4JI0I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji0I00
4WUDA 4DR6I 1PVGA 1HNXE 4JI6I 2HKJA 2UUCE 4GKJE 4X64E 1XMOI 1DARA 4FWGA 4I3HA 4HYMA 2UU9I 4URLA 4PU9A 3T1HI 1KIJA 4DR6E 1RREA 4JI6E 4XTJA 4FWHA 1XMOE 1PIEA 4LFCI 2UU9E 1I94I 1OJ4A 4JI0I 4DR1I 5LMNI 4P7AA 3ZKDA 4JI5I 1Z59A 3T1YI 4WUCA 3K17A 4B3TI 1FWLA 4UTGA 4KQVA 1NHHA 1QZRA 4LFCE 4LF9E 4ZVIA 4JI0E 1NHJA 4DR1E 2HHHI 5LMNE 1IBLI 1N34I 2CZ9A 3T1YE 4DPWA 4AQYI 4LF5E 3J7AM 4B3TE 2GS8A 4DR7I 3GONA 2ZM6I 1XHKA 2X36A 1D6TA 1H7SA 2HHHE 4DV2I 1XNRI 3QT7A 1IBLE 4UT4A 1N0VC 3PYDA 4DV1I 1N34E 4P52A 4DPYA 5L3JA 4AQYE 4KHPI 4JYAI 4DR2I 4DR7E 2ZM6E 4B3SI 1N32I 2ZBKB 4DV2E 1XNRE 4Z7YA 2HKEA 4DV1E 4DV0I 1UEKA 4M1KA 4KHPE 4FW9A 4JYAE 1Z0GA 4MYUA 3ZKBA 3V5RA 4B3SE 2R3VA 4DV4I 1N32E 4JI2I 2EFGA 1RR9A 4X66I 4JI7I 4DV0E 3QT5A 1N33I 4JI1I 4JG4A 3OTOI 1WUUA 1KTVA 2DEJA 2UXBI 5BR8I 4X66E 4JI7E 4GKKI 1ELOA 1N33E 5GMEA 2WW4A 1Z0WA 4DV5I 4X62E 3OTOE 2UUBI 2R42A 3B78A 4OX9I 2UXBE 4ED4A 5BR8E 4LF8E 4GKKE 1IBKI 3LPSA 1N0UA 4MYTA 4DV5E 2VQFI 2UUBE 1ZM2A 4OX9E 4X65I 2UXCE 4B3MI 2ZITA 4DR4I 1IBKE 4LF9I 2A2DA 1ZM4A 4NXMI 2XEXA 1A6FA 1PKPA 2VQFE 1FWKA 4X65E 2X7IA 2A2CA 4LF5I 1HNWE 4B3ME 2VQEI 3LTOA 4DR4E 1H72C 1MG7A 2BM1A 4NXME 1H7UA 4DPUA 4USMA 4FWDA 2E1RA 4LFBI 1Z0VA 5IWAI 1FKAE 2V2VA 2VQEE 4DXLA 2HK2A 4JI3E 1ZXNA 4DUYI 4LFAI 3F0NA 2UUAI 1EI1A 4LFBE 5IWAE 1XMQI 4EMDA 4DUYE 4HACA 4USKA 4LFAE 5FLXQ 5FLXC 2HFSA 3WU6A 1KVKA 3J81C 2UXDI 2UUAE 1NHIA 1B62A 4HXZA 4DPTA 1FI4A 1VISA 1XMQE 3K1JA 1Z5AA 1BKNA 4HACB 3PYFA 2HK3A 4NXNE 2V8PA 4DV7I 2UXDE 2VF3A 5LL6R 1EA6A 4X62I 2J7KA 3WU5A 4PRVA 4DV7E 3QT8A 4DU7A 4LF8I 4LF7I 1MX0A 2HFUA 3V2UC 4JI4I 3WU4A 3QT6A 3J7AG 2UXCI 3M6AA 4LF7E 4JI4E 5LMUI 1HNZI 3PYEA 2F4VI 2OI2A 4WUBA 1ZM9A 2AJ4A 2DEIA 4DUZE 4HY1A 2V2QA 4DV6I 1N36I 1HNWI 1FNMA 4JI8I 1KKHA 5LMUE 1HNZE 3Q1QA 2F4VE 1ZM3A 5A2QQ 3ZZ0A 5GMDA 2Q2EB 3H4LA 5A2QC 1B63A 4LF4I 3WU3A 1U2RA 4DV6E 1N36E 4JI8E 4JI3I 3ZZTA 4YY3I 3D4JA 1Z0EA 3T1HE 4LF4E 3JAMQ 4R1FA 4YY3E 3JAMC 1I94E 3ZZUA 2E5LI 1S4EA 4K0KI 2BM0A 4JI5E 4NXNI 3J80Q 4JV5I 3B82A 3J81Q 1Z0BA 3J80C 1S16A 4DR5I 2E5LE 4DR3I 1H74A 1XNQI 4K0KE 1Z0CA 1J5EI 2LJPA 1Z5BA 2V34A 1MU5A 1ZXMA 3HULA 4JV5E 4DU8A 4YHHI 4DR5E 3CWVA 4DR3E 1XNQE 2NPFA 4B3RI 1J5EE 1Z5CA 1K47A 4DPXA 4DR2E 1HR0I 4DV3I 4YHHE 4Z7CA 1FJGI 2BV3A 1IBMI 4LF6I 1H73A 5IT9Q 4B3RE 4PRXA 1Z0TA 3B8HA 5IT9C 4FN5A 4DUZI 1HR0E 4RPFA 3ZM7A 4DV3E 1HNXI 3LNUA 2V2ZA 2UUCI 4DV4E 1FJGE 4GKJI 4JI2E 3PYGA 1IBME 4X64I 4LF6E 1NZ0A 4JI1E
chains in the Genus database with same CATH superfamily
3DD6A 3PS1A 4WUDA 4DR6I 1PVGA 1HNXE 2J65A 5C0XB 2HKJA 4JI6I 2UUCE 4GKJE 4MU0A 4X64E 1XMOI 1DARA 4FWGA 4I3HA 4HYMA 5K36A 2UU9I 1RHYA 4URLA 4PU9A 3T1HI 1KIJA 4DR6E 4LOMA 1RREA 4JI6E 4XTJA 4OO1D 4FWHA 1XMOE 1PIEA 1YH8A 5K36B 4LFCI 4IFDD 2UU9E 1I94I 1OJ4A 4JI0I 3UHMA 4DR1I 5LMNI 4P7AA 3ZKDA 4JI5I 3CDIA 1Z59A 3T1YI 2NN6D 4WUCA 3K17A 4FW6A 1UDOA 4B3TI 1FWLA 4UTGA 4KQVA 1NHHA 1QZRA 4LFCE 4LF9E 4ZVIA 4QNKA 4JI0E 1NHJA 4BA1A 3M7ND 4DR1E 2HHHI 5LMNE 1IBLI 2AE8A 1N34I 2CZ9A 3T1YE 2Z5CB 4DPWA 2WNRA 4AQYI 4LF5E 3J7AM 4B3TE 4MU1A 2GS8A 4DR7I 3GONA 2ZM6I 1XHKA 1XXEA 4BA1B 2X36A 1D6TA 1H7SA 1HK7A 2HHHE 4DV2I 1XNRI 3QT7A 5JEAD 3U1YA 1IBLE 4UT4A 1N0VC 3PYDA 4DV1I 1N34E 4P52A 4FW4A 2PNZB 4DPYA 2WNRB 4LCHA 5L3JA 4AQYE 2PO1A 4KHPI 4JYAI 3PS2A 4DR2I 4DR7E 2ZM6E 4B3SI 2GO4A 1Y4UA 1N32I 2ZBKB 4DV2E 1XNRE 1R6LA 4Z7YA 2HKEA 3HKMA 4DV1E 4DV0I 2PO2A 5DROA 4M1KA 1UEKA 3M7NG 4BA2B 2PO1B 5K36D 3U1KA 4KHPE 4FW9A 4JYAE 1Z0GA 4MYUA 1UDNA 3V5RA 3ZKBA 4ISAA 4B3SE 2R3VA 4DV4I 5DRQA 1N32E 4JI2I 2IESA 2IOPA 2EFGA 1RR9A 4X66I 4JI7I 2PO2B 4DV0E 3QT5A 1N33I 2C38A 4JI1I 3K85A 4JG4A 4OO1C 4J3DA 3OTOI 1WUUA 1KTVA 1Y4SA 2DEJA 2UXBI 2PO0A 5BR8I 4X66E 4JI7E 4IZKA 4GKKI 1ELOA 2VESA 1N33E 5GMEA 4IZJB 2WW4A 2O1TA 1Z0WA 3Q6MA 4DV5I 2Z5EA 4X62E 3OTOE 2UUBI 2R42A 3B78A 4OX9I 2PO0B 2UXBE 4ED4A 5BR8E 1USVA 4LF8E 4IZKB 2PNLA 3P06A 4GKKE 1IBKI 3PRYA 1E3PA 3LPSA 1N0UA 1R6MA 1Y5YA 4MYTA 4DV5E 2VQFI 2CVEA 2UUBE 1ZM2A 4OO1F 4OX9E 4X65I 2UXCE 5DNLA 4IFDF 4B3MI 1Y6ZA 5JEAC 5C0XC 2ZITA 4DR4I 1IBKE 4LF9I 2A2DA 1ZM4A 4U3DA 4NXMI 5DRPA 1UDQA 2XEXA 1A6FA 1PKPA 2VQFE 2NN6F 1FWKA 4QNJA 4X65E 4IS9A 2F1DA 2Z5CA 2X7IA 2A2CA 4LF5I 1HNWE 4B3ME 2VQEI 3LTOA 4DR4E 1H72C 1MG7A 3P3GA 2BM1A 4NXME 5K36C 1H7UA 4DPUA 2BR2B 4USMA 1P42A 3GCMA 4FWDA 2E1RA 2PNZA 4LFBI 4N3OA 1Z0VA 5IWAI 1FKAE 3M85D 2V2VA 2VQEE 4DXLA 2HK2A 4JI3E 1ZXNA 4DUYI 1OYSA 4FW7A 4LFAI 1UDSA 4AM3A 5JEAF 3KRNA 4MQYA 3F0NA 5C0XD 2UUAI 5DRRA 1EI1A 4LFBE 4OO1E 1Y60A 5IWAE 1XMQI 4BA2A 4IFDE 4EMDA 4DUYE 4HACA 4USKA 2BA1D 4LFAE 5FLXQ 5FLXC 2HFSA 3WU6A 1KVKA 3J81C 2UXDI 2UUAE 1NHIA 1B62A 5K36F 4HXZA 2PNMA 2NN6E 4DPTA 1FI4A 1VISA 1XMQE 3K1JA 3Q6NA 1Z5AA 1BKNA 4HACB 3PYFA 2HK3A 4NXNE 2V8PA 3M85G 4DV7I 2JEBA 2UXDE 4OZEA 4FW5A 2VF3A 4IZJA 4IFDB 2JT2A 5LL6R 1EA6A 2C39A 4X62I 2J7KA 2JE6A 2WP8A 3WU5A 4PRVA 2JEBB 2O1UA 3QT8A 4DU7A 4DV7E 5JEAE 4LF8I 4LF7I 1MX0A 2HFUA 2GQ0A 2NN6B 3V2UC 4JI4I 2C39B 3WU4A 3QT6A 2JE6B 2WP8B 3P3EA 2O3ZA 3J7AG 2C37A 2O1VA 2UXCI 3M6AA 4LF7E 4FW3A 4JI4E 5EKWA 5LMUI 5K36E 1HNZI 3PYEA 4AIMA 2F4VI 2OI2A 4NBQA 4WUBA 1ZM9A 2AJ4A 2DEIA 2C37B 2GO3A 4DUZE 4HY1A 2V2QA 5JEAB 4DV6I 2CGEA 1N36I 1HNWI 4MDTA 1FNMA 5ELWA 4JI8I 3GLLA 1KKHA 5LMUE 1HNZE 3Q1QA 2F4VE 1ZM3A 2BR2A 2IOQA 5GMDA 4OKGA 3ZZ0A 4LCFA 5A2QQ 2Q2EB 3H4LA 5A2QC 5FWKA 1B63A 4LF4I 3WU3A 1U2RA 4DV6E 1N36E 2O1WA 4JI8E 4JI3I 3ZZTA 2BA0D 3NZKA 4YY3I 3D4JA 5DNXA 3PS3A 1Z0EA 3T1HE 1VI7A 4LF4E 4U3BA 4IZJD 3JAMQ 4R1FA 4AIDA 5C0XF 4YY3E 3JAMC 1USUA 1I94E 3ZZUA 2E5LI 1S4EA 4K0KI 2BM0A 3HJCA 4JI5E 2IERA 4MU3A 4NXNI 5EL9A 2Z5BA 3J80Q 4JV5I 3B4TA 3B82A 3J81Q 1Z0BA 3J80C 1S16A 4DR5I 2E5LE 2BA0G 4DR3I 1H74A 4OO1A 1XNQI 4K0KE 1Z0CA 1J5EI 2LJPA 3GMEA 1Z5BA 2V34A 4IFDA 1OYRA 1MU5A 1ZXMA 4LPFA 3HULA 2Z5BB 4JV5E 4DU8A 4MU4A 4YHHI 3H1CA 3P3CA 4DR5E 3L7ZA 3CWVA 2NN6A 2JEAA 4OO1B 4DR3E 1XNQE 2NPFA 3P76A 4B3RI 1J5EE 1Z5CA 1OYPA 4LCGA 1K47A 4DPXA 4DR2E 1HR0I 4DV3I 5C0XE 4YHHE 4Z7CA 1FJGI 3L7ZB 2BV3A 1IBMI 2BA1G 2JEAB 4LF6I 4GQUA 1H73A 5IT9Q 4B3RE 4PRXA 1Z0TA 3CDJA 1E3HA 3B8HA 5IT9C 4FN5A 4DUZI 1HR0E 2CG9A 4RPFA 4IFDC 3ZM7A 4DV3E 1HNXI 3LNUA 5JEAA 2V2ZA 5C0XA 2UUCI 1YHCA 4DV4E 1FJGE 4GKJI 4JI2E 3PYGA 1IBME 4X64I 4LF6E 1NZ0A 2C38B 2NN6C 4JI1E
chains in the Genus database with same CATH topology
4WUDA 4DR6I 1PVGA 1HNXE 4JI6I 2HKJA 2UUCE 4GKJE 4X64E 1XMOI 1DARA 4FWGA 4I3HA 4HYMA 2UU9I 4URLA 4PU9A 3T1HI 1KIJA 4DR6E 1RREA 4JI6E 4XTJA 4FWHA 1XMOE 1PIEA 4LFCI 2UU9E 1I94I 1OJ4A 4JI0I 4DR1I 5LMNI 4P7AA 3ZKDA 4JI5I 1Z59A 3T1YI 4WUCA 3K17A 4B3TI 1FWLA 4UTGA 4KQVA 1NHHA 1QZRA 4LFCE 4LF9E 4ZVIA 4JI0E 1NHJA 4DR1E 2HHHI 5LMNE 1IBLI 1N34I 2CZ9A 3T1YE 2Z5CB 4DPWA 4AQYI 4LF5E 3J7AM 4B3TE 2GS8A 4DR7I 3GONA 2ZM6I 1XHKA 2X36A 1D6TA 1H7SA 1HK7A 2HHHE 4DV2I 1XNRI 3QT7A 1IBLE 4UT4A 1N0VC 3PYDA 4DV1I 1N34E 4P52A 4DPYA 5L3JA 4AQYE 4KHPI 4JYAI 4DR2I 4DR7E 2ZM6E 4B3SI 1Y4UA 1N32I 2ZBKB 4DV2E 1XNRE 4Z7YA 2HKEA 4DV1E 4DV0I 1UEKA 4M1KA 4KHPE 4FW9A 4JYAE 1Z0GA 4MYUA 3ZKBA 3V5RA 4B3SE 2R3VA 4DV4I 1N32E 4JI2I 2IOPA 2EFGA 1RR9A 4X66I 4JI7I 4DV0E 3QT5A 1N33I 4JI1I 3K85A 4JG4A 3OTOI 1WUUA 1KTVA 1Y4SA 2DEJA 2UXBI 5BR8I 4X66E 4JI7E 4IZKA 4GKKI 1ELOA 1N33E 5GMEA 4IZJB 2WW4A 2O1TA 1Z0WA 3Q6MA 4DV5I 2Z5EA 4X62E 3OTOE 2UUBI 2R42A 3B78A 4OX9I 2UXBE 4ED4A 5BR8E 1USVA 4LF8E 4IZKB 2PNLA 3P06A 4GKKE 1IBKI 3PRYA 3LPSA 1N0UA 4MYTA 4DV5E 2VQFI 2UUBE 1ZM2A 4OX9E 4X65I 2UXCE 4B3MI 1Y6ZA 2ZITA 4DR4I 1IBKE 4LF9I 2A2DA 1ZM4A 4NXMI 2XEXA 1A6FA 1PKPA 2VQFE 1FWKA 4X65E 2Z5CA 2X7IA 2A2CA 4LF5I 1HNWE 4B3ME 2VQEI 3LTOA 4DR4E 1H72C 1MG7A 2BM1A 4NXME 1H7UA 4DPUA 4USMA 4FWDA 2E1RA 4LFBI 4N3OA 1Z0VA 5IWAI 1FKAE 2V2VA 2VQEE 4DXLA 2HK2A 4JI3E 1ZXNA 4DUYI 4LFAI 3F0NA 2UUAI 1EI1A 4LFBE 5IWAE 1XMQI 4EMDA 4DUYE 4HACA 4USKA 4LFAE 5FLXQ 5FLXC 2HFSA 3WU6A 1KVKA 3J81C 2UXDI 2UUAE 1NHIA 1B62A 4HXZA 2PNMA 4DPTA 1FI4A 1VISA 1XMQE 3K1JA 3Q6NA 1Z5AA 1BKNA 4HACB 3PYFA 2HK3A 4NXNE 2V8PA 4DV7I 2UXDE 2VF3A 4IZJA 5LL6R 1EA6A 4X62I 2J7KA 3WU5A 4PRVA 2O1UA 3QT8A 4DU7A 4DV7E 4LF8I 4LF7I 1MX0A 2HFUA 2GQ0A 3V2UC 4JI4I 3WU4A 3QT6A 3J7AG 2O1VA 2UXCI 3M6AA 4LF7E 4JI4E 5LMUI 1HNZI 3PYEA 2F4VI 2OI2A 4WUBA 1ZM9A 2AJ4A 2DEIA 4DUZE 4HY1A 2V2QA 4DV6I 2CGEA 1N36I 1HNWI 1FNMA 4JI8I 1KKHA 5LMUE 1HNZE 3Q1QA 2F4VE 1ZM3A 5A2QQ 2IOQA 5GMDA 3ZZ0A 2Q2EB 3H4LA 5A2QC 5FWKA 1B63A 4LF4I 3WU3A 1U2RA 4DV6E 1N36E 2O1WA 4JI8E 4JI3I 3ZZTA 4YY3I 3D4JA 1Z0EA 3T1HE 4LF4E 4IZJD 3JAMQ 4R1FA 4YY3E 3JAMC 1USUA 1I94E 3ZZUA 2E5LI 1S4EA 4K0KI 2BM0A 3HJCA 4JI5E 4NXNI 2Z5BA 3J80Q 4JV5I 3B82A 3J81Q 1Z0BA 3J80C 1S16A 4DR5I 2E5LE 4DR3I 1H74A 1XNQI 4K0KE 1Z0CA 1J5EI 2LJPA 1Z5BA 2V34A 1MU5A 1ZXMA 3HULA 2Z5BB 4JV5E 4DU8A 4YHHI 4DR5E 3CWVA 4DR3E 1XNQE 2NPFA 4B3RI 1J5EE 1Z5CA 1K47A 4DPXA 4DR2E 1HR0I 4DV3I 4YHHE 4Z7CA 1FJGI 2BV3A 1IBMI 4LF6I 1H73A 5IT9Q 4B3RE 4PRXA 1Z0TA 3B8HA 5IT9C 4FN5A 4DUZI 1HR0E 2CG9A 4RPFA 3ZM7A 4DV3E 1HNXI 3LNUA 2V2ZA 2UUCI 4DV4E 1FJGE 4GKJI 4JI2E 3PYGA 1IBME 4X64I 4LF6E 1NZ0A 4JI1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUD A;  4DR6 I;  1PVG A;  1HNX E;  4JI6 I;  2HKJ A;  2UUC E;  4GKJ E;  4X64 E;  1XMO I;  1DAR A;  4FWG A;  4I3H A;  4HYM A;  2UU9 I;  4URL A;  4PU9 A;  3T1H I;  1KIJ A;  4DR6 E;  1RRE A;  4JI6 E;  4XTJ A;  4FWH A;  1XMO E;  1PIE A;  4LFC I;  2UU9 E;  1I94 I;  1OJ4 A;  4JI0 I;  4DR1 I;  5LMN I;  4P7A A;  3ZKD A;  4JI5 I;  1Z59 A;  3T1Y I;  4WUC A;  3K17 A;  4B3T I;  1FWL A;  4UTG A;  4KQV A;  1NHH A;  1QZR A;  4LFC E;  4LF9 E;  4ZVI A;  4JI0 E;  1NHJ A;  4DR1 E;  2HHH I;  5LMN E;  1IBL I;  1N34 I;  2CZ9 A;  3T1Y E;  4DPW A;  4AQY I;  4LF5 E;  3J7A M;  4B3T E;  2GS8 A;  4DR7 I;  3GON A;  2ZM6 I;  1XHK A;  2X36 A;  1D6T A;  1H7S A;  2HHH E;  4DV2 I;  1XNR I;  3QT7 A;  1IBL E;  4UT4 A;  1N0V C;  3PYD A;  4DV1 I;  1N34 E;  4P52 A;  4DPY A;  5L3J A;  4AQY E;  4KHP I;  4JYA I;  4DR2 I;  4DR7 E;  2ZM6 E;  4B3S I;  1N32 I;  2ZBK B;  4DV2 E;  1XNR E;  4Z7Y A;  2HKE A;  4DV1 E;  4DV0 I;  1UEK A;  4M1K A;  4KHP E;  4FW9 A;  4JYA E;  1Z0G A;  4MYU A;  3ZKB A;  3V5R A;  4B3S E;  2R3V A;  4DV4 I;  1N32 E;  4JI2 I;  2EFG A;  1RR9 A;  4X66 I;  4JI7 I;  4DV0 E;  3QT5 A;  1N33 I;  4JI1 I;  4JG4 A;  3OTO I;  1WUU A;  1KTV A;  2DEJ A;  2UXB I;  5BR8 I;  4X66 E;  4JI7 E;  4GKK I;  1ELO A;  1N33 E;  5GME A;  2WW4 A;  1Z0W A;  4DV5 I;  4X62 E;  3OTO E;  2UUB I;  2R42 A;  3B78 A;  4OX9 I;  2UXB E;  4ED4 A;  5BR8 E;  4LF8 E;  4GKK E;  1IBK I;  3LPS A;  1N0U A;  4MYT A;  4DV5 E;  2VQF I;  2UUB E;  1ZM2 A;  4OX9 E;  4X65 I;  2UXC E;  4B3M I;  2ZIT A;  4DR4 I;  1IBK E;  4LF9 I;  2A2D A;  1ZM4 A;  4NXM I;  2XEX A;  1A6F A;  1PKP A;  2VQF E;  1FWK A;  4X65 E;  2X7I A;  2A2C A;  4LF5 I;  1HNW E;  4B3M E;  2VQE I;  3LTO A;  4DR4 E;  1H72 C;  1MG7 A;  2BM1 A;  4NXM E;  1H7U A;  4DPU A;  4USM A;  4FWD A;  2E1R A;  4LFB I;  1Z0V A;  5IWA I;  1FKA E;  2V2V A;  2VQE E;  4DXL A;  2HK2 A;  4JI3 E;  1ZXN A;  4DUY I;  4LFA I;  3F0N A;  2UUA I;  1EI1 A;  4LFB E;  5IWA E;  1XMQ I;  4EMD A;  4DUY E;  4HAC A;  4USK A;  4LFA E;  5FLX Q;  5FLX C;  2HFS A;  3WU6 A;  1KVK A;  3J81 C;  2UXD I;  2UUA E;  1NHI A;  1B62 A;  4HXZ A;  4DPT A;  1FI4 A;  1VIS A;  1XMQ E;  3K1J A;  1Z5A A;  1BKN A;  4HAC B;  3PYF A;  2HK3 A;  4NXN E;  2V8P A;  4DV7 I;  2UXD E;  2VF3 A;  5LL6 R;  1EA6 A;  4X62 I;  2J7K A;  3WU5 A;  4PRV A;  4DV7 E;  3QT8 A;  4DU7 A;  4LF8 I;  4LF7 I;  1MX0 A;  2HFU A;  3V2U C;  4JI4 I;  3WU4 A;  3QT6 A;  3J7A G;  2UXC I;  3M6A A;  4LF7 E;  4JI4 E;  5LMU I;  1HNZ I;  3PYE A;  2F4V I;  2OI2 A;  4WUB A;  1ZM9 A;  2AJ4 A;  2DEI A;  4DUZ E;  4HY1 A;  2V2Q A;  4DV6 I;  1N36 I;  1HNW I;  1FNM A;  4JI8 I;  1KKH A;  5LMU E;  1HNZ E;  3Q1Q A;  2F4V E;  1ZM3 A;  5A2Q Q;  3ZZ0 A;  5GMD A;  2Q2E B;  3H4L A;  5A2Q C;  1B63 A;  4LF4 I;  3WU3 A;  1U2R A;  4DV6 E;  1N36 E;  4JI8 E;  4JI3 I;  3ZZT A;  4YY3 I;  3D4J A;  1Z0E A;  3T1H E;  4LF4 E;  3JAM Q;  4R1F A;  4YY3 E;  3JAM C;  1I94 E;  3ZZU A;  2E5L I;  1S4E A;  4K0K I;  2BM0 A;  4JI5 E;  4NXN I;  3J80 Q;  4JV5 I;  3B82 A;  3J81 Q;  1Z0B A;  3J80 C;  1S16 A;  4DR5 I;  2E5L E;  4DR3 I;  1H74 A;  1XNQ I;  4K0K E;  1Z0C A;  1J5E I;  2LJP A;  1Z5B A;  2V34 A;  1MU5 A;  1ZXM A;  3HUL A;  4JV5 E;  4DU8 A;  4YHH I;  4DR5 E;  3CWV A;  4DR3 E;  1XNQ E;  2NPF A;  4B3R I;  1J5E E;  1Z5C A;  1K47 A;  4DPX A;  4DR2 E;  1HR0 I;  4DV3 I;  4YHH E;  4Z7C A;  1FJG I;  2BV3 A;  1IBM I;  4LF6 I;  1H73 A;  5IT9 Q;  4B3R E;  4PRX A;  1Z0T A;  3B8H A;  5IT9 C;  4FN5 A;  4DUZ I;  1HR0 E;  4RPF A;  3ZM7 A;  4DV3 E;  1HNX I;  3LNU A;  2V2Z A;  2UUC I;  4DV4 E;  1FJG E;  4GKJ I;  4JI2 E;  3PYG A;  1IBM E;  4X64 I;  4LF6 E;  1NZ0 A;  4JI1 E; 
#chains in the Genus database with same CATH topology
 3DD6 A;  3PS1 A;  4WUD A;  4DR6 I;  1PVG A;  1HNX E;  2J65 A;  5C0X B;  2HKJ A;  4JI6 I;  2UUC E;  4GKJ E;  4MU0 A;  4X64 E;  1XMO I;  1DAR A;  4FWG A;  4I3H A;  4HYM A;  5K36 A;  2UU9 I;  1RHY A;  4URL A;  4PU9 A;  3T1H I;  1KIJ A;  4DR6 E;  4LOM A;  1RRE A;  4JI6 E;  4XTJ A;  4OO1 D;  4FWH A;  1XMO E;  1PIE A;  1YH8 A;  5K36 B;  4LFC I;  4IFD D;  2UU9 E;  1I94 I;  1OJ4 A;  4JI0 I;  3UHM A;  4DR1 I;  5LMN I;  4P7A A;  3ZKD A;  4JI5 I;  3CDI A;  1Z59 A;  3T1Y I;  2NN6 D;  4WUC A;  3K17 A;  4FW6 A;  1UDO A;  4B3T I;  1FWL A;  4UTG A;  4KQV A;  1NHH A;  1QZR A;  4LFC E;  4LF9 E;  4ZVI A;  4QNK A;  4JI0 E;  1NHJ A;  4BA1 A;  3M7N D;  4DR1 E;  2HHH I;  5LMN E;  1IBL I;  2AE8 A;  1N34 I;  2CZ9 A;  3T1Y E;  2Z5C B;  4DPW A;  2WNR A;  4AQY I;  4LF5 E;  3J7A M;  4B3T E;  4MU1 A;  2GS8 A;  4DR7 I;  3GON A;  2ZM6 I;  1XHK A;  1XXE A;  4BA1 B;  2X36 A;  1D6T A;  1H7S A;  1HK7 A;  2HHH E;  4DV2 I;  1XNR I;  3QT7 A;  5JEA D;  3U1Y A;  1IBL E;  4UT4 A;  1N0V C;  3PYD A;  4DV1 I;  1N34 E;  4P52 A;  4FW4 A;  2PNZ B;  4DPY A;  2WNR B;  4LCH A;  5L3J A;  4AQY E;  2PO1 A;  4KHP I;  4JYA I;  3PS2 A;  4DR2 I;  4DR7 E;  2ZM6 E;  4B3S I;  2GO4 A;  1Y4U A;  1N32 I;  2ZBK B;  4DV2 E;  1XNR E;  1R6L A;  4Z7Y A;  2HKE A;  3HKM A;  4DV1 E;  4DV0 I;  2PO2 A;  5DRO A;  4M1K A;  1UEK A;  3M7N G;  4BA2 B;  2PO1 B;  5K36 D;  3U1K A;  4KHP E;  4FW9 A;  4JYA E;  1Z0G A;  4MYU A;  1UDN A;  3V5R A;  3ZKB A;  4ISA A;  4B3S E;  2R3V A;  4DV4 I;  5DRQ A;  1N32 E;  4JI2 I;  2IES A;  2IOP A;  2EFG A;  1RR9 A;  4X66 I;  4JI7 I;  2PO2 B;  4DV0 E;  3QT5 A;  1N33 I;  2C38 A;  4JI1 I;  3K85 A;  4JG4 A;  4OO1 C;  4J3D A;  3OTO I;  1WUU A;  1KTV A;  1Y4S A;  2DEJ A;  2UXB I;  2PO0 A;  5BR8 I;  4X66 E;  4JI7 E;  4IZK A;  4GKK I;  1ELO A;  2VES A;  1N33 E;  5GME A;  4IZJ B;  2WW4 A;  2O1T A;  1Z0W A;  3Q6M A;  4DV5 I;  2Z5E A;  4X62 E;  3OTO E;  2UUB I;  2R42 A;  3B78 A;  4OX9 I;  2PO0 B;  2UXB E;  4ED4 A;  5BR8 E;  1USV A;  4LF8 E;  4IZK B;  2PNL A;  3P06 A;  4GKK E;  1IBK I;  3PRY A;  1E3P A;  3LPS A;  1N0U A;  1R6M A;  1Y5Y A;  4MYT A;  4DV5 E;  2VQF I;  2CVE A;  2UUB E;  1ZM2 A;  4OO1 F;  4OX9 E;  4X65 I;  2UXC E;  5DNL A;  4IFD F;  4B3M I;  1Y6Z A;  5JEA C;  5C0X C;  2ZIT A;  4DR4 I;  1IBK E;  4LF9 I;  2A2D A;  1ZM4 A;  4U3D A;  4NXM I;  5DRP A;  1UDQ A;  2XEX A;  1A6F A;  1PKP A;  2VQF E;  2NN6 F;  1FWK A;  4QNJ A;  4X65 E;  4IS9 A;  2F1D A;  2Z5C A;  2X7I A;  2A2C A;  4LF5 I;  1HNW E;  4B3M E;  2VQE I;  3LTO A;  4DR4 E;  1H72 C;  1MG7 A;  3P3G A;  2BM1 A;  4NXM E;  5K36 C;  1H7U A;  4DPU A;  2BR2 B;  4USM A;  1P42 A;  3GCM A;  4FWD A;  2E1R A;  2PNZ A;  4LFB I;  4N3O A;  1Z0V A;  5IWA I;  1FKA E;  3M85 D;  2V2V A;  2VQE E;  4DXL A;  2HK2 A;  4JI3 E;  1ZXN A;  4DUY I;  1OYS A;  4FW7 A;  4LFA I;  1UDS A;  4AM3 A;  5JEA F;  3KRN A;  4MQY A;  3F0N A;  5C0X D;  2UUA I;  5DRR A;  1EI1 A;  4LFB E;  4OO1 E;  1Y60 A;  5IWA E;  1XMQ I;  4BA2 A;  4IFD E;  4EMD A;  4DUY E;  4HAC A;  4USK A;  2BA1 D;  4LFA E;  5FLX Q;  5FLX C;  2HFS A;  3WU6 A;  1KVK A;  3J81 C;  2UXD I;  2UUA E;  1NHI A;  1B62 A;  5K36 F;  4HXZ A;  2PNM A;  2NN6 E;  4DPT A;  1FI4 A;  1VIS A;  1XMQ E;  3K1J A;  3Q6N A;  1Z5A A;  1BKN A;  4HAC B;  3PYF A;  2HK3 A;  4NXN E;  2V8P A;  3M85 G;  4DV7 I;  2JEB A;  2UXD E;  4OZE A;  4FW5 A;  2VF3 A;  4IZJ A;  4IFD B;  2JT2 A;  5LL6 R;  1EA6 A;  2C39 A;  4X62 I;  2J7K A;  2JE6 A;  2WP8 A;  3WU5 A;  4PRV A;  2JEB B;  2O1U A;  3QT8 A;  4DU7 A;  4DV7 E;  5JEA E;  4LF8 I;  4LF7 I;  1MX0 A;  2HFU A;  2GQ0 A;  2NN6 B;  3V2U C;  4JI4 I;  2C39 B;  3WU4 A;  3QT6 A;  2JE6 B;  2WP8 B;  3P3E A;  2O3Z A;  3J7A G;  2C37 A;  2O1V A;  2UXC I;  3M6A A;  4LF7 E;  4FW3 A;  4JI4 E;  5EKW A;  5LMU I;  5K36 E;  1HNZ I;  3PYE A;  4AIM A;  2F4V I;  2OI2 A;  4NBQ A;  4WUB A;  1ZM9 A;  2AJ4 A;  2DEI A;  2C37 B;  2GO3 A;  4DUZ E;  4HY1 A;  2V2Q A;  5JEA B;  4DV6 I;  2CGE A;  1N36 I;  1HNW I;  4MDT A;  1FNM A;  5ELW A;  4JI8 I;  3GLL A;  1KKH A;  5LMU E;  1HNZ E;  3Q1Q A;  2F4V E;  1ZM3 A;  2BR2 A;  2IOQ A;  5GMD A;  4OKG A;  3ZZ0 A;  4LCF A;  5A2Q Q;  2Q2E B;  3H4L A;  5A2Q C;  5FWK A;  1B63 A;  4LF4 I;  3WU3 A;  1U2R A;  4DV6 E;  1N36 E;  2O1W A;  4JI8 E;  4JI3 I;  3ZZT A;  2BA0 D;  3NZK A;  4YY3 I;  3D4J A;  5DNX A;  3PS3 A;  1Z0E A;  3T1H E;  1VI7 A;  4LF4 E;  4U3B A;  4IZJ D;  3JAM Q;  4R1F A;  4AID A;  5C0X F;  4YY3 E;  3JAM C;  1USU A;  1I94 E;  3ZZU A;  2E5L I;  1S4E A;  4K0K I;  2BM0 A;  3HJC A;  4JI5 E;  2IER A;  4MU3 A;  4NXN I;  5EL9 A;  2Z5B A;  3J80 Q;  4JV5 I;  3B4T A;  3B82 A;  3J81 Q;  1Z0B A;  3J80 C;  1S16 A;  4DR5 I;  2E5L E;  2BA0 G;  4DR3 I;  1H74 A;  4OO1 A;  1XNQ I;  4K0K E;  1Z0C A;  1J5E I;  2LJP A;  3GME A;  1Z5B A;  2V34 A;  4IFD A;  1OYR A;  1MU5 A;  1ZXM A;  4LPF A;  3HUL A;  2Z5B B;  4JV5 E;  4DU8 A;  4MU4 A;  4YHH I;  3H1C A;  3P3C A;  4DR5 E;  3L7Z A;  3CWV A;  2NN6 A;  2JEA A;  4OO1 B;  4DR3 E;  1XNQ E;  2NPF A;  3P76 A;  4B3R I;  1J5E E;  1Z5C A;  1OYP A;  4LCG A;  1K47 A;  4DPX A;  4DR2 E;  1HR0 I;  4DV3 I;  5C0X E;  4YHH E;  4Z7C A;  1FJG I;  3L7Z B;  2BV3 A;  1IBM I;  2BA1 G;  2JEA B;  4LF6 I;  4GQU A;  1H73 A;  5IT9 Q;  4B3R E;  4PRX A;  1Z0T A;  3CDJ A;  1E3H A;  3B8H A;  5IT9 C;  4FN5 A;  4DUZ I;  1HR0 E;  2CG9 A;  4RPF A;  4IFD C;  3ZM7 A;  4DV3 E;  1HNX I;  3LNU A;  5JEA A;  2V2Z A;  5C0X A;  2UUC I;  1YHC A;  4DV4 E;  1FJG E;  4GKJ I;  4JI2 E;  3PYG A;  1IBM E;  4X64 I;  4LF6 E;  1NZ0 A;  2C38 B;  2NN6 C;  4JI1 E; 
#chains in the Genus database with same CATH homology
 4WUD A;  4DR6 I;  1PVG A;  1HNX E;  4JI6 I;  2HKJ A;  2UUC E;  4GKJ E;  4X64 E;  1XMO I;  1DAR A;  4FWG A;  4I3H A;  4HYM A;  2UU9 I;  4URL A;  4PU9 A;  3T1H I;  1KIJ A;  4DR6 E;  1RRE A;  4JI6 E;  4XTJ A;  4FWH A;  1XMO E;  1PIE A;  4LFC I;  2UU9 E;  1I94 I;  1OJ4 A;  4JI0 I;  4DR1 I;  5LMN I;  4P7A A;  3ZKD A;  4JI5 I;  1Z59 A;  3T1Y I;  4WUC A;  3K17 A;  4B3T I;  1FWL A;  4UTG A;  4KQV A;  1NHH A;  1QZR A;  4LFC E;  4LF9 E;  4ZVI A;  4JI0 E;  1NHJ A;  4DR1 E;  2HHH I;  5LMN E;  1IBL I;  1N34 I;  2CZ9 A;  3T1Y E;  2Z5C B;  4DPW A;  4AQY I;  4LF5 E;  3J7A M;  4B3T E;  2GS8 A;  4DR7 I;  3GON A;  2ZM6 I;  1XHK A;  2X36 A;  1D6T A;  1H7S A;  1HK7 A;  2HHH E;  4DV2 I;  1XNR I;  3QT7 A;  1IBL E;  4UT4 A;  1N0V C;  3PYD A;  4DV1 I;  1N34 E;  4P52 A;  4DPY A;  5L3J A;  4AQY E;  4KHP I;  4JYA I;  4DR2 I;  4DR7 E;  2ZM6 E;  4B3S I;  1Y4U A;  1N32 I;  2ZBK B;  4DV2 E;  1XNR E;  4Z7Y A;  2HKE A;  4DV1 E;  4DV0 I;  1UEK A;  4M1K A;  4KHP E;  4FW9 A;  4JYA E;  1Z0G A;  4MYU A;  3ZKB A;  3V5R A;  4B3S E;  2R3V A;  4DV4 I;  1N32 E;  4JI2 I;  2IOP A;  2EFG A;  1RR9 A;  4X66 I;  4JI7 I;  4DV0 E;  3QT5 A;  1N33 I;  4JI1 I;  3K85 A;  4JG4 A;  3OTO I;  1WUU A;  1KTV A;  1Y4S A;  2DEJ A;  2UXB I;  5BR8 I;  4X66 E;  4JI7 E;  4IZK A;  4GKK I;  1ELO A;  1N33 E;  5GME A;  4IZJ B;  2WW4 A;  2O1T A;  1Z0W A;  3Q6M A;  4DV5 I;  2Z5E A;  4X62 E;  3OTO E;  2UUB I;  2R42 A;  3B78 A;  4OX9 I;  2UXB E;  4ED4 A;  5BR8 E;  1USV A;  4LF8 E;  4IZK B;  2PNL A;  3P06 A;  4GKK E;  1IBK I;  3PRY A;  3LPS A;  1N0U A;  4MYT A;  4DV5 E;  2VQF I;  2UUB E;  1ZM2 A;  4OX9 E;  4X65 I;  2UXC E;  4B3M I;  1Y6Z A;  2ZIT A;  4DR4 I;  1IBK E;  4LF9 I;  2A2D A;  1ZM4 A;  4NXM I;  2XEX A;  1A6F A;  1PKP A;  2VQF E;  1FWK A;  4X65 E;  2Z5C A;  2X7I A;  2A2C A;  4LF5 I;  1HNW E;  4B3M E;  2VQE I;  3LTO A;  4DR4 E;  1H72 C;  1MG7 A;  2BM1 A;  4NXM E;  1H7U A;  4DPU A;  4USM A;  4FWD A;  2E1R A;  4LFB I;  4N3O A;  1Z0V A;  5IWA I;  1FKA E;  2V2V A;  2VQE E;  4DXL A;  2HK2 A;  4JI3 E;  1ZXN A;  4DUY I;  4LFA I;  3F0N A;  2UUA I;  1EI1 A;  4LFB E;  5IWA E;  1XMQ I;  4EMD A;  4DUY E;  4HAC A;  4USK A;  4LFA E;  5FLX Q;  5FLX C;  2HFS A;  3WU6 A;  1KVK A;  3J81 C;  2UXD I;  2UUA E;  1NHI A;  1B62 A;  4HXZ A;  2PNM A;  4DPT A;  1FI4 A;  1VIS A;  1XMQ E;  3K1J A;  3Q6N A;  1Z5A A;  1BKN A;  4HAC B;  3PYF A;  2HK3 A;  4NXN E;  2V8P A;  4DV7 I;  2UXD E;  2VF3 A;  4IZJ A;  5LL6 R;  1EA6 A;  4X62 I;  2J7K A;  3WU5 A;  4PRV A;  2O1U A;  3QT8 A;  4DU7 A;  4DV7 E;  4LF8 I;  4LF7 I;  1MX0 A;  2HFU A;  2GQ0 A;  3V2U C;  4JI4 I;  3WU4 A;  3QT6 A;  3J7A G;  2O1V A;  2UXC I;  3M6A A;  4LF7 E;  4JI4 E;  5LMU I;  1HNZ I;  3PYE A;  2F4V I;  2OI2 A;  4WUB A;  1ZM9 A;  2AJ4 A;  2DEI A;  4DUZ E;  4HY1 A;  2V2Q A;  4DV6 I;  2CGE A;  1N36 I;  1HNW I;  1FNM A;  4JI8 I;  1KKH A;  5LMU E;  1HNZ E;  3Q1Q A;  2F4V E;  1ZM3 A;  5A2Q Q;  2IOQ A;  5GMD A;  3ZZ0 A;  2Q2E B;  3H4L A;  5A2Q C;  5FWK A;  1B63 A;  4LF4 I;  3WU3 A;  1U2R A;  4DV6 E;  1N36 E;  2O1W A;  4JI8 E;  4JI3 I;  3ZZT A;  4YY3 I;  3D4J A;  1Z0E A;  3T1H E;  4LF4 E;  4IZJ D;  3JAM Q;  4R1F A;  4YY3 E;  3JAM C;  1USU A;  1I94 E;  3ZZU A;  2E5L I;  1S4E A;  4K0K I;  2BM0 A;  3HJC A;  4JI5 E;  4NXN I;  2Z5B A;  3J80 Q;  4JV5 I;  3B82 A;  3J81 Q;  1Z0B A;  3J80 C;  1S16 A;  4DR5 I;  2E5L E;  4DR3 I;  1H74 A;  1XNQ I;  4K0K E;  1Z0C A;  1J5E I;  2LJP A;  1Z5B A;  2V34 A;  1MU5 A;  1ZXM A;  3HUL A;  2Z5B B;  4JV5 E;  4DU8 A;  4YHH I;  4DR5 E;  3CWV A;  4DR3 E;  1XNQ E;  2NPF A;  4B3R I;  1J5E E;  1Z5C A;  1K47 A;  4DPX A;  4DR2 E;  1HR0 I;  4DV3 I;  4YHH E;  4Z7C A;  1FJG I;  2BV3 A;  1IBM I;  4LF6 I;  1H73 A;  5IT9 Q;  4B3R E;  4PRX A;  1Z0T A;  3B8H A;  5IT9 C;  4FN5 A;  4DUZ I;  1HR0 E;  2CG9 A;  4RPF A;  3ZM7 A;  4DV3 E;  1HNX I;  3LNU A;  2V2Z A;  2UUC I;  4DV4 E;  1FJG E;  4GKJ I;  4JI2 E;  3PYG A;  1IBM E;  4X64 I;  4LF6 E;  1NZ0 A;  4JI1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...