4DUZI

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzI00
4DV5I 1HNXE 3ZZUA 4LFBI 4FWDA 5IWAI 4YY3I 1KIJA 2V2QA 2OI2A 1N34E 4K0KI 3ZKDA 1I94E 1NZ0A 3J81Q 4JI7I 1H74A 4JI6E 4B3SI 3ZZTA 1N32E 1FWKA 1H73A 4LF5I 2V2VA 2VF3A 4PRXA 3J7AM 2LJPA 3J7AG 2UUAE 1FWLA 4Z7CA 1MX0A 1DARA 1Z0TA 1N36I 1OJ4A 4NXME 2UXCI 3ZZ0A 3V5RA 4GKJI 4X66E 4PRVA 3J81C 1XNRE 1EI1A 2ZBKB 4UT4A 2E5LI 4HXZA 1ZM4A 4LF8I 1N33I 3LNUA 4LF6E 1H7SA 3Q1QA 2UUCI 1ZXMA 1FKAE 1S16A 4Z7YA 4FWGA 2V2ZA 5GMEA 2HKJA 2UU9I 4JV5E 4AQYE 4DR6I 4FW9A 4LF4I 4DR3I 4DV4E 3T1HI 1Z5AA 3PYFA 1MU5A 1Z0EA 4JI2I 4DUZI 4JI0E 1XNQE 1MG7A 3CWVA 2DEIA 1XNQI 4JI0I 3K1JA 4DUZE 1H7UA 4LF4E 5A2QC 2HFSA 3GONA 1Z0GA 5L3JA 1H72C 4LF9I 4JV5I 1IBME 1HR0E 1IBKE 3PYGA 4DR1E 4X62I 2HHHI 2V34A 4R1FA 3T1YI 4ZVIA 4LFAI 4LF6I 4B3TI 4LF8E 2UUBI 1ZXNA 4JI4I 1XNRI 4URLA 4DR5E 4GKJE 4JI3E 4FWHA 2UXCE 2BM0A 4NXMI 1A6FA 1N36E 3WU5A 3H4LA 3J80C 2V8PA 2UUAI 1RR9A 4DU8A 1N0UA 4M1KA 4LF5E 1BKNA 4RPFA 1N32I 1ZM9A 4B3SE 1K47A 3ZM7A 4JI7E 2E1RA 3K17A 4JI3I 4DR5I 1NHHA 4JG4A 4JI4E 1Z0WA 1I94I 2UUBE 4K0KE 4B3TE 3JAMQ 5IWAE 4LFAE 1EA6A 3T1YE 2HKEA 2EFGA 1B62A 1XHKA 2HHHE 4X62E 5IT9C 4LFBE 4P7AA 4DR1I 1Z5BA 2NPFA 4DPYA 1Z0VA 1IBKI 1HR0I 1FJGI 1IBMI 3WU3A 3V2UC 4DPTA 1HNWE 4LF9E 4LF7E 4JI5I 4DV6E 1NHJA 2VQEI 4DV3E 3WU6A 2BV3A 4HYMA 3F0NA 3QT6A 2AJ4A 4DV0E 5A2QQ 3QT5A 2J7KA 4DV7I 1IBLI 2VQFI 4JI2E 4B3ME 1XMOE 3T1HE 2HK3A 4DV4I 4B3RE 3ZKBA 4DR3E 5FLXC 4DR6E 1PKPA 4DUYE 3QT7A 4JI8I 4ED4A 4AQYI 2UU9E 1NHIA 1Z0BA 2R42A 4PU9A 4GKKI 4DXLA 4HY1A 1KKHA 3PYEA 3JAMC 5LMNE 5LL6R 5BR8I 3OTOI 2UUCE 1KTVA 1N33E 1ZM2A 1WUUA 2E5LE 2HK2A 4DPUA 4LFCE 4X66I 1N0VC 4OX9E 2F4VI 3HULA 4MYTA 4FN5A 1QZRA 5LMUE 4KHPI 1FI4A 1KVKA 2GS8A 4DV2I 3M6AA 4YHHI 5IT9Q 2A2DA 2UXBI 1ZM3A 4DPWA 1XMQI 4UTGA 4HACB 4DR7E 4NXNI 4USMA 4X64E 4JI1I 4JI6I 4JI1E 4X64I 4NXNE 4DR7I 2HFUA 1XMQE 4MYUA 2WW4A 2XEXA 3B82A 2UXBE 1N34I 4YHHE 2ZITA 4YY3E 4DV2E 4KHPE 1VISA 5GMDA 5LMUI 2A2CA 1PIEA 1HNXI 4DV5E 1Z0CA 3LTOA 4DV1E 2BM1A 2R3VA 2F4VE 4HACA 1HNZI 2X36A 4OX9I 4P52A 1Z59A 3WU4A 4LFCI 3PYDA 4DPXA 1UEKA 2ZM6E 3J80Q 5FLXQ 1J5EE 4JYAI 1U2RA 4WUDA 2UXDI 3OTOE 5BR8E 4WUBA 5LMNI 4DR4I 4DR2E 2X7IA 4I3HA 1B63A 4USKA 4GKKE 4X65I 1S4EA 3LPSA 2CZ9A 4JI8E 4DUYI 1RREA 3QT8A 4X65E 1PVGA 4B3RI 4EMDA 4DR2I 1XMOI 4B3MI 1Z5CA 4DR4E 2VQFE 1IBLE 2UXDE 4DV7E 4JYAE 1J5EI 2ZM6I 4DV0I 1FNMA 4WUCA 1ELOA 1D6TA 3B78A 3B8HA 4DV3I 4XTJA 2VQEE 3D4JA 1HNZE 2Q2EB 4DV6I 4DV1I 4JI5E 2DEJA 4LF7I 4DU7A 1HNWI 4KQVA 1FJGE
chains in the Genus database with same CATH superfamily
4DV5I 4LCGA 2JEBB 1HNXE 3ZZUA 4QNJA 5C0XA 4LFBI 4FW7A 2GQ0A 4FWDA 1VI7A 5C0XF 5IWAI 4YY3I 1KIJA 2V2QA 2OI2A 1YH8A 1N34E 2Z5BA 4K0KI 3ZKDA 1I94E 2VESA 1NZ0A 3J81Q 4OKGA 5DRPA 4MU3A 4MU1A 2WP8A 4JI7I 1H74A 2JEBA 4JI6E 4B3SI 4LPFA 3ZZTA 1N32E 1FWKA 5DROA 5C0XB 4NBQA 3P3EA 1H73A 4LF5I 2V2VA 2VF3A 4PRXA 4MU4A 3J7AM 2LJPA 3J7AG 4IFDD 2UUAE 2NN6D 1FWLA 2WNRA 4Z7CA 1MX0A 1DARA 1Z0TA 1N36I 1OJ4A 3H1CA 4NXME 4GQUA 2UXCI 4FW4A 3ZZ0A 3V5RA 4FW6A 3P06A 4GKJI 2F1DA 4X66E 4PRVA 3J81C 1XNRE 2NN6F 4MDTA 1EI1A 2ZBKB 2Z5CB 4UT4A 4IFDF 1UDOA 2E5LI 1Y5YA 4HXZA 1ZM4A 4MQYA 4LF8I 1N33I 3LNUA 4OZEA 4LF6E 1H7SA 3Q1QA 2UUCI 1ZXMA 1FKAE 1S16A 4Z7YA 4FWGA 3CDJA 2V2ZA 5GMEA 4BA1A 4FW5A 2PO0B 2HKJA 2UU9I 4JV5E 2WNRB 4AQYE 3CDIA 1Y6ZA 2C38B 5C0XC 4DR6I 4IFDE 5JEAC 2BR2B 3HJCA 5DNLA 4FW9A 4IZKA 4DR3I 4LF4I 4DV4E 3T1HI 2BA0G 1Z5AA 3PYFA 1MU5A 1Z0EA 4JI2I 4DUZI 4JI0E 1XNQE 1MG7A 3CWVA 2DEIA 1UDSA 1XNQI 5K36B 2JE6A 3K1JA 4JI0I 4DUZE 5EL9A 3GMEA 1H7UA 4LF4E 4OO1D 5A2QC 2C38A 3M7ND 2HFSA 3GONA 3NZKA 1Z0GA 5L3JA 4ISAA 1H72C 4LF9I 4JV5I 1IBME 1HR0E 1IBKE 3PS1A 2J65A 3PYGA 4DR1E 1Y4SA 4X62I 2HHHI 2V34A 2CGEA 4R1FA 3T1YI 4ZVIA 4LFAI 4LF6I 4B3TI 4LF8E 2UUBI 1ZXNA 4JI4I 2JEAA 1XNRI 4URLA 4IFDC 4DR5E 1UDQA 2NN6A 3UHMA 2C39B 3PS2A 4GKJE 4JI3E 4FWHA 1P42A 2UXCE 2BM0A 4BA1B 4NXMI 1A6FA 1N36E 5C0XE 5JEAE 3WU5A 3H4LA 3J80C 3M85D 2V8PA 2UUAI 2BA0D 1RR9A 4DU8A 4J3DA 1N0UA 4M1KA 5JEAF 4LF5E 4OO1A 1BKNA 3U1KA 4RPFA 2Z5EA 1N32I 1ZM9A 4B3SE 1K47A 3ZM7A 2WP8B 4JI7E 5DNXA 2E1RA 2PNZB 3K17A 4JI3I 4DR5I 1NHHA 4JG4A 1HK7A 4JI4E 1OYPA 1Z0WA 1YHCA 1I94I 2UUBE 2O1UA 4K0KE 2JT2A 4B3TE 4U3BA 3JAMQ 5IWAE 4LFAE 1EA6A 3T1YE 2HKEA 4IS9A 2EFGA 1B62A 1XHKA 2HHHE 4X62E 5IT9C 4LFBE 4P7AA 4DR1I 1Z5BA 2NPFA 3Q6MA 4DPYA 1Z0VA 1IBKI 2PO1B 5K36D 1HR0I 3KRNA 1FJGI 1IBMI 3WU3A 3V2UC 4DPTA 1HNWE 4LF9E 4LF7E 4JI5I 2PO2B 3GLLA 4DV6E 3P3CA 3L7ZA 1NHJA 2VQEI 4DV3E 3WU6A 2GO3A 2BV3A 4HYMA 1Y4UA 5JEAD 3F0NA 3QT6A 2AJ4A 4DV0E 5A2QQ 3QT5A 4AM3A 2J7KA 2Z5CA 4DV7I 4IZJB 1IBLI 2VQFI 4JI2E 5EKWA 4B3ME 1XMOE 3T1HE 2HK3A 4DV4I 4B3RE 3ZKBA 4DR3E 5FLXC 3P76A 4DR6E 1PKPA 4DUYE 3QT7A 4JI8I 4LOMA 4ED4A 4AQYI 2C37A 2UU9E 1NHIA 1Z0BA 2R42A 3DD6A 2PO1A 4PU9A 4IZKB 2C39A 4GKKI 2IOPA 4DXLA 4HY1A 2C37B 1KKHA 2JEAB 2BR2A 3PYEA 3JAMC 5LMNE 2PNZA 5LL6R 5BR8I 3OTOI 4IFDB 3M7NG 2UUCE 2NN6B 5K36F 1KTVA 1N33E 5JEAA 1ZM2A 1WUUA 1R6MA 2O1VA 2HK2A 2E5LE 4OO1B 3M85G 4OO1E 3B4TA 4DPUA 4LFCE 4X66I 1N0VC 4OX9E 2IERA 2F4VI 4OO1C 3HULA 5JEAB 4MYTA 4FN5A 1QZRA 5LMUE 4KHPI 5K36A 1FI4A 1KVKA 2GS8A 4DV2I 3M6AA 4YHHI 2BA1G 5IT9Q 2A2DA 2UXBI 1ZM3A 4MU0A 4DPWA 1XMQI 4UTGA 4HACB 4DR7E 1USVA 4NXNI 4USMA 4X64E 4JI1I 4JI6I 5DRQA 4JI1E 4X64I 2O1WA 4NXNE 1R6LA 4DR7I 2HFUA 1XMQE 4MYUA 2WW4A 2XEXA 3B82A 2UXBE 1N34I 4YHHE 2ZITA 4YY3E 4DV2E 2O1TA 3Q6NA 3L7ZB 4KHPE 1USUA 1VISA 2PO2A 5GMDA 5LMUI 5ELWA 2IOQA 2A2CA 2JE6B 1PIEA 1HNXI 1UDNA 4DV5E 1Z0CA 3LTOA 1OYSA 4DV1E 1Y60A 2BM1A 2R3VA 2F4VE 4HACA 5K36C 1HNZI 3P3GA 2X36A 4OX9I 2PNLA 1Z59A 3PRYA 3HKMA 4P52A 3WU4A 4LFCI 3PYDA 5C0XD 4BA2B 2O3ZA 2BA1D 2GO4A 4DPXA 1UEKA 2ZM6E 3J80Q 4LCHA 5FLXQ 1E3HA 4FW3A 4OO1F 1J5EE 4JYAI 1U2RA 3GCMA 4WUDA 2UXDI 3OTOE 5BR8E 4WUBA 5LMNI 4DR4I 1RHYA 2X7IA 4DR2E 4I3HA 1B63A 1E3PA 4USKA 4GKKE 4X65I 2PO0A 1S4EA 1XXEA 3LPSA 5DRRA 4BA2A 2CZ9A 4JI8E 4DUYI 1RREA 3QT8A 1OYRA 2CG9A 4X65E 1PVGA 4B3RI 4IZJA 4EMDA 4DR2I 1XMOI 4LCFA 1Z5CA 4B3MI 4DR4E 2VQFE 1IBLE 2UXDE 4DV7E 2Z5BB 4JYAE 1J5EI 5FWKA 4IZJD 2CVEA 2ZM6I 2PNMA 4DV0I 1FNMA 2AE8A 2NN6C 4IFDA 4WUCA 1ELOA 5K36E 1D6TA 3B78A 4AIMA 4AIDA 3B8HA 4QNKA 4XTJA 4DV3I 2VQEE 3D4JA 2NN6E 4U3DA 1HNZE 2Q2EB 4DV6I 4N3OA 4DV1I 4JI5E 2DEJA 2IESA 4DU7A 4LF7I 1HNWI 3U1YA 3PS3A 4KQVA 3K85A 1FJGE
chains in the Genus database with same CATH topology
4DV5I 1HNXE 3ZZUA 4LFBI 2GQ0A 4FWDA 5IWAI 4YY3I 1KIJA 2V2QA 2OI2A 1N34E 2Z5BA 4K0KI 3ZKDA 1I94E 1NZ0A 3J81Q 4JI7I 1H74A 4JI6E 4B3SI 3ZZTA 1N32E 1FWKA 1H73A 4LF5I 2V2VA 2VF3A 4PRXA 3J7AM 2LJPA 3J7AG 2UUAE 1FWLA 4Z7CA 1MX0A 1DARA 1Z0TA 1N36I 1OJ4A 4NXME 2UXCI 3ZZ0A 3V5RA 3P06A 4GKJI 4X66E 4PRVA 3J81C 1XNRE 1EI1A 2ZBKB 2Z5CB 4UT4A 2E5LI 4HXZA 1ZM4A 4LF8I 1N33I 3LNUA 4LF6E 1H7SA 3Q1QA 2UUCI 1ZXMA 1FKAE 1S16A 4Z7YA 4FWGA 2V2ZA 5GMEA 2HKJA 2UU9I 4JV5E 4AQYE 1Y6ZA 4DR6I 3HJCA 4FW9A 4IZKA 4DR3I 4LF4I 4DV4E 3T1HI 1Z5AA 3PYFA 1MU5A 1Z0EA 4JI2I 4DUZI 4JI0E 1XNQE 1MG7A 3CWVA 2DEIA 1XNQI 4JI0I 3K1JA 4DUZE 1H7UA 4LF4E 5A2QC 2HFSA 3GONA 1Z0GA 5L3JA 1H72C 4LF9I 4JV5I 1IBME 1HR0E 1IBKE 3PYGA 4DR1E 1Y4SA 4X62I 2HHHI 2V34A 2CGEA 4R1FA 3T1YI 4ZVIA 4LFAI 4LF6I 4B3TI 4LF8E 2UUBI 1ZXNA 4JI4I 1XNRI 4URLA 4DR5E 4GKJE 4JI3E 4FWHA 2UXCE 2BM0A 4NXMI 1A6FA 1N36E 3WU5A 3H4LA 3J80C 2V8PA 2UUAI 1RR9A 4DU8A 1N0UA 4M1KA 4LF5E 1BKNA 4RPFA 2Z5EA 1N32I 1ZM9A 4B3SE 1K47A 3ZM7A 4JI7E 2E1RA 3K17A 4JI3I 4DR5I 1NHHA 4JG4A 1HK7A 4JI4E 1Z0WA 1I94I 2UUBE 2O1UA 4K0KE 4B3TE 3JAMQ 5IWAE 4LFAE 1EA6A 3T1YE 2HKEA 2EFGA 1B62A 1XHKA 2HHHE 4X62E 5IT9C 4LFBE 4P7AA 4DR1I 1Z5BA 2NPFA 3Q6MA 4DPYA 1Z0VA 1IBKI 1HR0I 1FJGI 1IBMI 3WU3A 3V2UC 4DPTA 1HNWE 4LF9E 4LF7E 4JI5I 4DV6E 1NHJA 2VQEI 4DV3E 3WU6A 2BV3A 4HYMA 1Y4UA 3F0NA 3QT6A 2AJ4A 4DV0E 5A2QQ 3QT5A 2J7KA 2Z5CA 4DV7I 4IZJB 1IBLI 2VQFI 4JI2E 4B3ME 1XMOE 3T1HE 2HK3A 4DV4I 4B3RE 3ZKBA 4DR3E 5FLXC 4DR6E 1PKPA 4DUYE 3QT7A 4JI8I 4ED4A 4AQYI 2UU9E 1NHIA 1Z0BA 2R42A 4PU9A 4IZKB 4GKKI 2IOPA 4DXLA 4HY1A 1KKHA 3PYEA 3JAMC 5LMNE 5LL6R 5BR8I 3OTOI 2UUCE 1KTVA 1N33E 1ZM2A 1WUUA 2O1VA 2E5LE 2HK2A 4DPUA 4LFCE 4X66I 1N0VC 4OX9E 2F4VI 3HULA 4MYTA 4FN5A 1QZRA 5LMUE 4KHPI 1FI4A 1KVKA 2GS8A 4DV2I 3M6AA 4YHHI 5IT9Q 2A2DA 2UXBI 1ZM3A 4DPWA 1XMQI 4UTGA 4HACB 4DR7E 1USVA 4NXNI 4USMA 4X64E 4JI1I 4JI6I 4JI1E 4X64I 2O1WA 4NXNE 4DR7I 2HFUA 1XMQE 4MYUA 2WW4A 2XEXA 3B82A 2UXBE 1N34I 4YHHE 2ZITA 4YY3E 4DV2E 2O1TA 3Q6NA 4KHPE 1USUA 1VISA 5GMDA 5LMUI 2IOQA 2A2CA 1PIEA 1HNXI 4DV5E 1Z0CA 3LTOA 4DV1E 2BM1A 2R3VA 2F4VE 4HACA 1HNZI 2X36A 4OX9I 2PNLA 1Z59A 3PRYA 4P52A 4LFCI 3WU4A 3PYDA 4DPXA 1UEKA 2ZM6E 3J80Q 5FLXQ 1J5EE 4JYAI 1U2RA 4WUDA 2UXDI 3OTOE 5BR8E 4WUBA 5LMNI 4DR4I 4DR2E 2X7IA 4I3HA 1B63A 4USKA 4GKKE 4X65I 1S4EA 3LPSA 2CZ9A 4JI8E 4DUYI 1RREA 3QT8A 2CG9A 4X65E 1PVGA 4B3RI 4IZJA 4EMDA 4DR2I 1XMOI 4B3MI 1Z5CA 4DR4E 2VQFE 1IBLE 2UXDE 4DV7E 2Z5BB 4JYAE 1J5EI 5FWKA 4IZJD 2ZM6I 2PNMA 4DV0I 1FNMA 4WUCA 1ELOA 1D6TA 3B78A 3B8HA 4DV3I 4XTJA 2VQEE 3D4JA 1HNZE 2Q2EB 4DV6I 4N3OA 4DV1I 4JI5E 4DU7A 2DEJA 4LF7I 1HNWI 4KQVA 3K85A 1FJGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 I;  1HNX E;  3ZZU A;  4LFB I;  4FWD A;  5IWA I;  4YY3 I;  1KIJ A;  2V2Q A;  2OI2 A;  1N34 E;  4K0K I;  3ZKD A;  1I94 E;  1NZ0 A;  3J81 Q;  4JI7 I;  1H74 A;  4JI6 E;  4B3S I;  3ZZT A;  1N32 E;  1FWK A;  1H73 A;  4LF5 I;  2V2V A;  2VF3 A;  4PRX A;  3J7A M;  2LJP A;  3J7A G;  2UUA E;  1FWL A;  4Z7C A;  1MX0 A;  1DAR A;  1Z0T A;  1N36 I;  1OJ4 A;  4NXM E;  2UXC I;  3ZZ0 A;  3V5R A;  4GKJ I;  4X66 E;  4PRV A;  3J81 C;  1XNR E;  1EI1 A;  2ZBK B;  4UT4 A;  2E5L I;  4HXZ A;  1ZM4 A;  4LF8 I;  1N33 I;  3LNU A;  4LF6 E;  1H7S A;  3Q1Q A;  2UUC I;  1ZXM A;  1FKA E;  1S16 A;  4Z7Y A;  4FWG A;  2V2Z A;  5GME A;  2HKJ A;  2UU9 I;  4JV5 E;  4AQY E;  4DR6 I;  4FW9 A;  4LF4 I;  4DR3 I;  4DV4 E;  3T1H I;  1Z5A A;  3PYF A;  1MU5 A;  1Z0E A;  4JI2 I;  4DUZ I;  4JI0 E;  1XNQ E;  1MG7 A;  3CWV A;  2DEI A;  1XNQ I;  4JI0 I;  3K1J A;  4DUZ E;  1H7U A;  4LF4 E;  5A2Q C;  2HFS A;  3GON A;  1Z0G A;  5L3J A;  1H72 C;  4LF9 I;  4JV5 I;  1IBM E;  1HR0 E;  1IBK E;  3PYG A;  4DR1 E;  4X62 I;  2HHH I;  2V34 A;  4R1F A;  3T1Y I;  4ZVI A;  4LFA I;  4LF6 I;  4B3T I;  4LF8 E;  2UUB I;  1ZXN A;  4JI4 I;  1XNR I;  4URL A;  4DR5 E;  4GKJ E;  4JI3 E;  4FWH A;  2UXC E;  2BM0 A;  4NXM I;  1A6F A;  1N36 E;  3WU5 A;  3H4L A;  3J80 C;  2V8P A;  2UUA I;  1RR9 A;  4DU8 A;  1N0U A;  4M1K A;  4LF5 E;  1BKN A;  4RPF A;  1N32 I;  1ZM9 A;  4B3S E;  1K47 A;  3ZM7 A;  4JI7 E;  2E1R A;  3K17 A;  4JI3 I;  4DR5 I;  1NHH A;  4JG4 A;  4JI4 E;  1Z0W A;  1I94 I;  2UUB E;  4K0K E;  4B3T E;  3JAM Q;  5IWA E;  4LFA E;  1EA6 A;  3T1Y E;  2HKE A;  2EFG A;  1B62 A;  1XHK A;  2HHH E;  4X62 E;  5IT9 C;  4LFB E;  4P7A A;  4DR1 I;  1Z5B A;  2NPF A;  4DPY A;  1Z0V A;  1IBK I;  1HR0 I;  1FJG I;  1IBM I;  3WU3 A;  3V2U C;  4DPT A;  1HNW E;  4LF9 E;  4LF7 E;  4JI5 I;  4DV6 E;  1NHJ A;  2VQE I;  4DV3 E;  3WU6 A;  2BV3 A;  4HYM A;  3F0N A;  3QT6 A;  2AJ4 A;  4DV0 E;  5A2Q Q;  3QT5 A;  2J7K A;  4DV7 I;  1IBL I;  2VQF I;  4JI2 E;  4B3M E;  1XMO E;  3T1H E;  2HK3 A;  4DV4 I;  4B3R E;  3ZKB A;  4DR3 E;  5FLX C;  4DR6 E;  1PKP A;  4DUY E;  3QT7 A;  4JI8 I;  4ED4 A;  4AQY I;  2UU9 E;  1NHI A;  1Z0B A;  2R42 A;  4PU9 A;  4GKK I;  4DXL A;  4HY1 A;  1KKH A;  3PYE A;  3JAM C;  5LMN E;  5LL6 R;  5BR8 I;  3OTO I;  2UUC E;  1KTV A;  1N33 E;  1ZM2 A;  1WUU A;  2E5L E;  2HK2 A;  4DPU A;  4LFC E;  4X66 I;  1N0V C;  4OX9 E;  2F4V I;  3HUL A;  4MYT A;  4FN5 A;  1QZR A;  5LMU E;  4KHP I;  1FI4 A;  1KVK A;  2GS8 A;  4DV2 I;  3M6A A;  4YHH I;  5IT9 Q;  2A2D A;  2UXB I;  1ZM3 A;  4DPW A;  1XMQ I;  4UTG A;  4HAC B;  4DR7 E;  4NXN I;  4USM A;  4X64 E;  4JI1 I;  4JI6 I;  4JI1 E;  4X64 I;  4NXN E;  4DR7 I;  2HFU A;  1XMQ E;  4MYU A;  2WW4 A;  2XEX A;  3B82 A;  2UXB E;  1N34 I;  4YHH E;  2ZIT A;  4YY3 E;  4DV2 E;  4KHP E;  1VIS A;  5GMD A;  5LMU I;  2A2C A;  1PIE A;  1HNX I;  4DV5 E;  1Z0C A;  3LTO A;  4DV1 E;  2BM1 A;  2R3V A;  2F4V E;  4HAC A;  1HNZ I;  2X36 A;  4OX9 I;  4P52 A;  1Z59 A;  3WU4 A;  4LFC I;  3PYD A;  4DPX A;  1UEK A;  2ZM6 E;  3J80 Q;  5FLX Q;  1J5E E;  4JYA I;  1U2R A;  4WUD A;  2UXD I;  3OTO E;  5BR8 E;  4WUB A;  5LMN I;  4DR4 I;  4DR2 E;  2X7I A;  4I3H A;  1B63 A;  4USK A;  4GKK E;  4X65 I;  1S4E A;  3LPS A;  2CZ9 A;  4JI8 E;  4DUY I;  1RRE A;  3QT8 A;  4X65 E;  1PVG A;  4B3R I;  4EMD A;  4DR2 I;  1XMO I;  4B3M I;  1Z5C A;  4DR4 E;  2VQF E;  1IBL E;  2UXD E;  4DV7 E;  4JYA E;  1J5E I;  2ZM6 I;  4DV0 I;  1FNM A;  4WUC A;  1ELO A;  1D6T A;  3B78 A;  3B8H A;  4DV3 I;  4XTJ A;  2VQE E;  3D4J A;  1HNZ E;  2Q2E B;  4DV6 I;  4DV1 I;  4JI5 E;  2DEJ A;  4LF7 I;  4DU7 A;  1HNW I;  4KQV A;  1FJG E; 
#chains in the Genus database with same CATH topology
 4DV5 I;  4LCG A;  2JEB B;  1HNX E;  3ZZU A;  4QNJ A;  5C0X A;  4LFB I;  4FW7 A;  2GQ0 A;  4FWD A;  1VI7 A;  5C0X F;  5IWA I;  4YY3 I;  1KIJ A;  2V2Q A;  2OI2 A;  1YH8 A;  1N34 E;  2Z5B A;  4K0K I;  3ZKD A;  1I94 E;  2VES A;  1NZ0 A;  3J81 Q;  4OKG A;  5DRP A;  4MU3 A;  4MU1 A;  2WP8 A;  4JI7 I;  1H74 A;  2JEB A;  4JI6 E;  4B3S I;  4LPF A;  3ZZT A;  1N32 E;  1FWK A;  5DRO A;  5C0X B;  4NBQ A;  3P3E A;  1H73 A;  4LF5 I;  2V2V A;  2VF3 A;  4PRX A;  4MU4 A;  3J7A M;  2LJP A;  3J7A G;  4IFD D;  2UUA E;  2NN6 D;  1FWL A;  2WNR A;  4Z7C A;  1MX0 A;  1DAR A;  1Z0T A;  1N36 I;  1OJ4 A;  3H1C A;  4NXM E;  4GQU A;  2UXC I;  4FW4 A;  3ZZ0 A;  3V5R A;  4FW6 A;  3P06 A;  4GKJ I;  2F1D A;  4X66 E;  4PRV A;  3J81 C;  1XNR E;  2NN6 F;  4MDT A;  1EI1 A;  2ZBK B;  2Z5C B;  4UT4 A;  4IFD F;  1UDO A;  2E5L I;  1Y5Y A;  4HXZ A;  1ZM4 A;  4MQY A;  4LF8 I;  1N33 I;  3LNU A;  4OZE A;  4LF6 E;  1H7S A;  3Q1Q A;  2UUC I;  1ZXM A;  1FKA E;  1S16 A;  4Z7Y A;  4FWG A;  3CDJ A;  2V2Z A;  5GME A;  4BA1 A;  4FW5 A;  2PO0 B;  2HKJ A;  2UU9 I;  4JV5 E;  2WNR B;  4AQY E;  3CDI A;  1Y6Z A;  2C38 B;  5C0X C;  4DR6 I;  4IFD E;  5JEA C;  2BR2 B;  3HJC A;  5DNL A;  4FW9 A;  4IZK A;  4DR3 I;  4LF4 I;  4DV4 E;  3T1H I;  2BA0 G;  1Z5A A;  3PYF A;  1MU5 A;  1Z0E A;  4JI2 I;  4DUZ I;  4JI0 E;  1XNQ E;  1MG7 A;  3CWV A;  2DEI A;  1UDS A;  1XNQ I;  5K36 B;  2JE6 A;  3K1J A;  4JI0 I;  4DUZ E;  5EL9 A;  3GME A;  1H7U A;  4LF4 E;  4OO1 D;  5A2Q C;  2C38 A;  3M7N D;  2HFS A;  3GON A;  3NZK A;  1Z0G A;  5L3J A;  4ISA A;  1H72 C;  4LF9 I;  4JV5 I;  1IBM E;  1HR0 E;  1IBK E;  3PS1 A;  2J65 A;  3PYG A;  4DR1 E;  1Y4S A;  4X62 I;  2HHH I;  2V34 A;  2CGE A;  4R1F A;  3T1Y I;  4ZVI A;  4LFA I;  4LF6 I;  4B3T I;  4LF8 E;  2UUB I;  1ZXN A;  4JI4 I;  2JEA A;  1XNR I;  4URL A;  4IFD C;  4DR5 E;  1UDQ A;  2NN6 A;  3UHM A;  2C39 B;  3PS2 A;  4GKJ E;  4JI3 E;  4FWH A;  1P42 A;  2UXC E;  2BM0 A;  4BA1 B;  4NXM I;  1A6F A;  1N36 E;  5C0X E;  5JEA E;  3WU5 A;  3H4L A;  3J80 C;  3M85 D;  2V8P A;  2UUA I;  2BA0 D;  1RR9 A;  4DU8 A;  4J3D A;  1N0U A;  4M1K A;  5JEA F;  4LF5 E;  4OO1 A;  1BKN A;  3U1K A;  4RPF A;  2Z5E A;  1N32 I;  1ZM9 A;  4B3S E;  1K47 A;  3ZM7 A;  2WP8 B;  4JI7 E;  5DNX A;  2E1R A;  2PNZ B;  3K17 A;  4JI3 I;  4DR5 I;  1NHH A;  4JG4 A;  1HK7 A;  4JI4 E;  1OYP A;  1Z0W A;  1YHC A;  1I94 I;  2UUB E;  2O1U A;  4K0K E;  2JT2 A;  4B3T E;  4U3B A;  3JAM Q;  5IWA E;  4LFA E;  1EA6 A;  3T1Y E;  2HKE A;  4IS9 A;  2EFG A;  1B62 A;  1XHK A;  2HHH E;  4X62 E;  5IT9 C;  4LFB E;  4P7A A;  4DR1 I;  1Z5B A;  2NPF A;  3Q6M A;  4DPY A;  1Z0V A;  1IBK I;  2PO1 B;  5K36 D;  1HR0 I;  3KRN A;  1FJG I;  1IBM I;  3WU3 A;  3V2U C;  4DPT A;  1HNW E;  4LF9 E;  4LF7 E;  4JI5 I;  2PO2 B;  3GLL A;  4DV6 E;  3P3C A;  3L7Z A;  1NHJ A;  2VQE I;  4DV3 E;  3WU6 A;  2GO3 A;  2BV3 A;  4HYM A;  1Y4U A;  5JEA D;  3F0N A;  3QT6 A;  2AJ4 A;  4DV0 E;  5A2Q Q;  3QT5 A;  4AM3 A;  2J7K A;  2Z5C A;  4DV7 I;  4IZJ B;  1IBL I;  2VQF I;  4JI2 E;  5EKW A;  4B3M E;  1XMO E;  3T1H E;  2HK3 A;  4DV4 I;  4B3R E;  3ZKB A;  4DR3 E;  5FLX C;  3P76 A;  4DR6 E;  1PKP A;  4DUY E;  3QT7 A;  4JI8 I;  4LOM A;  4ED4 A;  4AQY I;  2C37 A;  2UU9 E;  1NHI A;  1Z0B A;  2R42 A;  3DD6 A;  2PO1 A;  4PU9 A;  4IZK B;  2C39 A;  4GKK I;  2IOP A;  4DXL A;  4HY1 A;  2C37 B;  1KKH A;  2JEA B;  2BR2 A;  3PYE A;  3JAM C;  5LMN E;  2PNZ A;  5LL6 R;  5BR8 I;  3OTO I;  4IFD B;  3M7N G;  2UUC E;  2NN6 B;  5K36 F;  1KTV A;  1N33 E;  5JEA A;  1ZM2 A;  1WUU A;  1R6M A;  2O1V A;  2HK2 A;  2E5L E;  4OO1 B;  3M85 G;  4OO1 E;  3B4T A;  4DPU A;  4LFC E;  4X66 I;  1N0V C;  4OX9 E;  2IER A;  2F4V I;  4OO1 C;  3HUL A;  5JEA B;  4MYT A;  4FN5 A;  1QZR A;  5LMU E;  4KHP I;  5K36 A;  1FI4 A;  1KVK A;  2GS8 A;  4DV2 I;  3M6A A;  4YHH I;  2BA1 G;  5IT9 Q;  2A2D A;  2UXB I;  1ZM3 A;  4MU0 A;  4DPW A;  1XMQ I;  4UTG A;  4HAC B;  4DR7 E;  1USV A;  4NXN I;  4USM A;  4X64 E;  4JI1 I;  4JI6 I;  5DRQ A;  4JI1 E;  4X64 I;  2O1W A;  4NXN E;  1R6L A;  4DR7 I;  2HFU A;  1XMQ E;  4MYU A;  2WW4 A;  2XEX A;  3B82 A;  2UXB E;  1N34 I;  4YHH E;  2ZIT A;  4YY3 E;  4DV2 E;  2O1T A;  3Q6N A;  3L7Z B;  4KHP E;  1USU A;  1VIS A;  2PO2 A;  5GMD A;  5LMU I;  5ELW A;  2IOQ A;  2A2C A;  2JE6 B;  1PIE A;  1HNX I;  1UDN A;  4DV5 E;  1Z0C A;  3LTO A;  1OYS A;  4DV1 E;  1Y60 A;  2BM1 A;  2R3V A;  2F4V E;  4HAC A;  5K36 C;  1HNZ I;  3P3G A;  2X36 A;  4OX9 I;  2PNL A;  1Z59 A;  3PRY A;  3HKM A;  4P52 A;  3WU4 A;  4LFC I;  3PYD A;  5C0X D;  4BA2 B;  2O3Z A;  2BA1 D;  2GO4 A;  4DPX A;  1UEK A;  2ZM6 E;  3J80 Q;  4LCH A;  5FLX Q;  1E3H A;  4FW3 A;  4OO1 F;  1J5E E;  4JYA I;  1U2R A;  3GCM A;  4WUD A;  2UXD I;  3OTO E;  5BR8 E;  4WUB A;  5LMN I;  4DR4 I;  1RHY A;  2X7I A;  4DR2 E;  4I3H A;  1B63 A;  1E3P A;  4USK A;  4GKK E;  4X65 I;  2PO0 A;  1S4E A;  1XXE A;  3LPS A;  5DRR A;  4BA2 A;  2CZ9 A;  4JI8 E;  4DUY I;  1RRE A;  3QT8 A;  1OYR A;  2CG9 A;  4X65 E;  1PVG A;  4B3R I;  4IZJ A;  4EMD A;  4DR2 I;  1XMO I;  4LCF A;  1Z5C A;  4B3M I;  4DR4 E;  2VQF E;  1IBL E;  2UXD E;  4DV7 E;  2Z5B B;  4JYA E;  1J5E I;  5FWK A;  4IZJ D;  2CVE A;  2ZM6 I;  2PNM A;  4DV0 I;  1FNM A;  2AE8 A;  2NN6 C;  4IFD A;  4WUC A;  1ELO A;  5K36 E;  1D6T A;  3B78 A;  4AIM A;  4AID A;  3B8H A;  4QNK A;  4XTJ A;  4DV3 I;  2VQE E;  3D4J A;  2NN6 E;  4U3D A;  1HNZ E;  2Q2E B;  4DV6 I;  4N3O A;  4DV1 I;  4JI5 E;  2DEJ A;  2IES A;  4DU7 A;  4LF7 I;  1HNW I;  3U1Y A;  3PS3 A;  4KQV A;  3K85 A;  1FJG E; 
#chains in the Genus database with same CATH homology
 4DV5 I;  1HNX E;  3ZZU A;  4LFB I;  2GQ0 A;  4FWD A;  5IWA I;  4YY3 I;  1KIJ A;  2V2Q A;  2OI2 A;  1N34 E;  2Z5B A;  4K0K I;  3ZKD A;  1I94 E;  1NZ0 A;  3J81 Q;  4JI7 I;  1H74 A;  4JI6 E;  4B3S I;  3ZZT A;  1N32 E;  1FWK A;  1H73 A;  4LF5 I;  2V2V A;  2VF3 A;  4PRX A;  3J7A M;  2LJP A;  3J7A G;  2UUA E;  1FWL A;  4Z7C A;  1MX0 A;  1DAR A;  1Z0T A;  1N36 I;  1OJ4 A;  4NXM E;  2UXC I;  3ZZ0 A;  3V5R A;  3P06 A;  4GKJ I;  4X66 E;  4PRV A;  3J81 C;  1XNR E;  1EI1 A;  2ZBK B;  2Z5C B;  4UT4 A;  2E5L I;  4HXZ A;  1ZM4 A;  4LF8 I;  1N33 I;  3LNU A;  4LF6 E;  1H7S A;  3Q1Q A;  2UUC I;  1ZXM A;  1FKA E;  1S16 A;  4Z7Y A;  4FWG A;  2V2Z A;  5GME A;  2HKJ A;  2UU9 I;  4JV5 E;  4AQY E;  1Y6Z A;  4DR6 I;  3HJC A;  4FW9 A;  4IZK A;  4DR3 I;  4LF4 I;  4DV4 E;  3T1H I;  1Z5A A;  3PYF A;  1MU5 A;  1Z0E A;  4JI2 I;  4DUZ I;  4JI0 E;  1XNQ E;  1MG7 A;  3CWV A;  2DEI A;  1XNQ I;  4JI0 I;  3K1J A;  4DUZ E;  1H7U A;  4LF4 E;  5A2Q C;  2HFS A;  3GON A;  1Z0G A;  5L3J A;  1H72 C;  4LF9 I;  4JV5 I;  1IBM E;  1HR0 E;  1IBK E;  3PYG A;  4DR1 E;  1Y4S A;  4X62 I;  2HHH I;  2V34 A;  2CGE A;  4R1F A;  3T1Y I;  4ZVI A;  4LFA I;  4LF6 I;  4B3T I;  4LF8 E;  2UUB I;  1ZXN A;  4JI4 I;  1XNR I;  4URL A;  4DR5 E;  4GKJ E;  4JI3 E;  4FWH A;  2UXC E;  2BM0 A;  4NXM I;  1A6F A;  1N36 E;  3WU5 A;  3H4L A;  3J80 C;  2V8P A;  2UUA I;  1RR9 A;  4DU8 A;  1N0U A;  4M1K A;  4LF5 E;  1BKN A;  4RPF A;  2Z5E A;  1N32 I;  1ZM9 A;  4B3S E;  1K47 A;  3ZM7 A;  4JI7 E;  2E1R A;  3K17 A;  4JI3 I;  4DR5 I;  1NHH A;  4JG4 A;  1HK7 A;  4JI4 E;  1Z0W A;  1I94 I;  2UUB E;  2O1U A;  4K0K E;  4B3T E;  3JAM Q;  5IWA E;  4LFA E;  1EA6 A;  3T1Y E;  2HKE A;  2EFG A;  1B62 A;  1XHK A;  2HHH E;  4X62 E;  5IT9 C;  4LFB E;  4P7A A;  4DR1 I;  1Z5B A;  2NPF A;  3Q6M A;  4DPY A;  1Z0V A;  1IBK I;  1HR0 I;  1FJG I;  1IBM I;  3WU3 A;  3V2U C;  4DPT A;  1HNW E;  4LF9 E;  4LF7 E;  4JI5 I;  4DV6 E;  1NHJ A;  2VQE I;  4DV3 E;  3WU6 A;  2BV3 A;  4HYM A;  1Y4U A;  3F0N A;  3QT6 A;  2AJ4 A;  4DV0 E;  5A2Q Q;  3QT5 A;  2J7K A;  2Z5C A;  4DV7 I;  4IZJ B;  1IBL I;  2VQF I;  4JI2 E;  4B3M E;  1XMO E;  3T1H E;  2HK3 A;  4DV4 I;  4B3R E;  3ZKB A;  4DR3 E;  5FLX C;  4DR6 E;  1PKP A;  4DUY E;  3QT7 A;  4JI8 I;  4ED4 A;  4AQY I;  2UU9 E;  1NHI A;  1Z0B A;  2R42 A;  4PU9 A;  4IZK B;  4GKK I;  2IOP A;  4DXL A;  4HY1 A;  1KKH A;  3PYE A;  3JAM C;  5LMN E;  5LL6 R;  5BR8 I;  3OTO I;  2UUC E;  1KTV A;  1N33 E;  1ZM2 A;  1WUU A;  2O1V A;  2E5L E;  2HK2 A;  4DPU A;  4LFC E;  4X66 I;  1N0V C;  4OX9 E;  2F4V I;  3HUL A;  4MYT A;  4FN5 A;  1QZR A;  5LMU E;  4KHP I;  1FI4 A;  1KVK A;  2GS8 A;  4DV2 I;  3M6A A;  4YHH I;  5IT9 Q;  2A2D A;  2UXB I;  1ZM3 A;  4DPW A;  1XMQ I;  4UTG A;  4HAC B;  4DR7 E;  1USV A;  4NXN I;  4USM A;  4X64 E;  4JI1 I;  4JI6 I;  4JI1 E;  4X64 I;  2O1W A;  4NXN E;  4DR7 I;  2HFU A;  1XMQ E;  4MYU A;  2WW4 A;  2XEX A;  3B82 A;  2UXB E;  1N34 I;  4YHH E;  2ZIT A;  4YY3 E;  4DV2 E;  2O1T A;  3Q6N A;  4KHP E;  1USU A;  1VIS A;  5GMD A;  5LMU I;  2IOQ A;  2A2C A;  1PIE A;  1HNX I;  4DV5 E;  1Z0C A;  3LTO A;  4DV1 E;  2BM1 A;  2R3V A;  2F4V E;  4HAC A;  1HNZ I;  2X36 A;  4OX9 I;  2PNL A;  1Z59 A;  3PRY A;  4P52 A;  4LFC I;  3WU4 A;  3PYD A;  4DPX A;  1UEK A;  2ZM6 E;  3J80 Q;  5FLX Q;  1J5E E;  4JYA I;  1U2R A;  4WUD A;  2UXD I;  3OTO E;  5BR8 E;  4WUB A;  5LMN I;  4DR4 I;  4DR2 E;  2X7I A;  4I3H A;  1B63 A;  4USK A;  4GKK E;  4X65 I;  1S4E A;  3LPS A;  2CZ9 A;  4JI8 E;  4DUY I;  1RRE A;  3QT8 A;  2CG9 A;  4X65 E;  1PVG A;  4B3R I;  4IZJ A;  4EMD A;  4DR2 I;  1XMO I;  4B3M I;  1Z5C A;  4DR4 E;  2VQF E;  1IBL E;  2UXD E;  4DV7 E;  2Z5B B;  4JYA E;  1J5E I;  5FWK A;  4IZJ D;  2ZM6 I;  2PNM A;  4DV0 I;  1FNM A;  4WUC A;  1ELO A;  1D6T A;  3B78 A;  3B8H A;  4DV3 I;  4XTJ A;  2VQE E;  3D4J A;  1HNZ E;  2Q2E B;  4DV6 I;  4N3O A;  4DV1 I;  4JI5 E;  4DU7 A;  2DEJ A;  4LF7 I;  1HNW I;  4KQV A;  3K85 A;  1FJG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...