1XNQE

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnqE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnqE02
4NXME 1H72C 3ZZ0A 1N34E 4Z7YA 1YYKA 4ZVIA 4X62E 5BR8I 4K0KE 2DMYA 4B3RI 2F4VE 2UXDE 3OTOI 1HNZI 4GKJI 1RREA 1UEKA 4B3MI 2N3GA 1MX0A 4DV6E 4HACA 4DV4I 2CZ9A 1H74A 3V2UC 5LL6R 2DIXA 2HHHI 1UILA 3PYFA 4YHHI 3QT5A 4LFBI 1HNXE 3C4BA 4DU8A 3K1JA 4LF5E 4DV1I 4LFAI 4URLA 4LF7E 4LFCE 4WFTA 4DPTA 5GMDA 2RTXA 4B3TI 1J26A 4NXNI 1O0WA 1PKPA 1BKNA 1N34I 4GKKE 5LMUI 2X7IA 1Z0GA 4YY3I 1IBME 2F4VI 4LF6E 2L3JA 1Z0EA 1DI2A 1J5EE 3ADLA 2V8PA 2MDRA 3JAMQ 1ZBTA 2UUCI 1Z0TA 3T1HE 3F0NA 1RC7A 3ADJA 1XNQE 1XMQE 2UUAE 1S4EA 4DU7A 2DEIA 3J80C 2WW4A 2ZM6E 5FLXC 4NXNE 4X65I 4JI8I 2E5LI 1FI4A 3B82A 5L3JA 2HHHE 5LMNE 4DV7E 4JI0E 4DXLA 4LF5I 2UU9I 1N0VC 1NHHA 4DV3E 4YHHE 2UXBE 4XTJA 3ZKBA 4JI6I 4B3SI 1K47A 1RR9A 3HTXA 4B3TE 4DV5E 5CFFE 1Z0CA 4M2ZA 1QU6A 3ZZTA 4GKKI 4JI8E 4JI1E 1NHIA 4M30A 2DB2A 2BM1A 3T1HI 1FJGI 1S16A 2LUPB 1XNQI 4DPXA 3WU5A 1KIJA 1N33I 4DV3I 2CPNA 2UUCE 4FWHA 1H73A 3ADIA 1WHNA 3P1XA 4B3SE 1IBLE 1PVGA 3H4LA 4JYAE 4OX9I 2RS7A 1KTVA 3PYGA 4DV7I 3B78A 4AQYE 4X8WA 1STUA 1FWKA 4JI3E 5A2QC 1KVKA 3JAMC 1Z5BA 1ELOA 4JI1I 4DR3I 4B3RE 2NA2A 4HYMA 2L2NA 4DR5E 2DEJA 3J7Yp 4DV4E 1ZM9A 3J7AG 4LF9I 1XHKA 4LFBE 3V5RA 4RPFA 4P7AA 2NUFA 3J81Q 4LF4E 4OOGC 1Z5AA 4FWDA 4GKJE 4FWGA 4LF8E 1D6TA 1X49A 3LLHA 1NHJA 2A2CA 3C4TA 4Z7CA 3LNUA 4JI5E 4PU9A 4DV2E 2HFSA 5LMUE 4JV5I 1RQ0A 3WU6A 4JI3I 3CWVA 3Q1QA 2X36A 2HKEA 3WU3A 1FNMA 4DV0E 4WUDA 1ZM2A 2VQEI 4DR7I 3LPSA 4LF7I 1IBLI 3T1YI 4LF9E 2VQFI 4DR2E 2LBSB 3QT7A 4X64I 4LF4I 3VYXA 3J7AM 4WUBA 2V34A 3WU4A 2ZM6I 5LMNI 4KQVA 1I94E 3PYDA 4R1FA 3D4JA 4JI7I 3ADGA 1XMQI 2UUAI 2ZITA 5IWAI 1HR0E 2R42A 2UUBE 4DR1E 1H7UA 1N32I 1MU5A 4WYQB 2OI2A 4JI5I 3VYYA 2E5LE 4PRVA 4LF8I 5BR8E 4P52A 1Z59A 2VQFE 1HNWI 2NUEA 1YZ9A 1WHQA 2AJ4A 4WUCA 4KHPE 4DR2I 1QZRA 1IBKE 4DR6E 1Z5CA 4EMDA 4JI2E 1FJGE 1NZ0A 2UU9E 1DARA 5IWAE 3PYEA 4X66I 2UUBI 2L2MA 2B7TA 4DUYE 1GQEA 4MYTA 2V2ZA 4DPWA 1WUUA 2NUGA 1ZM4A 2UXCI 4X62I 1OJ4A 1U2RA 4LFCI 4MYUA 2RSMA 1T4NA 4FW9A 5IT9Q 1B62A 3J80Q 1IBMI 1UHZA 5FLXQ 1N36I 4LF6I 2EFGA 2KHXA 4DV6I 4HXZA 2BM0A 2Q2EB 5IT9C 4DPYA 4YY3E 1T4LB 1N33E 4DR1I 1IBKI 4DKKA 1T4OA 1Z0VA 1FKAE 4I3HA 2A2DA 3ZZUA 1N0UA 4OX9E 2J7KA 3QT6A 4JYAI 3ZKDA 4DR6I 2JVAA 2E1RA 2UXCE 2LRSA 4DUZI 1J5EI 1MG7A 2L33A 2LUQA 4USMA 4KHPI 2JY9A 2HKJA 2V2VA 2IHR1 1XNRI 4JI4I 1A6FA 4JI0I 1X47A 2LTSA 3ZM7A 1YYOA 1EA6A 2V2QA 3M6AA 4DPUA 2RS6A 1FWLA 4X66E 4HY1A 2L2KB 4DUYI 1N36E 1EKZA 1XMOE 1YYWA 3B8HA 2VQEE 4DR7E 5A2QQ 2B7VA 4JV5E 2UXBI 2LJHA 4NXMI 1EI1A 2GS8A 4X65E 4DV2I 1ZM3A 4DUZE 4FN5A 2ZBKB 4DR4E 3K17A 4DV5I 5GMEA 4UTGA 1XNRE 4M1KA 4X64E 3OTOE 4JI7E 1HNZE 1VISA 1H7SA 2L3CA 3T1YE 4K0KI 2HK2A 4DV0I 4B3ME 4USKA 1B63A 2UXDI 4LFAE 3LTOA 4JI6E 2LJPA 1ZXMA 2EZ6A 4HACB 1HNXI 1KKHA 1Z0BA 1Z0WA 4DV1E 2B3TB 4AQYI 2XEXA 1PIEA 2HFUA 3J81C 2YT4A 2BV3A 2HK3A 3HULA 3QT8A 2LTRA 4DR3E 4JG4A 1I94I 4DR4I 1HNWE 4JI4E 2N3HA 4ED4A 4UT4A 1HR0I 1X48A 3GONA 2NPFA 2R3VA 4PRXA 1ZXNA 1N32E 1XMOI 4DR5I 4JI2I 2VF3A
chains in the Genus database with same CATH superfamily
2KONA 4NXME 1H72C 3ZZ0A 1X6FA 1N34E 4Z7YA 3EPLA 1YYKA 4ZVIA 4X62E 2YWQA 5BR8I 3P3EA 1EH6A 4O5GA 2EOIA 1IQSA 4K0KE 4GQUA 2J65A 4Q35B 2DMYA 1ZBQA 4LU9A 4B3RI 1KJKA 2F4VE 4R2CA 4BBYA 2BA0D 2UXDE 3U1KA 3PS3A 3OTOI 1SR9A 1N3GA 2EMIA 2JYAA 4R2QA 1HNZI 3M85G 4GKJI 1RREA 2WP8B 2F8BA 2JXPA 1WRJA 3TQMA 5C0XF 1IMUA 5KL5A 1UEKA 2PNZA 2EM9A 1EH8A 2YTJA 4B3MI 2N3GA 1MX0A 4DV6E 4HACA 4MQYA 4DV4I 2CZ9A 4FW3A 2V88A 2EOJA 2J7JA 1H74A 4QNKA 3V2UC 5LL6R 2DIXA 2EMZA 2HHHI 3AUZA 1UILA 4F2JC 1P47A 3PYFA 3Q6MA 3KZZA 3QT5A 4YHHI 4LFBI 1HNXE 4M9VC 3C4BA 4DU8A 3K1JA 1A1HA 4LF5E 4DV1I 3QG5C 4RHBB 4LFAI 1UDQA 4URLA 2EN4A 2EMGA 2V8QB 4LF7E 4LFCE 4WFTA 4DPTA 5AC5A 3UHMA 5GMDA 2EPXA 2RTXA 4B3TI 1J26A 4NXNI 1O0WA 1PKPA 2EM4A 1BKNA 1NCSA 4WSPA 2DLKA 2FGGA 4BMJA 1N34I 4BC7A 5F3WA 4GKKE 2WBTA 1JK1A 5LMUI 2X7IA 1Z0GA 4TUIA 4YY3I 1IBME 5AE3A 1G2FC 3KRNA 2F4VI 4LOMA 3B4TA 4LF6E 2JPAA 2EPOA 1YH8A 2GHFA 2L3JA 2EJ4A 1Z0EA 2BBGA 1DI2A 1J5EE 3HXLA 3ADLA 2EN1A 2V8PA 2BA0G 2JR1A 2Q8UA 2MDRA 4IZKA 1YSAC 3JAMQ 4IFDF 5K36D 3F6GA 5T6JA 3PS2A 1ZBTA 2JWOA 2UUCI 2EMFA 3T1HE 1Z0TA 3F0NA 1RC7A 3ADJA 3M7NG 1G2DC 1X6HA 1XNQE 4F6NA 1XMQE 2UUAE 1S4EA 2LV2A 2C37B 2EMWA 2GO4A 1ZR9A 2WNRB 4DU7A 5DNLA 2DEIA 2BB8A 3ECRA 5K36A 3J80C 2EPKX 3M85D 2EOHA 2WW4A 5FLXC 2ZM6E 2EPUA 3THOB 4NXNE 4F54A 3HPZA 5DROA 3HPSA 4X65I 3THNA 3MSWA 4J8ZA 4JI8I 5JEAB 2E5LI 1FI4A 2EN8A 3B82A 1F2IG 2JE6A 2MKDA 5L3JA 2HHHE 5LMNE 4KWYA 3KWRA 4DV7E 2EN2A 4JI0E 1BBGA 2O1TA 4DXLA 2WBSA 4IFDA 1LLMC 4LF5I 2UU9I 2YSOA 2RSIA 1N0VC 1NHHA 4DV3E 4YHHE 2VE7C 2LMZA 2UXBE 1HK7A 4XTJA 3VK6A 5AC4A 2ENAA 3Q6NA 2PNMA 3ZKBA 2EQ3A 2AE8A 4JI6I 4B3SI 1K47A 1RR9A 2MDGA 3BIDA 3HTXA 4B3TE 4BHCA 4L8NA 4DV5E 2M9AA 5CFFE 2EMLA 1Z0CA 5IXMB 4M2ZA 2BA1G 2NABA 1A1LA 1QU6A 3ZZTA 4GKKI 4JI8E 1UN6B 3MHSC 4P7DA 4F6MA 4JI1E 2C37A 2EOZA 1UDSA 1NHIA 4M30A 2G7HA 4L5NC 4WSGA 2DB2A 4IZJB 2YU5A 2YTDA 2BM1A 2N8XA 2JOXA 4F9CB 2CT1A 2CVEA 3T1HI 1FJGI 1S16A 3M99B 2LUPB 1XNQI 2NN6D 4DPXA 5AE2A 2M1SA 4LCHA 3WU5A 2EM7A 1KIJA 1N33I 4DV3I 2CPNA 2EOYA 2UUCE 2EOQA 4OO1D 4FWHA 1H73A 2NN6A 3ADIA 2CGEA 1YPNA 1WHNA 1R6LA 3P1XA 1X3CA 4ZYHA 4B3SE 4R2RA 1IBLE 5A6BD 1A1GA 4OO1B 1PVGA 3H4LA 4JYAE 4OX9I 2RS7A 4BA2A 2EPRA 2YTPA 1KTVA 3PYGA 4DV7I 3B78A 2YPNA 2GPIA 1OYSA 4AQYE 5AE1A 1WJPA 2EM8A 1STUA 4X8WA 1FWKA 4JI3E 5A2QC 5KL4A 1KVKA 3JAMC 4HTGA 1Z5BA 1ELOA 1X5WA 2EM5A 1BB8A 4JI1I 4DR3I 2L6MA 3UK3C 2EPAA 4B3RE 2NA2A 4NZVA 1AAYA 3U1YA 2YTEA 2BA1D 4HYMA 2IERA 2L2NA 2ODRD 4DR5E 2DEJA 2C39A 2YTFA 3BGHA 4WX9A 3J7Yp 4DV4E 3J7AG 1ZM9A 1E3PA 1B69A 1Y4SA 4LF9I 4MLQA 1XHKA 4IZKB 2LE2A 4OO1C 4LFBE 2IOPA 4RPFA 3V5RA 5KL3A 2H36X 4P7AA 1UDOA 2NUFA 3J81Q 5IV8B 5JEAD 4LF4E 3RMPA 4OOGC 1Y4UA 3H09A 4GKJE 1Z5AA 4LF8E 4FWGA 4FWDA 1D6TA 2EE8A 2R1FA 4FW7A 2YZTA 1X49A 2M4IA 3LLHA 1NHJA 2A2CA 3C4TA 1UDNA 3GLLA 3LNUA 4Z7CA 2LT7A 4JI5E 4R2PA 2FTXB 4PU9A 2O1VA 3L00A 4DV2E 2HFSA 3JU0A 1A1FA 2EMYA 5LMUE 2PO0A 4IZJD 4O43A 2GLIA 1YHCA 4JV5I 1USVA 1RQ0A 2ENHA 1ZAAC 2NN6B 2ODRC 2I9IA 3EQ1A 4HEIA 4DMIA 2MKNA 1E3HA 3WU6A 1NEIA 5K36B 2PO2A 4JI3I 2VESA 1PJSA 4QNJA 2BR2A 3CWVA 4IFDB 3Q1QA 2X36A 4BA2B 2EP3A 2EL5A 1RHYA 5ELWA 2WBUA 2HKEA 3WU3A 2EMKA 2V86A 3K6QA 1FNMA 4DV0E 4WUDA 4ZYDA 1ZM2A 2VQEI 5JEAE 4DR7I 4AIDA 3LPSA 2EN6A 1QNTA 1VI7A 4LF7I 3BF2A 1IBLI 3T1YI 4LF9E 1RMDA 2VQFI 1GTKA 3DF6A 4DR2E 4TUGA 4LTYA 2EM0A 2LBSB 3P76A 3QT7A 2EPNA 3CDJA 4NHRA 1OYPA 4X64I 3GCMA 1PDAA 4R2AA 3L7ZA 2YTNA 4LF4I 4FK5C 3VYXA 2YRKA 1A1JA 3J7AM 1Z1BA 1MEYC 3K85A 5DNYA 4WUBA 2V34A 4OO1E 2DSYA 3WU4A 2YU8A 1SFEA 2ZM6I 1TN9A 1UBDC 2O1WA 1I94E 4KQVA 2JEBB 5LMNI 2WNRA 2Z5BA 3EPHA 3FIGA 3PYDA 4LCGA 3D4JA 4R1FA 4JI7I 1BBOA 3LMLA 3ADGA 5A6KA 3IWBA 1XMQI 2EPZA 3F6HA 2ZITA 3P06A 1HR0E 5IWAI 2R42A 2UUAI 5C0XA 2PO0B 2UUBE 3PS1A 4DR1E 2JE6B 2HC5A 1H7UA 1N32I 1YUJA 1MU5A 4WYQB 2OI2A 3CDIA 4JI5I 2B9DA 1AH5A 2C38B 4N4RB 1KYQA 4GEQB 3VYYA 2E5LE 4PRVA 5C0XD 2EMAA 4LF8I 5BR8E 4P52A 4WPYA 3JTZA 1Z59A 4MU3A 2VQFE 2GQ0A 4P78A 4I8OA 2NUEA 2O1UA 2EOOA 5EKWA 1HNWI 5K36F 1WXRA 5KL7A 1YZ9A 1WHQA 4MDTA 2VRDA 2EWLA 5A6AA 2AJ4A 4WUCA 3DJWA 5DNXA 3IWCA 3H1CA 4OKGA 1A1KA 4KHPE 4MU1A 2EM3A 4F9AB 3OMLA 3ZOQB 1IBKE 4DR6E 1QZRA 1Z5CA 4DR2I 2E1MA 4EMDA 2RQLA 2LO3A 4JI2E 2DMIA 2R76A 1FJGE 1NZ0A 4BCAA 1X6EA 2UU9E 2GO3A 4N3OA 1DARA 2RPCA 1IQOA 1MGTA 5IWAE 2IESA 1PJQA 2PNLA 3PYEA 4X66I 4RH8A 2YSPA 2UUBI 4MLVA 2L2MA 2B7TA 4DUYE 1GQEA 2EM6A 2EQ0A 2WP8A 4MYTA 2V2ZA 4DPWA 1WUUA 1R6MA 2NUGA 2JEBA 1ZM4A 2ELZA 2UXCI 4KZSA 4GZNC 5A6JA 4X62I 2V89A 2LCEA 1OJ4A 2VF1A 1U2RA 2IOQA 4MYUA 4R2DA 2RSMA 1Y6ZA 1T4NA 4LFCI 2CTDA 5JEAC 4BS9A 4OZEA 2JT2A 1Y5YA 5A69A 4R2EA 4FW9A 5LLQA 5KL6A 5IT9Q 4IFDD 5DRQA 3HKMA 2EL4A 4IS9A 2V85A 2C38A 2CG9A 1B62A 2EMCA 1P42A 3J80Q 1IBMI 1UHZA 3KZYA 5FLXQ 1N36I 4LF6I 2PRTA 2EFGA 2KHXA 2EN7A 4DV6I 2DRPA 4HXZA 2BM0A 2WCC3 4IS1C 2Q2EB 3C6KA 5IT9C 4DPYA 4YY3E 2EOMA 1T4LB 1N33E 4DR1I 2EQ1A 3P3GA 1IBKI 4DKKA 2O3ZA 4U3DA 1DQ3A 2EPCA 2D9HA 2YTOA 1T4OA 1Z0VA 1FKAE 4I3HA 2A2DA 5EL9A 3P3CA 3ZZUA 4X9JA 1N0UA 1GZ6A 4LPFA 1T38A 4AM3A 2EMHA 2EORA 4OX9E 2J7KA 3C6MA 3QT6A 4O24A 3ZKDA 4JYAI 2JP9A 4DR6I 2JVAA 2E1RA 2LJUA 3HQ1A 2UXCE 2EMXA 2LRSA 4OO1F 4FW6A 4DUZI 5C0XE 3HJCA 1J5EI 2EL6A 5ADZA 3BBGA 1MG7A 2L33A 2LUQA 4USMA 4KHPI 2JY9A 2HGHA 1L4SA 2HKJA 2V2VA 2F1DA 2IHR1 1XNRI 4JI4I 1A6FA 2DLQA 4J3DA 4JI0I 1X47A 1EH7A 1T39A 2LVHA 2DGCA 2LTSA 2PNZB 2EPLX 3ZM7A 1YYOA 1EA6A 5C0XB 2V2QA 1PJTA 2ADRA 3M6AA 4DPUA 2PO1A 2RS6A 1FWLA 4R2SA 4X66E 4MU0A 4HY1A 2EN3A 2L2KB 4DUYI 2EMBA 2YRHA 1N36E 1EKZA 2KOUA 2MC5A 1XMOE 2L92A 1YYWA 2Z5CB 1JK2A 2M7QA 2EOFA 1A1IA 2VQEE 4DR7E 2YTQA 2B7VA 3B8HA 5A2QQ 1ZU1A 3NZKA 3AV0A 3PRYA 4JV5E 2UXBI 4OO1A 3M7ND 2NN6F 2LJHA 3IWDA 4IJDA 1YUIA 1EI1A 2GS8A 4AIMA 4BA1A 4X65E 5C0XC 4NXMI 4DV2I 1YFHA 5FWKA 2V83A 4R03A 1ZM3A 4DUZE 2NN6E 5DRRA 5A6BA 5K36E 4FN5A 2ZBKB 4O4KA 4DR4E 3K17A 4DV5I 5GMEA 4FW5A 2C39B 4UTGA 5AASA 1XNRE 2FV4B 2V87A 3EPJA 5TSEA 4M1KA 4X64E 3OTOE 4U3BA 5K36C 2NN6C 4JI7E 2L8TA 1HNZE 1VISA 4R8OA 2HJJA 5KL2A 2EM2A 2K7IA 2L3CA 1H7SA 4M0VA 2YTIA 3T1YE 2I13A 4ZYGA 3GMEA 4K0KI 2EOXA 2HK2A 2EPMX 4DV0I 2JOBA 4B3ME 3L7ZB 4USKA 4IFDE 1B63A 2YRMA 3EPKA 2E72A 2UXDI 4LFAE 2Z5BB 4JI6E 3LTOA 2LJPA 2A25A 2Z5EA 1ZXMA 4ISAA 4IZJA 5DRPA 4Q28A 2EZ6A 4HACB 1HNXI 1KKHA 2MC6A 4F9BB 4NBQA 4ZYEA 1Z0BA 1Z0WA 5JEAA 4DV1E 2B3TB 4AQYI 2ELYA 4WXDA 1XXEA 1Y60A 2ENCA 2XEXA 2PO1B 4BHBA 3J81C 1PIEA 2HFUA 2YT4A 2BV3A 2HK3A 3HULA 2EPPA 1USUA 3QT8A 2YTGA 4FW4A 4WXCA 2LTRA 4BC9A 4DR3E 1OYRA 4JG4A 1HNWE 4JI4E 2Z5CA 3DD6A 1I94I 4DR4I 3MHHC 2K4VA 1TF3A 1TF6A 2N3HA 1DGCA 2PO2B 5JEAF 4IFDC 2EOSA 2JEAA 4ED4A 4MU4A 3VHTB 2WZOA 4BA1B 4UT4A 1HR0I 2JEAB 1X48A 2CSHA 3GONA 2NPFA 2R3VA 2BR2B 4PRXA 1ZXNA 4LCFA 1N32E 1XMOI 4DR5I 4JI2I 2VF3A 2EOEA
chains in the Genus database with same CATH topology
2KONA 4NXME 1H72C 3ZZ0A 1N34E 4Z7YA 1YYKA 4ZVIA 4X62E 5BR8I 4K0KE 2DMYA 1ZBQA 4LU9A 4B3RI 2F4VE 4BBYA 2UXDE 3OTOI 1SR9A 1HNZI 4GKJI 1RREA 2F8BA 1UEKA 4B3MI 2N3GA 1MX0A 4DV6E 4HACA 4DV4I 2CZ9A 2V88A 1H74A 3V2UC 5LL6R 2DIXA 2HHHI 3AUZA 1UILA 3Q6MA 3PYFA 4YHHI 3QT5A 4LFBI 1HNXE 3C4BA 4DU8A 3K1JA 4LF5E 4DV1I 4LFAI 4URLA 2V8QB 4LF7E 4LFCE 4WFTA 4DPTA 5GMDA 2RTXA 4B3TI 1J26A 4NXNI 1O0WA 1PKPA 1BKNA 4WSPA 4BMJA 2FGGA 1N34I 4BC7A 5F3WA 4GKKE 5LMUI 2X7IA 1Z0GA 4TUIA 4YY3I 1IBME 5AE3A 2F4VI 4LF6E 2L3JA 1Z0EA 1DI2A 1J5EE 3HXLA 3ADLA 2V8PA 2JR1A 4IZKA 2MDRA 3JAMQ 3F6GA 5T6JA 1ZBTA 2JWOA 2UUCI 1Z0TA 3T1HE 3F0NA 1RC7A 3ADJA 1XNQE 1XMQE 2UUAE 1S4EA 4DU7A 2DEIA 3J80C 2WW4A 5FLXC 2ZM6E 4NXNE 4F54A 3HPZA 3HPSA 4X65I 3MSWA 4J8ZA 4JI8I 2E5LI 1FI4A 3B82A 5L3JA 2HHHE 5LMNE 3KWRA 4DV7E 4JI0E 2O1TA 4DXLA 4LF5I 2UU9I 1N0VC 1NHHA 4DV3E 4YHHE 2VE7C 2LMZA 2UXBE 1HK7A 4XTJA 3VK6A 3Q6NA 2PNMA 3ZKBA 4JI6I 4B3SI 1K47A 1RR9A 3HTXA 4B3TE 4L8NA 4DV5E 5CFFE 1Z0CA 4M2ZA 1QU6A 3ZZTA 4GKKI 4JI8E 4P7DA 4JI1E 1NHIA 4M30A 2G7HA 4L5NC 2DB2A 4IZJB 2BM1A 2JOXA 4F9CB 3T1HI 1FJGI 1S16A 2LUPB 1XNQI 4DPXA 5AE2A 2M1SA 3WU5A 1KIJA 1N33I 4DV3I 2CPNA 2UUCE 4FWHA 1H73A 3ADIA 2CGEA 1WHNA 3P1XA 4B3SE 1IBLE 1PVGA 3H4LA 4JYAE 4OX9I 2RS7A 1KTVA 3PYGA 4DV7I 3B78A 4AQYE 5AE1A 4X8WA 1STUA 1FWKA 4JI3E 5A2QC 1KVKA 3JAMC 1Z5BA 1ELOA 4JI1I 4DR3I 2L6MA 4B3RE 2NA2A 4HYMA 2L2NA 2ODRD 4DR5E 2DEJA 3J7Yp 4DV4E 3J7AG 1ZM9A 1Y4SA 4LF9I 1XHKA 4IZKB 2LE2A 4LFBE 2IOPA 4RPFA 3V5RA 2H36X 4P7AA 2NUFA 3J81Q 4LF4E 3RMPA 4OOGC 1Y4UA 3H09A 4GKJE 1Z5AA 4LF8E 4FWGA 4FWDA 1D6TA 2YZTA 1X49A 2M4IA 3LLHA 1NHJA 2A2CA 3C4TA 4Z7CA 3LNUA 4JI5E 2FTXB 4PU9A 2O1VA 4DV2E 2HFSA 3JU0A 5LMUE 4IZJD 4JV5I 1USVA 1RQ0A 2ODRC 4DMIA 3WU6A 4JI3I 3CWVA 3Q1QA 2X36A 2HKEA 3WU3A 2V86A 3K6QA 1FNMA 4DV0E 4WUDA 1ZM2A 2VQEI 4DR7I 3LPSA 4LF7I 1IBLI 3T1YI 4LF9E 2VQFI 3DF6A 4DR2E 4TUGA 4LTYA 2LBSB 3QT7A 4X64I 4LF4I 3VYXA 3J7AM 3K85A 5DNYA 4WUBA 2V34A 2DSYA 3WU4A 2ZM6I 5LMNI 4KQVA 2O1WA 1I94E 2Z5BA 3FIGA 3PYDA 4R1FA 3D4JA 4JI7I 3LMLA 3ADGA 3IWBA 1XMQI 3P06A 3F6HA 2ZITA 5IWAI 1HR0E 2UUAI 2R42A 2UUBE 4DR1E 1H7UA 1N32I 1MU5A 4WYQB 2OI2A 4JI5I 2B9DA 4GEQB 3VYYA 2E5LE 4PRVA 4LF8I 5BR8E 4P52A 4WPYA 3JTZA 1Z59A 2VQFE 2GQ0A 4P78A 4I8OA 2NUEA 2O1UA 1HNWI 1WXRA 1YZ9A 1WHQA 2EWLA 2AJ4A 4WUCA 3DJWA 3IWCA 4KHPE 4DR2I 4F9AB 1QZRA 3OMLA 3ZOQB 1IBKE 4DR6E 1Z5CA 2E1MA 4EMDA 4JI2E 1FJGE 1NZ0A 4N3OA 4BCAA 2UU9E 1DARA 5IWAE 2PNLA 3PYEA 4X66I 2UUBI 2L2MA 2B7TA 4DUYE 1GQEA 4MYTA 2V2ZA 4DPWA 1WUUA 2NUGA 1ZM4A 2UXCI 4KZSA 4X62I 2V89A 1OJ4A 2VF1A 1U2RA 2IOQA 4MYUA 1Y6ZA 2RSMA 4LFCI 1T4NA 4BS9A 4FW9A 5IT9Q 2V85A 2CG9A 1B62A 3J80Q 1IBMI 1UHZA 5FLXQ 1N36I 4LF6I 2EFGA 2KHXA 4DV6I 4HXZA 2BM0A 2Q2EB 5IT9C 4DPYA 4YY3E 1T4LB 1N33E 4DR1I 1IBKI 4DKKA 1DQ3A 1T4OA 1Z0VA 1FKAE 4I3HA 2A2DA 3ZZUA 1N0UA 1GZ6A 4OX9E 2J7KA 3QT6A 4JYAI 3ZKDA 4DR6I 2JVAA 2E1RA 3HQ1A 2UXCE 2LRSA 4DUZI 3HJCA 1J5EI 1MG7A 5ADZA 2L33A 2LUQA 4USMA 4KHPI 2JY9A 2HKJA 2V2VA 2IHR1 1XNRI 4JI4I 1A6FA 4JI0I 1X47A 2LTSA 3ZM7A 1YYOA 1EA6A 2V2QA 3M6AA 4DPUA 2RS6A 1FWLA 4X66E 4HY1A 2L2KB 4DUYI 1N36E 1EKZA 2KOUA 2MC5A 1XMOE 2L92A 1YYWA 2Z5CB 2M7QA 3B8HA 2VQEE 4DR7E 5A2QQ 2B7VA 3PRYA 3AV0A 4JV5E 2UXBI 2LJHA 3IWDA 4NXMI 1EI1A 2GS8A 4X65E 4DV2I 5FWKA 2V83A 4R03A 1ZM3A 4DUZE 4FN5A 2ZBKB 4DR4E 3K17A 4DV5I 5GMEA 4UTGA 5AASA 1XNRE 2FV4B 2V87A 4M1KA 4X64E 3OTOE 4JI7E 2L8TA 1HNZE 1VISA 4R8OA 1H7SA 2L3CA 4M0VA 3T1YE 4K0KI 2HK2A 4DV0I 2JOBA 4B3ME 4USKA 1B63A 2UXDI 4LFAE 2Z5BB 4JI6E 3LTOA 2LJPA 2Z5EA 1ZXMA 4IZJA 4Q28A 2EZ6A 4HACB 1HNXI 1KKHA 2MC6A 4F9BB 1Z0BA 1Z0WA 4DV1E 2B3TB 4AQYI 2XEXA 1PIEA 3J81C 2HFUA 2YT4A 2BV3A 2HK3A 3HULA 1USUA 3QT8A 4BC9A 2LTRA 4DR3E 4JG4A 1I94I 4DR4I 1HNWE 4JI4E 2Z5CA 2K4VA 2N3HA 4ED4A 4UT4A 2WZOA 1HR0I 1X48A 3GONA 2NPFA 2R3VA 4PRXA 1ZXNA 1N32E 1XMOI 4DR5I 4JI2I 2VF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM E;  1H72 C;  3ZZ0 A;  1N34 E;  4Z7Y A;  1YYK A;  4ZVI A;  4X62 E;  5BR8 I;  4K0K E;  2DMY A;  4B3R I;  2F4V E;  2UXD E;  3OTO I;  1HNZ I;  4GKJ I;  1RRE A;  1UEK A;  4B3M I;  2N3G A;  1MX0 A;  4DV6 E;  4HAC A;  4DV4 I;  2CZ9 A;  1H74 A;  3V2U C;  5LL6 R;  2DIX A;  2HHH I;  1UIL A;  3PYF A;  4YHH I;  3QT5 A;  4LFB I;  1HNX E;  3C4B A;  4DU8 A;  3K1J A;  4LF5 E;  4DV1 I;  4LFA I;  4URL A;  4LF7 E;  4LFC E;  4WFT A;  4DPT A;  5GMD A;  2RTX A;  4B3T I;  1J26 A;  4NXN I;  1O0W A;  1PKP A;  1BKN A;  1N34 I;  4GKK E;  5LMU I;  2X7I A;  1Z0G A;  4YY3 I;  1IBM E;  2F4V I;  4LF6 E;  2L3J A;  1Z0E A;  1DI2 A;  1J5E E;  3ADL A;  2V8P A;  2MDR A;  3JAM Q;  1ZBT A;  2UUC I;  1Z0T A;  3T1H E;  3F0N A;  1RC7 A;  3ADJ A;  1XNQ E;  1XMQ E;  2UUA E;  1S4E A;  4DU7 A;  2DEI A;  3J80 C;  2WW4 A;  2ZM6 E;  5FLX C;  4NXN E;  4X65 I;  4JI8 I;  2E5L I;  1FI4 A;  3B82 A;  5L3J A;  2HHH E;  5LMN E;  4DV7 E;  4JI0 E;  4DXL A;  4LF5 I;  2UU9 I;  1N0V C;  1NHH A;  4DV3 E;  4YHH E;  2UXB E;  4XTJ A;  3ZKB A;  4JI6 I;  4B3S I;  1K47 A;  1RR9 A;  3HTX A;  4B3T E;  4DV5 E;  5CFF E;  1Z0C A;  4M2Z A;  1QU6 A;  3ZZT A;  4GKK I;  4JI8 E;  4JI1 E;  1NHI A;  4M30 A;  2DB2 A;  2BM1 A;  3T1H I;  1FJG I;  1S16 A;  2LUP B;  1XNQ I;  4DPX A;  3WU5 A;  1KIJ A;  1N33 I;  4DV3 I;  2CPN A;  2UUC E;  4FWH A;  1H73 A;  3ADI A;  1WHN A;  3P1X A;  4B3S E;  1IBL E;  1PVG A;  3H4L A;  4JYA E;  4OX9 I;  2RS7 A;  1KTV A;  3PYG A;  4DV7 I;  3B78 A;  4AQY E;  4X8W A;  1STU A;  1FWK A;  4JI3 E;  5A2Q C;  1KVK A;  3JAM C;  1Z5B A;  1ELO A;  4JI1 I;  4DR3 I;  4B3R E;  2NA2 A;  4HYM A;  2L2N A;  4DR5 E;  2DEJ A;  3J7Y p;  4DV4 E;  1ZM9 A;  3J7A G;  4LF9 I;  1XHK A;  4LFB E;  3V5R A;  4RPF A;  4P7A A;  2NUF A;  3J81 Q;  4LF4 E;  4OOG C;  1Z5A A;  4FWD A;  4GKJ E;  4FWG A;  4LF8 E;  1D6T A;  1X49 A;  3LLH A;  1NHJ A;  2A2C A;  3C4T A;  4Z7C A;  3LNU A;  4JI5 E;  4PU9 A;  4DV2 E;  2HFS A;  5LMU E;  4JV5 I;  1RQ0 A;  3WU6 A;  4JI3 I;  3CWV A;  3Q1Q A;  2X36 A;  2HKE A;  3WU3 A;  1FNM A;  4DV0 E;  4WUD A;  1ZM2 A;  2VQE I;  4DR7 I;  3LPS A;  4LF7 I;  1IBL I;  3T1Y I;  4LF9 E;  2VQF I;  4DR2 E;  2LBS B;  3QT7 A;  4X64 I;  4LF4 I;  3VYX A;  3J7A M;  4WUB A;  2V34 A;  3WU4 A;  2ZM6 I;  5LMN I;  4KQV A;  1I94 E;  3PYD A;  4R1F A;  3D4J A;  4JI7 I;  3ADG A;  1XMQ I;  2UUA I;  2ZIT A;  5IWA I;  1HR0 E;  2R42 A;  2UUB E;  4DR1 E;  1H7U A;  1N32 I;  1MU5 A;  4WYQ B;  2OI2 A;  4JI5 I;  3VYY A;  2E5L E;  4PRV A;  4LF8 I;  5BR8 E;  4P52 A;  1Z59 A;  2VQF E;  1HNW I;  2NUE A;  1YZ9 A;  1WHQ A;  2AJ4 A;  4WUC A;  4KHP E;  4DR2 I;  1QZR A;  1IBK E;  4DR6 E;  1Z5C A;  4EMD A;  4JI2 E;  1FJG E;  1NZ0 A;  2UU9 E;  1DAR A;  5IWA E;  3PYE A;  4X66 I;  2UUB I;  2L2M A;  2B7T A;  4DUY E;  1GQE A;  4MYT A;  2V2Z A;  4DPW A;  1WUU A;  2NUG A;  1ZM4 A;  2UXC I;  4X62 I;  1OJ4 A;  1U2R A;  4LFC I;  4MYU A;  2RSM A;  1T4N A;  4FW9 A;  5IT9 Q;  1B62 A;  3J80 Q;  1IBM I;  1UHZ A;  5FLX Q;  1N36 I;  4LF6 I;  2EFG A;  2KHX A;  4DV6 I;  4HXZ A;  2BM0 A;  2Q2E B;  5IT9 C;  4DPY A;  4YY3 E;  1T4L B;  1N33 E;  4DR1 I;  1IBK I;  4DKK A;  1T4O A;  1Z0V A;  1FKA E;  4I3H A;  2A2D A;  3ZZU A;  1N0U A;  4OX9 E;  2J7K A;  3QT6 A;  4JYA I;  3ZKD A;  4DR6 I;  2JVA A;  2E1R A;  2UXC E;  2LRS A;  4DUZ I;  1J5E I;  1MG7 A;  2L33 A;  2LUQ A;  4USM A;  4KHP I;  2JY9 A;  2HKJ A;  2V2V A;  2IHR 1;  1XNR I;  4JI4 I;  1A6F A;  4JI0 I;  1X47 A;  2LTS A;  3ZM7 A;  1YYO A;  1EA6 A;  2V2Q A;  3M6A A;  4DPU A;  2RS6 A;  1FWL A;  4X66 E;  4HY1 A;  2L2K B;  4DUY I;  1N36 E;  1EKZ A;  1XMO E;  1YYW A;  3B8H A;  2VQE E;  4DR7 E;  5A2Q Q;  2B7V A;  4JV5 E;  2UXB I;  2LJH A;  4NXM I;  1EI1 A;  2GS8 A;  4X65 E;  4DV2 I;  1ZM3 A;  4DUZ E;  4FN5 A;  2ZBK B;  4DR4 E;  3K17 A;  4DV5 I;  5GME A;  4UTG A;  1XNR E;  4M1K A;  4X64 E;  3OTO E;  4JI7 E;  1HNZ E;  1VIS A;  1H7S A;  2L3C A;  3T1Y E;  4K0K I;  2HK2 A;  4DV0 I;  4B3M E;  4USK A;  1B63 A;  2UXD I;  4LFA E;  3LTO A;  4JI6 E;  2LJP A;  1ZXM A;  2EZ6 A;  4HAC B;  1HNX I;  1KKH A;  1Z0B A;  1Z0W A;  4DV1 E;  2B3T B;  4AQY I;  2XEX A;  1PIE A;  2HFU A;  3J81 C;  2YT4 A;  2BV3 A;  2HK3 A;  3HUL A;  3QT8 A;  2LTR A;  4DR3 E;  4JG4 A;  1I94 I;  4DR4 I;  1HNW E;  4JI4 E;  2N3H A;  4ED4 A;  4UT4 A;  1HR0 I;  1X48 A;  3GON A;  2NPF A;  2R3V A;  4PRX A;  1ZXN A;  1N32 E;  1XMO I;  4DR5 I;  4JI2 I;  2VF3 A; 
#chains in the Genus database with same CATH topology
 2KON A;  4NXM E;  1H72 C;  3ZZ0 A;  1X6F A;  1N34 E;  4Z7Y A;  3EPL A;  1YYK A;  4ZVI A;  4X62 E;  2YWQ A;  5BR8 I;  3P3E A;  1EH6 A;  4O5G A;  2EOI A;  1IQS A;  4K0K E;  4GQU A;  2J65 A;  4Q35 B;  2DMY A;  1ZBQ A;  4LU9 A;  4B3R I;  1KJK A;  2F4V E;  4R2C A;  4BBY A;  2BA0 D;  2UXD E;  3U1K A;  3PS3 A;  3OTO I;  1SR9 A;  1N3G A;  2EMI A;  2JYA A;  4R2Q A;  1HNZ I;  3M85 G;  4GKJ I;  1RRE A;  2WP8 B;  2F8B A;  2JXP A;  1WRJ A;  3TQM A;  5C0X F;  1IMU A;  5KL5 A;  1UEK A;  2PNZ A;  2EM9 A;  1EH8 A;  2YTJ A;  4B3M I;  2N3G A;  1MX0 A;  4DV6 E;  4HAC A;  4MQY A;  4DV4 I;  2CZ9 A;  4FW3 A;  2V88 A;  2EOJ A;  2J7J A;  1H74 A;  4QNK A;  3V2U C;  5LL6 R;  2DIX A;  2EMZ A;  2HHH I;  3AUZ A;  1UIL A;  4F2J C;  1P47 A;  3PYF A;  3Q6M A;  3KZZ A;  3QT5 A;  4YHH I;  4LFB I;  1HNX E;  4M9V C;  3C4B A;  4DU8 A;  3K1J A;  1A1H A;  4LF5 E;  4DV1 I;  3QG5 C;  4RHB B;  4LFA I;  1UDQ A;  4URL A;  2EN4 A;  2EMG A;  2V8Q B;  4LF7 E;  4LFC E;  4WFT A;  4DPT A;  5AC5 A;  3UHM A;  5GMD A;  2EPX A;  2RTX A;  4B3T I;  1J26 A;  4NXN I;  1O0W A;  1PKP A;  2EM4 A;  1BKN A;  1NCS A;  4WSP A;  2DLK A;  2FGG A;  4BMJ A;  1N34 I;  4BC7 A;  5F3W A;  4GKK E;  2WBT A;  1JK1 A;  5LMU I;  2X7I A;  1Z0G A;  4TUI A;  4YY3 I;  1IBM E;  5AE3 A;  1G2F C;  3KRN A;  2F4V I;  4LOM A;  3B4T A;  4LF6 E;  2JPA A;  2EPO A;  1YH8 A;  2GHF A;  2L3J A;  2EJ4 A;  1Z0E A;  2BBG A;  1DI2 A;  1J5E E;  3HXL A;  3ADL A;  2EN1 A;  2V8P A;  2BA0 G;  2JR1 A;  2Q8U A;  2MDR A;  4IZK A;  1YSA C;  3JAM Q;  4IFD F;  5K36 D;  3F6G A;  5T6J A;  3PS2 A;  1ZBT A;  2JWO A;  2UUC I;  2EMF A;  3T1H E;  1Z0T A;  3F0N A;  1RC7 A;  3ADJ A;  3M7N G;  1G2D C;  1X6H A;  1XNQ E;  4F6N A;  1XMQ E;  2UUA E;  1S4E A;  2LV2 A;  2C37 B;  2EMW A;  2GO4 A;  1ZR9 A;  2WNR B;  4DU7 A;  5DNL A;  2DEI A;  2BB8 A;  3ECR A;  5K36 A;  3J80 C;  2EPK X;  3M85 D;  2EOH A;  2WW4 A;  5FLX C;  2ZM6 E;  2EPU A;  3THO B;  4NXN E;  4F54 A;  3HPZ A;  5DRO A;  3HPS A;  4X65 I;  3THN A;  3MSW A;  4J8Z A;  4JI8 I;  5JEA B;  2E5L I;  1FI4 A;  2EN8 A;  3B82 A;  1F2I G;  2JE6 A;  2MKD A;  5L3J A;  2HHH E;  5LMN E;  4KWY A;  3KWR A;  4DV7 E;  2EN2 A;  4JI0 E;  1BBG A;  2O1T A;  4DXL A;  2WBS A;  4IFD A;  1LLM C;  4LF5 I;  2UU9 I;  2YSO A;  2RSI A;  1N0V C;  1NHH A;  4DV3 E;  4YHH E;  2VE7 C;  2LMZ A;  2UXB E;  1HK7 A;  4XTJ A;  3VK6 A;  5AC4 A;  2ENA A;  3Q6N A;  2PNM A;  3ZKB A;  2EQ3 A;  2AE8 A;  4JI6 I;  4B3S I;  1K47 A;  1RR9 A;  2MDG A;  3BID A;  3HTX A;  4B3T E;  4BHC A;  4L8N A;  4DV5 E;  2M9A A;  5CFF E;  2EML A;  1Z0C A;  5IXM B;  4M2Z A;  2BA1 G;  2NAB A;  1A1L A;  1QU6 A;  3ZZT A;  4GKK I;  4JI8 E;  1UN6 B;  3MHS C;  4P7D A;  4F6M A;  4JI1 E;  2C37 A;  2EOZ A;  1UDS A;  1NHI A;  4M30 A;  2G7H A;  4L5N C;  4WSG A;  2DB2 A;  4IZJ B;  2YU5 A;  2YTD A;  2BM1 A;  2N8X A;  2JOX A;  4F9C B;  2CT1 A;  2CVE A;  3T1H I;  1FJG I;  1S16 A;  3M99 B;  2LUP B;  1XNQ I;  2NN6 D;  4DPX A;  5AE2 A;  2M1S A;  4LCH A;  3WU5 A;  2EM7 A;  1KIJ A;  1N33 I;  4DV3 I;  2CPN A;  2EOY A;  2UUC E;  2EOQ A;  4OO1 D;  4FWH A;  1H73 A;  2NN6 A;  3ADI A;  2CGE A;  1YPN A;  1WHN A;  1R6L A;  3P1X A;  1X3C A;  4ZYH A;  4B3S E;  4R2R A;  1IBL E;  5A6B D;  1A1G A;  4OO1 B;  1PVG A;  3H4L A;  4JYA E;  4OX9 I;  2RS7 A;  4BA2 A;  2EPR A;  2YTP A;  1KTV A;  3PYG A;  4DV7 I;  3B78 A;  2YPN A;  2GPI A;  1OYS A;  4AQY E;  5AE1 A;  1WJP A;  2EM8 A;  1STU A;  4X8W A;  1FWK A;  4JI3 E;  5A2Q C;  5KL4 A;  1KVK A;  3JAM C;  4HTG A;  1Z5B A;  1ELO A;  1X5W A;  2EM5 A;  1BB8 A;  4JI1 I;  4DR3 I;  2L6M A;  3UK3 C;  2EPA A;  4B3R E;  2NA2 A;  4NZV A;  1AAY A;  3U1Y A;  2YTE A;  2BA1 D;  4HYM A;  2IER A;  2L2N A;  2ODR D;  4DR5 E;  2DEJ A;  2C39 A;  2YTF A;  3BGH A;  4WX9 A;  3J7Y p;  4DV4 E;  3J7A G;  1ZM9 A;  1E3P A;  1B69 A;  1Y4S A;  4LF9 I;  4MLQ A;  1XHK A;  4IZK B;  2LE2 A;  4OO1 C;  4LFB E;  2IOP A;  4RPF A;  3V5R A;  5KL3 A;  2H36 X;  4P7A A;  1UDO A;  2NUF A;  3J81 Q;  5IV8 B;  5JEA D;  4LF4 E;  3RMP A;  4OOG C;  1Y4U A;  3H09 A;  4GKJ E;  1Z5A A;  4LF8 E;  4FWG A;  4FWD A;  1D6T A;  2EE8 A;  2R1F A;  4FW7 A;  2YZT A;  1X49 A;  2M4I A;  3LLH A;  1NHJ A;  2A2C A;  3C4T A;  1UDN A;  3GLL A;  3LNU A;  4Z7C A;  2LT7 A;  4JI5 E;  4R2P A;  2FTX B;  4PU9 A;  2O1V A;  3L00 A;  4DV2 E;  2HFS A;  3JU0 A;  1A1F A;  2EMY A;  5LMU E;  2PO0 A;  4IZJ D;  4O43 A;  2GLI A;  1YHC A;  4JV5 I;  1USV A;  1RQ0 A;  2ENH A;  1ZAA C;  2NN6 B;  2ODR C;  2I9I A;  3EQ1 A;  4HEI A;  4DMI A;  2MKN A;  1E3H A;  3WU6 A;  1NEI A;  5K36 B;  2PO2 A;  4JI3 I;  2VES A;  1PJS A;  4QNJ A;  2BR2 A;  3CWV A;  4IFD B;  3Q1Q A;  2X36 A;  4BA2 B;  2EP3 A;  2EL5 A;  1RHY A;  5ELW A;  2WBU A;  2HKE A;  3WU3 A;  2EMK A;  2V86 A;  3K6Q A;  1FNM A;  4DV0 E;  4WUD A;  4ZYD A;  1ZM2 A;  2VQE I;  5JEA E;  4DR7 I;  4AID A;  3LPS A;  2EN6 A;  1QNT A;  1VI7 A;  4LF7 I;  3BF2 A;  1IBL I;  3T1Y I;  4LF9 E;  1RMD A;  2VQF I;  1GTK A;  3DF6 A;  4DR2 E;  4TUG A;  4LTY A;  2EM0 A;  2LBS B;  3P76 A;  3QT7 A;  2EPN A;  3CDJ A;  4NHR A;  1OYP A;  4X64 I;  3GCM A;  1PDA A;  4R2A A;  3L7Z A;  2YTN A;  4LF4 I;  4FK5 C;  3VYX A;  2YRK A;  1A1J A;  3J7A M;  1Z1B A;  1MEY C;  3K85 A;  5DNY A;  4WUB A;  2V34 A;  4OO1 E;  2DSY A;  3WU4 A;  2YU8 A;  1SFE A;  2ZM6 I;  1TN9 A;  1UBD C;  2O1W A;  1I94 E;  4KQV A;  2JEB B;  5LMN I;  2WNR A;  2Z5B A;  3EPH A;  3FIG A;  3PYD A;  4LCG A;  3D4J A;  4R1F A;  4JI7 I;  1BBO A;  3LML A;  3ADG A;  5A6K A;  3IWB A;  1XMQ I;  2EPZ A;  3F6H A;  2ZIT A;  3P06 A;  1HR0 E;  5IWA I;  2R42 A;  2UUA I;  5C0X A;  2PO0 B;  2UUB E;  3PS1 A;  4DR1 E;  2JE6 B;  2HC5 A;  1H7U A;  1N32 I;  1YUJ A;  1MU5 A;  4WYQ B;  2OI2 A;  3CDI A;  4JI5 I;  2B9D A;  1AH5 A;  2C38 B;  4N4R B;  1KYQ A;  4GEQ B;  3VYY A;  2E5L E;  4PRV A;  5C0X D;  2EMA A;  4LF8 I;  5BR8 E;  4P52 A;  4WPY A;  3JTZ A;  1Z59 A;  4MU3 A;  2VQF E;  2GQ0 A;  4P78 A;  4I8O A;  2NUE A;  2O1U A;  2EOO A;  5EKW A;  1HNW I;  5K36 F;  1WXR A;  5KL7 A;  1YZ9 A;  1WHQ A;  4MDT A;  2VRD A;  2EWL A;  5A6A A;  2AJ4 A;  4WUC A;  3DJW A;  5DNX A;  3IWC A;  3H1C A;  4OKG A;  1A1K A;  4KHP E;  4MU1 A;  2EM3 A;  4F9A B;  3OML A;  3ZOQ B;  1IBK E;  4DR6 E;  1QZR A;  1Z5C A;  4DR2 I;  2E1M A;  4EMD A;  2RQL A;  2LO3 A;  4JI2 E;  2DMI A;  2R76 A;  1FJG E;  1NZ0 A;  4BCA A;  1X6E A;  2UU9 E;  2GO3 A;  4N3O A;  1DAR A;  2RPC A;  1IQO A;  1MGT A;  5IWA E;  2IES A;  1PJQ A;  2PNL A;  3PYE A;  4X66 I;  4RH8 A;  2YSP A;  2UUB I;  4MLV A;  2L2M A;  2B7T A;  4DUY E;  1GQE A;  2EM6 A;  2EQ0 A;  2WP8 A;  4MYT A;  2V2Z A;  4DPW A;  1WUU A;  1R6M A;  2NUG A;  2JEB A;  1ZM4 A;  2ELZ A;  2UXC I;  4KZS A;  4GZN C;  5A6J A;  4X62 I;  2V89 A;  2LCE A;  1OJ4 A;  2VF1 A;  1U2R A;  2IOQ A;  4MYU A;  4R2D A;  2RSM A;  1Y6Z A;  1T4N A;  4LFC I;  2CTD A;  5JEA C;  4BS9 A;  4OZE A;  2JT2 A;  1Y5Y A;  5A69 A;  4R2E A;  4FW9 A;  5LLQ A;  5KL6 A;  5IT9 Q;  4IFD D;  5DRQ A;  3HKM A;  2EL4 A;  4IS9 A;  2V85 A;  2C38 A;  2CG9 A;  1B62 A;  2EMC A;  1P42 A;  3J80 Q;  1IBM I;  1UHZ A;  3KZY A;  5FLX Q;  1N36 I;  4LF6 I;  2PRT A;  2EFG A;  2KHX A;  2EN7 A;  4DV6 I;  2DRP A;  4HXZ A;  2BM0 A;  2WCC 3;  4IS1 C;  2Q2E B;  3C6K A;  5IT9 C;  4DPY A;  4YY3 E;  2EOM A;  1T4L B;  1N33 E;  4DR1 I;  2EQ1 A;  3P3G A;  1IBK I;  4DKK A;  2O3Z A;  4U3D A;  1DQ3 A;  2EPC A;  2D9H A;  2YTO A;  1T4O A;  1Z0V A;  1FKA E;  4I3H A;  2A2D A;  5EL9 A;  3P3C A;  3ZZU A;  4X9J A;  1N0U A;  1GZ6 A;  4LPF A;  1T38 A;  4AM3 A;  2EMH A;  2EOR A;  4OX9 E;  2J7K A;  3C6M A;  3QT6 A;  4O24 A;  3ZKD A;  4JYA I;  2JP9 A;  4DR6 I;  2JVA A;  2E1R A;  2LJU A;  3HQ1 A;  2UXC E;  2EMX A;  2LRS A;  4OO1 F;  4FW6 A;  4DUZ I;  5C0X E;  3HJC A;  1J5E I;  2EL6 A;  5ADZ A;  3BBG A;  1MG7 A;  2L33 A;  2LUQ A;  4USM A;  4KHP I;  2JY9 A;  2HGH A;  1L4S A;  2HKJ A;  2V2V A;  2F1D A;  2IHR 1;  1XNR I;  4JI4 I;  1A6F A;  2DLQ A;  4J3D A;  4JI0 I;  1X47 A;  1EH7 A;  1T39 A;  2LVH A;  2DGC A;  2LTS A;  2PNZ B;  2EPL X;  3ZM7 A;  1YYO A;  1EA6 A;  5C0X B;  2V2Q A;  1PJT A;  2ADR A;  3M6A A;  4DPU A;  2PO1 A;  2RS6 A;  1FWL A;  4R2S A;  4X66 E;  4MU0 A;  4HY1 A;  2EN3 A;  2L2K B;  4DUY I;  2EMB A;  2YRH A;  1N36 E;  1EKZ A;  2KOU A;  2MC5 A;  1XMO E;  2L92 A;  1YYW A;  2Z5C B;  1JK2 A;  2M7Q A;  2EOF A;  1A1I A;  2VQE E;  4DR7 E;  2YTQ A;  2B7V A;  3B8H A;  5A2Q Q;  1ZU1 A;  3NZK A;  3AV0 A;  3PRY A;  4JV5 E;  2UXB I;  4OO1 A;  3M7N D;  2NN6 F;  2LJH A;  3IWD A;  4IJD A;  1YUI A;  1EI1 A;  2GS8 A;  4AIM A;  4BA1 A;  4X65 E;  5C0X C;  4NXM I;  4DV2 I;  1YFH A;  5FWK A;  2V83 A;  4R03 A;  1ZM3 A;  4DUZ E;  2NN6 E;  5DRR A;  5A6B A;  5K36 E;  4FN5 A;  2ZBK B;  4O4K A;  4DR4 E;  3K17 A;  4DV5 I;  5GME A;  4FW5 A;  2C39 B;  4UTG A;  5AAS A;  1XNR E;  2FV4 B;  2V87 A;  3EPJ A;  5TSE A;  4M1K A;  4X64 E;  3OTO E;  4U3B A;  5K36 C;  2NN6 C;  4JI7 E;  2L8T A;  1HNZ E;  1VIS A;  4R8O A;  2HJJ A;  5KL2 A;  2EM2 A;  2K7I A;  2L3C A;  1H7S A;  4M0V A;  2YTI A;  3T1Y E;  2I13 A;  4ZYG A;  3GME A;  4K0K I;  2EOX A;  2HK2 A;  2EPM X;  4DV0 I;  2JOB A;  4B3M E;  3L7Z B;  4USK A;  4IFD E;  1B63 A;  2YRM A;  3EPK A;  2E72 A;  2UXD I;  4LFA E;  2Z5B B;  4JI6 E;  3LTO A;  2LJP A;  2A25 A;  2Z5E A;  1ZXM A;  4ISA A;  4IZJ A;  5DRP A;  4Q28 A;  2EZ6 A;  4HAC B;  1HNX I;  1KKH A;  2MC6 A;  4F9B B;  4NBQ A;  4ZYE A;  1Z0B A;  1Z0W A;  5JEA A;  4DV1 E;  2B3T B;  4AQY I;  2ELY A;  4WXD A;  1XXE A;  1Y60 A;  2ENC A;  2XEX A;  2PO1 B;  4BHB A;  3J81 C;  1PIE A;  2HFU A;  2YT4 A;  2BV3 A;  2HK3 A;  3HUL A;  2EPP A;  1USU A;  3QT8 A;  2YTG A;  4FW4 A;  4WXC A;  2LTR A;  4BC9 A;  4DR3 E;  1OYR A;  4JG4 A;  1HNW E;  4JI4 E;  2Z5C A;  3DD6 A;  1I94 I;  4DR4 I;  3MHH C;  2K4V A;  1TF3 A;  1TF6 A;  2N3H A;  1DGC A;  2PO2 B;  5JEA F;  4IFD C;  2EOS A;  2JEA A;  4ED4 A;  4MU4 A;  3VHT B;  2WZO A;  4BA1 B;  4UT4 A;  1HR0 I;  2JEA B;  1X48 A;  2CSH A;  3GON A;  2NPF A;  2R3V A;  2BR2 B;  4PRX A;  1ZXN A;  4LCF A;  1N32 E;  1XMO I;  4DR5 I;  4JI2 I;  2VF3 A;  2EOE A; 
#chains in the Genus database with same CATH homology
 2KON A;  4NXM E;  1H72 C;  3ZZ0 A;  1N34 E;  4Z7Y A;  1YYK A;  4ZVI A;  4X62 E;  5BR8 I;  4K0K E;  2DMY A;  1ZBQ A;  4LU9 A;  4B3R I;  2F4V E;  4BBY A;  2UXD E;  3OTO I;  1SR9 A;  1HNZ I;  4GKJ I;  1RRE A;  2F8B A;  1UEK A;  4B3M I;  2N3G A;  1MX0 A;  4DV6 E;  4HAC A;  4DV4 I;  2CZ9 A;  2V88 A;  1H74 A;  3V2U C;  5LL6 R;  2DIX A;  2HHH I;  3AUZ A;  1UIL A;  3Q6M A;  3PYF A;  4YHH I;  3QT5 A;  4LFB I;  1HNX E;  3C4B A;  4DU8 A;  3K1J A;  4LF5 E;  4DV1 I;  4LFA I;  4URL A;  2V8Q B;  4LF7 E;  4LFC E;  4WFT A;  4DPT A;  5GMD A;  2RTX A;  4B3T I;  1J26 A;  4NXN I;  1O0W A;  1PKP A;  1BKN A;  4WSP A;  4BMJ A;  2FGG A;  1N34 I;  4BC7 A;  5F3W A;  4GKK E;  5LMU I;  2X7I A;  1Z0G A;  4TUI A;  4YY3 I;  1IBM E;  5AE3 A;  2F4V I;  4LF6 E;  2L3J A;  1Z0E A;  1DI2 A;  1J5E E;  3HXL A;  3ADL A;  2V8P A;  2JR1 A;  4IZK A;  2MDR A;  3JAM Q;  3F6G A;  5T6J A;  1ZBT A;  2JWO A;  2UUC I;  1Z0T A;  3T1H E;  3F0N A;  1RC7 A;  3ADJ A;  1XNQ E;  1XMQ E;  2UUA E;  1S4E A;  4DU7 A;  2DEI A;  3J80 C;  2WW4 A;  5FLX C;  2ZM6 E;  4NXN E;  4F54 A;  3HPZ A;  3HPS A;  4X65 I;  3MSW A;  4J8Z A;  4JI8 I;  2E5L I;  1FI4 A;  3B82 A;  5L3J A;  2HHH E;  5LMN E;  3KWR A;  4DV7 E;  4JI0 E;  2O1T A;  4DXL A;  4LF5 I;  2UU9 I;  1N0V C;  1NHH A;  4DV3 E;  4YHH E;  2VE7 C;  2LMZ A;  2UXB E;  1HK7 A;  4XTJ A;  3VK6 A;  3Q6N A;  2PNM A;  3ZKB A;  4JI6 I;  4B3S I;  1K47 A;  1RR9 A;  3HTX A;  4B3T E;  4L8N A;  4DV5 E;  5CFF E;  1Z0C A;  4M2Z A;  1QU6 A;  3ZZT A;  4GKK I;  4JI8 E;  4P7D A;  4JI1 E;  1NHI A;  4M30 A;  2G7H A;  4L5N C;  2DB2 A;  4IZJ B;  2BM1 A;  2JOX A;  4F9C B;  3T1H I;  1FJG I;  1S16 A;  2LUP B;  1XNQ I;  4DPX A;  5AE2 A;  2M1S A;  3WU5 A;  1KIJ A;  1N33 I;  4DV3 I;  2CPN A;  2UUC E;  4FWH A;  1H73 A;  3ADI A;  2CGE A;  1WHN A;  3P1X A;  4B3S E;  1IBL E;  1PVG A;  3H4L A;  4JYA E;  4OX9 I;  2RS7 A;  1KTV A;  3PYG A;  4DV7 I;  3B78 A;  4AQY E;  5AE1 A;  4X8W A;  1STU A;  1FWK A;  4JI3 E;  5A2Q C;  1KVK A;  3JAM C;  1Z5B A;  1ELO A;  4JI1 I;  4DR3 I;  2L6M A;  4B3R E;  2NA2 A;  4HYM A;  2L2N A;  2ODR D;  4DR5 E;  2DEJ A;  3J7Y p;  4DV4 E;  3J7A G;  1ZM9 A;  1Y4S A;  4LF9 I;  1XHK A;  4IZK B;  2LE2 A;  4LFB E;  2IOP A;  4RPF A;  3V5R A;  2H36 X;  4P7A A;  2NUF A;  3J81 Q;  4LF4 E;  3RMP A;  4OOG C;  1Y4U A;  3H09 A;  4GKJ E;  1Z5A A;  4LF8 E;  4FWG A;  4FWD A;  1D6T A;  2YZT A;  1X49 A;  2M4I A;  3LLH A;  1NHJ A;  2A2C A;  3C4T A;  4Z7C A;  3LNU A;  4JI5 E;  2FTX B;  4PU9 A;  2O1V A;  4DV2 E;  2HFS A;  3JU0 A;  5LMU E;  4IZJ D;  4JV5 I;  1USV A;  1RQ0 A;  2ODR C;  4DMI A;  3WU6 A;  4JI3 I;  3CWV A;  3Q1Q A;  2X36 A;  2HKE A;  3WU3 A;  2V86 A;  3K6Q A;  1FNM A;  4DV0 E;  4WUD A;  1ZM2 A;  2VQE I;  4DR7 I;  3LPS A;  4LF7 I;  1IBL I;  3T1Y I;  4LF9 E;  2VQF I;  3DF6 A;  4DR2 E;  4TUG A;  4LTY A;  2LBS B;  3QT7 A;  4X64 I;  4LF4 I;  3VYX A;  3J7A M;  3K85 A;  5DNY A;  4WUB A;  2V34 A;  2DSY A;  3WU4 A;  2ZM6 I;  5LMN I;  4KQV A;  2O1W A;  1I94 E;  2Z5B A;  3FIG A;  3PYD A;  4R1F A;  3D4J A;  4JI7 I;  3LML A;  3ADG A;  3IWB A;  1XMQ I;  3P06 A;  3F6H A;  2ZIT A;  5IWA I;  1HR0 E;  2UUA I;  2R42 A;  2UUB E;  4DR1 E;  1H7U A;  1N32 I;  1MU5 A;  4WYQ B;  2OI2 A;  4JI5 I;  2B9D A;  4GEQ B;  3VYY A;  2E5L E;  4PRV A;  4LF8 I;  5BR8 E;  4P52 A;  4WPY A;  3JTZ A;  1Z59 A;  2VQF E;  2GQ0 A;  4P78 A;  4I8O A;  2NUE A;  2O1U A;  1HNW I;  1WXR A;  1YZ9 A;  1WHQ A;  2EWL A;  2AJ4 A;  4WUC A;  3DJW A;  3IWC A;  4KHP E;  4DR2 I;  4F9A B;  1QZR A;  3OML A;  3ZOQ B;  1IBK E;  4DR6 E;  1Z5C A;  2E1M A;  4EMD A;  4JI2 E;  1FJG E;  1NZ0 A;  4N3O A;  4BCA A;  2UU9 E;  1DAR A;  5IWA E;  2PNL A;  3PYE A;  4X66 I;  2UUB I;  2L2M A;  2B7T A;  4DUY E;  1GQE A;  4MYT A;  2V2Z A;  4DPW A;  1WUU A;  2NUG A;  1ZM4 A;  2UXC I;  4KZS A;  4X62 I;  2V89 A;  1OJ4 A;  2VF1 A;  1U2R A;  2IOQ A;  4MYU A;  1Y6Z A;  2RSM A;  4LFC I;  1T4N A;  4BS9 A;  4FW9 A;  5IT9 Q;  2V85 A;  2CG9 A;  1B62 A;  3J80 Q;  1IBM I;  1UHZ A;  5FLX Q;  1N36 I;  4LF6 I;  2EFG A;  2KHX A;  4DV6 I;  4HXZ A;  2BM0 A;  2Q2E B;  5IT9 C;  4DPY A;  4YY3 E;  1T4L B;  1N33 E;  4DR1 I;  1IBK I;  4DKK A;  1DQ3 A;  1T4O A;  1Z0V A;  1FKA E;  4I3H A;  2A2D A;  3ZZU A;  1N0U A;  1GZ6 A;  4OX9 E;  2J7K A;  3QT6 A;  4JYA I;  3ZKD A;  4DR6 I;  2JVA A;  2E1R A;  3HQ1 A;  2UXC E;  2LRS A;  4DUZ I;  3HJC A;  1J5E I;  1MG7 A;  5ADZ A;  2L33 A;  2LUQ A;  4USM A;  4KHP I;  2JY9 A;  2HKJ A;  2V2V A;  2IHR 1;  1XNR I;  4JI4 I;  1A6F A;  4JI0 I;  1X47 A;  2LTS A;  3ZM7 A;  1YYO A;  1EA6 A;  2V2Q A;  3M6A A;  4DPU A;  2RS6 A;  1FWL A;  4X66 E;  4HY1 A;  2L2K B;  4DUY I;  1N36 E;  1EKZ A;  2KOU A;  2MC5 A;  1XMO E;  2L92 A;  1YYW A;  2Z5C B;  2M7Q A;  3B8H A;  2VQE E;  4DR7 E;  5A2Q Q;  2B7V A;  3PRY A;  3AV0 A;  4JV5 E;  2UXB I;  2LJH A;  3IWD A;  4NXM I;  1EI1 A;  2GS8 A;  4X65 E;  4DV2 I;  5FWK A;  2V83 A;  4R03 A;  1ZM3 A;  4DUZ E;  4FN5 A;  2ZBK B;  4DR4 E;  3K17 A;  4DV5 I;  5GME A;  4UTG A;  5AAS A;  1XNR E;  2FV4 B;  2V87 A;  4M1K A;  4X64 E;  3OTO E;  4JI7 E;  2L8T A;  1HNZ E;  1VIS A;  4R8O A;  1H7S A;  2L3C A;  4M0V A;  3T1Y E;  4K0K I;  2HK2 A;  4DV0 I;  2JOB A;  4B3M E;  4USK A;  1B63 A;  2UXD I;  4LFA E;  2Z5B B;  4JI6 E;  3LTO A;  2LJP A;  2Z5E A;  1ZXM A;  4IZJ A;  4Q28 A;  2EZ6 A;  4HAC B;  1HNX I;  1KKH A;  2MC6 A;  4F9B B;  1Z0B A;  1Z0W A;  4DV1 E;  2B3T B;  4AQY I;  2XEX A;  1PIE A;  3J81 C;  2HFU A;  2YT4 A;  2BV3 A;  2HK3 A;  3HUL A;  1USU A;  3QT8 A;  4BC9 A;  2LTR A;  4DR3 E;  4JG4 A;  1I94 I;  4DR4 I;  1HNW E;  4JI4 E;  2Z5C A;  2K4V A;  2N3H A;  4ED4 A;  4UT4 A;  2WZO A;  1HR0 I;  1X48 A;  3GON A;  2NPF A;  2R3V A;  4PRX A;  1ZXN A;  1N32 E;  1XMO I;  4DR5 I;  4JI2 I;  2VF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...