4JI0I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji0I00
4DV5E 1N34E 4FWHA 4X66I 2DEIA 2ZM6I 4KHPE 4WUCA 2GS8A 1ZM3A 4YHHE 1Z5AA 4HY1A 5IT9Q 5IWAE 4RPFA 4GKKI 1XNQI 1HNWE 2VF3A 5FLXC 1N0VC 4DR2E 1OJ4A 4JI2I 4PU9A 1K47A 4JI4E 2UXBE 1B62A 1XMOE 4PRXA 5IT9C 1FKAE 2NPFA 1NHJA 1HR0I 1H74A 1Z0BA 2HKJA 3V5RA 5BR8I 4JI7E 3T1HE 5GMDA 2EFGA 4JI8I 2X36A 4JV5I 4NXME 1WUUA 4UT4A 4DR1I 2XEXA 1KIJA 4MYUA 3J7AM 4JI1I 3WU5A 4R1FA 1EA6A 1Z5BA 4JI0I 4USKA 4HXZA 4X62I 4DV0E 1H7SA 4M1KA 4JI3E 4DR4I 1B63A 1Z0WA 2UUCI 4LF4I 1S16A 3D4JA 2UUBE 4JYAI 3J81Q 2UUAI 1PKPA 3OTOE 4LFCI 4B3TE 5A2QQ 2VQFE 4Z7CA 4DV6E 4DV3I 3J81C 1ZM4A 4DR6I 1IBLE 2UXDE 1Z0EA 1S4EA 4LF9E 4B3SE 4DR3I 2HHHI 4JI6E 4DV5I 4URLA 1N34I 2J7KA 2WW4A 4K0KE 2UU9E 4KHPI 4YHHI 4UTGA 2CZ9A 5GMEA 3T1YE 1Z0CA 3LNUA 5IWAI 1IBME 1HNWI 1IBKE 4ZVIA 4OX9E 4DR2I 2E5LE 4FWGA 1ZXMA 4JI4I 3K17A 2UXBI 1XMOI 3JAMQ 3WU4A 2V34A 3PYDA 3WU3A 3PYEA 2UXCE 4LF5E 3QT8A 3T1HI 4JI7I 2VQEE 4FN5A 4EMDA 5LMNE 4NXMI 3V2UC 1FJGE 2X7IA 4X64E 4P7AA 3ZKDA 1XMQE 4I3HA 4GKJE 4YY3E 1NZ0A 1MX0A 4DUYE 1FI4A 4X65E 4DV0I 3ZZUA 4DR7E 1N33E 4LF8E 4JI3I 3J80Q 1EI1A 1H72C 1RREA 2UUBI 3B78A 2Q2EB 4NXNE 4USMA 1NHHA 2V2VA 2HK2A 3M6AA 3OTOI 2HFUA 3QT5A 1U2RA 4FW9A 3K1JA 4AQYE 4LFBE 1D6TA 4DPUA 2F4VE 4B3TI 1QZRA 1DARA 2VQFI 4DV6I 2R3VA 4DV7E 1IBLI 2UXDI 2V8PA 4ED4A 4LF9I 4MYTA 4B3SI 4JI6I 3WU6A 1FNMA 1NHIA 3QT7A 1J5EE 4K0KI 4JI5E 2A2CA 2UU9I 4B3RE 4DV1E 4LF6E 4DR5E 1IBMI 3ZZTA 2DEJA 3PYGA 1IBKI 1HNZE 4LF7E 4OX9I 4LFAE 1HNXE 2BV3A 5A2QC 3HULA 3ZKBA 4DPYA 2E5LI 4DV4E 3B8HA 2BM1A 2UXCI 1H7UA 4LF5I 1N32E 2E1RA 2VQEI 1N36E 1Z5CA 5LMNI 4B3ME 1XNRE 4DUZE 1FJGI 5FLXQ 1XHKA 4X64I 1XMQI 5LMUE 4HACB 4GKJI 1BKNA 4YY3I 4DUYI 1MG7A 2LJPA 4X65I 1N33I 4DR7I 1I94E 4LF8I 2V2ZA 4HACA 4DXLA 3JAMC 2HFSA 4KQVA 2V2QA 3GONA 4DU8A 3CWVA 4DV2E 4NXNI 4P52A 1PVGA 4X66E 3B82A 1KVKA 2ZM6E 1A6FA 1PIEA 1RR9A 4AQYI 2A2DA 4LFBI 2F4VI 4DPTA 4JG4A 3LTOA 1MU5A 4GKKE 4HYMA 1XNQE 5L3JA 2R42A 2ZBKB 3ZM7A 4JI2E 4DV7I 1Z0TA 4PRVA 3H4LA 3J80C 2BM0A 1J5EI 1UEKA 1Z0VA 4JI5I 4B3RI 1HR0E 4DV1I 5BR8E 4LF6I 1ELOA 4DR5I 4Z7YA 3Q1QA 1ZM9A 4JI8E 4JV5E 2HKEA 2AJ4A 1HNZI 4LF7I 4DPXA 4WUBA 4DR1E 4LFAI 4DV2I 1HNXI 4XTJA 1KKHA 4FWDA 4JI1E 4DV4I 3T1YI 3ZZ0A 4JI0E 1Z0GA 4X62E 5LL6R 4DU7A 4DR4E 1ZM2A 2UUCE 4LF4E 3J7AG 1N32I 4JYAE 1N36I 2UUAE 4B3MI 1FWKA 1XNRI 4DUZI 2HK3A 1KTVA 4WUDA 3QT6A 1Z59A 4LFCE 3PYFA 5LMUI 4DV3E 1I94I 4DPWA 3F0NA 4DR6E 2OI2A 1N0UA 1FWLA 1ZXNA 1H73A 2ZITA 1VISA 3LPSA 4DR3E 2HHHE
chains in the Genus database with same CATH superfamily
4DV5E 1N34E 4FWHA 4X66I 2DEIA 2ZM6I 4KHPE 4WUCA 2GS8A 1ZM3A 4YHHE 4MDTA 1Z5AA 4HY1A 1YHCA 5IT9Q 5IWAE 4RPFA 4GKKI 1XNQI 3P06A 4IZJD 1HNWE 2VF3A 4OO1E 5FLXC 2NN6E 1N0VC 5DRQA 4DR2E 1OJ4A 2O1UA 4JI2I 2O1TA 4PU9A 1K47A 4JI4E 2UXBE 3UHMA 1B62A 1XMOE 4PRXA 5IT9C 1FKAE 2NPFA 2HHHE 5JEAC 3M7ND 1NHJA 1HR0I 1H74A 1Z0BA 2HKJA 5C0XE 3V5RA 1Y6ZA 5BR8I 2J65A 4JI7E 3T1HE 5GMDA 2EFGA 2O3ZA 2GO3A 4JI8I 2X36A 4JV5I 4NXME 1WUUA 2BR2A 1E3PA 4UT4A 4DR1I 2XEXA 1KIJA 4IFDE 4MYUA 3J7AM 4AIDA 4JI1I 2O1VA 3WU5A 2NN6B 4R1FA 4IZKB 1EA6A 1Z5BA 4JI0I 1R6LA 4USKA 4HXZA 4X62I 4DV0E 1H7SA 4M1KA 4JI3E 4DR4I 1B63A 1Z0WA 4MU1A 2UUCI 4LF4I 1S16A 3D4JA 2UUBE 3KRNA 4JYAI 2BA1D 2JEBB 4IZJB 4LCHA 3J81Q 2UUAI 1PKPA 2WP8B 3OTOE 4LOMA 5C0XB 1Y4UA 2PNLA 1VI7A 4IZJA 4LFCI 4B3TE 2F1DA 2WP8A 5A2QQ 5C0XA 2VQFE 2BA0D 4Z7CA 4DV6E 4IFDB 4DV3I 4OO1F 2NN6F 5JEAE 3J81C 1ZM4A 4DR6I 1IBLE 2UXDE 1Z0EA 1S4EA 1UDNA 2PO2B 4LF9E 4LCGA 4B3SE 4DR3I 2HHHI 3L7ZA 4JI6E 4DV5I 4URLA 2Z5BB 1N34I 2J7KA 2WW4A 4K0KE 3DD6A 2UU9E 2C37A 4KHPI 4MQYA 5K36C 4YHHI 4UTGA 2CZ9A 5GMEA 3T1YE 1Z0CA 2Z5BA 3LNUA 5IWAI 1IBME 1HNWI 2IESA 1Y5YA 1OYPA 4OO1D 2NN6D 1IBKE 4ZVIA 4OX9E 4DR2I 4FW7A 2E5LE 4FWGA 1ZXMA 4JI4I 3K17A 4IFDF 2PO1A 2UXBI 1OYRA 2BA1G 1XMOI 3JAMQ 5DNXA 3HJCA 4MU4A 3WU4A 5JEAB 1Y60A 2V34A 3PYDA 3WU3A 3PYEA 1RHYA 2UXCE 4LCFA 3U1YA 3CDJA 4LF5E 5C0XD 2PO0B 3QT8A 2O1WA 3T1HI 4JI7I 2VQEE 2C39B 4FN5A 4EMDA 2Z5CB 5LMNE 4NXMI 3V2UC 2PO0A 1FJGE 2X7IA 4X64E 4P7AA 3ZKDA 4IFDD 5ELWA 1XMQE 4I3HA 4GKJE 4YY3E 5EL9A 1NZ0A 1MX0A 4DUYE 3P3EA 2C38B 1FI4A 4X65E 4DV0I 3ZZUA 4DR7E 1N33E 4LF8E 4JI3I 3J80Q 1EI1A 2CG9A 1R6MA 1H72C 1RREA 2PNZB 5K36E 5JEAF 2IOQA 2UUBI 3B78A 4FW6A 3K85A 2Q2EB 2C38A 4NXNE 3PRYA 4USMA 1NHHA 2V2VA 1USUA 4OO1B 2HK2A 3GMEA 3M6AA 3CDIA 3OTOI 2HFUA 3GCMA 3QT5A 1U2RA 4FW9A 3P76A 3K1JA 4AQYE 4LFBE 1D6TA 2IERA 3PS1A 4DPUA 2F4VE 1UDOA 4B3TI 1QZRA 4OO1A 2NN6A 4IZKA 1DARA 4BA2B 2VQFI 4DV6I 3U1KA 2R3VA 4DV7E 5JEAD 1IBLI 2UXDI 2V8PA 2JEBA 4ED4A 4LF9I 4MYTA 4B3SI 4JI6I 3WU6A 1FNMA 1NHIA 3QT7A 1J5EE 4K0KI 4JI5E 2A2CA 2WNRB 2UU9I 4B3RE 4DV1E 1OYSA 1UDQA 3M7NG 4LF6E 2PNMA 2JT2A 4DR5E 2Z5EA 4U3DA 1IBMI 2WNRA 4MU0A 3ZZTA 2DEJA 3PYGA 4J3DA 2JE6B 1IBKI 1HNZE 4LF7E 4OX9I 4IFDA 3HKMA 4LFAE 1HNXE 2BV3A 5A2QC 3HULA 3ZKBA 4DPYA 2E5LI 2PO2A 4DV4E 3B8HA 3GLLA 4FW4A 2BM1A 2UXCI 1H7UA 2AE8A 4LF5I 1N32E 2E1RA 2VQEI 1N36E 5K36F 1HK7A 4BA1B 1Z5CA 5LMNI 4B3ME 1XNRE 2JEAB 4DUZE 1FJGI 5FLXQ 1XHKA 5DNLA 4X64I 4AM3A 4BA1A 1XMQI 5LMUE 4HACB 4GKJI 1BKNA 4YY3I 2JEAA 4N3OA 5JEAA 4DUYI 1MG7A 2LJPA 4X65I 1N33I 4DR7I 1I94E 4LF8I 2BA0G 4MU3A 1Y4SA 2V2ZA 4HACA 4DXLA 3JAMC 2C39A 5K36D 2HFSA 4KQVA 2V2QA 3GONA 4DU8A 3CWVA 3Q6MA 4DV2E 2Z5CA 4NXNI 4P52A 1XXEA 1PVGA 3H1CA 3Q6NA 4U3BA 1E3HA 3B82A 4X66E 2VESA 1KVKA 2ZM6E 4OKGA 1A6FA 1PIEA 1RR9A 4AQYI 2A2DA 4LFBI 2F4VI 4DPTA 4JG4A 3P3CA 3LTOA 1MU5A 4GKKE 4HYMA 1XNQE 5L3JA 2R42A 2ZBKB 3ZM7A 1P42A 3M85D 2BR2B 2CVEA 4JI2E 4DV7I 2PNZA 5DRPA 1Z0TA 4PRVA 2IOPA 3H4LA 5FWKA 3J80C 2BM0A 5DRRA 1J5EI 1UEKA 1Z0VA 4QNJA 4QNKA 4JI5I 4B3RI 1HR0E 4NBQA 4DV1I 5BR8E 4LF6I 1ELOA 4DR5I 4Z7YA 4IS9A 2CGEA 3Q1QA 4BA2A 1ZM9A 5DROA 4JI8E 4JV5E 2HKEA 2AJ4A 1HNZI 4LF7I 4DPXA 4WUBA 4DR1E 4LFAI 1HNXI 4XTJA 3PS2A 1KKHA 5K36B 4FWDA 3B4TA 4FW3A 4DV4I 4JI1E 3T1YI 4OO1C 3ZZ0A 2NN6C 4JI0E 1Z0GA 4GQUA 4X62E 5LL6R 1UDSA 4AIMA 4DU7A 3P3GA 4DR4E 5K36A 1ZM2A 2UUCE 1USVA 4LF4E 3J7AG 1N32I 4JYAE 4ISAA 1N36I 2UUAE 3PS3A 3L7ZB 2JE6A 4B3MI 1FWKA 5C0XC 1XNRI 4DUZI 2C37B 3M85G 2HK3A 1KTVA 4WUDA 3QT6A 1YH8A 1Z59A 4LFCE 3PYFA 5LMUI 5EKWA 4OZEA 4LPFA 3NZKA 4DV3E 4IFDC 1I94I 4DPWA 2GO4A 3F0NA 4DR6E 2OI2A 1N0UA 5C0XF 1FWLA 2GQ0A 1ZXNA 4FW5A 1H73A 2ZITA 1VISA 2PO1B 3LPSA 4DR3E 4DV2I
chains in the Genus database with same CATH topology
4DV5E 1N34E 4FWHA 4X66I 2DEIA 2ZM6I 4KHPE 4WUCA 2GS8A 1ZM3A 4YHHE 1Z5AA 4HY1A 5IT9Q 5IWAE 4RPFA 4GKKI 1XNQI 3P06A 4IZJD 1HNWE 2VF3A 5FLXC 1N0VC 4DR2E 1OJ4A 2O1UA 4JI2I 2O1TA 4PU9A 1K47A 4JI4E 2UXBE 1B62A 1XMOE 4PRXA 5IT9C 1FKAE 2NPFA 2HHHE 1NHJA 1HR0I 1H74A 1Z0BA 2HKJA 3V5RA 1Y6ZA 5BR8I 4JI7E 3T1HE 5GMDA 2EFGA 4JI8I 2X36A 4JV5I 4NXME 1WUUA 4UT4A 4DR1I 2XEXA 1KIJA 4MYUA 3J7AM 4JI1I 2O1VA 3WU5A 4R1FA 4IZKB 1EA6A 1Z5BA 4JI0I 4USKA 4HXZA 4X62I 4DV0E 1H7SA 4M1KA 4JI3E 4DR4I 1B63A 1Z0WA 2UUCI 4LF4I 1S16A 3D4JA 2UUBE 4JYAI 4IZJB 3J81Q 2UUAI 1PKPA 3OTOE 1Y4UA 2PNLA 4IZJA 4LFCI 4B3TE 5A2QQ 2VQFE 4Z7CA 4DV6E 4DV3I 3J81C 1ZM4A 4DR6I 1IBLE 2UXDE 1Z0EA 1S4EA 4LF9E 4B3SE 4DR3I 2HHHI 4JI6E 4DV5I 4URLA 2Z5BB 1N34I 2J7KA 2WW4A 4K0KE 2UU9E 4KHPI 4YHHI 4UTGA 2CZ9A 5GMEA 3T1YE 1Z0CA 2Z5BA 3LNUA 5IWAI 1IBME 1HNWI 1IBKE 4ZVIA 4OX9E 4DR2I 2E5LE 4FWGA 1ZXMA 4JI4I 3K17A 2UXBI 1XMOI 3JAMQ 3HJCA 3WU4A 2V34A 3PYDA 3WU3A 3PYEA 2UXCE 4LF5E 3QT8A 2O1WA 3T1HI 4JI7I 2VQEE 4FN5A 4EMDA 2Z5CB 5LMNE 4NXMI 3V2UC 1FJGE 2X7IA 4X64E 4P7AA 3ZKDA 1XMQE 4I3HA 4GKJE 4YY3E 1NZ0A 1MX0A 4DUYE 1FI4A 4X65E 4DV0I 3ZZUA 4DR7E 1N33E 4LF8E 4JI3I 3J80Q 1EI1A 2CG9A 1H72C 1RREA 2IOQA 2UUBI 3B78A 3K85A 2Q2EB 4NXNE 3PRYA 4USMA 1NHHA 2V2VA 1USUA 2HK2A 3M6AA 3OTOI 2HFUA 3QT5A 1U2RA 4FW9A 3K1JA 4AQYE 4LFBE 1D6TA 4DPUA 2F4VE 4B3TI 1QZRA 4IZKA 1DARA 2VQFI 4DV6I 2R3VA 4DV7E 1IBLI 2UXDI 2V8PA 4ED4A 4LF9I 4MYTA 4B3SI 4JI6I 3WU6A 1FNMA 1NHIA 3QT7A 1J5EE 4K0KI 4JI5E 2A2CA 2UU9I 4B3RE 4DV1E 4LF6E 2PNMA 4DR5E 2Z5EA 1IBMI 3ZZTA 2DEJA 3PYGA 1IBKI 1HNZE 4LF7E 4OX9I 4LFAE 1HNXE 2BV3A 5A2QC 3HULA 3ZKBA 4DPYA 2E5LI 4DV4E 3B8HA 2BM1A 2UXCI 1H7UA 4LF5I 1N32E 2E1RA 2VQEI 1N36E 1HK7A 1Z5CA 5LMNI 4B3ME 1XNRE 4DUZE 1FJGI 5FLXQ 1XHKA 4X64I 1XMQI 5LMUE 4HACB 4GKJI 1BKNA 4YY3I 4N3OA 4DUYI 1MG7A 2LJPA 4X65I 1N33I 4DR7I 1I94E 4LF8I 1Y4SA 2V2ZA 4HACA 4DXLA 3JAMC 2HFSA 4KQVA 2V2QA 3GONA 4DU8A 3CWVA 3Q6MA 4DV2E 2Z5CA 4NXNI 4P52A 1PVGA 3Q6NA 4X66E 3B82A 1KVKA 2ZM6E 1A6FA 1PIEA 1RR9A 4AQYI 2A2DA 4LFBI 2F4VI 4DPTA 4JG4A 3LTOA 1MU5A 4GKKE 4HYMA 1XNQE 5L3JA 2R42A 2ZBKB 3ZM7A 4JI2E 4DV7I 1Z0TA 4PRVA 2IOPA 3H4LA 5FWKA 3J80C 2BM0A 1J5EI 1UEKA 1Z0VA 4JI5I 4B3RI 1HR0E 4DV1I 5BR8E 4LF6I 1ELOA 4DR5I 4Z7YA 2CGEA 3Q1QA 1ZM9A 4JI8E 4JV5E 2HKEA 2AJ4A 1HNZI 4LF7I 4DPXA 4WUBA 4DR1E 4LFAI 1HNXI 4XTJA 1KKHA 4FWDA 4JI1E 4DV4I 3T1YI 3ZZ0A 4JI0E 1Z0GA 4X62E 5LL6R 4DU7A 4DR4E 1ZM2A 2UUCE 1USVA 4LF4E 3J7AG 1N32I 4JYAE 1N36I 2UUAE 4B3MI 1FWKA 1XNRI 4DUZI 2HK3A 1KTVA 4WUDA 3QT6A 1Z59A 4LFCE 3PYFA 5LMUI 4DV3E 1I94I 4DPWA 3F0NA 4DR6E 2OI2A 1N0UA 1FWLA 2GQ0A 1ZXNA 1H73A 2ZITA 1VISA 3LPSA 4DR3E 4DV2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 E;  1N34 E;  4FWH A;  4X66 I;  2DEI A;  2ZM6 I;  4KHP E;  4WUC A;  2GS8 A;  1ZM3 A;  4YHH E;  1Z5A A;  4HY1 A;  5IT9 Q;  5IWA E;  4RPF A;  4GKK I;  1XNQ I;  1HNW E;  2VF3 A;  5FLX C;  1N0V C;  4DR2 E;  1OJ4 A;  4JI2 I;  4PU9 A;  1K47 A;  4JI4 E;  2UXB E;  1B62 A;  1XMO E;  4PRX A;  5IT9 C;  1FKA E;  2NPF A;  1NHJ A;  1HR0 I;  1H74 A;  1Z0B A;  2HKJ A;  3V5R A;  5BR8 I;  4JI7 E;  3T1H E;  5GMD A;  2EFG A;  4JI8 I;  2X36 A;  4JV5 I;  4NXM E;  1WUU A;  4UT4 A;  4DR1 I;  2XEX A;  1KIJ A;  4MYU A;  3J7A M;  4JI1 I;  3WU5 A;  4R1F A;  1EA6 A;  1Z5B A;  4JI0 I;  4USK A;  4HXZ A;  4X62 I;  4DV0 E;  1H7S A;  4M1K A;  4JI3 E;  4DR4 I;  1B63 A;  1Z0W A;  2UUC I;  4LF4 I;  1S16 A;  3D4J A;  2UUB E;  4JYA I;  3J81 Q;  2UUA I;  1PKP A;  3OTO E;  4LFC I;  4B3T E;  5A2Q Q;  2VQF E;  4Z7C A;  4DV6 E;  4DV3 I;  3J81 C;  1ZM4 A;  4DR6 I;  1IBL E;  2UXD E;  1Z0E A;  1S4E A;  4LF9 E;  4B3S E;  4DR3 I;  2HHH I;  4JI6 E;  4DV5 I;  4URL A;  1N34 I;  2J7K A;  2WW4 A;  4K0K E;  2UU9 E;  4KHP I;  4YHH I;  4UTG A;  2CZ9 A;  5GME A;  3T1Y E;  1Z0C A;  3LNU A;  5IWA I;  1IBM E;  1HNW I;  1IBK E;  4ZVI A;  4OX9 E;  4DR2 I;  2E5L E;  4FWG A;  1ZXM A;  4JI4 I;  3K17 A;  2UXB I;  1XMO I;  3JAM Q;  3WU4 A;  2V34 A;  3PYD A;  3WU3 A;  3PYE A;  2UXC E;  4LF5 E;  3QT8 A;  3T1H I;  4JI7 I;  2VQE E;  4FN5 A;  4EMD A;  5LMN E;  4NXM I;  3V2U C;  1FJG E;  2X7I A;  4X64 E;  4P7A A;  3ZKD A;  1XMQ E;  4I3H A;  4GKJ E;  4YY3 E;  1NZ0 A;  1MX0 A;  4DUY E;  1FI4 A;  4X65 E;  4DV0 I;  3ZZU A;  4DR7 E;  1N33 E;  4LF8 E;  4JI3 I;  3J80 Q;  1EI1 A;  1H72 C;  1RRE A;  2UUB I;  3B78 A;  2Q2E B;  4NXN E;  4USM A;  1NHH A;  2V2V A;  2HK2 A;  3M6A A;  3OTO I;  2HFU A;  3QT5 A;  1U2R A;  4FW9 A;  3K1J A;  4AQY E;  4LFB E;  1D6T A;  4DPU A;  2F4V E;  4B3T I;  1QZR A;  1DAR A;  2VQF I;  4DV6 I;  2R3V A;  4DV7 E;  1IBL I;  2UXD I;  2V8P A;  4ED4 A;  4LF9 I;  4MYT A;  4B3S I;  4JI6 I;  3WU6 A;  1FNM A;  1NHI A;  3QT7 A;  1J5E E;  4K0K I;  4JI5 E;  2A2C A;  2UU9 I;  4B3R E;  4DV1 E;  4LF6 E;  4DR5 E;  1IBM I;  3ZZT A;  2DEJ A;  3PYG A;  1IBK I;  1HNZ E;  4LF7 E;  4OX9 I;  4LFA E;  1HNX E;  2BV3 A;  5A2Q C;  3HUL A;  3ZKB A;  4DPY A;  2E5L I;  4DV4 E;  3B8H A;  2BM1 A;  2UXC I;  1H7U A;  4LF5 I;  1N32 E;  2E1R A;  2VQE I;  1N36 E;  1Z5C A;  5LMN I;  4B3M E;  1XNR E;  4DUZ E;  1FJG I;  5FLX Q;  1XHK A;  4X64 I;  1XMQ I;  5LMU E;  4HAC B;  4GKJ I;  1BKN A;  4YY3 I;  4DUY I;  1MG7 A;  2LJP A;  4X65 I;  1N33 I;  4DR7 I;  1I94 E;  4LF8 I;  2V2Z A;  4HAC A;  4DXL A;  3JAM C;  2HFS A;  4KQV A;  2V2Q A;  3GON A;  4DU8 A;  3CWV A;  4DV2 E;  4NXN I;  4P52 A;  1PVG A;  4X66 E;  3B82 A;  1KVK A;  2ZM6 E;  1A6F A;  1PIE A;  1RR9 A;  4AQY I;  2A2D A;  4LFB I;  2F4V I;  4DPT A;  4JG4 A;  3LTO A;  1MU5 A;  4GKK E;  4HYM A;  1XNQ E;  5L3J A;  2R42 A;  2ZBK B;  3ZM7 A;  4JI2 E;  4DV7 I;  1Z0T A;  4PRV A;  3H4L A;  3J80 C;  2BM0 A;  1J5E I;  1UEK A;  1Z0V A;  4JI5 I;  4B3R I;  1HR0 E;  4DV1 I;  5BR8 E;  4LF6 I;  1ELO A;  4DR5 I;  4Z7Y A;  3Q1Q A;  1ZM9 A;  4JI8 E;  4JV5 E;  2HKE A;  2AJ4 A;  1HNZ I;  4LF7 I;  4DPX A;  4WUB A;  4DR1 E;  4LFA I;  4DV2 I;  1HNX I;  4XTJ A;  1KKH A;  4FWD A;  4JI1 E;  4DV4 I;  3T1Y I;  3ZZ0 A;  4JI0 E;  1Z0G A;  4X62 E;  5LL6 R;  4DU7 A;  4DR4 E;  1ZM2 A;  2UUC E;  4LF4 E;  3J7A G;  1N32 I;  4JYA E;  1N36 I;  2UUA E;  4B3M I;  1FWK A;  1XNR I;  4DUZ I;  2HK3 A;  1KTV A;  4WUD A;  3QT6 A;  1Z59 A;  4LFC E;  3PYF A;  5LMU I;  4DV3 E;  1I94 I;  4DPW A;  3F0N A;  4DR6 E;  2OI2 A;  1N0U A;  1FWL A;  1ZXN A;  1H73 A;  2ZIT A;  1VIS A;  3LPS A;  4DR3 E;  2HHH E; 
#chains in the Genus database with same CATH topology
 4DV5 E;  1N34 E;  4FWH A;  4X66 I;  2DEI A;  2ZM6 I;  4KHP E;  4WUC A;  2GS8 A;  1ZM3 A;  4YHH E;  4MDT A;  1Z5A A;  4HY1 A;  1YHC A;  5IT9 Q;  5IWA E;  4RPF A;  4GKK I;  1XNQ I;  3P06 A;  4IZJ D;  1HNW E;  2VF3 A;  4OO1 E;  5FLX C;  2NN6 E;  1N0V C;  5DRQ A;  4DR2 E;  1OJ4 A;  2O1U A;  4JI2 I;  2O1T A;  4PU9 A;  1K47 A;  4JI4 E;  2UXB E;  3UHM A;  1B62 A;  1XMO E;  4PRX A;  5IT9 C;  1FKA E;  2NPF A;  2HHH E;  5JEA C;  3M7N D;  1NHJ A;  1HR0 I;  1H74 A;  1Z0B A;  2HKJ A;  5C0X E;  3V5R A;  1Y6Z A;  5BR8 I;  2J65 A;  4JI7 E;  3T1H E;  5GMD A;  2EFG A;  2O3Z A;  2GO3 A;  4JI8 I;  2X36 A;  4JV5 I;  4NXM E;  1WUU A;  2BR2 A;  1E3P A;  4UT4 A;  4DR1 I;  2XEX A;  1KIJ A;  4IFD E;  4MYU A;  3J7A M;  4AID A;  4JI1 I;  2O1V A;  3WU5 A;  2NN6 B;  4R1F A;  4IZK B;  1EA6 A;  1Z5B A;  4JI0 I;  1R6L A;  4USK A;  4HXZ A;  4X62 I;  4DV0 E;  1H7S A;  4M1K A;  4JI3 E;  4DR4 I;  1B63 A;  1Z0W A;  4MU1 A;  2UUC I;  4LF4 I;  1S16 A;  3D4J A;  2UUB E;  3KRN A;  4JYA I;  2BA1 D;  2JEB B;  4IZJ B;  4LCH A;  3J81 Q;  2UUA I;  1PKP A;  2WP8 B;  3OTO E;  4LOM A;  5C0X B;  1Y4U A;  2PNL A;  1VI7 A;  4IZJ A;  4LFC I;  4B3T E;  2F1D A;  2WP8 A;  5A2Q Q;  5C0X A;  2VQF E;  2BA0 D;  4Z7C A;  4DV6 E;  4IFD B;  4DV3 I;  4OO1 F;  2NN6 F;  5JEA E;  3J81 C;  1ZM4 A;  4DR6 I;  1IBL E;  2UXD E;  1Z0E A;  1S4E A;  1UDN A;  2PO2 B;  4LF9 E;  4LCG A;  4B3S E;  4DR3 I;  2HHH I;  3L7Z A;  4JI6 E;  4DV5 I;  4URL A;  2Z5B B;  1N34 I;  2J7K A;  2WW4 A;  4K0K E;  3DD6 A;  2UU9 E;  2C37 A;  4KHP I;  4MQY A;  5K36 C;  4YHH I;  4UTG A;  2CZ9 A;  5GME A;  3T1Y E;  1Z0C A;  2Z5B A;  3LNU A;  5IWA I;  1IBM E;  1HNW I;  2IES A;  1Y5Y A;  1OYP A;  4OO1 D;  2NN6 D;  1IBK E;  4ZVI A;  4OX9 E;  4DR2 I;  4FW7 A;  2E5L E;  4FWG A;  1ZXM A;  4JI4 I;  3K17 A;  4IFD F;  2PO1 A;  2UXB I;  1OYR A;  2BA1 G;  1XMO I;  3JAM Q;  5DNX A;  3HJC A;  4MU4 A;  3WU4 A;  5JEA B;  1Y60 A;  2V34 A;  3PYD A;  3WU3 A;  3PYE A;  1RHY A;  2UXC E;  4LCF A;  3U1Y A;  3CDJ A;  4LF5 E;  5C0X D;  2PO0 B;  3QT8 A;  2O1W A;  3T1H I;  4JI7 I;  2VQE E;  2C39 B;  4FN5 A;  4EMD A;  2Z5C B;  5LMN E;  4NXM I;  3V2U C;  2PO0 A;  1FJG E;  2X7I A;  4X64 E;  4P7A A;  3ZKD A;  4IFD D;  5ELW A;  1XMQ E;  4I3H A;  4GKJ E;  4YY3 E;  5EL9 A;  1NZ0 A;  1MX0 A;  4DUY E;  3P3E A;  2C38 B;  1FI4 A;  4X65 E;  4DV0 I;  3ZZU A;  4DR7 E;  1N33 E;  4LF8 E;  4JI3 I;  3J80 Q;  1EI1 A;  2CG9 A;  1R6M A;  1H72 C;  1RRE A;  2PNZ B;  5K36 E;  5JEA F;  2IOQ A;  2UUB I;  3B78 A;  4FW6 A;  3K85 A;  2Q2E B;  2C38 A;  4NXN E;  3PRY A;  4USM A;  1NHH A;  2V2V A;  1USU A;  4OO1 B;  2HK2 A;  3GME A;  3M6A A;  3CDI A;  3OTO I;  2HFU A;  3GCM A;  3QT5 A;  1U2R A;  4FW9 A;  3P76 A;  3K1J A;  4AQY E;  4LFB E;  1D6T A;  2IER A;  3PS1 A;  4DPU A;  2F4V E;  1UDO A;  4B3T I;  1QZR A;  4OO1 A;  2NN6 A;  4IZK A;  1DAR A;  4BA2 B;  2VQF I;  4DV6 I;  3U1K A;  2R3V A;  4DV7 E;  5JEA D;  1IBL I;  2UXD I;  2V8P A;  2JEB A;  4ED4 A;  4LF9 I;  4MYT A;  4B3S I;  4JI6 I;  3WU6 A;  1FNM A;  1NHI A;  3QT7 A;  1J5E E;  4K0K I;  4JI5 E;  2A2C A;  2WNR B;  2UU9 I;  4B3R E;  4DV1 E;  1OYS A;  1UDQ A;  3M7N G;  4LF6 E;  2PNM A;  2JT2 A;  4DR5 E;  2Z5E A;  4U3D A;  1IBM I;  2WNR A;  4MU0 A;  3ZZT A;  2DEJ A;  3PYG A;  4J3D A;  2JE6 B;  1IBK I;  1HNZ E;  4LF7 E;  4OX9 I;  4IFD A;  3HKM A;  4LFA E;  1HNX E;  2BV3 A;  5A2Q C;  3HUL A;  3ZKB A;  4DPY A;  2E5L I;  2PO2 A;  4DV4 E;  3B8H A;  3GLL A;  4FW4 A;  2BM1 A;  2UXC I;  1H7U A;  2AE8 A;  4LF5 I;  1N32 E;  2E1R A;  2VQE I;  1N36 E;  5K36 F;  1HK7 A;  4BA1 B;  1Z5C A;  5LMN I;  4B3M E;  1XNR E;  2JEA B;  4DUZ E;  1FJG I;  5FLX Q;  1XHK A;  5DNL A;  4X64 I;  4AM3 A;  4BA1 A;  1XMQ I;  5LMU E;  4HAC B;  4GKJ I;  1BKN A;  4YY3 I;  2JEA A;  4N3O A;  5JEA A;  4DUY I;  1MG7 A;  2LJP A;  4X65 I;  1N33 I;  4DR7 I;  1I94 E;  4LF8 I;  2BA0 G;  4MU3 A;  1Y4S A;  2V2Z A;  4HAC A;  4DXL A;  3JAM C;  2C39 A;  5K36 D;  2HFS A;  4KQV A;  2V2Q A;  3GON A;  4DU8 A;  3CWV A;  3Q6M A;  4DV2 E;  2Z5C A;  4NXN I;  4P52 A;  1XXE A;  1PVG A;  3H1C A;  3Q6N A;  4U3B A;  1E3H A;  3B82 A;  4X66 E;  2VES A;  1KVK A;  2ZM6 E;  4OKG A;  1A6F A;  1PIE A;  1RR9 A;  4AQY I;  2A2D A;  4LFB I;  2F4V I;  4DPT A;  4JG4 A;  3P3C A;  3LTO A;  1MU5 A;  4GKK E;  4HYM A;  1XNQ E;  5L3J A;  2R42 A;  2ZBK B;  3ZM7 A;  1P42 A;  3M85 D;  2BR2 B;  2CVE A;  4JI2 E;  4DV7 I;  2PNZ A;  5DRP A;  1Z0T A;  4PRV A;  2IOP A;  3H4L A;  5FWK A;  3J80 C;  2BM0 A;  5DRR A;  1J5E I;  1UEK A;  1Z0V A;  4QNJ A;  4QNK A;  4JI5 I;  4B3R I;  1HR0 E;  4NBQ A;  4DV1 I;  5BR8 E;  4LF6 I;  1ELO A;  4DR5 I;  4Z7Y A;  4IS9 A;  2CGE A;  3Q1Q A;  4BA2 A;  1ZM9 A;  5DRO A;  4JI8 E;  4JV5 E;  2HKE A;  2AJ4 A;  1HNZ I;  4LF7 I;  4DPX A;  4WUB A;  4DR1 E;  4LFA I;  1HNX I;  4XTJ A;  3PS2 A;  1KKH A;  5K36 B;  4FWD A;  3B4T A;  4FW3 A;  4DV4 I;  4JI1 E;  3T1Y I;  4OO1 C;  3ZZ0 A;  2NN6 C;  4JI0 E;  1Z0G A;  4GQU A;  4X62 E;  5LL6 R;  1UDS A;  4AIM A;  4DU7 A;  3P3G A;  4DR4 E;  5K36 A;  1ZM2 A;  2UUC E;  1USV A;  4LF4 E;  3J7A G;  1N32 I;  4JYA E;  4ISA A;  1N36 I;  2UUA E;  3PS3 A;  3L7Z B;  2JE6 A;  4B3M I;  1FWK A;  5C0X C;  1XNR I;  4DUZ I;  2C37 B;  3M85 G;  2HK3 A;  1KTV A;  4WUD A;  3QT6 A;  1YH8 A;  1Z59 A;  4LFC E;  3PYF A;  5LMU I;  5EKW A;  4OZE A;  4LPF A;  3NZK A;  4DV3 E;  4IFD C;  1I94 I;  4DPW A;  2GO4 A;  3F0N A;  4DR6 E;  2OI2 A;  1N0U A;  5C0X F;  1FWL A;  2GQ0 A;  1ZXN A;  4FW5 A;  1H73 A;  2ZIT A;  1VIS A;  2PO1 B;  3LPS A;  4DR3 E;  4DV2 I; 
#chains in the Genus database with same CATH homology
 4DV5 E;  1N34 E;  4FWH A;  4X66 I;  2DEI A;  2ZM6 I;  4KHP E;  4WUC A;  2GS8 A;  1ZM3 A;  4YHH E;  1Z5A A;  4HY1 A;  5IT9 Q;  5IWA E;  4RPF A;  4GKK I;  1XNQ I;  3P06 A;  4IZJ D;  1HNW E;  2VF3 A;  5FLX C;  1N0V C;  4DR2 E;  1OJ4 A;  2O1U A;  4JI2 I;  2O1T A;  4PU9 A;  1K47 A;  4JI4 E;  2UXB E;  1B62 A;  1XMO E;  4PRX A;  5IT9 C;  1FKA E;  2NPF A;  2HHH E;  1NHJ A;  1HR0 I;  1H74 A;  1Z0B A;  2HKJ A;  3V5R A;  1Y6Z A;  5BR8 I;  4JI7 E;  3T1H E;  5GMD A;  2EFG A;  4JI8 I;  2X36 A;  4JV5 I;  4NXM E;  1WUU A;  4UT4 A;  4DR1 I;  2XEX A;  1KIJ A;  4MYU A;  3J7A M;  4JI1 I;  2O1V A;  3WU5 A;  4R1F A;  4IZK B;  1EA6 A;  1Z5B A;  4JI0 I;  4USK A;  4HXZ A;  4X62 I;  4DV0 E;  1H7S A;  4M1K A;  4JI3 E;  4DR4 I;  1B63 A;  1Z0W A;  2UUC I;  4LF4 I;  1S16 A;  3D4J A;  2UUB E;  4JYA I;  4IZJ B;  3J81 Q;  2UUA I;  1PKP A;  3OTO E;  1Y4U A;  2PNL A;  4IZJ A;  4LFC I;  4B3T E;  5A2Q Q;  2VQF E;  4Z7C A;  4DV6 E;  4DV3 I;  3J81 C;  1ZM4 A;  4DR6 I;  1IBL E;  2UXD E;  1Z0E A;  1S4E A;  4LF9 E;  4B3S E;  4DR3 I;  2HHH I;  4JI6 E;  4DV5 I;  4URL A;  2Z5B B;  1N34 I;  2J7K A;  2WW4 A;  4K0K E;  2UU9 E;  4KHP I;  4YHH I;  4UTG A;  2CZ9 A;  5GME A;  3T1Y E;  1Z0C A;  2Z5B A;  3LNU A;  5IWA I;  1IBM E;  1HNW I;  1IBK E;  4ZVI A;  4OX9 E;  4DR2 I;  2E5L E;  4FWG A;  1ZXM A;  4JI4 I;  3K17 A;  2UXB I;  1XMO I;  3JAM Q;  3HJC A;  3WU4 A;  2V34 A;  3PYD A;  3WU3 A;  3PYE A;  2UXC E;  4LF5 E;  3QT8 A;  2O1W A;  3T1H I;  4JI7 I;  2VQE E;  4FN5 A;  4EMD A;  2Z5C B;  5LMN E;  4NXM I;  3V2U C;  1FJG E;  2X7I A;  4X64 E;  4P7A A;  3ZKD A;  1XMQ E;  4I3H A;  4GKJ E;  4YY3 E;  1NZ0 A;  1MX0 A;  4DUY E;  1FI4 A;  4X65 E;  4DV0 I;  3ZZU A;  4DR7 E;  1N33 E;  4LF8 E;  4JI3 I;  3J80 Q;  1EI1 A;  2CG9 A;  1H72 C;  1RRE A;  2IOQ A;  2UUB I;  3B78 A;  3K85 A;  2Q2E B;  4NXN E;  3PRY A;  4USM A;  1NHH A;  2V2V A;  1USU A;  2HK2 A;  3M6A A;  3OTO I;  2HFU A;  3QT5 A;  1U2R A;  4FW9 A;  3K1J A;  4AQY E;  4LFB E;  1D6T A;  4DPU A;  2F4V E;  4B3T I;  1QZR A;  4IZK A;  1DAR A;  2VQF I;  4DV6 I;  2R3V A;  4DV7 E;  1IBL I;  2UXD I;  2V8P A;  4ED4 A;  4LF9 I;  4MYT A;  4B3S I;  4JI6 I;  3WU6 A;  1FNM A;  1NHI A;  3QT7 A;  1J5E E;  4K0K I;  4JI5 E;  2A2C A;  2UU9 I;  4B3R E;  4DV1 E;  4LF6 E;  2PNM A;  4DR5 E;  2Z5E A;  1IBM I;  3ZZT A;  2DEJ A;  3PYG A;  1IBK I;  1HNZ E;  4LF7 E;  4OX9 I;  4LFA E;  1HNX E;  2BV3 A;  5A2Q C;  3HUL A;  3ZKB A;  4DPY A;  2E5L I;  4DV4 E;  3B8H A;  2BM1 A;  2UXC I;  1H7U A;  4LF5 I;  1N32 E;  2E1R A;  2VQE I;  1N36 E;  1HK7 A;  1Z5C A;  5LMN I;  4B3M E;  1XNR E;  4DUZ E;  1FJG I;  5FLX Q;  1XHK A;  4X64 I;  1XMQ I;  5LMU E;  4HAC B;  4GKJ I;  1BKN A;  4YY3 I;  4N3O A;  4DUY I;  1MG7 A;  2LJP A;  4X65 I;  1N33 I;  4DR7 I;  1I94 E;  4LF8 I;  1Y4S A;  2V2Z A;  4HAC A;  4DXL A;  3JAM C;  2HFS A;  4KQV A;  2V2Q A;  3GON A;  4DU8 A;  3CWV A;  3Q6M A;  4DV2 E;  2Z5C A;  4NXN I;  4P52 A;  1PVG A;  3Q6N A;  4X66 E;  3B82 A;  1KVK A;  2ZM6 E;  1A6F A;  1PIE A;  1RR9 A;  4AQY I;  2A2D A;  4LFB I;  2F4V I;  4DPT A;  4JG4 A;  3LTO A;  1MU5 A;  4GKK E;  4HYM A;  1XNQ E;  5L3J A;  2R42 A;  2ZBK B;  3ZM7 A;  4JI2 E;  4DV7 I;  1Z0T A;  4PRV A;  2IOP A;  3H4L A;  5FWK A;  3J80 C;  2BM0 A;  1J5E I;  1UEK A;  1Z0V A;  4JI5 I;  4B3R I;  1HR0 E;  4DV1 I;  5BR8 E;  4LF6 I;  1ELO A;  4DR5 I;  4Z7Y A;  2CGE A;  3Q1Q A;  1ZM9 A;  4JI8 E;  4JV5 E;  2HKE A;  2AJ4 A;  1HNZ I;  4LF7 I;  4DPX A;  4WUB A;  4DR1 E;  4LFA I;  1HNX I;  4XTJ A;  1KKH A;  4FWD A;  4JI1 E;  4DV4 I;  3T1Y I;  3ZZ0 A;  4JI0 E;  1Z0G A;  4X62 E;  5LL6 R;  4DU7 A;  4DR4 E;  1ZM2 A;  2UUC E;  1USV A;  4LF4 E;  3J7A G;  1N32 I;  4JYA E;  1N36 I;  2UUA E;  4B3M I;  1FWK A;  1XNR I;  4DUZ I;  2HK3 A;  1KTV A;  4WUD A;  3QT6 A;  1Z59 A;  4LFC E;  3PYF A;  5LMU I;  4DV3 E;  1I94 I;  4DPW A;  3F0N A;  4DR6 E;  2OI2 A;  1N0U A;  1FWL A;  2GQ0 A;  1ZXN A;  1H73 A;  2ZIT A;  1VIS A;  3LPS A;  4DR3 E;  4DV2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...