1XNQE

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnqE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnqE02
2B7VA 4LF6E 4LFBE 5LMUE 4DR5E 1HNZE 2UXDI 5IT9C 3GONA 2LUQA 1X48A 1XNRE 5GMEA 1ELOA 2VQFE 4HACB 4X62I 4MYUA 4FW9A 4ED4A 2E1RA 4EMDA 4B3SI 3VYYA 1PKPA 4USKA 2B7TA 1XNQE 3ZZUA 2E5LE 2CPNA 4YHHI 2A2CA 4B3TE 4M1KA 4MYTA 4ZVIA 1D6TA 4JI7I 4DR7I 4LF9I 2JY9A 1ZBTA 1N0VC 4RPFA 1DI2A 2LUPB 4NXNI 4FWHA 2LBSB 3PYEA 4P52A 4JI4E 2N3GA 4DV0E 4KHPE 2V34A 1XMOI 3F0NA 3J7Yp 4DV2I 1IBKE 2NPFA 2UXBE 4X65I 4DR2I 2BM0A 4JI6E 2AJ4A 1OJ4A 4X8WA 2DEJA 2VQEE 4JI5I 2OI2A 1T4OA 1Z5BA 3LPSA 4DV6I 1B63A 1ZM4A 3K1JA 4JI2I 1J5EE 3WU3A 1NHIA 4LF8I 4DUYE 1Z0BA 3B82A 3PYFA 4DUZI 1O0WA 4DR3E 1MU5A 4JYAE 2UUAE 1J26A 3H4LA 1YZ9A 4X64I 4PRVA 2Q2EB 4JI3E 3ADIA 4K0KI 2RS7A 2JVAA 5IWAE 3M6AA 5BR8I 4JI0I 1MG7A 4WUCA 3OTOI 2EZ6A 1X47A 1H72C 1Z0GA 4AQYE 1HNWI 1IBMI 4DV4I 4B3ME 1Z5AA 4M30A 2F4VE 2V2VA 1Z0TA 3P1XA 2J7KA 2UXCE 3K17A 4DV7I 1ZXNA 4USMA 1ZM3A 4M2ZA 1U2RA 1EA6A 3B8HA 1KVKA 4X66I 5LMNI 2HKEA 4DV3E 5L3JA 1VISA 1ZM2A 2V2ZA 4KQVA 1UHZA 2HHHE 4JI8I 1MX0A 4GKKE 4JG4A 4JI1I 3ZZ0A 3V2UC 1Z5CA 4DR4I 4DV1I 3ZKBA 1Z0CA 4YY3I 4LF7I 5FLXQ 3J81C 4HY1A 1HR0E 3ADGA 4WUDA 1T4NA 4URLA 1S4EA 5CFFE 2LTSA 5A2QC 3C4TA 4YHHE 2V8PA 3HTXA 2ZBKB 1N34E 1NZ0A 2DIXA 4JI7E 2N3HA 4DR7E 4LF9E 2HFUA 1N32I 3ADLA 1XNQI 4LFAI 3T1YE 2NUFA 4NXNE 4WYQB 3J80Q 4GKJI 4DR1I 1YYKA 2CZ9A 1IBLE 4LF4I 3LNUA 4DV2E 2LJPA 1Z59A 2ZM6I 4DR6E 2LRSA 2X36A 4JV5I 5IT9Q 1N33I 4FWDA 1RQ0A 4JI5E 4WUBA 1B62A 3T1HE 5LL6R 4DV6E 2B3TB 2UUCI 1XMQI 3QT6A 3Q1QA 4JI2E 2WW4A 1H7SA 1KTVA 4Z7CA 1BKNA 4LF8E 3J81Q 3PYDA 2YT4A 2VF3A 4DPTA 4DUZE 2V2QA 3C4BA 1H73A 2DEIA 1I94I 2L2NA 4X64E 1T4LB 1KKHA 4K0KE 4R1FA 4DR3I 4LFCI 5BR8E 2UUAI 2RSMA 2KHXA 4JI0E 2UU9I 4NXMI 1RR9A 3WU6A 3OTOE 2UUBI 2R42A 4DV5I 3VYXA 1HNWE 1UEKA 1IBME 5IWAI 4DV4E 1HNXI 4DXLA 1WUUA 4LF5I 4B3RI 4DU8A 3QT5A 1A6FA 2HK3A 4UT4A 4DV7E 4DPUA 4XTJA 1N36E 4OX9I 4X66E 1S16A 2UXCI 5LMNE 3J7AG 2GS8A 2UXDE 3B78A 1H74A 2L33A 1KIJA 2HFSA 1FJGI 3HULA 1NHHA 2DMYA 4WFTA 4LF6I 3LLHA 4LFBI 5LMUI 1N0UA 4DR5I 1HNZI 4JI1E 2LJHA 2EFGA 4PRXA 2HHHI 2HK2A 3JAMC 4X62E 2BV3A 4DR4E 4DV1E 4B3SE 4YY3E 1XNRI 4GKKI 4LF7E 2DB2A 1K47A 2VQFI 1DARA 1NHJA 2L2KB 3ADJA 2NUGA 1FWLA 2NUEA 3J7AM 1FKAE 2E5LI 1HR0I 1FWKA 4HACA 2A2DA 4DU7A 1N32E 1H7UA 4LFAE 4B3TI 2L2MA 1XMOE 1N34I 4GKJE 1QZRA 2RS6A 4DR1E 1YYWA 3T1YI 4DPYA 1FNMA 4FN5A 4JI4I 4X65E 4DR2E 4DV0I 4KHPI 4LF4E 1Z0VA 4HYMA 2ZM6E 3QT8A 4JV5E 1IBKI 1N33E 1IBLI 2UXBI 1YYOA 3PYGA 1WHNA 4JI6I 1X49A 4I3HA 1EI1A 5GMDA 2VQEI 3ZM7A 4P7AA 4DR6I 3CWVA 3ZKDA 2UUCE 1XMQE 3JAMQ 2L3JA 1J5EI 3T1HI 2X7IA 2BM1A 3WU4A 1FI4A 2MDRA 1ZXMA 2RTXA 4FWGA 2R3VA 5A2QQ 4DUYI 1PIEA 1QU6A 2NA2A 1I94E 3QT7A 4DKKA 4OOGC 4UTGA 3LTOA 4JYAI 2L3CA 4LFCE 4PU9A 4JI3I 2UU9E 1XHKA 4NXME 2UUBE 4DV5E 1UILA 3D4JA 1PVGA 4Z7YA 5FLXC 1HNXE 4AQYI 4LF5E 2HKJA 4B3MI 1Z0EA 4DPWA 2F4VI 4B3RE 4DPXA 1EKZA 1RREA 1RC7A 1GQEA 4OX9E 3J80C 3ZZTA 1WHQA 1ZM9A 3V5RA 4JI8E 2ZITA 2LTRA 1N36I 2IHR1 1STUA 1Z0WA 2XEXA 4HXZA 3WU5A 4DV3I 1FJGE
chains in the Genus database with same CATH superfamily
2B7VA 4LF6E 2EM9A 2EPAA 4LFBE 5LMUE 4MU3A 4DR5E 1UBDC 1HNZE 4MU1A 5KL4A 3P06A 2UXDI 1Y6ZA 5IT9C 4WX9A 5EKWA 3GONA 2LUQA 5LLQA 2IOQA 2HGHA 2YWQA 2EOMA 1X48A 2ELYA 1PDAA 1XNRE 2GQ0A 3F6HA 2Z5EA 3UHMA 1OYRA 5GMEA 4OO1F 4U3BA 3MSWA 4P78A 1ELOA 2VQFE 4HACB 4X62I 2MC6A 4MYUA 4IZJD 4FW9A 4ED4A 2IERA 2E1RA 4EMDA 5DNYA 4BA1A 4B3SI 2EN3A 2EOFA 3Q6MA 4OO1E 3VYYA 1PKPA 2H36X 4USKA 2B7TA 1XNQE 3ZZUA 2E5LE 1MEYC 2WCC3 4NBQA 2V83A 2CPNA 4F6NA 2PNLA 4YHHI 2A2CA 4B3TE 4M1KA 3TQMA 4MYTA 4ZVIA 1D6TA 2MKDA 5TSEA 4JI7I 4DR7I 5K36F 4LF9I 4M0VA 2JY9A 1ZBTA 2EOYA 1N0VC 4RPFA 1DI2A 2BR2B 2C37B 2YRHA 2LUPB 4OKGA 4NXNI 2EOOA 2K7IA 1DQ3A 4FWHA 1MGTA 2FV4B 1HK7A 5K36E 2LJUA 2LBSB 2NN6A 3PYEA 4P52A 4X9JA 2YTFA 5FWKA 1YUIA 2F8BA 4JI4E 2YSOA 2EMWA 2M9AA 2N3GA 4DV0E 4KHPE 1E3PA 1PJQA 2V34A 4N3OA 1XMOI 2VRDA 2EOIA 3F0NA 3CDJA 3KZZA 3J7Yp 4DV2I 4F9BB 4F2JC 1BBGA 2EMBA 3EQ1A 2EMLA 1IBKE 2NPFA 2UXBE 4X65I 4DR2I 2BM0A 4JI6E 2V86A 2AJ4A 1OJ4A 4X8WA 2DEJA 3LMLA 2JEAB 2VQEE 2CVEA 4JI5I 4LOMA 2OI2A 1USVA 4IFDD 4BHCA 4TUGA 5A6BD 2J65A 1T4OA 1Z5BA 3LPSA 4DV6I 2PO0A 2EE8A 2EPUA 1B63A 2ZBKB 1QNTA 1ZM4A 3K1JA 4JI2I 1J5EE 3B4TA 2FTXB 2JPAA 4IZJA 2EORA 3WU3A 1NHIA 4LF8I 4DUYE 3GCMA 1Z0BA 4KZSA 3B82A 3PYFA 5K36A 4IS1C 1A1HA 4DUZI 1O0WA 4DR3E 1MU5A 4JYAE 2UUAE 2EOZA 1J26A 3H4LA 1YZ9A 5AE3A 3CDIA 4U3DA 4X64I 4PRVA 2Q2EB 2BA0G 4JI3E 2YRMA 3ADIA 4K0KI 2RS7A 4FW5A 2JVAA 5IWAE 3M6AA 5BR8I 4OO1D 4JI0I 1MG7A 4WUCA 1KYQA 4LCFA 2JE6B 3OTOI 1IQSA 3VHTB 2EZ6A 2ENCA 1X47A 1H72C 1Z0GA 4AQYE 1T39A 5C0XE 1IBMI 1HNWI 4DV4I 5JEAE 1PJTA 4B3ME 1Z5AA 2LT7A 1UDNA 2JOXA 4M30A 2F4VE 2V2VA 3ECRA 1JK1A 1Z0TA 3F6GA 4IZKB 5K36D 2EPKX 3P1XA 2IESA 1VI7A 2J7KA 2UXCE 2O1UA 3K17A 4IFDA 2EOJA 2EL5A 5A6BA 3THOB 3ZOQB 2BA0D 4DV7I 1ZXNA 2HC5A 4USMA 2EP3A 5JEAC 2YRKA 2PRTA 2YTDA 1ZM3A 2CGEA 4M2ZA 1U2RA 1EA6A 1GTKA 1KVKA 3B8HA 1IQOA 4X66I 2GO3A 2I9IA 1OYSA 5LMNI 1F2IG 2HKEA 4MDTA 5KL5A 4DV3E 3K85A 1B69A 3BGHA 3M99B 5L3JA 4BC7A 3QG5C 5KL3A 1VISA 1ZM2A 2V2ZA 4KQVA 2JYAA 1UHZA 2HHHE 4JI8I 2KOUA 5AC4A 1MX0A 1XXEA 4GKKE 1A1IA 4AIDA 4JG4A 1E3HA 1Y60A 1X6HA 3OMLA 4JI1I 4O5GA 4BA1B 4R2RA 3ZZ0A 3V2UC 2ENAA 3M7NG 2EMKA 1Z5CA 4DR4I 4N4RB 3L00A 3GLLA 3ZKBA 4OO1A 1Z0CA 3M85G 4DV1I 4YY3I 4LF7I 1IMUA 5FLXQ 2EM0A 2EMZA 2Z5CA 2JR1A 3J81C 2EJ4A 4MU0A 4HTGA 4HY1A 1HR0E 3ADGA 4WUDA 1T4NA 4URLA 5AE2A 5DRPA 1S4EA 3HXLA 2O3ZA 2YTOA 1A1FA 2E1MA 5CFFE 2LTSA 1GZ6A 5KL7A 2WBTA 4J8ZA 2EPPA 5A2QC 5A6KA 3C4TA 4YHHE 2NN6B 3HTXA 2V8PA 2M4IA 1N34E 2VF1A 2LV2A 2I13A 1BBOA 1NZ0A 2DIXA 3JU0A 2YU5A 2N3HA 2DMIA 4JI7E 4LF9E 4DR7E 2V85A 2HFUA 3ADLA 1XNQI 1N32I 2A25A 4LFAI 2EMIA 3T1YE 3IWCA 5T6JA 2MKNA 2NUFA 4IJDA 1YUJA 4NXNE 2BA1G 1NEIA 4WYQB 3P76A 5C0XD 3J80Q 2EL4A 1DGCA 3NZKA 5JEAD 3P3EA 4GKJI 3M7ND 2YTJA 2D9HA 2ENHA 2WZOA 3M85D 4DR1I 1R6MA 2JEBA 2EM6A 1YYKA 3BIDA 2GHFA 2EQ0A 2YTEA 2CZ9A 1IBLE 2LMZA 2L8TA 1Z1BA 4R2CA 4LF4I 3LNUA 2RSIA 4DV2E 1Z59A 2LJPA 2NN6F 3PS3A 2ZM6I 1P47A 3MHHC 2ODRC 4DR6E 2PO0B 2DLKA 2EM2A 2LRSA 4LU9A 2X36A 4JV5I 5IT9Q 4R2DA 1N33I 4R03A 4FWDA 3H09A 3L7ZA 3AV0A 4IZJB 1RQ0A 4JI5E 5F3WA 1UDSA 4WUBA 4MLVA 2VE7C 1B62A 3T1HE 2EN7A 2WP8B 5LL6R 4DV6E 1ZBQA 2BA1D 2V89A 2B3TB 1UDQA 2UUCI 1XMQI 3QT6A 3Q1QA 2CTDA 2EN1A 4JI2E 2WW4A 1H7SA 1KTVA 2WP8A 2V87A 4Z7CA 2EM5A 2WNRA 2Z5BA 2Q8UA 4NZVA 1BKNA 2V8QB 4QNJA 2EOHA 1YFHA 4LF8E 2C39A 2EM7A 5AE1A 3J81Q 2EM4A 4NHRA 3PYDA 2YT4A 2VF3A 4DPTA 4DUZE 1Y5YA 2WBUA 2V2QA 3C4BA 4RH8A 3HPSA 1ZU1A 2WBSA 2EMHA 2YTGA 2EPLX 1H73A 2DEIA 2NN6C 2PNZA 5ELWA 2L2NA 1I94I 4X64E 4MU4A 5AC5A 1KJKA 1OYPA 2EL6A 1T4LB 1T38A 1KKHA 2MC5A 4WXDA 4K0KE 4R1FA 3P3CA 4DR3I 4LFCI 5BR8E 5DNXA 2UUAI 5C0XA 4WPYA 2YTPA 2YPNA 2RSMA 4WSGA 5KL6A 5JEAA 2KHXA 4JI0E 3HJCA 3HKMA 2UU9I 4NXMI 1RR9A 3WU6A 3EPLA 3OTOE 4BCAA 2DSYA 2R42A 4DV5I 2PO2A 2UUBI 3VYXA 2CG9A 4QNKA 1HNWE 1UEKA 1IBME 5IWAI 2EPXA 3IWBA 3IWDA 4DV4E 1TF6A 1HNXI 2EN8A 2EQ1A 4KWYA 4BHBA 4DXLA 4IFDB 4F54A 1WUUA 1Y4UA 4BC9A 4FW7A 4LF5I 4ZYDA 1SR9A 2O1TA 4B3RI 3MHSC 2LVHA 2HJJA 2EWLA 4DU8A 2LE2A 2RQLA 3KRNA 5EL9A 3QT5A 1A6FA 2EN4A 2HK3A 1N3GA 4DV7E 5KL2A 4UT4A 4RHBB 4DPUA 2RPCA 4GEQB 4R2AA 4XTJA 2VESA 1N36E 2EM3A 4OX9I 1TF3A 1G2DC 4X66E 1S16A 2EOXA 2PNMA 2PO1A 1A1LA 4IS9A 1AH5A 4IFDF 2UXCI 4WXCA 3VK6A 5LMNE 4MQYA 3J7AG 2YTQA 3PS1A 2K4VA 4F9CB 4LCGA 2GS8A 1RHYA 3Q6NA 4BA2A 2UXDE 3DD6A 2YTIA 3B78A 4WSPA 1H74A 2L33A 2EM8A 1X6FA 1KIJA 2HFSA 4O43A 2YSPA 1FJGI 2EPZA 2NABA 3HULA 4OO1B 2JOBA 2DMYA 1NHHA 4WFTA 4LF6I 3LLHA 4LFBI 4AIMA 4F6MA 5LMUI 2EMXA 4ISAA 1N0UA 2Z5CB 4DR5I 1HNZI 4JI1E 2LJHA 2EFGA 4PRXA 1A1GA 2HHHI 2HK2A 3JAMC 4X62E 2JWOA 3H1CA 2V88A 2BV3A 4DR4E 4DV1E 3EPKA 4B3SE 4YY3E 4LCHA 1XNRI 4GKKI 2J7JA 4LF7E 4GQUA 2DB2A 2BBGA 1K47A 3U1KA 2VQFI 3THNA 3AUZA 1BB8A 5K36B 4FW6A 2R76A 1DARA 2GO4A 4IFDC 1NHJA 2L2KB 3ADJA 2NUGA 5DRQA 3EPJA 3U1YA 1FWLA 2NUEA 4P7DA 2EOEA 2EPRA 3J7AM 4AM3A 5DRRA 1ZR9A 3DF6A 1FKAE 2E5LI 2F1DA 1HR0I 1FWKA 3UK3C 1YPNA 2G7HA 4HACA 2A2DA 4DU7A 3C6MA 4Q28A 2GLIA 2CT1A 2L6MA 1N32E 1P42A 1H7UA 2YTNA 2JEBB 4LFAE 1EH7A 4B3TI 1R6LA 3HPZA 4M9VC 2L2MA 2FGGA 1USUA 2JEAA 2DGCA 2EN6A 1XMOE 2EPCA 2IOPA 4GKJE 1QZRA 1N34I 2RS6A 1X6EA 4DR1E 1PJSA 3P3GA 4HEIA 1EH8A 4L8NA 2O1VA 1YYWA 5A6AA 2EMFA 3T1YI 1SFEA 4DPYA 1FNMA 1RMDA 3L7ZB 4FN5A 4JI4I 4X65E 4DR2E 4BS9A 4DV0I 4LF4E 1UN6B 1Z0VA 4KHPI 2C37A 3KZYA 2BR2A 4HYMA 2ZM6E 2NN6E 2L92A 3PS2A 3QT8A 4OO1C 1X3CA 4JV5E 4FW3A 1IBKI 1N33E 1IBLI 4J3DA 2UXBI 2YZTA 1YYOA 3RMPA 1WRJA 2EMCA 1YH8A 2WNRB 1WHNA 2Z5BB 3PYGA 4JI6I 1X49A 1A1KA 3GMEA 2EPMX 1EI1A 5GMDA 4I3HA 3ZM7A 2C39B 4P7AA 2VQEI 4DR6I 2EMGA 3CWVA 3ZKDA 2UUCE 1WJPA 1XMQE 3PRYA 3HQ1A 3JAMQ 2EOSA 2L3JA 3EPHA 2PNZB 3BF2A 2LCEA 1J5EI 5K36C 3T1HI 2X7IA 4Q35B 4O4KA 2BM1A 1FI4A 3WU4A 2MDRA 1ZXMA 2LO3A 2RTXA 4MLQA 4FWGA 1AAYA 2R1FA 4ZYEA 2R3VA 2ADRA 5A2QQ 3FIGA 4DUYI 1PIEA 1QU6A 4DMIA 2NA2A 5C0XB 1I94E 3QT7A 2E72A 4FK5C 5JEAB 4DKKA 4R2EA 4R8OA 4OOGC 1YHCA 1JK2A 4UTGA 3LTOA 4JYAI 2EMAA 2L3CA 1YSAC 2PO2B 5IXMB 4OZEA 2DLQA 4L5NC 2B9DA 4LFCE 4PU9A 5DROA 4JI3I 1TN9A 5A69A 1EH6A 2EMYA 2EQ3A 4ZYHA 4GZNC 2UU9E 1XHKA 4LPFA 4NXME 1Y4SA 2ODRD 1UDOA 2UUBE 4DV5E 2JT2A 1UILA 3D4JA 4R2SA 3K6QA 1PVGA 2ELZA 4Z7YA 5FLXC 3C6KA 2JP9A 5C0XF 1LLMC 1HNXE 4F9AB 5JEAF 5A6JA 4LTYA 4AQYI 4LF5E 2HKJA 5ADZA 2M1SA 1A1JA 4B3MI 2GPIA 1Z0EA 1ZAAC 4R2QA 4DPWA 2JXPA 2F4VI 4B3RE 4DPXA 2JE6A 2PO1B 1EKZA 2YU8A 2AE8A 5AASA 1RREA 1RC7A 5DNLA 1WXRA 1G2FC 2C38B 3BBGA 1GQEA 2CSHA 4BA2B 3JTZA 4OX9E 1L4SA 1NCSA 3DJWA 4O24A 4BMJA 5IV8B 3J80C 4R2PA 2C38A 3ZZTA 1WHQA 2NN6D 4ZYGA 1ZM9A 2EPNA 4IFDE 4BBYA 3V5RA 4IZKA 4JI8E 2ZITA 4I8OA 2LTRA 2EN2A 2M7QA 1N36I 2N8XA 3KWRA 4TUIA 2BB8A 1STUA 2IHR1 1Z0WA 2O1WA 2XEXA 2KONA 4FW4A 4HXZA 3WU5A 5C0XC 4DV3I 1X5WA 2EOQA 1FJGE 2MDGA 2EPOA 2DRPA
chains in the Genus database with same CATH topology
2B7VA 4LF6E 4LFBE 5LMUE 4DR5E 1HNZE 3P06A 2UXDI 1Y6ZA 5IT9C 3GONA 2LUQA 2IOQA 1X48A 1XNRE 2GQ0A 3F6HA 2Z5EA 5GMEA 3MSWA 4P78A 1ELOA 2VQFE 4HACB 4X62I 2MC6A 4MYUA 4IZJD 4FW9A 4ED4A 2E1RA 4EMDA 5DNYA 4B3SI 3Q6MA 3VYYA 1PKPA 2H36X 4USKA 2B7TA 1XNQE 3ZZUA 2E5LE 2V83A 2CPNA 2PNLA 4YHHI 2A2CA 4B3TE 4M1KA 4MYTA 4ZVIA 1D6TA 4JI7I 4DR7I 4LF9I 4M0VA 2JY9A 1ZBTA 1N0VC 4RPFA 1DI2A 2LUPB 4NXNI 1DQ3A 4FWHA 2FV4B 1HK7A 2LBSB 3PYEA 4P52A 2F8BA 4JI4E 2N3GA 4DV0E 4KHPE 2V34A 1XMOI 3F0NA 3J7Yp 4DV2I 4F9BB 1IBKE 2NPFA 2UXBE 4X65I 4DR2I 2BM0A 4JI6E 2V86A 2AJ4A 1OJ4A 4X8WA 2DEJA 3LMLA 2VQEE 4JI5I 2OI2A 1USVA 4TUGA 1T4OA 1Z5BA 3LPSA 4DV6I 1B63A 1ZM4A 3K1JA 4JI2I 1J5EE 2FTXB 4IZJA 3WU3A 1NHIA 4LF8I 4DUYE 1Z0BA 4KZSA 3B82A 3PYFA 4DUZI 1O0WA 4DR3E 1MU5A 4JYAE 2UUAE 1J26A 3H4LA 1YZ9A 5AE3A 4X64I 4PRVA 2Q2EB 4JI3E 3ADIA 4K0KI 2RS7A 2JVAA 5IWAE 3M6AA 5BR8I 4JI0I 1MG7A 4WUCA 3OTOI 2EZ6A 1X47A 1H72C 1Z0GA 4AQYE 1HNWI 1IBMI 4DV4I 4B3ME 1Z5AA 2JOXA 4M30A 2F4VE 2V2VA 1Z0TA 3F6GA 4IZKB 3P1XA 2J7KA 2O1UA 2UXCE 3K17A 3ZOQB 4DV7I 1ZXNA 4USMA 1ZM3A 2CGEA 4M2ZA 1U2RA 1EA6A 3B8HA 1KVKA 4X66I 5LMNI 2HKEA 4DV3E 3K85A 5L3JA 4BC7A 1VISA 1ZM2A 2V2ZA 4KQVA 1UHZA 2HHHE 4JI8I 2KOUA 1MX0A 4GKKE 4JG4A 3OMLA 4JI1I 3ZZ0A 3V2UC 1Z5CA 4DR4I 4DV1I 3ZKBA 1Z0CA 4YY3I 4LF7I 5FLXQ 2Z5CA 2JR1A 3J81C 4HY1A 1HR0E 3ADGA 4WUDA 1T4NA 4URLA 5AE2A 1S4EA 3HXLA 2E1MA 5CFFE 2LTSA 1GZ6A 5A2QC 4J8ZA 3C4TA 4YHHE 2V8PA 3HTXA 2ZBKB 2M4IA 1N34E 2VF1A 1NZ0A 2DIXA 3JU0A 4JI7E 2N3HA 4DR7E 4LF9E 2HFUA 1N32I 2V85A 3ADLA 1XNQI 4LFAI 3T1YE 3IWCA 5T6JA 2NUFA 4NXNE 4WYQB 3J80Q 4GKJI 2WZOA 4DR1I 1YYKA 2CZ9A 1IBLE 2LMZA 2L8TA 4LF4I 3LNUA 4DV2E 2LJPA 1Z59A 2ZM6I 2ODRC 4DR6E 2LRSA 4LU9A 2X36A 4JV5I 5IT9Q 1N33I 4R03A 4FWDA 3H09A 4IZJB 3AV0A 1RQ0A 4JI5E 5F3WA 4WUBA 1B62A 3T1HE 5LL6R 4DV6E 1ZBQA 2V89A 2B3TB 2UUCI 1XMQI 3QT6A 3Q1QA 4JI2E 2WW4A 1H7SA 1KTVA 4Z7CA 2V87A 2Z5BA 1BKNA 2V8QB 4LF8E 5AE1A 3J81Q 3PYDA 2YT4A 2VF3A 4DPTA 4DUZE 2V2QA 3C4BA 1H73A 3HPSA 2DEIA 1I94I 2L2NA 4X64E 1T4LB 1KKHA 2MC5A 4K0KE 4R1FA 4DR3I 4LFCI 5BR8E 2UUAI 4WPYA 2RSMA 2KHXA 4JI0E 3HJCA 2UU9I 4NXMI 1RR9A 3WU6A 3OTOE 4BCAA 2DSYA 2R42A 4DV5I 2UUBI 3VYXA 2CG9A 1HNWE 1UEKA 1IBME 5IWAI 3IWBA 3IWDA 4DV4E 1HNXI 4DXLA 4F54A 1WUUA 1Y4UA 4BC9A 4LF5I 1SR9A 2O1TA 4B3RI 2EWLA 4DU8A 2LE2A 3QT5A 1A6FA 2HK3A 4UT4A 4DV7E 4DPUA 4GEQB 4XTJA 1N36E 4OX9I 4X66E 1S16A 2PNMA 2UXCI 3VK6A 5LMNE 3J7AG 2K4VA 4F9CB 2GS8A 3Q6NA 2UXDE 3B78A 4WSPA 1H74A 2L33A 1KIJA 2HFSA 1FJGI 3HULA 2JOBA 2DMYA 1NHHA 4WFTA 4LF6I 3LLHA 4LFBI 5LMUI 1N0UA 2Z5CB 4DR5I 1HNZI 4JI1E 2LJHA 2EFGA 4PRXA 2HHHI 2HK2A 3JAMC 4X62E 2JWOA 2V88A 2BV3A 4DR4E 4DV1E 4B3SE 4YY3E 1XNRI 4GKKI 4LF7E 2DB2A 1K47A 2VQFI 3AUZA 1DARA 1NHJA 2L2KB 3ADJA 2NUGA 1FWLA 2NUEA 4P7DA 3J7AM 3DF6A 1FKAE 2E5LI 1HR0I 1FWKA 2G7HA 4HACA 2A2DA 4DU7A 4Q28A 4N3OA 1N32E 2L6MA 1H7UA 4LFAE 4B3TI 3HPZA 2L2MA 2FGGA 1USUA 1XMOE 2IOPA 4GKJE 1QZRA 1N34I 2RS6A 4DR1E 4L8NA 2O1VA 1YYWA 3T1YI 4DPYA 1FNMA 4FN5A 4JI4I 4X65E 4DR2E 4BS9A 4DV0I 4LF4E 4KHPI 1Z0VA 4HYMA 2ZM6E 2L92A 3QT8A 4JV5E 1IBKI 1N33E 1IBLI 2UXBI 2YZTA 1YYOA 3RMPA 3PYGA 1WHNA 2Z5BB 4JI6I 1X49A 4I3HA 1EI1A 5GMDA 2VQEI 3ZM7A 4P7AA 4DR6I 3CWVA 3ZKDA 2UUCE 1XMQE 3PRYA 3HQ1A 3JAMQ 2L3JA 1J5EI 3T1HI 2X7IA 2BM1A 3WU4A 1FI4A 2MDRA 1ZXMA 2RTXA 4FWGA 2R3VA 5A2QQ 3FIGA 4DUYI 1PIEA 1QU6A 4DMIA 2NA2A 1I94E 3QT7A 4DKKA 4OOGC 4R8OA 4UTGA 3LTOA 4JYAI 2L3CA 4L5NC 2B9DA 4LFCE 4PU9A 4JI3I 2UU9E 1XHKA 4NXME 1Y4SA 2ODRD 2UUBE 4DV5E 1UILA 3D4JA 3K6QA 1PVGA 4Z7YA 5FLXC 1HNXE 4F9AB 4LTYA 4AQYI 4LF5E 2HKJA 5ADZA 2M1SA 4B3MI 1Z0EA 4DPWA 2F4VI 4B3RE 4DPXA 1EKZA 5AASA 1RREA 1RC7A 1WXRA 1GQEA 3JTZA 4OX9E 3DJWA 4BMJA 3J80C 3ZZTA 1WHQA 1ZM9A 4BBYA 3V5RA 4IZKA 4JI8E 2ZITA 4I8OA 2LTRA 2M7QA 1N36I 3KWRA 4TUIA 2IHR1 1STUA 1Z0WA 2O1WA 2XEXA 4HXZA 2KONA 3WU5A 4DV3I 1FJGE 5FWKA 2VE7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7V A;  4LF6 E;  4LFB E;  5LMU E;  4DR5 E;  1HNZ E;  2UXD I;  5IT9 C;  3GON A;  2LUQ A;  1X48 A;  1XNR E;  5GME A;  1ELO A;  2VQF E;  4HAC B;  4X62 I;  4MYU A;  4FW9 A;  4ED4 A;  2E1R A;  4EMD A;  4B3S I;  3VYY A;  1PKP A;  4USK A;  2B7T A;  1XNQ E;  3ZZU A;  2E5L E;  2CPN A;  4YHH I;  2A2C A;  4B3T E;  4M1K A;  4MYT A;  4ZVI A;  1D6T A;  4JI7 I;  4DR7 I;  4LF9 I;  2JY9 A;  1ZBT A;  1N0V C;  4RPF A;  1DI2 A;  2LUP B;  4NXN I;  4FWH A;  2LBS B;  3PYE A;  4P52 A;  4JI4 E;  2N3G A;  4DV0 E;  4KHP E;  2V34 A;  1XMO I;  3F0N A;  3J7Y p;  4DV2 I;  1IBK E;  2NPF A;  2UXB E;  4X65 I;  4DR2 I;  2BM0 A;  4JI6 E;  2AJ4 A;  1OJ4 A;  4X8W A;  2DEJ A;  2VQE E;  4JI5 I;  2OI2 A;  1T4O A;  1Z5B A;  3LPS A;  4DV6 I;  1B63 A;  1ZM4 A;  3K1J A;  4JI2 I;  1J5E E;  3WU3 A;  1NHI A;  4LF8 I;  4DUY E;  1Z0B A;  3B82 A;  3PYF A;  4DUZ I;  1O0W A;  4DR3 E;  1MU5 A;  4JYA E;  2UUA E;  1J26 A;  3H4L A;  1YZ9 A;  4X64 I;  4PRV A;  2Q2E B;  4JI3 E;  3ADI A;  4K0K I;  2RS7 A;  2JVA A;  5IWA E;  3M6A A;  5BR8 I;  4JI0 I;  1MG7 A;  4WUC A;  3OTO I;  2EZ6 A;  1X47 A;  1H72 C;  1Z0G A;  4AQY E;  1HNW I;  1IBM I;  4DV4 I;  4B3M E;  1Z5A A;  4M30 A;  2F4V E;  2V2V A;  1Z0T A;  3P1X A;  2J7K A;  2UXC E;  3K17 A;  4DV7 I;  1ZXN A;  4USM A;  1ZM3 A;  4M2Z A;  1U2R A;  1EA6 A;  3B8H A;  1KVK A;  4X66 I;  5LMN I;  2HKE A;  4DV3 E;  5L3J A;  1VIS A;  1ZM2 A;  2V2Z A;  4KQV A;  1UHZ A;  2HHH E;  4JI8 I;  1MX0 A;  4GKK E;  4JG4 A;  4JI1 I;  3ZZ0 A;  3V2U C;  1Z5C A;  4DR4 I;  4DV1 I;  3ZKB A;  1Z0C A;  4YY3 I;  4LF7 I;  5FLX Q;  3J81 C;  4HY1 A;  1HR0 E;  3ADG A;  4WUD A;  1T4N A;  4URL A;  1S4E A;  5CFF E;  2LTS A;  5A2Q C;  3C4T A;  4YHH E;  2V8P A;  3HTX A;  2ZBK B;  1N34 E;  1NZ0 A;  2DIX A;  4JI7 E;  2N3H A;  4DR7 E;  4LF9 E;  2HFU A;  1N32 I;  3ADL A;  1XNQ I;  4LFA I;  3T1Y E;  2NUF A;  4NXN E;  4WYQ B;  3J80 Q;  4GKJ I;  4DR1 I;  1YYK A;  2CZ9 A;  1IBL E;  4LF4 I;  3LNU A;  4DV2 E;  2LJP A;  1Z59 A;  2ZM6 I;  4DR6 E;  2LRS A;  2X36 A;  4JV5 I;  5IT9 Q;  1N33 I;  4FWD A;  1RQ0 A;  4JI5 E;  4WUB A;  1B62 A;  3T1H E;  5LL6 R;  4DV6 E;  2B3T B;  2UUC I;  1XMQ I;  3QT6 A;  3Q1Q A;  4JI2 E;  2WW4 A;  1H7S A;  1KTV A;  4Z7C A;  1BKN A;  4LF8 E;  3J81 Q;  3PYD A;  2YT4 A;  2VF3 A;  4DPT A;  4DUZ E;  2V2Q A;  3C4B A;  1H73 A;  2DEI A;  1I94 I;  2L2N A;  4X64 E;  1T4L B;  1KKH A;  4K0K E;  4R1F A;  4DR3 I;  4LFC I;  5BR8 E;  2UUA I;  2RSM A;  2KHX A;  4JI0 E;  2UU9 I;  4NXM I;  1RR9 A;  3WU6 A;  3OTO E;  2UUB I;  2R42 A;  4DV5 I;  3VYX A;  1HNW E;  1UEK A;  1IBM E;  5IWA I;  4DV4 E;  1HNX I;  4DXL A;  1WUU A;  4LF5 I;  4B3R I;  4DU8 A;  3QT5 A;  1A6F A;  2HK3 A;  4UT4 A;  4DV7 E;  4DPU A;  4XTJ A;  1N36 E;  4OX9 I;  4X66 E;  1S16 A;  2UXC I;  5LMN E;  3J7A G;  2GS8 A;  2UXD E;  3B78 A;  1H74 A;  2L33 A;  1KIJ A;  2HFS A;  1FJG I;  3HUL A;  1NHH A;  2DMY A;  4WFT A;  4LF6 I;  3LLH A;  4LFB I;  5LMU I;  1N0U A;  4DR5 I;  1HNZ I;  4JI1 E;  2LJH A;  2EFG A;  4PRX A;  2HHH I;  2HK2 A;  3JAM C;  4X62 E;  2BV3 A;  4DR4 E;  4DV1 E;  4B3S E;  4YY3 E;  1XNR I;  4GKK I;  4LF7 E;  2DB2 A;  1K47 A;  2VQF I;  1DAR A;  1NHJ A;  2L2K B;  3ADJ A;  2NUG A;  1FWL A;  2NUE A;  3J7A M;  1FKA E;  2E5L I;  1HR0 I;  1FWK A;  4HAC A;  2A2D A;  4DU7 A;  1N32 E;  1H7U A;  4LFA E;  4B3T I;  2L2M A;  1XMO E;  1N34 I;  4GKJ E;  1QZR A;  2RS6 A;  4DR1 E;  1YYW A;  3T1Y I;  4DPY A;  1FNM A;  4FN5 A;  4JI4 I;  4X65 E;  4DR2 E;  4DV0 I;  4KHP I;  4LF4 E;  1Z0V A;  4HYM A;  2ZM6 E;  3QT8 A;  4JV5 E;  1IBK I;  1N33 E;  1IBL I;  2UXB I;  1YYO A;  3PYG A;  1WHN A;  4JI6 I;  1X49 A;  4I3H A;  1EI1 A;  5GMD A;  2VQE I;  3ZM7 A;  4P7A A;  4DR6 I;  3CWV A;  3ZKD A;  2UUC E;  1XMQ E;  3JAM Q;  2L3J A;  1J5E I;  3T1H I;  2X7I A;  2BM1 A;  3WU4 A;  1FI4 A;  2MDR A;  1ZXM A;  2RTX A;  4FWG A;  2R3V A;  5A2Q Q;  4DUY I;  1PIE A;  1QU6 A;  2NA2 A;  1I94 E;  3QT7 A;  4DKK A;  4OOG C;  4UTG A;  3LTO A;  4JYA I;  2L3C A;  4LFC E;  4PU9 A;  4JI3 I;  2UU9 E;  1XHK A;  4NXM E;  2UUB E;  4DV5 E;  1UIL A;  3D4J A;  1PVG A;  4Z7Y A;  5FLX C;  1HNX E;  4AQY I;  4LF5 E;  2HKJ A;  4B3M I;  1Z0E A;  4DPW A;  2F4V I;  4B3R E;  4DPX A;  1EKZ A;  1RRE A;  1RC7 A;  1GQE A;  4OX9 E;  3J80 C;  3ZZT A;  1WHQ A;  1ZM9 A;  3V5R A;  4JI8 E;  2ZIT A;  2LTR A;  1N36 I;  2IHR 1;  1STU A;  1Z0W A;  2XEX A;  4HXZ A;  3WU5 A;  4DV3 I;  1FJG E; 
#chains in the Genus database with same CATH topology
 2B7V A;  4LF6 E;  2EM9 A;  2EPA A;  4LFB E;  5LMU E;  4MU3 A;  4DR5 E;  1UBD C;  1HNZ E;  4MU1 A;  5KL4 A;  3P06 A;  2UXD I;  1Y6Z A;  5IT9 C;  4WX9 A;  5EKW A;  3GON A;  2LUQ A;  5LLQ A;  2IOQ A;  2HGH A;  2YWQ A;  2EOM A;  1X48 A;  2ELY A;  1PDA A;  1XNR E;  2GQ0 A;  3F6H A;  2Z5E A;  3UHM A;  1OYR A;  5GME A;  4OO1 F;  4U3B A;  3MSW A;  4P78 A;  1ELO A;  2VQF E;  4HAC B;  4X62 I;  2MC6 A;  4MYU A;  4IZJ D;  4FW9 A;  4ED4 A;  2IER A;  2E1R A;  4EMD A;  5DNY A;  4BA1 A;  4B3S I;  2EN3 A;  2EOF A;  3Q6M A;  4OO1 E;  3VYY A;  1PKP A;  2H36 X;  4USK A;  2B7T A;  1XNQ E;  3ZZU A;  2E5L E;  1MEY C;  2WCC 3;  4NBQ A;  2V83 A;  2CPN A;  4F6N A;  2PNL A;  4YHH I;  2A2C A;  4B3T E;  4M1K A;  3TQM A;  4MYT A;  4ZVI A;  1D6T A;  2MKD A;  5TSE A;  4JI7 I;  4DR7 I;  5K36 F;  4LF9 I;  4M0V A;  2JY9 A;  1ZBT A;  2EOY A;  1N0V C;  4RPF A;  1DI2 A;  2BR2 B;  2C37 B;  2YRH A;  2LUP B;  4OKG A;  4NXN I;  2EOO A;  2K7I A;  1DQ3 A;  4FWH A;  1MGT A;  2FV4 B;  1HK7 A;  5K36 E;  2LJU A;  2LBS B;  2NN6 A;  3PYE A;  4P52 A;  4X9J A;  2YTF A;  5FWK A;  1YUI A;  2F8B A;  4JI4 E;  2YSO A;  2EMW A;  2M9A A;  2N3G A;  4DV0 E;  4KHP E;  1E3P A;  1PJQ A;  2V34 A;  4N3O A;  1XMO I;  2VRD A;  2EOI A;  3F0N A;  3CDJ A;  3KZZ A;  3J7Y p;  4DV2 I;  4F9B B;  4F2J C;  1BBG A;  2EMB A;  3EQ1 A;  2EML A;  1IBK E;  2NPF A;  2UXB E;  4X65 I;  4DR2 I;  2BM0 A;  4JI6 E;  2V86 A;  2AJ4 A;  1OJ4 A;  4X8W A;  2DEJ A;  3LML A;  2JEA B;  2VQE E;  2CVE A;  4JI5 I;  4LOM A;  2OI2 A;  1USV A;  4IFD D;  4BHC A;  4TUG A;  5A6B D;  2J65 A;  1T4O A;  1Z5B A;  3LPS A;  4DV6 I;  2PO0 A;  2EE8 A;  2EPU A;  1B63 A;  2ZBK B;  1QNT A;  1ZM4 A;  3K1J A;  4JI2 I;  1J5E E;  3B4T A;  2FTX B;  2JPA A;  4IZJ A;  2EOR A;  3WU3 A;  1NHI A;  4LF8 I;  4DUY E;  3GCM A;  1Z0B A;  4KZS A;  3B82 A;  3PYF A;  5K36 A;  4IS1 C;  1A1H A;  4DUZ I;  1O0W A;  4DR3 E;  1MU5 A;  4JYA E;  2UUA E;  2EOZ A;  1J26 A;  3H4L A;  1YZ9 A;  5AE3 A;  3CDI A;  4U3D A;  4X64 I;  4PRV A;  2Q2E B;  2BA0 G;  4JI3 E;  2YRM A;  3ADI A;  4K0K I;  2RS7 A;  4FW5 A;  2JVA A;  5IWA E;  3M6A A;  5BR8 I;  4OO1 D;  4JI0 I;  1MG7 A;  4WUC A;  1KYQ A;  4LCF A;  2JE6 B;  3OTO I;  1IQS A;  3VHT B;  2EZ6 A;  2ENC A;  1X47 A;  1H72 C;  1Z0G A;  4AQY E;  1T39 A;  5C0X E;  1IBM I;  1HNW I;  4DV4 I;  5JEA E;  1PJT A;  4B3M E;  1Z5A A;  2LT7 A;  1UDN A;  2JOX A;  4M30 A;  2F4V E;  2V2V A;  3ECR A;  1JK1 A;  1Z0T A;  3F6G A;  4IZK B;  5K36 D;  2EPK X;  3P1X A;  2IES A;  1VI7 A;  2J7K A;  2UXC E;  2O1U A;  3K17 A;  4IFD A;  2EOJ A;  2EL5 A;  5A6B A;  3THO B;  3ZOQ B;  2BA0 D;  4DV7 I;  1ZXN A;  2HC5 A;  4USM A;  2EP3 A;  5JEA C;  2YRK A;  2PRT A;  2YTD A;  1ZM3 A;  2CGE A;  4M2Z A;  1U2R A;  1EA6 A;  1GTK A;  1KVK A;  3B8H A;  1IQO A;  4X66 I;  2GO3 A;  2I9I A;  1OYS A;  5LMN I;  1F2I G;  2HKE A;  4MDT A;  5KL5 A;  4DV3 E;  3K85 A;  1B69 A;  3BGH A;  3M99 B;  5L3J A;  4BC7 A;  3QG5 C;  5KL3 A;  1VIS A;  1ZM2 A;  2V2Z A;  4KQV A;  2JYA A;  1UHZ A;  2HHH E;  4JI8 I;  2KOU A;  5AC4 A;  1MX0 A;  1XXE A;  4GKK E;  1A1I A;  4AID A;  4JG4 A;  1E3H A;  1Y60 A;  1X6H A;  3OML A;  4JI1 I;  4O5G A;  4BA1 B;  4R2R A;  3ZZ0 A;  3V2U C;  2ENA A;  3M7N G;  2EMK A;  1Z5C A;  4DR4 I;  4N4R B;  3L00 A;  3GLL A;  3ZKB A;  4OO1 A;  1Z0C A;  3M85 G;  4DV1 I;  4YY3 I;  4LF7 I;  1IMU A;  5FLX Q;  2EM0 A;  2EMZ A;  2Z5C A;  2JR1 A;  3J81 C;  2EJ4 A;  4MU0 A;  4HTG A;  4HY1 A;  1HR0 E;  3ADG A;  4WUD A;  1T4N A;  4URL A;  5AE2 A;  5DRP A;  1S4E A;  3HXL A;  2O3Z A;  2YTO A;  1A1F A;  2E1M A;  5CFF E;  2LTS A;  1GZ6 A;  5KL7 A;  2WBT A;  4J8Z A;  2EPP A;  5A2Q C;  5A6K A;  3C4T A;  4YHH E;  2NN6 B;  3HTX A;  2V8P A;  2M4I A;  1N34 E;  2VF1 A;  2LV2 A;  2I13 A;  1BBO A;  1NZ0 A;  2DIX A;  3JU0 A;  2YU5 A;  2N3H A;  2DMI A;  4JI7 E;  4LF9 E;  4DR7 E;  2V85 A;  2HFU A;  3ADL A;  1XNQ I;  1N32 I;  2A25 A;  4LFA I;  2EMI A;  3T1Y E;  3IWC A;  5T6J A;  2MKN A;  2NUF A;  4IJD A;  1YUJ A;  4NXN E;  2BA1 G;  1NEI A;  4WYQ B;  3P76 A;  5C0X D;  3J80 Q;  2EL4 A;  1DGC A;  3NZK A;  5JEA D;  3P3E A;  4GKJ I;  3M7N D;  2YTJ A;  2D9H A;  2ENH A;  2WZO A;  3M85 D;  4DR1 I;  1R6M A;  2JEB A;  2EM6 A;  1YYK A;  3BID A;  2GHF A;  2EQ0 A;  2YTE A;  2CZ9 A;  1IBL E;  2LMZ A;  2L8T A;  1Z1B A;  4R2C A;  4LF4 I;  3LNU A;  2RSI A;  4DV2 E;  1Z59 A;  2LJP A;  2NN6 F;  3PS3 A;  2ZM6 I;  1P47 A;  3MHH C;  2ODR C;  4DR6 E;  2PO0 B;  2DLK A;  2EM2 A;  2LRS A;  4LU9 A;  2X36 A;  4JV5 I;  5IT9 Q;  4R2D A;  1N33 I;  4R03 A;  4FWD A;  3H09 A;  3L7Z A;  3AV0 A;  4IZJ B;  1RQ0 A;  4JI5 E;  5F3W A;  1UDS A;  4WUB A;  4MLV A;  2VE7 C;  1B62 A;  3T1H E;  2EN7 A;  2WP8 B;  5LL6 R;  4DV6 E;  1ZBQ A;  2BA1 D;  2V89 A;  2B3T B;  1UDQ A;  2UUC I;  1XMQ I;  3QT6 A;  3Q1Q A;  2CTD A;  2EN1 A;  4JI2 E;  2WW4 A;  1H7S A;  1KTV A;  2WP8 A;  2V87 A;  4Z7C A;  2EM5 A;  2WNR A;  2Z5B A;  2Q8U A;  4NZV A;  1BKN A;  2V8Q B;  4QNJ A;  2EOH A;  1YFH A;  4LF8 E;  2C39 A;  2EM7 A;  5AE1 A;  3J81 Q;  2EM4 A;  4NHR A;  3PYD A;  2YT4 A;  2VF3 A;  4DPT A;  4DUZ E;  1Y5Y A;  2WBU A;  2V2Q A;  3C4B A;  4RH8 A;  3HPS A;  1ZU1 A;  2WBS A;  2EMH A;  2YTG A;  2EPL X;  1H73 A;  2DEI A;  2NN6 C;  2PNZ A;  5ELW A;  2L2N A;  1I94 I;  4X64 E;  4MU4 A;  5AC5 A;  1KJK A;  1OYP A;  2EL6 A;  1T4L B;  1T38 A;  1KKH A;  2MC5 A;  4WXD A;  4K0K E;  4R1F A;  3P3C A;  4DR3 I;  4LFC I;  5BR8 E;  5DNX A;  2UUA I;  5C0X A;  4WPY A;  2YTP A;  2YPN A;  2RSM A;  4WSG A;  5KL6 A;  5JEA A;  2KHX A;  4JI0 E;  3HJC A;  3HKM A;  2UU9 I;  4NXM I;  1RR9 A;  3WU6 A;  3EPL A;  3OTO E;  4BCA A;  2DSY A;  2R42 A;  4DV5 I;  2PO2 A;  2UUB I;  3VYX A;  2CG9 A;  4QNK A;  1HNW E;  1UEK A;  1IBM E;  5IWA I;  2EPX A;  3IWB A;  3IWD A;  4DV4 E;  1TF6 A;  1HNX I;  2EN8 A;  2EQ1 A;  4KWY A;  4BHB A;  4DXL A;  4IFD B;  4F54 A;  1WUU A;  1Y4U A;  4BC9 A;  4FW7 A;  4LF5 I;  4ZYD A;  1SR9 A;  2O1T A;  4B3R I;  3MHS C;  2LVH A;  2HJJ A;  2EWL A;  4DU8 A;  2LE2 A;  2RQL A;  3KRN A;  5EL9 A;  3QT5 A;  1A6F A;  2EN4 A;  2HK3 A;  1N3G A;  4DV7 E;  5KL2 A;  4UT4 A;  4RHB B;  4DPU A;  2RPC A;  4GEQ B;  4R2A A;  4XTJ A;  2VES A;  1N36 E;  2EM3 A;  4OX9 I;  1TF3 A;  1G2D C;  4X66 E;  1S16 A;  2EOX A;  2PNM A;  2PO1 A;  1A1L A;  4IS9 A;  1AH5 A;  4IFD F;  2UXC I;  4WXC A;  3VK6 A;  5LMN E;  4MQY A;  3J7A G;  2YTQ A;  3PS1 A;  2K4V A;  4F9C B;  4LCG A;  2GS8 A;  1RHY A;  3Q6N A;  4BA2 A;  2UXD E;  3DD6 A;  2YTI A;  3B78 A;  4WSP A;  1H74 A;  2L33 A;  2EM8 A;  1X6F A;  1KIJ A;  2HFS A;  4O43 A;  2YSP A;  1FJG I;  2EPZ A;  2NAB A;  3HUL A;  4OO1 B;  2JOB A;  2DMY A;  1NHH A;  4WFT A;  4LF6 I;  3LLH A;  4LFB I;  4AIM A;  4F6M A;  5LMU I;  2EMX A;  4ISA A;  1N0U A;  2Z5C B;  4DR5 I;  1HNZ I;  4JI1 E;  2LJH A;  2EFG A;  4PRX A;  1A1G A;  2HHH I;  2HK2 A;  3JAM C;  4X62 E;  2JWO A;  3H1C A;  2V88 A;  2BV3 A;  4DR4 E;  4DV1 E;  3EPK A;  4B3S E;  4YY3 E;  4LCH A;  1XNR I;  4GKK I;  2J7J A;  4LF7 E;  4GQU A;  2DB2 A;  2BBG A;  1K47 A;  3U1K A;  2VQF I;  3THN A;  3AUZ A;  1BB8 A;  5K36 B;  4FW6 A;  2R76 A;  1DAR A;  2GO4 A;  4IFD C;  1NHJ A;  2L2K B;  3ADJ A;  2NUG A;  5DRQ A;  3EPJ A;  3U1Y A;  1FWL A;  2NUE A;  4P7D A;  2EOE A;  2EPR A;  3J7A M;  4AM3 A;  5DRR A;  1ZR9 A;  3DF6 A;  1FKA E;  2E5L I;  2F1D A;  1HR0 I;  1FWK A;  3UK3 C;  1YPN A;  2G7H A;  4HAC A;  2A2D A;  4DU7 A;  3C6M A;  4Q28 A;  2GLI A;  2CT1 A;  2L6M A;  1N32 E;  1P42 A;  1H7U A;  2YTN A;  2JEB B;  4LFA E;  1EH7 A;  4B3T I;  1R6L A;  3HPZ A;  4M9V C;  2L2M A;  2FGG A;  1USU A;  2JEA A;  2DGC A;  2EN6 A;  1XMO E;  2EPC A;  2IOP A;  4GKJ E;  1QZR A;  1N34 I;  2RS6 A;  1X6E A;  4DR1 E;  1PJS A;  3P3G A;  4HEI A;  1EH8 A;  4L8N A;  2O1V A;  1YYW A;  5A6A A;  2EMF A;  3T1Y I;  1SFE A;  4DPY A;  1FNM A;  1RMD A;  3L7Z B;  4FN5 A;  4JI4 I;  4X65 E;  4DR2 E;  4BS9 A;  4DV0 I;  4LF4 E;  1UN6 B;  1Z0V A;  4KHP I;  2C37 A;  3KZY A;  2BR2 A;  4HYM A;  2ZM6 E;  2NN6 E;  2L92 A;  3PS2 A;  3QT8 A;  4OO1 C;  1X3C A;  4JV5 E;  4FW3 A;  1IBK I;  1N33 E;  1IBL I;  4J3D A;  2UXB I;  2YZT A;  1YYO A;  3RMP A;  1WRJ A;  2EMC A;  1YH8 A;  2WNR B;  1WHN A;  2Z5B B;  3PYG A;  4JI6 I;  1X49 A;  1A1K A;  3GME A;  2EPM X;  1EI1 A;  5GMD A;  4I3H A;  3ZM7 A;  2C39 B;  4P7A A;  2VQE I;  4DR6 I;  2EMG A;  3CWV A;  3ZKD A;  2UUC E;  1WJP A;  1XMQ E;  3PRY A;  3HQ1 A;  3JAM Q;  2EOS A;  2L3J A;  3EPH A;  2PNZ B;  3BF2 A;  2LCE A;  1J5E I;  5K36 C;  3T1H I;  2X7I A;  4Q35 B;  4O4K A;  2BM1 A;  1FI4 A;  3WU4 A;  2MDR A;  1ZXM A;  2LO3 A;  2RTX A;  4MLQ A;  4FWG A;  1AAY A;  2R1F A;  4ZYE A;  2R3V A;  2ADR A;  5A2Q Q;  3FIG A;  4DUY I;  1PIE A;  1QU6 A;  4DMI A;  2NA2 A;  5C0X B;  1I94 E;  3QT7 A;  2E72 A;  4FK5 C;  5JEA B;  4DKK A;  4R2E A;  4R8O A;  4OOG C;  1YHC A;  1JK2 A;  4UTG A;  3LTO A;  4JYA I;  2EMA A;  2L3C A;  1YSA C;  2PO2 B;  5IXM B;  4OZE A;  2DLQ A;  4L5N C;  2B9D A;  4LFC E;  4PU9 A;  5DRO A;  4JI3 I;  1TN9 A;  5A69 A;  1EH6 A;  2EMY A;  2EQ3 A;  4ZYH A;  4GZN C;  2UU9 E;  1XHK A;  4LPF A;  4NXM E;  1Y4S A;  2ODR D;  1UDO A;  2UUB E;  4DV5 E;  2JT2 A;  1UIL A;  3D4J A;  4R2S A;  3K6Q A;  1PVG A;  2ELZ A;  4Z7Y A;  5FLX C;  3C6K A;  2JP9 A;  5C0X F;  1LLM C;  1HNX E;  4F9A B;  5JEA F;  5A6J A;  4LTY A;  4AQY I;  4LF5 E;  2HKJ A;  5ADZ A;  2M1S A;  1A1J A;  4B3M I;  2GPI A;  1Z0E A;  1ZAA C;  4R2Q A;  4DPW A;  2JXP A;  2F4V I;  4B3R E;  4DPX A;  2JE6 A;  2PO1 B;  1EKZ A;  2YU8 A;  2AE8 A;  5AAS A;  1RRE A;  1RC7 A;  5DNL A;  1WXR A;  1G2F C;  2C38 B;  3BBG A;  1GQE A;  2CSH A;  4BA2 B;  3JTZ A;  4OX9 E;  1L4S A;  1NCS A;  3DJW A;  4O24 A;  4BMJ A;  5IV8 B;  3J80 C;  4R2P A;  2C38 A;  3ZZT A;  1WHQ A;  2NN6 D;  4ZYG A;  1ZM9 A;  2EPN A;  4IFD E;  4BBY A;  3V5R A;  4IZK A;  4JI8 E;  2ZIT A;  4I8O A;  2LTR A;  2EN2 A;  2M7Q A;  1N36 I;  2N8X A;  3KWR A;  4TUI A;  2BB8 A;  1STU A;  2IHR 1;  1Z0W A;  2O1W A;  2XEX A;  2KON A;  4FW4 A;  4HXZ A;  3WU5 A;  5C0X C;  4DV3 I;  1X5W A;  2EOQ A;  1FJG E;  2MDG A;  2EPO A;  2DRP A; 
#chains in the Genus database with same CATH homology
 2B7V A;  4LF6 E;  4LFB E;  5LMU E;  4DR5 E;  1HNZ E;  3P06 A;  2UXD I;  1Y6Z A;  5IT9 C;  3GON A;  2LUQ A;  2IOQ A;  1X48 A;  1XNR E;  2GQ0 A;  3F6H A;  2Z5E A;  5GME A;  3MSW A;  4P78 A;  1ELO A;  2VQF E;  4HAC B;  4X62 I;  2MC6 A;  4MYU A;  4IZJ D;  4FW9 A;  4ED4 A;  2E1R A;  4EMD A;  5DNY A;  4B3S I;  3Q6M A;  3VYY A;  1PKP A;  2H36 X;  4USK A;  2B7T A;  1XNQ E;  3ZZU A;  2E5L E;  2V83 A;  2CPN A;  2PNL A;  4YHH I;  2A2C A;  4B3T E;  4M1K A;  4MYT A;  4ZVI A;  1D6T A;  4JI7 I;  4DR7 I;  4LF9 I;  4M0V A;  2JY9 A;  1ZBT A;  1N0V C;  4RPF A;  1DI2 A;  2LUP B;  4NXN I;  1DQ3 A;  4FWH A;  2FV4 B;  1HK7 A;  2LBS B;  3PYE A;  4P52 A;  2F8B A;  4JI4 E;  2N3G A;  4DV0 E;  4KHP E;  2V34 A;  1XMO I;  3F0N A;  3J7Y p;  4DV2 I;  4F9B B;  1IBK E;  2NPF A;  2UXB E;  4X65 I;  4DR2 I;  2BM0 A;  4JI6 E;  2V86 A;  2AJ4 A;  1OJ4 A;  4X8W A;  2DEJ A;  3LML A;  2VQE E;  4JI5 I;  2OI2 A;  1USV A;  4TUG A;  1T4O A;  1Z5B A;  3LPS A;  4DV6 I;  1B63 A;  1ZM4 A;  3K1J A;  4JI2 I;  1J5E E;  2FTX B;  4IZJ A;  3WU3 A;  1NHI A;  4LF8 I;  4DUY E;  1Z0B A;  4KZS A;  3B82 A;  3PYF A;  4DUZ I;  1O0W A;  4DR3 E;  1MU5 A;  4JYA E;  2UUA E;  1J26 A;  3H4L A;  1YZ9 A;  5AE3 A;  4X64 I;  4PRV A;  2Q2E B;  4JI3 E;  3ADI A;  4K0K I;  2RS7 A;  2JVA A;  5IWA E;  3M6A A;  5BR8 I;  4JI0 I;  1MG7 A;  4WUC A;  3OTO I;  2EZ6 A;  1X47 A;  1H72 C;  1Z0G A;  4AQY E;  1HNW I;  1IBM I;  4DV4 I;  4B3M E;  1Z5A A;  2JOX A;  4M30 A;  2F4V E;  2V2V A;  1Z0T A;  3F6G A;  4IZK B;  3P1X A;  2J7K A;  2O1U A;  2UXC E;  3K17 A;  3ZOQ B;  4DV7 I;  1ZXN A;  4USM A;  1ZM3 A;  2CGE A;  4M2Z A;  1U2R A;  1EA6 A;  3B8H A;  1KVK A;  4X66 I;  5LMN I;  2HKE A;  4DV3 E;  3K85 A;  5L3J A;  4BC7 A;  1VIS A;  1ZM2 A;  2V2Z A;  4KQV A;  1UHZ A;  2HHH E;  4JI8 I;  2KOU A;  1MX0 A;  4GKK E;  4JG4 A;  3OML A;  4JI1 I;  3ZZ0 A;  3V2U C;  1Z5C A;  4DR4 I;  4DV1 I;  3ZKB A;  1Z0C A;  4YY3 I;  4LF7 I;  5FLX Q;  2Z5C A;  2JR1 A;  3J81 C;  4HY1 A;  1HR0 E;  3ADG A;  4WUD A;  1T4N A;  4URL A;  5AE2 A;  1S4E A;  3HXL A;  2E1M A;  5CFF E;  2LTS A;  1GZ6 A;  5A2Q C;  4J8Z A;  3C4T A;  4YHH E;  2V8P A;  3HTX A;  2ZBK B;  2M4I A;  1N34 E;  2VF1 A;  1NZ0 A;  2DIX A;  3JU0 A;  4JI7 E;  2N3H A;  4DR7 E;  4LF9 E;  2HFU A;  1N32 I;  2V85 A;  3ADL A;  1XNQ I;  4LFA I;  3T1Y E;  3IWC A;  5T6J A;  2NUF A;  4NXN E;  4WYQ B;  3J80 Q;  4GKJ I;  2WZO A;  4DR1 I;  1YYK A;  2CZ9 A;  1IBL E;  2LMZ A;  2L8T A;  4LF4 I;  3LNU A;  4DV2 E;  2LJP A;  1Z59 A;  2ZM6 I;  2ODR C;  4DR6 E;  2LRS A;  4LU9 A;  2X36 A;  4JV5 I;  5IT9 Q;  1N33 I;  4R03 A;  4FWD A;  3H09 A;  4IZJ B;  3AV0 A;  1RQ0 A;  4JI5 E;  5F3W A;  4WUB A;  1B62 A;  3T1H E;  5LL6 R;  4DV6 E;  1ZBQ A;  2V89 A;  2B3T B;  2UUC I;  1XMQ I;  3QT6 A;  3Q1Q A;  4JI2 E;  2WW4 A;  1H7S A;  1KTV A;  4Z7C A;  2V87 A;  2Z5B A;  1BKN A;  2V8Q B;  4LF8 E;  5AE1 A;  3J81 Q;  3PYD A;  2YT4 A;  2VF3 A;  4DPT A;  4DUZ E;  2V2Q A;  3C4B A;  1H73 A;  3HPS A;  2DEI A;  1I94 I;  2L2N A;  4X64 E;  1T4L B;  1KKH A;  2MC5 A;  4K0K E;  4R1F A;  4DR3 I;  4LFC I;  5BR8 E;  2UUA I;  4WPY A;  2RSM A;  2KHX A;  4JI0 E;  3HJC A;  2UU9 I;  4NXM I;  1RR9 A;  3WU6 A;  3OTO E;  4BCA A;  2DSY A;  2R42 A;  4DV5 I;  2UUB I;  3VYX A;  2CG9 A;  1HNW E;  1UEK A;  1IBM E;  5IWA I;  3IWB A;  3IWD A;  4DV4 E;  1HNX I;  4DXL A;  4F54 A;  1WUU A;  1Y4U A;  4BC9 A;  4LF5 I;  1SR9 A;  2O1T A;  4B3R I;  2EWL A;  4DU8 A;  2LE2 A;  3QT5 A;  1A6F A;  2HK3 A;  4UT4 A;  4DV7 E;  4DPU A;  4GEQ B;  4XTJ A;  1N36 E;  4OX9 I;  4X66 E;  1S16 A;  2PNM A;  2UXC I;  3VK6 A;  5LMN E;  3J7A G;  2K4V A;  4F9C B;  2GS8 A;  3Q6N A;  2UXD E;  3B78 A;  4WSP A;  1H74 A;  2L33 A;  1KIJ A;  2HFS A;  1FJG I;  3HUL A;  2JOB A;  2DMY A;  1NHH A;  4WFT A;  4LF6 I;  3LLH A;  4LFB I;  5LMU I;  1N0U A;  2Z5C B;  4DR5 I;  1HNZ I;  4JI1 E;  2LJH A;  2EFG A;  4PRX A;  2HHH I;  2HK2 A;  3JAM C;  4X62 E;  2JWO A;  2V88 A;  2BV3 A;  4DR4 E;  4DV1 E;  4B3S E;  4YY3 E;  1XNR I;  4GKK I;  4LF7 E;  2DB2 A;  1K47 A;  2VQF I;  3AUZ A;  1DAR A;  1NHJ A;  2L2K B;  3ADJ A;  2NUG A;  1FWL A;  2NUE A;  4P7D A;  3J7A M;  3DF6 A;  1FKA E;  2E5L I;  1HR0 I;  1FWK A;  2G7H A;  4HAC A;  2A2D A;  4DU7 A;  4Q28 A;  4N3O A;  1N32 E;  2L6M A;  1H7U A;  4LFA E;  4B3T I;  3HPZ A;  2L2M A;  2FGG A;  1USU A;  1XMO E;  2IOP A;  4GKJ E;  1QZR A;  1N34 I;  2RS6 A;  4DR1 E;  4L8N A;  2O1V A;  1YYW A;  3T1Y I;  4DPY A;  1FNM A;  4FN5 A;  4JI4 I;  4X65 E;  4DR2 E;  4BS9 A;  4DV0 I;  4LF4 E;  4KHP I;  1Z0V A;  4HYM A;  2ZM6 E;  2L92 A;  3QT8 A;  4JV5 E;  1IBK I;  1N33 E;  1IBL I;  2UXB I;  2YZT A;  1YYO A;  3RMP A;  3PYG A;  1WHN A;  2Z5B B;  4JI6 I;  1X49 A;  4I3H A;  1EI1 A;  5GMD A;  2VQE I;  3ZM7 A;  4P7A A;  4DR6 I;  3CWV A;  3ZKD A;  2UUC E;  1XMQ E;  3PRY A;  3HQ1 A;  3JAM Q;  2L3J A;  1J5E I;  3T1H I;  2X7I A;  2BM1 A;  3WU4 A;  1FI4 A;  2MDR A;  1ZXM A;  2RTX A;  4FWG A;  2R3V A;  5A2Q Q;  3FIG A;  4DUY I;  1PIE A;  1QU6 A;  4DMI A;  2NA2 A;  1I94 E;  3QT7 A;  4DKK A;  4OOG C;  4R8O A;  4UTG A;  3LTO A;  4JYA I;  2L3C A;  4L5N C;  2B9D A;  4LFC E;  4PU9 A;  4JI3 I;  2UU9 E;  1XHK A;  4NXM E;  1Y4S A;  2ODR D;  2UUB E;  4DV5 E;  1UIL A;  3D4J A;  3K6Q A;  1PVG A;  4Z7Y A;  5FLX C;  1HNX E;  4F9A B;  4LTY A;  4AQY I;  4LF5 E;  2HKJ A;  5ADZ A;  2M1S A;  4B3M I;  1Z0E A;  4DPW A;  2F4V I;  4B3R E;  4DPX A;  1EKZ A;  5AAS A;  1RRE A;  1RC7 A;  1WXR A;  1GQE A;  3JTZ A;  4OX9 E;  3DJW A;  4BMJ A;  3J80 C;  3ZZT A;  1WHQ A;  1ZM9 A;  4BBY A;  3V5R A;  4IZK A;  4JI8 E;  2ZIT A;  4I8O A;  2LTR A;  2M7Q A;  1N36 I;  3KWR A;  4TUI A;  2IHR 1;  1STU A;  1Z0W A;  2O1W A;  2XEX A;  4HXZ A;  2KON A;  3WU5 A;  4DV3 I;  1FJG E;  5FWK A;  2VE7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...