1XNQE

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnqE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnqE02
3PYDA 4JI6I 4FW9A 2V8PA 4URLA 5LMUE 4X66E 3QT5A 1J26A 4OOGC 1STUA 4YHHE 1XNQI 4DR4E 4DV1E 4MYUA 4DXLA 4LFAI 2F4VE 1VISA 2UXCI 2LUPB 2CPNA 2RSMA 2X7IA 1HNXE 4GKJE 4LF8I 2XEXA 1RREA 1N36I 4EMDA 2V34A 1IBKE 2Q2EB 4UT4A 4M2ZA 4LF7I 3J80C 3T1HE 2NUFA 1Z0TA 4PU9A 1H7SA 1J5EE 4P7AA 4GKKE 1XNRI 4DV6E 2A2CA 1EA6A 2JY9A 2UXBE 2LTRA 4DR1I 1RR9A 2BV3A 4I3HA 2HK3A 3LPSA 1I94I 5LMNE 3VYYA 3M6AA 2E5LI 4Z7CA 4JI4E 2UUAI 3F0NA 4WFTA 4LF5E 1XMOI 4JI8I 4K0KI 3C4TA 4HY1A 4KHPI 4HXZA 3B82A 3WU6A 3H4LA 4YY3E 4USKA 4DUYI 2CZ9A 4JV5I 4JI0E 2B3TB 2RS6A 4DR3E 2NA2A 1PVGA 4LF4E 2UU9E 2L2MA 3QT6A 4JI6E 4DV0E 4AQYE 4DV4I 4DR5E 1XHKA 4X62I 4JI2I 4OX9I 4B3MI 1B63A 1QU6A 1UILA 4DV2E 1XNQE 5LL6R 2DB2A 1K47A 2ZBKB 1ZXMA 4DPWA 4B3RE 5A2QC 1S4EA 3ZKBA 4NXME 1S16A 1FI4A 3K1JA 2VQEE 4PRXA 4FN5A 3P1XA 2A2DA 1FWKA 4DR6I 1O0WA 2X36A 4DR2E 2VF3A 1X49A 5GMDA 4DV3E 2B7TA 1N34E 1N0VC 4HACA 3ADLA 4WUCA 4DPXA 2EFGA 1DARA 1WHNA 4B3SI 2VQFI 4WYQB 1H74A 2UUBI 3WU4A 1WHQA 2N3GA 1YYWA 4JI3I 5IT9Q 1Z5CA 3C4BA 4X65I 1X48A 1H73A 1HNWI 1ZM9A 1PIEA 3WU5A 3J7AM 1Z0GA 3HTXA 1T4OA 2HHHI 1EI1A 4KQVA 2YT4A 2RTXA 2OI2A 4JI5I 4NXNI 2MDRA 4RPFA 1NHIA 3B8HA 4ZVIA 5BR8I 4LF6I 4XTJA 4LFBI 3Q1QA 3ZZUA 4JI7E 1Z0WA 4M1KA 1FNMA 5FLXC 4WUBA 4P52A 4DUZE 4LF9I 2LUQA 1T4LB 2ZM6I 5IWAE 4DV7E 3T1YE 1HNZI 1YZ9A 4DR7I 2BM0A 1FJGI 4X8WA 1B62A 3ZZTA 1N32I 1H7UA 1HR0I 3JAMC 5L3JA 4X64I 1X47A 3QT7A 4ED4A 4DKKA 4B3TI 3WU3A 1IBLI 2HFSA 4JI1I 1XMQE 2UUCE 2UXDE 4DPUA 3J7AG 1KKHA 4JI3E 1ZBTA 3PYEA 3ZKDA 1N33I 3ADGA 1DI2A 2E1RA 3LLHA 1OJ4A 1H72C 1ZM4A 3QT8A 1FWLA 4LFAE 2UXCE 5LMUI 3J81Q 4LF8E 3LTOA 3OTOI 1N36E 4LF7E 4YHHI 4DR4I 4WUDA 4DV1I 1KIJA 4DV5I 2F4VI 5BR8E 1ZM2A 1ZXNA 1XNRE 2NUEA 1YYKA 4GKJI 3GONA 1NHJA 2L3CA 4DR1E 1IBKI 4LFCI 1U2RA 2LBSB 4M30A 3T1HI 2V2ZA 2AJ4A 2HKJA 1KVKA 2J7KA 1J5EI 1UEKA 4GKKI 1I94E 3LNUA 2E5LE 4DV6I 2UUAE 2UXBI 1XMOE 2L2NA 4JI8E 2LJHA 4K0KE 4KHPE 1ELOA 1HR0E 5LMNI 4DUYE 1Z5BA 4JI4I 1MU5A 3V5RA 1Z0CA 1IBLE 4JV5E 4LF5I 1WUUA 1MX0A 4JI1E 3K17A 1Z0VA 1Z0BA 2JVAA 2KHXA 3PYFA 1N0UA 3V2UC 2L3JA 1RC7A 4JI0I 4DV4E 4DR3I 2DEJA 1IBMI 4X62E 5IT9C 1PKPA 2UU9I 4JI2E 4OX9E 4B3ME 2DIXA 1GQEA 3ADIA 1NHHA 4DV0I 4AQYI 4DR5I 3J80Q 3OTOE 4JYAI 1KTVA 2B7VA 1RQ0A 4DV2I 4DV5E 2HFUA 2LJPA 5FLXQ 2V2VA 4DR6E 3CWVA 2DEIA 4LFCE 4B3RI 4R1FA 4NXMI 1Z0EA 5GMEA 1YYOA 2VQEI 2EZ6A 2BM1A 4HACB 4DPTA 3JAMQ 4B3SE 1FKAE 1QZRA 4DR2I 3ADJA 2VQFE 3ZZ0A 3B78A 2UUBE 2NPFA 4DV3I 1N34I 2LRSA 4PRVA 4X65E 2V2QA 1HNWE 2WW4A 2L33A 1BKNA 4FWDA 1MG7A 4FWGA 2R3VA 2HHHE 4DU7A 5CFFE 1IBME 4JI5E 1UHZA 4X66I 1NZ0A 4NXNE 4MYTA 2HKEA 1ZM3A 1D6TA 3J7Yp 5A2QQ 4LF6E 1HNXI 3D4JA 4JYAE 4FWHA 1T4NA 4LFBE 3HULA 3J81C 4DPYA 2N3HA 2LTSA 4Z7YA 4LF9E 4UTGA 3ZM7A 4DU8A 2DMYA 1HNZE 2ZM6E 4DR7E 4JI7I 1EKZA 1FJGE 2NUGA 2IHR1 1N32E 4DUZI 4X64E 1A6FA 5IWAI 4DV7I 3T1YI 4B3TE 3PYGA 2L2KB 4USMA 2RS7A 2HK2A 1Z5AA 4YY3I 2ZITA 1N33E 4JG4A 3VYXA 1Z59A 4HYMA 1XMQI 2UUCI 2UXDI 2GS8A 2R42A 4LF4I
chains in the Genus database with same CATH superfamily
1EH6A 3PYDA 2MKNA 4O24A 2WNRA 4JI6I 4FW9A 2CG9A 2V8PA 4URLA 1DQ3A 5LMUE 1A1FA 2EL5A 4MLVA 4X66E 4X9JA 1X3CA 1J26A 3QT5A 4U3BA 5AE1A 5EL9A 4OOGC 2NABA 4BMJA 2E1MA 1STUA 4YHHE 3PS3A 4DR4E 4DV1E 4MYUA 3C6MA 5FWKA 1XNQI 3Q6MA 4DXLA 4LFAI 4TUGA 2F4VE 1VISA 2UXCI 4BC7A 2V88A 4IJDA 2LUPB 2YPNA 2CPNA 4WXCA 4FW4A 2RSMA 2YTGA 1HNXE 2EN3A 2X7IA 2GO3A 4LCFA 2JEBA 4GKJE 4LF8I 2XEXA 1RREA 1N36I 3Q6NA 4EMDA 2V34A 1IBKE 2Q2EB 4FW5A 2EOJA 4M2ZA 4UT4A 3J80C 3DD6A 4LF7I 4AM3A 3T1HE 2EL6A 2NUFA 1Z0TA 3MHSC 4PU9A 2WBSA 3HPZA 1H7SA 1J5EE 4P7AA 4GKKE 4R2SA 1XNRI 5JEAC 2PO2A 3EQ1A 4DV6E 1KJKA 3M7ND 2A2CA 1EA6A 2JY9A 4R2RA 2UXBE 2LTRA 5F3WA 3OMLA 5JEAF 4DR1I 2LV2A 1RR9A 1YH8A 2EMLA 2BV3A 4I3HA 2M4IA 1HK7A 2HK3A 2ODRD 1X6HA 2EMWA 3LPSA 2K4VA 5LMNE 5AE2A 3VYYA 2JYAA 3M6AA 1I94I 2YTDA 2E5LI 2EPLX 4Z7CA 2YTEA 4JI4E 3M85G 1P42A 2UUAI 3F0NA 3BGHA 2EMZA 4WFTA 4LF5E 1XMOI 2EORA 2EM2A 2BA1G 4JI8I 4K0KI 3C4TA 4HY1A 4KHPI 4HXZA 2WP8B 4R2EA 2O1VA 2YTQA 2EOOA 2EPCA 2GHFA 1A1JA 3B82A 3WU6A 3EPJA 2VE7C 2LT7A 3H4LA 5DNXA 2M7QA 4YY3E 4USKA 1NCSA 4LTYA 5JEAD 4DUYI 3AUZA 2WCC3 3L7ZB 4IFDD 2EOQA 2CZ9A 4BC9A 5DRQA 4JV5I 3VK6A 2EPUA 2JOXA 2ENCA 2JWOA 2VRDA 4JI0E 2B3TB 5DRPA 2RS6A 3BIDA 4N3OA 4DR3E 2NA2A 4AIDA 1PVGA 4LF4E 1YSAC 4Q35B 2JXPA 2UU9E 2BA0G 2PNMA 2EM3A 2L2MA 3HJCA 4HEIA 2EPAA 2EN1A 3RMPA 1QNTA 5DRRA 3QT6A 4FK5C 4JI6E 2WNRB 5JEAE 2C37A 5IV8B 1E3HA 1R6LA 4DV0E 4IS1C 1DGCA 4AQYE 1YUIA 5T6JA 4LOMA 2EMBA 4DR5E 4DV4I 1WJPA 2V85A 1XHKA 4X62I 4JI2I 4OX9I 4B3MI 1OYRA 3EPHA 1B63A 2EPMX 1QU6A 1UILA 4DV2E 1XNQE 4MDTA 2LVHA 2DRPA 2K7IA 5LL6R 1UBDC 4IZKA 5C0XA 1YFHA 2YTOA 2DB2A 2F8BA 1K47A 2ZBKB 3H09A 2IERA 2V87A 4F6MA 2MDGA 2MC6A 2V89A 4NHRA 1ZXMA 4DPWA 2EOXA 2YWQA 4BA2A 4B3RE 5A2QC 1Y60A 5A6BD 1UDSA 2R1FA 2I13A 1S4EA 2EPPA 4MU1A 3ZKBA 4NXME 1HNZI 1S16A 4DMIA 1TN9A 1FI4A 3K1JA 2VQEE 4PRXA 2PO2B 4FN5A 2O1WA 3P1XA 2A2DA 1FWKA 1OYPA 2DMIA 4DR6I 2AE8A 4F9CB 1O0WA 2X36A 1BB8A 4MU0A 4DR2E 4FW6A 2EMKA 5EKWA 2VF3A 1UDQA 1Y5YA 2GPIA 2EM5A 2WBTA 1X49A 3EPKA 3P3GA 5K36D 1PJQA 3KZZA 5GMDA 2M9AA 2B7TA 4DV3E 3CDJA 1N34E 3M7NG 2YTJA 4WSPA 1N0VC 2O3ZA 4HACA 2MKDA 3ADLA 4WUCA 5A6KA 4ZYGA 4M9VC 2EFGA 4DPXA 1DARA 3HPSA 2V8QB 2EQ1A 1WHNA 3IWCA 4B3SI 2VQFI 4WYQB 4BHBA 1H74A 2EE8A 5C0XE 2UUBI 1KYQA 1WHQA 2ELZA 2N3GA 4WSGA 3WU4A 2LE2A 1YYWA 4JI3I 1WRJA 2BR2A 4R03A 3KRNA 2EN4A 5IT9Q 1BBOA 4GZNC 4R2CA 3C4BA 1G2FC 1Z5CA 4BA1A 4X65I 1X48A 1H73A 1HNWI 2ADRA 2CTDA 1ZM9A 1PIEA 4M0VA 2LJUA 3WU5A 2LCEA 3CDIA 4R2DA 2EPZA 3J7AM 3F6HA 2YRMA 2ODRC 2D9HA 2HC5A 1Z0GA 3HTXA 2EOIA 1T4OA 2HHHI 1EI1A 4KQVA 2YT4A 1T38A 2Z5BA 2RTXA 2OI2A 3NZKA 3P76A 1YHCA 4JI5I 4BCAA 4NXNI 2MDRA 2EMFA 1A1HA 2Z5EA 4RPFA 1NHIA 3B8HA 3M99B 5KL7A 4OO1C 4IZKB 4ZVIA 5C0XB 1Y4SA 2YSPA 5BR8I 4OO1F 1F2IG 4LF6I 1PJTA 1EH8A 4IFDC 5JEAA 4XTJA 2EMAA 4LFBI 3Q1QA 1ZAAC 3ZZUA 4IFDA 4KZSA 4JI7E 3GCMA 1Z0WA 4IFDF 4M1KA 1FNMA 5FLXC 4WUBA 4P52A 2DLKA 4DUZE 2ENHA 5KL6A 4LF9I 4WX9A 2LUQA 5DNLA 1T4LB 1OYSA 5IWAE 2EM0A 4DV7E 3T1YE 1YZ9A 2EOYA 3PS1A 2ZM6I 4DR7I 2EN6A 2NN6F 2BM0A 1FJGI 4X8WA 4OO1D 1B62A 2EN8A 3ZZTA 1N32I 1H7UA 1HR0I 3JAMC 5L3JA 4X64I 1X47A 3QT7A 4ED4A 1USUA 4DKKA 2EMCA 3WU3A 4B3TI 1IBLI 1EH7A 1PJSA 2PO1A 2C39B 1RMDA 2HFSA 5ELWA 4JI1I 2EM9A 4BS9A 1XMQE 2UUCE 2UXDE 4O43A 2Z5CA 2VF1A 1XXEA 4F2JC 4DPUA 3J7AG 3FIGA 1KKHA 4OO1E 4JI3E 1ZBTA 3PYEA 3ZKDA 2JEAA 2BR2B 5A6BA 1N33I 2NN6D 2YRKA 5AE3A 1RHYA 4FW3A 1IQOA 4OZEA 3ADGA 4OKGA 1N3GA 4IFDE 2YTIA 1DI2A 4QNKA 4F9BB 2E1RA 3LLHA 1OJ4A 2GQ0A 3C6KA 4BA1B 3ZOQB 2EP3A 2VESA 4FW7A 3DJWA 1H72C 1ZM4A 3GMEA 1USVA 2JR1A 3K6QA 4L8NA 3P3CA 3QT8A 1FWLA 4O5GA 1IMUA 1VI7A 4LFAE 2V86A 2JPAA 2UXCE 4F9AB 1A1IA 4Q28A 2KONA 5K36C 5LMUI 3J81Q 3MSWA 2Z5BB 5K36A 4LF8E 2JEBB 3LTOA 2PO0A 3OTOI 5K36F 1N36E 1GZ6A 2EPOA 4LF7E 2O1TA 4MU3A 2EMXA 2O1UA 4YHHI 2CT1A 2YTPA 1NEIA 4WUDA 4DV1I 4DR4I 1KIJA 4DV5I 2V83A 2F4VI 5BR8E 5IXMB 1ZM2A 1ZXNA 1XNRE 1BBGA 1ZU1A 2NUEA 1YYKA 2EL4A 4GKJI 5KL3A 1E3PA 1NHJA 3ECRA 2EPKX 2L3CA 4DR1E 3GONA 5JEAB 1IBKI 4LFCI 4IFDB 1Z1BA 1U2RA 2LBSB 4IZJA 4M30A 3T1HI 2V2ZA 2E72A 2AJ4A 2HKJA 1KVKA 2J7KA 1J5EI 2EOSA 4R2AA 2F1DA 4MU4A 1UEKA 4GKKI 1I94E 3LNUA 3L00A 2WBUA 2EN2A 2YTNA 4NZVA 4P78A 2E5LE 4DV6I 3M85D 3TQMA 3LMLA 3P3EA 2UUAE 2UXBI 3DF6A 5DROA 3BBGA 1XMOE 2L2NA 3KZYA 2LJHA 4JI8E 4K0KE 4KHPE 2GLIA 2KOUA 3THNA 1ELOA 2C38A 1AH5A 5A6AA 4NBQA 2EN7A 2M1SA 1HR0E 5LMNI 3H1CA 4DUYE 2YSOA 2EQ3A 1Z5BA 4WPYA 4JI4I 2EWLA 1MU5A 3V5RA 1Z0CA 5K36E 1ZBQA 1IBLE 4JV5E 2A25A 1MX0A 4ZYEA 1WUUA 4IZJD 4N4RB 4LF5I 2PO1B 4F54A 4JI1E 3K17A 2RPCA 5AC5A 1Z0VA 1Z0BA 2JE6A 2Z5CB 2BA0D 2Q8UA 3B4TA 2JVAA 2KHXA 3QG5C 3PYFA 2JEAB 3JTZA 4P7DA 1N0UA 3U1YA 3V2UC 2EPRA 2EMGA 2L3JA 1RC7A 2C37B 4JI0I 4BBYA 5KL2A 4DV4E 5AASA 5TSEA 2DEJA 2EOEA 3IWDA 4DR2I 4DR3I 1IBMI 4J8ZA 4X62E 5IT9C 1PKPA 1Y6ZA 4JI2E 4OX9E 2UU9I 4B3ME 4ZYDA 4LPFA 2DIXA 5AC4A 1GQEA 3ADIA 2RSIA 3MHHC 4WXDA 1NHHA 4ISAA 4J3DA 4ZYHA 2CSHA 4DV0I 2EMYA 4AQYI 4DR5I 4BHCA 2BBGA 3PRYA 4OO1A 3J80Q 2L8TA 1PDAA 3F6GA 4KWYA 3OTOE 5K36B 2I9IA 2PO0B 4JYAI 4BA2B 1KTVA 5A69A 2B7VA 1RQ0A 5KL4A 4DV2I 5KL5A 2EOZA 4I8OA 4DV5E 5LLQA 2HFUA 1MEYC 3JU0A 2LJPA 5ADZA 2CGEA 2EM7A 4R8OA 5FLXQ 1YPNA 2J65A 2V2VA 3KWRA 4DR6E 2DEIA 4LFCE 2NN6C 3CWVA 3PS2A 4B3RI 3GLLA 4R1FA 4IZJB 2NN6A 1MGTA 1AAYA 3P06A 4NXMI 3AV0A 1P47A 1Z0EA 5A6JA 1YYOA 5GMEA 4R2PA 3U1KA 2N8XA 4AIMA 2VQEI 3VHTB 2J7JA 2EJ4A 1A1GA 2EOMA 4L5NC 2EZ6A 2BM1A 2GO4A 4U3DA 4HACB 4DPTA 3JAMQ 2LMZA 4B3SE 1FKAE 1QZRA 2C38B 2BB8A 3ADJA 4HTGA 2VQFE 1L4SA 3EPLA 3ZZ0A 5DNYA 4R2QA 3B78A 3UK3C 2HJJA 2UUBE 2NPFA 2L92A 2PNZA 4LCHA 4DV3I 1N34I 2L6MA 2LRSA 4RHBB 1UDNA 2YU8A 4PRVA 3HQ1A 1G2DC 4X65E 2V2QA 1HNWE 2JE6B 4GQUA 2PRTA 2L33A 2WW4A 2EOFA 1X5WA 2YU5A 1BKNA 1Y4UA 1X6EA 3HKMA 4FWDA 4IS9A 1MG7A 2R3VA 4FWGA 2DSYA 1UN6B 2IOQA 3K85A 2HHHE 4DU7A 2G7HA 2EPXA 5CFFE 1IBME 2NN6E 2PNLA 3UHMA 4JI5E 1UHZA 4X66I 2EMHA 1NZ0A 2EMIA 4NXNE 1IQSA 4MYTA 1WXRA 2HKEA 2H36X 2JT2A 1ZM3A 4LCGA 1YUJA 1D6TA 2DLQA 3J7Yp 5A2QQ 2YZTA 2B9DA 1TF3A 4OO1B 4MQYA 4LF6E 1HNXI 2IOPA 1A1KA 3D4JA 4JYAE 2FGGA 4FWHA 1T4NA 4LFBE 3HULA 1LLMC 2EQ0A 3J81C 5C0XC 1SFEA 2RQLA 2EM6A 4DPYA 2N3HA 2YRHA 5C0XF 2EPNA 2DGCA 4O4KA 2LTSA 2EM4A 1GTKA 4Z7YA 2MC5A 4LF9E 4UTGA 2EOHA 4GEQB 3ZM7A 4DU8A 2R76A 2DMYA 1HNZE 2ZM6E 4TUIA 4MLQA 4DR7E 4JI7I 1JK2A 2NN6B 2BA1D 4RH8A 1UDOA 2ENAA 1EKZA 4QNJA 1FJGE 2NUGA 2EM8A 2IHR1 1N32E 2CVEA 1T39A 4DUZI 3HXLA 4X64E 2IESA 4LF4I 1TF6A 1A6FA 5IWAI 2HGHA 4DV7I 3T1YI 4B3TE 1R6MA 4F6NA 2JP9A 3PYGA 2YTFA 2WP8A 5C0XD 2JOBA 2L2KB 2PNZB 3IWBA 1X6FA 3THOB 4USMA 2RS7A 2HK2A 1Z5AA 4YY3I 1JK1A 3L7ZA 2ZITA 1A1LA 2FV4B 1N33E 2C39A 1ZR9A 2WZOA 4JG4A 3VYXA 3BF2A 2FTXB 2ELYA 1SR9A 1Z59A 4HYMA 1XMQI 2UUCI 2UXDI 1B69A 2GS8A 2R42A 2LO3A 4LU9A
chains in the Genus database with same CATH topology
3PYDA 4JI6I 4FW9A 2CG9A 2V8PA 4URLA 1DQ3A 5LMUE 4X66E 3QT5A 1J26A 5AE1A 4OOGC 4BMJA 2E1MA 1STUA 4YHHE 1XNQI 4DR4E 4DV1E 4MYUA 5FWKA 3Q6MA 4DXLA 4LFAI 4TUGA 2F4VE 1VISA 2UXCI 4BC7A 2V88A 2LUPB 2CPNA 2RSMA 2X7IA 1HNXE 4GKJE 4LF8I 2XEXA 1RREA 1N36I 3Q6NA 4EMDA 2V34A 1IBKE 2Q2EB 4UT4A 4M2ZA 4LF7I 3J80C 3T1HE 2NUFA 1Z0TA 4PU9A 1H7SA 3HPZA 1J5EE 4P7AA 4GKKE 1XNRI 4DV6E 2A2CA 1EA6A 2JY9A 2UXBE 2LTRA 5F3WA 3OMLA 4DR1I 1RR9A 2BV3A 4I3HA 2M4IA 1HK7A 2HK3A 2ODRD 3LPSA 2K4VA 5LMNE 5AE2A 3VYYA 3M6AA 1I94I 2E5LI 4Z7CA 4JI4E 2UUAI 3F0NA 4WFTA 4LF5E 1XMOI 4JI8I 4K0KI 3C4TA 4HY1A 4KHPI 4HXZA 2O1VA 3B82A 3WU6A 2VE7C 3H4LA 2M7QA 4YY3E 4USKA 4DUYI 4LTYA 3AUZA 2CZ9A 4BC9A 4JV5I 3VK6A 2JOXA 2JWOA 4JI0E 2B3TB 2RS6A 4N3OA 4DR3E 2NA2A 1PVGA 4LF4E 2UU9E 2PNMA 2L2MA 3HJCA 3RMPA 3QT6A 4JI6E 4DV0E 4AQYE 5T6JA 4DV4I 4DR5E 2V85A 1XHKA 4X62I 4JI2I 4OX9I 4B3MI 1B63A 1QU6A 1UILA 4DV2E 1XNQE 5LL6R 4IZKA 2DB2A 2F8BA 1K47A 2ZBKB 3H09A 2V87A 2MC6A 2V89A 1ZXMA 4DPWA 4B3RE 5A2QC 1S4EA 3ZKBA 4NXME 1S16A 4DMIA 1FI4A 3K1JA 2VQEE 4PRXA 4FN5A 2O1WA 3P1XA 2A2DA 1FWKA 4DR6I 4F9CB 1O0WA 2X36A 4DR2E 2VF3A 1X49A 5GMDA 4DV3E 2B7TA 1N34E 4WSPA 1N0VC 4HACA 3ADLA 4WUCA 4DPXA 2EFGA 1DARA 3HPSA 2V8QB 1WHNA 3IWCA 4B3SI 2VQFI 4WYQB 1H74A 2UUBI 3WU4A 1WHQA 2N3GA 2LE2A 1YYWA 4JI3I 4R03A 5IT9Q 1Z5CA 3C4BA 4X65I 1X48A 1H73A 1HNWI 1ZM9A 1PIEA 4M0VA 3WU5A 3J7AM 3F6HA 2ODRC 1Z0GA 3HTXA 1T4OA 2HHHI 1EI1A 4KQVA 2YT4A 2Z5BA 2RTXA 2OI2A 4JI5I 4BCAA 4NXNI 2MDRA 2Z5EA 4RPFA 1NHIA 3B8HA 4IZKB 4ZVIA 1Y4SA 5BR8I 4LF6I 4XTJA 4LFBI 3Q1QA 3ZZUA 4KZSA 4JI7E 1Z0WA 4M1KA 1FNMA 5FLXC 4WUBA 4P52A 4DUZE 4LF9I 2LUQA 1T4LB 2ZM6I 5IWAE 4DV7E 3T1YE 1HNZI 1YZ9A 4DR7I 2BM0A 1FJGI 4X8WA 1B62A 3ZZTA 1N32I 1H7UA 1HR0I 3JAMC 5L3JA 4X64I 1X47A 3QT7A 4ED4A 1USUA 4DKKA 4B3TI 3WU3A 1IBLI 2HFSA 4JI1I 4BS9A 1XMQE 2UUCE 2UXDE 2Z5CA 2VF1A 4DPUA 3J7AG 3FIGA 1KKHA 4JI3E 1ZBTA 3PYEA 3ZKDA 1N33I 5AE3A 3ADGA 1DI2A 4F9BB 2E1RA 3LLHA 1OJ4A 2GQ0A 3ZOQB 3DJWA 1H72C 1ZM4A 1USVA 2JR1A 3K6QA 4L8NA 3QT8A 1FWLA 4LFAE 2V86A 2UXCE 4F9AB 4Q28A 2KONA 5LMUI 3J81Q 3MSWA 2Z5BB 4LF8E 3LTOA 3OTOI 1N36E 1GZ6A 4LF7E 2O1TA 2O1UA 4YHHI 4DR4I 4WUDA 4DV1I 1KIJA 4DV5I 2V83A 2F4VI 5BR8E 1ZM2A 1ZXNA 1XNRE 2NUEA 1YYKA 4GKJI 3GONA 1NHJA 2L3CA 4DR1E 1IBKI 4LFCI 1U2RA 2LBSB 4IZJA 4M30A 3T1HI 2V2ZA 2AJ4A 2HKJA 1KVKA 2J7KA 1J5EI 1UEKA 4GKKI 1I94E 3LNUA 4P78A 2E5LE 4DV6I 3LMLA 2UUAE 2UXBI 3DF6A 1XMOE 2L2NA 4JI8E 2LJHA 4K0KE 4KHPE 2KOUA 1ELOA 2M1SA 1HR0E 5LMNI 4DUYE 1Z5BA 4JI4I 4WPYA 2EWLA 1MU5A 3V5RA 1Z0CA 1ZBQA 1IBLE 4JV5E 1WUUA 1MX0A 4IZJD 4LF5I 4F54A 4JI1E 3K17A 1Z0VA 1Z0BA 2Z5CB 2JVAA 2KHXA 3PYFA 3JTZA 4P7DA 1N0UA 3V2UC 2L3JA 1RC7A 4JI0I 4BBYA 4DV4E 5AASA 4DR3I 2DEJA 3IWDA 1IBMI 4J8ZA 4X62E 5IT9C 1PKPA 1Y6ZA 4OX9E 4JI2E 2UU9I 4B3ME 2DIXA 1GQEA 3ADIA 1NHHA 4DV0I 4AQYI 4DR5I 3J80Q 3PRYA 2L8TA 3F6GA 3OTOE 4JYAI 1KTVA 2B7VA 1RQ0A 4DV2I 4I8OA 4DV5E 2HFUA 3JU0A 2LJPA 5ADZA 2CGEA 4R8OA 5FLXQ 2V2VA 3KWRA 4DR6E 2DEIA 4LFCE 3CWVA 4B3RI 4R1FA 4IZJB 3P06A 4NXMI 3AV0A 1Z0EA 5GMEA 1YYOA 2VQEI 2EZ6A 4L5NC 2BM1A 4HACB 4DPTA 3JAMQ 2LMZA 4B3SE 1FKAE 1QZRA 4DR2I 3ADJA 2VQFE 3ZZ0A 5DNYA 3B78A 2UUBE 2NPFA 2L92A 4DV3I 1N34I 2L6MA 2LRSA 4PRVA 3HQ1A 4X65E 2V2QA 1HNWE 2WW4A 2L33A 1BKNA 1Y4UA 4FWDA 1MG7A 2R3VA 4FWGA 2DSYA 2IOQA 3K85A 2HHHE 4DU7A 2G7HA 5CFFE 1IBME 2PNLA 4JI5E 1UHZA 4X66I 1NZ0A 4NXNE 4MYTA 1WXRA 2HKEA 2H36X 1ZM3A 1D6TA 3J7Yp 5A2QQ 2YZTA 2B9DA 4LF6E 1HNXI 2IOPA 3D4JA 4JYAE 2FGGA 4FWHA 1T4NA 4LFBE 3HULA 3J81C 4DPYA 2N3HA 2LTSA 4Z7YA 2MC5A 4LF9E 4UTGA 4GEQB 3ZM7A 4DU8A 2DMYA 1HNZE 2ZM6E 4TUIA 4DR7E 4JI7I 1EKZA 1FJGE 2NUGA 2IHR1 1N32E 4DUZI 3HXLA 4X64E 1A6FA 5IWAI 4DV7I 3T1YI 4B3TE 3PYGA 2JOBA 2L2KB 4USMA 3IWBA 2RS7A 2HK2A 1Z5AA 4YY3I 2ZITA 2FV4B 1N33E 2WZOA 4JG4A 3VYXA 2FTXB 1SR9A 1Z59A 4HYMA 1XMQI 2UUCI 2UXDI 2GS8A 2R42A 4LF4I 4LU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYD A;  4JI6 I;  4FW9 A;  2V8P A;  4URL A;  5LMU E;  4X66 E;  3QT5 A;  1J26 A;  4OOG C;  1STU A;  4YHH E;  1XNQ I;  4DR4 E;  4DV1 E;  4MYU A;  4DXL A;  4LFA I;  2F4V E;  1VIS A;  2UXC I;  2LUP B;  2CPN A;  2RSM A;  2X7I A;  1HNX E;  4GKJ E;  4LF8 I;  2XEX A;  1RRE A;  1N36 I;  4EMD A;  2V34 A;  1IBK E;  2Q2E B;  4UT4 A;  4M2Z A;  4LF7 I;  3J80 C;  3T1H E;  2NUF A;  1Z0T A;  4PU9 A;  1H7S A;  1J5E E;  4P7A A;  4GKK E;  1XNR I;  4DV6 E;  2A2C A;  1EA6 A;  2JY9 A;  2UXB E;  2LTR A;  4DR1 I;  1RR9 A;  2BV3 A;  4I3H A;  2HK3 A;  3LPS A;  1I94 I;  5LMN E;  3VYY A;  3M6A A;  2E5L I;  4Z7C A;  4JI4 E;  2UUA I;  3F0N A;  4WFT A;  4LF5 E;  1XMO I;  4JI8 I;  4K0K I;  3C4T A;  4HY1 A;  4KHP I;  4HXZ A;  3B82 A;  3WU6 A;  3H4L A;  4YY3 E;  4USK A;  4DUY I;  2CZ9 A;  4JV5 I;  4JI0 E;  2B3T B;  2RS6 A;  4DR3 E;  2NA2 A;  1PVG A;  4LF4 E;  2UU9 E;  2L2M A;  3QT6 A;  4JI6 E;  4DV0 E;  4AQY E;  4DV4 I;  4DR5 E;  1XHK A;  4X62 I;  4JI2 I;  4OX9 I;  4B3M I;  1B63 A;  1QU6 A;  1UIL A;  4DV2 E;  1XNQ E;  5LL6 R;  2DB2 A;  1K47 A;  2ZBK B;  1ZXM A;  4DPW A;  4B3R E;  5A2Q C;  1S4E A;  3ZKB A;  4NXM E;  1S16 A;  1FI4 A;  3K1J A;  2VQE E;  4PRX A;  4FN5 A;  3P1X A;  2A2D A;  1FWK A;  4DR6 I;  1O0W A;  2X36 A;  4DR2 E;  2VF3 A;  1X49 A;  5GMD A;  4DV3 E;  2B7T A;  1N34 E;  1N0V C;  4HAC A;  3ADL A;  4WUC A;  4DPX A;  2EFG A;  1DAR A;  1WHN A;  4B3S I;  2VQF I;  4WYQ B;  1H74 A;  2UUB I;  3WU4 A;  1WHQ A;  2N3G A;  1YYW A;  4JI3 I;  5IT9 Q;  1Z5C A;  3C4B A;  4X65 I;  1X48 A;  1H73 A;  1HNW I;  1ZM9 A;  1PIE A;  3WU5 A;  3J7A M;  1Z0G A;  3HTX A;  1T4O A;  2HHH I;  1EI1 A;  4KQV A;  2YT4 A;  2RTX A;  2OI2 A;  4JI5 I;  4NXN I;  2MDR A;  4RPF A;  1NHI A;  3B8H A;  4ZVI A;  5BR8 I;  4LF6 I;  4XTJ A;  4LFB I;  3Q1Q A;  3ZZU A;  4JI7 E;  1Z0W A;  4M1K A;  1FNM A;  5FLX C;  4WUB A;  4P52 A;  4DUZ E;  4LF9 I;  2LUQ A;  1T4L B;  2ZM6 I;  5IWA E;  4DV7 E;  3T1Y E;  1HNZ I;  1YZ9 A;  4DR7 I;  2BM0 A;  1FJG I;  4X8W A;  1B62 A;  3ZZT A;  1N32 I;  1H7U A;  1HR0 I;  3JAM C;  5L3J A;  4X64 I;  1X47 A;  3QT7 A;  4ED4 A;  4DKK A;  4B3T I;  3WU3 A;  1IBL I;  2HFS A;  4JI1 I;  1XMQ E;  2UUC E;  2UXD E;  4DPU A;  3J7A G;  1KKH A;  4JI3 E;  1ZBT A;  3PYE A;  3ZKD A;  1N33 I;  3ADG A;  1DI2 A;  2E1R A;  3LLH A;  1OJ4 A;  1H72 C;  1ZM4 A;  3QT8 A;  1FWL A;  4LFA E;  2UXC E;  5LMU I;  3J81 Q;  4LF8 E;  3LTO A;  3OTO I;  1N36 E;  4LF7 E;  4YHH I;  4DR4 I;  4WUD A;  4DV1 I;  1KIJ A;  4DV5 I;  2F4V I;  5BR8 E;  1ZM2 A;  1ZXN A;  1XNR E;  2NUE A;  1YYK A;  4GKJ I;  3GON A;  1NHJ A;  2L3C A;  4DR1 E;  1IBK I;  4LFC I;  1U2R A;  2LBS B;  4M30 A;  3T1H I;  2V2Z A;  2AJ4 A;  2HKJ A;  1KVK A;  2J7K A;  1J5E I;  1UEK A;  4GKK I;  1I94 E;  3LNU A;  2E5L E;  4DV6 I;  2UUA E;  2UXB I;  1XMO E;  2L2N A;  4JI8 E;  2LJH A;  4K0K E;  4KHP E;  1ELO A;  1HR0 E;  5LMN I;  4DUY E;  1Z5B A;  4JI4 I;  1MU5 A;  3V5R A;  1Z0C A;  1IBL E;  4JV5 E;  4LF5 I;  1WUU A;  1MX0 A;  4JI1 E;  3K17 A;  1Z0V A;  1Z0B A;  2JVA A;  2KHX A;  3PYF A;  1N0U A;  3V2U C;  2L3J A;  1RC7 A;  4JI0 I;  4DV4 E;  4DR3 I;  2DEJ A;  1IBM I;  4X62 E;  5IT9 C;  1PKP A;  2UU9 I;  4JI2 E;  4OX9 E;  4B3M E;  2DIX A;  1GQE A;  3ADI A;  1NHH A;  4DV0 I;  4AQY I;  4DR5 I;  3J80 Q;  3OTO E;  4JYA I;  1KTV A;  2B7V A;  1RQ0 A;  4DV2 I;  4DV5 E;  2HFU A;  2LJP A;  5FLX Q;  2V2V A;  4DR6 E;  3CWV A;  2DEI A;  4LFC E;  4B3R I;  4R1F A;  4NXM I;  1Z0E A;  5GME A;  1YYO A;  2VQE I;  2EZ6 A;  2BM1 A;  4HAC B;  4DPT A;  3JAM Q;  4B3S E;  1FKA E;  1QZR A;  4DR2 I;  3ADJ A;  2VQF E;  3ZZ0 A;  3B78 A;  2UUB E;  2NPF A;  4DV3 I;  1N34 I;  2LRS A;  4PRV A;  4X65 E;  2V2Q A;  1HNW E;  2WW4 A;  2L33 A;  1BKN A;  4FWD A;  1MG7 A;  4FWG A;  2R3V A;  2HHH E;  4DU7 A;  5CFF E;  1IBM E;  4JI5 E;  1UHZ A;  4X66 I;  1NZ0 A;  4NXN E;  4MYT A;  2HKE A;  1ZM3 A;  1D6T A;  3J7Y p;  5A2Q Q;  4LF6 E;  1HNX I;  3D4J A;  4JYA E;  4FWH A;  1T4N A;  4LFB E;  3HUL A;  3J81 C;  4DPY A;  2N3H A;  2LTS A;  4Z7Y A;  4LF9 E;  4UTG A;  3ZM7 A;  4DU8 A;  2DMY A;  1HNZ E;  2ZM6 E;  4DR7 E;  4JI7 I;  1EKZ A;  1FJG E;  2NUG A;  2IHR 1;  1N32 E;  4DUZ I;  4X64 E;  1A6F A;  5IWA I;  4DV7 I;  3T1Y I;  4B3T E;  3PYG A;  2L2K B;  4USM A;  2RS7 A;  2HK2 A;  1Z5A A;  4YY3 I;  2ZIT A;  1N33 E;  4JG4 A;  3VYX A;  1Z59 A;  4HYM A;  1XMQ I;  2UUC I;  2UXD I;  2GS8 A;  2R42 A;  4LF4 I; 
#chains in the Genus database with same CATH topology
 1EH6 A;  3PYD A;  2MKN A;  4O24 A;  2WNR A;  4JI6 I;  4FW9 A;  2CG9 A;  2V8P A;  4URL A;  1DQ3 A;  5LMU E;  1A1F A;  2EL5 A;  4MLV A;  4X66 E;  4X9J A;  1X3C A;  1J26 A;  3QT5 A;  4U3B A;  5AE1 A;  5EL9 A;  4OOG C;  2NAB A;  4BMJ A;  2E1M A;  1STU A;  4YHH E;  3PS3 A;  4DR4 E;  4DV1 E;  4MYU A;  3C6M A;  5FWK A;  1XNQ I;  3Q6M A;  4DXL A;  4LFA I;  4TUG A;  2F4V E;  1VIS A;  2UXC I;  4BC7 A;  2V88 A;  4IJD A;  2LUP B;  2YPN A;  2CPN A;  4WXC A;  4FW4 A;  2RSM A;  2YTG A;  1HNX E;  2EN3 A;  2X7I A;  2GO3 A;  4LCF A;  2JEB A;  4GKJ E;  4LF8 I;  2XEX A;  1RRE A;  1N36 I;  3Q6N A;  4EMD A;  2V34 A;  1IBK E;  2Q2E B;  4FW5 A;  2EOJ A;  4M2Z A;  4UT4 A;  3J80 C;  3DD6 A;  4LF7 I;  4AM3 A;  3T1H E;  2EL6 A;  2NUF A;  1Z0T A;  3MHS C;  4PU9 A;  2WBS A;  3HPZ A;  1H7S A;  1J5E E;  4P7A A;  4GKK E;  4R2S A;  1XNR I;  5JEA C;  2PO2 A;  3EQ1 A;  4DV6 E;  1KJK A;  3M7N D;  2A2C A;  1EA6 A;  2JY9 A;  4R2R A;  2UXB E;  2LTR A;  5F3W A;  3OML A;  5JEA F;  4DR1 I;  2LV2 A;  1RR9 A;  1YH8 A;  2EML A;  2BV3 A;  4I3H A;  2M4I A;  1HK7 A;  2HK3 A;  2ODR D;  1X6H A;  2EMW A;  3LPS A;  2K4V A;  5LMN E;  5AE2 A;  3VYY A;  2JYA A;  3M6A A;  1I94 I;  2YTD A;  2E5L I;  2EPL X;  4Z7C A;  2YTE A;  4JI4 E;  3M85 G;  1P42 A;  2UUA I;  3F0N A;  3BGH A;  2EMZ A;  4WFT A;  4LF5 E;  1XMO I;  2EOR A;  2EM2 A;  2BA1 G;  4JI8 I;  4K0K I;  3C4T A;  4HY1 A;  4KHP I;  4HXZ A;  2WP8 B;  4R2E A;  2O1V A;  2YTQ A;  2EOO A;  2EPC A;  2GHF A;  1A1J A;  3B82 A;  3WU6 A;  3EPJ A;  2VE7 C;  2LT7 A;  3H4L A;  5DNX A;  2M7Q A;  4YY3 E;  4USK A;  1NCS A;  4LTY A;  5JEA D;  4DUY I;  3AUZ A;  2WCC 3;  3L7Z B;  4IFD D;  2EOQ A;  2CZ9 A;  4BC9 A;  5DRQ A;  4JV5 I;  3VK6 A;  2EPU A;  2JOX A;  2ENC A;  2JWO A;  2VRD A;  4JI0 E;  2B3T B;  5DRP A;  2RS6 A;  3BID A;  4N3O A;  4DR3 E;  2NA2 A;  4AID A;  1PVG A;  4LF4 E;  1YSA C;  4Q35 B;  2JXP A;  2UU9 E;  2BA0 G;  2PNM A;  2EM3 A;  2L2M A;  3HJC A;  4HEI A;  2EPA A;  2EN1 A;  3RMP A;  1QNT A;  5DRR A;  3QT6 A;  4FK5 C;  4JI6 E;  2WNR B;  5JEA E;  2C37 A;  5IV8 B;  1E3H A;  1R6L A;  4DV0 E;  4IS1 C;  1DGC A;  4AQY E;  1YUI A;  5T6J A;  4LOM A;  2EMB A;  4DR5 E;  4DV4 I;  1WJP A;  2V85 A;  1XHK A;  4X62 I;  4JI2 I;  4OX9 I;  4B3M I;  1OYR A;  3EPH A;  1B63 A;  2EPM X;  1QU6 A;  1UIL A;  4DV2 E;  1XNQ E;  4MDT A;  2LVH A;  2DRP A;  2K7I A;  5LL6 R;  1UBD C;  4IZK A;  5C0X A;  1YFH A;  2YTO A;  2DB2 A;  2F8B A;  1K47 A;  2ZBK B;  3H09 A;  2IER A;  2V87 A;  4F6M A;  2MDG A;  2MC6 A;  2V89 A;  4NHR A;  1ZXM A;  4DPW A;  2EOX A;  2YWQ A;  4BA2 A;  4B3R E;  5A2Q C;  1Y60 A;  5A6B D;  1UDS A;  2R1F A;  2I13 A;  1S4E A;  2EPP A;  4MU1 A;  3ZKB A;  4NXM E;  1HNZ I;  1S16 A;  4DMI A;  1TN9 A;  1FI4 A;  3K1J A;  2VQE E;  4PRX A;  2PO2 B;  4FN5 A;  2O1W A;  3P1X A;  2A2D A;  1FWK A;  1OYP A;  2DMI A;  4DR6 I;  2AE8 A;  4F9C B;  1O0W A;  2X36 A;  1BB8 A;  4MU0 A;  4DR2 E;  4FW6 A;  2EMK A;  5EKW A;  2VF3 A;  1UDQ A;  1Y5Y A;  2GPI A;  2EM5 A;  2WBT A;  1X49 A;  3EPK A;  3P3G A;  5K36 D;  1PJQ A;  3KZZ A;  5GMD A;  2M9A A;  2B7T A;  4DV3 E;  3CDJ A;  1N34 E;  3M7N G;  2YTJ A;  4WSP A;  1N0V C;  2O3Z A;  4HAC A;  2MKD A;  3ADL A;  4WUC A;  5A6K A;  4ZYG A;  4M9V C;  2EFG A;  4DPX A;  1DAR A;  3HPS A;  2V8Q B;  2EQ1 A;  1WHN A;  3IWC A;  4B3S I;  2VQF I;  4WYQ B;  4BHB A;  1H74 A;  2EE8 A;  5C0X E;  2UUB I;  1KYQ A;  1WHQ A;  2ELZ A;  2N3G A;  4WSG A;  3WU4 A;  2LE2 A;  1YYW A;  4JI3 I;  1WRJ A;  2BR2 A;  4R03 A;  3KRN A;  2EN4 A;  5IT9 Q;  1BBO A;  4GZN C;  4R2C A;  3C4B A;  1G2F C;  1Z5C A;  4BA1 A;  4X65 I;  1X48 A;  1H73 A;  1HNW I;  2ADR A;  2CTD A;  1ZM9 A;  1PIE A;  4M0V A;  2LJU A;  3WU5 A;  2LCE A;  3CDI A;  4R2D A;  2EPZ A;  3J7A M;  3F6H A;  2YRM A;  2ODR C;  2D9H A;  2HC5 A;  1Z0G A;  3HTX A;  2EOI A;  1T4O A;  2HHH I;  1EI1 A;  4KQV A;  2YT4 A;  1T38 A;  2Z5B A;  2RTX A;  2OI2 A;  3NZK A;  3P76 A;  1YHC A;  4JI5 I;  4BCA A;  4NXN I;  2MDR A;  2EMF A;  1A1H A;  2Z5E A;  4RPF A;  1NHI A;  3B8H A;  3M99 B;  5KL7 A;  4OO1 C;  4IZK B;  4ZVI A;  5C0X B;  1Y4S A;  2YSP A;  5BR8 I;  4OO1 F;  1F2I G;  4LF6 I;  1PJT A;  1EH8 A;  4IFD C;  5JEA A;  4XTJ A;  2EMA A;  4LFB I;  3Q1Q A;  1ZAA C;  3ZZU A;  4IFD A;  4KZS A;  4JI7 E;  3GCM A;  1Z0W A;  4IFD F;  4M1K A;  1FNM A;  5FLX C;  4WUB A;  4P52 A;  2DLK A;  4DUZ E;  2ENH A;  5KL6 A;  4LF9 I;  4WX9 A;  2LUQ A;  5DNL A;  1T4L B;  1OYS A;  5IWA E;  2EM0 A;  4DV7 E;  3T1Y E;  1YZ9 A;  2EOY A;  3PS1 A;  2ZM6 I;  4DR7 I;  2EN6 A;  2NN6 F;  2BM0 A;  1FJG I;  4X8W A;  4OO1 D;  1B62 A;  2EN8 A;  3ZZT A;  1N32 I;  1H7U A;  1HR0 I;  3JAM C;  5L3J A;  4X64 I;  1X47 A;  3QT7 A;  4ED4 A;  1USU A;  4DKK A;  2EMC A;  3WU3 A;  4B3T I;  1IBL I;  1EH7 A;  1PJS A;  2PO1 A;  2C39 B;  1RMD A;  2HFS A;  5ELW A;  4JI1 I;  2EM9 A;  4BS9 A;  1XMQ E;  2UUC E;  2UXD E;  4O43 A;  2Z5C A;  2VF1 A;  1XXE A;  4F2J C;  4DPU A;  3J7A G;  3FIG A;  1KKH A;  4OO1 E;  4JI3 E;  1ZBT A;  3PYE A;  3ZKD A;  2JEA A;  2BR2 B;  5A6B A;  1N33 I;  2NN6 D;  2YRK A;  5AE3 A;  1RHY A;  4FW3 A;  1IQO A;  4OZE A;  3ADG A;  4OKG A;  1N3G A;  4IFD E;  2YTI A;  1DI2 A;  4QNK A;  4F9B B;  2E1R A;  3LLH A;  1OJ4 A;  2GQ0 A;  3C6K A;  4BA1 B;  3ZOQ B;  2EP3 A;  2VES A;  4FW7 A;  3DJW A;  1H72 C;  1ZM4 A;  3GME A;  1USV A;  2JR1 A;  3K6Q A;  4L8N A;  3P3C A;  3QT8 A;  1FWL A;  4O5G A;  1IMU A;  1VI7 A;  4LFA E;  2V86 A;  2JPA A;  2UXC E;  4F9A B;  1A1I A;  4Q28 A;  2KON A;  5K36 C;  5LMU I;  3J81 Q;  3MSW A;  2Z5B B;  5K36 A;  4LF8 E;  2JEB B;  3LTO A;  2PO0 A;  3OTO I;  5K36 F;  1N36 E;  1GZ6 A;  2EPO A;  4LF7 E;  2O1T A;  4MU3 A;  2EMX A;  2O1U A;  4YHH I;  2CT1 A;  2YTP A;  1NEI A;  4WUD A;  4DV1 I;  4DR4 I;  1KIJ A;  4DV5 I;  2V83 A;  2F4V I;  5BR8 E;  5IXM B;  1ZM2 A;  1ZXN A;  1XNR E;  1BBG A;  1ZU1 A;  2NUE A;  1YYK A;  2EL4 A;  4GKJ I;  5KL3 A;  1E3P A;  1NHJ A;  3ECR A;  2EPK X;  2L3C A;  4DR1 E;  3GON A;  5JEA B;  1IBK I;  4LFC I;  4IFD B;  1Z1B A;  1U2R A;  2LBS B;  4IZJ A;  4M30 A;  3T1H I;  2V2Z A;  2E72 A;  2AJ4 A;  2HKJ A;  1KVK A;  2J7K A;  1J5E I;  2EOS A;  4R2A A;  2F1D A;  4MU4 A;  1UEK A;  4GKK I;  1I94 E;  3LNU A;  3L00 A;  2WBU A;  2EN2 A;  2YTN A;  4NZV A;  4P78 A;  2E5L E;  4DV6 I;  3M85 D;  3TQM A;  3LML A;  3P3E A;  2UUA E;  2UXB I;  3DF6 A;  5DRO A;  3BBG A;  1XMO E;  2L2N A;  3KZY A;  2LJH A;  4JI8 E;  4K0K E;  4KHP E;  2GLI A;  2KOU A;  3THN A;  1ELO A;  2C38 A;  1AH5 A;  5A6A A;  4NBQ A;  2EN7 A;  2M1S A;  1HR0 E;  5LMN I;  3H1C A;  4DUY E;  2YSO A;  2EQ3 A;  1Z5B A;  4WPY A;  4JI4 I;  2EWL A;  1MU5 A;  3V5R A;  1Z0C A;  5K36 E;  1ZBQ A;  1IBL E;  4JV5 E;  2A25 A;  1MX0 A;  4ZYE A;  1WUU A;  4IZJ D;  4N4R B;  4LF5 I;  2PO1 B;  4F54 A;  4JI1 E;  3K17 A;  2RPC A;  5AC5 A;  1Z0V A;  1Z0B A;  2JE6 A;  2Z5C B;  2BA0 D;  2Q8U A;  3B4T A;  2JVA A;  2KHX A;  3QG5 C;  3PYF A;  2JEA B;  3JTZ A;  4P7D A;  1N0U A;  3U1Y A;  3V2U C;  2EPR A;  2EMG A;  2L3J A;  1RC7 A;  2C37 B;  4JI0 I;  4BBY A;  5KL2 A;  4DV4 E;  5AAS A;  5TSE A;  2DEJ A;  2EOE A;  3IWD A;  4DR2 I;  4DR3 I;  1IBM I;  4J8Z A;  4X62 E;  5IT9 C;  1PKP A;  1Y6Z A;  4JI2 E;  4OX9 E;  2UU9 I;  4B3M E;  4ZYD A;  4LPF A;  2DIX A;  5AC4 A;  1GQE A;  3ADI A;  2RSI A;  3MHH C;  4WXD A;  1NHH A;  4ISA A;  4J3D A;  4ZYH A;  2CSH A;  4DV0 I;  2EMY A;  4AQY I;  4DR5 I;  4BHC A;  2BBG A;  3PRY A;  4OO1 A;  3J80 Q;  2L8T A;  1PDA A;  3F6G A;  4KWY A;  3OTO E;  5K36 B;  2I9I A;  2PO0 B;  4JYA I;  4BA2 B;  1KTV A;  5A69 A;  2B7V A;  1RQ0 A;  5KL4 A;  4DV2 I;  5KL5 A;  2EOZ A;  4I8O A;  4DV5 E;  5LLQ A;  2HFU A;  1MEY C;  3JU0 A;  2LJP A;  5ADZ A;  2CGE A;  2EM7 A;  4R8O A;  5FLX Q;  1YPN A;  2J65 A;  2V2V A;  3KWR A;  4DR6 E;  2DEI A;  4LFC E;  2NN6 C;  3CWV A;  3PS2 A;  4B3R I;  3GLL A;  4R1F A;  4IZJ B;  2NN6 A;  1MGT A;  1AAY A;  3P06 A;  4NXM I;  3AV0 A;  1P47 A;  1Z0E A;  5A6J A;  1YYO A;  5GME A;  4R2P A;  3U1K A;  2N8X A;  4AIM A;  2VQE I;  3VHT B;  2J7J A;  2EJ4 A;  1A1G A;  2EOM A;  4L5N C;  2EZ6 A;  2BM1 A;  2GO4 A;  4U3D A;  4HAC B;  4DPT A;  3JAM Q;  2LMZ A;  4B3S E;  1FKA E;  1QZR A;  2C38 B;  2BB8 A;  3ADJ A;  4HTG A;  2VQF E;  1L4S A;  3EPL A;  3ZZ0 A;  5DNY A;  4R2Q A;  3B78 A;  3UK3 C;  2HJJ A;  2UUB E;  2NPF A;  2L92 A;  2PNZ A;  4LCH A;  4DV3 I;  1N34 I;  2L6M A;  2LRS A;  4RHB B;  1UDN A;  2YU8 A;  4PRV A;  3HQ1 A;  1G2D C;  4X65 E;  2V2Q A;  1HNW E;  2JE6 B;  4GQU A;  2PRT A;  2L33 A;  2WW4 A;  2EOF A;  1X5W A;  2YU5 A;  1BKN A;  1Y4U A;  1X6E A;  3HKM A;  4FWD A;  4IS9 A;  1MG7 A;  2R3V A;  4FWG A;  2DSY A;  1UN6 B;  2IOQ A;  3K85 A;  2HHH E;  4DU7 A;  2G7H A;  2EPX A;  5CFF E;  1IBM E;  2NN6 E;  2PNL A;  3UHM A;  4JI5 E;  1UHZ A;  4X66 I;  2EMH A;  1NZ0 A;  2EMI A;  4NXN E;  1IQS A;  4MYT A;  1WXR A;  2HKE A;  2H36 X;  2JT2 A;  1ZM3 A;  4LCG A;  1YUJ A;  1D6T A;  2DLQ A;  3J7Y p;  5A2Q Q;  2YZT A;  2B9D A;  1TF3 A;  4OO1 B;  4MQY A;  4LF6 E;  1HNX I;  2IOP A;  1A1K A;  3D4J A;  4JYA E;  2FGG A;  4FWH A;  1T4N A;  4LFB E;  3HUL A;  1LLM C;  2EQ0 A;  3J81 C;  5C0X C;  1SFE A;  2RQL A;  2EM6 A;  4DPY A;  2N3H A;  2YRH A;  5C0X F;  2EPN A;  2DGC A;  4O4K A;  2LTS A;  2EM4 A;  1GTK A;  4Z7Y A;  2MC5 A;  4LF9 E;  4UTG A;  2EOH A;  4GEQ B;  3ZM7 A;  4DU8 A;  2R76 A;  2DMY A;  1HNZ E;  2ZM6 E;  4TUI A;  4MLQ A;  4DR7 E;  4JI7 I;  1JK2 A;  2NN6 B;  2BA1 D;  4RH8 A;  1UDO A;  2ENA A;  1EKZ A;  4QNJ A;  1FJG E;  2NUG A;  2EM8 A;  2IHR 1;  1N32 E;  2CVE A;  1T39 A;  4DUZ I;  3HXL A;  4X64 E;  2IES A;  4LF4 I;  1TF6 A;  1A6F A;  5IWA I;  2HGH A;  4DV7 I;  3T1Y I;  4B3T E;  1R6M A;  4F6N A;  2JP9 A;  3PYG A;  2YTF A;  2WP8 A;  5C0X D;  2JOB A;  2L2K B;  2PNZ B;  3IWB A;  1X6F A;  3THO B;  4USM A;  2RS7 A;  2HK2 A;  1Z5A A;  4YY3 I;  1JK1 A;  3L7Z A;  2ZIT A;  1A1L A;  2FV4 B;  1N33 E;  2C39 A;  1ZR9 A;  2WZO A;  4JG4 A;  3VYX A;  3BF2 A;  2FTX B;  2ELY A;  1SR9 A;  1Z59 A;  4HYM A;  1XMQ I;  2UUC I;  2UXD I;  1B69 A;  2GS8 A;  2R42 A;  2LO3 A;  4LU9 A; 
#chains in the Genus database with same CATH homology
 3PYD A;  4JI6 I;  4FW9 A;  2CG9 A;  2V8P A;  4URL A;  1DQ3 A;  5LMU E;  4X66 E;  3QT5 A;  1J26 A;  5AE1 A;  4OOG C;  4BMJ A;  2E1M A;  1STU A;  4YHH E;  1XNQ I;  4DR4 E;  4DV1 E;  4MYU A;  5FWK A;  3Q6M A;  4DXL A;  4LFA I;  4TUG A;  2F4V E;  1VIS A;  2UXC I;  4BC7 A;  2V88 A;  2LUP B;  2CPN A;  2RSM A;  2X7I A;  1HNX E;  4GKJ E;  4LF8 I;  2XEX A;  1RRE A;  1N36 I;  3Q6N A;  4EMD A;  2V34 A;  1IBK E;  2Q2E B;  4UT4 A;  4M2Z A;  4LF7 I;  3J80 C;  3T1H E;  2NUF A;  1Z0T A;  4PU9 A;  1H7S A;  3HPZ A;  1J5E E;  4P7A A;  4GKK E;  1XNR I;  4DV6 E;  2A2C A;  1EA6 A;  2JY9 A;  2UXB E;  2LTR A;  5F3W A;  3OML A;  4DR1 I;  1RR9 A;  2BV3 A;  4I3H A;  2M4I A;  1HK7 A;  2HK3 A;  2ODR D;  3LPS A;  2K4V A;  5LMN E;  5AE2 A;  3VYY A;  3M6A A;  1I94 I;  2E5L I;  4Z7C A;  4JI4 E;  2UUA I;  3F0N A;  4WFT A;  4LF5 E;  1XMO I;  4JI8 I;  4K0K I;  3C4T A;  4HY1 A;  4KHP I;  4HXZ A;  2O1V A;  3B82 A;  3WU6 A;  2VE7 C;  3H4L A;  2M7Q A;  4YY3 E;  4USK A;  4DUY I;  4LTY A;  3AUZ A;  2CZ9 A;  4BC9 A;  4JV5 I;  3VK6 A;  2JOX A;  2JWO A;  4JI0 E;  2B3T B;  2RS6 A;  4N3O A;  4DR3 E;  2NA2 A;  1PVG A;  4LF4 E;  2UU9 E;  2PNM A;  2L2M A;  3HJC A;  3RMP A;  3QT6 A;  4JI6 E;  4DV0 E;  4AQY E;  5T6J A;  4DV4 I;  4DR5 E;  2V85 A;  1XHK A;  4X62 I;  4JI2 I;  4OX9 I;  4B3M I;  1B63 A;  1QU6 A;  1UIL A;  4DV2 E;  1XNQ E;  5LL6 R;  4IZK A;  2DB2 A;  2F8B A;  1K47 A;  2ZBK B;  3H09 A;  2V87 A;  2MC6 A;  2V89 A;  1ZXM A;  4DPW A;  4B3R E;  5A2Q C;  1S4E A;  3ZKB A;  4NXM E;  1S16 A;  4DMI A;  1FI4 A;  3K1J A;  2VQE E;  4PRX A;  4FN5 A;  2O1W A;  3P1X A;  2A2D A;  1FWK A;  4DR6 I;  4F9C B;  1O0W A;  2X36 A;  4DR2 E;  2VF3 A;  1X49 A;  5GMD A;  4DV3 E;  2B7T A;  1N34 E;  4WSP A;  1N0V C;  4HAC A;  3ADL A;  4WUC A;  4DPX A;  2EFG A;  1DAR A;  3HPS A;  2V8Q B;  1WHN A;  3IWC A;  4B3S I;  2VQF I;  4WYQ B;  1H74 A;  2UUB I;  3WU4 A;  1WHQ A;  2N3G A;  2LE2 A;  1YYW A;  4JI3 I;  4R03 A;  5IT9 Q;  1Z5C A;  3C4B A;  4X65 I;  1X48 A;  1H73 A;  1HNW I;  1ZM9 A;  1PIE A;  4M0V A;  3WU5 A;  3J7A M;  3F6H A;  2ODR C;  1Z0G A;  3HTX A;  1T4O A;  2HHH I;  1EI1 A;  4KQV A;  2YT4 A;  2Z5B A;  2RTX A;  2OI2 A;  4JI5 I;  4BCA A;  4NXN I;  2MDR A;  2Z5E A;  4RPF A;  1NHI A;  3B8H A;  4IZK B;  4ZVI A;  1Y4S A;  5BR8 I;  4LF6 I;  4XTJ A;  4LFB I;  3Q1Q A;  3ZZU A;  4KZS A;  4JI7 E;  1Z0W A;  4M1K A;  1FNM A;  5FLX C;  4WUB A;  4P52 A;  4DUZ E;  4LF9 I;  2LUQ A;  1T4L B;  2ZM6 I;  5IWA E;  4DV7 E;  3T1Y E;  1HNZ I;  1YZ9 A;  4DR7 I;  2BM0 A;  1FJG I;  4X8W A;  1B62 A;  3ZZT A;  1N32 I;  1H7U A;  1HR0 I;  3JAM C;  5L3J A;  4X64 I;  1X47 A;  3QT7 A;  4ED4 A;  1USU A;  4DKK A;  4B3T I;  3WU3 A;  1IBL I;  2HFS A;  4JI1 I;  4BS9 A;  1XMQ E;  2UUC E;  2UXD E;  2Z5C A;  2VF1 A;  4DPU A;  3J7A G;  3FIG A;  1KKH A;  4JI3 E;  1ZBT A;  3PYE A;  3ZKD A;  1N33 I;  5AE3 A;  3ADG A;  1DI2 A;  4F9B B;  2E1R A;  3LLH A;  1OJ4 A;  2GQ0 A;  3ZOQ B;  3DJW A;  1H72 C;  1ZM4 A;  1USV A;  2JR1 A;  3K6Q A;  4L8N A;  3QT8 A;  1FWL A;  4LFA E;  2V86 A;  2UXC E;  4F9A B;  4Q28 A;  2KON A;  5LMU I;  3J81 Q;  3MSW A;  2Z5B B;  4LF8 E;  3LTO A;  3OTO I;  1N36 E;  1GZ6 A;  4LF7 E;  2O1T A;  2O1U A;  4YHH I;  4DR4 I;  4WUD A;  4DV1 I;  1KIJ A;  4DV5 I;  2V83 A;  2F4V I;  5BR8 E;  1ZM2 A;  1ZXN A;  1XNR E;  2NUE A;  1YYK A;  4GKJ I;  3GON A;  1NHJ A;  2L3C A;  4DR1 E;  1IBK I;  4LFC I;  1U2R A;  2LBS B;  4IZJ A;  4M30 A;  3T1H I;  2V2Z A;  2AJ4 A;  2HKJ A;  1KVK A;  2J7K A;  1J5E I;  1UEK A;  4GKK I;  1I94 E;  3LNU A;  4P78 A;  2E5L E;  4DV6 I;  3LML A;  2UUA E;  2UXB I;  3DF6 A;  1XMO E;  2L2N A;  4JI8 E;  2LJH A;  4K0K E;  4KHP E;  2KOU A;  1ELO A;  2M1S A;  1HR0 E;  5LMN I;  4DUY E;  1Z5B A;  4JI4 I;  4WPY A;  2EWL A;  1MU5 A;  3V5R A;  1Z0C A;  1ZBQ A;  1IBL E;  4JV5 E;  1WUU A;  1MX0 A;  4IZJ D;  4LF5 I;  4F54 A;  4JI1 E;  3K17 A;  1Z0V A;  1Z0B A;  2Z5C B;  2JVA A;  2KHX A;  3PYF A;  3JTZ A;  4P7D A;  1N0U A;  3V2U C;  2L3J A;  1RC7 A;  4JI0 I;  4BBY A;  4DV4 E;  5AAS A;  4DR3 I;  2DEJ A;  3IWD A;  1IBM I;  4J8Z A;  4X62 E;  5IT9 C;  1PKP A;  1Y6Z A;  4OX9 E;  4JI2 E;  2UU9 I;  4B3M E;  2DIX A;  1GQE A;  3ADI A;  1NHH A;  4DV0 I;  4AQY I;  4DR5 I;  3J80 Q;  3PRY A;  2L8T A;  3F6G A;  3OTO E;  4JYA I;  1KTV A;  2B7V A;  1RQ0 A;  4DV2 I;  4I8O A;  4DV5 E;  2HFU A;  3JU0 A;  2LJP A;  5ADZ A;  2CGE A;  4R8O A;  5FLX Q;  2V2V A;  3KWR A;  4DR6 E;  2DEI A;  4LFC E;  3CWV A;  4B3R I;  4R1F A;  4IZJ B;  3P06 A;  4NXM I;  3AV0 A;  1Z0E A;  5GME A;  1YYO A;  2VQE I;  2EZ6 A;  4L5N C;  2BM1 A;  4HAC B;  4DPT A;  3JAM Q;  2LMZ A;  4B3S E;  1FKA E;  1QZR A;  4DR2 I;  3ADJ A;  2VQF E;  3ZZ0 A;  5DNY A;  3B78 A;  2UUB E;  2NPF A;  2L92 A;  4DV3 I;  1N34 I;  2L6M A;  2LRS A;  4PRV A;  3HQ1 A;  4X65 E;  2V2Q A;  1HNW E;  2WW4 A;  2L33 A;  1BKN A;  1Y4U A;  4FWD A;  1MG7 A;  2R3V A;  4FWG A;  2DSY A;  2IOQ A;  3K85 A;  2HHH E;  4DU7 A;  2G7H A;  5CFF E;  1IBM E;  2PNL A;  4JI5 E;  1UHZ A;  4X66 I;  1NZ0 A;  4NXN E;  4MYT A;  1WXR A;  2HKE A;  2H36 X;  1ZM3 A;  1D6T A;  3J7Y p;  5A2Q Q;  2YZT A;  2B9D A;  4LF6 E;  1HNX I;  2IOP A;  3D4J A;  4JYA E;  2FGG A;  4FWH A;  1T4N A;  4LFB E;  3HUL A;  3J81 C;  4DPY A;  2N3H A;  2LTS A;  4Z7Y A;  2MC5 A;  4LF9 E;  4UTG A;  4GEQ B;  3ZM7 A;  4DU8 A;  2DMY A;  1HNZ E;  2ZM6 E;  4TUI A;  4DR7 E;  4JI7 I;  1EKZ A;  1FJG E;  2NUG A;  2IHR 1;  1N32 E;  4DUZ I;  3HXL A;  4X64 E;  1A6F A;  5IWA I;  4DV7 I;  3T1Y I;  4B3T E;  3PYG A;  2JOB A;  2L2K B;  4USM A;  3IWB A;  2RS7 A;  2HK2 A;  1Z5A A;  4YY3 I;  2ZIT A;  2FV4 B;  1N33 E;  2WZO A;  4JG4 A;  3VYX A;  2FTX B;  1SR9 A;  1Z59 A;  4HYM A;  1XMQ I;  2UUC I;  2UXD I;  2GS8 A;  2R42 A;  4LF4 I;  4LU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...