4JI0I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji0I00
4K0KI 4FW9A 4DV4E 1KTVA 2VQFE 3ZZ0A 3Q1QA 1DARA 2X36A 1XNQI 5LL6R 3PYEA 2UXDE 5FLXQ 4Z7YA 4LF5E 2OI2A 2HK2A 3QT5A 2BV3A 4JI7E 4X65I 4DV0E 4DPXA 4JI5E 2UUAE 5IWAE 1N34E 4NXME 1IBKI 1N33I 2NPFA 4DU7A 4DPTA 3ZKBA 1RREA 2E5LI 1OJ4A 4DR7E 1ZM9A 5GMEA 1XMOI 4JI3E 1ZXNA 4JV5I 4DV5I 2VQEE 1IBKE 4PRXA 3D4JA 1Z5BA 4JI0I 4DV1E 2A2DA 2HHHI 3M6AA 4DV6E 4JI2I 2BM1A 3B78A 2V34A 2X7IA 1XMOE 4DV5E 2XEXA 1HNWE 1MU5A 4R1FA 1Z0VA 4XTJA 5BR8I 4X66E 3T1YE 3ZKDA 1ZXMA 4NXNI 4UTGA 5IT9C 3OTOI 2HKEA 5FLXC 2UUBE 1NZ0A 5LMNI 1I94E 1XHKA 3WU4A 1MX0A 2BM0A 4I3HA 4DR2I 4DR6I 2UUCE 4GKKI 4ED4A 1H7UA 3PYGA 4LF9I 2UXBE 4DUYI 1FI4A 4NXNE 2AJ4A 3WU5A 4WUCA 1H74A 1IBME 4KHPI 3LTOA 4DU8A 1J5EI 4YY3I 4GKKE 4EMDA 3T1HE 1UEKA 4MYTA 4LFAE 3JAMQ 4GKJI 4DUYE 2HKJA 4DV2I 2UXCE 3QT7A 3WU6A 1H72C 2GS8A 4DV7I 1H7SA 4DR4E 5GMDA 3HULA 1B63A 4P52A 4PRVA 4KHPE 4X64I 4B3RI 3J80Q 4JI6E 3B82A 1NHJA 4WUBA 4JYAI 4AQYI 2V2QA 4DV3I 4K0KE 1RR9A 1N36I 1Z5CA 4P7AA 3LNUA 1VISA 4USKA 1XNQE 1HNXI 4HYMA 2E1RA 1FKAE 1FWKA 2CZ9A 2ZM6I 4FN5A 4X65E 4LFCI 4JG4A 4JYAE 4DXLA 4WUDA 4LF8I 3ZZTA 1Z0CA 1N36E 1N32I 1N33E 4FWDA 4USMA 5LMUI 2VF3A 4DR1I 3J81Q 4LFBI 2ZBKB 2ZITA 2V2VA 1QZRA 2E5LE 4HACB 4DR3I 4LF6I 4JV5E 4PU9A 2R42A 3F0NA 1N32E 3JAMC 4HY1A 1IBLI 4JI0E 1ZM2A 1HNZI 2HHHE 1S4EA 1HR0I 4LFBE 4DR5I 3QT6A 1Z5AA 4JI2E 4YHHI 3WU3A 4JI8I 4UT4A 3V5RA 2A2CA 3ZM7A 1EI1A 1NHHA 2EFGA 3V2UC 1Z0WA 5BR8E 1Z0TA 1IBLE 1XNRI 1WUUA 3PYDA 1KVKA 3OTOE 4OX9I 2DEIA 5LMNE 2J7KA 4JI8E 1XMQI 1PVGA 4JI4I 4DR2E 4DR6E 4DV4I 1KIJA 4LF9E 1D6TA 4DPYA 2HK3A 2HFSA 4LF4I 4KQVA 1XNRE 4MYUA 2Q2EB 5A2QQ 2WW4A 3J81C 2UXDI 4OX9E 4M1KA 4LF5I 4JI7I 1XMQE 4JI5I 1Z0GA 2UUAI 4JI4E 4FWGA 4HXZA 1J5EE 2UU9I 4YY3E 5IWAI 1Z0EA 1N34I 1H73A 4NXMI 4LF4E 4GKJE 1MG7A 4DPWA 4JI1I 4DV2E 4LF7I 4HACA 4FWHA 5IT9Q 4DV7E 1B62A 4X64E 4B3RE 4DR7I 1U2RA 4JI3I 2UU9E 3K17A 3CWVA 2HFUA 4AQYE 2VQEI 4DV3E 2DEJA 1ZM3A 4RPFA 4JI1E 4DV1I 3H4LA 1NHIA 4LF7E 3PYFA 1Z59A 1FNMA 4DV6I 1HNXE 2ZM6E 1EA6A 2F4VI 1N0VC 4LFCE 3QT8A 1HNWI 2V8PA 4LF8E 4X66I 3T1YI 5LMUE 5A2QC 1KKHA 4DR1E 4URLA 1PKPA 4ZVIA 1K47A 1FJGI 2UUBI 1ELOA 1I94I 1A6FA 2F4VE 3J80C 1PIEA 4X62I 4B3TI 2UUCI 3ZZUA 1ZM4A 4DR3E 4LF6E 4B3SI 2UXBI 5L3JA 2R3VA 4B3MI 2LJPA 3J7AM 1HNZE 1HR0E 1Z0BA 1FJGE 4DR5E 1IBMI 3J7AG 1BKNA 4DPUA 4YHHE 1S16A 2V2ZA 4DUZI 4X62E 4B3TE 3B8HA 3LPSA 3T1HI 4LFAI 2VQFI 4B3SE 1N0UA 2UXCI 4B3ME 3GONA 4DR4I 1FWLA 4JI6I 4Z7CA 4DUZE 4DV0I 3K1JA
chains in the Genus database with same CATH superfamily
4K0KI 4FW9A 4DV4E 4OO1A 1KTVA 2VQFE 3ZZ0A 3Q1QA 1RHYA 4ISAA 2BR2A 1DARA 2X36A 1XNQI 5LL6R 4IS9A 3PYEA 2UXDE 5FLXQ 4Z7YA 2JEBA 5DNXA 4LF5E 2OI2A 2HK2A 3QT5A 2BV3A 4JI7E 4X65I 4DV0E 4DPXA 4JI5E 2UUAE 2AE8A 2GQ0A 5IWAE 1N34E 4NXME 1IBKI 1N33I 2NPFA 4BA1A 4IZKA 4DU7A 4DPTA 3ZKBA 5K36F 1RREA 3B4TA 2E5LI 1OJ4A 4DR7E 1ZM9A 3K85A 5GMEA 1XMOI 4JI3E 1R6LA 1ZXNA 4JV5I 4DV5I 2VQEE 1IBKE 4PRXA 3D4JA 2Z5BA 1Z5BA 3Q6MA 2JT2A 4JI0I 5ELWA 4DV1E 2A2DA 2HHHI 1Y4UA 5EL9A 5C0XD 3M6AA 4DV6E 4JI2I 2BM1A 3B78A 2V34A 2X7IA 4IZJD 1USVA 1XMOE 4BA1B 4FW6A 4IZKB 2XEXA 4DV5E 1HNWE 1MU5A 4R1FA 5FWKA 1Z0VA 4XTJA 5BR8I 2C39A 2BA1D 4X66E 3CDIA 3T1YE 3ZKDA 4QNJA 2BA0G 1ZXMA 4NXNI 5JEAF 4UTGA 5IT9C 3OTOI 1UDQA 2HKEA 2NN6D 5FLXC 2UUBE 1NZ0A 5LMNI 1I94E 1XHKA 3WU4A 1MX0A 2Z5BB 2BM0A 4I3HA 4DR2I 4DR6I 2PNMA 2UUCE 4OZEA 4GKKI 4ED4A 1H7UA 2GO4A 3PYGA 4LF9I 2UXBE 3Q6NA 4DUYI 1FI4A 5DROA 4NXNE 2AJ4A 3WU5A 3HKMA 4WUCA 2VESA 1H74A 1IBME 4KHPI 3PS1A 2C39B 3LTOA 2C37B 4DU8A 4OKGA 3GMEA 1J5EI 4YY3I 2O1TA 5DRPA 4GKKE 4EMDA 1E3PA 3T1HE 1UEKA 3CDJA 4MYTA 4LFAE 4MU0A 3JAMQ 4GKJI 4DUYE 2HKJA 4NBQA 4DV2I 4OO1F 1E3HA 2UXCE 5K36E 2PO0A 2NN6E 3QT7A 3WU6A 1H72C 2GS8A 5C0XC 1H7SA 4DV7I 4DR4E 1USUA 5GMDA 3M7NG 3HULA 1B63A 4P52A 4PRVA 4KHPE 2F1DA 4X64I 4B3RI 3J80Q 4JI6E 3B82A 1NHJA 4WUBA 2CG9A 4JYAI 1XXEA 4AQYI 2V2QA 4DV3I 4K0KE 1RR9A 1N36I 1Z5CA 2WNRB 5C0XA 4P7AA 3U1YA 3LNUA 1VISA 4GQUA 4USKA 2O1UA 1XNQE 2Z5EA 4MDTA 1HNXI 4IZJA 4HYMA 2E1RA 2O1VA 1FKAE 2NN6C 1FWKA 1OYRA 2CZ9A 2ZM6I 4FN5A 4X65E 4IFDD 4LFCI 4JG4A 4JYAE 4DXLA 4WUDA 4LF8I 2PO0B 3ZZTA 1Z0CA 1N36E 4BA2A 1N32I 5JEAE 4U3DA 1N33E 4FWDA 5DRRA 4USMA 5LMUI 2VF3A 2NN6A 4DR1I 2WP8A 3J81Q 3UHMA 4LFBI 2ZBKB 2ZITA 2V2VA 1QZRA 2E5LE 3P3GA 1OYPA 5C0XB 4J3DA 2IERA 4HACB 3NZKA 4DR3I 4LF6I 4JV5E 4PU9A 2R42A 3F0NA 3L7ZA 1N32E 3JAMC 4IZJB 4HY1A 2C37A 2PNZA 1IBLI 4JI0E 3DD6A 1ZM2A 1HNZI 2HHHE 1S4EA 1HR0I 4LFBE 5K36D 3GCMA 4DR5I 4IFDE 3QT6A 1Z5AA 3HJCA 4JI2E 4QNKA 4YHHI 4BA2B 3WU3A 4JI8I 4UT4A 5K36B 3V5RA 2PO1A 2A2CA 3KRNA 2NN6B 3ZM7A 1EI1A 2WP8B 4OO1E 1NHHA 2EFGA 3V2UC 1Z0WA 5BR8E 1Z0TA 2IOQA 2CVEA 1P42A 1IBLE 1XNRI 1WUUA 1Y5YA 2JE6A 2IESA 3PYDA 1KVKA 3GLLA 3OTOE 2WNRA 5DRQA 4OX9I 2DEIA 3L7ZB 5LMNE 2J7KA 4JI8E 1XMQI 1PVGA 4IFDC 4JI4I 2PNZB 4DR2E 4DR6E 4DV4I 3P3CA 1KIJA 4LF9E 1D6TA 4DPYA 2HK3A 2HFSA 4LF4I 2PO2A 4KQVA 1XNRE 4MYUA 2Q2EB 5A2QQ 2Z5CB 2WW4A 5JEAD 4MU4A 3J81C 5DNLA 4IFDA 2PO1B 2UXDI 2O3ZA 2BA1G 4OX9E 3PS3A 4M1KA 4LF5I 4JI7I 2GO3A 1XMQE 4JI5I 1Z0GA 2UUAI 4JI4E 4FWGA 4HXZA 1J5EE 1YHCA 4YY3E 2UU9I 5IWAI 1Z0EA 2JE6B 4FW3A 3M85D 1H73A 1N34I 4NXMI 3U1KA 4LCGA 2CGEA 4LF4E 4GKJE 1MG7A 4LCFA 4DPWA 4JI1I 4DV2E 4LF7I 4HACA 3P3EA 4FWHA 5IT9Q 5C0XF 4DV7E 1B62A 2JEAA 5K36C 4LPFA 4X64E 4B3RE 4DR7I 4MU1A 1U2RA 4JI3I 2PO2B 2UU9E 3K17A 3CWVA 2HFUA 4FW4A 2BA0D 4AQYE 2VQEI 4DV3E 2DEJA 3PS2A 4IFDB 3P06A 1ZM3A 4RPFA 4OO1D 4JI1E 5K36A 4DV1I 3H4LA 1NHIA 1VI7A 4LF7E 3PYFA 2IOPA 1Z59A 1FNMA 4U3BA 4DV6I 2O1WA 4OO1B 2NN6F 1HNXE 2ZM6E 1EA6A 2F4VI 1N0VC 4LFCE 3QT8A 2BR2B 3H1CA 1HNWI 4N3OA 2V8PA 4LF8E 4FW5A 3P76A 4X66I 2JEAB 2JEBB 1OYSA 3T1YI 1Y60A 1UDOA 3M85G 5LMUE 5A2QC 4AIDA 1KKHA 4DR1E 4URLA 5JEAC 1PKPA 4ZVIA 1K47A 1FJGI 2UUBI 1ELOA 1I94I 1A6FA 2C38A 2F4VE 3J80C 1UDSA 2Z5CA 1PIEA 4X62I 4B3TI 2UUCI 3ZZUA 2PNLA 4LCHA 1R6MA 1ZM4A 4DR3E 4LF6E 3PRYA 4B3SI 2UXBI 5JEAA 3M7ND 5L3JA 2R3VA 4B3MI 2LJPA 3J7AM 4FW7A 1HNZE 4LOMA 1HR0E 1Z0BA 1FJGE 4DR5E 1IBMI 3J7AG 4MU3A 1BKNA 4DPUA 4YHHE 1S16A 2V2ZA 4DUZI 4X62E 4B3TE 3B8HA 3LPSA 3T1HI 4MQYA 4LFAI 2VQFI 4B3SE 5C0XE 2J65A 1N0UA 1UDNA 2UXCI 4B3ME 3GONA 4OO1C 2C38B 1YH8A 4DR4I 4AM3A 1FWLA 4JI6I 4Z7CA 4IFDF 4DUZE 4DV0I 5JEAB 1HK7A 3K1JA 4AIMA 1Y6ZA 1Y4SA 5EKWA
chains in the Genus database with same CATH topology
4K0KI 4FW9A 4DV4E 1KTVA 2VQFE 3ZZ0A 3Q1QA 1DARA 2X36A 1XNQI 5LL6R 3PYEA 2UXDE 5FLXQ 4Z7YA 4LF5E 2OI2A 2HK2A 3QT5A 2BV3A 4JI7E 4X65I 4DV0E 4DPXA 4JI5E 2UUAE 2GQ0A 5IWAE 1N34E 4NXME 1IBKI 1N33I 2NPFA 4IZKA 4DU7A 4DPTA 3ZKBA 1RREA 2E5LI 1OJ4A 4DR7E 1ZM9A 3K85A 5GMEA 1XMOI 4JI3E 1ZXNA 4JV5I 4DV5I 2VQEE 1IBKE 4PRXA 3D4JA 2Z5BA 1Z5BA 3Q6MA 4JI0I 4DV1E 2A2DA 2HHHI 1Y4UA 3M6AA 4DV6E 4JI2I 2BM1A 3B78A 2V34A 2X7IA 4IZJD 1USVA 1XMOE 4IZKB 2XEXA 4DV5E 1HNWE 1MU5A 4R1FA 5FWKA 1Z0VA 4XTJA 5BR8I 4X66E 3T1YE 3ZKDA 1ZXMA 4NXNI 4UTGA 5IT9C 3OTOI 2HKEA 5FLXC 2UUBE 1NZ0A 5LMNI 1I94E 1XHKA 3WU4A 1MX0A 2Z5BB 2BM0A 4I3HA 4DR2I 4DR6I 2PNMA 2UUCE 4GKKI 4ED4A 1H7UA 3PYGA 4LF9I 2UXBE 3Q6NA 4DUYI 1FI4A 4NXNE 2AJ4A 3WU5A 4WUCA 1H74A 1IBME 4KHPI 3LTOA 4DU8A 1J5EI 4YY3I 2O1TA 4GKKE 4EMDA 3T1HE 1UEKA 4MYTA 4LFAE 3JAMQ 4GKJI 4DUYE 2HKJA 4DV2I 2UXCE 3QT7A 3WU6A 1H72C 2GS8A 4DV7I 1H7SA 4DR4E 1USUA 5GMDA 3HULA 1B63A 4P52A 4PRVA 4KHPE 4X64I 4B3RI 3J80Q 4JI6E 3B82A 1NHJA 4WUBA 2CG9A 4JYAI 4AQYI 2V2QA 4DV3I 4K0KE 1RR9A 1N36I 1Z5CA 4P7AA 3LNUA 1VISA 4USKA 2O1UA 1XNQE 2Z5EA 1HNXI 4IZJA 4HYMA 2E1RA 2O1VA 1FKAE 1FWKA 2CZ9A 2ZM6I 4FN5A 4X65E 4LFCI 4JG4A 4JYAE 4DXLA 4WUDA 4LF8I 3ZZTA 1Z0CA 1N36E 1N32I 1N33E 4FWDA 4USMA 5LMUI 2VF3A 4DR1I 3J81Q 4LFBI 2ZBKB 2ZITA 2V2VA 1QZRA 2E5LE 4HACB 4DR3I 4LF6I 4JV5E 4PU9A 2R42A 3F0NA 1N32E 3JAMC 4IZJB 4HY1A 1IBLI 4JI0E 1ZM2A 1HNZI 2HHHE 1S4EA 1HR0I 4LFBE 4DR5I 3QT6A 1Z5AA 3HJCA 4JI2E 4YHHI 3WU3A 4JI8I 4UT4A 3V5RA 2A2CA 3ZM7A 1EI1A 1NHHA 2EFGA 3V2UC 1Z0WA 5BR8E 1Z0TA 2IOQA 1IBLE 1XNRI 1WUUA 3PYDA 1KVKA 3OTOE 4OX9I 2DEIA 5LMNE 2J7KA 4JI8E 1XMQI 1PVGA 4JI4I 4DR2E 4DR6E 4DV4I 1KIJA 4LF9E 1D6TA 4DPYA 2HK3A 2HFSA 4LF4I 4KQVA 1XNRE 4MYUA 2Q2EB 5A2QQ 2Z5CB 2WW4A 3J81C 2UXDI 4OX9E 4M1KA 4LF5I 4JI7I 1XMQE 4JI5I 1Z0GA 2UUAI 4JI4E 4FWGA 4HXZA 1J5EE 2UU9I 4YY3E 5IWAI 1Z0EA 1N34I 1H73A 4NXMI 2CGEA 4LF4E 4GKJE 1MG7A 4DPWA 4JI1I 4DV2E 4LF7I 4HACA 4FWHA 5IT9Q 4DV7E 1B62A 4X64E 4B3RE 4DR7I 1U2RA 4JI3I 2UU9E 3K17A 3CWVA 2HFUA 4AQYE 2VQEI 4DV3E 2DEJA 3P06A 1ZM3A 4RPFA 4JI1E 4DV1I 3H4LA 1NHIA 4LF7E 3PYFA 2IOPA 1Z59A 1FNMA 4DV6I 2O1WA 1HNXE 2ZM6E 1EA6A 2F4VI 1N0VC 4LFCE 3QT8A 1HNWI 4N3OA 2V8PA 4LF8E 4X66I 3T1YI 5LMUE 5A2QC 1KKHA 4DR1E 4URLA 1PKPA 4ZVIA 1K47A 1FJGI 2UUBI 1ELOA 1I94I 1A6FA 2F4VE 3J80C 2Z5CA 1PIEA 4X62I 4B3TI 2UUCI 3ZZUA 2PNLA 1ZM4A 4DR3E 4LF6E 3PRYA 4B3SI 2UXBI 5L3JA 2R3VA 4B3MI 2LJPA 3J7AM 1HNZE 1HR0E 1Z0BA 1FJGE 4DR5E 1IBMI 3J7AG 1BKNA 4DPUA 4YHHE 1S16A 2V2ZA 4DUZI 4X62E 4B3TE 3B8HA 3LPSA 3T1HI 4LFAI 2VQFI 4B3SE 1N0UA 2UXCI 4B3ME 3GONA 4DR4I 1FWLA 4JI6I 4Z7CA 4DUZE 4DV0I 1HK7A 3K1JA 1Y6ZA 1Y4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K I;  4FW9 A;  4DV4 E;  1KTV A;  2VQF E;  3ZZ0 A;  3Q1Q A;  1DAR A;  2X36 A;  1XNQ I;  5LL6 R;  3PYE A;  2UXD E;  5FLX Q;  4Z7Y A;  4LF5 E;  2OI2 A;  2HK2 A;  3QT5 A;  2BV3 A;  4JI7 E;  4X65 I;  4DV0 E;  4DPX A;  4JI5 E;  2UUA E;  5IWA E;  1N34 E;  4NXM E;  1IBK I;  1N33 I;  2NPF A;  4DU7 A;  4DPT A;  3ZKB A;  1RRE A;  2E5L I;  1OJ4 A;  4DR7 E;  1ZM9 A;  5GME A;  1XMO I;  4JI3 E;  1ZXN A;  4JV5 I;  4DV5 I;  2VQE E;  1IBK E;  4PRX A;  3D4J A;  1Z5B A;  4JI0 I;  4DV1 E;  2A2D A;  2HHH I;  3M6A A;  4DV6 E;  4JI2 I;  2BM1 A;  3B78 A;  2V34 A;  2X7I A;  1XMO E;  4DV5 E;  2XEX A;  1HNW E;  1MU5 A;  4R1F A;  1Z0V A;  4XTJ A;  5BR8 I;  4X66 E;  3T1Y E;  3ZKD A;  1ZXM A;  4NXN I;  4UTG A;  5IT9 C;  3OTO I;  2HKE A;  5FLX C;  2UUB E;  1NZ0 A;  5LMN I;  1I94 E;  1XHK A;  3WU4 A;  1MX0 A;  2BM0 A;  4I3H A;  4DR2 I;  4DR6 I;  2UUC E;  4GKK I;  4ED4 A;  1H7U A;  3PYG A;  4LF9 I;  2UXB E;  4DUY I;  1FI4 A;  4NXN E;  2AJ4 A;  3WU5 A;  4WUC A;  1H74 A;  1IBM E;  4KHP I;  3LTO A;  4DU8 A;  1J5E I;  4YY3 I;  4GKK E;  4EMD A;  3T1H E;  1UEK A;  4MYT A;  4LFA E;  3JAM Q;  4GKJ I;  4DUY E;  2HKJ A;  4DV2 I;  2UXC E;  3QT7 A;  3WU6 A;  1H72 C;  2GS8 A;  4DV7 I;  1H7S A;  4DR4 E;  5GMD A;  3HUL A;  1B63 A;  4P52 A;  4PRV A;  4KHP E;  4X64 I;  4B3R I;  3J80 Q;  4JI6 E;  3B82 A;  1NHJ A;  4WUB A;  4JYA I;  4AQY I;  2V2Q A;  4DV3 I;  4K0K E;  1RR9 A;  1N36 I;  1Z5C A;  4P7A A;  3LNU A;  1VIS A;  4USK A;  1XNQ E;  1HNX I;  4HYM A;  2E1R A;  1FKA E;  1FWK A;  2CZ9 A;  2ZM6 I;  4FN5 A;  4X65 E;  4LFC I;  4JG4 A;  4JYA E;  4DXL A;  4WUD A;  4LF8 I;  3ZZT A;  1Z0C A;  1N36 E;  1N32 I;  1N33 E;  4FWD A;  4USM A;  5LMU I;  2VF3 A;  4DR1 I;  3J81 Q;  4LFB I;  2ZBK B;  2ZIT A;  2V2V A;  1QZR A;  2E5L E;  4HAC B;  4DR3 I;  4LF6 I;  4JV5 E;  4PU9 A;  2R42 A;  3F0N A;  1N32 E;  3JAM C;  4HY1 A;  1IBL I;  4JI0 E;  1ZM2 A;  1HNZ I;  2HHH E;  1S4E A;  1HR0 I;  4LFB E;  4DR5 I;  3QT6 A;  1Z5A A;  4JI2 E;  4YHH I;  3WU3 A;  4JI8 I;  4UT4 A;  3V5R A;  2A2C A;  3ZM7 A;  1EI1 A;  1NHH A;  2EFG A;  3V2U C;  1Z0W A;  5BR8 E;  1Z0T A;  1IBL E;  1XNR I;  1WUU A;  3PYD A;  1KVK A;  3OTO E;  4OX9 I;  2DEI A;  5LMN E;  2J7K A;  4JI8 E;  1XMQ I;  1PVG A;  4JI4 I;  4DR2 E;  4DR6 E;  4DV4 I;  1KIJ A;  4LF9 E;  1D6T A;  4DPY A;  2HK3 A;  2HFS A;  4LF4 I;  4KQV A;  1XNR E;  4MYU A;  2Q2E B;  5A2Q Q;  2WW4 A;  3J81 C;  2UXD I;  4OX9 E;  4M1K A;  4LF5 I;  4JI7 I;  1XMQ E;  4JI5 I;  1Z0G A;  2UUA I;  4JI4 E;  4FWG A;  4HXZ A;  1J5E E;  2UU9 I;  4YY3 E;  5IWA I;  1Z0E A;  1N34 I;  1H73 A;  4NXM I;  4LF4 E;  4GKJ E;  1MG7 A;  4DPW A;  4JI1 I;  4DV2 E;  4LF7 I;  4HAC A;  4FWH A;  5IT9 Q;  4DV7 E;  1B62 A;  4X64 E;  4B3R E;  4DR7 I;  1U2R A;  4JI3 I;  2UU9 E;  3K17 A;  3CWV A;  2HFU A;  4AQY E;  2VQE I;  4DV3 E;  2DEJ A;  1ZM3 A;  4RPF A;  4JI1 E;  4DV1 I;  3H4L A;  1NHI A;  4LF7 E;  3PYF A;  1Z59 A;  1FNM A;  4DV6 I;  1HNX E;  2ZM6 E;  1EA6 A;  2F4V I;  1N0V C;  4LFC E;  3QT8 A;  1HNW I;  2V8P A;  4LF8 E;  4X66 I;  3T1Y I;  5LMU E;  5A2Q C;  1KKH A;  4DR1 E;  4URL A;  1PKP A;  4ZVI A;  1K47 A;  1FJG I;  2UUB I;  1ELO A;  1I94 I;  1A6F A;  2F4V E;  3J80 C;  1PIE A;  4X62 I;  4B3T I;  2UUC I;  3ZZU A;  1ZM4 A;  4DR3 E;  4LF6 E;  4B3S I;  2UXB I;  5L3J A;  2R3V A;  4B3M I;  2LJP A;  3J7A M;  1HNZ E;  1HR0 E;  1Z0B A;  1FJG E;  4DR5 E;  1IBM I;  3J7A G;  1BKN A;  4DPU A;  4YHH E;  1S16 A;  2V2Z A;  4DUZ I;  4X62 E;  4B3T E;  3B8H A;  3LPS A;  3T1H I;  4LFA I;  2VQF I;  4B3S E;  1N0U A;  2UXC I;  4B3M E;  3GON A;  4DR4 I;  1FWL A;  4JI6 I;  4Z7C A;  4DUZ E;  4DV0 I;  3K1J A; 
#chains in the Genus database with same CATH topology
 4K0K I;  4FW9 A;  4DV4 E;  4OO1 A;  1KTV A;  2VQF E;  3ZZ0 A;  3Q1Q A;  1RHY A;  4ISA A;  2BR2 A;  1DAR A;  2X36 A;  1XNQ I;  5LL6 R;  4IS9 A;  3PYE A;  2UXD E;  5FLX Q;  4Z7Y A;  2JEB A;  5DNX A;  4LF5 E;  2OI2 A;  2HK2 A;  3QT5 A;  2BV3 A;  4JI7 E;  4X65 I;  4DV0 E;  4DPX A;  4JI5 E;  2UUA E;  2AE8 A;  2GQ0 A;  5IWA E;  1N34 E;  4NXM E;  1IBK I;  1N33 I;  2NPF A;  4BA1 A;  4IZK A;  4DU7 A;  4DPT A;  3ZKB A;  5K36 F;  1RRE A;  3B4T A;  2E5L I;  1OJ4 A;  4DR7 E;  1ZM9 A;  3K85 A;  5GME A;  1XMO I;  4JI3 E;  1R6L A;  1ZXN A;  4JV5 I;  4DV5 I;  2VQE E;  1IBK E;  4PRX A;  3D4J A;  2Z5B A;  1Z5B A;  3Q6M A;  2JT2 A;  4JI0 I;  5ELW A;  4DV1 E;  2A2D A;  2HHH I;  1Y4U A;  5EL9 A;  5C0X D;  3M6A A;  4DV6 E;  4JI2 I;  2BM1 A;  3B78 A;  2V34 A;  2X7I A;  4IZJ D;  1USV A;  1XMO E;  4BA1 B;  4FW6 A;  4IZK B;  2XEX A;  4DV5 E;  1HNW E;  1MU5 A;  4R1F A;  5FWK A;  1Z0V A;  4XTJ A;  5BR8 I;  2C39 A;  2BA1 D;  4X66 E;  3CDI A;  3T1Y E;  3ZKD A;  4QNJ A;  2BA0 G;  1ZXM A;  4NXN I;  5JEA F;  4UTG A;  5IT9 C;  3OTO I;  1UDQ A;  2HKE A;  2NN6 D;  5FLX C;  2UUB E;  1NZ0 A;  5LMN I;  1I94 E;  1XHK A;  3WU4 A;  1MX0 A;  2Z5B B;  2BM0 A;  4I3H A;  4DR2 I;  4DR6 I;  2PNM A;  2UUC E;  4OZE A;  4GKK I;  4ED4 A;  1H7U A;  2GO4 A;  3PYG A;  4LF9 I;  2UXB E;  3Q6N A;  4DUY I;  1FI4 A;  5DRO A;  4NXN E;  2AJ4 A;  3WU5 A;  3HKM A;  4WUC A;  2VES A;  1H74 A;  1IBM E;  4KHP I;  3PS1 A;  2C39 B;  3LTO A;  2C37 B;  4DU8 A;  4OKG A;  3GME A;  1J5E I;  4YY3 I;  2O1T A;  5DRP A;  4GKK E;  4EMD A;  1E3P A;  3T1H E;  1UEK A;  3CDJ A;  4MYT A;  4LFA E;  4MU0 A;  3JAM Q;  4GKJ I;  4DUY E;  2HKJ A;  4NBQ A;  4DV2 I;  4OO1 F;  1E3H A;  2UXC E;  5K36 E;  2PO0 A;  2NN6 E;  3QT7 A;  3WU6 A;  1H72 C;  2GS8 A;  5C0X C;  1H7S A;  4DV7 I;  4DR4 E;  1USU A;  5GMD A;  3M7N G;  3HUL A;  1B63 A;  4P52 A;  4PRV A;  4KHP E;  2F1D A;  4X64 I;  4B3R I;  3J80 Q;  4JI6 E;  3B82 A;  1NHJ A;  4WUB A;  2CG9 A;  4JYA I;  1XXE A;  4AQY I;  2V2Q A;  4DV3 I;  4K0K E;  1RR9 A;  1N36 I;  1Z5C A;  2WNR B;  5C0X A;  4P7A A;  3U1Y A;  3LNU A;  1VIS A;  4GQU A;  4USK A;  2O1U A;  1XNQ E;  2Z5E A;  4MDT A;  1HNX I;  4IZJ A;  4HYM A;  2E1R A;  2O1V A;  1FKA E;  2NN6 C;  1FWK A;  1OYR A;  2CZ9 A;  2ZM6 I;  4FN5 A;  4X65 E;  4IFD D;  4LFC I;  4JG4 A;  4JYA E;  4DXL A;  4WUD A;  4LF8 I;  2PO0 B;  3ZZT A;  1Z0C A;  1N36 E;  4BA2 A;  1N32 I;  5JEA E;  4U3D A;  1N33 E;  4FWD A;  5DRR A;  4USM A;  5LMU I;  2VF3 A;  2NN6 A;  4DR1 I;  2WP8 A;  3J81 Q;  3UHM A;  4LFB I;  2ZBK B;  2ZIT A;  2V2V A;  1QZR A;  2E5L E;  3P3G A;  1OYP A;  5C0X B;  4J3D A;  2IER A;  4HAC B;  3NZK A;  4DR3 I;  4LF6 I;  4JV5 E;  4PU9 A;  2R42 A;  3F0N A;  3L7Z A;  1N32 E;  3JAM C;  4IZJ B;  4HY1 A;  2C37 A;  2PNZ A;  1IBL I;  4JI0 E;  3DD6 A;  1ZM2 A;  1HNZ I;  2HHH E;  1S4E A;  1HR0 I;  4LFB E;  5K36 D;  3GCM A;  4DR5 I;  4IFD E;  3QT6 A;  1Z5A A;  3HJC A;  4JI2 E;  4QNK A;  4YHH I;  4BA2 B;  3WU3 A;  4JI8 I;  4UT4 A;  5K36 B;  3V5R A;  2PO1 A;  2A2C A;  3KRN A;  2NN6 B;  3ZM7 A;  1EI1 A;  2WP8 B;  4OO1 E;  1NHH A;  2EFG A;  3V2U C;  1Z0W A;  5BR8 E;  1Z0T A;  2IOQ A;  2CVE A;  1P42 A;  1IBL E;  1XNR I;  1WUU A;  1Y5Y A;  2JE6 A;  2IES A;  3PYD A;  1KVK A;  3GLL A;  3OTO E;  2WNR A;  5DRQ A;  4OX9 I;  2DEI A;  3L7Z B;  5LMN E;  2J7K A;  4JI8 E;  1XMQ I;  1PVG A;  4IFD C;  4JI4 I;  2PNZ B;  4DR2 E;  4DR6 E;  4DV4 I;  3P3C A;  1KIJ A;  4LF9 E;  1D6T A;  4DPY A;  2HK3 A;  2HFS A;  4LF4 I;  2PO2 A;  4KQV A;  1XNR E;  4MYU A;  2Q2E B;  5A2Q Q;  2Z5C B;  2WW4 A;  5JEA D;  4MU4 A;  3J81 C;  5DNL A;  4IFD A;  2PO1 B;  2UXD I;  2O3Z A;  2BA1 G;  4OX9 E;  3PS3 A;  4M1K A;  4LF5 I;  4JI7 I;  2GO3 A;  1XMQ E;  4JI5 I;  1Z0G A;  2UUA I;  4JI4 E;  4FWG A;  4HXZ A;  1J5E E;  1YHC A;  4YY3 E;  2UU9 I;  5IWA I;  1Z0E A;  2JE6 B;  4FW3 A;  3M85 D;  1H73 A;  1N34 I;  4NXM I;  3U1K A;  4LCG A;  2CGE A;  4LF4 E;  4GKJ E;  1MG7 A;  4LCF A;  4DPW A;  4JI1 I;  4DV2 E;  4LF7 I;  4HAC A;  3P3E A;  4FWH A;  5IT9 Q;  5C0X F;  4DV7 E;  1B62 A;  2JEA A;  5K36 C;  4LPF A;  4X64 E;  4B3R E;  4DR7 I;  4MU1 A;  1U2R A;  4JI3 I;  2PO2 B;  2UU9 E;  3K17 A;  3CWV A;  2HFU A;  4FW4 A;  2BA0 D;  4AQY E;  2VQE I;  4DV3 E;  2DEJ A;  3PS2 A;  4IFD B;  3P06 A;  1ZM3 A;  4RPF A;  4OO1 D;  4JI1 E;  5K36 A;  4DV1 I;  3H4L A;  1NHI A;  1VI7 A;  4LF7 E;  3PYF A;  2IOP A;  1Z59 A;  1FNM A;  4U3B A;  4DV6 I;  2O1W A;  4OO1 B;  2NN6 F;  1HNX E;  2ZM6 E;  1EA6 A;  2F4V I;  1N0V C;  4LFC E;  3QT8 A;  2BR2 B;  3H1C A;  1HNW I;  4N3O A;  2V8P A;  4LF8 E;  4FW5 A;  3P76 A;  4X66 I;  2JEA B;  2JEB B;  1OYS A;  3T1Y I;  1Y60 A;  1UDO A;  3M85 G;  5LMU E;  5A2Q C;  4AID A;  1KKH A;  4DR1 E;  4URL A;  5JEA C;  1PKP A;  4ZVI A;  1K47 A;  1FJG I;  2UUB I;  1ELO A;  1I94 I;  1A6F A;  2C38 A;  2F4V E;  3J80 C;  1UDS A;  2Z5C A;  1PIE A;  4X62 I;  4B3T I;  2UUC I;  3ZZU A;  2PNL A;  4LCH A;  1R6M A;  1ZM4 A;  4DR3 E;  4LF6 E;  3PRY A;  4B3S I;  2UXB I;  5JEA A;  3M7N D;  5L3J A;  2R3V A;  4B3M I;  2LJP A;  3J7A M;  4FW7 A;  1HNZ E;  4LOM A;  1HR0 E;  1Z0B A;  1FJG E;  4DR5 E;  1IBM I;  3J7A G;  4MU3 A;  1BKN A;  4DPU A;  4YHH E;  1S16 A;  2V2Z A;  4DUZ I;  4X62 E;  4B3T E;  3B8H A;  3LPS A;  3T1H I;  4MQY A;  4LFA I;  2VQF I;  4B3S E;  5C0X E;  2J65 A;  1N0U A;  1UDN A;  2UXC I;  4B3M E;  3GON A;  4OO1 C;  2C38 B;  1YH8 A;  4DR4 I;  4AM3 A;  1FWL A;  4JI6 I;  4Z7C A;  4IFD F;  4DUZ E;  4DV0 I;  5JEA B;  1HK7 A;  3K1J A;  4AIM A;  1Y6Z A;  1Y4S A;  5EKW A; 
#chains in the Genus database with same CATH homology
 4K0K I;  4FW9 A;  4DV4 E;  1KTV A;  2VQF E;  3ZZ0 A;  3Q1Q A;  1DAR A;  2X36 A;  1XNQ I;  5LL6 R;  3PYE A;  2UXD E;  5FLX Q;  4Z7Y A;  4LF5 E;  2OI2 A;  2HK2 A;  3QT5 A;  2BV3 A;  4JI7 E;  4X65 I;  4DV0 E;  4DPX A;  4JI5 E;  2UUA E;  2GQ0 A;  5IWA E;  1N34 E;  4NXM E;  1IBK I;  1N33 I;  2NPF A;  4IZK A;  4DU7 A;  4DPT A;  3ZKB A;  1RRE A;  2E5L I;  1OJ4 A;  4DR7 E;  1ZM9 A;  3K85 A;  5GME A;  1XMO I;  4JI3 E;  1ZXN A;  4JV5 I;  4DV5 I;  2VQE E;  1IBK E;  4PRX A;  3D4J A;  2Z5B A;  1Z5B A;  3Q6M A;  4JI0 I;  4DV1 E;  2A2D A;  2HHH I;  1Y4U A;  3M6A A;  4DV6 E;  4JI2 I;  2BM1 A;  3B78 A;  2V34 A;  2X7I A;  4IZJ D;  1USV A;  1XMO E;  4IZK B;  2XEX A;  4DV5 E;  1HNW E;  1MU5 A;  4R1F A;  5FWK A;  1Z0V A;  4XTJ A;  5BR8 I;  4X66 E;  3T1Y E;  3ZKD A;  1ZXM A;  4NXN I;  4UTG A;  5IT9 C;  3OTO I;  2HKE A;  5FLX C;  2UUB E;  1NZ0 A;  5LMN I;  1I94 E;  1XHK A;  3WU4 A;  1MX0 A;  2Z5B B;  2BM0 A;  4I3H A;  4DR2 I;  4DR6 I;  2PNM A;  2UUC E;  4GKK I;  4ED4 A;  1H7U A;  3PYG A;  4LF9 I;  2UXB E;  3Q6N A;  4DUY I;  1FI4 A;  4NXN E;  2AJ4 A;  3WU5 A;  4WUC A;  1H74 A;  1IBM E;  4KHP I;  3LTO A;  4DU8 A;  1J5E I;  4YY3 I;  2O1T A;  4GKK E;  4EMD A;  3T1H E;  1UEK A;  4MYT A;  4LFA E;  3JAM Q;  4GKJ I;  4DUY E;  2HKJ A;  4DV2 I;  2UXC E;  3QT7 A;  3WU6 A;  1H72 C;  2GS8 A;  4DV7 I;  1H7S A;  4DR4 E;  1USU A;  5GMD A;  3HUL A;  1B63 A;  4P52 A;  4PRV A;  4KHP E;  4X64 I;  4B3R I;  3J80 Q;  4JI6 E;  3B82 A;  1NHJ A;  4WUB A;  2CG9 A;  4JYA I;  4AQY I;  2V2Q A;  4DV3 I;  4K0K E;  1RR9 A;  1N36 I;  1Z5C A;  4P7A A;  3LNU A;  1VIS A;  4USK A;  2O1U A;  1XNQ E;  2Z5E A;  1HNX I;  4IZJ A;  4HYM A;  2E1R A;  2O1V A;  1FKA E;  1FWK A;  2CZ9 A;  2ZM6 I;  4FN5 A;  4X65 E;  4LFC I;  4JG4 A;  4JYA E;  4DXL A;  4WUD A;  4LF8 I;  3ZZT A;  1Z0C A;  1N36 E;  1N32 I;  1N33 E;  4FWD A;  4USM A;  5LMU I;  2VF3 A;  4DR1 I;  3J81 Q;  4LFB I;  2ZBK B;  2ZIT A;  2V2V A;  1QZR A;  2E5L E;  4HAC B;  4DR3 I;  4LF6 I;  4JV5 E;  4PU9 A;  2R42 A;  3F0N A;  1N32 E;  3JAM C;  4IZJ B;  4HY1 A;  1IBL I;  4JI0 E;  1ZM2 A;  1HNZ I;  2HHH E;  1S4E A;  1HR0 I;  4LFB E;  4DR5 I;  3QT6 A;  1Z5A A;  3HJC A;  4JI2 E;  4YHH I;  3WU3 A;  4JI8 I;  4UT4 A;  3V5R A;  2A2C A;  3ZM7 A;  1EI1 A;  1NHH A;  2EFG A;  3V2U C;  1Z0W A;  5BR8 E;  1Z0T A;  2IOQ A;  1IBL E;  1XNR I;  1WUU A;  3PYD A;  1KVK A;  3OTO E;  4OX9 I;  2DEI A;  5LMN E;  2J7K A;  4JI8 E;  1XMQ I;  1PVG A;  4JI4 I;  4DR2 E;  4DR6 E;  4DV4 I;  1KIJ A;  4LF9 E;  1D6T A;  4DPY A;  2HK3 A;  2HFS A;  4LF4 I;  4KQV A;  1XNR E;  4MYU A;  2Q2E B;  5A2Q Q;  2Z5C B;  2WW4 A;  3J81 C;  2UXD I;  4OX9 E;  4M1K A;  4LF5 I;  4JI7 I;  1XMQ E;  4JI5 I;  1Z0G A;  2UUA I;  4JI4 E;  4FWG A;  4HXZ A;  1J5E E;  2UU9 I;  4YY3 E;  5IWA I;  1Z0E A;  1N34 I;  1H73 A;  4NXM I;  2CGE A;  4LF4 E;  4GKJ E;  1MG7 A;  4DPW A;  4JI1 I;  4DV2 E;  4LF7 I;  4HAC A;  4FWH A;  5IT9 Q;  4DV7 E;  1B62 A;  4X64 E;  4B3R E;  4DR7 I;  1U2R A;  4JI3 I;  2UU9 E;  3K17 A;  3CWV A;  2HFU A;  4AQY E;  2VQE I;  4DV3 E;  2DEJ A;  3P06 A;  1ZM3 A;  4RPF A;  4JI1 E;  4DV1 I;  3H4L A;  1NHI A;  4LF7 E;  3PYF A;  2IOP A;  1Z59 A;  1FNM A;  4DV6 I;  2O1W A;  1HNX E;  2ZM6 E;  1EA6 A;  2F4V I;  1N0V C;  4LFC E;  3QT8 A;  1HNW I;  4N3O A;  2V8P A;  4LF8 E;  4X66 I;  3T1Y I;  5LMU E;  5A2Q C;  1KKH A;  4DR1 E;  4URL A;  1PKP A;  4ZVI A;  1K47 A;  1FJG I;  2UUB I;  1ELO A;  1I94 I;  1A6F A;  2F4V E;  3J80 C;  2Z5C A;  1PIE A;  4X62 I;  4B3T I;  2UUC I;  3ZZU A;  2PNL A;  1ZM4 A;  4DR3 E;  4LF6 E;  3PRY A;  4B3S I;  2UXB I;  5L3J A;  2R3V A;  4B3M I;  2LJP A;  3J7A M;  1HNZ E;  1HR0 E;  1Z0B A;  1FJG E;  4DR5 E;  1IBM I;  3J7A G;  1BKN A;  4DPU A;  4YHH E;  1S16 A;  2V2Z A;  4DUZ I;  4X62 E;  4B3T E;  3B8H A;  3LPS A;  3T1H I;  4LFA I;  2VQF I;  4B3S E;  1N0U A;  2UXC I;  4B3M E;  3GON A;  4DR4 I;  1FWL A;  4JI6 I;  4Z7C A;  4DUZ E;  4DV0 I;  1HK7 A;  3K1J A;  1Y6Z A;  1Y4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...