4DUZI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzI00
4KHPI 5IWAI 1XNQI 3T1YI 4DR7I 3Q1QA 4RPFA 4B3SE 1ZM3A 3H4LA 4JI2I 2V2ZA 1IBKI 4X65E 2ZM6I 4DUYI 4GKKI 1XMQE 1XNRI 1N0UA 4GKJE 5L3JA 4DV6E 4HACB 2UXDE 1QZRA 4DR2E 3GONA 4HYMA 1ZXMA 4JI0E 4X64I 1HNXI 3J81Q 1N33I 4DR4I 4DR5E 2E5LE 1Z5AA 1J5EI 2NPFA 4URLA 1HNZI 1FKAE 4B3ME 4DR1E 1H73A 4LF6I 3WU5A 2HKEA 1Z0BA 4LFAI 1MX0A 1I94I 4HXZA 4USKA 4LF7I 1FJGE 4NXMI 1N36E 4DV3I 4JI6E 5IT9C 1MU5A 3D4JA 4XTJA 4KHPE 5IWAE 2UU9E 3J80C 3K1JA 4DV0E 3T1YE 2V34A 4B3TE 1FWLA 4DR7E 5A2QC 1ZXNA 2VQEI 2HHHI 2UUCI 1U2RA 4JI2E 2DEJA 2UUAI 2ZM6E 4DUYE 4GKKE 2ZBKB 3J7AG 2BV3A 4DPTA 1D6TA 2EFGA 3OTOI 3LPSA 4DPUA 5FLXQ 1PVGA 1N32E 1Z0TA 1IBMI 4HACA 1OJ4A 1IBLE 1Z0WA 4DV4I 1Z59A 4DPWA 4KQVA 4LFBI 4DV1I 4AQYI 4JV5I 2CZ9A 4DV7I 2J7KA 1N33E 4LFCI 2X36A 4DU8A 1B63A 2X7IA 2AJ4A 1ZM9A 4FWGA 4NXNE 1PIEA 1PKPA 2BM0A 3WU6A 4LF6E 4LF8E 3WU3A 2HKJA 3B82A 1N34I 2V2QA 4DV2E 1Z0EA 4PU9A 1H7SA 2UXBI 1HNWI 4DV3E 4LF9I 1XHKA 1EA6A 3ZKDA 3T1HE 4JI4E 4DR3E 4DUZI 4WUDA 2HHHE 2UXCI 4FN5A 4LF5I 4K0KE 4JI7I 2UUAE 1DARA 4JYAE 1KTVA 2V2VA 4FWHA 3OTOE 2LJPA 3ZZUA 3ZZ0A 1VISA 4JI3I 5LMUI 1IBME 3ZM7A 2VQFE 3WU4A 4DV4E 1KIJA 3PYDA 2BM1A 4X66E 4LFBE 4M1KA 5IT9Q 4JI5E 2HFUA 4WUBA 2XEXA 3J80Q 4LF4E 4Z7CA 4Z7YA 1S4EA 5A2QQ 1NZ0A 1H72C 1XNQE 2R3VA 3JAMC 1HR0I 4ED4A 4UT4A 4GKJI 4MYUA 2DEIA 1IBKE 2V8PA 1UEKA 2UXDI 4YHHI 4DV5I 1XNRE 4DR2I 5LL6R 1Z0VA 5BR8I 1HNWE 4LF9E 4DR5I 3PYFA 1EI1A 3ZKBA 1N0VC 5GMDA 4JI1I 1ZM2A 4X64E 3J7AM 1HNXE 4B3MI 4X62I 2UXCE 3HULA 1FWKA 1Z0GA 4DR4E 1Z5BA 4DR6I 3F0NA 1NHIA 1J5EE 1HNZE 4MYTA 1NHHA 4PRVA 4R1FA 4JI6I 4JG4A 4LFAE 2UU9I 4HY1A 4DV0I 2HK2A 4B3TI 1I94E 1S16A 4LF7E 1KKHA 4NXME 2WW4A 3V2UC 1XMOI 3LNUA 4I3HA 3K17A 4JI8I 1HR0E 1KVKA 4WUCA 4USMA 2VQEE 2UUCE 3LTOA 1BKNA 1K47A 1N32I 1FI4A 4YY3I 5LMNI 2UUBI 2F4VI 1IBLI 1ZM4A 4YHHE 4DV5E 4OX9I 3M6AA 4B3RI 2R42A 1FNMA 5BR8E 3QT8A 4DPXA 2A2DA 3PYEA 2A2CA 1WUUA 4FW9A 1RR9A 3J81C 4UTGA 4DV1E 2HK3A 4AQYE 4JI1E 4NXNI 2VF3A 1MG7A 4JV5E 4B3SI 1RREA 4DV7E 3JAMQ 4X62E 4LFCE 1H74A 4X65I 4PRXA 4LF8I 4EMDA 3ZZTA 1XMQI 1B62A 4DR6E 2E1RA 4FWDA 4DV2I 4P52A 1Z0CA 4DV6I 3QT6A 3QT5A 1Z5CA 3QT7A 1N34E 5GMEA 3T1HI 2Q2EB 4DR3I 4JI4I 2UXBE 1H7UA 4P7AA 4JI0I 2ZITA 2OI2A 4ZVIA 4DPYA 1XMOE 3B78A 3B8HA 3PYGA 4K0KI 4JYAI 2E5LI 4JI8E 1A6FA 4DUZE 2HFSA 2GS8A 3V5RA 4DR1I 4DU7A 4LF5E 4YY3E 5LMNE 2VQFI 4JI7E 2UUBE 1ELOA 2F4VE 5FLXC 4OX9E 4X66I 4B3RE 4JI5I 4JI3E 1FJGI 5LMUE 1N36I 4DXLA 1NHJA 3CWVA 4LF4I
chains in the Genus database with same CATH superfamily
4KHPI 5IWAI 1XNQI 3T1YI 2GO4A 4DR7I 3Q1QA 4RPFA 4B3SE 4GQUA 2IOQA 1P42A 1ZM3A 3H4LA 4JI2I 2V2ZA 1IBKI 4X65E 2ZM6I 4DUYI 4GKKI 2Z5BB 2JEAA 4ISAA 1XMQE 4OO1A 1XNRI 1N0UA 4GKJE 2WP8B 5L3JA 4DV6E 2JT2A 4BA1B 3L7ZB 5DROA 2PO1B 2BR2A 4HACB 2UXDE 1QZRA 4BA2A 4MDTA 2CVEA 4DR2E 2PNMA 3GONA 4AIDA 3PS3A 4HYMA 1ZXMA 3NZKA 4JI0E 5DNXA 4X64I 1HNXI 3J81Q 3M85G 1UDSA 1N33I 4IFDB 3KRNA 4LPFA 3GCMA 4DR4I 4DR5E 4AIMA 1USVA 2E5LE 1Z5AA 3GLLA 1J5EI 2NPFA 4URLA 1HNZI 1FKAE 5EKWA 4B3ME 2C37B 4DR1E 3P3EA 1H73A 4LF6I 3WU5A 2HKEA 1Z0BA 4LFAI 1MX0A 1I94I 2C39A 4HXZA 4USKA 5C0XB 4LF7I 1FJGE 2JEBA 4NXMI 1N36E 3M7ND 2O3ZA 1RHYA 4DV3I 4JI6E 5IT9C 4MU1A 1MU5A 3D4JA 4XTJA 4KHPE 5IWAE 2UU9E 4FW5A 3K1JA 3J80C 4DV0E 3T1YE 4U3BA 2V34A 4B3TE 1FWLA 4DR7E 4OO1D 5A2QC 1ZXNA 2BA0G 2VQEI 2HHHI 2UUCI 1U2RA 2Z5BA 2O1VA 4JI2E 2DEJA 3K85A 2UUAI 4OZEA 2ZM6E 4DUYE 4GKKE 2ZBKB 3J7AG 2BV3A 2WP8A 4DPTA 1D6TA 2EFGA 3OTOI 3LPSA 4DPUA 4BA1A 3L7ZA 5FLXQ 1PVGA 1N32E 1Z0TA 2PO1A 1IBMI 4HACA 1OJ4A 1IBLE 1Z0WA 4FW4A 4DV4I 1Z59A 4QNJA 4DPWA 4KQVA 4LFBI 4DV1I 5JEAC 1E3HA 4AQYI 4JV5I 2CZ9A 2IERA 4DV7I 2J7KA 1OYRA 1N33E 4LFCI 2X36A 4DU8A 1B63A 2X7IA 4QNKA 4IZJB 5ELWA 2AJ4A 2C38B 1ZM9A 4FWGA 2C37A 4NXNE 1PIEA 3PS2A 2BA1G 3M85D 4FW3A 4MU3A 3PS1A 1PKPA 2BM0A 3WU6A 4LF6E 4LF8E 3WU3A 2HKJA 3B82A 1N34I 5C0XA 2V2QA 3U1YA 4DV2E 1Z0EA 4PU9A 5DRQA 2CGEA 1H7SA 2UXBI 2O1WA 2NN6C 4LOMA 3H1CA 1HNWI 4DV3E 4LF9I 1XHKA 1EA6A 2PNZA 4NBQA 2NN6E 3ZKDA 3T1HE 4JI4E 4DR3E 4DUZI 2F1DA 4WUDA 2Z5EA 2Z5CB 2HHHE 2UXCI 4FN5A 4LF5I 4K0KE 4JI7I 2UUAE 1DARA 4JYAE 4MU0A 1KTVA 2V2VA 4FWHA 3OTOE 2LJPA 3ZZUA 3UHMA 4LCGA 3ZZ0A 1YH8A 3B4TA 1VISA 4IFDD 4JI3I 5LMUI 1IBME 3ZM7A 2VQFE 3WU4A 4DV4E 1KIJA 3PYDA 2BM1A 4X66E 4LFBE 4J3DA 4M1KA 5IT9Q 4MQYA 4JI5E 3DD6A 2HFUA 4WUBA 5JEAB 2XEXA 3J80Q 5JEAF 1R6LA 4LF4E 4IZJA 4Z7CA 4Z7YA 1S4EA 5A2QQ 1NZ0A 2IESA 2C38A 1H72C 1XNQE 2R3VA 3JAMC 1HR0I 4ED4A 4UT4A 2PNZB 5C0XD 1YHCA 4GKJI 3P06A 4MYUA 2DEIA 1IBKE 1USUA 2V8PA 1UDOA 4LCFA 1UEKA 2UXDI 4YHHI 4DV5I 1XNRE 2BA1D 4DR2I 3PRYA 5LL6R 1Z0VA 5BR8I 2NN6B 1HNWE 2NN6F 4LF9E 3P3CA 2PNLA 2JE6B 4DR5I 2O1TA 3PYFA 3Q6MA 3CDIA 1EI1A 4AM3A 3ZKBA 2Z5CA 1N0VC 5GMDA 1XXEA 4JI1I 2IOPA 1ZM2A 4X64E 3J7AM 1HNXE 1Y5YA 4B3MI 4X62I 2UXCE 3HULA 1FWKA 1Z0GA 5K36F 4DR4E 5JEAE 2WNRB 1Z5BA 3M7NG 4DR6I 3F0NA 1NHIA 1J5EE 1HNZE 4MYTA 1NHHA 3GMEA 3P76A 4PRVA 4R1FA 4JI6I 4IZJD 4JG4A 4LFAE 2UU9I 5FWKA 4HY1A 4DV0I 2GO3A 2HK2A 4OKGA 5JEAA 4B3TI 1I94E 1S16A 4IZKB 4LF7E 1KKHA 4IS9A 2WW4A 4NXME 1Y4UA 3V2UC 1UDQA 1XMOI 2O1UA 3LNUA 2PO0B 4I3HA 3K17A 4JI8I 1HR0E 1KVKA 4WUCA 4USMA 5K36C 2VQEE 2UUCE 3LTOA 1BKNA 1K47A 2PO2B 1N32I 1FI4A 2CG9A 4YY3I 5LMNI 2UUBI 2F4VI 3CDJA 1IBLI 5K36E 3Q6NA 1ZM4A 5DRPA 4YHHE 2BA0D 2VESA 4LCHA 4DV5E 3M6AA 4OX9I 4MU4A 4B3RI 2NN6A 3U1KA 2R42A 1FNMA 5BR8E 2JE6A 3QT8A 4DPXA 1HK7A 2A2DA 3PYEA 4IFDF 2A2CA 1WUUA 1OYSA 4FW9A 1RR9A 3J81C 4UTGA 4DV1E 2HK3A 4AQYE 5K36A 4JI1E 4NXNI 2VF3A 1MG7A 4JV5E 4B3SI 1RREA 4DV7E 3JAMQ 2GQ0A 2WNRA 4X62E 4LFCE 1H74A 4X65I 4PRXA 4N3OA 4LF8I 4EMDA 3ZZTA 1XMQI 1B62A 4DR6E 2E1RA 4FWDA 4DV2I 2JEAB 2J65A 5DNLA 5JEAD 4OO1B 3HKMA 4P52A 2AE8A 1Z0CA 4OO1F 4DV6I 3QT6A 4FW6A 5C0XF 3QT5A 3P3GA 4FW7A 1Z5CA 3QT7A 1N34E 2BR2B 1Y60A 4IZKA 5GMEA 3T1HI 2Q2EB 4DR3I 4JI4I 4BA2B 4U3DA 1H7UA 4P7AA 2UXBE 4IFDC 4JI0I 2ZITA 2OI2A 2PO0A 4ZVIA 4DPYA 1XMOE 3B78A 3B8HA 3PYGA 4K0KI 4IFDE 4JYAI 2E5LI 4JI8E 1A6FA 1VI7A 2PO2A 4DUZE 2GS8A 2HFSA 3V5RA 4DR1I 5K36B 1E3PA 2NN6D 1UDNA 4DU7A 4LF5E 4YY3E 2VQFI 5LMNE 4JI7E 1ELOA 2UUBE 2F4VE 5FLXC 1Y6ZA 3HJCA 4OO1C 1Y4SA 4OX9E 5C0XC 4X66I 4B3RE 4JI5I 4IFDA 4JI3E 1FJGI 5LMUE 5K36D 1N36I 1R6MA 4DXLA 4OO1E 1NHJA 2C39B 3CWVA 1OYPA 5DRRA 4LF4I 5EL9A 5C0XE 2JEBB
chains in the Genus database with same CATH topology
4KHPI 5IWAI 1XNQI 3T1YI 4DR7I 3Q1QA 4RPFA 4B3SE 2IOQA 1ZM3A 3H4LA 4JI2I 2V2ZA 1IBKI 4X65E 2ZM6I 4DUYI 4GKKI 2Z5BB 1XMQE 1XNRI 1N0UA 4GKJE 5L3JA 4DV6E 4HACB 2UXDE 1QZRA 4DR2E 2PNMA 3GONA 4HYMA 1ZXMA 4JI0E 4X64I 1HNXI 3J81Q 1N33I 4DR4I 4DR5E 1USVA 2E5LE 1Z5AA 1J5EI 2NPFA 4URLA 1HNZI 1FKAE 4B3ME 4DR1E 1H73A 4LF6I 3WU5A 2HKEA 1Z0BA 4LFAI 1MX0A 1I94I 4HXZA 4USKA 4LF7I 1FJGE 4NXMI 1N36E 4DV3I 4JI6E 5IT9C 1MU5A 3D4JA 4XTJA 4KHPE 5IWAE 2UU9E 3J80C 3K1JA 4DV0E 3T1YE 2V34A 4B3TE 1FWLA 4DR7E 5A2QC 1ZXNA 2VQEI 2HHHI 2UUCI 1U2RA 2Z5BA 2O1VA 4JI2E 2DEJA 3K85A 2UUAI 2ZM6E 4DUYE 4GKKE 2ZBKB 3J7AG 2BV3A 4DPTA 1D6TA 2EFGA 3OTOI 3LPSA 4DPUA 5FLXQ 1PVGA 1N32E 1Z0TA 1IBMI 4HACA 1OJ4A 1IBLE 1Z0WA 4DV4I 1Z59A 4DPWA 4KQVA 4LFBI 4DV1I 4AQYI 4JV5I 2CZ9A 4DV7I 2J7KA 1N33E 4LFCI 2X36A 4DU8A 1B63A 2X7IA 4IZJB 2AJ4A 1ZM9A 4FWGA 4NXNE 1PIEA 1PKPA 2BM0A 3WU6A 4LF6E 4LF8E 3WU3A 2HKJA 3B82A 1N34I 2V2QA 4DV2E 1Z0EA 4PU9A 2CGEA 1H7SA 2UXBI 2O1WA 1HNWI 4DV3E 4LF9I 1XHKA 1EA6A 3ZKDA 3T1HE 4JI4E 4DR3E 4DUZI 4WUDA 2Z5EA 2Z5CB 2HHHE 2UXCI 4FN5A 4LF5I 4K0KE 4JI7I 2UUAE 1DARA 4JYAE 1KTVA 2V2VA 4FWHA 3OTOE 2LJPA 3ZZUA 3ZZ0A 1VISA 4JI3I 5LMUI 1IBME 3ZM7A 2VQFE 3WU4A 4DV4E 1KIJA 3PYDA 2BM1A 4X66E 4LFBE 4M1KA 5IT9Q 4JI5E 2HFUA 4WUBA 2XEXA 3J80Q 4LF4E 4IZJA 4Z7CA 4Z7YA 1S4EA 5A2QQ 1NZ0A 1H72C 1XNQE 2R3VA 3JAMC 1HR0I 4ED4A 4UT4A 4GKJI 3P06A 4MYUA 2DEIA 1IBKE 1USUA 2V8PA 1UEKA 2UXDI 4YHHI 4DV5I 1XNRE 4DR2I 3PRYA 5LL6R 1Z0VA 5BR8I 1HNWE 4LF9E 2PNLA 4DR5I 2O1TA 3PYFA 3Q6MA 1EI1A 3ZKBA 2Z5CA 1N0VC 5GMDA 4JI1I 2IOPA 1ZM2A 4X64E 3J7AM 1HNXE 4B3MI 4X62I 2UXCE 3HULA 1FWKA 1Z0GA 4DR4E 1Z5BA 4DR6I 3F0NA 1NHIA 1J5EE 1HNZE 4MYTA 1NHHA 4PRVA 4R1FA 4JI6I 4IZJD 4JG4A 4LFAE 2UU9I 5FWKA 4HY1A 4DV0I 2HK2A 4B3TI 1I94E 1S16A 4IZKB 4LF7E 1KKHA 4NXME 2WW4A 1Y4UA 3V2UC 1XMOI 2O1UA 3LNUA 4I3HA 3K17A 4JI8I 1HR0E 1KVKA 4WUCA 4USMA 2VQEE 2UUCE 3LTOA 1BKNA 1K47A 1N32I 1FI4A 2CG9A 4YY3I 5LMNI 2UUBI 2F4VI 1IBLI 3Q6NA 1ZM4A 4YHHE 4DV5E 4OX9I 3M6AA 4B3RI 2R42A 1FNMA 5BR8E 3QT8A 4DPXA 1HK7A 2A2DA 3PYEA 2A2CA 1WUUA 4FW9A 1RR9A 3J81C 4UTGA 4DV1E 2HK3A 4AQYE 4JI1E 4NXNI 2VF3A 1MG7A 4JV5E 4B3SI 1RREA 4DV7E 3JAMQ 2GQ0A 4X62E 4LFCE 1H74A 4X65I 4PRXA 4N3OA 4LF8I 4EMDA 3ZZTA 1XMQI 1B62A 4DR6E 2E1RA 4FWDA 4DV2I 4P52A 1Z0CA 4DV6I 3QT6A 3QT5A 1Z5CA 3QT7A 1N34E 4IZKA 5GMEA 3T1HI 2Q2EB 4DR3I 4JI4I 2UXBE 1H7UA 4P7AA 4JI0I 2ZITA 2OI2A 4ZVIA 4DPYA 1XMOE 3B78A 3B8HA 3PYGA 4K0KI 4JYAI 2E5LI 4JI8E 1A6FA 4DUZE 2GS8A 2HFSA 3V5RA 4DR1I 4DU7A 4LF5E 4YY3E 5LMNE 2VQFI 4JI7E 1ELOA 2UUBE 2F4VE 5FLXC 1Y6ZA 3HJCA 1Y4SA 4OX9E 4X66I 4B3RE 4JI5I 4JI3E 1FJGI 5LMUE 1N36I 4DXLA 1NHJA 3CWVA 4LF4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP I;  5IWA I;  1XNQ I;  3T1Y I;  4DR7 I;  3Q1Q A;  4RPF A;  4B3S E;  1ZM3 A;  3H4L A;  4JI2 I;  2V2Z A;  1IBK I;  4X65 E;  2ZM6 I;  4DUY I;  4GKK I;  1XMQ E;  1XNR I;  1N0U A;  4GKJ E;  5L3J A;  4DV6 E;  4HAC B;  2UXD E;  1QZR A;  4DR2 E;  3GON A;  4HYM A;  1ZXM A;  4JI0 E;  4X64 I;  1HNX I;  3J81 Q;  1N33 I;  4DR4 I;  4DR5 E;  2E5L E;  1Z5A A;  1J5E I;  2NPF A;  4URL A;  1HNZ I;  1FKA E;  4B3M E;  4DR1 E;  1H73 A;  4LF6 I;  3WU5 A;  2HKE A;  1Z0B A;  4LFA I;  1MX0 A;  1I94 I;  4HXZ A;  4USK A;  4LF7 I;  1FJG E;  4NXM I;  1N36 E;  4DV3 I;  4JI6 E;  5IT9 C;  1MU5 A;  3D4J A;  4XTJ A;  4KHP E;  5IWA E;  2UU9 E;  3J80 C;  3K1J A;  4DV0 E;  3T1Y E;  2V34 A;  4B3T E;  1FWL A;  4DR7 E;  5A2Q C;  1ZXN A;  2VQE I;  2HHH I;  2UUC I;  1U2R A;  4JI2 E;  2DEJ A;  2UUA I;  2ZM6 E;  4DUY E;  4GKK E;  2ZBK B;  3J7A G;  2BV3 A;  4DPT A;  1D6T A;  2EFG A;  3OTO I;  3LPS A;  4DPU A;  5FLX Q;  1PVG A;  1N32 E;  1Z0T A;  1IBM I;  4HAC A;  1OJ4 A;  1IBL E;  1Z0W A;  4DV4 I;  1Z59 A;  4DPW A;  4KQV A;  4LFB I;  4DV1 I;  4AQY I;  4JV5 I;  2CZ9 A;  4DV7 I;  2J7K A;  1N33 E;  4LFC I;  2X36 A;  4DU8 A;  1B63 A;  2X7I A;  2AJ4 A;  1ZM9 A;  4FWG A;  4NXN E;  1PIE A;  1PKP A;  2BM0 A;  3WU6 A;  4LF6 E;  4LF8 E;  3WU3 A;  2HKJ A;  3B82 A;  1N34 I;  2V2Q A;  4DV2 E;  1Z0E A;  4PU9 A;  1H7S A;  2UXB I;  1HNW I;  4DV3 E;  4LF9 I;  1XHK A;  1EA6 A;  3ZKD A;  3T1H E;  4JI4 E;  4DR3 E;  4DUZ I;  4WUD A;  2HHH E;  2UXC I;  4FN5 A;  4LF5 I;  4K0K E;  4JI7 I;  2UUA E;  1DAR A;  4JYA E;  1KTV A;  2V2V A;  4FWH A;  3OTO E;  2LJP A;  3ZZU A;  3ZZ0 A;  1VIS A;  4JI3 I;  5LMU I;  1IBM E;  3ZM7 A;  2VQF E;  3WU4 A;  4DV4 E;  1KIJ A;  3PYD A;  2BM1 A;  4X66 E;  4LFB E;  4M1K A;  5IT9 Q;  4JI5 E;  2HFU A;  4WUB A;  2XEX A;  3J80 Q;  4LF4 E;  4Z7C A;  4Z7Y A;  1S4E A;  5A2Q Q;  1NZ0 A;  1H72 C;  1XNQ E;  2R3V A;  3JAM C;  1HR0 I;  4ED4 A;  4UT4 A;  4GKJ I;  4MYU A;  2DEI A;  1IBK E;  2V8P A;  1UEK A;  2UXD I;  4YHH I;  4DV5 I;  1XNR E;  4DR2 I;  5LL6 R;  1Z0V A;  5BR8 I;  1HNW E;  4LF9 E;  4DR5 I;  3PYF A;  1EI1 A;  3ZKB A;  1N0V C;  5GMD A;  4JI1 I;  1ZM2 A;  4X64 E;  3J7A M;  1HNX E;  4B3M I;  4X62 I;  2UXC E;  3HUL A;  1FWK A;  1Z0G A;  4DR4 E;  1Z5B A;  4DR6 I;  3F0N A;  1NHI A;  1J5E E;  1HNZ E;  4MYT A;  1NHH A;  4PRV A;  4R1F A;  4JI6 I;  4JG4 A;  4LFA E;  2UU9 I;  4HY1 A;  4DV0 I;  2HK2 A;  4B3T I;  1I94 E;  1S16 A;  4LF7 E;  1KKH A;  4NXM E;  2WW4 A;  3V2U C;  1XMO I;  3LNU A;  4I3H A;  3K17 A;  4JI8 I;  1HR0 E;  1KVK A;  4WUC A;  4USM A;  2VQE E;  2UUC E;  3LTO A;  1BKN A;  1K47 A;  1N32 I;  1FI4 A;  4YY3 I;  5LMN I;  2UUB I;  2F4V I;  1IBL I;  1ZM4 A;  4YHH E;  4DV5 E;  4OX9 I;  3M6A A;  4B3R I;  2R42 A;  1FNM A;  5BR8 E;  3QT8 A;  4DPX A;  2A2D A;  3PYE A;  2A2C A;  1WUU A;  4FW9 A;  1RR9 A;  3J81 C;  4UTG A;  4DV1 E;  2HK3 A;  4AQY E;  4JI1 E;  4NXN I;  2VF3 A;  1MG7 A;  4JV5 E;  4B3S I;  1RRE A;  4DV7 E;  3JAM Q;  4X62 E;  4LFC E;  1H74 A;  4X65 I;  4PRX A;  4LF8 I;  4EMD A;  3ZZT A;  1XMQ I;  1B62 A;  4DR6 E;  2E1R A;  4FWD A;  4DV2 I;  4P52 A;  1Z0C A;  4DV6 I;  3QT6 A;  3QT5 A;  1Z5C A;  3QT7 A;  1N34 E;  5GME A;  3T1H I;  2Q2E B;  4DR3 I;  4JI4 I;  2UXB E;  1H7U A;  4P7A A;  4JI0 I;  2ZIT A;  2OI2 A;  4ZVI A;  4DPY A;  1XMO E;  3B78 A;  3B8H A;  3PYG A;  4K0K I;  4JYA I;  2E5L I;  4JI8 E;  1A6F A;  4DUZ E;  2HFS A;  2GS8 A;  3V5R A;  4DR1 I;  4DU7 A;  4LF5 E;  4YY3 E;  5LMN E;  2VQF I;  4JI7 E;  2UUB E;  1ELO A;  2F4V E;  5FLX C;  4OX9 E;  4X66 I;  4B3R E;  4JI5 I;  4JI3 E;  1FJG I;  5LMU E;  1N36 I;  4DXL A;  1NHJ A;  3CWV A;  4LF4 I; 
#chains in the Genus database with same CATH topology
 4KHP I;  5IWA I;  1XNQ I;  3T1Y I;  2GO4 A;  4DR7 I;  3Q1Q A;  4RPF A;  4B3S E;  4GQU A;  2IOQ A;  1P42 A;  1ZM3 A;  3H4L A;  4JI2 I;  2V2Z A;  1IBK I;  4X65 E;  2ZM6 I;  4DUY I;  4GKK I;  2Z5B B;  2JEA A;  4ISA A;  1XMQ E;  4OO1 A;  1XNR I;  1N0U A;  4GKJ E;  2WP8 B;  5L3J A;  4DV6 E;  2JT2 A;  4BA1 B;  3L7Z B;  5DRO A;  2PO1 B;  2BR2 A;  4HAC B;  2UXD E;  1QZR A;  4BA2 A;  4MDT A;  2CVE A;  4DR2 E;  2PNM A;  3GON A;  4AID A;  3PS3 A;  4HYM A;  1ZXM A;  3NZK A;  4JI0 E;  5DNX A;  4X64 I;  1HNX I;  3J81 Q;  3M85 G;  1UDS A;  1N33 I;  4IFD B;  3KRN A;  4LPF A;  3GCM A;  4DR4 I;  4DR5 E;  4AIM A;  1USV A;  2E5L E;  1Z5A A;  3GLL A;  1J5E I;  2NPF A;  4URL A;  1HNZ I;  1FKA E;  5EKW A;  4B3M E;  2C37 B;  4DR1 E;  3P3E A;  1H73 A;  4LF6 I;  3WU5 A;  2HKE A;  1Z0B A;  4LFA I;  1MX0 A;  1I94 I;  2C39 A;  4HXZ A;  4USK A;  5C0X B;  4LF7 I;  1FJG E;  2JEB A;  4NXM I;  1N36 E;  3M7N D;  2O3Z A;  1RHY A;  4DV3 I;  4JI6 E;  5IT9 C;  4MU1 A;  1MU5 A;  3D4J A;  4XTJ A;  4KHP E;  5IWA E;  2UU9 E;  4FW5 A;  3K1J A;  3J80 C;  4DV0 E;  3T1Y E;  4U3B A;  2V34 A;  4B3T E;  1FWL A;  4DR7 E;  4OO1 D;  5A2Q C;  1ZXN A;  2BA0 G;  2VQE I;  2HHH I;  2UUC I;  1U2R A;  2Z5B A;  2O1V A;  4JI2 E;  2DEJ A;  3K85 A;  2UUA I;  4OZE A;  2ZM6 E;  4DUY E;  4GKK E;  2ZBK B;  3J7A G;  2BV3 A;  2WP8 A;  4DPT A;  1D6T A;  2EFG A;  3OTO I;  3LPS A;  4DPU A;  4BA1 A;  3L7Z A;  5FLX Q;  1PVG A;  1N32 E;  1Z0T A;  2PO1 A;  1IBM I;  4HAC A;  1OJ4 A;  1IBL E;  1Z0W A;  4FW4 A;  4DV4 I;  1Z59 A;  4QNJ A;  4DPW A;  4KQV A;  4LFB I;  4DV1 I;  5JEA C;  1E3H A;  4AQY I;  4JV5 I;  2CZ9 A;  2IER A;  4DV7 I;  2J7K A;  1OYR A;  1N33 E;  4LFC I;  2X36 A;  4DU8 A;  1B63 A;  2X7I A;  4QNK A;  4IZJ B;  5ELW A;  2AJ4 A;  2C38 B;  1ZM9 A;  4FWG A;  2C37 A;  4NXN E;  1PIE A;  3PS2 A;  2BA1 G;  3M85 D;  4FW3 A;  4MU3 A;  3PS1 A;  1PKP A;  2BM0 A;  3WU6 A;  4LF6 E;  4LF8 E;  3WU3 A;  2HKJ A;  3B82 A;  1N34 I;  5C0X A;  2V2Q A;  3U1Y A;  4DV2 E;  1Z0E A;  4PU9 A;  5DRQ A;  2CGE A;  1H7S A;  2UXB I;  2O1W A;  2NN6 C;  4LOM A;  3H1C A;  1HNW I;  4DV3 E;  4LF9 I;  1XHK A;  1EA6 A;  2PNZ A;  4NBQ A;  2NN6 E;  3ZKD A;  3T1H E;  4JI4 E;  4DR3 E;  4DUZ I;  2F1D A;  4WUD A;  2Z5E A;  2Z5C B;  2HHH E;  2UXC I;  4FN5 A;  4LF5 I;  4K0K E;  4JI7 I;  2UUA E;  1DAR A;  4JYA E;  4MU0 A;  1KTV A;  2V2V A;  4FWH A;  3OTO E;  2LJP A;  3ZZU A;  3UHM A;  4LCG A;  3ZZ0 A;  1YH8 A;  3B4T A;  1VIS A;  4IFD D;  4JI3 I;  5LMU I;  1IBM E;  3ZM7 A;  2VQF E;  3WU4 A;  4DV4 E;  1KIJ A;  3PYD A;  2BM1 A;  4X66 E;  4LFB E;  4J3D A;  4M1K A;  5IT9 Q;  4MQY A;  4JI5 E;  3DD6 A;  2HFU A;  4WUB A;  5JEA B;  2XEX A;  3J80 Q;  5JEA F;  1R6L A;  4LF4 E;  4IZJ A;  4Z7C A;  4Z7Y A;  1S4E A;  5A2Q Q;  1NZ0 A;  2IES A;  2C38 A;  1H72 C;  1XNQ E;  2R3V A;  3JAM C;  1HR0 I;  4ED4 A;  4UT4 A;  2PNZ B;  5C0X D;  1YHC A;  4GKJ I;  3P06 A;  4MYU A;  2DEI A;  1IBK E;  1USU A;  2V8P A;  1UDO A;  4LCF A;  1UEK A;  2UXD I;  4YHH I;  4DV5 I;  1XNR E;  2BA1 D;  4DR2 I;  3PRY A;  5LL6 R;  1Z0V A;  5BR8 I;  2NN6 B;  1HNW E;  2NN6 F;  4LF9 E;  3P3C A;  2PNL A;  2JE6 B;  4DR5 I;  2O1T A;  3PYF A;  3Q6M A;  3CDI A;  1EI1 A;  4AM3 A;  3ZKB A;  2Z5C A;  1N0V C;  5GMD A;  1XXE A;  4JI1 I;  2IOP A;  1ZM2 A;  4X64 E;  3J7A M;  1HNX E;  1Y5Y A;  4B3M I;  4X62 I;  2UXC E;  3HUL A;  1FWK A;  1Z0G A;  5K36 F;  4DR4 E;  5JEA E;  2WNR B;  1Z5B A;  3M7N G;  4DR6 I;  3F0N A;  1NHI A;  1J5E E;  1HNZ E;  4MYT A;  1NHH A;  3GME A;  3P76 A;  4PRV A;  4R1F A;  4JI6 I;  4IZJ D;  4JG4 A;  4LFA E;  2UU9 I;  5FWK A;  4HY1 A;  4DV0 I;  2GO3 A;  2HK2 A;  4OKG A;  5JEA A;  4B3T I;  1I94 E;  1S16 A;  4IZK B;  4LF7 E;  1KKH A;  4IS9 A;  2WW4 A;  4NXM E;  1Y4U A;  3V2U C;  1UDQ A;  1XMO I;  2O1U A;  3LNU A;  2PO0 B;  4I3H A;  3K17 A;  4JI8 I;  1HR0 E;  1KVK A;  4WUC A;  4USM A;  5K36 C;  2VQE E;  2UUC E;  3LTO A;  1BKN A;  1K47 A;  2PO2 B;  1N32 I;  1FI4 A;  2CG9 A;  4YY3 I;  5LMN I;  2UUB I;  2F4V I;  3CDJ A;  1IBL I;  5K36 E;  3Q6N A;  1ZM4 A;  5DRP A;  4YHH E;  2BA0 D;  2VES A;  4LCH A;  4DV5 E;  3M6A A;  4OX9 I;  4MU4 A;  4B3R I;  2NN6 A;  3U1K A;  2R42 A;  1FNM A;  5BR8 E;  2JE6 A;  3QT8 A;  4DPX A;  1HK7 A;  2A2D A;  3PYE A;  4IFD F;  2A2C A;  1WUU A;  1OYS A;  4FW9 A;  1RR9 A;  3J81 C;  4UTG A;  4DV1 E;  2HK3 A;  4AQY E;  5K36 A;  4JI1 E;  4NXN I;  2VF3 A;  1MG7 A;  4JV5 E;  4B3S I;  1RRE A;  4DV7 E;  3JAM Q;  2GQ0 A;  2WNR A;  4X62 E;  4LFC E;  1H74 A;  4X65 I;  4PRX A;  4N3O A;  4LF8 I;  4EMD A;  3ZZT A;  1XMQ I;  1B62 A;  4DR6 E;  2E1R A;  4FWD A;  4DV2 I;  2JEA B;  2J65 A;  5DNL A;  5JEA D;  4OO1 B;  3HKM A;  4P52 A;  2AE8 A;  1Z0C A;  4OO1 F;  4DV6 I;  3QT6 A;  4FW6 A;  5C0X F;  3QT5 A;  3P3G A;  4FW7 A;  1Z5C A;  3QT7 A;  1N34 E;  2BR2 B;  1Y60 A;  4IZK A;  5GME A;  3T1H I;  2Q2E B;  4DR3 I;  4JI4 I;  4BA2 B;  4U3D A;  1H7U A;  4P7A A;  2UXB E;  4IFD C;  4JI0 I;  2ZIT A;  2OI2 A;  2PO0 A;  4ZVI A;  4DPY A;  1XMO E;  3B78 A;  3B8H A;  3PYG A;  4K0K I;  4IFD E;  4JYA I;  2E5L I;  4JI8 E;  1A6F A;  1VI7 A;  2PO2 A;  4DUZ E;  2GS8 A;  2HFS A;  3V5R A;  4DR1 I;  5K36 B;  1E3P A;  2NN6 D;  1UDN A;  4DU7 A;  4LF5 E;  4YY3 E;  2VQF I;  5LMN E;  4JI7 E;  1ELO A;  2UUB E;  2F4V E;  5FLX C;  1Y6Z A;  3HJC A;  4OO1 C;  1Y4S A;  4OX9 E;  5C0X C;  4X66 I;  4B3R E;  4JI5 I;  4IFD A;  4JI3 E;  1FJG I;  5LMU E;  5K36 D;  1N36 I;  1R6M A;  4DXL A;  4OO1 E;  1NHJ A;  2C39 B;  3CWV A;  1OYP A;  5DRR A;  4LF4 I;  5EL9 A;  5C0X E;  2JEB B; 
#chains in the Genus database with same CATH homology
 4KHP I;  5IWA I;  1XNQ I;  3T1Y I;  4DR7 I;  3Q1Q A;  4RPF A;  4B3S E;  2IOQ A;  1ZM3 A;  3H4L A;  4JI2 I;  2V2Z A;  1IBK I;  4X65 E;  2ZM6 I;  4DUY I;  4GKK I;  2Z5B B;  1XMQ E;  1XNR I;  1N0U A;  4GKJ E;  5L3J A;  4DV6 E;  4HAC B;  2UXD E;  1QZR A;  4DR2 E;  2PNM A;  3GON A;  4HYM A;  1ZXM A;  4JI0 E;  4X64 I;  1HNX I;  3J81 Q;  1N33 I;  4DR4 I;  4DR5 E;  1USV A;  2E5L E;  1Z5A A;  1J5E I;  2NPF A;  4URL A;  1HNZ I;  1FKA E;  4B3M E;  4DR1 E;  1H73 A;  4LF6 I;  3WU5 A;  2HKE A;  1Z0B A;  4LFA I;  1MX0 A;  1I94 I;  4HXZ A;  4USK A;  4LF7 I;  1FJG E;  4NXM I;  1N36 E;  4DV3 I;  4JI6 E;  5IT9 C;  1MU5 A;  3D4J A;  4XTJ A;  4KHP E;  5IWA E;  2UU9 E;  3J80 C;  3K1J A;  4DV0 E;  3T1Y E;  2V34 A;  4B3T E;  1FWL A;  4DR7 E;  5A2Q C;  1ZXN A;  2VQE I;  2HHH I;  2UUC I;  1U2R A;  2Z5B A;  2O1V A;  4JI2 E;  2DEJ A;  3K85 A;  2UUA I;  2ZM6 E;  4DUY E;  4GKK E;  2ZBK B;  3J7A G;  2BV3 A;  4DPT A;  1D6T A;  2EFG A;  3OTO I;  3LPS A;  4DPU A;  5FLX Q;  1PVG A;  1N32 E;  1Z0T A;  1IBM I;  4HAC A;  1OJ4 A;  1IBL E;  1Z0W A;  4DV4 I;  1Z59 A;  4DPW A;  4KQV A;  4LFB I;  4DV1 I;  4AQY I;  4JV5 I;  2CZ9 A;  4DV7 I;  2J7K A;  1N33 E;  4LFC I;  2X36 A;  4DU8 A;  1B63 A;  2X7I A;  4IZJ B;  2AJ4 A;  1ZM9 A;  4FWG A;  4NXN E;  1PIE A;  1PKP A;  2BM0 A;  3WU6 A;  4LF6 E;  4LF8 E;  3WU3 A;  2HKJ A;  3B82 A;  1N34 I;  2V2Q A;  4DV2 E;  1Z0E A;  4PU9 A;  2CGE A;  1H7S A;  2UXB I;  2O1W A;  1HNW I;  4DV3 E;  4LF9 I;  1XHK A;  1EA6 A;  3ZKD A;  3T1H E;  4JI4 E;  4DR3 E;  4DUZ I;  4WUD A;  2Z5E A;  2Z5C B;  2HHH E;  2UXC I;  4FN5 A;  4LF5 I;  4K0K E;  4JI7 I;  2UUA E;  1DAR A;  4JYA E;  1KTV A;  2V2V A;  4FWH A;  3OTO E;  2LJP A;  3ZZU A;  3ZZ0 A;  1VIS A;  4JI3 I;  5LMU I;  1IBM E;  3ZM7 A;  2VQF E;  3WU4 A;  4DV4 E;  1KIJ A;  3PYD A;  2BM1 A;  4X66 E;  4LFB E;  4M1K A;  5IT9 Q;  4JI5 E;  2HFU A;  4WUB A;  2XEX A;  3J80 Q;  4LF4 E;  4IZJ A;  4Z7C A;  4Z7Y A;  1S4E A;  5A2Q Q;  1NZ0 A;  1H72 C;  1XNQ E;  2R3V A;  3JAM C;  1HR0 I;  4ED4 A;  4UT4 A;  4GKJ I;  3P06 A;  4MYU A;  2DEI A;  1IBK E;  1USU A;  2V8P A;  1UEK A;  2UXD I;  4YHH I;  4DV5 I;  1XNR E;  4DR2 I;  3PRY A;  5LL6 R;  1Z0V A;  5BR8 I;  1HNW E;  4LF9 E;  2PNL A;  4DR5 I;  2O1T A;  3PYF A;  3Q6M A;  1EI1 A;  3ZKB A;  2Z5C A;  1N0V C;  5GMD A;  4JI1 I;  2IOP A;  1ZM2 A;  4X64 E;  3J7A M;  1HNX E;  4B3M I;  4X62 I;  2UXC E;  3HUL A;  1FWK A;  1Z0G A;  4DR4 E;  1Z5B A;  4DR6 I;  3F0N A;  1NHI A;  1J5E E;  1HNZ E;  4MYT A;  1NHH A;  4PRV A;  4R1F A;  4JI6 I;  4IZJ D;  4JG4 A;  4LFA E;  2UU9 I;  5FWK A;  4HY1 A;  4DV0 I;  2HK2 A;  4B3T I;  1I94 E;  1S16 A;  4IZK B;  4LF7 E;  1KKH A;  4NXM E;  2WW4 A;  1Y4U A;  3V2U C;  1XMO I;  2O1U A;  3LNU A;  4I3H A;  3K17 A;  4JI8 I;  1HR0 E;  1KVK A;  4WUC A;  4USM A;  2VQE E;  2UUC E;  3LTO A;  1BKN A;  1K47 A;  1N32 I;  1FI4 A;  2CG9 A;  4YY3 I;  5LMN I;  2UUB I;  2F4V I;  1IBL I;  3Q6N A;  1ZM4 A;  4YHH E;  4DV5 E;  4OX9 I;  3M6A A;  4B3R I;  2R42 A;  1FNM A;  5BR8 E;  3QT8 A;  4DPX A;  1HK7 A;  2A2D A;  3PYE A;  2A2C A;  1WUU A;  4FW9 A;  1RR9 A;  3J81 C;  4UTG A;  4DV1 E;  2HK3 A;  4AQY E;  4JI1 E;  4NXN I;  2VF3 A;  1MG7 A;  4JV5 E;  4B3S I;  1RRE A;  4DV7 E;  3JAM Q;  2GQ0 A;  4X62 E;  4LFC E;  1H74 A;  4X65 I;  4PRX A;  4N3O A;  4LF8 I;  4EMD A;  3ZZT A;  1XMQ I;  1B62 A;  4DR6 E;  2E1R A;  4FWD A;  4DV2 I;  4P52 A;  1Z0C A;  4DV6 I;  3QT6 A;  3QT5 A;  1Z5C A;  3QT7 A;  1N34 E;  4IZK A;  5GME A;  3T1H I;  2Q2E B;  4DR3 I;  4JI4 I;  2UXB E;  1H7U A;  4P7A A;  4JI0 I;  2ZIT A;  2OI2 A;  4ZVI A;  4DPY A;  1XMO E;  3B78 A;  3B8H A;  3PYG A;  4K0K I;  4JYA I;  2E5L I;  4JI8 E;  1A6F A;  4DUZ E;  2GS8 A;  2HFS A;  3V5R A;  4DR1 I;  4DU7 A;  4LF5 E;  4YY3 E;  5LMN E;  2VQF I;  4JI7 E;  1ELO A;  2UUB E;  2F4V E;  5FLX C;  1Y6Z A;  3HJC A;  1Y4S A;  4OX9 E;  4X66 I;  4B3R E;  4JI5 I;  4JI3 E;  1FJG I;  5LMU E;  1N36 I;  4DXL A;  1NHJ A;  3CWV A;  4LF4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...