4DUZI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzI00
1D6TA 3ZKBA 1J5EE 1N36I 1RREA 1S4EA 3B78A 2V34A 1H73A 1H74A 4DR1E 1OJ4A 5GMEA 3CWVA 1N0VC 5BR8I 4JV5E 2GS8A 4JI4I 2HHHE 1HNZI 3T1HE 4HY1A 3ZZTA 2UUCI 2UXBI 4FW9A 4PRXA 4B3SE 2DEIA 2VF3A 4JI3I 4GKJE 2V2ZA 4DPWA 2AJ4A 4P52A 1Z0GA 4LFCE 5GMDA 1HR0I 3T1YE 4B3MI 4DR3E 4LF8I 1N33E 4NXNE 1ZM3A 1IBMI 2UXDI 1XMQI 2BV3A 4K0KI 4X62I 1H72C 4HACA 4DV3E 1HNXE 4NXMI 5L3JA 1FJGE 1Z0EA 4DUYE 1FNMA 2HK3A 3GONA 4X66E 4DR5E 5IT9C 1KVKA 4USKA 2ZBKB 4DV7E 4FWGA 4JI0E 4GKKE 1N34I 3OTOE 1XNRE 2ZM6E 4JI7E 1XMOI 4JYAI 1Z59A 4X65I 5FLXC 1Z0VA 3B82A 2WW4A 3J7AG 4DV0E 1EA6A 4X64E 4LFAE 4DV6I 5LMUI 2E5LE 2UU9E 4JI2I 4FWDA 4FWHA 4DU8A 1NZ0A 2UXCE 4Z7YA 2UUBE 4B3TE 5LMNE 2HFUA 1J5EI 4RPFA 3K1JA 4MYTA 4LFBE 4M1KA 4DR1I 2X7IA 4P7AA 4YHHE 2HFSA 5LL6R 4JV5I 3QT6A 3T1HI 1A6FA 2UUAI 2BM0A 4B3SI 1K47A 4HYMA 1PKPA 1BKNA 1ZXNA 4DUZI 4GKJI 1ZXMA 3J81Q 1XNQE 4YY3E 4MYUA 1HNWI 4LFCI 2V8PA 2VQFE 4PRVA 3T1YI 4DV5I 1Z0CA 1IBKI 3LPSA 1I94E 1MX0A 1N32I 4OX9I 1ELOA 1MG7A 3K17A 4DV4E 1IBLE 4DV3I 4AQYE 4USMA 4JI8E 1HNXI 2V2VA 4DR7E 1FJGI 1B63A 4DUYI 4X66I 4JG4A 4LF9I 4DR5I 4DR6E 4LF4I 4ZVIA 1H7SA 4DV7I 1ZM9A 2BM1A 4GKKI 3OTOI 2ZM6I 4JI7I 3Q1QA 4LF5E 4LF7E 2F4VI 3F0NA 4WUCA 4DPXA 4JI6E 3J80Q 4DV0I 4LFAI 1WUUA 2A2CA 5IWAI 2E5LI 2NPFA 4LF6E 1VISA 1Z0WA 4DV2E 4DV1I 1U2RA 1Z5CA 2UXCI 2UUBI 4B3TI 5LMNI 1PIEA 2E1RA 3ZKDA 3ZM7A 2OI2A 3JAMQ 4JI5E 4B3RE 4NXME 1DARA 1FWLA 1Z0TA 3WU6A 4YHHI 2VQEE 2A2DA 3WU5A 1FWKA 4R1FA 4DR4E 2CZ9A 2EFGA 3ZZ0A 1S16A 1B62A 1XNQI 4X65E 1H7UA 1EI1A 4KHPE 1ZM4A 2HHHI 4ED4A 2VQFI 4KQVA 3H4LA 2X36A 3J81C 1KIJA 1I94I 4FN5A 5A2QQ 1N0UA 1FKAE 4DV4I 4UTGA 3PYDA 2J7KA 1IBLI 1PVGA 2LJPA 4JI1E 1KTVA 4AQYI 3M6AA 4JI8I 4DR2E 1ZM2A 4DR3I 1N33I 4NXNI 1FI4A 3QT7A 3ZZUA 2R42A 4DR7I 1Z0BA 3B8HA 1NHIA 4DR6I 3QT8A 1N36E 1Z5BA 2UUAE 3PYEA 2V2QA 4LF5I 4LF7I 4XTJA 4HACB 4DUZE 3WU4A 4JI6I 5BR8E 3LNUA 4JI4E 1UEKA 4JI0I 1HNZE 1HNWE 2HK2A 1XNRI 2UUCE 4DV5E 3V2UC 2UXBE 1IBKE 4LF6I 4HXZA 4JI3E 3J80C 4DV2I 1N32E 4OX9E 4DXLA 3LTOA 1RR9A 4X64I 4JI5I 4B3RI 3D4JA 1HR0E 2Q2EB 4B3ME 4LF8E 1IBME 2UU9I 2UXDE 1XMQE 4K0KE 4DPUA 4LF9E 3JAMC 4X62E 2VQEI 4I3HA 4LF4E 3HULA 1NHHA 4DR4I 5IT9Q 1XHKA 4WUBA 2XEXA 4LFBI 2ZITA 2F4VE 4KHPI 4PU9A 3PYGA 1Z5AA 4DPTA 1N34E 2HKJA 5FLXQ 1KKHA 3J7AM 1NHJA 5IWAE 1XMOE 4JYAE 3V5RA 2DEJA 4DV1E 4YY3I 3QT5A 4WUDA 4URLA 2R3VA 4JI1I 3WU3A 3PYFA 1QZRA 4DR2I 4EMDA 5A2QC 4DV6E 5LMUE 4DPYA 4DU7A 4UT4A 4Z7CA 2HKEA 4JI2E 1MU5A
chains in the Genus database with same CATH superfamily
1D6TA 5K36C 4MU0A 3ZKBA 4IZKA 1J5EE 3Q6MA 1N36I 1RREA 1S4EA 5ELWA 4BA2A 5K36A 3B78A 2V34A 1P42A 1H73A 1H74A 4DR1E 1OJ4A 1VI7A 5GMEA 3CWVA 1N0VC 5EL9A 5BR8I 4IZJD 2BA1D 3DD6A 4JV5E 2GS8A 4JI4I 3P06A 2HHHE 1HNZI 3T1HE 4FW6A 4HY1A 3ZZTA 2UUCI 2UXBI 4FW9A 4PRXA 4B3SE 2DEIA 2VF3A 2JEBA 4JI3I 1RHYA 2JE6A 4GKJE 2V2ZA 4DPWA 1YHCA 2AJ4A 4P52A 1Z0GA 2IOPA 3CDJA 4LFCE 5GMDA 1HR0I 3T1YE 4B3MI 4DR3E 4LF8I 5JEAB 1N33E 2WNRB 4NXNE 1ZM3A 1IBMI 3NZKA 4IFDF 5FWKA 2UXDI 1XMQI 2BV3A 4K0KI 4X62I 2BR2B 1H72C 4HACA 4DV3E 4IFDE 1HNXE 2C38A 4NXMI 4MU3A 5L3JA 1FJGE 2O1VA 1Z0EA 4DUYE 4BA1B 1FNMA 2HK3A 3GONA 4X66E 2JEAA 4DR5E 5IT9C 1KVKA 4USKA 2PO0B 2WP8A 2ZBKB 4DV7E 5K36D 4FWGA 2GO3A 5K36F 4JI0E 4GKKE 1N34I 1OYPA 4IS9A 3OTOE 4OKGA 1YH8A 1XNRE 2ZM6E 4JI7E 1XMOI 4JYAI 2PNMA 1USUA 1Z59A 4X65I 3PS1A 5FLXC 1Z0VA 3B82A 2WW4A 3J7AG 3HKMA 4DV0E 1EA6A 4X64E 2C37A 2F1DA 4LFAE 3GCMA 4DV6I 5LMUI 2C39B 2PO2B 2E5LE 2UU9E 4IFDB 4JI2I 4FWDA 4FWHA 4DU8A 3U1KA 1NZ0A 2UXCE 4Z7YA 2UUBE 4LCHA 5LMNE 4B3TE 2HFUA 1J5EI 1R6LA 4RPFA 3K1JA 2Z5CB 2IOQA 4MYTA 3L7ZB 4LFBE 4M1KA 4DR1I 2NN6A 2X7IA 4MU4A 4MU1A 4P7AA 4YHHE 5C0XA 2HFSA 5LL6R 4JV5I 3QT6A 1R6MA 3P3CA 3T1HI 1A6FA 2UUAI 4J3DA 2BM0A 4B3SI 1K47A 4HYMA 1Y4SA 1PKPA 1BKNA 1ZXNA 3P3GA 4DUZI 4GKJI 1ZXMA 3J81Q 1XNQE 4YY3E 4U3DA 4MYUA 1Y4UA 1HNWI 4LFCI 2V8PA 4FW4A 2VQFE 2O3ZA 4PRVA 4OO1C 3T1YI 4DV5I 1Z0CA 1IBKI 2JE6B 3LPSA 1I94E 1MX0A 2AE8A 1N32I 5DRRA 4OO1A 1ELOA 1MG7A 4OX9I 3K17A 4DV4E 1IBLE 2GQ0A 4DV3I 4AQYE 4USMA 4JI8E 1HNXI 2V2VA 4DR7E 3CDIA 1FJGI 1B63A 4DUYI 4X66I 4JG4A 4LF9I 4DR5I 4DR6E 1UDSA 4U3BA 4LF4I 4ZVIA 1H7SA 4DV7I 1ZM9A 2BM1A 4GKKI 5JEAC 2NN6D 3OTOI 2NN6F 2ZM6I 4JI7I 4FW3A 1XXEA 2Z5BA 5C0XD 2JEAB 5C0XF 3Q1QA 4LF5E 5JEAA 2WNRA 4LF7E 2F4VI 3F0NA 4WUCA 4DPXA 4JI6E 2PO1A 4IZJB 3J80Q 4MQYA 4DV0I 2GO4A 4N3OA 4LFAI 1WUUA 2A2CA 3PS2A 5IWAI 2E5LI 2NPFA 4LF6E 3H1CA 4LOMA 2PNZB 1VISA 1HK7A 2IERA 5K36E 1Z0WA 4DV2E 4DV1I 1U2RA 5DNLA 1Z5CA 2UXCI 2UUBI 4B3TI 5LMNI 1PIEA 2C37B 2E1RA 3ZKDA 3ZM7A 5DRQA 2OI2A 3JAMQ 2PO0A 4JI5E 3GMEA 4B3RE 1USVA 2CGEA 4OO1D 4OO1F 4NXME 1Y6ZA 1DARA 1FWLA 3P76A 1Z0TA 3WU6A 4YHHI 4FW7A 4NBQA 2VQEE 3M7NG 2CVEA 2A2DA 3WU5A 1FWKA 4R1FA 4DR4E 2NN6B 1Y5YA 4IFDC 2CZ9A 2EFGA 5C0XB 3ZZ0A 1S16A 1B62A 4IZKB 1XNQI 4X65E 1H7UA 1EI1A 4FW5A 1OYSA 3UHMA 4KHPE 3U1YA 1ZM4A 2HHHI 4ED4A 1OYRA 4BA2B 2VQFI 4KQVA 2IESA 5K36B 5JEAD 5DROA 3H4LA 2X36A 3J81C 1KIJA 3KRNA 4OZEA 1I94I 4FN5A 4MDTA 5A2QQ 1N0UA 4DV4I 1FKAE 4UTGA 3PYDA 2J7KA 1IBLI 1PVGA 2LJPA 4JI1E 1KTVA 4AQYI 3M6AA 2J65A 4JI8I 4DR2E 1ZM2A 4DR3I 2JEBB 1N33I 4NXNI 1FI4A 3QT7A 3ZZUA 2R42A 4DR7I 1Z0BA 4OO1B 4GQUA 5DRPA 3HJCA 3B8HA 3PS3A 4ISAA 2BA0G 1NHIA 1UDNA 4DR6I 4AIMA 3QT8A 1N36E 1Z5BA 2O1WA 2UUAE 3K85A 3P3EA 3PYEA 2V2QA 4LF5I 4LF7I 4LCFA 4XTJA 4HACB 4DUZE 3M85G 3WU4A 4JI6I 5BR8E 2C38B 3LNUA 4JI4E 1UEKA 4JI0I 2Z5BB 1HNZE 2HK2A 1HNWE 4AM3A 1XNRI 2UUCE 4DV5E 3V2UC 2UXBE 3GLLA 1IBKE 4LF6I 3M7ND 4IFDD 4HXZA 4JI3E 2WP8B 3J80C 4DV2I 2PO1B 1N32E 4OX9E 2NN6E 4DXLA 5DNXA 3LTOA 1Y60A 5C0XE 2BR2A 2JT2A 1RR9A 4X64I 4JI5I 4B3RI 3D4JA 1HR0E 2Q2EB 4B3ME 4LF8E 2BA1G 2CG9A 1UDQA 1IBME 2VESA 2UU9I 4AIDA 2UXDE 1XMQE 5EKWA 4K0KE 4DPUA 1E3HA 4LF9E 3JAMC 4BA1A 4X62E 2VQEI 4I3HA 4LF4E 3HULA 1NHHA 4DR4I 5IT9Q 1XHKA 4WUBA 4IZJA 2XEXA 4LFBI 2ZITA 4QNJA 2O1UA 2PNZA 4OO1E 2F4VE 4KHPI 4LCGA 4PU9A 3PYGA 1Z5AA 2BA0D 4DPTA 1N34E 2HKJA 5FLXQ 1KKHA 4QNKA 3J7AM 1NHJA 5IWAE 1XMOE 4JYAE 3V5RA 2C39A 2PO2A 3Q6NA 2DEJA 2PNLA 4DV1E 4YY3I 3QT5A 4WUDA 4IFDA 2Z5EA 4URLA 2R3VA 4JI1I 1UDOA 3WU3A 3PYFA 1QZRA 4DR2I 3PRYA 2NN6C 5JEAF 2O1TA 3M85D 4EMDA 5A2QC 3B4TA 4DV6E 5C0XC 5LMUE 2Z5CA 4DPYA 4DU7A 1E3PA 3L7ZA 4LPFA 4UT4A 4Z7CA 2HKEA 4JI2E 1MU5A 5JEAE
chains in the Genus database with same CATH topology
1D6TA 3ZKBA 4IZKA 1J5EE 3Q6MA 1N36I 1RREA 1S4EA 3B78A 2V34A 1H73A 1H74A 4DR1E 1OJ4A 5GMEA 3CWVA 1N0VC 5BR8I 4IZJD 4JV5E 2GS8A 4JI4I 3P06A 2HHHE 1HNZI 3T1HE 4HY1A 3ZZTA 2UUCI 2UXBI 4FW9A 4PRXA 4B3SE 2DEIA 2VF3A 4JI3I 4GKJE 2V2ZA 4DPWA 2AJ4A 4P52A 1Z0GA 2IOPA 4LFCE 5GMDA 1HR0I 3T1YE 4B3MI 4DR3E 4LF8I 1N33E 4NXNE 1ZM3A 1IBMI 5FWKA 2UXDI 1XMQI 2BV3A 4K0KI 4X62I 1H72C 4HACA 4DV3E 1HNXE 4NXMI 5L3JA 1FJGE 2O1VA 1Z0EA 4DUYE 1FNMA 2HK3A 3GONA 4X66E 4DR5E 5IT9C 1KVKA 4USKA 2ZBKB 4DV7E 4FWGA 4JI0E 4GKKE 1N34I 3OTOE 1XNRE 2ZM6E 4JI7E 1XMOI 4JYAI 2PNMA 1USUA 1Z59A 4X65I 5FLXC 1Z0VA 3B82A 2WW4A 3J7AG 4DV0E 1EA6A 4X64E 4LFAE 4DV6I 5LMUI 2E5LE 2UU9E 4JI2I 4FWDA 4FWHA 4DU8A 1NZ0A 2UXCE 4Z7YA 2UUBE 4B3TE 5LMNE 2HFUA 1J5EI 4RPFA 3K1JA 2Z5CB 2IOQA 4MYTA 4LFBE 4M1KA 4DR1I 2X7IA 4P7AA 4YHHE 2HFSA 5LL6R 4JV5I 3QT6A 3T1HI 1A6FA 2UUAI 2BM0A 4B3SI 1K47A 4HYMA 1Y4SA 1PKPA 1BKNA 1ZXNA 4DUZI 4GKJI 1ZXMA 3J81Q 1XNQE 4YY3E 4MYUA 1Y4UA 1HNWI 4LFCI 2V8PA 2VQFE 4PRVA 3T1YI 4DV5I 1Z0CA 1IBKI 3LPSA 1I94E 1MX0A 1N32I 4OX9I 1ELOA 1MG7A 3K17A 4DV4E 1IBLE 2GQ0A 4DV3I 4AQYE 4USMA 4JI8E 1HNXI 2V2VA 4DR7E 1FJGI 1B63A 4DUYI 4X66I 4JG4A 4LF9I 4DR5I 4DR6E 4LF4I 4ZVIA 1H7SA 4DV7I 1ZM9A 2BM1A 4GKKI 3OTOI 2ZM6I 4JI7I 2Z5BA 3Q1QA 4LF5E 4LF7E 2F4VI 3F0NA 4WUCA 4DPXA 4JI6E 4IZJB 3J80Q 4DV0I 4N3OA 4LFAI 1WUUA 2A2CA 5IWAI 2E5LI 2NPFA 4LF6E 1VISA 1HK7A 1Z0WA 4DV2E 4DV1I 1U2RA 1Z5CA 2UXCI 2UUBI 4B3TI 5LMNI 1PIEA 2E1RA 3ZKDA 3ZM7A 2OI2A 3JAMQ 4JI5E 4B3RE 1USVA 2CGEA 4NXME 1Y6ZA 1DARA 1FWLA 1Z0TA 3WU6A 4YHHI 2VQEE 2A2DA 3WU5A 1FWKA 4R1FA 4DR4E 2CZ9A 2EFGA 3ZZ0A 1S16A 1B62A 4IZKB 1XNQI 4X65E 1H7UA 1EI1A 4KHPE 1ZM4A 2HHHI 4ED4A 2VQFI 4KQVA 3H4LA 2X36A 3J81C 1KIJA 1I94I 4FN5A 5A2QQ 1N0UA 4DV4I 1FKAE 4UTGA 3PYDA 2J7KA 1IBLI 1PVGA 2LJPA 4JI1E 1KTVA 4AQYI 3M6AA 4JI8I 4DR2E 1ZM2A 4DR3I 1N33I 4NXNI 1FI4A 3QT7A 3ZZUA 2R42A 4DR7I 1Z0BA 3HJCA 3B8HA 1NHIA 4DR6I 3QT8A 1N36E 1Z5BA 2O1WA 2UUAE 3K85A 3PYEA 2V2QA 4LF5I 4LF7I 4XTJA 4HACB 4DUZE 3WU4A 4JI6I 5BR8E 3LNUA 4JI4E 1UEKA 4JI0I 2Z5BB 1HNZE 2HK2A 1HNWE 1XNRI 2UUCE 4DV5E 3V2UC 2UXBE 1IBKE 4LF6I 4HXZA 4JI3E 3J80C 4DV2I 1N32E 4OX9E 4DXLA 3LTOA 1RR9A 4X64I 4JI5I 4B3RI 3D4JA 1HR0E 2Q2EB 4B3ME 4LF8E 2CG9A 1IBME 2UU9I 2UXDE 1XMQE 4K0KE 4DPUA 4LF9E 3JAMC 4X62E 2VQEI 4I3HA 4LF4E 3HULA 1NHHA 4DR4I 5IT9Q 1XHKA 4WUBA 4IZJA 2XEXA 4LFBI 2ZITA 2O1UA 2F4VE 4KHPI 4PU9A 3PYGA 1Z5AA 4DPTA 1N34E 2HKJA 5FLXQ 1KKHA 3J7AM 1NHJA 5IWAE 1XMOE 4JYAE 3V5RA 3Q6NA 2DEJA 2PNLA 4DV1E 4YY3I 3QT5A 4WUDA 2Z5EA 4URLA 2R3VA 4JI1I 3WU3A 3PYFA 1QZRA 4DR2I 3PRYA 2O1TA 4EMDA 5A2QC 4DV6E 5LMUE 2Z5CA 4DPYA 4DU7A 4UT4A 4Z7CA 2HKEA 4JI2E 1MU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D6T A;  3ZKB A;  1J5E E;  1N36 I;  1RRE A;  1S4E A;  3B78 A;  2V34 A;  1H73 A;  1H74 A;  4DR1 E;  1OJ4 A;  5GME A;  3CWV A;  1N0V C;  5BR8 I;  4JV5 E;  2GS8 A;  4JI4 I;  2HHH E;  1HNZ I;  3T1H E;  4HY1 A;  3ZZT A;  2UUC I;  2UXB I;  4FW9 A;  4PRX A;  4B3S E;  2DEI A;  2VF3 A;  4JI3 I;  4GKJ E;  2V2Z A;  4DPW A;  2AJ4 A;  4P52 A;  1Z0G A;  4LFC E;  5GMD A;  1HR0 I;  3T1Y E;  4B3M I;  4DR3 E;  4LF8 I;  1N33 E;  4NXN E;  1ZM3 A;  1IBM I;  2UXD I;  1XMQ I;  2BV3 A;  4K0K I;  4X62 I;  1H72 C;  4HAC A;  4DV3 E;  1HNX E;  4NXM I;  5L3J A;  1FJG E;  1Z0E A;  4DUY E;  1FNM A;  2HK3 A;  3GON A;  4X66 E;  4DR5 E;  5IT9 C;  1KVK A;  4USK A;  2ZBK B;  4DV7 E;  4FWG A;  4JI0 E;  4GKK E;  1N34 I;  3OTO E;  1XNR E;  2ZM6 E;  4JI7 E;  1XMO I;  4JYA I;  1Z59 A;  4X65 I;  5FLX C;  1Z0V A;  3B82 A;  2WW4 A;  3J7A G;  4DV0 E;  1EA6 A;  4X64 E;  4LFA E;  4DV6 I;  5LMU I;  2E5L E;  2UU9 E;  4JI2 I;  4FWD A;  4FWH A;  4DU8 A;  1NZ0 A;  2UXC E;  4Z7Y A;  2UUB E;  4B3T E;  5LMN E;  2HFU A;  1J5E I;  4RPF A;  3K1J A;  4MYT A;  4LFB E;  4M1K A;  4DR1 I;  2X7I A;  4P7A A;  4YHH E;  2HFS A;  5LL6 R;  4JV5 I;  3QT6 A;  3T1H I;  1A6F A;  2UUA I;  2BM0 A;  4B3S I;  1K47 A;  4HYM A;  1PKP A;  1BKN A;  1ZXN A;  4DUZ I;  4GKJ I;  1ZXM A;  3J81 Q;  1XNQ E;  4YY3 E;  4MYU A;  1HNW I;  4LFC I;  2V8P A;  2VQF E;  4PRV A;  3T1Y I;  4DV5 I;  1Z0C A;  1IBK I;  3LPS A;  1I94 E;  1MX0 A;  1N32 I;  4OX9 I;  1ELO A;  1MG7 A;  3K17 A;  4DV4 E;  1IBL E;  4DV3 I;  4AQY E;  4USM A;  4JI8 E;  1HNX I;  2V2V A;  4DR7 E;  1FJG I;  1B63 A;  4DUY I;  4X66 I;  4JG4 A;  4LF9 I;  4DR5 I;  4DR6 E;  4LF4 I;  4ZVI A;  1H7S A;  4DV7 I;  1ZM9 A;  2BM1 A;  4GKK I;  3OTO I;  2ZM6 I;  4JI7 I;  3Q1Q A;  4LF5 E;  4LF7 E;  2F4V I;  3F0N A;  4WUC A;  4DPX A;  4JI6 E;  3J80 Q;  4DV0 I;  4LFA I;  1WUU A;  2A2C A;  5IWA I;  2E5L I;  2NPF A;  4LF6 E;  1VIS A;  1Z0W A;  4DV2 E;  4DV1 I;  1U2R A;  1Z5C A;  2UXC I;  2UUB I;  4B3T I;  5LMN I;  1PIE A;  2E1R A;  3ZKD A;  3ZM7 A;  2OI2 A;  3JAM Q;  4JI5 E;  4B3R E;  4NXM E;  1DAR A;  1FWL A;  1Z0T A;  3WU6 A;  4YHH I;  2VQE E;  2A2D A;  3WU5 A;  1FWK A;  4R1F A;  4DR4 E;  2CZ9 A;  2EFG A;  3ZZ0 A;  1S16 A;  1B62 A;  1XNQ I;  4X65 E;  1H7U A;  1EI1 A;  4KHP E;  1ZM4 A;  2HHH I;  4ED4 A;  2VQF I;  4KQV A;  3H4L A;  2X36 A;  3J81 C;  1KIJ A;  1I94 I;  4FN5 A;  5A2Q Q;  1N0U A;  1FKA E;  4DV4 I;  4UTG A;  3PYD A;  2J7K A;  1IBL I;  1PVG A;  2LJP A;  4JI1 E;  1KTV A;  4AQY I;  3M6A A;  4JI8 I;  4DR2 E;  1ZM2 A;  4DR3 I;  1N33 I;  4NXN I;  1FI4 A;  3QT7 A;  3ZZU A;  2R42 A;  4DR7 I;  1Z0B A;  3B8H A;  1NHI A;  4DR6 I;  3QT8 A;  1N36 E;  1Z5B A;  2UUA E;  3PYE A;  2V2Q A;  4LF5 I;  4LF7 I;  4XTJ A;  4HAC B;  4DUZ E;  3WU4 A;  4JI6 I;  5BR8 E;  3LNU A;  4JI4 E;  1UEK A;  4JI0 I;  1HNZ E;  1HNW E;  2HK2 A;  1XNR I;  2UUC E;  4DV5 E;  3V2U C;  2UXB E;  1IBK E;  4LF6 I;  4HXZ A;  4JI3 E;  3J80 C;  4DV2 I;  1N32 E;  4OX9 E;  4DXL A;  3LTO A;  1RR9 A;  4X64 I;  4JI5 I;  4B3R I;  3D4J A;  1HR0 E;  2Q2E B;  4B3M E;  4LF8 E;  1IBM E;  2UU9 I;  2UXD E;  1XMQ E;  4K0K E;  4DPU A;  4LF9 E;  3JAM C;  4X62 E;  2VQE I;  4I3H A;  4LF4 E;  3HUL A;  1NHH A;  4DR4 I;  5IT9 Q;  1XHK A;  4WUB A;  2XEX A;  4LFB I;  2ZIT A;  2F4V E;  4KHP I;  4PU9 A;  3PYG A;  1Z5A A;  4DPT A;  1N34 E;  2HKJ A;  5FLX Q;  1KKH A;  3J7A M;  1NHJ A;  5IWA E;  1XMO E;  4JYA E;  3V5R A;  2DEJ A;  4DV1 E;  4YY3 I;  3QT5 A;  4WUD A;  4URL A;  2R3V A;  4JI1 I;  3WU3 A;  3PYF A;  1QZR A;  4DR2 I;  4EMD A;  5A2Q C;  4DV6 E;  5LMU E;  4DPY A;  4DU7 A;  4UT4 A;  4Z7C A;  2HKE A;  4JI2 E;  1MU5 A; 
#chains in the Genus database with same CATH topology
 1D6T A;  5K36 C;  4MU0 A;  3ZKB A;  4IZK A;  1J5E E;  3Q6M A;  1N36 I;  1RRE A;  1S4E A;  5ELW A;  4BA2 A;  5K36 A;  3B78 A;  2V34 A;  1P42 A;  1H73 A;  1H74 A;  4DR1 E;  1OJ4 A;  1VI7 A;  5GME A;  3CWV A;  1N0V C;  5EL9 A;  5BR8 I;  4IZJ D;  2BA1 D;  3DD6 A;  4JV5 E;  2GS8 A;  4JI4 I;  3P06 A;  2HHH E;  1HNZ I;  3T1H E;  4FW6 A;  4HY1 A;  3ZZT A;  2UUC I;  2UXB I;  4FW9 A;  4PRX A;  4B3S E;  2DEI A;  2VF3 A;  2JEB A;  4JI3 I;  1RHY A;  2JE6 A;  4GKJ E;  2V2Z A;  4DPW A;  1YHC A;  2AJ4 A;  4P52 A;  1Z0G A;  2IOP A;  3CDJ A;  4LFC E;  5GMD A;  1HR0 I;  3T1Y E;  4B3M I;  4DR3 E;  4LF8 I;  5JEA B;  1N33 E;  2WNR B;  4NXN E;  1ZM3 A;  1IBM I;  3NZK A;  4IFD F;  5FWK A;  2UXD I;  1XMQ I;  2BV3 A;  4K0K I;  4X62 I;  2BR2 B;  1H72 C;  4HAC A;  4DV3 E;  4IFD E;  1HNX E;  2C38 A;  4NXM I;  4MU3 A;  5L3J A;  1FJG E;  2O1V A;  1Z0E A;  4DUY E;  4BA1 B;  1FNM A;  2HK3 A;  3GON A;  4X66 E;  2JEA A;  4DR5 E;  5IT9 C;  1KVK A;  4USK A;  2PO0 B;  2WP8 A;  2ZBK B;  4DV7 E;  5K36 D;  4FWG A;  2GO3 A;  5K36 F;  4JI0 E;  4GKK E;  1N34 I;  1OYP A;  4IS9 A;  3OTO E;  4OKG A;  1YH8 A;  1XNR E;  2ZM6 E;  4JI7 E;  1XMO I;  4JYA I;  2PNM A;  1USU A;  1Z59 A;  4X65 I;  3PS1 A;  5FLX C;  1Z0V A;  3B82 A;  2WW4 A;  3J7A G;  3HKM A;  4DV0 E;  1EA6 A;  4X64 E;  2C37 A;  2F1D A;  4LFA E;  3GCM A;  4DV6 I;  5LMU I;  2C39 B;  2PO2 B;  2E5L E;  2UU9 E;  4IFD B;  4JI2 I;  4FWD A;  4FWH A;  4DU8 A;  3U1K A;  1NZ0 A;  2UXC E;  4Z7Y A;  2UUB E;  4LCH A;  5LMN E;  4B3T E;  2HFU A;  1J5E I;  1R6L A;  4RPF A;  3K1J A;  2Z5C B;  2IOQ A;  4MYT A;  3L7Z B;  4LFB E;  4M1K A;  4DR1 I;  2NN6 A;  2X7I A;  4MU4 A;  4MU1 A;  4P7A A;  4YHH E;  5C0X A;  2HFS A;  5LL6 R;  4JV5 I;  3QT6 A;  1R6M A;  3P3C A;  3T1H I;  1A6F A;  2UUA I;  4J3D A;  2BM0 A;  4B3S I;  1K47 A;  4HYM A;  1Y4S A;  1PKP A;  1BKN A;  1ZXN A;  3P3G A;  4DUZ I;  4GKJ I;  1ZXM A;  3J81 Q;  1XNQ E;  4YY3 E;  4U3D A;  4MYU A;  1Y4U A;  1HNW I;  4LFC I;  2V8P A;  4FW4 A;  2VQF E;  2O3Z A;  4PRV A;  4OO1 C;  3T1Y I;  4DV5 I;  1Z0C A;  1IBK I;  2JE6 B;  3LPS A;  1I94 E;  1MX0 A;  2AE8 A;  1N32 I;  5DRR A;  4OO1 A;  1ELO A;  1MG7 A;  4OX9 I;  3K17 A;  4DV4 E;  1IBL E;  2GQ0 A;  4DV3 I;  4AQY E;  4USM A;  4JI8 E;  1HNX I;  2V2V A;  4DR7 E;  3CDI A;  1FJG I;  1B63 A;  4DUY I;  4X66 I;  4JG4 A;  4LF9 I;  4DR5 I;  4DR6 E;  1UDS A;  4U3B A;  4LF4 I;  4ZVI A;  1H7S A;  4DV7 I;  1ZM9 A;  2BM1 A;  4GKK I;  5JEA C;  2NN6 D;  3OTO I;  2NN6 F;  2ZM6 I;  4JI7 I;  4FW3 A;  1XXE A;  2Z5B A;  5C0X D;  2JEA B;  5C0X F;  3Q1Q A;  4LF5 E;  5JEA A;  2WNR A;  4LF7 E;  2F4V I;  3F0N A;  4WUC A;  4DPX A;  4JI6 E;  2PO1 A;  4IZJ B;  3J80 Q;  4MQY A;  4DV0 I;  2GO4 A;  4N3O A;  4LFA I;  1WUU A;  2A2C A;  3PS2 A;  5IWA I;  2E5L I;  2NPF A;  4LF6 E;  3H1C A;  4LOM A;  2PNZ B;  1VIS A;  1HK7 A;  2IER A;  5K36 E;  1Z0W A;  4DV2 E;  4DV1 I;  1U2R A;  5DNL A;  1Z5C A;  2UXC I;  2UUB I;  4B3T I;  5LMN I;  1PIE A;  2C37 B;  2E1R A;  3ZKD A;  3ZM7 A;  5DRQ A;  2OI2 A;  3JAM Q;  2PO0 A;  4JI5 E;  3GME A;  4B3R E;  1USV A;  2CGE A;  4OO1 D;  4OO1 F;  4NXM E;  1Y6Z A;  1DAR A;  1FWL A;  3P76 A;  1Z0T A;  3WU6 A;  4YHH I;  4FW7 A;  4NBQ A;  2VQE E;  3M7N G;  2CVE A;  2A2D A;  3WU5 A;  1FWK A;  4R1F A;  4DR4 E;  2NN6 B;  1Y5Y A;  4IFD C;  2CZ9 A;  2EFG A;  5C0X B;  3ZZ0 A;  1S16 A;  1B62 A;  4IZK B;  1XNQ I;  4X65 E;  1H7U A;  1EI1 A;  4FW5 A;  1OYS A;  3UHM A;  4KHP E;  3U1Y A;  1ZM4 A;  2HHH I;  4ED4 A;  1OYR A;  4BA2 B;  2VQF I;  4KQV A;  2IES A;  5K36 B;  5JEA D;  5DRO A;  3H4L A;  2X36 A;  3J81 C;  1KIJ A;  3KRN A;  4OZE A;  1I94 I;  4FN5 A;  4MDT A;  5A2Q Q;  1N0U A;  4DV4 I;  1FKA E;  4UTG A;  3PYD A;  2J7K A;  1IBL I;  1PVG A;  2LJP A;  4JI1 E;  1KTV A;  4AQY I;  3M6A A;  2J65 A;  4JI8 I;  4DR2 E;  1ZM2 A;  4DR3 I;  2JEB B;  1N33 I;  4NXN I;  1FI4 A;  3QT7 A;  3ZZU A;  2R42 A;  4DR7 I;  1Z0B A;  4OO1 B;  4GQU A;  5DRP A;  3HJC A;  3B8H A;  3PS3 A;  4ISA A;  2BA0 G;  1NHI A;  1UDN A;  4DR6 I;  4AIM A;  3QT8 A;  1N36 E;  1Z5B A;  2O1W A;  2UUA E;  3K85 A;  3P3E A;  3PYE A;  2V2Q A;  4LF5 I;  4LF7 I;  4LCF A;  4XTJ A;  4HAC B;  4DUZ E;  3M85 G;  3WU4 A;  4JI6 I;  5BR8 E;  2C38 B;  3LNU A;  4JI4 E;  1UEK A;  4JI0 I;  2Z5B B;  1HNZ E;  2HK2 A;  1HNW E;  4AM3 A;  1XNR I;  2UUC E;  4DV5 E;  3V2U C;  2UXB E;  3GLL A;  1IBK E;  4LF6 I;  3M7N D;  4IFD D;  4HXZ A;  4JI3 E;  2WP8 B;  3J80 C;  4DV2 I;  2PO1 B;  1N32 E;  4OX9 E;  2NN6 E;  4DXL A;  5DNX A;  3LTO A;  1Y60 A;  5C0X E;  2BR2 A;  2JT2 A;  1RR9 A;  4X64 I;  4JI5 I;  4B3R I;  3D4J A;  1HR0 E;  2Q2E B;  4B3M E;  4LF8 E;  2BA1 G;  2CG9 A;  1UDQ A;  1IBM E;  2VES A;  2UU9 I;  4AID A;  2UXD E;  1XMQ E;  5EKW A;  4K0K E;  4DPU A;  1E3H A;  4LF9 E;  3JAM C;  4BA1 A;  4X62 E;  2VQE I;  4I3H A;  4LF4 E;  3HUL A;  1NHH A;  4DR4 I;  5IT9 Q;  1XHK A;  4WUB A;  4IZJ A;  2XEX A;  4LFB I;  2ZIT A;  4QNJ A;  2O1U A;  2PNZ A;  4OO1 E;  2F4V E;  4KHP I;  4LCG A;  4PU9 A;  3PYG A;  1Z5A A;  2BA0 D;  4DPT A;  1N34 E;  2HKJ A;  5FLX Q;  1KKH A;  4QNK A;  3J7A M;  1NHJ A;  5IWA E;  1XMO E;  4JYA E;  3V5R A;  2C39 A;  2PO2 A;  3Q6N A;  2DEJ A;  2PNL A;  4DV1 E;  4YY3 I;  3QT5 A;  4WUD A;  4IFD A;  2Z5E A;  4URL A;  2R3V A;  4JI1 I;  1UDO A;  3WU3 A;  3PYF A;  1QZR A;  4DR2 I;  3PRY A;  2NN6 C;  5JEA F;  2O1T A;  3M85 D;  4EMD A;  5A2Q C;  3B4T A;  4DV6 E;  5C0X C;  5LMU E;  2Z5C A;  4DPY A;  4DU7 A;  1E3P A;  3L7Z A;  4LPF A;  4UT4 A;  4Z7C A;  2HKE A;  4JI2 E;  1MU5 A;  5JEA E; 
#chains in the Genus database with same CATH homology
 1D6T A;  3ZKB A;  4IZK A;  1J5E E;  3Q6M A;  1N36 I;  1RRE A;  1S4E A;  3B78 A;  2V34 A;  1H73 A;  1H74 A;  4DR1 E;  1OJ4 A;  5GME A;  3CWV A;  1N0V C;  5BR8 I;  4IZJ D;  4JV5 E;  2GS8 A;  4JI4 I;  3P06 A;  2HHH E;  1HNZ I;  3T1H E;  4HY1 A;  3ZZT A;  2UUC I;  2UXB I;  4FW9 A;  4PRX A;  4B3S E;  2DEI A;  2VF3 A;  4JI3 I;  4GKJ E;  2V2Z A;  4DPW A;  2AJ4 A;  4P52 A;  1Z0G A;  2IOP A;  4LFC E;  5GMD A;  1HR0 I;  3T1Y E;  4B3M I;  4DR3 E;  4LF8 I;  1N33 E;  4NXN E;  1ZM3 A;  1IBM I;  5FWK A;  2UXD I;  1XMQ I;  2BV3 A;  4K0K I;  4X62 I;  1H72 C;  4HAC A;  4DV3 E;  1HNX E;  4NXM I;  5L3J A;  1FJG E;  2O1V A;  1Z0E A;  4DUY E;  1FNM A;  2HK3 A;  3GON A;  4X66 E;  4DR5 E;  5IT9 C;  1KVK A;  4USK A;  2ZBK B;  4DV7 E;  4FWG A;  4JI0 E;  4GKK E;  1N34 I;  3OTO E;  1XNR E;  2ZM6 E;  4JI7 E;  1XMO I;  4JYA I;  2PNM A;  1USU A;  1Z59 A;  4X65 I;  5FLX C;  1Z0V A;  3B82 A;  2WW4 A;  3J7A G;  4DV0 E;  1EA6 A;  4X64 E;  4LFA E;  4DV6 I;  5LMU I;  2E5L E;  2UU9 E;  4JI2 I;  4FWD A;  4FWH A;  4DU8 A;  1NZ0 A;  2UXC E;  4Z7Y A;  2UUB E;  4B3T E;  5LMN E;  2HFU A;  1J5E I;  4RPF A;  3K1J A;  2Z5C B;  2IOQ A;  4MYT A;  4LFB E;  4M1K A;  4DR1 I;  2X7I A;  4P7A A;  4YHH E;  2HFS A;  5LL6 R;  4JV5 I;  3QT6 A;  3T1H I;  1A6F A;  2UUA I;  2BM0 A;  4B3S I;  1K47 A;  4HYM A;  1Y4S A;  1PKP A;  1BKN A;  1ZXN A;  4DUZ I;  4GKJ I;  1ZXM A;  3J81 Q;  1XNQ E;  4YY3 E;  4MYU A;  1Y4U A;  1HNW I;  4LFC I;  2V8P A;  2VQF E;  4PRV A;  3T1Y I;  4DV5 I;  1Z0C A;  1IBK I;  3LPS A;  1I94 E;  1MX0 A;  1N32 I;  4OX9 I;  1ELO A;  1MG7 A;  3K17 A;  4DV4 E;  1IBL E;  2GQ0 A;  4DV3 I;  4AQY E;  4USM A;  4JI8 E;  1HNX I;  2V2V A;  4DR7 E;  1FJG I;  1B63 A;  4DUY I;  4X66 I;  4JG4 A;  4LF9 I;  4DR5 I;  4DR6 E;  4LF4 I;  4ZVI A;  1H7S A;  4DV7 I;  1ZM9 A;  2BM1 A;  4GKK I;  3OTO I;  2ZM6 I;  4JI7 I;  2Z5B A;  3Q1Q A;  4LF5 E;  4LF7 E;  2F4V I;  3F0N A;  4WUC A;  4DPX A;  4JI6 E;  4IZJ B;  3J80 Q;  4DV0 I;  4N3O A;  4LFA I;  1WUU A;  2A2C A;  5IWA I;  2E5L I;  2NPF A;  4LF6 E;  1VIS A;  1HK7 A;  1Z0W A;  4DV2 E;  4DV1 I;  1U2R A;  1Z5C A;  2UXC I;  2UUB I;  4B3T I;  5LMN I;  1PIE A;  2E1R A;  3ZKD A;  3ZM7 A;  2OI2 A;  3JAM Q;  4JI5 E;  4B3R E;  1USV A;  2CGE A;  4NXM E;  1Y6Z A;  1DAR A;  1FWL A;  1Z0T A;  3WU6 A;  4YHH I;  2VQE E;  2A2D A;  3WU5 A;  1FWK A;  4R1F A;  4DR4 E;  2CZ9 A;  2EFG A;  3ZZ0 A;  1S16 A;  1B62 A;  4IZK B;  1XNQ I;  4X65 E;  1H7U A;  1EI1 A;  4KHP E;  1ZM4 A;  2HHH I;  4ED4 A;  2VQF I;  4KQV A;  3H4L A;  2X36 A;  3J81 C;  1KIJ A;  1I94 I;  4FN5 A;  5A2Q Q;  1N0U A;  4DV4 I;  1FKA E;  4UTG A;  3PYD A;  2J7K A;  1IBL I;  1PVG A;  2LJP A;  4JI1 E;  1KTV A;  4AQY I;  3M6A A;  4JI8 I;  4DR2 E;  1ZM2 A;  4DR3 I;  1N33 I;  4NXN I;  1FI4 A;  3QT7 A;  3ZZU A;  2R42 A;  4DR7 I;  1Z0B A;  3HJC A;  3B8H A;  1NHI A;  4DR6 I;  3QT8 A;  1N36 E;  1Z5B A;  2O1W A;  2UUA E;  3K85 A;  3PYE A;  2V2Q A;  4LF5 I;  4LF7 I;  4XTJ A;  4HAC B;  4DUZ E;  3WU4 A;  4JI6 I;  5BR8 E;  3LNU A;  4JI4 E;  1UEK A;  4JI0 I;  2Z5B B;  1HNZ E;  2HK2 A;  1HNW E;  1XNR I;  2UUC E;  4DV5 E;  3V2U C;  2UXB E;  1IBK E;  4LF6 I;  4HXZ A;  4JI3 E;  3J80 C;  4DV2 I;  1N32 E;  4OX9 E;  4DXL A;  3LTO A;  1RR9 A;  4X64 I;  4JI5 I;  4B3R I;  3D4J A;  1HR0 E;  2Q2E B;  4B3M E;  4LF8 E;  2CG9 A;  1IBM E;  2UU9 I;  2UXD E;  1XMQ E;  4K0K E;  4DPU A;  4LF9 E;  3JAM C;  4X62 E;  2VQE I;  4I3H A;  4LF4 E;  3HUL A;  1NHH A;  4DR4 I;  5IT9 Q;  1XHK A;  4WUB A;  4IZJ A;  2XEX A;  4LFB I;  2ZIT A;  2O1U A;  2F4V E;  4KHP I;  4PU9 A;  3PYG A;  1Z5A A;  4DPT A;  1N34 E;  2HKJ A;  5FLX Q;  1KKH A;  3J7A M;  1NHJ A;  5IWA E;  1XMO E;  4JYA E;  3V5R A;  3Q6N A;  2DEJ A;  2PNL A;  4DV1 E;  4YY3 I;  3QT5 A;  4WUD A;  2Z5E A;  4URL A;  2R3V A;  4JI1 I;  3WU3 A;  3PYF A;  1QZR A;  4DR2 I;  3PRY A;  2O1T A;  4EMD A;  5A2Q C;  4DV6 E;  5LMU E;  2Z5C A;  4DPY A;  4DU7 A;  4UT4 A;  4Z7C A;  2HKE A;  4JI2 E;  1MU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...