4DUZI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzI00
4DV2E 2UUCI 1PVGA 2CZ9A 3ZKBA 2DEJA 4OX9E 2NPFA 3J80C 1FJGI 3PYGA 3WU5A 4URLA 3QT5A 4GKKI 4JYAE 4JI8I 1Z0EA 4DPYA 5GMEA 1NHIA 4JI5I 4LF6E 4LFBI 4X66I 2VQEI 1ZM3A 4DR3I 1IBKI 4DV1I 2E5LE 1HNZI 1H73A 1N34I 4LF5I 1J5EE 2V34A 2UXDI 1Z5AA 3CWVA 1H7SA 4X65E 2HK2A 4JI8E 2WW4A 4JI7E 4GKKE 4EMDA 1IBMI 2UUBI 3PYFA 4JI1I 1I94E 4LF9I 4JI4I 2F4VI 1Z0VA 2R42A 1PKPA 1HNZE 2V2QA 1D6TA 4FWHA 1XNQE 1XNQI 1N0UA 4DV4I 4JI3E 4DR4I 3LTOA 1VISA 1FWKA 4PU9A 4DV5E 2BM0A 3J80Q 4DPUA 4LF4I 2UXBE 1DARA 2OI2A 3QT7A 4B3SI 4DR2E 2HHHI 2XEXA 4X64I 4GKJE 3M6AA 1XHKA 3JAMQ 2VQFI 2V8PA 3V5RA 1A6FA 4LF8I 5FLXQ 2HKJA 4DR5I 2UXDE 1NHHA 5A2QC 1Z0TA 2UUAI 4FWGA 4DV6E 4JI6E 4Z7CA 4PRVA 1XMQE 4WUCA 4YHHE 4HACB 2BV3A 4JI2E 1FI4A 3T1YI 4JI0I 4JV5I 4JV5E 4B3RI 5LL6R 4AQYI 1EA6A 3H4LA 1ZXMA 4DV7E 4DV3I 1IBLI 4DV3E 1IBLE 4B3TI 5IWAI 5IWAE 1IBME 4FWDA 1PIEA 4KQVA 2UXCI 4KHPE 4LF4E 4UTGA 4DPWA 2UUAE 1H7UA 4DU7A 4LFCI 4DV2I 3ZZ0A 5BR8I 4Z7YA 4DV7I 1J5EI 4B3RE 4NXNE 2Q2EB 4X64E 1HNXE 2AJ4A 2HFSA 1ZM9A 4FN5A 1N33I 1S4EA 1KKHA 3J81C 4WUBA 2UXCE 1QZRA 1N0VC 3K1JA 1B62A 4JI6I 1XNRE 2HK3A 1Z0BA 4DUZI 1HR0I 5LMNI 4DR5E 3ZZUA 3D4JA 4DPTA 4NXNI 1N32I 4YHHI 4LFAI 5LMUI 4MYTA 1Z5BA 1Z0CA 1N36E 1N34E 1KTVA 4DU8A 1RR9A 2V2VA 3ZZTA 1FNMA 4LF5E 2HFUA 1FJGE 4B3TE 5IT9C 3PYDA 1HNXI 4XTJA 2ZBKB 4JI1E 1Z0WA 4DV6I 4LFCE 4JI5E 4LF6I 4DR2I 1UEKA 4LFBE 1HR0E 4GKJI 4M1KA 4X65I 4P52A 4K0KI 4OX9I 5L3JA 4LF7E 5IT9Q 1N33E 4FW9A 3LNUA 4PRXA 1XMOI 5A2QQ 1H74A 4USKA 1S16A 1WUUA 2E1RA 4B3ME 4B3MI 4UT4A 2ZITA 4DV5I 3JAMC 2UXBI 3QT8A 2UUBE 2A2CA 2HKEA 4DUZE 4B3SE 3WU6A 3OTOI 1ELOA 4HYMA 3OTOE 1N36I 1NZ0A 4LF9E 1MX0A 2GS8A 1XNRI 4DUYI 2X36A 4YY3I 1ZM2A 4DR1E 2V2ZA 5GMDA 1EI1A 4JI3I 2X7IA 1XMOE 4R1FA 3WU4A 4JG4A 2A2DA 1RREA 2ZM6I 4DV4E 4X62E 1N32E 3ZKDA 1NHJA 1Z59A 3ZM7A 3PYEA 4DV0I 3T1HI 5FLXC 4JI2I 4DR3E 1H72C 1IBKE 1HNWE 3B8HA 4NXME 4AQYE 4YY3E 1XMQI 3J7AG 4USMA 4JI0E 4DPXA 4RPFA 4LF7I 4DUYE 4WUDA 4K0KE 3QT6A 2R3VA 4DR6E 1FWLA 2VQFE 3F0NA 1OJ4A 1ZM4A 4HXZA 4HY1A 2EFGA 2J7KA 4X62I 3K17A 3B78A 4X66E 3HULA 3J81Q 4ZVIA 1K47A 1MU5A 3J7AM 4P7AA 1Z5CA 3T1YE 1MG7A 2BM1A 2DEIA 4DR7E 4DR6I 4MYUA 4KHPI 2ZM6E 4DR4E 2UU9E 5LMUE 3GONA 4JYAI 1KIJA 4DV0E 2LJPA 2UUCE 2VF3A 3Q1QA 3LPSA 2F4VE 4HACA 4NXMI 4DV1E 2E5LI 5BR8E 4JI4E 2VQEE 3B82A 2HHHE 5LMNE 1ZXNA 1Z0GA 1U2RA 1KVKA 4ED4A 4DR1I 4I3HA 4LF8E 4JI7I 4DR7I 3WU3A 1BKNA 4DXLA 1HNWI 4LFAE 1B63A 2UU9I 3V2UC 1FKAE 1I94I 3T1HE
chains in the Genus database with same CATH superfamily
5DNXA 5JEAF 4DV2E 2UUCI 1PVGA 3ZKBA 2DEJA 4OX9E 3KRNA 2NPFA 3J80C 1FJGI 3PYGA 3WU5A 1HK7A 4MU0A 4URLA 3QT5A 4GKKI 4JYAE 3H1CA 2BR2B 2NN6D 4JI8I 3GCMA 1XXEA 1Z0EA 4DPYA 4OKGA 5GMEA 1NHIA 5DNLA 5JEAC 4JI5I 4LF6E 2NN6B 4MDTA 4U3BA 4LFBI 4X66I 2VQEI 1ZM3A 4DR3I 1IBKI 3UHMA 1Y6ZA 2PO0A 4DV1I 2E5LE 1HNZI 1UDNA 1H73A 2C37A 5JEAB 5JEAE 1N34I 2BA1G 4LF5I 1OYSA 1J5EE 5C0XB 4OO1C 1Y60A 2V34A 2UXDI 1Z5AA 3CWVA 1H7SA 4X65E 2HK2A 4JI8E 5FWKA 1R6MA 2WW4A 2JEAB 4JI7E 4GKKE 4EMDA 1IBMI 4LCFA 2UUBI 3PYFA 4JI1I 5C0XE 1I94E 3Q6MA 4LF9I 4JI4I 2O1VA 3L7ZA 2JE6A 2F4VI 3B4TA 2F1DA 1Z0VA 2PNZA 2R42A 1PKPA 1USVA 3M85D 2NN6F 4OO1A 1HNZE 2V2QA 1D6TA 4FWHA 5ELWA 4IFDA 1XNQE 1XNQI 1N0UA 2Z5BB 4DV4I 4JI3E 1OYPA 4DR4I 3LTOA 3GMEA 1VISA 1FWKA 4PU9A 4DV5E 2BM0A 3J80Q 3P76A 4DPUA 4LF4I 2UXBE 1DARA 2OI2A 3PS2A 1RHYA 3QT7A 2WP8B 4LCHA 4B3SI 2IOPA 4DR2E 2HHHI 2GQ0A 3P3EA 4MU4A 2XEXA 4X64I 4GKJE 3M6AA 1XHKA 5C0XC 3JAMQ 3P06A 2VQFI 2V8PA 2PO0B 3V5RA 1A6FA 4LF8I 5FLXQ 2HKJA 4DR5I 2UXDE 1NHHA 3HKMA 4AIMA 5A2QC 1Z0TA 2UUAI 4FWGA 4DV6E 4JI6E 4Z7CA 4PRVA 1XMQE 3PS3A 4WUCA 4YHHE 4HACB 2BV3A 4JI2E 1FI4A 3T1YI 4JI0I 2BA1D 4JV5I 3U1YA 4JV5E 4B3RI 5LL6R 4AQYI 1FKAE 5K36C 1EA6A 4LPFA 3H4LA 1ZXMA 3L7ZB 4DV7E 4DV3I 1IBLI 4DV3E 1IBLE 4B3TI 1E3PA 5IWAI 5IWAE 1IBME 4IZJB 4FWDA 4IFDC 4IFDB 1PIEA 4QNKA 4KQVA 2UXCI 4KHPE 4FW5A 2C39A 4LF4E 4UTGA 4DPWA 3NZKA 2UUAE 1H7UA 4DU7A 4FW4A 5K36B 4LFCI 4DV2I 3ZZ0A 2J65A 3P3CA 4ISAA 5BR8I 4Z7YA 4DV7I 5DRPA 4OZEA 1J5EI 1YH8A 4IS9A 4B3RE 4NXNE 2Q2EB 4X64E 2O1UA 1HNXE 2JEBA 2AJ4A 2JEBB 2HFSA 4IZKA 1ZM9A 4FN5A 4BA2A 2C38B 1N33I 1S4EA 5K36A 4MU1A 5EL9A 4IZKB 5JEAA 1KKHA 3J81C 4WUBA 2UXCE 1QZRA 5K36E 1N0VC 3K1JA 1B62A 2GO3A 4JI6I 1XNRE 2O1TA 2CGEA 2HK3A 1Z0BA 1Y5YA 4DUZI 3DD6A 1HR0I 5LMNI 3CDJA 2C37B 4LCGA 4DR5E 3ZZUA 3PS1A 3D4JA 2BR2A 5JEAD 2Z5CB 4DPTA 4NXNI 2CG9A 1N32I 5K36D 4IFDF 4YHHI 2PO2A 4LFAI 2O3ZA 2PNMA 5LMUI 2IERA 4MYTA 1R6LA 1Z5BA 1Z0CA 1N36E 1N34E 4BA1B 1KTVA 4J3DA 4DU8A 2PO1B 1RR9A 2V2VA 3ZZTA 4OO1B 4N3OA 1FNMA 4LF5E 4FW6A 2Z5CA 2HFUA 1FJGE 2O1WA 2CVEA 4B3TE 4IFDE 5IT9C 3PYDA 1HNXI 4U3DA 4XTJA 2ZBKB 4OO1D 4JI1E 1Z0WA 5C0XD 4DV6I 4LFCE 4IZJA 4JI5E 4LF6I 2C38A 4DR2I 1UEKA 3M85G 4LFBE 1HR0E 4GKJI 5K36F 4M1KA 1E3HA 4X65I 4P52A 4K0KI 4QNJA 4OX9I 5L3JA 2JT2A 4LF7E 5IT9Q 1N33E 4FW9A 3LNUA 4PRXA 1XMOI 5A2QQ 2IOQA 5DRQA 1H74A 4USKA 1S16A 1WUUA 2E1RA 4B3ME 4B3MI 4UT4A 2ZITA 4DV5I 3JAMC 4BA1A 5DRRA 2UXBI 3QT8A 4OO1E 1USUA 2UUBE 2WP8A 2A2CA 2HKEA 4DUZE 4B3SE 3WU6A 2IESA 4AIDA 4BA2B 3OTOI 1ELOA 4HYMA 3OTOE 1P42A 2Z5EA 1N36I 3PRYA 3HJCA 1NZ0A 4LF9E 1Y4SA 1MX0A 2GS8A 2AE8A 1XNRI 4DUYI 2X36A 4YY3I 3CDIA 2GO4A 1ZM2A 4DR1E 2V2ZA 5GMDA 1EI1A 4JI3I 2X7IA 1XMOE 4R1FA 3WU4A 4AM3A 3P3GA 4JG4A 2A2DA 5EKWA 1RREA 2ZM6I 4DV4E 4X62E 1NHJA 3ZKDA 1N32E 1Z59A 3ZM7A 3PYEA 4DV0I 3T1HI 5FLXC 2JE6B 4FW7A 4JI2I 4IFDD 2NN6E 2WNRB 1H72C 4MU3A 4DR3E 1IBKE 3M7NG 1HNWE 3B8HA 4NXME 4AQYE 4YY3E 2PO1A 3Q6NA 1XMQI 5C0XA 3J7AG 1UDSA 4USMA 4JI0E 4DPXA 2NN6C 4RPFA 4LF7I 4MQYA 1UDQA 4DUYE 4WUDA 2PNLA 4K0KE 3QT6A 1OYRA 2R3VA 2BA0D 1FWLA 4DR6E 2Z5BA 2VQFE 3F0NA 4FW3A 1OJ4A 1ZM4A 4HXZA 4HY1A 2EFGA 2J7KA 2VESA 4X62I 3K17A 1YHCA 2WNRA 3B78A 4X66E 3HULA 3J81Q 4ZVIA 1K47A 1MU5A 4IZJD 3J7AM 4P7AA 1Z5CA 3M7ND 3T1YE 1MG7A 1Y4UA 2BM1A 2DEIA 2JEAA 4DR7E 5DROA 4DR6I 1UDOA 4MYUA 4KHPI 2ZM6E 4DR4E 2UU9E 5LMUE 3GONA 4JYAI 1KIJA 4DV0E 3K85A 2LJPA 2NN6A 2UUCE 4OO1F 2PNZB 2VF3A 5C0XF 3Q1QA 3LPSA 2F4VE 4HACA 4NXMI 4DV1E 2E5LI 5BR8E 4JI4E 2VQEE 3B82A 2PO2B 5LMNE 2HHHE 1ZXNA 1Z0GA 4NBQA 3U1KA 1U2RA 1KVKA 2BA0G 4ED4A 1VI7A 4DR1I 3GLLA 4I3HA 4LF8E 4JI7I 4DR7I 3WU3A 4LOMA 4GQUA 1BKNA 2C39B 4DXLA 1HNWI 4LFAE 1B63A 2UU9I 3V2UC 2CZ9A 1I94I 3T1HE
chains in the Genus database with same CATH topology
4DV2E 2UUCI 1PVGA 2CZ9A 3ZKBA 2DEJA 4OX9E 2NPFA 3J80C 1FJGI 3PYGA 3WU5A 1HK7A 4URLA 3QT5A 4GKKI 4JYAE 4JI8I 1Z0EA 4DPYA 5GMEA 1NHIA 4JI5I 4LF6E 4LFBI 4X66I 2VQEI 1ZM3A 4DR3I 1IBKI 1Y6ZA 4DV1I 2E5LE 1HNZI 1H73A 1N34I 4LF5I 1J5EE 2V34A 2UXDI 1Z5AA 3CWVA 1H7SA 4X65E 2HK2A 4JI8E 5FWKA 2WW4A 4JI7E 4GKKE 4EMDA 1IBMI 2UUBI 3PYFA 4JI1I 1I94E 3Q6MA 4LF9I 4JI4I 2O1VA 2F4VI 1Z0VA 2R42A 1PKPA 1USVA 1HNZE 2V2QA 1D6TA 4FWHA 1XNQE 1XNQI 1N0UA 2Z5BB 4DV4I 4JI3E 4DR4I 3LTOA 1VISA 1FWKA 4PU9A 4DV5E 2BM0A 3J80Q 4DPUA 4LF4I 2UXBE 1DARA 2OI2A 3QT7A 4B3SI 2IOPA 4DR2E 2HHHI 2GQ0A 2XEXA 4X64I 4GKJE 3M6AA 1XHKA 3JAMQ 3P06A 2VQFI 2V8PA 3V5RA 1A6FA 4LF8I 5FLXQ 2HKJA 4DR5I 2UXDE 1NHHA 5A2QC 1Z0TA 2UUAI 4FWGA 4DV6E 4JI6E 4Z7CA 4PRVA 1XMQE 4WUCA 4YHHE 4HACB 2BV3A 4JI2E 1FI4A 3T1YI 4JI0I 4JV5I 4JV5E 4B3RI 5LL6R 4AQYI 1EA6A 3H4LA 1ZXMA 4DV7E 4DV3I 1IBLI 4DV3E 1IBLE 4B3TI 5IWAI 5IWAE 1IBME 4IZJB 4FWDA 1PIEA 4KQVA 2UXCI 4KHPE 4LF4E 4UTGA 4DPWA 2UUAE 1H7UA 4DU7A 4LFCI 4DV2I 3ZZ0A 5BR8I 4Z7YA 4DV7I 1J5EI 4B3RE 4NXNE 2Q2EB 4X64E 2O1UA 1HNXE 2AJ4A 2HFSA 4IZKA 1ZM9A 4FN5A 1N33I 1S4EA 4IZKB 1KKHA 3J81C 4WUBA 2UXCE 1QZRA 1N0VC 3K1JA 1B62A 4JI6I 1XNRE 2O1TA 2CGEA 2HK3A 1Z0BA 4DUZI 1HR0I 5LMNI 4DR5E 3ZZUA 3D4JA 2Z5CB 4DPTA 4NXNI 2CG9A 1N32I 4YHHI 4LFAI 2PNMA 5LMUI 4MYTA 1Z5BA 1Z0CA 1N36E 1N34E 1KTVA 4DU8A 1RR9A 2V2VA 3ZZTA 4N3OA 1FNMA 4LF5E 2Z5CA 2HFUA 1FJGE 2O1WA 4B3TE 5IT9C 3PYDA 1HNXI 4XTJA 2ZBKB 4JI1E 1Z0WA 4DV6I 4LFCE 4IZJA 4JI5E 4LF6I 4DR2I 1UEKA 4LFBE 1HR0E 4GKJI 4M1KA 4X65I 4P52A 4K0KI 4OX9I 5L3JA 4LF7E 5IT9Q 1N33E 4FW9A 3LNUA 4PRXA 1XMOI 5A2QQ 2IOQA 1H74A 4USKA 1S16A 1WUUA 2E1RA 4B3ME 4B3MI 4UT4A 2ZITA 4DV5I 3JAMC 2UXBI 3QT8A 1USUA 2UUBE 2A2CA 2HKEA 4DUZE 4B3SE 3WU6A 3OTOI 1ELOA 4HYMA 3OTOE 2Z5EA 1N36I 3PRYA 3HJCA 1NZ0A 4LF9E 1Y4SA 1MX0A 2GS8A 1XNRI 4DUYI 2X36A 4YY3I 1ZM2A 4DR1E 2V2ZA 5GMDA 1EI1A 4JI3I 2X7IA 1XMOE 4R1FA 3WU4A 4JG4A 2A2DA 1RREA 2ZM6I 4DV4E 4X62E 1NHJA 3ZKDA 1N32E 1Z59A 3ZM7A 3PYEA 4DV0I 3T1HI 5FLXC 4JI2I 4DR3E 1H72C 1IBKE 1HNWE 3B8HA 4NXME 4AQYE 4YY3E 3Q6NA 1XMQI 3J7AG 4USMA 4JI0E 4DPXA 4RPFA 4LF7I 4DUYE 4WUDA 2PNLA 4K0KE 3QT6A 2R3VA 4DR6E 1FWLA 2Z5BA 2VQFE 3F0NA 1OJ4A 1ZM4A 4HXZA 4HY1A 2EFGA 2J7KA 4X62I 3K17A 3B78A 4X66E 3HULA 3J81Q 4ZVIA 1K47A 1MU5A 4IZJD 3J7AM 4P7AA 1Z5CA 3T1YE 1MG7A 1Y4UA 2BM1A 2DEIA 4DR7E 4DR6I 4MYUA 4KHPI 2ZM6E 4DR4E 2UU9E 5LMUE 3GONA 4JYAI 1KIJA 4DV0E 3K85A 2UUCE 2LJPA 2VF3A 3Q1QA 3LPSA 2F4VE 4HACA 4NXMI 4DV1E 2E5LI 5BR8E 4JI4E 2VQEE 3B82A 2HHHE 5LMNE 1ZXNA 1Z0GA 1U2RA 1KVKA 4ED4A 4DR1I 4I3HA 4LF8E 4JI7I 4DR7I 3WU3A 1BKNA 4DXLA 1HNWI 4LFAE 1B63A 2UU9I 3V2UC 1FKAE 1I94I 3T1HE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 E;  2UUC I;  1PVG A;  2CZ9 A;  3ZKB A;  2DEJ A;  4OX9 E;  2NPF A;  3J80 C;  1FJG I;  3PYG A;  3WU5 A;  4URL A;  3QT5 A;  4GKK I;  4JYA E;  4JI8 I;  1Z0E A;  4DPY A;  5GME A;  1NHI A;  4JI5 I;  4LF6 E;  4LFB I;  4X66 I;  2VQE I;  1ZM3 A;  4DR3 I;  1IBK I;  4DV1 I;  2E5L E;  1HNZ I;  1H73 A;  1N34 I;  4LF5 I;  1J5E E;  2V34 A;  2UXD I;  1Z5A A;  3CWV A;  1H7S A;  4X65 E;  2HK2 A;  4JI8 E;  2WW4 A;  4JI7 E;  4GKK E;  4EMD A;  1IBM I;  2UUB I;  3PYF A;  4JI1 I;  1I94 E;  4LF9 I;  4JI4 I;  2F4V I;  1Z0V A;  2R42 A;  1PKP A;  1HNZ E;  2V2Q A;  1D6T A;  4FWH A;  1XNQ E;  1XNQ I;  1N0U A;  4DV4 I;  4JI3 E;  4DR4 I;  3LTO A;  1VIS A;  1FWK A;  4PU9 A;  4DV5 E;  2BM0 A;  3J80 Q;  4DPU A;  4LF4 I;  2UXB E;  1DAR A;  2OI2 A;  3QT7 A;  4B3S I;  4DR2 E;  2HHH I;  2XEX A;  4X64 I;  4GKJ E;  3M6A A;  1XHK A;  3JAM Q;  2VQF I;  2V8P A;  3V5R A;  1A6F A;  4LF8 I;  5FLX Q;  2HKJ A;  4DR5 I;  2UXD E;  1NHH A;  5A2Q C;  1Z0T A;  2UUA I;  4FWG A;  4DV6 E;  4JI6 E;  4Z7C A;  4PRV A;  1XMQ E;  4WUC A;  4YHH E;  4HAC B;  2BV3 A;  4JI2 E;  1FI4 A;  3T1Y I;  4JI0 I;  4JV5 I;  4JV5 E;  4B3R I;  5LL6 R;  4AQY I;  1EA6 A;  3H4L A;  1ZXM A;  4DV7 E;  4DV3 I;  1IBL I;  4DV3 E;  1IBL E;  4B3T I;  5IWA I;  5IWA E;  1IBM E;  4FWD A;  1PIE A;  4KQV A;  2UXC I;  4KHP E;  4LF4 E;  4UTG A;  4DPW A;  2UUA E;  1H7U A;  4DU7 A;  4LFC I;  4DV2 I;  3ZZ0 A;  5BR8 I;  4Z7Y A;  4DV7 I;  1J5E I;  4B3R E;  4NXN E;  2Q2E B;  4X64 E;  1HNX E;  2AJ4 A;  2HFS A;  1ZM9 A;  4FN5 A;  1N33 I;  1S4E A;  1KKH A;  3J81 C;  4WUB A;  2UXC E;  1QZR A;  1N0V C;  3K1J A;  1B62 A;  4JI6 I;  1XNR E;  2HK3 A;  1Z0B A;  4DUZ I;  1HR0 I;  5LMN I;  4DR5 E;  3ZZU A;  3D4J A;  4DPT A;  4NXN I;  1N32 I;  4YHH I;  4LFA I;  5LMU I;  4MYT A;  1Z5B A;  1Z0C A;  1N36 E;  1N34 E;  1KTV A;  4DU8 A;  1RR9 A;  2V2V A;  3ZZT A;  1FNM A;  4LF5 E;  2HFU A;  1FJG E;  4B3T E;  5IT9 C;  3PYD A;  1HNX I;  4XTJ A;  2ZBK B;  4JI1 E;  1Z0W A;  4DV6 I;  4LFC E;  4JI5 E;  4LF6 I;  4DR2 I;  1UEK A;  4LFB E;  1HR0 E;  4GKJ I;  4M1K A;  4X65 I;  4P52 A;  4K0K I;  4OX9 I;  5L3J A;  4LF7 E;  5IT9 Q;  1N33 E;  4FW9 A;  3LNU A;  4PRX A;  1XMO I;  5A2Q Q;  1H74 A;  4USK A;  1S16 A;  1WUU A;  2E1R A;  4B3M E;  4B3M I;  4UT4 A;  2ZIT A;  4DV5 I;  3JAM C;  2UXB I;  3QT8 A;  2UUB E;  2A2C A;  2HKE A;  4DUZ E;  4B3S E;  3WU6 A;  3OTO I;  1ELO A;  4HYM A;  3OTO E;  1N36 I;  1NZ0 A;  4LF9 E;  1MX0 A;  2GS8 A;  1XNR I;  4DUY I;  2X36 A;  4YY3 I;  1ZM2 A;  4DR1 E;  2V2Z A;  5GMD A;  1EI1 A;  4JI3 I;  2X7I A;  1XMO E;  4R1F A;  3WU4 A;  4JG4 A;  2A2D A;  1RRE A;  2ZM6 I;  4DV4 E;  4X62 E;  1N32 E;  3ZKD A;  1NHJ A;  1Z59 A;  3ZM7 A;  3PYE A;  4DV0 I;  3T1H I;  5FLX C;  4JI2 I;  4DR3 E;  1H72 C;  1IBK E;  1HNW E;  3B8H A;  4NXM E;  4AQY E;  4YY3 E;  1XMQ I;  3J7A G;  4USM A;  4JI0 E;  4DPX A;  4RPF A;  4LF7 I;  4DUY E;  4WUD A;  4K0K E;  3QT6 A;  2R3V A;  4DR6 E;  1FWL A;  2VQF E;  3F0N A;  1OJ4 A;  1ZM4 A;  4HXZ A;  4HY1 A;  2EFG A;  2J7K A;  4X62 I;  3K17 A;  3B78 A;  4X66 E;  3HUL A;  3J81 Q;  4ZVI A;  1K47 A;  1MU5 A;  3J7A M;  4P7A A;  1Z5C A;  3T1Y E;  1MG7 A;  2BM1 A;  2DEI A;  4DR7 E;  4DR6 I;  4MYU A;  4KHP I;  2ZM6 E;  4DR4 E;  2UU9 E;  5LMU E;  3GON A;  4JYA I;  1KIJ A;  4DV0 E;  2LJP A;  2UUC E;  2VF3 A;  3Q1Q A;  3LPS A;  2F4V E;  4HAC A;  4NXM I;  4DV1 E;  2E5L I;  5BR8 E;  4JI4 E;  2VQE E;  3B82 A;  2HHH E;  5LMN E;  1ZXN A;  1Z0G A;  1U2R A;  1KVK A;  4ED4 A;  4DR1 I;  4I3H A;  4LF8 E;  4JI7 I;  4DR7 I;  3WU3 A;  1BKN A;  4DXL A;  1HNW I;  4LFA E;  1B63 A;  2UU9 I;  3V2U C;  1FKA E;  1I94 I;  3T1H E; 
#chains in the Genus database with same CATH topology
 5DNX A;  5JEA F;  4DV2 E;  2UUC I;  1PVG A;  3ZKB A;  2DEJ A;  4OX9 E;  3KRN A;  2NPF A;  3J80 C;  1FJG I;  3PYG A;  3WU5 A;  1HK7 A;  4MU0 A;  4URL A;  3QT5 A;  4GKK I;  4JYA E;  3H1C A;  2BR2 B;  2NN6 D;  4JI8 I;  3GCM A;  1XXE A;  1Z0E A;  4DPY A;  4OKG A;  5GME A;  1NHI A;  5DNL A;  5JEA C;  4JI5 I;  4LF6 E;  2NN6 B;  4MDT A;  4U3B A;  4LFB I;  4X66 I;  2VQE I;  1ZM3 A;  4DR3 I;  1IBK I;  3UHM A;  1Y6Z A;  2PO0 A;  4DV1 I;  2E5L E;  1HNZ I;  1UDN A;  1H73 A;  2C37 A;  5JEA B;  5JEA E;  1N34 I;  2BA1 G;  4LF5 I;  1OYS A;  1J5E E;  5C0X B;  4OO1 C;  1Y60 A;  2V34 A;  2UXD I;  1Z5A A;  3CWV A;  1H7S A;  4X65 E;  2HK2 A;  4JI8 E;  5FWK A;  1R6M A;  2WW4 A;  2JEA B;  4JI7 E;  4GKK E;  4EMD A;  1IBM I;  4LCF A;  2UUB I;  3PYF A;  4JI1 I;  5C0X E;  1I94 E;  3Q6M A;  4LF9 I;  4JI4 I;  2O1V A;  3L7Z A;  2JE6 A;  2F4V I;  3B4T A;  2F1D A;  1Z0V A;  2PNZ A;  2R42 A;  1PKP A;  1USV A;  3M85 D;  2NN6 F;  4OO1 A;  1HNZ E;  2V2Q A;  1D6T A;  4FWH A;  5ELW A;  4IFD A;  1XNQ E;  1XNQ I;  1N0U A;  2Z5B B;  4DV4 I;  4JI3 E;  1OYP A;  4DR4 I;  3LTO A;  3GME A;  1VIS A;  1FWK A;  4PU9 A;  4DV5 E;  2BM0 A;  3J80 Q;  3P76 A;  4DPU A;  4LF4 I;  2UXB E;  1DAR A;  2OI2 A;  3PS2 A;  1RHY A;  3QT7 A;  2WP8 B;  4LCH A;  4B3S I;  2IOP A;  4DR2 E;  2HHH I;  2GQ0 A;  3P3E A;  4MU4 A;  2XEX A;  4X64 I;  4GKJ E;  3M6A A;  1XHK A;  5C0X C;  3JAM Q;  3P06 A;  2VQF I;  2V8P A;  2PO0 B;  3V5R A;  1A6F A;  4LF8 I;  5FLX Q;  2HKJ A;  4DR5 I;  2UXD E;  1NHH A;  3HKM A;  4AIM A;  5A2Q C;  1Z0T A;  2UUA I;  4FWG A;  4DV6 E;  4JI6 E;  4Z7C A;  4PRV A;  1XMQ E;  3PS3 A;  4WUC A;  4YHH E;  4HAC B;  2BV3 A;  4JI2 E;  1FI4 A;  3T1Y I;  4JI0 I;  2BA1 D;  4JV5 I;  3U1Y A;  4JV5 E;  4B3R I;  5LL6 R;  4AQY I;  1FKA E;  5K36 C;  1EA6 A;  4LPF A;  3H4L A;  1ZXM A;  3L7Z B;  4DV7 E;  4DV3 I;  1IBL I;  4DV3 E;  1IBL E;  4B3T I;  1E3P A;  5IWA I;  5IWA E;  1IBM E;  4IZJ B;  4FWD A;  4IFD C;  4IFD B;  1PIE A;  4QNK A;  4KQV A;  2UXC I;  4KHP E;  4FW5 A;  2C39 A;  4LF4 E;  4UTG A;  4DPW A;  3NZK A;  2UUA E;  1H7U A;  4DU7 A;  4FW4 A;  5K36 B;  4LFC I;  4DV2 I;  3ZZ0 A;  2J65 A;  3P3C A;  4ISA A;  5BR8 I;  4Z7Y A;  4DV7 I;  5DRP A;  4OZE A;  1J5E I;  1YH8 A;  4IS9 A;  4B3R E;  4NXN E;  2Q2E B;  4X64 E;  2O1U A;  1HNX E;  2JEB A;  2AJ4 A;  2JEB B;  2HFS A;  4IZK A;  1ZM9 A;  4FN5 A;  4BA2 A;  2C38 B;  1N33 I;  1S4E A;  5K36 A;  4MU1 A;  5EL9 A;  4IZK B;  5JEA A;  1KKH A;  3J81 C;  4WUB A;  2UXC E;  1QZR A;  5K36 E;  1N0V C;  3K1J A;  1B62 A;  2GO3 A;  4JI6 I;  1XNR E;  2O1T A;  2CGE A;  2HK3 A;  1Z0B A;  1Y5Y A;  4DUZ I;  3DD6 A;  1HR0 I;  5LMN I;  3CDJ A;  2C37 B;  4LCG A;  4DR5 E;  3ZZU A;  3PS1 A;  3D4J A;  2BR2 A;  5JEA D;  2Z5C B;  4DPT A;  4NXN I;  2CG9 A;  1N32 I;  5K36 D;  4IFD F;  4YHH I;  2PO2 A;  4LFA I;  2O3Z A;  2PNM A;  5LMU I;  2IER A;  4MYT A;  1R6L A;  1Z5B A;  1Z0C A;  1N36 E;  1N34 E;  4BA1 B;  1KTV A;  4J3D A;  4DU8 A;  2PO1 B;  1RR9 A;  2V2V A;  3ZZT A;  4OO1 B;  4N3O A;  1FNM A;  4LF5 E;  4FW6 A;  2Z5C A;  2HFU A;  1FJG E;  2O1W A;  2CVE A;  4B3T E;  4IFD E;  5IT9 C;  3PYD A;  1HNX I;  4U3D A;  4XTJ A;  2ZBK B;  4OO1 D;  4JI1 E;  1Z0W A;  5C0X D;  4DV6 I;  4LFC E;  4IZJ A;  4JI5 E;  4LF6 I;  2C38 A;  4DR2 I;  1UEK A;  3M85 G;  4LFB E;  1HR0 E;  4GKJ I;  5K36 F;  4M1K A;  1E3H A;  4X65 I;  4P52 A;  4K0K I;  4QNJ A;  4OX9 I;  5L3J A;  2JT2 A;  4LF7 E;  5IT9 Q;  1N33 E;  4FW9 A;  3LNU A;  4PRX A;  1XMO I;  5A2Q Q;  2IOQ A;  5DRQ A;  1H74 A;  4USK A;  1S16 A;  1WUU A;  2E1R A;  4B3M E;  4B3M I;  4UT4 A;  2ZIT A;  4DV5 I;  3JAM C;  4BA1 A;  5DRR A;  2UXB I;  3QT8 A;  4OO1 E;  1USU A;  2UUB E;  2WP8 A;  2A2C A;  2HKE A;  4DUZ E;  4B3S E;  3WU6 A;  2IES A;  4AID A;  4BA2 B;  3OTO I;  1ELO A;  4HYM A;  3OTO E;  1P42 A;  2Z5E A;  1N36 I;  3PRY A;  3HJC A;  1NZ0 A;  4LF9 E;  1Y4S A;  1MX0 A;  2GS8 A;  2AE8 A;  1XNR I;  4DUY I;  2X36 A;  4YY3 I;  3CDI A;  2GO4 A;  1ZM2 A;  4DR1 E;  2V2Z A;  5GMD A;  1EI1 A;  4JI3 I;  2X7I A;  1XMO E;  4R1F A;  3WU4 A;  4AM3 A;  3P3G A;  4JG4 A;  2A2D A;  5EKW A;  1RRE A;  2ZM6 I;  4DV4 E;  4X62 E;  1NHJ A;  3ZKD A;  1N32 E;  1Z59 A;  3ZM7 A;  3PYE A;  4DV0 I;  3T1H I;  5FLX C;  2JE6 B;  4FW7 A;  4JI2 I;  4IFD D;  2NN6 E;  2WNR B;  1H72 C;  4MU3 A;  4DR3 E;  1IBK E;  3M7N G;  1HNW E;  3B8H A;  4NXM E;  4AQY E;  4YY3 E;  2PO1 A;  3Q6N A;  1XMQ I;  5C0X A;  3J7A G;  1UDS A;  4USM A;  4JI0 E;  4DPX A;  2NN6 C;  4RPF A;  4LF7 I;  4MQY A;  1UDQ A;  4DUY E;  4WUD A;  2PNL A;  4K0K E;  3QT6 A;  1OYR A;  2R3V A;  2BA0 D;  1FWL A;  4DR6 E;  2Z5B A;  2VQF E;  3F0N A;  4FW3 A;  1OJ4 A;  1ZM4 A;  4HXZ A;  4HY1 A;  2EFG A;  2J7K A;  2VES A;  4X62 I;  3K17 A;  1YHC A;  2WNR A;  3B78 A;  4X66 E;  3HUL A;  3J81 Q;  4ZVI A;  1K47 A;  1MU5 A;  4IZJ D;  3J7A M;  4P7A A;  1Z5C A;  3M7N D;  3T1Y E;  1MG7 A;  1Y4U A;  2BM1 A;  2DEI A;  2JEA A;  4DR7 E;  5DRO A;  4DR6 I;  1UDO A;  4MYU A;  4KHP I;  2ZM6 E;  4DR4 E;  2UU9 E;  5LMU E;  3GON A;  4JYA I;  1KIJ A;  4DV0 E;  3K85 A;  2LJP A;  2NN6 A;  2UUC E;  4OO1 F;  2PNZ B;  2VF3 A;  5C0X F;  3Q1Q A;  3LPS A;  2F4V E;  4HAC A;  4NXM I;  4DV1 E;  2E5L I;  5BR8 E;  4JI4 E;  2VQE E;  3B82 A;  2PO2 B;  5LMN E;  2HHH E;  1ZXN A;  1Z0G A;  4NBQ A;  3U1K A;  1U2R A;  1KVK A;  2BA0 G;  4ED4 A;  1VI7 A;  4DR1 I;  3GLL A;  4I3H A;  4LF8 E;  4JI7 I;  4DR7 I;  3WU3 A;  4LOM A;  4GQU A;  1BKN A;  2C39 B;  4DXL A;  1HNW I;  4LFA E;  1B63 A;  2UU9 I;  3V2U C;  2CZ9 A;  1I94 I;  3T1H E; 
#chains in the Genus database with same CATH homology
 4DV2 E;  2UUC I;  1PVG A;  2CZ9 A;  3ZKB A;  2DEJ A;  4OX9 E;  2NPF A;  3J80 C;  1FJG I;  3PYG A;  3WU5 A;  1HK7 A;  4URL A;  3QT5 A;  4GKK I;  4JYA E;  4JI8 I;  1Z0E A;  4DPY A;  5GME A;  1NHI A;  4JI5 I;  4LF6 E;  4LFB I;  4X66 I;  2VQE I;  1ZM3 A;  4DR3 I;  1IBK I;  1Y6Z A;  4DV1 I;  2E5L E;  1HNZ I;  1H73 A;  1N34 I;  4LF5 I;  1J5E E;  2V34 A;  2UXD I;  1Z5A A;  3CWV A;  1H7S A;  4X65 E;  2HK2 A;  4JI8 E;  5FWK A;  2WW4 A;  4JI7 E;  4GKK E;  4EMD A;  1IBM I;  2UUB I;  3PYF A;  4JI1 I;  1I94 E;  3Q6M A;  4LF9 I;  4JI4 I;  2O1V A;  2F4V I;  1Z0V A;  2R42 A;  1PKP A;  1USV A;  1HNZ E;  2V2Q A;  1D6T A;  4FWH A;  1XNQ E;  1XNQ I;  1N0U A;  2Z5B B;  4DV4 I;  4JI3 E;  4DR4 I;  3LTO A;  1VIS A;  1FWK A;  4PU9 A;  4DV5 E;  2BM0 A;  3J80 Q;  4DPU A;  4LF4 I;  2UXB E;  1DAR A;  2OI2 A;  3QT7 A;  4B3S I;  2IOP A;  4DR2 E;  2HHH I;  2GQ0 A;  2XEX A;  4X64 I;  4GKJ E;  3M6A A;  1XHK A;  3JAM Q;  3P06 A;  2VQF I;  2V8P A;  3V5R A;  1A6F A;  4LF8 I;  5FLX Q;  2HKJ A;  4DR5 I;  2UXD E;  1NHH A;  5A2Q C;  1Z0T A;  2UUA I;  4FWG A;  4DV6 E;  4JI6 E;  4Z7C A;  4PRV A;  1XMQ E;  4WUC A;  4YHH E;  4HAC B;  2BV3 A;  4JI2 E;  1FI4 A;  3T1Y I;  4JI0 I;  4JV5 I;  4JV5 E;  4B3R I;  5LL6 R;  4AQY I;  1EA6 A;  3H4L A;  1ZXM A;  4DV7 E;  4DV3 I;  1IBL I;  4DV3 E;  1IBL E;  4B3T I;  5IWA I;  5IWA E;  1IBM E;  4IZJ B;  4FWD A;  1PIE A;  4KQV A;  2UXC I;  4KHP E;  4LF4 E;  4UTG A;  4DPW A;  2UUA E;  1H7U A;  4DU7 A;  4LFC I;  4DV2 I;  3ZZ0 A;  5BR8 I;  4Z7Y A;  4DV7 I;  1J5E I;  4B3R E;  4NXN E;  2Q2E B;  4X64 E;  2O1U A;  1HNX E;  2AJ4 A;  2HFS A;  4IZK A;  1ZM9 A;  4FN5 A;  1N33 I;  1S4E A;  4IZK B;  1KKH A;  3J81 C;  4WUB A;  2UXC E;  1QZR A;  1N0V C;  3K1J A;  1B62 A;  4JI6 I;  1XNR E;  2O1T A;  2CGE A;  2HK3 A;  1Z0B A;  4DUZ I;  1HR0 I;  5LMN I;  4DR5 E;  3ZZU A;  3D4J A;  2Z5C B;  4DPT A;  4NXN I;  2CG9 A;  1N32 I;  4YHH I;  4LFA I;  2PNM A;  5LMU I;  4MYT A;  1Z5B A;  1Z0C A;  1N36 E;  1N34 E;  1KTV A;  4DU8 A;  1RR9 A;  2V2V A;  3ZZT A;  4N3O A;  1FNM A;  4LF5 E;  2Z5C A;  2HFU A;  1FJG E;  2O1W A;  4B3T E;  5IT9 C;  3PYD A;  1HNX I;  4XTJ A;  2ZBK B;  4JI1 E;  1Z0W A;  4DV6 I;  4LFC E;  4IZJ A;  4JI5 E;  4LF6 I;  4DR2 I;  1UEK A;  4LFB E;  1HR0 E;  4GKJ I;  4M1K A;  4X65 I;  4P52 A;  4K0K I;  4OX9 I;  5L3J A;  4LF7 E;  5IT9 Q;  1N33 E;  4FW9 A;  3LNU A;  4PRX A;  1XMO I;  5A2Q Q;  2IOQ A;  1H74 A;  4USK A;  1S16 A;  1WUU A;  2E1R A;  4B3M E;  4B3M I;  4UT4 A;  2ZIT A;  4DV5 I;  3JAM C;  2UXB I;  3QT8 A;  1USU A;  2UUB E;  2A2C A;  2HKE A;  4DUZ E;  4B3S E;  3WU6 A;  3OTO I;  1ELO A;  4HYM A;  3OTO E;  2Z5E A;  1N36 I;  3PRY A;  3HJC A;  1NZ0 A;  4LF9 E;  1Y4S A;  1MX0 A;  2GS8 A;  1XNR I;  4DUY I;  2X36 A;  4YY3 I;  1ZM2 A;  4DR1 E;  2V2Z A;  5GMD A;  1EI1 A;  4JI3 I;  2X7I A;  1XMO E;  4R1F A;  3WU4 A;  4JG4 A;  2A2D A;  1RRE A;  2ZM6 I;  4DV4 E;  4X62 E;  1NHJ A;  3ZKD A;  1N32 E;  1Z59 A;  3ZM7 A;  3PYE A;  4DV0 I;  3T1H I;  5FLX C;  4JI2 I;  4DR3 E;  1H72 C;  1IBK E;  1HNW E;  3B8H A;  4NXM E;  4AQY E;  4YY3 E;  3Q6N A;  1XMQ I;  3J7A G;  4USM A;  4JI0 E;  4DPX A;  4RPF A;  4LF7 I;  4DUY E;  4WUD A;  2PNL A;  4K0K E;  3QT6 A;  2R3V A;  4DR6 E;  1FWL A;  2Z5B A;  2VQF E;  3F0N A;  1OJ4 A;  1ZM4 A;  4HXZ A;  4HY1 A;  2EFG A;  2J7K A;  4X62 I;  3K17 A;  3B78 A;  4X66 E;  3HUL A;  3J81 Q;  4ZVI A;  1K47 A;  1MU5 A;  4IZJ D;  3J7A M;  4P7A A;  1Z5C A;  3T1Y E;  1MG7 A;  1Y4U A;  2BM1 A;  2DEI A;  4DR7 E;  4DR6 I;  4MYU A;  4KHP I;  2ZM6 E;  4DR4 E;  2UU9 E;  5LMU E;  3GON A;  4JYA I;  1KIJ A;  4DV0 E;  3K85 A;  2UUC E;  2LJP A;  2VF3 A;  3Q1Q A;  3LPS A;  2F4V E;  4HAC A;  4NXM I;  4DV1 E;  2E5L I;  5BR8 E;  4JI4 E;  2VQE E;  3B82 A;  2HHH E;  5LMN E;  1ZXN A;  1Z0G A;  1U2R A;  1KVK A;  4ED4 A;  4DR1 I;  4I3H A;  4LF8 E;  4JI7 I;  4DR7 I;  3WU3 A;  1BKN A;  4DXL A;  1HNW I;  4LFA E;  1B63 A;  2UU9 I;  3V2U C;  1FKA E;  1I94 I;  3T1H E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...