4DUZI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzI00
3T1HI 3J80C 2UXCE 2HFUA 4JI3E 1XNQE 1FNMA 4YHHI 1EI1A 2UXBE 3J7AG 2NPFA 4LF4I 4PU9A 1KTVA 1IBLI 2V2VA 3JAMQ 1PVGA 4Z7CA 4GKJE 4DV1E 4JYAI 5FLXQ 1XMQI 4LF7E 4JI2I 2E1RA 1S16A 1Z0CA 4WUCA 4I3HA 1N33E 3OTOE 4DV7E 3PYGA 3PYEA 4DR7E 5IT9Q 1J5EI 4FWGA 2F4VE 5GMEA 2UXCI 2UXDE 2DEJA 4DV0I 1IBKE 1XNQI 4JI3I 4DV2I 2UXBI 1BKNA 4DV5E 3ZZUA 1DARA 1U2RA 2ZM6E 3ZKBA 4YY3I 1NHJA 4GKJI 3CWVA 4DU7A 4DV1I 2DEIA 4LF5E 4B3RI 5GMDA 4LFAI 3F0NA 1KKHA 4DPYA 3PYDA 1N33I 4URLA 3ZKDA 1HNWE 4DR4E 3QT5A 2HHHE 3K1JA 4GKKI 3OTOI 3D4JA 5BR8E 4R1FA 1Z0TA 2HKEA 4JI4E 2F4VI 4LF6E 2V34A 3LTOA 1Z0VA 5A2QC 2UUCI 4B3MI 3B82A 4WUDA 4HY1A 4PRXA 4DR1I 4DV3E 4JI7I 1HNZI 2ZBKB 1Z59A 2VF3A 1FJGI 2HKJA 1XMOI 3J7AM 4DUYI 4RPFA 1KVKA 4LF9I 2UUAI 4X62E 3H4LA 1XNRE 1FWKA 3ZM7A 5BR8I 4JI0E 4JI4I 4JI5E 4DR2I 4HACB 1ZM4A 4LF6I 5LMNE 1B62A 4DV6E 2UUBE 4JI6E 1N36E 4FWHA 4LFBE 2CZ9A 1FKAE 4X65E 1Z5BA 3HULA 4AQYE 4OX9I 4DV3I 1RR9A 3WU4A 4NXMI 3ZZ0A 4USMA 4DR6I 1Z0EA 4X62I 1PIEA 2VQEE 3Q1QA 1XNRI 1HNXE 1OJ4A 1N32E 1H72C 4UT4A 1RREA 1XHKA 4K0KE 4JI5I 4JI1I 3WU5A 2OI2A 5LMNI 1I94I 1ZXMA 1FI4A 4LFBI 2V8PA 4DUZE 4AQYI 5LMUE 4DPTA 2EFGA 1NHHA 1Z0WA 1HR0E 4LFCE 4HXZA 3K17A 1UEKA 1D6TA 4DXLA 4LF7I 1H73A 1QZRA 2AJ4A 3LNUA 1N32I 2WW4A 3QT6A 3J81C 4B3TE 1KIJA 4DV7I 4DU8A 4DR7I 4JV5E 4DUZI 4X66E 2UXDI 1IBME 1IBKI 1PKPA 1WUUA 3T1YE 5LMUI 4DR5E 4NXNE 3QT7A 4DV5I 1MU5A 2ZM6I 4LFCI 4DPWA 4B3SE 1Z0BA 2VQFE 4KHPE 3B78A 5A2QQ 4LF5I 2XEXA 2A2CA 4P7AA 1H74A 1HNWI 4DR4I 2HHHI 3M6AA 4MYUA 4LF4E 4UTGA 4JV5I 4USKA 2X7IA 1ZM3A 3PYFA 2HK3A 4HYMA 2UU9E 4X66I 4FWDA 4JYAE 1IBMI 1N34E 4DV4E 1XMQE 4NXNI 4JI2E 1N0VC 1Z0GA 3V2UC 4KQVA 2HFSA 4B3SI 2ZITA 4M1KA 2VQFI 4KHPI 2BM0A 4P52A 1H7SA 4ZVIA 1Z5CA 1J5EE 3JAMC 1S4EA 3B8HA 3J80Q 5FLXC 1NZ0A 4DV0E 4DV2E 4FW9A 4JI0I 3WU3A 4HACA 1A6FA 4YY3E 4JI8E 2UU9I 4EMDA 4DV6I 2UUBI 4JI6I 5IT9C 1N36I 1N34I 4DV4I 4B3RE 4X65I 2HK2A 4LFAE 1ZXNA 4WUBA 4Z7YA 4GKKE 1N0UA 1FWLA 4DR3E 1H7UA 2VQEI 1B63A 1MG7A 4DPXA 2UUCE 1MX0A 1VISA 1EA6A 4B3ME 5IWAE 2Q2EB 1HNXI 2GS8A 4ED4A 5LL6R 4K0KI 4X64E 3ZZTA 4DR1E 4JI8I 4JI7E 1HNZE 1FJGE 2BM1A 1XMOE 4DUYE 1Z5AA 4FN5A 4LF9E 4PRVA 4XTJA 2UUAE 2BV3A 3WU6A 3J81Q 2R42A 4JG4A 2R3VA 4LF8E 1HR0I 1NHIA 1ZM2A 2V2ZA 4DR3I 2X36A 2V2QA 4DR2E 2E5LE 5IWAI 3T1HE 4B3TI 4X64I 4YHHE 4OX9E 1ELOA 4MYTA 3GONA 4DPUA 1K47A 1IBLE 5L3JA 2A2DA 4NXME 1ZM9A 4DR6E 3T1YI 4DR5I 4LF8I 3V5RA 3QT8A 2J7KA 2LJPA 3LPSA 4JI1E 2E5LI 1I94E
chains in the Genus database with same CATH superfamily
3T1HI 3J80C 2PO2B 2UXCE 2HFUA 4JI3E 1XNQE 1FNMA 4YHHI 1EI1A 2UXBE 3J7AG 2NPFA 4LF4I 4PU9A 3H1CA 1KTVA 2BR2B 1UDSA 1R6MA 1IBLI 1UDNA 2V2VA 3JAMQ 1PVGA 4Z7CA 4GKJE 3PRYA 4DV1E 4JYAI 4BA2A 3GLLA 5FLXQ 5JEAA 1XMQI 4LF7E 4OO1E 3UHMA 4JI2I 2E1RA 1S16A 1Z0CA 4WUCA 4I3HA 1N33E 1VI7A 2Z5CB 2NN6E 4FW4A 3OTOE 4DV7E 3PYGA 3U1KA 5DNLA 3PYEA 4DR7E 5IT9Q 1J5EI 4FWGA 2F4VE 5GMEA 2UXCI 2UXDE 2DEJA 4DV0I 1IBKE 1XNQI 4JI3I 4DV2I 1USVA 2UXBI 5FWKA 5C0XB 1BKNA 4DV5E 3ZZUA 1DARA 1U2RA 2CG9A 4MQYA 2ZM6E 3ZKBA 4U3BA 4YY3I 1NHJA 4GKJI 3CWVA 4DU7A 5JEAF 4DV1I 2DEIA 1YHCA 4LF5E 4B3RI 5GMDA 4LFAI 3F0NA 1KKHA 3U1YA 4DPYA 3PYDA 5JEAD 4IFDA 1N33I 4URLA 3ZKDA 1HNWE 4DR4E 3QT5A 2HHHE 3K1JA 4GKKI 5K36F 2PNZB 3OTOI 3D4JA 2O1VA 5BR8E 4R1FA 1Z0TA 2HKEA 4JI4E 2F4VI 3Q6NA 4LF6E 4LCGA 2V34A 3LTOA 1Z0VA 5A2QC 2UUCI 3L7ZA 4B3MI 3B82A 4WUDA 4HY1A 4J3DA 4PRXA 3P06A 4DV3E 4DR1I 2PO0A 4JI7I 5C0XE 1HNZI 2ZBKB 1Z59A 2VF3A 1FJGI 2HKJA 1XMOI 3J7AM 3DD6A 4DUYI 4IFDF 4RPFA 2VESA 1KVKA 4LF9I 2GO3A 3M7ND 2UUAI 4X62E 3P3EA 3H4LA 4FW5A 1XNRE 4IFDD 1FWKA 3ZM7A 5BR8I 4FW7A 4JI0E 4JI4I 4JI5E 4DR2I 4HACB 4N3OA 1ZM4A 4LF6I 5LMNE 1B62A 2JEAA 2PO1A 4DV6E 2UUBE 4JI6E 1N36E 2BA1G 4FWHA 4LFBE 2CZ9A 1FKAE 1E3PA 3M85G 4X65E 1Z5BA 3HULA 4AQYE 1HK7A 4OX9I 4DV3I 2CVEA 4IZJA 1RR9A 3P76A 3WU4A 4OO1A 4NXMI 2WP8B 2BA0D 3ZZ0A 4USMA 4DR6I 1Z0EA 4X62I 1PIEA 2VQEE 2Z5BA 3Q1QA 1USUA 1XNRI 1HNXE 1OJ4A 1N32E 1H72C 4UT4A 1RREA 4NBQA 1XHKA 4K0KE 4JI5I 4FW6A 4JI1I 5K36A 3WU5A 2OI2A 3PS2A 5LMNI 1I94I 1ZXMA 3GMEA 1FI4A 4LFBI 2PO2A 2V8PA 4OO1C 4DUZE 5DNXA 4AQYI 4AM3A 5LMUE 5JEAC 4OO1F 4DPTA 2EFGA 1NHHA 1Z0WA 1HR0E 4LFCE 3HJCA 4LCHA 4HXZA 2NN6F 4IZJD 3K17A 3K85A 1UEKA 2Z5EA 4OO1D 1D6TA 5K36C 4DXLA 4LF7I 1H73A 5DROA 2O3ZA 1QZRA 2AJ4A 3LNUA 3L7ZB 2Z5CA 1N32I 4IZKB 2WW4A 3QT6A 3J81C 4B3TE 2CGEA 1KIJA 3CDIA 4DV7I 4DU8A 2WNRB 4DR7I 1YH8A 2PO0B 4JV5E 2JT2A 5K36D 4BA1B 2JEBB 1E3HA 4DUZI 4X66E 2UXDI 1IBME 1IBKI 1PKPA 2JE6B 1WUUA 5C0XA 3T1YE 5LMUI 4DR5E 4NXNE 1OYSA 2C39B 3QT7A 4DV5I 1MU5A 3GCMA 2ZM6I 4LFCI 4IFDC 4DPWA 2AE8A 4B3SE 1Z0BA 2VQFE 4KHPE 2C37A 3B78A 5A2QQ 4LF5I 2XEXA 4GQUA 2A2CA 2PO1B 4P7AA 1H74A 2PNZA 1HNWI 4DR4I 2HHHI 3M6AA 2O1TA 4MYUA 5C0XC 4LF4E 4UTGA 4JV5I 4USKA 4IZJB 1UDOA 2X7IA 1ZM3A 1R6LA 2HK3A 3PYFA 4HYMA 2UU9E 3NZKA 2O1WA 4FWDA 5C0XF 4X66I 4IS9A 4JYAE 1IBMI 1N34E 4BA2B 1Y5YA 4DV4E 1XMQE 5JEAB 4NXNI 4JI2E 1N0VC 1Z0GA 2IOPA 3V2UC 4FW3A 4LOMA 5C0XD 4KQVA 2C38A 2HFSA 4B3SI 2ZITA 4LCFA 4M1KA 2VQFI 4KHPI 2BM0A 4P52A 1H7SA 4ZVIA 5K36B 1Z5CA 1J5EE 3P3CA 3JAMC 1OYPA 1S4EA 3B8HA 3M7NG 3J80Q 2NN6A 5FLXC 1NZ0A 4DV0E 3HKMA 4DV2E 5EKWA 4FW9A 2O1UA 4JI0I 3WU3A 4HACA 3CDJA 1A6FA 4AIMA 4YY3E 4JI8E 2GO4A 2UU9I 4EMDA 4DV6I 2UUBI 4JI6I 5IT9C 1N36I 1N34I 4DV4I 4B3RE 3B4TA 4X65I 2HK2A 4LFAE 1ZXNA 4WUBA 2NN6C 4IFDB 4Z7YA 2BR2A 2F1DA 4GKKE 5JEAE 1N0UA 1Y60A 4MDTA 2WP8A 1FWLA 4MU0A 4DR3E 2BA0G 1H7UA 5DRQA 2VQEI 1B63A 3P3GA 1MG7A 4DPXA 2UUCE 1MX0A 1VISA 5K36E 1EA6A 2NN6D 4B3ME 5IWAE 2Q2EB 1HNXI 2GS8A 4ED4A 3KRNA 4OKGA 5LL6R 4MU1A 4QNJA 4K0KI 5DRPA 4X64E 4U3DA 1Y4UA 3ZZTA 5EL9A 4DR1E 1OYRA 4JI8I 4JI7E 1HNZE 1FJGE 3Q6MA 2BM1A 1XMOE 2C37B 4DUYE 2IERA 1Z5AA 4FN5A 3PS1A 4LF9E 4PRVA 4XTJA 2UUAE 2IESA 2IOQA 1Y4SA 2BV3A 4ISAA 3WU6A 3J81Q 2R42A 4JG4A 2R3VA 4LF8E 1HR0I 1NHIA 1ZM2A 2V2ZA 4IFDE 4DR3I 2X36A 2V2QA 4DR2E 2PNMA 2E5LE 1UDQA 2JEAB 2BA1D 5IWAI 3T1HE 2J65A 4IZKA 4MU4A 4LPFA 4MU3A 3M85D 4B3TI 2WNRA 4X64I 4YHHE 4OX9E 1ELOA 4MYTA 2PNLA 2C38B 5ELWA 4BA1A 3GONA 3PS3A 4DPUA 1K47A 2JEBA 1IBLE 1Y6ZA 5L3JA 4OO1B 2A2DA 4NXME 5DRRA 1ZM9A 2JE6A 4DR6E 1RHYA 3T1YI 2C39A 2NN6B 4DR5I 4AIDA 2Z5BB 4LF8I 1XXEA 3V5RA 3QT8A 2J7KA 4QNKA 2LJPA 3LPSA 1P42A 4JI1E 4OZEA 2GQ0A 2E5LI 1I94E
chains in the Genus database with same CATH topology
3T1HI 3J80C 2UXCE 2HFUA 4JI3E 1XNQE 1FNMA 4YHHI 1EI1A 2UXBE 3J7AG 2NPFA 4LF4I 4PU9A 1KTVA 1IBLI 2V2VA 3JAMQ 1PVGA 4Z7CA 4GKJE 3PRYA 4DV1E 4JYAI 5FLXQ 1XMQI 4LF7E 4JI2I 2E1RA 1S16A 1Z0CA 4WUCA 4I3HA 1N33E 2Z5CB 3OTOE 4DV7E 3PYGA 3PYEA 4DR7E 5IT9Q 1J5EI 4FWGA 2F4VE 5GMEA 2UXCI 2UXDE 2DEJA 4DV0I 1IBKE 1XNQI 4JI3I 4DV2I 1USVA 2UXBI 5FWKA 1BKNA 4DV5E 3ZZUA 1DARA 1U2RA 2CG9A 2ZM6E 3ZKBA 4YY3I 1NHJA 4GKJI 3CWVA 4DU7A 4DV1I 2DEIA 4LF5E 4B3RI 5GMDA 4LFAI 3F0NA 1KKHA 4DPYA 3PYDA 1N33I 4URLA 3ZKDA 1HNWE 4DR4E 3QT5A 2HHHE 3K1JA 4GKKI 3OTOI 3D4JA 2O1VA 5BR8E 4R1FA 1Z0TA 2HKEA 4JI4E 2F4VI 3Q6NA 4LF6E 2V34A 3LTOA 1Z0VA 5A2QC 2UUCI 4B3MI 3B82A 4WUDA 4HY1A 4PRXA 3P06A 4DV3E 4DR1I 4JI7I 1HNZI 2ZBKB 1Z59A 2VF3A 1FJGI 2HKJA 1XMOI 3J7AM 4DUYI 4RPFA 1KVKA 4LF9I 2UUAI 4X62E 3H4LA 1XNRE 1FWKA 3ZM7A 5BR8I 4JI0E 4JI4I 4JI5E 4DR2I 4HACB 4N3OA 1ZM4A 4LF6I 5LMNE 1B62A 4DV6E 2UUBE 4JI6E 1N36E 4FWHA 4LFBE 2CZ9A 1FKAE 4X65E 1Z5BA 3HULA 4AQYE 1HK7A 4OX9I 4DV3I 4IZJA 1RR9A 3WU4A 4NXMI 3ZZ0A 4USMA 4DR6I 1Z0EA 4X62I 1PIEA 2VQEE 2Z5BA 3Q1QA 1USUA 1XNRI 1HNXE 1OJ4A 1N32E 1H72C 4UT4A 1RREA 1XHKA 4K0KE 4JI5I 4JI1I 3WU5A 2OI2A 5LMNI 1I94I 1ZXMA 1FI4A 4LFBI 2V8PA 4DUZE 4AQYI 5LMUE 4DPTA 2EFGA 1NHHA 1Z0WA 1HR0E 4LFCE 3HJCA 4HXZA 4IZJD 3K17A 3K85A 1UEKA 2Z5EA 1D6TA 4DXLA 4LF7I 1H73A 1QZRA 2AJ4A 3LNUA 2Z5CA 1N32I 4IZKB 2WW4A 3QT6A 3J81C 4B3TE 2CGEA 1KIJA 4DV7I 4DU8A 4DR7I 4JV5E 4DUZI 4X66E 2UXDI 1IBME 1IBKI 1PKPA 1WUUA 3T1YE 5LMUI 4DR5E 4NXNE 3QT7A 4DV5I 1MU5A 2ZM6I 4LFCI 4DPWA 4B3SE 1Z0BA 2VQFE 4KHPE 3B78A 5A2QQ 4LF5I 2XEXA 2A2CA 4P7AA 1H74A 1HNWI 4DR4I 2HHHI 3M6AA 2O1TA 4MYUA 4LF4E 4UTGA 4JV5I 4USKA 4IZJB 2X7IA 1ZM3A 3PYFA 2HK3A 4HYMA 2UU9E 2O1WA 4FWDA 4X66I 4JYAE 1IBMI 1N34E 4DV4E 1XMQE 4NXNI 4JI2E 1N0VC 1Z0GA 2IOPA 3V2UC 4KQVA 2HFSA 4B3SI 2ZITA 4M1KA 2VQFI 4KHPI 2BM0A 4P52A 1H7SA 4ZVIA 1Z5CA 1J5EE 3JAMC 1S4EA 3B8HA 3J80Q 5FLXC 1NZ0A 4DV0E 4DV2E 4FW9A 2O1UA 4JI0I 3WU3A 4HACA 1A6FA 4YY3E 4JI8E 2UU9I 4EMDA 4DV6I 2UUBI 4JI6I 5IT9C 1N36I 1N34I 4DV4I 4B3RE 4X65I 2HK2A 4LFAE 1ZXNA 4WUBA 4Z7YA 4GKKE 1N0UA 1FWLA 4DR3E 1H7UA 2VQEI 1B63A 1MG7A 4DPXA 2UUCE 1MX0A 1VISA 1EA6A 4B3ME 5IWAE 2Q2EB 1HNXI 2GS8A 4ED4A 5LL6R 4K0KI 4X64E 1Y4UA 3ZZTA 4DR1E 4JI8I 4JI7E 1HNZE 1FJGE 3Q6MA 2BM1A 1XMOE 4DUYE 1Z5AA 4FN5A 4LF9E 4PRVA 4XTJA 2UUAE 2IOQA 1Y4SA 2BV3A 3WU6A 3J81Q 2R42A 4JG4A 2R3VA 4LF8E 1HR0I 1NHIA 1ZM2A 2V2ZA 4DR3I 2X36A 2V2QA 4DR2E 2PNMA 2E5LE 5IWAI 3T1HE 4IZKA 4B3TI 4X64I 4YHHE 4OX9E 1ELOA 4MYTA 2PNLA 3GONA 4DPUA 1K47A 1IBLE 1Y6ZA 5L3JA 2A2DA 4NXME 1ZM9A 4DR6E 3T1YI 4DR5I 2Z5BB 4LF8I 3V5RA 3QT8A 2J7KA 2LJPA 3LPSA 4JI1E 2GQ0A 2E5LI 1I94E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H I;  3J80 C;  2UXC E;  2HFU A;  4JI3 E;  1XNQ E;  1FNM A;  4YHH I;  1EI1 A;  2UXB E;  3J7A G;  2NPF A;  4LF4 I;  4PU9 A;  1KTV A;  1IBL I;  2V2V A;  3JAM Q;  1PVG A;  4Z7C A;  4GKJ E;  4DV1 E;  4JYA I;  5FLX Q;  1XMQ I;  4LF7 E;  4JI2 I;  2E1R A;  1S16 A;  1Z0C A;  4WUC A;  4I3H A;  1N33 E;  3OTO E;  4DV7 E;  3PYG A;  3PYE A;  4DR7 E;  5IT9 Q;  1J5E I;  4FWG A;  2F4V E;  5GME A;  2UXC I;  2UXD E;  2DEJ A;  4DV0 I;  1IBK E;  1XNQ I;  4JI3 I;  4DV2 I;  2UXB I;  1BKN A;  4DV5 E;  3ZZU A;  1DAR A;  1U2R A;  2ZM6 E;  3ZKB A;  4YY3 I;  1NHJ A;  4GKJ I;  3CWV A;  4DU7 A;  4DV1 I;  2DEI A;  4LF5 E;  4B3R I;  5GMD A;  4LFA I;  3F0N A;  1KKH A;  4DPY A;  3PYD A;  1N33 I;  4URL A;  3ZKD A;  1HNW E;  4DR4 E;  3QT5 A;  2HHH E;  3K1J A;  4GKK I;  3OTO I;  3D4J A;  5BR8 E;  4R1F A;  1Z0T A;  2HKE A;  4JI4 E;  2F4V I;  4LF6 E;  2V34 A;  3LTO A;  1Z0V A;  5A2Q C;  2UUC I;  4B3M I;  3B82 A;  4WUD A;  4HY1 A;  4PRX A;  4DR1 I;  4DV3 E;  4JI7 I;  1HNZ I;  2ZBK B;  1Z59 A;  2VF3 A;  1FJG I;  2HKJ A;  1XMO I;  3J7A M;  4DUY I;  4RPF A;  1KVK A;  4LF9 I;  2UUA I;  4X62 E;  3H4L A;  1XNR E;  1FWK A;  3ZM7 A;  5BR8 I;  4JI0 E;  4JI4 I;  4JI5 E;  4DR2 I;  4HAC B;  1ZM4 A;  4LF6 I;  5LMN E;  1B62 A;  4DV6 E;  2UUB E;  4JI6 E;  1N36 E;  4FWH A;  4LFB E;  2CZ9 A;  1FKA E;  4X65 E;  1Z5B A;  3HUL A;  4AQY E;  4OX9 I;  4DV3 I;  1RR9 A;  3WU4 A;  4NXM I;  3ZZ0 A;  4USM A;  4DR6 I;  1Z0E A;  4X62 I;  1PIE A;  2VQE E;  3Q1Q A;  1XNR I;  1HNX E;  1OJ4 A;  1N32 E;  1H72 C;  4UT4 A;  1RRE A;  1XHK A;  4K0K E;  4JI5 I;  4JI1 I;  3WU5 A;  2OI2 A;  5LMN I;  1I94 I;  1ZXM A;  1FI4 A;  4LFB I;  2V8P A;  4DUZ E;  4AQY I;  5LMU E;  4DPT A;  2EFG A;  1NHH A;  1Z0W A;  1HR0 E;  4LFC E;  4HXZ A;  3K17 A;  1UEK A;  1D6T A;  4DXL A;  4LF7 I;  1H73 A;  1QZR A;  2AJ4 A;  3LNU A;  1N32 I;  2WW4 A;  3QT6 A;  3J81 C;  4B3T E;  1KIJ A;  4DV7 I;  4DU8 A;  4DR7 I;  4JV5 E;  4DUZ I;  4X66 E;  2UXD I;  1IBM E;  1IBK I;  1PKP A;  1WUU A;  3T1Y E;  5LMU I;  4DR5 E;  4NXN E;  3QT7 A;  4DV5 I;  1MU5 A;  2ZM6 I;  4LFC I;  4DPW A;  4B3S E;  1Z0B A;  2VQF E;  4KHP E;  3B78 A;  5A2Q Q;  4LF5 I;  2XEX A;  2A2C A;  4P7A A;  1H74 A;  1HNW I;  4DR4 I;  2HHH I;  3M6A A;  4MYU A;  4LF4 E;  4UTG A;  4JV5 I;  4USK A;  2X7I A;  1ZM3 A;  3PYF A;  2HK3 A;  4HYM A;  2UU9 E;  4X66 I;  4FWD A;  4JYA E;  1IBM I;  1N34 E;  4DV4 E;  1XMQ E;  4NXN I;  4JI2 E;  1N0V C;  1Z0G A;  3V2U C;  4KQV A;  2HFS A;  4B3S I;  2ZIT A;  4M1K A;  2VQF I;  4KHP I;  2BM0 A;  4P52 A;  1H7S A;  4ZVI A;  1Z5C A;  1J5E E;  3JAM C;  1S4E A;  3B8H A;  3J80 Q;  5FLX C;  1NZ0 A;  4DV0 E;  4DV2 E;  4FW9 A;  4JI0 I;  3WU3 A;  4HAC A;  1A6F A;  4YY3 E;  4JI8 E;  2UU9 I;  4EMD A;  4DV6 I;  2UUB I;  4JI6 I;  5IT9 C;  1N36 I;  1N34 I;  4DV4 I;  4B3R E;  4X65 I;  2HK2 A;  4LFA E;  1ZXN A;  4WUB A;  4Z7Y A;  4GKK E;  1N0U A;  1FWL A;  4DR3 E;  1H7U A;  2VQE I;  1B63 A;  1MG7 A;  4DPX A;  2UUC E;  1MX0 A;  1VIS A;  1EA6 A;  4B3M E;  5IWA E;  2Q2E B;  1HNX I;  2GS8 A;  4ED4 A;  5LL6 R;  4K0K I;  4X64 E;  3ZZT A;  4DR1 E;  4JI8 I;  4JI7 E;  1HNZ E;  1FJG E;  2BM1 A;  1XMO E;  4DUY E;  1Z5A A;  4FN5 A;  4LF9 E;  4PRV A;  4XTJ A;  2UUA E;  2BV3 A;  3WU6 A;  3J81 Q;  2R42 A;  4JG4 A;  2R3V A;  4LF8 E;  1HR0 I;  1NHI A;  1ZM2 A;  2V2Z A;  4DR3 I;  2X36 A;  2V2Q A;  4DR2 E;  2E5L E;  5IWA I;  3T1H E;  4B3T I;  4X64 I;  4YHH E;  4OX9 E;  1ELO A;  4MYT A;  3GON A;  4DPU A;  1K47 A;  1IBL E;  5L3J A;  2A2D A;  4NXM E;  1ZM9 A;  4DR6 E;  3T1Y I;  4DR5 I;  4LF8 I;  3V5R A;  3QT8 A;  2J7K A;  2LJP A;  3LPS A;  4JI1 E;  2E5L I;  1I94 E; 
#chains in the Genus database with same CATH topology
 3T1H I;  3J80 C;  2PO2 B;  2UXC E;  2HFU A;  4JI3 E;  1XNQ E;  1FNM A;  4YHH I;  1EI1 A;  2UXB E;  3J7A G;  2NPF A;  4LF4 I;  4PU9 A;  3H1C A;  1KTV A;  2BR2 B;  1UDS A;  1R6M A;  1IBL I;  1UDN A;  2V2V A;  3JAM Q;  1PVG A;  4Z7C A;  4GKJ E;  3PRY A;  4DV1 E;  4JYA I;  4BA2 A;  3GLL A;  5FLX Q;  5JEA A;  1XMQ I;  4LF7 E;  4OO1 E;  3UHM A;  4JI2 I;  2E1R A;  1S16 A;  1Z0C A;  4WUC A;  4I3H A;  1N33 E;  1VI7 A;  2Z5C B;  2NN6 E;  4FW4 A;  3OTO E;  4DV7 E;  3PYG A;  3U1K A;  5DNL A;  3PYE A;  4DR7 E;  5IT9 Q;  1J5E I;  4FWG A;  2F4V E;  5GME A;  2UXC I;  2UXD E;  2DEJ A;  4DV0 I;  1IBK E;  1XNQ I;  4JI3 I;  4DV2 I;  1USV A;  2UXB I;  5FWK A;  5C0X B;  1BKN A;  4DV5 E;  3ZZU A;  1DAR A;  1U2R A;  2CG9 A;  4MQY A;  2ZM6 E;  3ZKB A;  4U3B A;  4YY3 I;  1NHJ A;  4GKJ I;  3CWV A;  4DU7 A;  5JEA F;  4DV1 I;  2DEI A;  1YHC A;  4LF5 E;  4B3R I;  5GMD A;  4LFA I;  3F0N A;  1KKH A;  3U1Y A;  4DPY A;  3PYD A;  5JEA D;  4IFD A;  1N33 I;  4URL A;  3ZKD A;  1HNW E;  4DR4 E;  3QT5 A;  2HHH E;  3K1J A;  4GKK I;  5K36 F;  2PNZ B;  3OTO I;  3D4J A;  2O1V A;  5BR8 E;  4R1F A;  1Z0T A;  2HKE A;  4JI4 E;  2F4V I;  3Q6N A;  4LF6 E;  4LCG A;  2V34 A;  3LTO A;  1Z0V A;  5A2Q C;  2UUC I;  3L7Z A;  4B3M I;  3B82 A;  4WUD A;  4HY1 A;  4J3D A;  4PRX A;  3P06 A;  4DV3 E;  4DR1 I;  2PO0 A;  4JI7 I;  5C0X E;  1HNZ I;  2ZBK B;  1Z59 A;  2VF3 A;  1FJG I;  2HKJ A;  1XMO I;  3J7A M;  3DD6 A;  4DUY I;  4IFD F;  4RPF A;  2VES A;  1KVK A;  4LF9 I;  2GO3 A;  3M7N D;  2UUA I;  4X62 E;  3P3E A;  3H4L A;  4FW5 A;  1XNR E;  4IFD D;  1FWK A;  3ZM7 A;  5BR8 I;  4FW7 A;  4JI0 E;  4JI4 I;  4JI5 E;  4DR2 I;  4HAC B;  4N3O A;  1ZM4 A;  4LF6 I;  5LMN E;  1B62 A;  2JEA A;  2PO1 A;  4DV6 E;  2UUB E;  4JI6 E;  1N36 E;  2BA1 G;  4FWH A;  4LFB E;  2CZ9 A;  1FKA E;  1E3P A;  3M85 G;  4X65 E;  1Z5B A;  3HUL A;  4AQY E;  1HK7 A;  4OX9 I;  4DV3 I;  2CVE A;  4IZJ A;  1RR9 A;  3P76 A;  3WU4 A;  4OO1 A;  4NXM I;  2WP8 B;  2BA0 D;  3ZZ0 A;  4USM A;  4DR6 I;  1Z0E A;  4X62 I;  1PIE A;  2VQE E;  2Z5B A;  3Q1Q A;  1USU A;  1XNR I;  1HNX E;  1OJ4 A;  1N32 E;  1H72 C;  4UT4 A;  1RRE A;  4NBQ A;  1XHK A;  4K0K E;  4JI5 I;  4FW6 A;  4JI1 I;  5K36 A;  3WU5 A;  2OI2 A;  3PS2 A;  5LMN I;  1I94 I;  1ZXM A;  3GME A;  1FI4 A;  4LFB I;  2PO2 A;  2V8P A;  4OO1 C;  4DUZ E;  5DNX A;  4AQY I;  4AM3 A;  5LMU E;  5JEA C;  4OO1 F;  4DPT A;  2EFG A;  1NHH A;  1Z0W A;  1HR0 E;  4LFC E;  3HJC A;  4LCH A;  4HXZ A;  2NN6 F;  4IZJ D;  3K17 A;  3K85 A;  1UEK A;  2Z5E A;  4OO1 D;  1D6T A;  5K36 C;  4DXL A;  4LF7 I;  1H73 A;  5DRO A;  2O3Z A;  1QZR A;  2AJ4 A;  3LNU A;  3L7Z B;  2Z5C A;  1N32 I;  4IZK B;  2WW4 A;  3QT6 A;  3J81 C;  4B3T E;  2CGE A;  1KIJ A;  3CDI A;  4DV7 I;  4DU8 A;  2WNR B;  4DR7 I;  1YH8 A;  2PO0 B;  4JV5 E;  2JT2 A;  5K36 D;  4BA1 B;  2JEB B;  1E3H A;  4DUZ I;  4X66 E;  2UXD I;  1IBM E;  1IBK I;  1PKP A;  2JE6 B;  1WUU A;  5C0X A;  3T1Y E;  5LMU I;  4DR5 E;  4NXN E;  1OYS A;  2C39 B;  3QT7 A;  4DV5 I;  1MU5 A;  3GCM A;  2ZM6 I;  4LFC I;  4IFD C;  4DPW A;  2AE8 A;  4B3S E;  1Z0B A;  2VQF E;  4KHP E;  2C37 A;  3B78 A;  5A2Q Q;  4LF5 I;  2XEX A;  4GQU A;  2A2C A;  2PO1 B;  4P7A A;  1H74 A;  2PNZ A;  1HNW I;  4DR4 I;  2HHH I;  3M6A A;  2O1T A;  4MYU A;  5C0X C;  4LF4 E;  4UTG A;  4JV5 I;  4USK A;  4IZJ B;  1UDO A;  2X7I A;  1ZM3 A;  1R6L A;  2HK3 A;  3PYF A;  4HYM A;  2UU9 E;  3NZK A;  2O1W A;  4FWD A;  5C0X F;  4X66 I;  4IS9 A;  4JYA E;  1IBM I;  1N34 E;  4BA2 B;  1Y5Y A;  4DV4 E;  1XMQ E;  5JEA B;  4NXN I;  4JI2 E;  1N0V C;  1Z0G A;  2IOP A;  3V2U C;  4FW3 A;  4LOM A;  5C0X D;  4KQV A;  2C38 A;  2HFS A;  4B3S I;  2ZIT A;  4LCF A;  4M1K A;  2VQF I;  4KHP I;  2BM0 A;  4P52 A;  1H7S A;  4ZVI A;  5K36 B;  1Z5C A;  1J5E E;  3P3C A;  3JAM C;  1OYP A;  1S4E A;  3B8H A;  3M7N G;  3J80 Q;  2NN6 A;  5FLX C;  1NZ0 A;  4DV0 E;  3HKM A;  4DV2 E;  5EKW A;  4FW9 A;  2O1U A;  4JI0 I;  3WU3 A;  4HAC A;  3CDJ A;  1A6F A;  4AIM A;  4YY3 E;  4JI8 E;  2GO4 A;  2UU9 I;  4EMD A;  4DV6 I;  2UUB I;  4JI6 I;  5IT9 C;  1N36 I;  1N34 I;  4DV4 I;  4B3R E;  3B4T A;  4X65 I;  2HK2 A;  4LFA E;  1ZXN A;  4WUB A;  2NN6 C;  4IFD B;  4Z7Y A;  2BR2 A;  2F1D A;  4GKK E;  5JEA E;  1N0U A;  1Y60 A;  4MDT A;  2WP8 A;  1FWL A;  4MU0 A;  4DR3 E;  2BA0 G;  1H7U A;  5DRQ A;  2VQE I;  1B63 A;  3P3G A;  1MG7 A;  4DPX A;  2UUC E;  1MX0 A;  1VIS A;  5K36 E;  1EA6 A;  2NN6 D;  4B3M E;  5IWA E;  2Q2E B;  1HNX I;  2GS8 A;  4ED4 A;  3KRN A;  4OKG A;  5LL6 R;  4MU1 A;  4QNJ A;  4K0K I;  5DRP A;  4X64 E;  4U3D A;  1Y4U A;  3ZZT A;  5EL9 A;  4DR1 E;  1OYR A;  4JI8 I;  4JI7 E;  1HNZ E;  1FJG E;  3Q6M A;  2BM1 A;  1XMO E;  2C37 B;  4DUY E;  2IER A;  1Z5A A;  4FN5 A;  3PS1 A;  4LF9 E;  4PRV A;  4XTJ A;  2UUA E;  2IES A;  2IOQ A;  1Y4S A;  2BV3 A;  4ISA A;  3WU6 A;  3J81 Q;  2R42 A;  4JG4 A;  2R3V A;  4LF8 E;  1HR0 I;  1NHI A;  1ZM2 A;  2V2Z A;  4IFD E;  4DR3 I;  2X36 A;  2V2Q A;  4DR2 E;  2PNM A;  2E5L E;  1UDQ A;  2JEA B;  2BA1 D;  5IWA I;  3T1H E;  2J65 A;  4IZK A;  4MU4 A;  4LPF A;  4MU3 A;  3M85 D;  4B3T I;  2WNR A;  4X64 I;  4YHH E;  4OX9 E;  1ELO A;  4MYT A;  2PNL A;  2C38 B;  5ELW A;  4BA1 A;  3GON A;  3PS3 A;  4DPU A;  1K47 A;  2JEB A;  1IBL E;  1Y6Z A;  5L3J A;  4OO1 B;  2A2D A;  4NXM E;  5DRR A;  1ZM9 A;  2JE6 A;  4DR6 E;  1RHY A;  3T1Y I;  2C39 A;  2NN6 B;  4DR5 I;  4AID A;  2Z5B B;  4LF8 I;  1XXE A;  3V5R A;  3QT8 A;  2J7K A;  4QNK A;  2LJP A;  3LPS A;  1P42 A;  4JI1 E;  4OZE A;  2GQ0 A;  2E5L I;  1I94 E; 
#chains in the Genus database with same CATH homology
 3T1H I;  3J80 C;  2UXC E;  2HFU A;  4JI3 E;  1XNQ E;  1FNM A;  4YHH I;  1EI1 A;  2UXB E;  3J7A G;  2NPF A;  4LF4 I;  4PU9 A;  1KTV A;  1IBL I;  2V2V A;  3JAM Q;  1PVG A;  4Z7C A;  4GKJ E;  3PRY A;  4DV1 E;  4JYA I;  5FLX Q;  1XMQ I;  4LF7 E;  4JI2 I;  2E1R A;  1S16 A;  1Z0C A;  4WUC A;  4I3H A;  1N33 E;  2Z5C B;  3OTO E;  4DV7 E;  3PYG A;  3PYE A;  4DR7 E;  5IT9 Q;  1J5E I;  4FWG A;  2F4V E;  5GME A;  2UXC I;  2UXD E;  2DEJ A;  4DV0 I;  1IBK E;  1XNQ I;  4JI3 I;  4DV2 I;  1USV A;  2UXB I;  5FWK A;  1BKN A;  4DV5 E;  3ZZU A;  1DAR A;  1U2R A;  2CG9 A;  2ZM6 E;  3ZKB A;  4YY3 I;  1NHJ A;  4GKJ I;  3CWV A;  4DU7 A;  4DV1 I;  2DEI A;  4LF5 E;  4B3R I;  5GMD A;  4LFA I;  3F0N A;  1KKH A;  4DPY A;  3PYD A;  1N33 I;  4URL A;  3ZKD A;  1HNW E;  4DR4 E;  3QT5 A;  2HHH E;  3K1J A;  4GKK I;  3OTO I;  3D4J A;  2O1V A;  5BR8 E;  4R1F A;  1Z0T A;  2HKE A;  4JI4 E;  2F4V I;  3Q6N A;  4LF6 E;  2V34 A;  3LTO A;  1Z0V A;  5A2Q C;  2UUC I;  4B3M I;  3B82 A;  4WUD A;  4HY1 A;  4PRX A;  3P06 A;  4DV3 E;  4DR1 I;  4JI7 I;  1HNZ I;  2ZBK B;  1Z59 A;  2VF3 A;  1FJG I;  2HKJ A;  1XMO I;  3J7A M;  4DUY I;  4RPF A;  1KVK A;  4LF9 I;  2UUA I;  4X62 E;  3H4L A;  1XNR E;  1FWK A;  3ZM7 A;  5BR8 I;  4JI0 E;  4JI4 I;  4JI5 E;  4DR2 I;  4HAC B;  4N3O A;  1ZM4 A;  4LF6 I;  5LMN E;  1B62 A;  4DV6 E;  2UUB E;  4JI6 E;  1N36 E;  4FWH A;  4LFB E;  2CZ9 A;  1FKA E;  4X65 E;  1Z5B A;  3HUL A;  4AQY E;  1HK7 A;  4OX9 I;  4DV3 I;  4IZJ A;  1RR9 A;  3WU4 A;  4NXM I;  3ZZ0 A;  4USM A;  4DR6 I;  1Z0E A;  4X62 I;  1PIE A;  2VQE E;  2Z5B A;  3Q1Q A;  1USU A;  1XNR I;  1HNX E;  1OJ4 A;  1N32 E;  1H72 C;  4UT4 A;  1RRE A;  1XHK A;  4K0K E;  4JI5 I;  4JI1 I;  3WU5 A;  2OI2 A;  5LMN I;  1I94 I;  1ZXM A;  1FI4 A;  4LFB I;  2V8P A;  4DUZ E;  4AQY I;  5LMU E;  4DPT A;  2EFG A;  1NHH A;  1Z0W A;  1HR0 E;  4LFC E;  3HJC A;  4HXZ A;  4IZJ D;  3K17 A;  3K85 A;  1UEK A;  2Z5E A;  1D6T A;  4DXL A;  4LF7 I;  1H73 A;  1QZR A;  2AJ4 A;  3LNU A;  2Z5C A;  1N32 I;  4IZK B;  2WW4 A;  3QT6 A;  3J81 C;  4B3T E;  2CGE A;  1KIJ A;  4DV7 I;  4DU8 A;  4DR7 I;  4JV5 E;  4DUZ I;  4X66 E;  2UXD I;  1IBM E;  1IBK I;  1PKP A;  1WUU A;  3T1Y E;  5LMU I;  4DR5 E;  4NXN E;  3QT7 A;  4DV5 I;  1MU5 A;  2ZM6 I;  4LFC I;  4DPW A;  4B3S E;  1Z0B A;  2VQF E;  4KHP E;  3B78 A;  5A2Q Q;  4LF5 I;  2XEX A;  2A2C A;  4P7A A;  1H74 A;  1HNW I;  4DR4 I;  2HHH I;  3M6A A;  2O1T A;  4MYU A;  4LF4 E;  4UTG A;  4JV5 I;  4USK A;  4IZJ B;  2X7I A;  1ZM3 A;  3PYF A;  2HK3 A;  4HYM A;  2UU9 E;  2O1W A;  4FWD A;  4X66 I;  4JYA E;  1IBM I;  1N34 E;  4DV4 E;  1XMQ E;  4NXN I;  4JI2 E;  1N0V C;  1Z0G A;  2IOP A;  3V2U C;  4KQV A;  2HFS A;  4B3S I;  2ZIT A;  4M1K A;  2VQF I;  4KHP I;  2BM0 A;  4P52 A;  1H7S A;  4ZVI A;  1Z5C A;  1J5E E;  3JAM C;  1S4E A;  3B8H A;  3J80 Q;  5FLX C;  1NZ0 A;  4DV0 E;  4DV2 E;  4FW9 A;  2O1U A;  4JI0 I;  3WU3 A;  4HAC A;  1A6F A;  4YY3 E;  4JI8 E;  2UU9 I;  4EMD A;  4DV6 I;  2UUB I;  4JI6 I;  5IT9 C;  1N36 I;  1N34 I;  4DV4 I;  4B3R E;  4X65 I;  2HK2 A;  4LFA E;  1ZXN A;  4WUB A;  4Z7Y A;  4GKK E;  1N0U A;  1FWL A;  4DR3 E;  1H7U A;  2VQE I;  1B63 A;  1MG7 A;  4DPX A;  2UUC E;  1MX0 A;  1VIS A;  1EA6 A;  4B3M E;  5IWA E;  2Q2E B;  1HNX I;  2GS8 A;  4ED4 A;  5LL6 R;  4K0K I;  4X64 E;  1Y4U A;  3ZZT A;  4DR1 E;  4JI8 I;  4JI7 E;  1HNZ E;  1FJG E;  3Q6M A;  2BM1 A;  1XMO E;  4DUY E;  1Z5A A;  4FN5 A;  4LF9 E;  4PRV A;  4XTJ A;  2UUA E;  2IOQ A;  1Y4S A;  2BV3 A;  3WU6 A;  3J81 Q;  2R42 A;  4JG4 A;  2R3V A;  4LF8 E;  1HR0 I;  1NHI A;  1ZM2 A;  2V2Z A;  4DR3 I;  2X36 A;  2V2Q A;  4DR2 E;  2PNM A;  2E5L E;  5IWA I;  3T1H E;  4IZK A;  4B3T I;  4X64 I;  4YHH E;  4OX9 E;  1ELO A;  4MYT A;  2PNL A;  3GON A;  4DPU A;  1K47 A;  1IBL E;  1Y6Z A;  5L3J A;  2A2D A;  4NXM E;  1ZM9 A;  4DR6 E;  3T1Y I;  4DR5 I;  2Z5B B;  4LF8 I;  3V5R A;  3QT8 A;  2J7K A;  2LJP A;  3LPS A;  4JI1 E;  2GQ0 A;  2E5L I;  1I94 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...