A 2HFSA 4X66I 1FNMA 2HFUA 3ZZTA 4JI1I 4WUDA 1HNZI 4MYTA 2UU9E 5A2QQ 1FKAE 2X7IA 4X65E 1EI1A 2ZITA 1IBLI 3J80Q 2E1RA 1Z0TA 4KHPI 4USKA 4X62E 4EMDA 3B82A 4JI0E 3M6AA 1XMQE 3F0NA 2X36A 1N0UA 3PYFA 2Z5BB 4DR5I 5LMNE 4DV3E 2VQFI 3LTOA 2R42A 1FJGE 4DR4E 2F4VI 1DARA 1N34E 1N36I 3HULA 2VQEE 2AJ4A 4UT4A 1MU5A 4HXZA 1ZXNA 1XMOE 1UEKA 1I94I 4OX9E 4JI7E 2A2CA 4DV7E 1D6TA 4ED4A 4LF4E 3K17A 5GMEA 1Z0GA 4LF9I 1HNWI 4NXNI 4JYAI 4JI3E 2PNLA 4DPWA 4DR1I 1Z0VA 4B3SE 1Z0CA 3PYDA 4LFBI 1HNXI 3D4JA 4B3RI 2CZ9A 4JI4E 3ZZ0A 1N33I 3ZM7A 4DUYI 2UXCI 4LF5E 4HACA 2UUAI 1USVA 4DPUA 4FN5A 5LL6R 4P52A 5IT9Q 1RREA 1Z5BA 1XHKA 4HYMA 2V34A 4JG4A 1NHHA 1HR0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ I;  4R1F A;  4DR3 E;  2UUC I;  4DR6 I;  2DEI A;  3GON A;  2E5L E;  4YHH I;  3J7A G;  4JV5 I;  3LNU A;  5BR8 I;  4FWD A;  4LF8 E;  4DV2 E;  4DV6 I;  1U2R A;  2HHH E;  1Z0W A;  3CWV A;  2UXD I;  2V8P A;  4ZVI A;  2R3V A;  4X65 I;  2A2D A;  3ZKB A;  2UUB E;  4XTJ A;  1FWK A;  4FW9 A;  4X62 I;  1IBK E;  1XNR I;  1MG7 A;  4JI6 E;  3K1J A;  1XMQ I;  4DR7 I;  5LMU I;  4HAC B;  4NXM I;  1K47 A;  4MYU A;  4DV1 I;  4Z7Y A;  1FJG I;  2LJP A;  2VQE I;  1NHI A;  1Z5A A;  4GKJ E;  2Q2E B;  3OTO E;  4OX9 I;  4DU7 A;  3QT5 A;  4DV7 I;  2NPF A;  4GKK E;  1H7S A;  4LF4 I;  2HK3 A;  4WUC A;  3WU3 A;  4JI8 I;  3J7A M;  1ELO A;  3B8H A;  4X66 E;  4DV0 I;  4B3S I;  1MX0 A;  4B3M I;  1HNZ E;  1N32 I;  4AQY I;  4X64 I;  5L3J A;  2WW4 A;  3ZKD A;  1KVK A;  1IBL E;  1BKN A;  4JI5 E;  4KHP E;  4USM A;  4B3T I;  1FWL A;  4DR3 I;  3JAM C;  2ZM6 E;  2E5L I;  4LF6 E;  2V2V A;  2BV3 A;  1IBM E;  3Q1Q A;  1PKP A;  3ZZU A;  4DR5 E;  3T1H E;  4I3H A;  2VQF E;  3QT8 A;  1QZR A;  4LF8 I;  4LFA I;  2F4V E;  4PRX A;  4UTG A;  4K0K E;  4FWH A;  5FLX C;  2HHH I;  2UXB E;  3T1Y I;  1RR9 A;  2DEJ A;  4YY3 I;  3QT7 A;  4DV5 E;  4PU9 A;  5IWA E;  1Z0E A;  3WU6 A;  1J5E E;  4LF9 E;  2BM1 A;  2UUB I;  4JYA E;  4DV4 E;  4FWG A;  2EFG A;  1HNX E;  4B3R E;  3H4L A;  2GS8 A;  2V2Q A;  2UU9 I;  4LF7 E;  3WU4 A;  1Z5C A;  3LPS A;  1XNQ E;  1ZM4 A;  4JI0 I;  4DU8 A;  4GKJ I;  1OJ4 A;  3J81 C;  4P7A A;  1FI4 A;  4YHH E;  5LMN I;  4DV3 I;  4DPY A;  4DR4 I;  2BM0 A;  1N34 I;  5BR8 E;  5A2Q C;  1XMO I;  1H73 A;  4DV6 E;  4JI7 I;  4JI2 E;  1ZM2 A;  2HK2 A;  1H72 C;  3J80 C;  4Z7C A;  4WUB A;  2UXD E;  1Z0B A;  4LFC E;  4DR2 E;  1S4E A;  4JI3 I;  4JI5 I;  3V2U C;  1XNR E;  1NHJ A;  1ZXM A;  2V2Z A;  2ZBK B;  4JI4 I;  4RPF A;  4JI1 E;  1ZM3 A;  4PRV A;  4DPX A;  2ZM6 I;  4LF6 I;  3WU5 A;  4DR7 E;  1IBM I;  5LMU E;  1H74 A;  3T1H I;  4LF5 I;  1S16 A;  2HKE A;  4URL A;  4NXM E;  4DV1 E;  1HR0 I;  4K0K I;  2OI2 A;  2UXB I;  2VF3 A;  4DPT A;  1EA6 A;  3V5R A;  3QT6 A;  3JAM Q;  2HKJ A;  4DV5 I;  2J7K A;  5IWA I;  4JI8 E;  1J5E I;  4HY1 A;  4DV4 I;  1B62 A;  4DV0 E;  1KTV A;  1N36 E;  4KQV A;  4DV2 I;  1N0V C;  4B3M E;  1N32 E;  4AQY E;  1I94 E;  4LF7 I;  1H7U A;  4X64 E;  5IT9 C;  5FLX Q;  1NZ0 A;  1KKH A;  1HNW E;  4NXN E;  1XNQ I;  1IBK I;  4DR1 E;  1ZM9 A;  4LFB E;  4JI6 I;  4B3T E;  1PIE A;  1VIS A;  1KIJ A;  1WUU A;  1N33 E;  4DUY E;  2UXC E;  3PYE A;  5GMD A;  2UUA E;  1PVG A;  3B78 A;  4LFA E;  4M1K A;  3OTO I;  4DUZ E;  4DXL A;  2XEX A;  4JI2 I;  3T1Y E;  2UUC E;  4DR6 E;  4GKK I;  1A6F A;  4YY3 E;  3PYG A;  4LFC I;  3J81 Q;  4DR2 I;  1Z59 A;  4JV5 E;  1B63 A;  2HFS A;  4X66 I;  1FNM A;  2HFU A;  3ZZT A;  4JI1 I;  4WUD A;  1HNZ I;  4MYT A;  2UU9 E;  5A2Q Q;  1FKA E;  2X7I A;  4X65 E;  1EI1 A;  2ZIT A;  1IBL I;  3J80 Q;  2E1R A;  1Z0T A;  4KHP I;  4USK A;  4X62 E;  4EMD A;  3B82 A;  4JI0 E;  3M6A A;  1XMQ E;  3F0N A;  2X36 A;  1N0U A;  3PYF A;  4DR5 I;  5LMN E;  4DV3 E;  2VQF I;  3LTO A;  2R42 A;  1FJG E;  4DR4 E;  2F4V I;  1DAR A;  1N34 E;  1N36 I;  3HUL A;  2VQE E;  2AJ4 A;  4UT4 A;  1MU5 A;  4HXZ A;  1ZXN A;  1XMO E;  1UEK A;  1I94 I;  4OX9 E;  4JI7 E;  2A2C A;  4DV7 E;  1D6T A;  4ED4 A;  4LF4 E;  3K17 A;  5GME A;  1Z0G A;  4LF9 I;  1HNW I;  4NXN I;  4JYA I;  4JI3 E;  4DPW A;  4DR1 I;  1Z0V A;  4B3S E;  1Z0C A;  3PYD A;  4LFB I;  1HNX I;  3D4J A;  4B3R I;  2CZ9 A;  4JI4 E;  3ZZ0 A;  1N33 I;  3ZM7 A;  4DUY I;  2UXC I;  4LF5 E;  4HAC A;  2UUA I;  5LL6 R;  4FN5 A;  4DPU A;  5IT9 Q;  4P52 A;  1RRE A;  1Z5B A;  1XHK A;  4HYM A;  2V34 A;  4JG4 A;  1NHH A;  1HR0 E; 
#chains in the Genus database with same CATH topology
 4DUZ I;  4R1F A;  4DR3 E;  5DNL A;  2IER A;  2UUC I;  4DR6 I;  4QNJ A;  2DEI A;  4OKG A;  3GON A;  2E5L E;  2PO1 B;  4YHH I;  4OO1 E;  5FWK A;  3J7A G;  3P3G A;  4JV5 I;  2IES A;  3LNU A;  5BR8 I;  4FWD A;  4LF8 E;  1YHC A;  5K36 B;  4FW5 A;  3P06 A;  4DV2 E;  4DV6 I;  2J65 A;  1U2R A;  2NN6 A;  4MQY A;  2HHH E;  1Z0W A;  3CWV A;  2UXD I;  3P76 A;  2V8P A;  2Z5C A;  4ZVI A;  2R3V A;  4X65 I;  2A2D A;  3ZKB A;  4IZJ A;  4XTJ A;  2UUB E;  1FWK A;  4FW9 A;  4X62 I;  1IBK E;  4IFD B;  3H1C A;  1XNR I;  1MG7 A;  4JI6 E;  3K1J A;  2GO4 A;  4LCG A;  4U3D A;  5DRO A;  4AID A;  1XMQ I;  4DR7 I;  5LMU I;  4HAC B;  2O3Z A;  4NXM I;  1K47 A;  4MYU A;  4DV1 I;  4MU3 A;  4Z7Y A;  1FJG I;  4U3B A;  2LJP A;  4OO1 F;  4MU4 A;  2VQE I;  1NHI A;  1Z5A A;  4GKJ E;  2Q2E B;  2CGE A;  3PS3 A;  3OTO E;  4OX9 I;  4DU7 A;  3QT5 A;  4DV7 I;  2NPF A;  4GKK E;  1H7S A;  4LF4 I;  2HK3 A;  3PS1 A;  4WUC A;  3WU3 A;  1E3P A;  2BA0 G;  4JI8 I;  4OO1 D;  3J7A M;  1ELO A;  2BA0 D;  2PNM A;  4ISA A;  3B8H A;  4FW4 A;  4X66 E;  4DV0 I;  4B3S I;  2C37 A;  2NN6 B;  4MU1 A;  1MX0 A;  3U1K A;  5C0X F;  4B3M I;  1HNZ E;  1N32 I;  4AQY I;  2Z5C B;  4X64 I;  5L3J A;  2WW4 A;  3ZKD A;  4IZJ B;  1KVK A;  2CVE A;  1IBL E;  5C0X D;  5DNX A;  1Y4S A;  1BKN A;  3Q6M A;  3P3C A;  4JI5 E;  3GME A;  4KHP E;  4USM A;  4B3T I;  1FWL A;  4DR3 I;  5JEA E;  3JAM C;  4BA2 A;  2ZM6 E;  5C0X C;  2E5L I;  4LF6 E;  2O1T A;  2V2V A;  2BV3 A;  1IBM E;  3Q1Q A;  1PKP A;  3ZZU A;  4DR5 E;  3T1H E;  4I3H A;  2VQF E;  3QT8 A;  1QZR A;  2O1U A;  4LF8 I;  4LFA I;  2F4V E;  3M7N G;  4PRX A;  2WNR A;  4UTG A;  4K0K E;  4FWH A;  5FLX C;  2HHH I;  2UXB E;  3T1Y I;  1RR9 A;  2DEJ A;  2C39 A;  4YY3 I;  3QT7 A;  1P42 A;  4DV5 E;  4PU9 A;  2O1W A;  5IWA E;  1XXE A;  1Z0E A;  3P3E A;  3WU6 A;  1J5E E;  4LF9 E;  2JEA A;  2C37 B;  2PNZ B;  2BM1 A;  2UUB I;  4JYA E;  4DV4 E;  4FWG A;  2PO2 A;  2EFG A;  1HNX E;  4FW7 A;  4FW6 A;  4B3R E;  3H4L A;  2GS8 A;  2V2Q A;  2UU9 I;  4LF7 E;  4LCH A;  2JE6 A;  2C38 A;  5JEA F;  1Y5Y A;  4LPF A;  1Z5C A;  3WU4 A;  5C0X E;  2VES A;  3LPS A;  4MDT A;  4AIM A;  2JT2 A;  3M85 G;  1XNQ E;  4BA2 B;  3M85 D;  3NZK A;  1ZM4 A;  4JI0 I;  4DU8 A;  4GKJ I;  1OJ4 A;  5JEA D;  3J81 C;  4P7A A;  1FI4 A;  2IOP A;  2BR2 A;  4YHH E;  5LMN I;  5DRQ A;  4DV3 I;  3B4T A;  4IZK A;  4DPY A;  4DR4 I;  2WNR B;  2BM0 A;  5JEA C;  1N34 I;  4AM3 A;  5BR8 E;  5K36 F;  3K85 A;  5A2Q C;  2C39 B;  1Y6Z A;  2AE8 A;  1XMO I;  1H73 A;  4DV6 E;  1Y60 A;  4JI7 I;  1OYS A;  4JI2 E;  1ZM2 A;  2HK2 A;  1USU A;  1H72 C;  2Z5E A;  3J80 C;  4Z7C A;  4WUB A;  2UXD E;  2JEA B;  1Z0B A;  4LFC E;  5K36 D;  4DR2 E;  1S4E A;  4LOM A;  2PO2 B;  4JI3 I;  4JI5 I;  4LCF A;  4N3O A;  4IFD F;  2JEB A;  3V2U C;  1XNR E;  1NHJ A;  1ZXM A;  2V2Z A;  2WP8 A;  2ZBK B;  4RPF A;  4JI4 I;  4JI1 E;  2JE6 B;  1ZM3 A;  4PRV A;  4DPX A;  2ZM6 I;  2C38 B;  5K36 C;  4LF6 I;  3WU5 A;  4DR7 E;  1IBM I;  5LMU E;  3L7Z A;  1H74 A;  3T1H I;  4LF5 I;  1S16 A;  2HKE A;  4IFD D;  4URL A;  4NXM E;  4IS9 A;  3CDI A;  4DV1 E;  2GQ0 A;  4MU0 A;  1UDQ A;  1HK7 A;  2O1V A;  1HR0 I;  4OO1 A;  4K0K I;  2OI2 A;  2UXB I;  2VF3 A;  4IFD C;  4DPT A;  1EA6 A;  3V5R A;  3QT6 A;  4IZK B;  2HKJ A;  3JAM Q;  2J7K A;  4DV5 I;  5IWA I;  4JI8 E;  2CG9 A;  3Q6N A;  1J5E I;  4HY1 A;  3U1Y A;  1E3H A;  4DV4 I;  2NN6 F;  1B62 A;  4DV0 E;  1KTV A;  1N36 E;  4KQV A;  4DV2 I;  1N0V C;  3M7N D;  4B3M E;  1N32 E;  4NBQ A;  4AQY E;  5C0X A;  1I94 E;  4LF7 I;  1H7U A;  4X64 E;  5IT9 C;  5FLX Q;  5DRP A;  3UHM A;  1NZ0 A;  1KKH A;  2NN6 D;  5ELW A;  5K36 E;  1YH8 A;  2JEB B;  3PRY A;  1HNW E;  2BA1 G;  4NXN E;  1XNQ I;  1IBK I;  4DR1 E;  2BA1 D;  1ZM9 A;  3DD6 A;  4BA1 A;  4LFB E;  1Y4U A;  4JI6 I;  4B3T E;  1UDO A;  1PIE A;  1VIS A;  2NN6 C;  3L7Z B;  1KIJ A;  1WUU A;  4IZJ D;  1N33 E;  4DUY E;  2F1D A;  2UXC E;  3PYE A;  4IFD E;  5GMD A;  2IOQ A;  2Z5B A;  1OYP A;  2UUA E;  4OO1 B;  1PVG A;  3B78 A;  4LFA E;  1R6M A;  4M1K A;  3OTO I;  1UDN A;  3HJC A;  4DUZ E;  3PS2 A;  4DXL A;  2XEX A;  4JI2 I;  3T1Y E;  2UUC E;  4DR6 E;  4GKK I;  1A6F A;  4YY3 E;  3PYG A;  5DRR A;  4LFC I;  3J81 Q;  4DR2 I;  1Z59 A;  4JV5 E;  1B63 A;  2HFS A;  4X66 I;  1FNM A;  3HKM A;  5EL9 A;  2HFU A;  5C0X B;  3ZZT A;  4JI1 I;  4WUD A;  1HNZ I;  4MYT A;  2UU9 E;  5A2Q Q;  1FKA E;  2X7I A;  2NN6 E;  4X65 E;  1EI1 A;  2ZIT A;  2GO3 A;  1IBL I;  3J80 Q;  2E1R A;  5JEA A;  4BA1 B;  1Z0T A;  4KHP I;  4USK A;  4X62 E;  2PO0 A;  4EMD A;  5EKW A;  3B82 A;  4FW3 A;  4JI0 E;  1RHY A;  3M6A A;  1XMQ E;  3F0N A;  2X36 A;  1N0U A;  3PYF A;  2Z5B B;  4DR5 I;  1R6L A;  2PO1 A;  5LMN E;  4DV3 E;  2VQF I;  3LTO A;  2R42 A;  1FJG E;  4DR4 E;  2F4V I;  3CDJ A;  1DAR A;  1N34 E;  1N36 I;  3HUL A;  2PNZ A;  1UDS A;  2AJ4 A;  2VQE E;  4UT4 A;  1MU5 A;  4HXZ A;  4GQU A;  4OO1 C;  1ZXN A;  4QNK A;  1UEK A;  1XMO E;  1I94 I;  2BR2 B;  4OX9 E;  5K36 A;  4JI7 E;  2A2C A;  4DV7 E;  1D6T A;  4ED4 A;  4LF4 E;  3K17 A;  5GME A;  4OZE A;  1Z0G A;  4LF9 I;  1HNW I;  4NXN I;  4JYA I;  4JI3 E;  2PNL A;  4DPW A;  4DR1 I;  1Z0V A;  4B3S E;  1Z0C A;  3PYD A;  4LFB I;  3GLL A;  1HNX I;  3D4J A;  4B3R I;  2CZ9 A;  4JI4 E;  4IFD A;  3ZZ0 A;  1N33 I;  3ZM7 A;  4DUY I;  2UXC I;  1VI7 A;  3KRN A;  4J3D A;  4LF5 E;  5JEA B;  1OYR A;  3GCM A;  4HAC A;  2UUA I;  2PO0 B;  5LL6 R;  1USV A;  4FN5 A;  4DPU A;  4P52 A;  5IT9 Q;  2WP8 B;  1RRE A;  1Z5B A;  1XHK A;  4HYM A;  2V34 A;  4JG4 A;  1NHH A;  1HR0 E; 
#chains in the Genus database with same CATH homology
 4DUZ I;  4R1F A;  4DR3 E;  2UUC I;  4DR6 I;  2DEI A;  3GON A;  2E5L E;  4YHH I;  5FWK A;  3J7A G;  4JV5 I;  3LNU A;  5BR8 I;  4FWD A;  4LF8 E;  3P06 A;  4DV2 E;  4DV6 I;  1U2R A;  2HHH E;  1Z0W A;  3CWV A;  2UXD I;  2V8P A;  2Z5C A;  4ZVI A;  2R3V A;  4X65 I;  2A2D A;  3ZKB A;  4IZJ A;  4XTJ A;  2UUB E;  1FWK A;  4FW9 A;  4X62 I;  1IBK E;  1XNR I;  1MG7 A;  4JI6 E;  3K1J A;  1XMQ I;  4DR7 I;  5LMU I;  4HAC B;  4NXM I;  1K47 A;  4MYU A;  4DV1 I;  4Z7Y A;  1FJG I;  2LJP A;  2VQE I;  1NHI A;  1Z5A A;  4GKJ E;  2Q2E B;  2CGE A;  3OTO E;  4OX9 I;  4DU7 A;  3QT5 A;  4DV7 I;  2NPF A;  4GKK E;  1H7S A;  4LF4 I;  2HK3 A;  4WUC A;  3WU3 A;  4JI8 I;  3J7A M;  1ELO A;  2PNM A;  3B8H A;  4X66 E;  4DV0 I;  4B3S I;  1MX0 A;  4B3M I;  1HNZ E;  1N32 I;  4AQY I;  2Z5C B;  4X64 I;  5L3J A;  2WW4 A;  3ZKD A;  4IZJ B;  1KVK A;  1IBL E;  1Y4S A;  1BKN A;  3Q6M A;  4JI5 E;  4KHP E;  4USM A;  4B3T I;  1FWL A;  4DR3 I;  3JAM C;  2ZM6 E;  2E5L I;  4LF6 E;  2O1T A;  2V2V A;  2BV3 A;  1IBM E;  3Q1Q A;  1PKP A;  3ZZU A;  4DR5 E;  3T1H E;  4I3H A;  2VQF E;  3QT8 A;  1QZR A;  2O1U A;  4LF8 I;  4LFA I;  2F4V E;  4PRX A;  4UTG A;  4K0K E;  4FWH A;  5FLX C;  2HHH I;  2UXB E;  3T1Y I;  1RR9 A;  2DEJ A;  4YY3 I;  3QT7 A;  4DV5 E;  4PU9 A;  2O1W A;  5IWA E;  1Z0E A;  3WU6 A;  1J5E E;  4LF9 E;  2BM1 A;  2UUB I;  4JYA E;  4DV4 E;  4FWG A;  2EFG A;  1HNX E;  4B3R E;  3H4L A;  2GS8 A;  2V2Q A;  2UU9 I;  4LF7 E;  3WU4 A;  1Z5C A;  3LPS A;  1XNQ E;  1ZM4 A;  4JI0 I;  4DU8 A;  4GKJ I;  1OJ4 A;  3J81 C;  4P7A A;  1FI4 A;  2IOP A;  4YHH E;  5LMN I;  4DV3 I;  4IZK A;  4DPY A;  4DR4 I;  2BM0 A;  1N34 I;  5BR8 E;  3K85 A;  5A2Q C;  1Y6Z A;  1XMO I;  1H73 A;  4DV6 E;  4JI7 I;  4JI2 E;  1ZM2 A;  2HK2 A;  1H72 C;  1USU A;  2Z5E A;  3J80 C;  4Z7C A;  4WUB A;  2UXD E;  1Z0B A;  4LFC E;  4DR2 E;  1S4E A;  4JI3 I;  4JI5 I;  4N3O A;  3V2U C;  1XNR E;  1NHJ A;  1ZXM A;  2V2Z A;  2ZBK B;  4JI4 I;  4RPF A;  4JI1 E;  1ZM3 A;  4PRV A;  4DPX A;  2ZM6 I;  4LF6 I;  3WU5 A;  4DR7 E;  1IBM I;  5LMU E;  1H74 A;  3T1H I;  4LF5 I;  1S16 A;  2HKE A;  4URL A;  4NXM E;  4DV1 E;  2GQ0 A;  1HK7 A;  2O1V A;  1HR0 I;  4K0K I;  2OI2 A;  2UXB I;  2VF3 A;  4DPT A;  1EA6 A;  3V5R A;  3QT6 A;  4IZK B;  2HKJ A;  3JAM Q;  2J7K A;  4DV5 I;  5IWA I;  4JI8 E;  2CG9 A;  3Q6N A;  1J5E I;  4HY1 A;  4DV4 I;  1B62 A;  4DV0 E;  1KTV A;  1N36 E;  4KQV A;  4DV2 I;  1N0V C;  4B3M E;  1N32 E;  4AQY E;  1I94 E;  4LF7 I;  1H7U A;  4X64 E;  5IT9 C;  5FLX Q;  1NZ0 A;  1KKH A;  3PRY A;  1HNW E;  4NXN E;  1XNQ I;  1IBK I;  4DR1 E;  1ZM9 A;  4LFB E;  1Y4U A;  4JI6 I;  4B3T E;  1PIE A;  1VIS A;  1KIJ A;  1WUU A;  4IZJ D;  1N33 E;  4DUY E;  2UXC E;  3PYE A;  5GMD A;  2IOQ A;  2Z5B A;  2UUA E;  1PVG A;  3B78 A;  4LFA E;  4M1K A;  3OTO I;  3HJC A;  4DUZ E;  4DXL A;  2XEX A;  4JI2 I;  3T1Y E;  2UUC E;  4DR6 E;  4GKK I;  1A6F A;  4YY3 E;  3PYG A;  4LFC I;  3J81 Q;  4DR2 I;  1Z59 A;  4JV5 E;  1B63 A;  2HFS A;  4X66 I;  1FNM A;  2HFU A;  3ZZT A;  4JI1 I;  4WUD A;  1HNZ I;  4MYT A;  2UU9 E;  5A2Q Q;  1FKA E;  2X7I A;  4X65 E;  1EI1 A;  2ZIT A;  1IBL I;  3J80 Q;  2E1R A;  1Z0T A;  4KHP I;  4USK A;  4X62 E;  4EMD A;  3B82 A;  4JI0 E;  3M6A A;  1XMQ E;  3F0N A;  2X36 A;  1N0U A;  3PYF A;  2Z5B B;  4DR5 I;  5LMN E;  4DV3 E;  2VQF I;  3LTO A;  2R42 A;  1FJG E;  4DR4 E;  2F4V I;  1DAR A;  1N34 E;  1N36 I;  3HUL A;  2VQE E;  2AJ4 A;  4UT4 A;  1MU5 A;  4HXZ A;  1ZXN A;  1XMO E;  1UEK A;  1I94 I;  4OX9 E;  4JI7 E;  2A2C A;  4DV7 E;  1D6T A;  4ED4 A;  4LF4 E;  3K17 A;  5GME A;  1Z0G A;  4LF9 I;  1HNW I;  4NXN I;  4JYA I;  4JI3 E;  2PNL A;  4DPW A;  4DR1 I;  1Z0V A;  4B3S E;  1Z0C A;  3PYD A;  4LFB I;  1HNX I;  3D4J A;  4B3R I;  2CZ9 A;  4JI4 E;  3ZZ0 A;  1N33 I;  3ZM7 A;  4DUY I;  2UXC I;  4LF5 E;  4HAC A;  2UUA I;  1USV A;  4DPU A;  4FN5 A;  5LL6 R;  4P52 A;  5IT9 Q;  1RRE A;  1Z5B A;  1XHK A;  4HYM A;  2V34 A;  4JG4 A;  1NHH A;  1HR0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...