4JI0I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji0I00
5FLXC 4JI8E 1OJ4A 4FWHA 1N32E 4K0KE 3ZZTA 4LF6E 5BR8E 2ZM6I 4JG4A 4DV0I 3QT5A 4UT4A 1NHJA 3ZKDA 1N33E 3J80C 1N0UA 4JYAI 4DPWA 1FI4A 1S4EA 4GKJE 4DV1I 1PVGA 4JI4E 2ZM6E 4DUZI 5IT9C 4LFAI 4DV2I 2BM1A 2UXBI 4JI0I 4LF7I 3LPSA 4LF8E 4JV5I 1HNXE 4JYAE 2V2VA 1WUUA 4USKA 4DR3E 2AJ4A 4DV1E 4DUZE 2UXDI 4LFAE 4DV2E 1S16A 1NHHA 1HNWE 2X7IA 4LF7E 4HACB 1FWLA 2V2QA 2UUAI 1PIEA 3V5RA 1RREA 4GKKE 3LTOA 4DR5I 1I94I 1XMQI 1IBMI 4DU8A 3OTOE 1N36I 5GMEA 1A6FA 4DV5I 5LMUI 4NXNI 3B82A 2WW4A 1HNZE 5A2QQ 4DPYA 3PYEA 1Z59A 2HHHE 2CZ9A 3T1HI 1I94E 4B3SI 1Z0EA 5LL6R 1IBME 1N36E 4KHPI 5IT9Q 4JI3I 3K1JA 4DR6I 4NXMI 3WU3A 4NXNE 4LF9I 4DR2I 2R3VA 4JI5I 2HK2A 3WU4A 1XNRE 1ZM9A 4B3TE 3J81Q 1FJGE 4URLA 5L3JA 2UU9E 4DR4I 1EI1A 1DARA 1RR9A 2F4VE 4WUBA 4DV6E 1HR0E 3QT8A 1H74A 4KHPE 5A2QC 4USMA 4DV3I 4EMDA 1N34I 1Z0WA 2VQEI 4B3MI 4YHHI 2HKEA 4JI5E 2HK3A 1B62A 4FN5A 4KQVA 4DV0E 4DR1I 1FKAE 1ELOA 4DV7I 2BM0A 3ZZ0A 2ZBKB 4OX9I 1ZM2A 3B78A 4DR4E 2E5LI 1H7SA 1BKNA 3HULA 1QZRA 2NPFA 2VF3A 3M6AA 4P52A 2V8PA 3J81C 3QT6A 4X62I 2X36A 2Q2EB 1N34E 2UXCI 4B3ME 4AQYI 4DR1E 4DV7E 4OX9E 4DUYI 3JAMC 4HACA 4FW9A 4RPFA 1IBLI 2UXBE 3GONA 1D6TA 4JI0E 4B3RI 4JV5E 1KTVA 4MYTA 2UXCE 3T1YI 1XNQI 2A2CA 1IBKI 4YY3I 4AQYE 2UXDE 4FWDA 4Z7CA 2BV3A 3D4JA 4DUYE 2HFSA 1H7UA 1J5EI 4B3RE 4LF5I 2UUCI 4R1FA 2UUAE 5GMDA 3T1YE 1XNQE 1Z5BA 1VISA 4YY3E 1XMOI 1H72C 4DR5E 5LMNI 1N0VC 2J7KA 2DEIA 4X66I 1XMQE 1UEKA 3J7AG 1MU5A 4LF4I 1PKPA 4DR7I 2GS8A 4LF5E 2UUCE 4PRVA 1ZM3A 2V2ZA 4M1KA 4DV5E 5LMUE 1KIJA 4Z7YA 4LF6I 1FWKA 2V34A 2LJPA 3WU5A 1ZM4A 4DU7A 1XMOE 4X65I 1N33I 3QT7A 3T1HE 4XTJA 4B3SE 1Z5AA 1XHKA 4LF4E 4WUCA 4DR7E 4JI3E 1Z0VA 4GKJI 4DR6E 4NXME 3PYDA 1FNMA 3JAMQ 4JI4I 4LF9E 2E1RA 4DR2E 1B63A 1Z0CA 4X65E 4JI6I 5IWAI 4ED4A 4LF8I 1HNXI 4P7AA 1Z0BA 4DR3I 4DV3E 1ZXMA 3WU6A 4JI1I 2UUBI 4JI7I 4DV4I 1NZ0A 2VQEE 4YHHE 3K17A 4X64I 4JI6E 5IWAE 1HNWI 2E5LE 2XEXA 4LFBI 4FWGA 1KVKA 1Z5CA 4JI1E 2UUBE 4ZVIA 4JI7E 4X62E 4DPUA 4DV4E 2DEJA 1Z0TA 1K47A 4GKKI 2ZITA 1MX0A 4I3HA 3F0NA 4X64E 3OTOI 1KKHA 2A2DA 4LFBE 1U2RA 3ZKBA 1IBLE 4DPXA 3Q1QA 3H4LA 4HYMA 1EA6A 3LNUA 2VQFI 1HNZI 3CWVA 3ZZUA 4LFCI 5FLXQ 2HHHI 3ZM7A 2EFGA 1MG7A 3PYGA 1IBKE 4JI2I 2OI2A 4MYUA 4PU9A 2HKJA 4JI8I 1N32I 1J5EE 3J7AM 4HY1A 4UTGA 2VQFE 4K0KI 2R42A 3V2UC 4DPTA 4HXZA 5BR8I 1ZXNA 4LFCE 1XNRI 3J80Q 4B3TI 2HFUA 4WUDA 1FJGI 3B8HA 4JI2E 2UU9I 1Z0GA 2F4VI 3PYFA 1NHIA 4DV6I 1HR0I 1H73A 5LMNE 4X66E 4PRXA 4DXLA
chains in the Genus database with same CATH superfamily
5FLXC 4JI8E 1OJ4A 4FWHA 1N32E 1UDSA 4K0KE 1VI7A 3ZZTA 4LF6E 3U1KA 5BR8E 2ZM6I 5ELWA 4JG4A 4DV0I 3QT5A 4UT4A 2IESA 1NHJA 2BA1D 1YHCA 3ZKDA 1N33E 1UDNA 3M7NG 3KRNA 3P76A 4LCFA 1N0UA 3J80C 4JYAI 4DPWA 3M85D 1FI4A 1S4EA 4GKJE 2C38A 5K36A 2CG9A 4DV1I 1PVGA 4JI4E 2ZM6E 2C38B 4DUZI 5IT9C 5K36B 1OYPA 4LFAI 1OYRA 4DV2I 1Y4SA 2C37A 2BM1A 5EL9A 3PS3A 2UXBI 4JI0I 4LF7I 2C37B 3LPSA 4LF8E 4JV5I 1HNXE 4JYAE 2V2VA 1WUUA 4USKA 4DR3E 2AJ4A 4DV1E 4DUZE 2UXDI 5DROA 4LFAE 2O3ZA 2GO4A 5C0XD 4DV2E 1S16A 2JE6A 1NHHA 1HNWE 2X7IA 3HKMA 2JE6B 2NN6F 4LF7E 4HACB 1FWLA 1RHYA 2V2QA 4BA2B 2UUAI 1PIEA 4NBQA 2F1DA 3P3CA 3V5RA 4IFDA 1RREA 4GKKE 1YH8A 4IFDB 4LPFA 3LTOA 4DR5I 1I94I 3UHMA 5JEAA 1XMQI 1IBMI 4DU8A 3OTOE 1N36I 5GMEA 1A6FA 4DV5I 2CVEA 5LMUI 4NXNI 2PNZB 3B82A 2WW4A 5JEAD 1HNZE 5A2QQ 3B4TA 4DPYA 3PYEA 1Z59A 2HHHE 5DNXA 2CZ9A 3GMEA 4MU0A 3T1HI 1I94E 4B3SI 1Z0EA 5LL6R 1IBME 1N36E 4KHPI 5IT9Q 4JI3I 4OO1D 2BA0D 5DRQA 3K1JA 4DR6I 4NXMI 3WU3A 2JT2A 4NXNE 4LF9I 4DR2I 4FW6A 1Y6ZA 2R3VA 4JI5I 2NN6E 2O1TA 2HK2A 5DRRA 3WU4A 1XNRE 1ZM9A 4B3TE 3J81Q 2Z5CA 1FJGE 4URLA 2PO1A 5L3JA 2UU9E 4DR4I 1EI1A 3P3GA 1DARA 1RR9A 2Z5CB 4LOMA 4WUBA 4DV6E 2PO1B 2F4VE 1HR0E 3QT8A 1H74A 2VESA 5C0XF 4KHPE 5A2QC 3K85A 4USMA 2NN6C 4DV3I 4EMDA 1N34I 1Z0WA 2VQEI 4B3MI 4YHHI 2HKEA 4JI5E 2HK3A 2JEBA 1B62A 3Q6MA 4FN5A 4KQVA 4DV0E 4DR1I 1FKAE 2JEBB 4LCHA 1ELOA 3P06A 2WP8A 4DV7I 2BM0A 4IZJA 3ZZ0A 2ZBKB 4MQYA 1ZM2A 4OX9I 2CGEA 4J3DA 2AE8A 3B78A 4LCGA 2E5LI 2BR2A 4DR4E 1H7SA 4U3BA 2WP8B 4IZJB 1BKNA 5K36D 3HULA 2BR2B 4AIDA 5DNLA 1QZRA 2BA1G 3GLLA 2NPFA 2JEAB 2VF3A 3M6AA 4P52A 2GO3A 2V8PA 3QT6A 4X62I 1UDQA 2PO0A 2X36A 3J81C 2Q2EB 1N34E 2UXCI 4B3ME 2PO0B 4AQYI 4DR1E 5JEAF 1UDOA 3M85G 4DV7E 4OX9E 2PNLA 2GQ0A 3JAMC 4DUYI 4HACA 4GQUA 4FW9A 4RPFA 3U1YA 2Z5EA 1IBLI 2UXBE 3GONA 1D6TA 4AM3A 4JI0E 4BA2A 4B3RI 2PO2A 4JV5E 2C39A 1KTVA 2PO2B 4MYTA 4OO1F 2UXCE 2C39B 3T1YI 1XNQI 2A2CA 1IBKI 4YY3I 4AQYE 2UXDE 4N3OA 4FWDA 2WNRA 4Z7CA 2BV3A 3CDJA 3D4JA 4DUYE 2WNRB 4IFDD 2HFSA 1H7UA 4U3DA 1J5EI 2PNZA 3H1CA 4B3RE 4LF5I 5C0XC 2UUCI 3PS2A 4R1FA 2J65A 2UUAE 5GMDA 3T1YE 1XNQE 1Z5BA 1VISA 4YY3E 1XMOI 1USUA 5DRPA 1H72C 5EKWA 4DR5E 5LMNI 1N0VC 2J7KA 2DEIA 4X66I 1E3HA 1XMQE 1UEKA 3Q6NA 4MU1A 3J7AG 1MU5A 4LF4I 1PKPA 4DR7I 2NN6A 2GS8A 5FWKA 4LF5E 2UUCE 4PRVA 1XXEA 1ZM3A 2V2ZA 4M1KA 4DV5E 4ISAA 2NN6B 5LMUE 5K36F 1KIJA 4Z7YA 4LF6I 3M7ND 1FWKA 2V34A 2LJPA 3WU5A 4IZKA 1ZM4A 4OZEA 4DU7A 1XMOE 4X65I 1N33I 3QT7A 3T1HE 4IZKB 4XTJA 5JEAC 4MDTA 4B3SE 1Z5AA 1XHKA 4AIMA 4LF4E 3PS1A 4WUCA 2O1WA 4DR7E 4JI3E 1Z0VA 4GKJI 4DR6E 4NXME 3PYDA 1FNMA 3JAMQ 4JI4I 4LF9E 2E1RA 4DR2E 4OO1C 1P42A 4FW3A 2BA0G 1B63A 1Z0CA 4X65E 4JI6I 5IWAI 4ED4A 2Z5BA 4LF8I 1Y5YA 2JEAA 2Z5BB 1HNXI 4P7AA 4FW7A 1Z0BA 4DR3I 4DV3E 1USVA 1ZXMA 3WU6A 4JI1I 3HJCA 4IZJD 2UUBI 4JI7I 4IFDF 4DV4I 1NZ0A 2VQEE 4YHHE 3K17A 2O1UA 1R6LA 1OYSA 5K36E 4X64I 4JI6E 1HK7A 5IWAE 1HNWI 4OKGA 3L7ZA 2E5LE 1R6MA 2XEXA 4IS9A 4LFBI 2IOPA 3GCMA 4FWGA 3L7ZB 5C0XA 3CDIA 4BA1A 2PNMA 3DD6A 1KVKA 5C0XB 1Z5CA 4FW4A 4JI1E 2UUBE 4ZVIA 4JI7E 4BA1B 4X62E 4DPUA 4DV4E 2DEJA 5K36C 1Z0TA 1K47A 4GKKI 5C0XE 2ZITA 1MX0A 4I3HA 4MU3A 3F0NA 4X64E 2IOQA 4QNKA 3OTOI 1KKHA 2A2DA 4LFBE 1U2RA 3ZKBA 1IBLE 4DPXA 3Q1QA 3H4LA 4HYMA 1EA6A 3LNUA 2VQFI 1HNZI 4QNJA 3CWVA 3ZZUA 4LFCI 5FLXQ 2HHHI 3ZM7A 2IERA 2EFGA 1MG7A 3PYGA 1IBKE 4JI2I 3P3EA 3PRYA 4IFDE 2O1VA 3NZKA 2OI2A 4MYUA 4MU4A 5JEAB 4FW5A 4PU9A 2HKJA 4JI8I 1N32I 1J5EE 3J7AM 5JEAE 4HY1A 4UTGA 1E3PA 2VQFE 4K0KI 2R42A 3V2UC 4DPTA 4HXZA 5BR8I 1ZXNA 4OO1A 4LFCE 1XNRI 4IFDC 3J80Q 4B3TI 2HFUA 4WUDA 1FJGI 4OO1B 3B8HA 2NN6D 4JI2E 1Y4UA 2UU9I 1Z0GA 2F4VI 3PYFA 1NHIA 4DV6I 1Y60A 1H73A 1HR0I 5LMNE 4OO1E 4X66E 4PRXA 4DXLA
chains in the Genus database with same CATH topology
5FLXC 4JI8E 1OJ4A 4FWHA 1N32E 4K0KE 3ZZTA 4LF6E 5BR8E 2ZM6I 4JG4A 4DV0I 3QT5A 4UT4A 1NHJA 3ZKDA 1N33E 3J80C 1N0UA 4JYAI 4DPWA 1FI4A 1S4EA 4GKJE 2CG9A 4DV1I 1PVGA 4JI4E 2ZM6E 4DUZI 5IT9C 4LFAI 4DV2I 1Y4SA 2BM1A 2UXBI 4JI0I 4LF7I 3LPSA 4LF8E 4JV5I 1HNXE 4JYAE 2V2VA 1WUUA 4USKA 4DR3E 2AJ4A 4DV1E 4DUZE 2UXDI 4LFAE 4DV2E 1S16A 1NHHA 1HNWE 2X7IA 4LF7E 4HACB 1FWLA 2V2QA 2UUAI 1PIEA 3V5RA 1RREA 4GKKE 3LTOA 4DR5I 1I94I 1XMQI 1IBMI 4DU8A 3OTOE 1N36I 5GMEA 1A6FA 4DV5I 5LMUI 4NXNI 3B82A 2WW4A 1HNZE 5A2QQ 4DPYA 3PYEA 1Z59A 2HHHE 2CZ9A 3T1HI 1I94E 4B3SI 1Z0EA 5LL6R 1IBME 1N36E 4KHPI 5IT9Q 4JI3I 3K1JA 4DR6I 4NXMI 3WU3A 4NXNE 4LF9I 4DR2I 1Y6ZA 2R3VA 4JI5I 2O1TA 2HK2A 3WU4A 1XNRE 1ZM9A 4B3TE 3J81Q 2Z5CA 1FJGE 4URLA 5L3JA 2UU9E 4DR4I 1EI1A 1DARA 1RR9A 2Z5CB 2F4VE 4WUBA 4DV6E 1HR0E 3QT8A 1H74A 4KHPE 5A2QC 3K85A 4USMA 4DV3I 4EMDA 1N34I 1Z0WA 2VQEI 4B3MI 4YHHI 2HKEA 4JI5E 2HK3A 1B62A 3Q6MA 4FN5A 4KQVA 4DV0E 4DR1I 1FKAE 1ELOA 3P06A 4DV7I 2BM0A 4IZJA 3ZZ0A 2ZBKB 4OX9I 1ZM2A 2CGEA 3B78A 4DR4E 2E5LI 1H7SA 4IZJB 1BKNA 3HULA 1QZRA 2NPFA 2VF3A 3M6AA 4P52A 2V8PA 3J81C 3QT6A 4X62I 2X36A 2Q2EB 1N34E 2UXCI 4B3ME 4AQYI 4DR1E 4DV7E 4OX9E 2PNLA 2GQ0A 3JAMC 4DUYI 4HACA 4FW9A 4RPFA 2Z5EA 1IBLI 2UXBE 3GONA 1D6TA 4JI0E 4B3RI 4JV5E 1KTVA 4MYTA 2UXCE 3T1YI 1XNQI 2A2CA 1IBKI 4YY3I 4AQYE 2UXDE 4N3OA 4FWDA 4Z7CA 2BV3A 3D4JA 4DUYE 2HFSA 1H7UA 1J5EI 4B3RE 4LF5I 2UUCI 4R1FA 2UUAE 5GMDA 3T1YE 1XNQE 1Z5BA 1VISA 4YY3E 1XMOI 1USUA 1H72C 4DR5E 5LMNI 1N0VC 2J7KA 2DEIA 4X66I 1XMQE 1UEKA 3Q6NA 3J7AG 1MU5A 4LF4I 1PKPA 4DR7I 2GS8A 5FWKA 4LF5E 2UUCE 4PRVA 1ZM3A 2V2ZA 4M1KA 4DV5E 5LMUE 1KIJA 4Z7YA 4LF6I 1FWKA 2V34A 2LJPA 3WU5A 4IZKA 1ZM4A 4DU7A 1XMOE 4X65I 1N33I 3QT7A 3T1HE 4IZKB 4XTJA 4B3SE 1Z5AA 1XHKA 4LF4E 4WUCA 2O1WA 4DR7E 4JI3E 1Z0VA 4GKJI 4DR6E 4NXME 3PYDA 1FNMA 3JAMQ 4JI4I 4LF9E 2E1RA 4DR2E 1B63A 1Z0CA 4X65E 4JI6I 5IWAI 4ED4A 2Z5BA 4LF8I 2Z5BB 1HNXI 4P7AA 1Z0BA 4DR3I 4DV3E 1USVA 1ZXMA 3WU6A 4JI1I 3HJCA 4IZJD 2UUBI 4JI7I 4DV4I 1NZ0A 2VQEE 4YHHE 3K17A 2O1UA 4X64I 4JI6E 1HK7A 5IWAE 1HNWI 2E5LE 2XEXA 4LFBI 2IOPA 4FWGA 2PNMA 1KVKA 1Z5CA 4JI1E 2UUBE 4ZVIA 4JI7E 4X62E 4DPUA 4DV4E 2DEJA 1Z0TA 1K47A 4GKKI 2ZITA 1MX0A 4I3HA 3F0NA 4X64E 2IOQA 3OTOI 1KKHA 2A2DA 4LFBE 1U2RA 3ZKBA 1IBLE 4DPXA 3Q1QA 3H4LA 4HYMA 1EA6A 3LNUA 2VQFI 1HNZI 3CWVA 3ZZUA 4LFCI 5FLXQ 2HHHI 3ZM7A 2EFGA 1MG7A 3PYGA 1IBKE 4JI2I 3PRYA 2O1VA 2OI2A 4MYUA 4PU9A 2HKJA 4JI8I 1N32I 1J5EE 3J7AM 4HY1A 4UTGA 2VQFE 4K0KI 2R42A 3V2UC 4DPTA 4HXZA 5BR8I 1ZXNA 4LFCE 1XNRI 3J80Q 4B3TI 2HFUA 4WUDA 1FJGI 3B8HA 4JI2E 1Y4UA 2UU9I 1Z0GA 2F4VI 3PYFA 1NHIA 4DV6I 1HR0I 1H73A 5LMNE 4X66E 4PRXA 4DXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX C;  4JI8 E;  1OJ4 A;  4FWH A;  1N32 E;  4K0K E;  3ZZT A;  4LF6 E;  5BR8 E;  2ZM6 I;  4JG4 A;  4DV0 I;  3QT5 A;  4UT4 A;  1NHJ A;  3ZKD A;  1N33 E;  3J80 C;  1N0U A;  4JYA I;  4DPW A;  1FI4 A;  1S4E A;  4GKJ E;  4DV1 I;  1PVG A;  4JI4 E;  2ZM6 E;  4DUZ I;  5IT9 C;  4LFA I;  4DV2 I;  2BM1 A;  2UXB I;  4JI0 I;  4LF7 I;  3LPS A;  4LF8 E;  4JV5 I;  1HNX E;  4JYA E;  2V2V A;  1WUU A;  4USK A;  4DR3 E;  2AJ4 A;  4DV1 E;  4DUZ E;  2UXD I;  4LFA E;  4DV2 E;  1S16 A;  1NHH A;  1HNW E;  2X7I A;  4LF7 E;  4HAC B;  1FWL A;  2V2Q A;  2UUA I;  1PIE A;  3V5R A;  1RRE A;  4GKK E;  3LTO A;  4DR5 I;  1I94 I;  1XMQ I;  1IBM I;  4DU8 A;  3OTO E;  1N36 I;  5GME A;  1A6F A;  4DV5 I;  5LMU I;  4NXN I;  3B82 A;  2WW4 A;  1HNZ E;  5A2Q Q;  4DPY A;  3PYE A;  1Z59 A;  2HHH E;  2CZ9 A;  3T1H I;  1I94 E;  4B3S I;  1Z0E A;  5LL6 R;  1IBM E;  1N36 E;  4KHP I;  5IT9 Q;  4JI3 I;  3K1J A;  4DR6 I;  4NXM I;  3WU3 A;  4NXN E;  4LF9 I;  4DR2 I;  2R3V A;  4JI5 I;  2HK2 A;  3WU4 A;  1XNR E;  1ZM9 A;  4B3T E;  3J81 Q;  1FJG E;  4URL A;  5L3J A;  2UU9 E;  4DR4 I;  1EI1 A;  1DAR A;  1RR9 A;  2F4V E;  4WUB A;  4DV6 E;  1HR0 E;  3QT8 A;  1H74 A;  4KHP E;  5A2Q C;  4USM A;  4DV3 I;  4EMD A;  1N34 I;  1Z0W A;  2VQE I;  4B3M I;  4YHH I;  2HKE A;  4JI5 E;  2HK3 A;  1B62 A;  4FN5 A;  4KQV A;  4DV0 E;  4DR1 I;  1FKA E;  1ELO A;  4DV7 I;  2BM0 A;  3ZZ0 A;  2ZBK B;  4OX9 I;  1ZM2 A;  3B78 A;  4DR4 E;  2E5L I;  1H7S A;  1BKN A;  3HUL A;  1QZR A;  2NPF A;  2VF3 A;  3M6A A;  4P52 A;  2V8P A;  3J81 C;  3QT6 A;  4X62 I;  2X36 A;  2Q2E B;  1N34 E;  2UXC I;  4B3M E;  4AQY I;  4DR1 E;  4DV7 E;  4OX9 E;  4DUY I;  3JAM C;  4HAC A;  4FW9 A;  4RPF A;  1IBL I;  2UXB E;  3GON A;  1D6T A;  4JI0 E;  4B3R I;  4JV5 E;  1KTV A;  4MYT A;  2UXC E;  3T1Y I;  1XNQ I;  2A2C A;  1IBK I;  4YY3 I;  4AQY E;  2UXD E;  4FWD A;  4Z7C A;  2BV3 A;  3D4J A;  4DUY E;  2HFS A;  1H7U A;  1J5E I;  4B3R E;  4LF5 I;  2UUC I;  4R1F A;  2UUA E;  5GMD A;  3T1Y E;  1XNQ E;  1Z5B A;  1VIS A;  4YY3 E;  1XMO I;  1H72 C;  4DR5 E;  5LMN I;  1N0V C;  2J7K A;  2DEI A;  4X66 I;  1XMQ E;  1UEK A;  3J7A G;  1MU5 A;  4LF4 I;  1PKP A;  4DR7 I;  2GS8 A;  4LF5 E;  2UUC E;  4PRV A;  1ZM3 A;  2V2Z A;  4M1K A;  4DV5 E;  5LMU E;  1KIJ A;  4Z7Y A;  4LF6 I;  1FWK A;  2V34 A;  2LJP A;  3WU5 A;  1ZM4 A;  4DU7 A;  1XMO E;  4X65 I;  1N33 I;  3QT7 A;  3T1H E;  4XTJ A;  4B3S E;  1Z5A A;  1XHK A;  4LF4 E;  4WUC A;  4DR7 E;  4JI3 E;  1Z0V A;  4GKJ I;  4DR6 E;  4NXM E;  3PYD A;  1FNM A;  3JAM Q;  4JI4 I;  4LF9 E;  2E1R A;  4DR2 E;  1B63 A;  1Z0C A;  4X65 E;  4JI6 I;  5IWA I;  4ED4 A;  4LF8 I;  1HNX I;  4P7A A;  1Z0B A;  4DR3 I;  4DV3 E;  1ZXM A;  3WU6 A;  4JI1 I;  2UUB I;  4JI7 I;  4DV4 I;  1NZ0 A;  2VQE E;  4YHH E;  3K17 A;  4X64 I;  4JI6 E;  5IWA E;  1HNW I;  2E5L E;  2XEX A;  4LFB I;  4FWG A;  1KVK A;  1Z5C A;  4JI1 E;  2UUB E;  4ZVI A;  4JI7 E;  4X62 E;  4DPU A;  4DV4 E;  2DEJ A;  1Z0T A;  1K47 A;  4GKK I;  2ZIT A;  1MX0 A;  4I3H A;  3F0N A;  4X64 E;  3OTO I;  1KKH A;  2A2D A;  4LFB E;  1U2R A;  3ZKB A;  1IBL E;  4DPX A;  3Q1Q A;  3H4L A;  4HYM A;  1EA6 A;  3LNU A;  2VQF I;  1HNZ I;  3CWV A;  3ZZU A;  4LFC I;  5FLX Q;  2HHH I;  3ZM7 A;  2EFG A;  1MG7 A;  3PYG A;  1IBK E;  4JI2 I;  2OI2 A;  4MYU A;  4PU9 A;  2HKJ A;  4JI8 I;  1N32 I;  1J5E E;  3J7A M;  4HY1 A;  4UTG A;  2VQF E;  4K0K I;  2R42 A;  3V2U C;  4DPT A;  4HXZ A;  5BR8 I;  1ZXN A;  4LFC E;  1XNR I;  3J80 Q;  4B3T I;  2HFU A;  4WUD A;  1FJG I;  3B8H A;  4JI2 E;  2UU9 I;  1Z0G A;  2F4V I;  3PYF A;  1NHI A;  4DV6 I;  1HR0 I;  1H73 A;  5LMN E;  4X66 E;  4PRX A;  4DXL A; 
#chains in the Genus database with same CATH topology
 5FLX C;  4JI8 E;  1OJ4 A;  4FWH A;  1N32 E;  1UDS A;  4K0K E;  1VI7 A;  3ZZT A;  4LF6 E;  3U1K A;  5BR8 E;  2ZM6 I;  5ELW A;  4JG4 A;  4DV0 I;  3QT5 A;  4UT4 A;  2IES A;  1NHJ A;  2BA1 D;  1YHC A;  3ZKD A;  1N33 E;  1UDN A;  3M7N G;  3KRN A;  3P76 A;  4LCF A;  1N0U A;  3J80 C;  4JYA I;  4DPW A;  3M85 D;  1FI4 A;  1S4E A;  4GKJ E;  2C38 A;  5K36 A;  2CG9 A;  4DV1 I;  1PVG A;  4JI4 E;  2ZM6 E;  2C38 B;  4DUZ I;  5IT9 C;  5K36 B;  1OYP A;  4LFA I;  1OYR A;  4DV2 I;  1Y4S A;  2C37 A;  2BM1 A;  5EL9 A;  3PS3 A;  2UXB I;  4JI0 I;  4LF7 I;  2C37 B;  3LPS A;  4LF8 E;  4JV5 I;  1HNX E;  4JYA E;  2V2V A;  1WUU A;  4USK A;  4DR3 E;  2AJ4 A;  4DV1 E;  4DUZ E;  2UXD I;  5DRO A;  4LFA E;  2O3Z A;  2GO4 A;  5C0X D;  4DV2 E;  1S16 A;  2JE6 A;  1NHH A;  1HNW E;  2X7I A;  3HKM A;  2JE6 B;  2NN6 F;  4LF7 E;  4HAC B;  1FWL A;  1RHY A;  2V2Q A;  4BA2 B;  2UUA I;  1PIE A;  4NBQ A;  2F1D A;  3P3C A;  3V5R A;  4IFD A;  1RRE A;  4GKK E;  1YH8 A;  4IFD B;  4LPF A;  3LTO A;  4DR5 I;  1I94 I;  3UHM A;  5JEA A;  1XMQ I;  1IBM I;  4DU8 A;  3OTO E;  1N36 I;  5GME A;  1A6F A;  4DV5 I;  2CVE A;  5LMU I;  4NXN I;  2PNZ B;  3B82 A;  2WW4 A;  5JEA D;  1HNZ E;  5A2Q Q;  3B4T A;  4DPY A;  3PYE A;  1Z59 A;  2HHH E;  5DNX A;  2CZ9 A;  3GME A;  4MU0 A;  3T1H I;  1I94 E;  4B3S I;  1Z0E A;  5LL6 R;  1IBM E;  1N36 E;  4KHP I;  5IT9 Q;  4JI3 I;  4OO1 D;  2BA0 D;  5DRQ A;  3K1J A;  4DR6 I;  4NXM I;  3WU3 A;  2JT2 A;  4NXN E;  4LF9 I;  4DR2 I;  4FW6 A;  1Y6Z A;  2R3V A;  4JI5 I;  2NN6 E;  2O1T A;  2HK2 A;  5DRR A;  3WU4 A;  1XNR E;  1ZM9 A;  4B3T E;  3J81 Q;  2Z5C A;  1FJG E;  4URL A;  2PO1 A;  5L3J A;  2UU9 E;  4DR4 I;  1EI1 A;  3P3G A;  1DAR A;  1RR9 A;  2Z5C B;  4LOM A;  4WUB A;  4DV6 E;  2PO1 B;  2F4V E;  1HR0 E;  3QT8 A;  1H74 A;  2VES A;  5C0X F;  4KHP E;  5A2Q C;  3K85 A;  4USM A;  2NN6 C;  4DV3 I;  4EMD A;  1N34 I;  1Z0W A;  2VQE I;  4B3M I;  4YHH I;  2HKE A;  4JI5 E;  2HK3 A;  2JEB A;  1B62 A;  3Q6M A;  4FN5 A;  4KQV A;  4DV0 E;  4DR1 I;  1FKA E;  2JEB B;  4LCH A;  1ELO A;  3P06 A;  2WP8 A;  4DV7 I;  2BM0 A;  4IZJ A;  3ZZ0 A;  2ZBK B;  4MQY A;  1ZM2 A;  4OX9 I;  2CGE A;  4J3D A;  2AE8 A;  3B78 A;  4LCG A;  2E5L I;  2BR2 A;  4DR4 E;  1H7S A;  4U3B A;  2WP8 B;  4IZJ B;  1BKN A;  5K36 D;  3HUL A;  2BR2 B;  4AID A;  5DNL A;  1QZR A;  2BA1 G;  3GLL A;  2NPF A;  2JEA B;  2VF3 A;  3M6A A;  4P52 A;  2GO3 A;  2V8P A;  3QT6 A;  4X62 I;  1UDQ A;  2PO0 A;  2X36 A;  3J81 C;  2Q2E B;  1N34 E;  2UXC I;  4B3M E;  2PO0 B;  4AQY I;  4DR1 E;  5JEA F;  1UDO A;  3M85 G;  4DV7 E;  4OX9 E;  2PNL A;  2GQ0 A;  3JAM C;  4DUY I;  4HAC A;  4GQU A;  4FW9 A;  4RPF A;  3U1Y A;  2Z5E A;  1IBL I;  2UXB E;  3GON A;  1D6T A;  4AM3 A;  4JI0 E;  4BA2 A;  4B3R I;  2PO2 A;  4JV5 E;  2C39 A;  1KTV A;  2PO2 B;  4MYT A;  4OO1 F;  2UXC E;  2C39 B;  3T1Y I;  1XNQ I;  2A2C A;  1IBK I;  4YY3 I;  4AQY E;  2UXD E;  4N3O A;  4FWD A;  2WNR A;  4Z7C A;  2BV3 A;  3CDJ A;  3D4J A;  4DUY E;  2WNR B;  4IFD D;  2HFS A;  1H7U A;  4U3D A;  1J5E I;  2PNZ A;  3H1C A;  4B3R E;  4LF5 I;  5C0X C;  2UUC I;  3PS2 A;  4R1F A;  2J65 A;  2UUA E;  5GMD A;  3T1Y E;  1XNQ E;  1Z5B A;  1VIS A;  4YY3 E;  1XMO I;  1USU A;  5DRP A;  1H72 C;  5EKW A;  4DR5 E;  5LMN I;  1N0V C;  2J7K A;  2DEI A;  4X66 I;  1E3H A;  1XMQ E;  1UEK A;  3Q6N A;  4MU1 A;  3J7A G;  1MU5 A;  4LF4 I;  1PKP A;  4DR7 I;  2NN6 A;  2GS8 A;  5FWK A;  4LF5 E;  2UUC E;  4PRV A;  1XXE A;  1ZM3 A;  2V2Z A;  4M1K A;  4DV5 E;  4ISA A;  2NN6 B;  5LMU E;  5K36 F;  1KIJ A;  4Z7Y A;  4LF6 I;  3M7N D;  1FWK A;  2V34 A;  2LJP A;  3WU5 A;  4IZK A;  1ZM4 A;  4OZE A;  4DU7 A;  1XMO E;  4X65 I;  1N33 I;  3QT7 A;  3T1H E;  4IZK B;  4XTJ A;  5JEA C;  4MDT A;  4B3S E;  1Z5A A;  1XHK A;  4AIM A;  4LF4 E;  3PS1 A;  4WUC A;  2O1W A;  4DR7 E;  4JI3 E;  1Z0V A;  4GKJ I;  4DR6 E;  4NXM E;  3PYD A;  1FNM A;  3JAM Q;  4JI4 I;  4LF9 E;  2E1R A;  4DR2 E;  4OO1 C;  1P42 A;  4FW3 A;  2BA0 G;  1B63 A;  1Z0C A;  4X65 E;  4JI6 I;  5IWA I;  4ED4 A;  2Z5B A;  4LF8 I;  1Y5Y A;  2JEA A;  2Z5B B;  1HNX I;  4P7A A;  4FW7 A;  1Z0B A;  4DR3 I;  4DV3 E;  1USV A;  1ZXM A;  3WU6 A;  4JI1 I;  3HJC A;  4IZJ D;  2UUB I;  4JI7 I;  4IFD F;  4DV4 I;  1NZ0 A;  2VQE E;  4YHH E;  3K17 A;  2O1U A;  1R6L A;  1OYS A;  5K36 E;  4X64 I;  4JI6 E;  1HK7 A;  5IWA E;  1HNW I;  4OKG A;  3L7Z A;  2E5L E;  1R6M A;  2XEX A;  4IS9 A;  4LFB I;  2IOP A;  3GCM A;  4FWG A;  3L7Z B;  5C0X A;  3CDI A;  4BA1 A;  2PNM A;  3DD6 A;  1KVK A;  5C0X B;  1Z5C A;  4FW4 A;  4JI1 E;  2UUB E;  4ZVI A;  4JI7 E;  4BA1 B;  4X62 E;  4DPU A;  4DV4 E;  2DEJ A;  5K36 C;  1Z0T A;  1K47 A;  4GKK I;  5C0X E;  2ZIT A;  1MX0 A;  4I3H A;  4MU3 A;  3F0N A;  4X64 E;  2IOQ A;  4QNK A;  3OTO I;  1KKH A;  2A2D A;  4LFB E;  1U2R A;  3ZKB A;  1IBL E;  4DPX A;  3Q1Q A;  3H4L A;  4HYM A;  1EA6 A;  3LNU A;  2VQF I;  1HNZ I;  4QNJ A;  3CWV A;  3ZZU A;  4LFC I;  5FLX Q;  2HHH I;  3ZM7 A;  2IER A;  2EFG A;  1MG7 A;  3PYG A;  1IBK E;  4JI2 I;  3P3E A;  3PRY A;  4IFD E;  2O1V A;  3NZK A;  2OI2 A;  4MYU A;  4MU4 A;  5JEA B;  4FW5 A;  4PU9 A;  2HKJ A;  4JI8 I;  1N32 I;  1J5E E;  3J7A M;  5JEA E;  4HY1 A;  4UTG A;  1E3P A;  2VQF E;  4K0K I;  2R42 A;  3V2U C;  4DPT A;  4HXZ A;  5BR8 I;  1ZXN A;  4OO1 A;  4LFC E;  1XNR I;  4IFD C;  3J80 Q;  4B3T I;  2HFU A;  4WUD A;  1FJG I;  4OO1 B;  3B8H A;  2NN6 D;  4JI2 E;  1Y4U A;  2UU9 I;  1Z0G A;  2F4V I;  3PYF A;  1NHI A;  4DV6 I;  1Y60 A;  1H73 A;  1HR0 I;  5LMN E;  4OO1 E;  4X66 E;  4PRX A;  4DXL A; 
#chains in the Genus database with same CATH homology
 5FLX C;  4JI8 E;  1OJ4 A;  4FWH A;  1N32 E;  4K0K E;  3ZZT A;  4LF6 E;  5BR8 E;  2ZM6 I;  4JG4 A;  4DV0 I;  3QT5 A;  4UT4 A;  1NHJ A;  3ZKD A;  1N33 E;  3J80 C;  1N0U A;  4JYA I;  4DPW A;  1FI4 A;  1S4E A;  4GKJ E;  2CG9 A;  4DV1 I;  1PVG A;  4JI4 E;  2ZM6 E;  4DUZ I;  5IT9 C;  4LFA I;  4DV2 I;  1Y4S A;  2BM1 A;  2UXB I;  4JI0 I;  4LF7 I;  3LPS A;  4LF8 E;  4JV5 I;  1HNX E;  4JYA E;  2V2V A;  1WUU A;  4USK A;  4DR3 E;  2AJ4 A;  4DV1 E;  4DUZ E;  2UXD I;  4LFA E;  4DV2 E;  1S16 A;  1NHH A;  1HNW E;  2X7I A;  4LF7 E;  4HAC B;  1FWL A;  2V2Q A;  2UUA I;  1PIE A;  3V5R A;  1RRE A;  4GKK E;  3LTO A;  4DR5 I;  1I94 I;  1XMQ I;  1IBM I;  4DU8 A;  3OTO E;  1N36 I;  5GME A;  1A6F A;  4DV5 I;  5LMU I;  4NXN I;  3B82 A;  2WW4 A;  1HNZ E;  5A2Q Q;  4DPY A;  3PYE A;  1Z59 A;  2HHH E;  2CZ9 A;  3T1H I;  1I94 E;  4B3S I;  1Z0E A;  5LL6 R;  1IBM E;  1N36 E;  4KHP I;  5IT9 Q;  4JI3 I;  3K1J A;  4DR6 I;  4NXM I;  3WU3 A;  4NXN E;  4LF9 I;  4DR2 I;  1Y6Z A;  2R3V A;  4JI5 I;  2O1T A;  2HK2 A;  3WU4 A;  1XNR E;  1ZM9 A;  4B3T E;  3J81 Q;  2Z5C A;  1FJG E;  4URL A;  5L3J A;  2UU9 E;  4DR4 I;  1EI1 A;  1DAR A;  1RR9 A;  2Z5C B;  2F4V E;  4WUB A;  4DV6 E;  1HR0 E;  3QT8 A;  1H74 A;  4KHP E;  5A2Q C;  3K85 A;  4USM A;  4DV3 I;  4EMD A;  1N34 I;  1Z0W A;  2VQE I;  4B3M I;  4YHH I;  2HKE A;  4JI5 E;  2HK3 A;  1B62 A;  3Q6M A;  4FN5 A;  4KQV A;  4DV0 E;  4DR1 I;  1FKA E;  1ELO A;  3P06 A;  4DV7 I;  2BM0 A;  4IZJ A;  3ZZ0 A;  2ZBK B;  4OX9 I;  1ZM2 A;  2CGE A;  3B78 A;  4DR4 E;  2E5L I;  1H7S A;  4IZJ B;  1BKN A;  3HUL A;  1QZR A;  2NPF A;  2VF3 A;  3M6A A;  4P52 A;  2V8P A;  3J81 C;  3QT6 A;  4X62 I;  2X36 A;  2Q2E B;  1N34 E;  2UXC I;  4B3M E;  4AQY I;  4DR1 E;  4DV7 E;  4OX9 E;  2PNL A;  2GQ0 A;  3JAM C;  4DUY I;  4HAC A;  4FW9 A;  4RPF A;  2Z5E A;  1IBL I;  2UXB E;  3GON A;  1D6T A;  4JI0 E;  4B3R I;  4JV5 E;  1KTV A;  4MYT A;  2UXC E;  3T1Y I;  1XNQ I;  2A2C A;  1IBK I;  4YY3 I;  4AQY E;  2UXD E;  4N3O A;  4FWD A;  4Z7C A;  2BV3 A;  3D4J A;  4DUY E;  2HFS A;  1H7U A;  1J5E I;  4B3R E;  4LF5 I;  2UUC I;  4R1F A;  2UUA E;  5GMD A;  3T1Y E;  1XNQ E;  1Z5B A;  1VIS A;  4YY3 E;  1XMO I;  1USU A;  1H72 C;  4DR5 E;  5LMN I;  1N0V C;  2J7K A;  2DEI A;  4X66 I;  1XMQ E;  1UEK A;  3Q6N A;  3J7A G;  1MU5 A;  4LF4 I;  1PKP A;  4DR7 I;  2GS8 A;  5FWK A;  4LF5 E;  2UUC E;  4PRV A;  1ZM3 A;  2V2Z A;  4M1K A;  4DV5 E;  5LMU E;  1KIJ A;  4Z7Y A;  4LF6 I;  1FWK A;  2V34 A;  2LJP A;  3WU5 A;  4IZK A;  1ZM4 A;  4DU7 A;  1XMO E;  4X65 I;  1N33 I;  3QT7 A;  3T1H E;  4IZK B;  4XTJ A;  4B3S E;  1Z5A A;  1XHK A;  4LF4 E;  4WUC A;  2O1W A;  4DR7 E;  4JI3 E;  1Z0V A;  4GKJ I;  4DR6 E;  4NXM E;  3PYD A;  1FNM A;  3JAM Q;  4JI4 I;  4LF9 E;  2E1R A;  4DR2 E;  1B63 A;  1Z0C A;  4X65 E;  4JI6 I;  5IWA I;  4ED4 A;  2Z5B A;  4LF8 I;  2Z5B B;  1HNX I;  4P7A A;  1Z0B A;  4DR3 I;  4DV3 E;  1USV A;  1ZXM A;  3WU6 A;  4JI1 I;  3HJC A;  4IZJ D;  2UUB I;  4JI7 I;  4DV4 I;  1NZ0 A;  2VQE E;  4YHH E;  3K17 A;  2O1U A;  4X64 I;  4JI6 E;  1HK7 A;  5IWA E;  1HNW I;  2E5L E;  2XEX A;  4LFB I;  2IOP A;  4FWG A;  2PNM A;  1KVK A;  1Z5C A;  4JI1 E;  2UUB E;  4ZVI A;  4JI7 E;  4X62 E;  4DPU A;  4DV4 E;  2DEJ A;  1Z0T A;  1K47 A;  4GKK I;  2ZIT A;  1MX0 A;  4I3H A;  3F0N A;  4X64 E;  2IOQ A;  3OTO I;  1KKH A;  2A2D A;  4LFB E;  1U2R A;  3ZKB A;  1IBL E;  4DPX A;  3Q1Q A;  3H4L A;  4HYM A;  1EA6 A;  3LNU A;  2VQF I;  1HNZ I;  3CWV A;  3ZZU A;  4LFC I;  5FLX Q;  2HHH I;  3ZM7 A;  2EFG A;  1MG7 A;  3PYG A;  1IBK E;  4JI2 I;  3PRY A;  2O1V A;  2OI2 A;  4MYU A;  4PU9 A;  2HKJ A;  4JI8 I;  1N32 I;  1J5E E;  3J7A M;  4HY1 A;  4UTG A;  2VQF E;  4K0K I;  2R42 A;  3V2U C;  4DPT A;  4HXZ A;  5BR8 I;  1ZXN A;  4LFC E;  1XNR I;  3J80 Q;  4B3T I;  2HFU A;  4WUD A;  1FJG I;  3B8H A;  4JI2 E;  1Y4U A;  2UU9 I;  1Z0G A;  2F4V I;  3PYF A;  1NHI A;  4DV6 I;  1HR0 I;  1H73 A;  5LMN E;  4X66 E;  4PRX A;  4DXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...