4DUZI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzI00
1FWLA 4DR7I 2NPFA 3ZZUA 1Z0WA 3K17A 1NHJA 4JI8I 4B3RI 4LFBE 4DV3I 1ZXNA 2ZM6I 4AQYE 2UUBE 4X62E 4FW9A 1IBKI 4YHHI 4DR4I 4JI6I 4DR1E 4LFCE 3ZM7A 4LF7I 4NXNE 3J7AM 2HHHI 4OX9E 4WUDA 5IT9C 3V2UC 3CWVA 3WU3A 4DV0I 3T1HE 4KQVA 4LF5I 4DPUA 3B78A 1PKPA 2UUAI 1OJ4A 4DUYE 4K0KI 3PYDA 1FKAE 4DPXA 1IBME 1J5EE 1XNRE 3OTOE 4USKA 3J81Q 2DEJA 4JV5I 1RREA 2DEIA 4X64E 4X65I 1Z0VA 1N36I 1HNWE 2E5LI 2E1RA 4PU9A 1H72C 1Z5BA 1HNXI 1QZRA 1FJGE 2HK3A 2HKEA 2HKJA 4JI3I 2UUCE 4FWHA 2UXCE 1UEKA 3LPSA 2VQEE 1PIEA 4DV2E 4DR3I 4DV1E 1DARA 4GKKE 1XHKA 4KHPE 4ZVIA 2EFGA 1ZM2A 4DPTA 3F0NA 4LFAI 4DR6E 3ZKDA 3ZZ0A 4DR7E 4JI8E 4Z7YA 4DV3E 1H7UA 1KKHA 1KTVA 1KVKA 4DPYA 1Z0TA 4JI4I 1IBLI 1KIJA 1ZXMA 2F4VE 3T1YI 1XMQI 4LF7E 2V2VA 4JYAE 4RPFA 4DV6E 1B62A 4DV4I 4DV5E 1N33E 4X66E 4JI0E 1FI4A 5LMUI 4LF9I 3JAMQ 1N0VC 5IWAE 4USMA 1H74A 4LF6I 4JI1I 1XMOI 3QT7A 4DR5E 4GKJI 4MYUA 4LF4I 4Z7CA 4JG4A 1D6TA 1BKNA 2V2QA 4B3SI 4DU7A 4LF8I 4PRVA 3J80C 1N32E 2V2ZA 3H4LA 4X65E 4AQYI 2UUBI 4JI2I 4X62I 2A2CA 4EMDA 1N36E 2UXBI 3HULA 4FWDA 2UU9E 1MU5A 5LMNE 1HNXE 1Z0CA 4DV7E 5GMDA 4LFCI 2R42A 4HXZA 1HNZE 4NXNI 1U2RA 3QT8A 4ED4A 4UTGA 1PVGA 1VISA 2HFSA 4HY1A 3GONA 5A2QC 4DR2I 4NXMI 4DR3E 1N34E 1N0UA 3B82A 3T1HI 2VQFE 4B3ME 2BV3A 1ZM3A 4I3HA 1FWKA 2BM1A 1S4EA 2BM0A 3PYGA 4JI7I 2WW4A 1WUUA 2UXDE 4JI5I 1IBMI 1I94E 3OTOI 2R3VA 4DU8A 1RR9A 1ZM4A 1S16A 1FNMA 4YY3E 4XTJA 1HNWI 3Q1QA 5FLXC 3PYEA 1XMQE 4B3RE 2HFUA 3LTOA 1Z0BA 2ZM6E 1FJGI 3QT6A 2V8PA 2HK2A 1IBKE 3PYFA 4YHHE 4WUCA 4DR4E 5LMUE 4JI6E 4DPWA 2UUCI 1K47A 2UXCI 4JI1E 1XMOE 2VQEI 4DV1I 2AJ4A 4GKJE 4R1FA 1H7SA 4GKKI 2HHHE 4LF4E 4DUZI 5L3JA 2ZITA 1MX0A 3K1JA 3LNUA 4B3SE 4DV0E 3JAMC 4B3TI 4MYTA 4LF8E 4LF5E 2UUAE 2X36A 1NZ0A 5BR8I 3ZZTA 4JI2E 4K0KE 1HR0I 2UXBE 2GS8A 1XNQI 2F4VI 1NHHA 4DXLA 2ZBKB 2VF3A 1Z5AA 2J7KA 3J7AG 4JV5E 4M1KA 4LFBI 4JYAI 4DV6I 1Z5CA 5IT9Q 4DV5I 1N33I 4X66I 4JI0I 4HACA 4DR2E 3WU5A 4NXME 2E5LE 2CZ9A 4FN5A 5IWAI 2A2DA 3J80Q 1H73A 4DR1I 3WU4A 3J81C 4DR5I 2OI2A 1EI1A 3M6AA 4OX9I 4JI3E 4JI7E 4JI5E 1NHIA 4HYMA 1MG7A 2X7IA 3QT5A 3WU6A 2Q2EB 1N32I 1ELOA 4LFAE 5LL6R 4HACB 4PRXA 4DUYI 5A2QQ 2UU9I 4P52A 1J5EI 4WUBA 1XNRI 5LMNI 4UT4A 4DV7I 1Z0EA 3ZKBA 4JI4E 3B8HA 4X64I 1IBLE 1HNZI 4FWGA 1Z59A 3T1YE 1ZM9A 1N34I 1B63A 3V5RA 2VQFI 4B3MI 3D4JA 4DV4E 4DUZE 4P7AA 4LF9E 4B3TE 2XEXA 4LF6E 1A6FA 1Z0GA 5FLXQ 5GMEA 4DV2I 2UXDI 1I94I 1EA6A 4URLA 5BR8E 4KHPI 1HR0E 2V34A 1XNQE 4DR6I 4YY3I 2LJPA
chains in the Genus database with same CATH superfamily
1FWLA 4DR7I 2NPFA 3ZZUA 1Z0WA 2PNZA 3K17A 4N3OA 2BA1D 1NHJA 4JI8I 4B3RI 2Z5BB 4DV3I 4LFBE 2JE6A 1ZXNA 2ZM6I 2C38B 4AQYE 2UUBE 2BR2A 4X62E 1USVA 3PS1A 4FW9A 2VESA 1IBKI 5C0XD 4YHHI 4DR4I 4JI6I 4DR1E 4LFCE 3ZM7A 4LF7I 1UDSA 4NXNE 1Y4UA 3J7AM 2HHHI 4IZJA 4OX9E 3GCMA 4WUDA 5IT9C 3V2UC 3CWVA 3WU3A 4MU3A 4DV0I 2GO3A 3T1HE 1OYSA 2F1DA 4KQVA 4LF5I 4DPUA 2JE6B 3B78A 1PKPA 2UUAI 2BR2B 1OJ4A 4DUYE 4K0KI 3PYDA 1YH8A 5DNXA 3GMEA 1FKAE 4DPXA 1IBME 1J5EE 1R6LA 1XNRE 4FW3A 4J3DA 3OTOE 4USKA 3J81Q 3U1YA 2DEJA 2Z5EA 3PRYA 4JV5I 1RREA 2DEIA 4X64E 4X65I 1Y60A 1Z0VA 1N36I 3HJCA 1HNWE 1UDNA 2IOPA 2E5LI 2E1RA 5ELWA 4FW6A 3NZKA 4PU9A 1H72C 1Z5BA 1HNXI 1QZRA 1FJGE 4LOMA 3B4TA 4QNKA 2HK3A 2NN6F 2PO2A 4IFDC 2HKEA 2HKJA 4JI3I 2UUCE 4FWHA 2UXCE 1UEKA 3LPSA 2VQEE 1PIEA 4DV2E 4U3BA 4DR3I 4DV1E 1DARA 3L7ZB 4GKKE 1XHKA 2NN6C 4KHPE 4ISAA 4ZVIA 1E3HA 2EFGA 2C37A 5JEAF 3KRNA 1ZM2A 4DPTA 3F0NA 4IZJD 4LFAI 4DR6E 3ZKDA 3ZZ0A 2WNRA 4DR7E 5DROA 4IFDA 4AM3A 4JI8E 4Z7YA 4DV3E 5JEAC 3M7ND 1H7UA 1KKHA 1KTVA 2PO2B 3P76A 1KVKA 4DPYA 1Z0TA 3PS2A 2BA0G 4JI4I 1IBLI 1KIJA 1ZXMA 2NN6A 2F4VE 2WP8A 3GLLA 3T1YI 1XMQI 4LF7E 2V2VA 4JYAE 4RPFA 4BA2A 4DV6E 2C37B 4GQUA 1OYPA 1B62A 4DV4I 4DV5E 1N33E 4X66E 4JI0E 5JEAA 1FI4A 5LMUI 4LF9I 3JAMQ 1N0VC 5IWAE 4U3DA 4USMA 1H74A 4LF6I 4IFDE 5DRRA 4BA1A 4IFDB 4JI1I 1XMOI 3QT7A 2BA0D 2IESA 4DR5E 4GKJI 4MYUA 4LF4I 4Z7CA 4JG4A 1D6TA 2NN6E 4MU0A 1BKNA 2NN6B 2WP8B 2V2QA 2IERA 4B3SI 4DU7A 2PO0A 3CDIA 2PNZB 4LF8I 4PRVA 3J80C 1N32E 2V2ZA 4BA2B 4MQYA 3H4LA 4X65E 5JEAE 4AQYI 2UUBI 5JEAB 4X62I 2A2CA 4EMDA 1N36E 4JI2I 2UXBI 3HULA 4FWDA 2UU9E 2JEAA 4BA1B 1MU5A 5LMNE 2C39A 5EKWA 1HNXE 3P3CA 1Z0CA 4DV7E 4IFDD 2PNLA 5GMDA 1HK7A 4LFCI 4IZJB 2R42A 4HXZA 1HNZE 4NXNI 1U2RA 3U1KA 3QT8A 4ED4A 4UTGA 1PVGA 1VISA 4HY1A 2HFSA 3GONA 5A2QC 2NN6D 3K85A 2PO0B 4DR2I 1UDOA 4NXMI 4FW4A 4DR3E 1N34E 1N0UA 3B82A 3T1HI 2VQFE 4B3ME 2BV3A 3PS3A 1ZM3A 4I3HA 1FWKA 2BM1A 1S4EA 2O1TA 5DRPA 3M7NG 2BM0A 3PYGA 4JI7I 2JEAB 5JEAD 5K36F 2WW4A 1WUUA 2UXDE 4JI5I 1IBMI 2C39B 1I94E 2JEBA 1E3PA 3H1CA 4IZKA 3OTOI 2R3VA 4AIMA 4DU8A 1RR9A 4AIDA 1ZM4A 1S16A 3Q6MA 5K36C 1FNMA 4YY3E 4XTJA 1HNWI 4LCFA 3Q1QA 5FLXC 2JT2A 3PYEA 1XMQE 4B3RE 2HFUA 3LTOA 1Z0BA 3P3EA 1YHCA 4LCHA 2ZM6E 1FJGI 3QT6A 2V8PA 2HK2A 1IBKE 2C38A 3PYFA 4YHHE 4WUCA 2CG9A 1USUA 2IOQA 5LMUE 4DR4E 4JI6E 1P42A 4DPWA 4FW5A 2UUCI 4OO1F 1K47A 2UXCI 2JEBB 4JI1E 1XMOE 2VQEI 2PNMA 5K36A 4IZKB 5DNLA 4DV1I 2AJ4A 4GKJE 4R1FA 1H7SA 4QNJA 4GKKI 2HHHE 1RHYA 4LF4E 4DUZI 5L3JA 3CDJA 2ZITA 1MX0A 3K1JA 4OO1C 2WNRB 3LNUA 4B3SE 4DV0E 2O1UA 3HKMA 3JAMC 4B3TI 4MYTA 4LF8E 4LF5E 4IS9A 2UUAE 2X36A 1NZ0A 5BR8I 3ZZTA 4JI2E 4K0KE 1HR0I 2UXBE 2GS8A 2PO1A 3Q6NA 1XNQI 2F4VI 2Z5CA 2CVEA 5K36E 5K36B 1NHHA 1XXEA 4DXLA 4OO1A 2ZBKB 3UHMA 2VF3A 1Z5AA 2J7KA 4NBQA 3J7AG 4JV5E 5C0XF 4M1KA 1R6MA 4JYAI 4LFBI 4DV6I 1Z5CA 3M85G 5IT9Q 4DV5I 1N33I 4X66I 4JI0I 4HACA 4DR2E 3WU5A 4NXME 2E5LE 2CZ9A 4FN5A 5IWAI 4OZEA 2A2DA 5C0XC 3DD6A 4LCGA 3J80Q 1H73A 4DR1I 3WU4A 3J81C 4DR5I 2OI2A 1EI1A 1Y5YA 5DRQA 3M6AA 4OX9I 4JI3E 4JI7E 2PO1B 2Z5CB 2AE8A 4JI5E 4OO1E 4OO1B 1NHIA 4HYMA 1MG7A 2X7IA 3M85D 3QT5A 5K36D 3P06A 4LPFA 4MU1A 3L7ZA 2Q2EB 3WU6A 1N32I 4MU4A 1ELOA 2CGEA 1Y4SA 2O1VA 5C0XA 5LL6R 4LFAE 4HACB 4PRXA 2GQ0A 4DUYI 5A2QQ 1Y6ZA 4IFDF 2UU9I 4P52A 1J5EI 4WUBA 1XNRI 5LMNI 4UT4A 5FWKA 4DV7I 1Z0EA 3ZKBA 4JI4E 3B8HA 2J65A 1UDQA 4X64I 1IBLE 1HNZI 4FWGA 1OYRA 1Z59A 3T1YE 1ZM9A 2O3ZA 4FW7A 1N34I 4OO1D 1B63A 3V5RA 2VQFI 3P3GA 4B3MI 3D4JA 4DV4E 2Z5BA 5C0XE 4DUZE 5C0XB 4P7AA 2BA1G 4LF9E 5EL9A 2O1WA 4B3TE 2XEXA 4LF6E 1A6FA 2GO4A 4OKGA 1Z0GA 5FLXQ 4MDTA 5GMEA 4DV2I 2UXDI 1I94I 1EA6A 1VI7A 4URLA 5BR8E 4KHPI 1HR0E 2V34A 1XNQE 4DR6I 4YY3I 2LJPA
chains in the Genus database with same CATH topology
1FWLA 4DR7I 2NPFA 3ZZUA 1Z0WA 3K17A 4N3OA 1NHJA 4JI8I 4B3RI 2Z5BB 4DV3I 4LFBE 1ZXNA 2ZM6I 4AQYE 2UUBE 4X62E 1USVA 4FW9A 1IBKI 4YHHI 4DR4I 4JI6I 4DR1E 4LFCE 3ZM7A 4LF7I 4NXNE 1Y4UA 3J7AM 2HHHI 4IZJA 4OX9E 4WUDA 5IT9C 3V2UC 3CWVA 3WU3A 4DV0I 3T1HE 4KQVA 4LF5I 4DPUA 3B78A 1PKPA 2UUAI 1OJ4A 4DUYE 4K0KI 3PYDA 1FKAE 4DPXA 1IBME 1J5EE 1XNRE 3OTOE 4USKA 3J81Q 2DEJA 2Z5EA 3PRYA 4JV5I 1RREA 2DEIA 4X64E 4X65I 1Z0VA 1N36I 3HJCA 1HNWE 2IOPA 2E5LI 2E1RA 4PU9A 1H72C 1Z5BA 1HNXI 1QZRA 1FJGE 2HK3A 2HKEA 2HKJA 4JI3I 2UUCE 4FWHA 2UXCE 1UEKA 3LPSA 2VQEE 1PIEA 4DV2E 4DR3I 4DV1E 1DARA 4GKKE 1XHKA 4KHPE 4ZVIA 2EFGA 1ZM2A 4DPTA 3F0NA 4IZJD 4LFAI 4DR6E 3ZKDA 3ZZ0A 4DR7E 4JI8E 4Z7YA 4DV3E 1H7UA 1KKHA 1KTVA 1KVKA 4DPYA 1Z0TA 4JI4I 1IBLI 1KIJA 1ZXMA 2F4VE 3T1YI 1XMQI 4LF7E 2V2VA 4JYAE 4RPFA 4DV6E 1B62A 4DV4I 4DV5E 1N33E 4X66E 4JI0E 1FI4A 5LMUI 4LF9I 3JAMQ 1N0VC 5IWAE 4USMA 1H74A 4LF6I 4JI1I 1XMOI 3QT7A 4DR5E 4GKJI 4MYUA 4LF4I 4Z7CA 4JG4A 1D6TA 1BKNA 2V2QA 4B3SI 4DU7A 4LF8I 4PRVA 3J80C 1N32E 2V2ZA 3H4LA 4X65E 4AQYI 2UUBI 4JI2I 4X62I 2A2CA 4EMDA 1N36E 2UXBI 3HULA 4FWDA 2UU9E 1MU5A 5LMNE 1HNXE 1Z0CA 4DV7E 2PNLA 5GMDA 1HK7A 4LFCI 4IZJB 2R42A 4HXZA 1HNZE 4NXNI 1U2RA 3QT8A 4ED4A 4UTGA 1PVGA 1VISA 2HFSA 4HY1A 3GONA 5A2QC 4DR2I 3K85A 4NXMI 4DR3E 1N34E 1N0UA 3B82A 3T1HI 2VQFE 4B3ME 2BV3A 1ZM3A 4I3HA 1FWKA 2BM1A 1S4EA 2O1TA 2BM0A 3PYGA 4JI7I 2WW4A 1WUUA 2UXDE 4JI5I 1IBMI 1I94E 4IZKA 3OTOI 2R3VA 4DU8A 1RR9A 1ZM4A 1S16A 3Q6MA 1FNMA 4YY3E 4XTJA 1HNWI 3Q1QA 5FLXC 3PYEA 1XMQE 4B3RE 2HFUA 3LTOA 1Z0BA 2ZM6E 1FJGI 3QT6A 2V8PA 2HK2A 1IBKE 3PYFA 4YHHE 4WUCA 2CG9A 1USUA 2IOQA 5LMUE 4DR4E 4JI6E 4DPWA 2UUCI 1K47A 2UXCI 4JI1E 1XMOE 2VQEI 2PNMA 4IZKB 4DV1I 2AJ4A 4GKJE 4R1FA 1H7SA 4GKKI 2HHHE 4LF4E 4DUZI 5L3JA 2ZITA 1MX0A 3K1JA 3LNUA 4B3SE 4DV0E 2O1UA 3JAMC 4B3TI 4MYTA 4LF8E 4LF5E 2UUAE 2X36A 1NZ0A 5BR8I 3ZZTA 4JI2E 4K0KE 1HR0I 2UXBE 2GS8A 3Q6NA 1XNQI 2F4VI 2Z5CA 1NHHA 4DXLA 2ZBKB 2VF3A 1Z5AA 2J7KA 3J7AG 4JV5E 4M1KA 4LFBI 4JYAI 4DV6I 1Z5CA 5IT9Q 4DV5I 1N33I 4X66I 4JI0I 4HACA 4DR2E 3WU5A 4NXME 2E5LE 2CZ9A 4FN5A 5IWAI 2A2DA 3J80Q 1H73A 4DR1I 3WU4A 3J81C 4DR5I 2OI2A 1EI1A 3M6AA 4OX9I 4JI3E 4JI7E 2Z5CB 4JI5E 1NHIA 4HYMA 1MG7A 2X7IA 3QT5A 3P06A 3WU6A 2Q2EB 1N32I 1ELOA 2CGEA 1Y4SA 2O1VA 4LFAE 5LL6R 4HACB 4PRXA 2GQ0A 4DUYI 5A2QQ 1Y6ZA 2UU9I 4P52A 1J5EI 4WUBA 1XNRI 5LMNI 4UT4A 5FWKA 4DV7I 1Z0EA 3ZKBA 4JI4E 3B8HA 4X64I 1IBLE 1HNZI 4FWGA 1Z59A 3T1YE 1ZM9A 1N34I 1B63A 3V5RA 2VQFI 4B3MI 3D4JA 4DV4E 2Z5BA 4DUZE 4P7AA 4LF9E 2O1WA 4B3TE 2XEXA 4LF6E 1A6FA 1Z0GA 5FLXQ 5GMEA 4DV2I 2UXDI 1I94I 1EA6A 4URLA 5BR8E 4KHPI 1HR0E 2V34A 1XNQE 4DR6I 4YY3I 2LJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWL A;  4DR7 I;  2NPF A;  3ZZU A;  1Z0W A;  3K17 A;  1NHJ A;  4JI8 I;  4B3R I;  4LFB E;  4DV3 I;  1ZXN A;  2ZM6 I;  4AQY E;  2UUB E;  4X62 E;  4FW9 A;  1IBK I;  4YHH I;  4DR4 I;  4JI6 I;  4DR1 E;  4LFC E;  3ZM7 A;  4LF7 I;  4NXN E;  3J7A M;  2HHH I;  4OX9 E;  4WUD A;  5IT9 C;  3V2U C;  3CWV A;  3WU3 A;  4DV0 I;  3T1H E;  4KQV A;  4LF5 I;  4DPU A;  3B78 A;  1PKP A;  2UUA I;  1OJ4 A;  4DUY E;  4K0K I;  3PYD A;  1FKA E;  4DPX A;  1IBM E;  1J5E E;  1XNR E;  3OTO E;  4USK A;  3J81 Q;  2DEJ A;  4JV5 I;  1RRE A;  2DEI A;  4X64 E;  4X65 I;  1Z0V A;  1N36 I;  1HNW E;  2E5L I;  2E1R A;  4PU9 A;  1H72 C;  1Z5B A;  1HNX I;  1QZR A;  1FJG E;  2HK3 A;  2HKE A;  2HKJ A;  4JI3 I;  2UUC E;  4FWH A;  2UXC E;  1UEK A;  3LPS A;  2VQE E;  1PIE A;  4DV2 E;  4DR3 I;  4DV1 E;  1DAR A;  4GKK E;  1XHK A;  4KHP E;  4ZVI A;  2EFG A;  1ZM2 A;  4DPT A;  3F0N A;  4LFA I;  4DR6 E;  3ZKD A;  3ZZ0 A;  4DR7 E;  4JI8 E;  4Z7Y A;  4DV3 E;  1H7U A;  1KKH A;  1KTV A;  1KVK A;  4DPY A;  1Z0T A;  4JI4 I;  1IBL I;  1KIJ A;  1ZXM A;  2F4V E;  3T1Y I;  1XMQ I;  4LF7 E;  2V2V A;  4JYA E;  4RPF A;  4DV6 E;  1B62 A;  4DV4 I;  4DV5 E;  1N33 E;  4X66 E;  4JI0 E;  1FI4 A;  5LMU I;  4LF9 I;  3JAM Q;  1N0V C;  5IWA E;  4USM A;  1H74 A;  4LF6 I;  4JI1 I;  1XMO I;  3QT7 A;  4DR5 E;  4GKJ I;  4MYU A;  4LF4 I;  4Z7C A;  4JG4 A;  1D6T A;  1BKN A;  2V2Q A;  4B3S I;  4DU7 A;  4LF8 I;  4PRV A;  3J80 C;  1N32 E;  2V2Z A;  3H4L A;  4X65 E;  4AQY I;  2UUB I;  4JI2 I;  4X62 I;  2A2C A;  4EMD A;  1N36 E;  2UXB I;  3HUL A;  4FWD A;  2UU9 E;  1MU5 A;  5LMN E;  1HNX E;  1Z0C A;  4DV7 E;  5GMD A;  4LFC I;  2R42 A;  4HXZ A;  1HNZ E;  4NXN I;  1U2R A;  3QT8 A;  4ED4 A;  4UTG A;  1PVG A;  1VIS A;  2HFS A;  4HY1 A;  3GON A;  5A2Q C;  4DR2 I;  4NXM I;  4DR3 E;  1N34 E;  1N0U A;  3B82 A;  3T1H I;  2VQF E;  4B3M E;  2BV3 A;  1ZM3 A;  4I3H A;  1FWK A;  2BM1 A;  1S4E A;  2BM0 A;  3PYG A;  4JI7 I;  2WW4 A;  1WUU A;  2UXD E;  4JI5 I;  1IBM I;  1I94 E;  3OTO I;  2R3V A;  4DU8 A;  1RR9 A;  1ZM4 A;  1S16 A;  1FNM A;  4YY3 E;  4XTJ A;  1HNW I;  3Q1Q A;  5FLX C;  3PYE A;  1XMQ E;  4B3R E;  2HFU A;  3LTO A;  1Z0B A;  2ZM6 E;  1FJG I;  3QT6 A;  2V8P A;  2HK2 A;  1IBK E;  3PYF A;  4YHH E;  4WUC A;  4DR4 E;  5LMU E;  4JI6 E;  4DPW A;  2UUC I;  1K47 A;  2UXC I;  4JI1 E;  1XMO E;  2VQE I;  4DV1 I;  2AJ4 A;  4GKJ E;  4R1F A;  1H7S A;  4GKK I;  2HHH E;  4LF4 E;  4DUZ I;  5L3J A;  2ZIT A;  1MX0 A;  3K1J A;  3LNU A;  4B3S E;  4DV0 E;  3JAM C;  4B3T I;  4MYT A;  4LF8 E;  4LF5 E;  2UUA E;  2X36 A;  1NZ0 A;  5BR8 I;  3ZZT A;  4JI2 E;  4K0K E;  1HR0 I;  2UXB E;  2GS8 A;  1XNQ I;  2F4V I;  1NHH A;  4DXL A;  2ZBK B;  2VF3 A;  1Z5A A;  2J7K A;  3J7A G;  4JV5 E;  4M1K A;  4LFB I;  4JYA I;  4DV6 I;  1Z5C A;  5IT9 Q;  4DV5 I;  1N33 I;  4X66 I;  4JI0 I;  4HAC A;  4DR2 E;  3WU5 A;  4NXM E;  2E5L E;  2CZ9 A;  4FN5 A;  5IWA I;  2A2D A;  3J80 Q;  1H73 A;  4DR1 I;  3WU4 A;  3J81 C;  4DR5 I;  2OI2 A;  1EI1 A;  3M6A A;  4OX9 I;  4JI3 E;  4JI7 E;  4JI5 E;  1NHI A;  4HYM A;  1MG7 A;  2X7I A;  3QT5 A;  3WU6 A;  2Q2E B;  1N32 I;  1ELO A;  4LFA E;  5LL6 R;  4HAC B;  4PRX A;  4DUY I;  5A2Q Q;  2UU9 I;  4P52 A;  1J5E I;  4WUB A;  1XNR I;  5LMN I;  4UT4 A;  4DV7 I;  1Z0E A;  3ZKB A;  4JI4 E;  3B8H A;  4X64 I;  1IBL E;  1HNZ I;  4FWG A;  1Z59 A;  3T1Y E;  1ZM9 A;  1N34 I;  1B63 A;  3V5R A;  2VQF I;  4B3M I;  3D4J A;  4DV4 E;  4DUZ E;  4P7A A;  4LF9 E;  4B3T E;  2XEX A;  4LF6 E;  1A6F A;  1Z0G A;  5FLX Q;  5GME A;  4DV2 I;  2UXD I;  1I94 I;  1EA6 A;  4URL A;  5BR8 E;  4KHP I;  1HR0 E;  2V34 A;  1XNQ E;  4DR6 I;  4YY3 I;  2LJP A; 
#chains in the Genus database with same CATH topology
 1FWL A;  4DR7 I;  2NPF A;  3ZZU A;  1Z0W A;  2PNZ A;  3K17 A;  4N3O A;  2BA1 D;  1NHJ A;  4JI8 I;  4B3R I;  2Z5B B;  4DV3 I;  4LFB E;  2JE6 A;  1ZXN A;  2ZM6 I;  2C38 B;  4AQY E;  2UUB E;  2BR2 A;  4X62 E;  1USV A;  3PS1 A;  4FW9 A;  2VES A;  1IBK I;  5C0X D;  4YHH I;  4DR4 I;  4JI6 I;  4DR1 E;  4LFC E;  3ZM7 A;  4LF7 I;  1UDS A;  4NXN E;  1Y4U A;  3J7A M;  2HHH I;  4IZJ A;  4OX9 E;  3GCM A;  4WUD A;  5IT9 C;  3V2U C;  3CWV A;  3WU3 A;  4MU3 A;  4DV0 I;  2GO3 A;  3T1H E;  1OYS A;  2F1D A;  4KQV A;  4LF5 I;  4DPU A;  2JE6 B;  3B78 A;  1PKP A;  2UUA I;  2BR2 B;  1OJ4 A;  4DUY E;  4K0K I;  3PYD A;  1YH8 A;  5DNX A;  3GME A;  1FKA E;  4DPX A;  1IBM E;  1J5E E;  1R6L A;  1XNR E;  4FW3 A;  4J3D A;  3OTO E;  4USK A;  3J81 Q;  3U1Y A;  2DEJ A;  2Z5E A;  3PRY A;  4JV5 I;  1RRE A;  2DEI A;  4X64 E;  4X65 I;  1Y60 A;  1Z0V A;  1N36 I;  3HJC A;  1HNW E;  1UDN A;  2IOP A;  2E5L I;  2E1R A;  5ELW A;  4FW6 A;  3NZK A;  4PU9 A;  1H72 C;  1Z5B A;  1HNX I;  1QZR A;  1FJG E;  4LOM A;  3B4T A;  4QNK A;  2HK3 A;  2NN6 F;  2PO2 A;  4IFD C;  2HKE A;  2HKJ A;  4JI3 I;  2UUC E;  4FWH A;  2UXC E;  1UEK A;  3LPS A;  2VQE E;  1PIE A;  4DV2 E;  4U3B A;  4DR3 I;  4DV1 E;  1DAR A;  3L7Z B;  4GKK E;  1XHK A;  2NN6 C;  4KHP E;  4ISA A;  4ZVI A;  1E3H A;  2EFG A;  2C37 A;  5JEA F;  3KRN A;  1ZM2 A;  4DPT A;  3F0N A;  4IZJ D;  4LFA I;  4DR6 E;  3ZKD A;  3ZZ0 A;  2WNR A;  4DR7 E;  5DRO A;  4IFD A;  4AM3 A;  4JI8 E;  4Z7Y A;  4DV3 E;  5JEA C;  3M7N D;  1H7U A;  1KKH A;  1KTV A;  2PO2 B;  3P76 A;  1KVK A;  4DPY A;  1Z0T A;  3PS2 A;  2BA0 G;  4JI4 I;  1IBL I;  1KIJ A;  1ZXM A;  2NN6 A;  2F4V E;  2WP8 A;  3GLL A;  3T1Y I;  1XMQ I;  4LF7 E;  2V2V A;  4JYA E;  4RPF A;  4BA2 A;  4DV6 E;  2C37 B;  4GQU A;  1OYP A;  1B62 A;  4DV4 I;  4DV5 E;  1N33 E;  4X66 E;  4JI0 E;  5JEA A;  1FI4 A;  5LMU I;  4LF9 I;  3JAM Q;  1N0V C;  5IWA E;  4U3D A;  4USM A;  1H74 A;  4LF6 I;  4IFD E;  5DRR A;  4BA1 A;  4IFD B;  4JI1 I;  1XMO I;  3QT7 A;  2BA0 D;  2IES A;  4DR5 E;  4GKJ I;  4MYU A;  4LF4 I;  4Z7C A;  4JG4 A;  1D6T A;  2NN6 E;  4MU0 A;  1BKN A;  2NN6 B;  2WP8 B;  2V2Q A;  2IER A;  4B3S I;  4DU7 A;  2PO0 A;  3CDI A;  2PNZ B;  4LF8 I;  4PRV A;  3J80 C;  1N32 E;  2V2Z A;  4BA2 B;  4MQY A;  3H4L A;  4X65 E;  5JEA E;  4AQY I;  2UUB I;  5JEA B;  4X62 I;  2A2C A;  4EMD A;  1N36 E;  4JI2 I;  2UXB I;  3HUL A;  4FWD A;  2UU9 E;  2JEA A;  4BA1 B;  1MU5 A;  5LMN E;  2C39 A;  5EKW A;  1HNX E;  3P3C A;  1Z0C A;  4DV7 E;  4IFD D;  2PNL A;  5GMD A;  1HK7 A;  4LFC I;  4IZJ B;  2R42 A;  4HXZ A;  1HNZ E;  4NXN I;  1U2R A;  3U1K A;  3QT8 A;  4ED4 A;  4UTG A;  1PVG A;  1VIS A;  4HY1 A;  2HFS A;  3GON A;  5A2Q C;  2NN6 D;  3K85 A;  2PO0 B;  4DR2 I;  1UDO A;  4NXM I;  4FW4 A;  4DR3 E;  1N34 E;  1N0U A;  3B82 A;  3T1H I;  2VQF E;  4B3M E;  2BV3 A;  3PS3 A;  1ZM3 A;  4I3H A;  1FWK A;  2BM1 A;  1S4E A;  2O1T A;  5DRP A;  3M7N G;  2BM0 A;  3PYG A;  4JI7 I;  2JEA B;  5JEA D;  5K36 F;  2WW4 A;  1WUU A;  2UXD E;  4JI5 I;  1IBM I;  2C39 B;  1I94 E;  2JEB A;  1E3P A;  3H1C A;  4IZK A;  3OTO I;  2R3V A;  4AIM A;  4DU8 A;  1RR9 A;  4AID A;  1ZM4 A;  1S16 A;  3Q6M A;  5K36 C;  1FNM A;  4YY3 E;  4XTJ A;  1HNW I;  4LCF A;  3Q1Q A;  5FLX C;  2JT2 A;  3PYE A;  1XMQ E;  4B3R E;  2HFU A;  3LTO A;  1Z0B A;  3P3E A;  1YHC A;  4LCH A;  2ZM6 E;  1FJG I;  3QT6 A;  2V8P A;  2HK2 A;  1IBK E;  2C38 A;  3PYF A;  4YHH E;  4WUC A;  2CG9 A;  1USU A;  2IOQ A;  5LMU E;  4DR4 E;  4JI6 E;  1P42 A;  4DPW A;  4FW5 A;  2UUC I;  4OO1 F;  1K47 A;  2UXC I;  2JEB B;  4JI1 E;  1XMO E;  2VQE I;  2PNM A;  5K36 A;  4IZK B;  5DNL A;  4DV1 I;  2AJ4 A;  4GKJ E;  4R1F A;  1H7S A;  4QNJ A;  4GKK I;  2HHH E;  1RHY A;  4LF4 E;  4DUZ I;  5L3J A;  3CDJ A;  2ZIT A;  1MX0 A;  3K1J A;  4OO1 C;  2WNR B;  3LNU A;  4B3S E;  4DV0 E;  2O1U A;  3HKM A;  3JAM C;  4B3T I;  4MYT A;  4LF8 E;  4LF5 E;  4IS9 A;  2UUA E;  2X36 A;  1NZ0 A;  5BR8 I;  3ZZT A;  4JI2 E;  4K0K E;  1HR0 I;  2UXB E;  2GS8 A;  2PO1 A;  3Q6N A;  1XNQ I;  2F4V I;  2Z5C A;  2CVE A;  5K36 E;  5K36 B;  1NHH A;  1XXE A;  4DXL A;  4OO1 A;  2ZBK B;  3UHM A;  2VF3 A;  1Z5A A;  2J7K A;  4NBQ A;  3J7A G;  4JV5 E;  5C0X F;  4M1K A;  1R6M A;  4JYA I;  4LFB I;  4DV6 I;  1Z5C A;  3M85 G;  5IT9 Q;  4DV5 I;  1N33 I;  4X66 I;  4JI0 I;  4HAC A;  4DR2 E;  3WU5 A;  4NXM E;  2E5L E;  2CZ9 A;  4FN5 A;  5IWA I;  4OZE A;  2A2D A;  5C0X C;  3DD6 A;  4LCG A;  3J80 Q;  1H73 A;  4DR1 I;  3WU4 A;  3J81 C;  4DR5 I;  2OI2 A;  1EI1 A;  1Y5Y A;  5DRQ A;  3M6A A;  4OX9 I;  4JI3 E;  4JI7 E;  2PO1 B;  2Z5C B;  2AE8 A;  4JI5 E;  4OO1 E;  4OO1 B;  1NHI A;  4HYM A;  1MG7 A;  2X7I A;  3M85 D;  3QT5 A;  5K36 D;  3P06 A;  4LPF A;  4MU1 A;  3L7Z A;  2Q2E B;  3WU6 A;  1N32 I;  4MU4 A;  1ELO A;  2CGE A;  1Y4S A;  2O1V A;  5C0X A;  5LL6 R;  4LFA E;  4HAC B;  4PRX A;  2GQ0 A;  4DUY I;  5A2Q Q;  1Y6Z A;  4IFD F;  2UU9 I;  4P52 A;  1J5E I;  4WUB A;  1XNR I;  5LMN I;  4UT4 A;  5FWK A;  4DV7 I;  1Z0E A;  3ZKB A;  4JI4 E;  3B8H A;  2J65 A;  1UDQ A;  4X64 I;  1IBL E;  1HNZ I;  4FWG A;  1OYR A;  1Z59 A;  3T1Y E;  1ZM9 A;  2O3Z A;  4FW7 A;  1N34 I;  4OO1 D;  1B63 A;  3V5R A;  2VQF I;  3P3G A;  4B3M I;  3D4J A;  4DV4 E;  2Z5B A;  5C0X E;  4DUZ E;  5C0X B;  4P7A A;  2BA1 G;  4LF9 E;  5EL9 A;  2O1W A;  4B3T E;  2XEX A;  4LF6 E;  1A6F A;  2GO4 A;  4OKG A;  1Z0G A;  5FLX Q;  4MDT A;  5GME A;  4DV2 I;  2UXD I;  1I94 I;  1EA6 A;  1VI7 A;  4URL A;  5BR8 E;  4KHP I;  1HR0 E;  2V34 A;  1XNQ E;  4DR6 I;  4YY3 I;  2LJP A; 
#chains in the Genus database with same CATH homology
 1FWL A;  4DR7 I;  2NPF A;  3ZZU A;  1Z0W A;  3K17 A;  4N3O A;  1NHJ A;  4JI8 I;  4B3R I;  2Z5B B;  4DV3 I;  4LFB E;  1ZXN A;  2ZM6 I;  4AQY E;  2UUB E;  4X62 E;  1USV A;  4FW9 A;  1IBK I;  4YHH I;  4DR4 I;  4JI6 I;  4DR1 E;  4LFC E;  3ZM7 A;  4LF7 I;  4NXN E;  1Y4U A;  3J7A M;  2HHH I;  4IZJ A;  4OX9 E;  4WUD A;  5IT9 C;  3V2U C;  3CWV A;  3WU3 A;  4DV0 I;  3T1H E;  4KQV A;  4LF5 I;  4DPU A;  3B78 A;  1PKP A;  2UUA I;  1OJ4 A;  4DUY E;  4K0K I;  3PYD A;  1FKA E;  4DPX A;  1IBM E;  1J5E E;  1XNR E;  3OTO E;  4USK A;  3J81 Q;  2DEJ A;  2Z5E A;  3PRY A;  4JV5 I;  1RRE A;  2DEI A;  4X64 E;  4X65 I;  1Z0V A;  1N36 I;  3HJC A;  1HNW E;  2IOP A;  2E5L I;  2E1R A;  4PU9 A;  1H72 C;  1Z5B A;  1HNX I;  1QZR A;  1FJG E;  2HK3 A;  2HKE A;  2HKJ A;  4JI3 I;  2UUC E;  4FWH A;  2UXC E;  1UEK A;  3LPS A;  2VQE E;  1PIE A;  4DV2 E;  4DR3 I;  4DV1 E;  1DAR A;  4GKK E;  1XHK A;  4KHP E;  4ZVI A;  2EFG A;  1ZM2 A;  4DPT A;  3F0N A;  4IZJ D;  4LFA I;  4DR6 E;  3ZKD A;  3ZZ0 A;  4DR7 E;  4JI8 E;  4Z7Y A;  4DV3 E;  1H7U A;  1KKH A;  1KTV A;  1KVK A;  4DPY A;  1Z0T A;  4JI4 I;  1IBL I;  1KIJ A;  1ZXM A;  2F4V E;  3T1Y I;  1XMQ I;  4LF7 E;  2V2V A;  4JYA E;  4RPF A;  4DV6 E;  1B62 A;  4DV4 I;  4DV5 E;  1N33 E;  4X66 E;  4JI0 E;  1FI4 A;  5LMU I;  4LF9 I;  3JAM Q;  1N0V C;  5IWA E;  4USM A;  1H74 A;  4LF6 I;  4JI1 I;  1XMO I;  3QT7 A;  4DR5 E;  4GKJ I;  4MYU A;  4LF4 I;  4Z7C A;  4JG4 A;  1D6T A;  1BKN A;  2V2Q A;  4B3S I;  4DU7 A;  4LF8 I;  4PRV A;  3J80 C;  1N32 E;  2V2Z A;  3H4L A;  4X65 E;  4AQY I;  2UUB I;  4JI2 I;  4X62 I;  2A2C A;  4EMD A;  1N36 E;  2UXB I;  3HUL A;  4FWD A;  2UU9 E;  1MU5 A;  5LMN E;  1HNX E;  1Z0C A;  4DV7 E;  2PNL A;  5GMD A;  1HK7 A;  4LFC I;  4IZJ B;  2R42 A;  4HXZ A;  1HNZ E;  4NXN I;  1U2R A;  3QT8 A;  4ED4 A;  4UTG A;  1PVG A;  1VIS A;  2HFS A;  4HY1 A;  3GON A;  5A2Q C;  4DR2 I;  3K85 A;  4NXM I;  4DR3 E;  1N34 E;  1N0U A;  3B82 A;  3T1H I;  2VQF E;  4B3M E;  2BV3 A;  1ZM3 A;  4I3H A;  1FWK A;  2BM1 A;  1S4E A;  2O1T A;  2BM0 A;  3PYG A;  4JI7 I;  2WW4 A;  1WUU A;  2UXD E;  4JI5 I;  1IBM I;  1I94 E;  4IZK A;  3OTO I;  2R3V A;  4DU8 A;  1RR9 A;  1ZM4 A;  1S16 A;  3Q6M A;  1FNM A;  4YY3 E;  4XTJ A;  1HNW I;  3Q1Q A;  5FLX C;  3PYE A;  1XMQ E;  4B3R E;  2HFU A;  3LTO A;  1Z0B A;  2ZM6 E;  1FJG I;  3QT6 A;  2V8P A;  2HK2 A;  1IBK E;  3PYF A;  4YHH E;  4WUC A;  2CG9 A;  1USU A;  2IOQ A;  5LMU E;  4DR4 E;  4JI6 E;  4DPW A;  2UUC I;  1K47 A;  2UXC I;  4JI1 E;  1XMO E;  2VQE I;  2PNM A;  4IZK B;  4DV1 I;  2AJ4 A;  4GKJ E;  4R1F A;  1H7S A;  4GKK I;  2HHH E;  4LF4 E;  4DUZ I;  5L3J A;  2ZIT A;  1MX0 A;  3K1J A;  3LNU A;  4B3S E;  4DV0 E;  2O1U A;  3JAM C;  4B3T I;  4MYT A;  4LF8 E;  4LF5 E;  2UUA E;  2X36 A;  1NZ0 A;  5BR8 I;  3ZZT A;  4JI2 E;  4K0K E;  1HR0 I;  2UXB E;  2GS8 A;  3Q6N A;  1XNQ I;  2F4V I;  2Z5C A;  1NHH A;  4DXL A;  2ZBK B;  2VF3 A;  1Z5A A;  2J7K A;  3J7A G;  4JV5 E;  4M1K A;  4LFB I;  4JYA I;  4DV6 I;  1Z5C A;  5IT9 Q;  4DV5 I;  1N33 I;  4X66 I;  4JI0 I;  4HAC A;  4DR2 E;  3WU5 A;  4NXM E;  2E5L E;  2CZ9 A;  4FN5 A;  5IWA I;  2A2D A;  3J80 Q;  1H73 A;  4DR1 I;  3WU4 A;  3J81 C;  4DR5 I;  2OI2 A;  1EI1 A;  3M6A A;  4OX9 I;  4JI3 E;  4JI7 E;  2Z5C B;  4JI5 E;  1NHI A;  4HYM A;  1MG7 A;  2X7I A;  3QT5 A;  3P06 A;  3WU6 A;  2Q2E B;  1N32 I;  1ELO A;  2CGE A;  1Y4S A;  2O1V A;  4LFA E;  5LL6 R;  4HAC B;  4PRX A;  2GQ0 A;  4DUY I;  5A2Q Q;  1Y6Z A;  2UU9 I;  4P52 A;  1J5E I;  4WUB A;  1XNR I;  5LMN I;  4UT4 A;  5FWK A;  4DV7 I;  1Z0E A;  3ZKB A;  4JI4 E;  3B8H A;  4X64 I;  1IBL E;  1HNZ I;  4FWG A;  1Z59 A;  3T1Y E;  1ZM9 A;  1N34 I;  1B63 A;  3V5R A;  2VQF I;  4B3M I;  3D4J A;  4DV4 E;  2Z5B A;  4DUZ E;  4P7A A;  4LF9 E;  2O1W A;  4B3T E;  2XEX A;  4LF6 E;  1A6F A;  1Z0G A;  5FLX Q;  5GME A;  4DV2 I;  2UXD I;  1I94 I;  1EA6 A;  4URL A;  5BR8 E;  4KHP I;  1HR0 E;  2V34 A;  1XNQ E;  4DR6 I;  4YY3 I;  2LJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...