1XNQE

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnqE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnqE02
4DV7I 1FKAE 4B3SE 4Z7YA 4FWGA 3K1JA 2LJHA 3V5RA 1ZXMA 4JV5E 5IT9C 4LF8I 3ZKBA 3PYDA 4LF4I 1KIJA 4JI6E 1EKZA 1RR9A 4KHPI 1X49A 1FJGE 2UUCE 4WUDA 1J5EI 2LTRA 1RC7A 4LFAI 5GMDA 3C4BA 3ZZTA 1VISA 4X65I 1GQEA 3ZKDA 4FN5A 4HYMA 3HTXA 4ED4A 3T1HI 3ZZ0A 1H7SA 2B3TB 1T4OA 1NHHA 4LF7E 1OJ4A 3B8HA 4DUZI 3J81C 4DR7I 2E1RA 2HKJA 2JY9A 1Z0BA 4X62I 5GMEA 4FWDA 2R42A 1PVGA 1XNRE 1FI4A 3OTOE 2UU9I 4WFTA 4M30A 1HNWI 4JI8E 4LFBI 2CPNA 3M6AA 2L3JA 1IBME 4LFCI 1WHNA 4DV2E 4YY3E 4DR5I 4DV3I 3WU3A 3LTOA 2L2NA 2ZM6I 4YHHE 4DV4E 1XMOI 4DR4E 4DV1E 1Z0VA 1PKPA 1MG7A 4JI5E 2DMYA 2IHR1 2R3VA 1STUA 1N34I 2VF3A 2DEIA 2HK3A 1ZM4A 1YZ9A 4ZVIA 1DARA 1XNQI 2EZ6A 4JI7E 1Z0GA 2NUGA 2E5LE 2HHHI 1MX0A 1H74A 4DV5I 1HNXI 3ADIA 5BR8E 4DU7A 2GS8A 1I94I 4X64I 2V34A 1XHKA 4DR3E 1A6FA 4NXMI 2Q2EB 4B3RE 4LF8E 4OOGC 1N33I 4LF4E 2F4VI 4DR6I 4PU9A 4UT4A 4KHPE 1ELOA 2OI2A 4JG4A 4JI4I 1T4NA 1NHIA 2B7TA 4LFAE 1H7UA 4LF9E 4USKA 1RREA 1Z5BA 5LMNI 4DPXA 3J80Q 1O0WA 4X65E 1N36I 2LUQA 2CZ9A 1XMQI 3T1HE 4AQYI 4RPFA 1B62A 4HACB 5CFFE 4X66I 4WUCA 4MYUA 2LBSB 4DV6I 1RQ0A 4FW9A 1J26A 4LF6I 3PYGA 1YYKA 3ZZUA 3VYYA 4M1KA 4GKJI 5LMUI 1ZM3A 4K0KI 1X47A 1HR0I 2UU9E 2UXBE 1IBLE 1MU5A 2VQEI 1FWLA 1UILA 1UEKA 4LFBE 4M2ZA 3QT6A 5IWAE 4NXNI 5FLXQ 3ZM7A 4LFCE 4DR2E 4DR5E 1D6TA 4DV3E 4DR1E 2ZM6E 3LLHA 3B78A 3LPSA 3PYEA 1Z0CA 1N34E 4JI1I 3WU6A 1KVKA 1XNQE 3J7Yp 2LTSA 4DV0E 3JAMQ 4DV5E 1UHZA 2UUBI 4B3SI 4X64E 4GKKI 4XTJA 2X36A 2RSMA 4B3ME 2LUPB 3J7AG 1IBKI 4DPWA 2UXDE 4JI2I 4PRVA 3P1XA 2HKEA 1N33E 2UXCE 2YT4A 2UUCI 3F0NA 2DB2A 4DUYI 2L3CA 1KKHA 1QU6A 2MDRA 3ADJA 3WU5A 5LMNE 2LRSA 2VQFE 3QT7A 1H73A 3J80C 2A2DA 1PIEA 1HNZI 1FNMA 2X7IA 2V8PA 1T4LB 4X66E 4LF7I 4LF5I 1KTVA 4DV7E 2L2KB 2EFGA 4EMDA 1ZM2A 4DV6E 2ZBKB 4HXZA 4LF6E 2V2QA 4PRXA 2WW4A 5LMUE 4KQVA 3D4JA 3QT8A 3HULA 1J5EE 1N0VC 3ADGA 2BM0A 2XEXA 2VQEE 1B63A 4JI8I 1H72C 4NXNE 5FLXC 3J7AM 1EI1A 4JI0I 3LNUA 4URLA 4YY3I 1DI2A 4JI3I 1Z0TA 1X48A 4JYAI 4HACA 2UUAI 4DU8A 4YHHI 4DUZE 4DV4I 2B7VA 4DPYA 4DR4I 4USMA 4DR7E 4DV1I 4JI5I 2L2MA 1FWKA 4P52A 4OX9I 2V2VA 4X62E 4JI1E 4DPUA 2HK2A 4JI7I 2E5LI 1WHQA 3JAMC 5A2QQ 5BR8I 3K17A 5LL6R 2UUBE 2NA2A 1BKNA 4GKKE 3VYXA 1HNWE 4DPTA 1N32I 3T1YI 4DR3I 1Z5CA 1IBKE 4JI2E 4B3RI 2N3HA 1XMOE 2RTXA 1Z0WA 1EA6A 4B3TI 4DUYE 3PYFA 4LF9I 1S16A 2DEJA 1HNZE 2HHHE 1HNXE 1QZRA 4X8WA 1I94E 4LF5E 2BV3A 4DKKA 2NPFA 2LJPA 2HFSA 2NUEA 1NHJA 5IT9Q 4JV5I 4NXME 1Z59A 1ZBTA 1ZM9A 2F4VE 4DR6E 4JI6I 2ZITA 1FJGI 4WUBA 4JI4E 2UXBI 1IBLI 2BM1A 3B82A 5IWAI 1N36E 1U2RA 4DR2I 4JI0E 4JI3E 4I3HA 3Q1QA 1YYWA 1XMQE 4AQYE 4DR1I 4JYAE 2UUAE 3J81Q 3H4LA 4Z7CA 3ADLA 2L33A 1S4EA 4OX9E 1Z0EA 2HFUA 4UTGA 5L3JA 4GKJE 1Z5AA 1ZXNA 4DXLA 4K0KE 3CWVA 1XNRI 4DV0I 1HR0E 2NUFA 3OTOI 4P7AA 5A2QC 3C4TA 2DIXA 2RS7A 2JVAA 1N0UA 2V2ZA 1N32E 3T1YE 4B3MI 1YYOA 1IBMI 2AJ4A 4DV2I 2UXDI 1K47A 3WU4A 3QT5A 1NZ0A 3V2UC 2UXCI 4R1FA 4B3TE 2RS6A 4HY1A 2J7KA 2KHXA 4MYTA 2VQFI 4WYQB 2A2CA 1WUUA 2N3GA 4FWHA 3GONA
chains in the Genus database with same CATH superfamily
4DV7I 1FKAE 4B3SE 2EOJA 2V87A 4Z7YA 3UHMA 1UDSA 2YTJA 4JI3I 4MQYA 2LE2A 4FWGA 3K1JA 2LJHA 3V5RA 4Q28A 1ZXMA 4JV5E 4F6MA 2LT7A 5IT9C 3TQMA 4LF8I 2YRKA 3ZKBA 2ADRA 4ZYGA 4IFDC 1E3PA 3PYDA 4LF4I 3M99B 1Y5YA 1KIJA 4JI6E 4GZNC 1EKZA 1RR9A 1X49A 1ZU1A 1FJGE 3P3CA 5JEAD 2G7HA 2UUCE 4WUDA 3M85G 1J5EI 2LTRA 4BA2A 4NBQA 4KZSA 1RC7A 1HK7A 4LFAI 2WP8B 2EMIA 2YU8A 2M9AA 2GLIA 2PNMA 2EM7A 5GMDA 3C4BA 3ZZTA 1VISA 3ZOQB 1PDAA 1L4SA 5JEAE 4X65I 4R03A 1GQEA 2Z5BB 3ZKDA 5C0XD 2VESA 2C37B 4FN5A 5LLQA 2EPOA 3HTXA 2JOXA 4HYMA 5JEAF 4ED4A 3T1HI 1IQSA 3ZZ0A 1H7SA 3DJWA 3FIGA 2B3TB 1T4OA 2KONA 4F9BB 1A1IA 4LF7E 4WXCA 1NHHA 1OJ4A 2LCEA 3B8HA 3CDIA 3J81C 2EE8A 4DUZI 4DR7I 2E1RA 4OO1A 5C0XE 3AUZA 1BBOA 2HKJA 2EQ3A 2JY9A 2IERA 1Z0BA 4LOMA 2MC6A 3HKMA 4X62I 4LCFA 4M9VC 5GMEA 5K36C 3KRNA 2EM8A 4R2RA 4FWDA 2EM5A 4TUGA 2R42A 4WXDA 1PVGA 2WBSA 1XNRE 2EMHA 1FI4A 3GCMA 2EOZA 4R2DA 3OTOE 1UN6B 1Y60A 2YU5A 2YWQA 2CGEA 2YPNA 3M85D 4WFTA 3L7ZA 2UU9I 1ZBQA 2EJ4A 2EWLA 4M30A 1B69A 1DGCA 1HNWI 4JI8E 4LFBI 2CPNA 4GQUA 3M6AA 4N3OA 2L3JA 3BIDA 1EH8A 1IBME 1EH6A 1WHNA 2EPPA 4LFCI 4DV2E 5EKWA 4R2SA 2GPIA 4YY3E 4DR5I 4NZVA 2DLQA 1X6HA 2C38A 4YHHI 3WU3A 4BC7A 3LTOA 4DV3I 2L2NA 2ZM6I 1Z1BA 4YHHE 4DV4E 1XMOI 2DMIA 4IZKA 4DR4E 4DV1E 1Z0VA 1PKPA 1MG7A 2O1UA 4JI5E 2BA0G 2DMYA 2IHR1 2LV2A 1USVA 2R3VA 5DROA 1STUA 1N34I 2VF3A 2DEIA 3HJCA 2HK3A 1ZM4A 1UDQA 3U1YA 1YZ9A 2RSIA 4ZVIA 1DARA 1XNQI 2RPCA 4WSGA 2EZ6A 1PJTA 4R8OA 4JI7E 4NHRA 1Z0GA 3M7NG 2YTIA 2NUGA 2E5LE 2O1WA 1MX0A 1H74A 4DV5I 1BBGA 1HNXI 3ADIA 2HHHI 2JEBA 5BR8E 4DU7A 4OZEA 2GS8A 1I94I 4X64I 4R2QA 2BR2B 2I13A 2V34A 3EQ1A 3EPLA 4DV4I 2YTNA 4ZYHA 3HQ1A 2BB8A 1PJSA 1XHKA 5JEAA 2PO1B 3JTZA 4HEIA 4OO1F 4DR3E 5AE2A 1MEYC 2FGGA 1A6FA 2C39B 2C39A 4NXMI 3Q6MA 2Q2EB 1YUIA 4B3RE 4IFDB 2N8XA 4LF8E 2J65A 1WRJA 4F9CB 2PNZB 4OOGC 1N33I 1YUJA 2HC5A 2YTFA 4LF4E 2F4VI 4DR6I 2Z5CB 4PU9A 4UT4A 4KHPE 5C0XA 4FW7A 1ELOA 2OI2A 1MGTA 4JG4A 4JI4I 2K7IA 1T4NA 1NHIA 2B7TA 2MKNA 4LFAE 2EPNA 1YHCA 4N4RB 1H7UA 4LF9E 4USKA 1RREA 2ELZA 2ENAA 2BBGA 1Z5BA 3NZKA 3UK3C 2PO2A 4DPXA 5F3WA 5LMNI 3J80Q 1O0WA 4X65E 4IS9A 1N36I 2LUQA 2CZ9A 1WJPA 3LMLA 2E1MA 2EOEA 4F2JC 3T1HE 4AQYI 1XMQI 5EL9A 1A1HA 1B62A 1T38A 5CFFE 4HACB 4RPFA 2JE6B 4X66I 1USUA 4WUCA 2CSHA 4MYUA 3H09A 2LBSB 4DV6I 1RQ0A 2A25A 4FW6A 4FW9A 2PO0B 1P42A 3VK6A 5ADZA 1J26A 5K36B 2ENCA 3PYGA 4LF6I 1YYKA 1YSAC 2FTXB 4MU3A 3VYYA 3ZZUA 4M1KA 4GKJI 5LMUI 1ZM3A 1R6LA 4K0KI 4DU8A 1X47A 3K85A 1UBDC 1HR0I 2M7QA 2JT2A 3EPHA 2PRTA 2UU9E 2MKDA 2UXBE 1IBLE 2L6MA 1MU5A 4AIMA 2VQEI 1FWLA 2EOMA 1UILA 1UEKA 2WP8A 4MDTA 4HTGA 4IFDD 2EOYA 4MLQA 2YTOA 4M2ZA 4LFBE 1Y4SA 3QT6A 5IWAE 4NXNI 2J7JA 5FLXQ 2JEAB 2Z5BA 3ZM7A 4LFCE 4DR2E 1KJKA 2C37A 4J3DA 4DR5E 2JOBA 2EPMX 2LVHA 1D6TA 4IFDE 4DV3E 3AV0A 4DR1E 1JK1A 2EPUA 4BHCA 2ZM6E 3LLHA 3B78A 4BBYA 3LPSA 1GTKA 5A6BA 4BMJA 3PYEA 1Z0CA 5C0XF 1N34E 2EP3A 2EMFA 5IV8B 1PJQA 4JI1I 3THNA 2V83A 1YH8A 4LCHA 5KL6A 3BF2A 4M0VA 4R2PA 2JR1A 1KVKA 2IOQA 3WU6A 1XNQE 2YRMA 3J7Yp 4P78A 4MU1A 4R2CA 2LTSA 4DV0E 3JAMQ 4DV5E 2KOUA 4IS1C 2NN6C 1UHZA 4LTYA 3F6GA 2B9DA 2UUBI 5K36D 4B3SI 4X64E 2EOIA 2L8TA 4GKKI 2EMAA 2EPXA 2YTQA 1SR9A 3C6KA 1TN9A 4XTJA 2X36A 5AE3A 2VF1A 4F54A 2RSMA 1ZAAC 1YFHA 2V85A 4I8OA 2LUPB 4ZYEA 2WCC3 4B3ME 3J7AG 1IBKI 4DPWA 2UXDE 4JI2I 4BA1B 2EQ1A 4FK5C 5K36E 1RMDA 4PRVA 3P1XA 2HKEA 2EPZA 2WZOA 1N33E 2UXCE 2YTEA 2YT4A 2DGCA 2UUCI 3F0NA 2JPAA 5KL5A 5IXMB 5KL3A 2DB2A 1X6EA 2EMBA 2EORA 2IESA 4DUYI 2L3CA 1KKHA 5AC5A 4LCGA 2WNRB 2MDGA 3OMLA 3P3GA 1QU6A 1WXRA 2MDRA 3PS3A 2YTGA 3ADJA 3WU5A 5LMNE 2LRSA 3HPZA 2VQFE 3QT7A 3PS1A 3J80C 1H73A 2JWOA 2EMZA 2A2DA 1PIEA 3Q6NA 1HNZI 2EMYA 2PO1A 1FNMA 2X7IA 2EQ0A 1R6MA 4BC9A 2V8PA 1T4LB 4X66E 4LF7I 4LF5I 2EPRA 1KTVA 4DV7E 2L2KB 2BR2A 2FV4B 2EM2A 4J8ZA 4F6NA 2EFGA 1ZM2A 4EMDA 4OO1C 4DV6E 3H1CA 1GZ6A 2ZBKB 4HXZA 2AE8A 1ZR9A 3U1KA 1OYPA 4RHBB 2LMZA 4BCAA 5A6JA 1TF3A 4LF6E 2BA1G 2CG9A 2V2QA 5A6KA 4PRXA 4IFDA 2EN8A 2WW4A 2PNZA 4KHPI 5LMUE 1T39A 5A6AA 4LU9A 5KL7A 2V89A 2Z5CA 4IZJB 4KQVA 3D4JA 5T6JA 3HULA 2D9HA 3PS2A 3QT8A 2CVEA 1J5EE 1N0VC 3F6HA 3ADGA 4O24A 2BM0A 1OYRA 2JYAA 2BA0D 2F1DA 2XEXA 2H36X 4MU4A 2VQEE 2EN2A 2JXPA 3ECRA 4FW4A 1B63A 4JI8I 1H72C 1EH7A 2EPLX 1VI7A 1F2IG 4NXNE 1BB8A 5FLXC 3J7AM 1EI1A 2R1FA 3LNUA 4JI0I 4URLA 1DI2A 4AIDA 3DF6A 2NABA 1Z0TA 4YY3I 2EM9A 3M7ND 1X48A 4JYAI 2YSOA 4HACA 2UUAI 3P3EA 1LLMC 2JE6A 4DUZE 4O43A 2B7VA 4BHBA 3B4TA 3P06A 3QG5C 4L8NA 1KYQA 4DR7E 4DPYA 1UDOA 4USMA 4DV1I 4DR4I 2EN7A 4U3DA 3HXLA 4JI5I 4QNKA 2PO0A 2ELYA 2L2MA 5DNLA 1FWKA 4P52A 2EMXA 4OX9I 2EM6A 5K36A 2V2VA 4X62E 4JI1E 1A1FA 4DPUA 2GQ0A 2HK2A 1Y6ZA 5DRRA 4JI7I 2DRPA 1OYSA 2ENHA 2E5LI 2F8BA 2NN6B 1WHQA 3JAMC 1TF6A 5A2QQ 5BR8I 2EM3A 3KZZA 4X9JA 3C6MA 5LL6R 1A1JA 3K17A 2UUBE 2NA2A 1BKNA 4GKKE 3VYXA 2RQLA 1HNWE 2EM4A 1IMUA 4DPTA 1N32I 4TUIA 3T1YI 4DR3I 4WX9A 2EMWA 5JEAC 4F9AB 1Z5CA 4IZJD 2JEAA 5DRQA 1IBKE 4JI2E 1QNTA 4B3RI 1UDNA 1NEIA 1G2DC 2N3HA 2O3ZA 1XMOE 1X6FA 2YRHA 2GO3A 4MU0A 2RTXA 1Z0WA 5TSEA 1EA6A 4R2AA 4IFDF 1X5WA 5C0XC 4BA2B 3MSWA 2EMKA 2MC5A 2I9IA 2E72A 3IWBA 4DUYE 3RMPA 3PYFA 4B3TI 3IWDA 2M4IA 4LF9I 1S16A 4LPFA 4Q35B 2DEJA 2VE7C 2EM0A 5DRPA 1A1LA 2IOPA 5ELWA 2EOOA 3K6QA 5AASA 5AC4A 1HNZE 2HHHE 4GEQB 2CTDA 1HNXE 2O1TA 2HJJA 4KWYA 4DMIA 1QZRA 4X8WA 2V88A 1I94E 4LF5E 2BV3A 2WBTA 4DKKA 2LO3A 4OO1B 2NPFA 2R76A 2HFSA 1A1KA 2NUEA 2LJPA 1XXEA 3KZYA 2EPCA 1NHJA 2V8QB 4JV5I 4R2EA 5IT9Q 2NN6D 4NXME 1Z59A 4BA1A 2EN4A 1ZBTA 1ZM9A 3P76A 2DLKA 3DD6A 5K36F 2YZTA 1IQOA 2F4VE 4DR6E 1N3GA 5FWKA 4JI6I 2ZITA 1G2FC 3EPKA 1FJGI 3HPSA 2NN6E 3MHSC 4O5GA 3GMEA 4WUBA 1AAYA 4JI4E 3L7ZB 2UXBI 1IBLI 2DSYA 1Y4UA 2NN6F 4FW5A 1YPNA 2WNRA 3JU0A 2BM1A 4ISAA 2EOFA 3B82A 5DNXA 5IWAI 3BBGA 3KWRA 5KL2A 1N36E 1U2RA 4OKGA 4DR2I 4JI0E 4JI3E 2EOXA 4I3HA 3Q1QA 2C38B 1JK2A 1YYWA 4L5NC 1XMQE 2EPKX 2V86A 4AQYE 4JYAE 4DR1I 2EL6A 2UUAE 4IJDA 3J81Q 2ODRC 4IZKB 2YSPA 5KL4A 3H4LA 2JP9A 2EL5A 4Z7CA 5AE1A 5A69A 4O4KA 2HGHA 3IWCA 1SFEA 2EN6A 2YTPA 3ADLA 2L33A 1AH5A 1S4EA 4OX9E 1Z0EA 2HFUA 3PRYA 2Z5EA 4FW3A 4MLVA 3CDJA 2ODRD 4UTGA 5L3JA 2EMCA 2EL4A 2EOSA 4GKJE 1Z5AA 3EPJA 1ZXNA 4DXLA 4U3BA 2GO4A 4K0KE 3CWVA 1XNRI 4OO1D 4IZJA 5A6BD 4DV0I 1HR0E 2NUFA 3GLLA 3OTOI 2WBUA 2JEBB 4P7AA 5A2QC 3C4TA 2DIXA 4ZYDA 2EMLA 2RS7A 2JVAA 1N0UA 2V2ZA 4OO1E 1N32E 5JEAB 3T1YE 2O1VA 4B3MI 1YYOA 4AM3A 1IBMI 2AJ4A 4DV2I 2UXDI 2EN3A 1K47A 2EN1A 1NCSA 3L00A 4RH8A 3THOB 3QT5A 1X3CA 1NZ0A 3WU4A 3V2UC 4WPYA 2M1SA 2UXCI 1A1GA 5C0XB 2EOQA 2PNLA 2EPAA 4BS9A 4R1FA 4B3TE 2RS6A 4HY1A 2J7KA 4P7DA 2KHXA 2K4VA 2BA1D 2CT1A 2LJUA 1E3HA 2PO2B 4MYTA 2VQFI 3BGHA 4WYQB 4QNJA 3VHTB 5DNYA 1DQ3A 2Q8UA 2YTDA 2A2CA 2EOHA 1WUUA 2L92A 2NN6A 2N3GA 3MHHC 2VRDA 2GHFA 1P47A 1RHYA 2EMGA 3GONA 4FWHA 4WSPA
chains in the Genus database with same CATH topology
4DV7I 1FKAE 4B3SE 2V87A 4Z7YA 2LE2A 4FWGA 3K1JA 2LJHA 3V5RA 4Q28A 1ZXMA 4JV5E 5IT9C 4LF8I 3ZKBA 3PYDA 4LF4I 1KIJA 4JI6E 1EKZA 1RR9A 4KHPI 1X49A 1FJGE 2G7HA 2UUCE 4WUDA 1J5EI 2LTRA 4KZSA 1RC7A 1HK7A 4LFAI 2PNMA 5GMDA 3C4BA 3ZZTA 1VISA 3ZOQB 4X65I 4R03A 1GQEA 2Z5BB 3ZKDA 4FN5A 4HYMA 3HTXA 2JOXA 4ED4A 3T1HI 3ZZ0A 1H7SA 3DJWA 3FIGA 2B3TB 1T4OA 2KONA 4F9BB 1NHHA 4LF7E 1OJ4A 3B8HA 4DUZI 3J81C 4DR7I 2E1RA 3AUZA 2HKJA 2JY9A 1Z0BA 2MC6A 4X62I 5GMEA 4FWDA 4TUGA 2R42A 1PVGA 1XNRE 1FI4A 3OTOE 2CGEA 2UU9I 4WFTA 1ZBQA 2EWLA 4M30A 1HNWI 4JI8E 4LFBI 2CPNA 3M6AA 4N3OA 2L3JA 1IBME 4LFCI 1WHNA 4DV2E 4YY3E 4DR5I 4DV3I 3WU3A 4BC7A 3LTOA 2L2NA 2ZM6I 4YHHE 4DV4E 1XMOI 4IZKA 4DR4E 4DV1E 1Z0VA 1PKPA 1MG7A 2O1UA 4JI5E 2DMYA 2IHR1 1USVA 2R3VA 1STUA 1N34I 2VF3A 2DEIA 3HJCA 2HK3A 1ZM4A 1YZ9A 4ZVIA 1DARA 1XNQI 2EZ6A 4R8OA 4JI7E 1Z0GA 2NUGA 2E5LE 2O1WA 1MX0A 1H74A 4DV5I 1HNXI 2HHHI 3ADIA 5BR8E 4DU7A 2GS8A 1I94I 4X64I 2V34A 3HQ1A 1XHKA 3JTZA 4DR3E 5AE2A 2FGGA 1A6FA 4NXMI 3Q6MA 2Q2EB 4B3RE 4LF8E 4F9CB 4OOGC 1N33I 4LF4E 2F4VI 4DR6I 2Z5CB 4PU9A 4UT4A 4KHPE 1ELOA 2OI2A 4JG4A 4JI4I 1T4NA 1NHIA 2B7TA 4LFAE 1H7UA 4LF9E 4USKA 1RREA 1Z5BA 5LMNI 4DPXA 5F3WA 3J80Q 1O0WA 4X65E 1N36I 2LUQA 2CZ9A 3LMLA 2E1MA 1XMQI 3T1HE 4AQYI 4RPFA 1B62A 4HACB 5CFFE 4X66I 1USUA 4WUCA 4MYUA 3H09A 2LBSB 4DV6I 1RQ0A 4FW9A 3VK6A 5ADZA 1J26A 4LF6I 3PYGA 1YYKA 2FTXB 3ZZUA 3VYYA 4M1KA 4GKJI 5LMUI 1ZM3A 4K0KI 1X47A 3K85A 1HR0I 2M7QA 2UU9E 2UXBE 1IBLE 2L6MA 1MU5A 2VQEI 1FWLA 1UILA 1UEKA 4LFBE 4M2ZA 1Y4SA 3QT6A 5IWAE 4NXNI 5FLXQ 2Z5BA 3ZM7A 4LFCE 4DR2E 4DR5E 2JOBA 1D6TA 4DV3E 3AV0A 4DR1E 2ZM6E 3LLHA 3B78A 4BBYA 3LPSA 4BMJA 3PYEA 1Z0CA 1N34E 4JI1I 2V83A 4M0VA 3WU6A 2JR1A 1KVKA 2IOQA 1XNQE 3J7Yp 4P78A 2LTSA 4DV0E 3JAMQ 4DV5E 2KOUA 1UHZA 4LTYA 3F6GA 2B9DA 2UUBI 4B3SI 4X64E 4GKKI 2L8TA 1SR9A 4XTJA 2X36A 5AE3A 2VF1A 4F54A 2RSMA 4B3ME 2V85A 4I8OA 2LUPB 3J7AG 1IBKI 4DPWA 2UXDE 4JI2I 4PRVA 3P1XA 2HKEA 1N33E 2WZOA 2UXCE 2YT4A 2UUCI 3F0NA 2DB2A 4DUYI 2L3CA 1KKHA 3OMLA 1QU6A 1WXRA 2MDRA 3ADJA 3WU5A 5LMNE 2LRSA 3HPZA 2VQFE 3QT7A 3J80C 1H73A 2JWOA 2A2DA 1PIEA 3Q6NA 1HNZI 1FNMA 2X7IA 4BC9A 2V8PA 1T4LB 4X66E 4LF7I 4LF5I 1KTVA 4DV7E 2L2KB 2FV4B 2EFGA 4J8ZA 4EMDA 1ZM2A 4DV6E 1GZ6A 2ZBKB 4HXZA 4BCAA 2LMZA 2CG9A 4LF6E 2V2QA 4PRXA 2WW4A 5LMUE 4LU9A 2V89A 2Z5CA 4IZJB 4KQVA 3D4JA 5T6JA 3HULA 3QT8A 1J5EE 1N0VC 3F6HA 3ADGA 2BM0A 2XEXA 2H36X 2VQEE 1B63A 4JI8I 1H72C 4NXNE 5FLXC 3J7AM 1EI1A 4JI0I 3LNUA 4URLA 4YY3I 1DI2A 4JI3I 3DF6A 1Z0TA 1X48A 4JYAI 4HACA 2UUAI 4DU8A 4YHHI 4DUZE 4DV4I 2B7VA 3P06A 4DPYA 4DR4I 4L8NA 4USMA 4DR7E 4DV1I 4JI5I 3HXLA 2L2MA 1FWKA 4P52A 4OX9I 2V2VA 4X62E 4JI1E 4DPUA 2GQ0A 2HK2A 1Y6ZA 4JI7I 2E5LI 2F8BA 1WHQA 3JAMC 5A2QQ 5BR8I 3K17A 5LL6R 2UUBE 2NA2A 1BKNA 4GKKE 3VYXA 1HNWE 4DPTA 1N32I 4TUIA 3T1YI 4DR3I 4F9AB 1Z5CA 4IZJD 1IBKE 4JI2E 4B3RI 2N3HA 1XMOE 2RTXA 1Z0WA 1EA6A 3IWBA 2MC5A 3MSWA 4B3TI 4DUYE 3RMPA 3PYFA 3IWDA 2M4IA 4LF9I 1S16A 2DEJA 2VE7C 2IOPA 3K6QA 5AASA 1HNZE 2HHHE 2O1TA 4GEQB 1HNXE 4DMIA 1QZRA 4X8WA 2V88A 1I94E 4LF5E 2BV3A 4DKKA 2NPFA 2LJPA 2HFSA 2NUEA 1NHJA 2V8QB 4JV5I 5IT9Q 4NXME 1Z59A 1ZBTA 1ZM9A 2YZTA 2F4VE 4DR6E 5FWKA 4JI6I 2ZITA 1FJGI 3HPSA 4WUBA 4JI4E 2UXBI 1IBLI 2DSYA 1Y4UA 3JU0A 2BM1A 3B82A 5IWAI 3KWRA 1N36E 1U2RA 4DR2I 4JI0E 4JI3E 4I3HA 3Q1QA 1YYWA 4L5NC 1XMQE 4AQYE 2V86A 4DR1I 4JYAE 2UUAE 3J81Q 2ODRC 4IZKB 3H4LA 4Z7CA 5AE1A 3IWCA 3ADLA 2L33A 1S4EA 4OX9E 1Z0EA 2HFUA 3PRYA 2Z5EA 2ODRD 4UTGA 5L3JA 4GKJE 1Z5AA 1ZXNA 4DXLA 4K0KE 3CWVA 1XNRI 4IZJA 4DV0I 1HR0E 2NUFA 3OTOI 4P7AA 5A2QC 3C4TA 2DIXA 2RS7A 2JVAA 1N0UA 2V2ZA 1N32E 3T1YE 2O1VA 4B3MI 1YYOA 1IBMI 2AJ4A 4DV2I 2UXDI 1K47A 3WU4A 3QT5A 1NZ0A 3V2UC 4WPYA 2M1SA 2UXCI 2PNLA 4R1FA 4BS9A 4B3TE 2RS6A 4HY1A 2J7KA 4P7DA 2KHXA 2K4VA 4MYTA 2VQFI 4WYQB 5DNYA 1DQ3A 2A2CA 1WUUA 2L92A 2N3GA 4FWHA 3GONA 4WSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 I;  1FKA E;  4B3S E;  4Z7Y A;  4FWG A;  3K1J A;  2LJH A;  3V5R A;  1ZXM A;  4JV5 E;  5IT9 C;  4LF8 I;  3ZKB A;  3PYD A;  4LF4 I;  1KIJ A;  4JI6 E;  1EKZ A;  1RR9 A;  4KHP I;  1X49 A;  1FJG E;  2UUC E;  4WUD A;  1J5E I;  2LTR A;  1RC7 A;  4LFA I;  5GMD A;  3C4B A;  3ZZT A;  1VIS A;  4X65 I;  1GQE A;  3ZKD A;  4FN5 A;  4HYM A;  3HTX A;  4ED4 A;  3T1H I;  3ZZ0 A;  1H7S A;  2B3T B;  1T4O A;  1NHH A;  4LF7 E;  1OJ4 A;  3B8H A;  4DUZ I;  3J81 C;  4DR7 I;  2E1R A;  2HKJ A;  2JY9 A;  1Z0B A;  4X62 I;  5GME A;  4FWD A;  2R42 A;  1PVG A;  1XNR E;  1FI4 A;  3OTO E;  2UU9 I;  4WFT A;  4M30 A;  1HNW I;  4JI8 E;  4LFB I;  2CPN A;  3M6A A;  2L3J A;  1IBM E;  4LFC I;  1WHN A;  4DV2 E;  4YY3 E;  4DR5 I;  4DV3 I;  3WU3 A;  3LTO A;  2L2N A;  2ZM6 I;  4YHH E;  4DV4 E;  1XMO I;  4DR4 E;  4DV1 E;  1Z0V A;  1PKP A;  1MG7 A;  4JI5 E;  2DMY A;  2IHR 1;  2R3V A;  1STU A;  1N34 I;  2VF3 A;  2DEI A;  2HK3 A;  1ZM4 A;  1YZ9 A;  4ZVI A;  1DAR A;  1XNQ I;  2EZ6 A;  4JI7 E;  1Z0G A;  2NUG A;  2E5L E;  2HHH I;  1MX0 A;  1H74 A;  4DV5 I;  1HNX I;  3ADI A;  5BR8 E;  4DU7 A;  2GS8 A;  1I94 I;  4X64 I;  2V34 A;  1XHK A;  4DR3 E;  1A6F A;  4NXM I;  2Q2E B;  4B3R E;  4LF8 E;  4OOG C;  1N33 I;  4LF4 E;  2F4V I;  4DR6 I;  4PU9 A;  4UT4 A;  4KHP E;  1ELO A;  2OI2 A;  4JG4 A;  4JI4 I;  1T4N A;  1NHI A;  2B7T A;  4LFA E;  1H7U A;  4LF9 E;  4USK A;  1RRE A;  1Z5B A;  5LMN I;  4DPX A;  3J80 Q;  1O0W A;  4X65 E;  1N36 I;  2LUQ A;  2CZ9 A;  1XMQ I;  3T1H E;  4AQY I;  4RPF A;  1B62 A;  4HAC B;  5CFF E;  4X66 I;  4WUC A;  4MYU A;  2LBS B;  4DV6 I;  1RQ0 A;  4FW9 A;  1J26 A;  4LF6 I;  3PYG A;  1YYK A;  3ZZU A;  3VYY A;  4M1K A;  4GKJ I;  5LMU I;  1ZM3 A;  4K0K I;  1X47 A;  1HR0 I;  2UU9 E;  2UXB E;  1IBL E;  1MU5 A;  2VQE I;  1FWL A;  1UIL A;  1UEK A;  4LFB E;  4M2Z A;  3QT6 A;  5IWA E;  4NXN I;  5FLX Q;  3ZM7 A;  4LFC E;  4DR2 E;  4DR5 E;  1D6T A;  4DV3 E;  4DR1 E;  2ZM6 E;  3LLH A;  3B78 A;  3LPS A;  3PYE A;  1Z0C A;  1N34 E;  4JI1 I;  3WU6 A;  1KVK A;  1XNQ E;  3J7Y p;  2LTS A;  4DV0 E;  3JAM Q;  4DV5 E;  1UHZ A;  2UUB I;  4B3S I;  4X64 E;  4GKK I;  4XTJ A;  2X36 A;  2RSM A;  4B3M E;  2LUP B;  3J7A G;  1IBK I;  4DPW A;  2UXD E;  4JI2 I;  4PRV A;  3P1X A;  2HKE A;  1N33 E;  2UXC E;  2YT4 A;  2UUC I;  3F0N A;  2DB2 A;  4DUY I;  2L3C A;  1KKH A;  1QU6 A;  2MDR A;  3ADJ A;  3WU5 A;  5LMN E;  2LRS A;  2VQF E;  3QT7 A;  1H73 A;  3J80 C;  2A2D A;  1PIE A;  1HNZ I;  1FNM A;  2X7I A;  2V8P A;  1T4L B;  4X66 E;  4LF7 I;  4LF5 I;  1KTV A;  4DV7 E;  2L2K B;  2EFG A;  4EMD A;  1ZM2 A;  4DV6 E;  2ZBK B;  4HXZ A;  4LF6 E;  2V2Q A;  4PRX A;  2WW4 A;  5LMU E;  4KQV A;  3D4J A;  3QT8 A;  3HUL A;  1J5E E;  1N0V C;  3ADG A;  2BM0 A;  2XEX A;  2VQE E;  1B63 A;  4JI8 I;  1H72 C;  4NXN E;  5FLX C;  3J7A M;  1EI1 A;  4JI0 I;  3LNU A;  4URL A;  4YY3 I;  1DI2 A;  4JI3 I;  1Z0T A;  1X48 A;  4JYA I;  4HAC A;  2UUA I;  4DU8 A;  4YHH I;  4DUZ E;  4DV4 I;  2B7V A;  4DPY A;  4DR4 I;  4USM A;  4DR7 E;  4DV1 I;  4JI5 I;  2L2M A;  1FWK A;  4P52 A;  4OX9 I;  2V2V A;  4X62 E;  4JI1 E;  4DPU A;  2HK2 A;  4JI7 I;  2E5L I;  1WHQ A;  3JAM C;  5A2Q Q;  5BR8 I;  3K17 A;  5LL6 R;  2UUB E;  2NA2 A;  1BKN A;  4GKK E;  3VYX A;  1HNW E;  4DPT A;  1N32 I;  3T1Y I;  4DR3 I;  1Z5C A;  1IBK E;  4JI2 E;  4B3R I;  2N3H A;  1XMO E;  2RTX A;  1Z0W A;  1EA6 A;  4B3T I;  4DUY E;  3PYF A;  4LF9 I;  1S16 A;  2DEJ A;  1HNZ E;  2HHH E;  1HNX E;  1QZR A;  4X8W A;  1I94 E;  4LF5 E;  2BV3 A;  4DKK A;  2NPF A;  2LJP A;  2HFS A;  2NUE A;  1NHJ A;  5IT9 Q;  4JV5 I;  4NXM E;  1Z59 A;  1ZBT A;  1ZM9 A;  2F4V E;  4DR6 E;  4JI6 I;  2ZIT A;  1FJG I;  4WUB A;  4JI4 E;  2UXB I;  1IBL I;  2BM1 A;  3B82 A;  5IWA I;  1N36 E;  1U2R A;  4DR2 I;  4JI0 E;  4JI3 E;  4I3H A;  3Q1Q A;  1YYW A;  1XMQ E;  4AQY E;  4DR1 I;  4JYA E;  2UUA E;  3J81 Q;  3H4L A;  4Z7C A;  3ADL A;  2L33 A;  1S4E A;  4OX9 E;  1Z0E A;  2HFU A;  4UTG A;  5L3J A;  4GKJ E;  1Z5A A;  1ZXN A;  4DXL A;  4K0K E;  3CWV A;  1XNR I;  4DV0 I;  1HR0 E;  2NUF A;  3OTO I;  4P7A A;  5A2Q C;  3C4T A;  2DIX A;  2RS7 A;  2JVA A;  1N0U A;  2V2Z A;  1N32 E;  3T1Y E;  4B3M I;  1YYO A;  1IBM I;  2AJ4 A;  4DV2 I;  2UXD I;  1K47 A;  3WU4 A;  3QT5 A;  1NZ0 A;  3V2U C;  2UXC I;  4R1F A;  4B3T E;  2RS6 A;  4HY1 A;  2J7K A;  2KHX A;  4MYT A;  2VQF I;  4WYQ B;  2A2C A;  1WUU A;  2N3G A;  4FWH A;  3GON A; 
#chains in the Genus database with same CATH topology
 4DV7 I;  1FKA E;  4B3S E;  2EOJ A;  2V87 A;  4Z7Y A;  3UHM A;  1UDS A;  2YTJ A;  4JI3 I;  4MQY A;  2LE2 A;  4FWG A;  3K1J A;  2LJH A;  3V5R A;  4Q28 A;  1ZXM A;  4JV5 E;  4F6M A;  2LT7 A;  5IT9 C;  3TQM A;  4LF8 I;  2YRK A;  3ZKB A;  2ADR A;  4ZYG A;  4IFD C;  1E3P A;  3PYD A;  4LF4 I;  3M99 B;  1Y5Y A;  1KIJ A;  4JI6 E;  4GZN C;  1EKZ A;  1RR9 A;  1X49 A;  1ZU1 A;  1FJG E;  3P3C A;  5JEA D;  2G7H A;  2UUC E;  4WUD A;  3M85 G;  1J5E I;  2LTR A;  4BA2 A;  4NBQ A;  4KZS A;  1RC7 A;  1HK7 A;  4LFA I;  2WP8 B;  2EMI A;  2YU8 A;  2M9A A;  2GLI A;  2PNM A;  2EM7 A;  5GMD A;  3C4B A;  3ZZT A;  1VIS A;  3ZOQ B;  1PDA A;  1L4S A;  5JEA E;  4X65 I;  4R03 A;  1GQE A;  2Z5B B;  3ZKD A;  5C0X D;  2VES A;  2C37 B;  4FN5 A;  5LLQ A;  2EPO A;  3HTX A;  2JOX A;  4HYM A;  5JEA F;  4ED4 A;  3T1H I;  1IQS A;  3ZZ0 A;  1H7S A;  3DJW A;  3FIG A;  2B3T B;  1T4O A;  2KON A;  4F9B B;  1A1I A;  4LF7 E;  4WXC A;  1NHH A;  1OJ4 A;  2LCE A;  3B8H A;  3CDI A;  3J81 C;  2EE8 A;  4DUZ I;  4DR7 I;  2E1R A;  4OO1 A;  5C0X E;  3AUZ A;  1BBO A;  2HKJ A;  2EQ3 A;  2JY9 A;  2IER A;  1Z0B A;  4LOM A;  2MC6 A;  3HKM A;  4X62 I;  4LCF A;  4M9V C;  5GME A;  5K36 C;  3KRN A;  2EM8 A;  4R2R A;  4FWD A;  2EM5 A;  4TUG A;  2R42 A;  4WXD A;  1PVG A;  2WBS A;  1XNR E;  2EMH A;  1FI4 A;  3GCM A;  2EOZ A;  4R2D A;  3OTO E;  1UN6 B;  1Y60 A;  2YU5 A;  2YWQ A;  2CGE A;  2YPN A;  3M85 D;  4WFT A;  3L7Z A;  2UU9 I;  1ZBQ A;  2EJ4 A;  2EWL A;  4M30 A;  1B69 A;  1DGC A;  1HNW I;  4JI8 E;  4LFB I;  2CPN A;  4GQU A;  3M6A A;  4N3O A;  2L3J A;  3BID A;  1EH8 A;  1IBM E;  1EH6 A;  1WHN A;  2EPP A;  4LFC I;  4DV2 E;  5EKW A;  4R2S A;  2GPI A;  4YY3 E;  4DR5 I;  4NZV A;  2DLQ A;  1X6H A;  2C38 A;  4YHH I;  3WU3 A;  4BC7 A;  3LTO A;  4DV3 I;  2L2N A;  2ZM6 I;  1Z1B A;  4YHH E;  4DV4 E;  1XMO I;  2DMI A;  4IZK A;  4DR4 E;  4DV1 E;  1Z0V A;  1PKP A;  1MG7 A;  2O1U A;  4JI5 E;  2BA0 G;  2DMY A;  2IHR 1;  2LV2 A;  1USV A;  2R3V A;  5DRO A;  1STU A;  1N34 I;  2VF3 A;  2DEI A;  3HJC A;  2HK3 A;  1ZM4 A;  1UDQ A;  3U1Y A;  1YZ9 A;  2RSI A;  4ZVI A;  1DAR A;  1XNQ I;  2RPC A;  4WSG A;  2EZ6 A;  1PJT A;  4R8O A;  4JI7 E;  4NHR A;  1Z0G A;  3M7N G;  2YTI A;  2NUG A;  2E5L E;  2O1W A;  1MX0 A;  1H74 A;  4DV5 I;  1BBG A;  1HNX I;  3ADI A;  2HHH I;  2JEB A;  5BR8 E;  4DU7 A;  4OZE A;  2GS8 A;  1I94 I;  4X64 I;  4R2Q A;  2BR2 B;  2I13 A;  2V34 A;  3EQ1 A;  3EPL A;  4DV4 I;  2YTN A;  4ZYH A;  3HQ1 A;  2BB8 A;  1PJS A;  1XHK A;  5JEA A;  2PO1 B;  3JTZ A;  4HEI A;  4OO1 F;  4DR3 E;  5AE2 A;  1MEY C;  2FGG A;  1A6F A;  2C39 B;  2C39 A;  4NXM I;  3Q6M A;  2Q2E B;  1YUI A;  4B3R E;  4IFD B;  2N8X A;  4LF8 E;  2J65 A;  1WRJ A;  4F9C B;  2PNZ B;  4OOG C;  1N33 I;  1YUJ A;  2HC5 A;  2YTF A;  4LF4 E;  2F4V I;  4DR6 I;  2Z5C B;  4PU9 A;  4UT4 A;  4KHP E;  5C0X A;  4FW7 A;  1ELO A;  2OI2 A;  1MGT A;  4JG4 A;  4JI4 I;  2K7I A;  1T4N A;  1NHI A;  2B7T A;  2MKN A;  4LFA E;  2EPN A;  1YHC A;  4N4R B;  1H7U A;  4LF9 E;  4USK A;  1RRE A;  2ELZ A;  2ENA A;  2BBG A;  1Z5B A;  3NZK A;  3UK3 C;  2PO2 A;  4DPX A;  5F3W A;  5LMN I;  3J80 Q;  1O0W A;  4X65 E;  4IS9 A;  1N36 I;  2LUQ A;  2CZ9 A;  1WJP A;  3LML A;  2E1M A;  2EOE A;  4F2J C;  3T1H E;  4AQY I;  1XMQ I;  5EL9 A;  1A1H A;  1B62 A;  1T38 A;  5CFF E;  4HAC B;  4RPF A;  2JE6 B;  4X66 I;  1USU A;  4WUC A;  2CSH A;  4MYU A;  3H09 A;  2LBS B;  4DV6 I;  1RQ0 A;  2A25 A;  4FW6 A;  4FW9 A;  2PO0 B;  1P42 A;  3VK6 A;  5ADZ A;  1J26 A;  5K36 B;  2ENC A;  3PYG A;  4LF6 I;  1YYK A;  1YSA C;  2FTX B;  4MU3 A;  3VYY A;  3ZZU A;  4M1K A;  4GKJ I;  5LMU I;  1ZM3 A;  1R6L A;  4K0K I;  4DU8 A;  1X47 A;  3K85 A;  1UBD C;  1HR0 I;  2M7Q A;  2JT2 A;  3EPH A;  2PRT A;  2UU9 E;  2MKD A;  2UXB E;  1IBL E;  2L6M A;  1MU5 A;  4AIM A;  2VQE I;  1FWL A;  2EOM A;  1UIL A;  1UEK A;  2WP8 A;  4MDT A;  4HTG A;  4IFD D;  2EOY A;  4MLQ A;  2YTO A;  4M2Z A;  4LFB E;  1Y4S A;  3QT6 A;  5IWA E;  4NXN I;  2J7J A;  5FLX Q;  2JEA B;  2Z5B A;  3ZM7 A;  4LFC E;  4DR2 E;  1KJK A;  2C37 A;  4J3D A;  4DR5 E;  2JOB A;  2EPM X;  2LVH A;  1D6T A;  4IFD E;  4DV3 E;  3AV0 A;  4DR1 E;  1JK1 A;  2EPU A;  4BHC A;  2ZM6 E;  3LLH A;  3B78 A;  4BBY A;  3LPS A;  1GTK A;  5A6B A;  4BMJ A;  3PYE A;  1Z0C A;  5C0X F;  1N34 E;  2EP3 A;  2EMF A;  5IV8 B;  1PJQ A;  4JI1 I;  3THN A;  2V83 A;  1YH8 A;  4LCH A;  5KL6 A;  3BF2 A;  4M0V A;  4R2P A;  2JR1 A;  1KVK A;  2IOQ A;  3WU6 A;  1XNQ E;  2YRM A;  3J7Y p;  4P78 A;  4MU1 A;  4R2C A;  2LTS A;  4DV0 E;  3JAM Q;  4DV5 E;  2KOU A;  4IS1 C;  2NN6 C;  1UHZ A;  4LTY A;  3F6G A;  2B9D A;  2UUB I;  5K36 D;  4B3S I;  4X64 E;  2EOI A;  2L8T A;  4GKK I;  2EMA A;  2EPX A;  2YTQ A;  1SR9 A;  3C6K A;  1TN9 A;  4XTJ A;  2X36 A;  5AE3 A;  2VF1 A;  4F54 A;  2RSM A;  1ZAA C;  1YFH A;  2V85 A;  4I8O A;  2LUP B;  4ZYE A;  2WCC 3;  4B3M E;  3J7A G;  1IBK I;  4DPW A;  2UXD E;  4JI2 I;  4BA1 B;  2EQ1 A;  4FK5 C;  5K36 E;  1RMD A;  4PRV A;  3P1X A;  2HKE A;  2EPZ A;  2WZO A;  1N33 E;  2UXC E;  2YTE A;  2YT4 A;  2DGC A;  2UUC I;  3F0N A;  2JPA A;  5KL5 A;  5IXM B;  5KL3 A;  2DB2 A;  1X6E A;  2EMB A;  2EOR A;  2IES A;  4DUY I;  2L3C A;  1KKH A;  5AC5 A;  4LCG A;  2WNR B;  2MDG A;  3OML A;  3P3G A;  1QU6 A;  1WXR A;  2MDR A;  3PS3 A;  2YTG A;  3ADJ A;  3WU5 A;  5LMN E;  2LRS A;  3HPZ A;  2VQF E;  3QT7 A;  3PS1 A;  3J80 C;  1H73 A;  2JWO A;  2EMZ A;  2A2D A;  1PIE A;  3Q6N A;  1HNZ I;  2EMY A;  2PO1 A;  1FNM A;  2X7I A;  2EQ0 A;  1R6M A;  4BC9 A;  2V8P A;  1T4L B;  4X66 E;  4LF7 I;  4LF5 I;  2EPR A;  1KTV A;  4DV7 E;  2L2K B;  2BR2 A;  2FV4 B;  2EM2 A;  4J8Z A;  4F6N A;  2EFG A;  1ZM2 A;  4EMD A;  4OO1 C;  4DV6 E;  3H1C A;  1GZ6 A;  2ZBK B;  4HXZ A;  2AE8 A;  1ZR9 A;  3U1K A;  1OYP A;  4RHB B;  2LMZ A;  4BCA A;  5A6J A;  1TF3 A;  4LF6 E;  2BA1 G;  2CG9 A;  2V2Q A;  5A6K A;  4PRX A;  4IFD A;  2EN8 A;  2WW4 A;  2PNZ A;  4KHP I;  5LMU E;  1T39 A;  5A6A A;  4LU9 A;  5KL7 A;  2V89 A;  2Z5C A;  4IZJ B;  4KQV A;  3D4J A;  5T6J A;  3HUL A;  2D9H A;  3PS2 A;  3QT8 A;  2CVE A;  1J5E E;  1N0V C;  3F6H A;  3ADG A;  4O24 A;  2BM0 A;  1OYR A;  2JYA A;  2BA0 D;  2F1D A;  2XEX A;  2H36 X;  4MU4 A;  2VQE E;  2EN2 A;  2JXP A;  3ECR A;  4FW4 A;  1B63 A;  4JI8 I;  1H72 C;  1EH7 A;  2EPL X;  1VI7 A;  1F2I G;  4NXN E;  1BB8 A;  5FLX C;  3J7A M;  1EI1 A;  2R1F A;  3LNU A;  4JI0 I;  4URL A;  1DI2 A;  4AID A;  3DF6 A;  2NAB A;  1Z0T A;  4YY3 I;  2EM9 A;  3M7N D;  1X48 A;  4JYA I;  2YSO A;  4HAC A;  2UUA I;  3P3E A;  1LLM C;  2JE6 A;  4DUZ E;  4O43 A;  2B7V A;  4BHB A;  3B4T A;  3P06 A;  3QG5 C;  4L8N A;  1KYQ A;  4DR7 E;  4DPY A;  1UDO A;  4USM A;  4DV1 I;  4DR4 I;  2EN7 A;  4U3D A;  3HXL A;  4JI5 I;  4QNK A;  2PO0 A;  2ELY A;  2L2M A;  5DNL A;  1FWK A;  4P52 A;  2EMX A;  4OX9 I;  2EM6 A;  5K36 A;  2V2V A;  4X62 E;  4JI1 E;  1A1F A;  4DPU A;  2GQ0 A;  2HK2 A;  1Y6Z A;  5DRR A;  4JI7 I;  2DRP A;  1OYS A;  2ENH A;  2E5L I;  2F8B A;  2NN6 B;  1WHQ A;  3JAM C;  1TF6 A;  5A2Q Q;  5BR8 I;  2EM3 A;  3KZZ A;  4X9J A;  3C6M A;  5LL6 R;  1A1J A;  3K17 A;  2UUB E;  2NA2 A;  1BKN A;  4GKK E;  3VYX A;  2RQL A;  1HNW E;  2EM4 A;  1IMU A;  4DPT A;  1N32 I;  4TUI A;  3T1Y I;  4DR3 I;  4WX9 A;  2EMW A;  5JEA C;  4F9A B;  1Z5C A;  4IZJ D;  2JEA A;  5DRQ A;  1IBK E;  4JI2 E;  1QNT A;  4B3R I;  1UDN A;  1NEI A;  1G2D C;  2N3H A;  2O3Z A;  1XMO E;  1X6F A;  2YRH A;  2GO3 A;  4MU0 A;  2RTX A;  1Z0W A;  5TSE A;  1EA6 A;  4R2A A;  4IFD F;  1X5W A;  5C0X C;  4BA2 B;  3MSW A;  2EMK A;  2MC5 A;  2I9I A;  2E72 A;  3IWB A;  4DUY E;  3RMP A;  3PYF A;  4B3T I;  3IWD A;  2M4I A;  4LF9 I;  1S16 A;  4LPF A;  4Q35 B;  2DEJ A;  2VE7 C;  2EM0 A;  5DRP A;  1A1L A;  2IOP A;  5ELW A;  2EOO A;  3K6Q A;  5AAS A;  5AC4 A;  1HNZ E;  2HHH E;  4GEQ B;  2CTD A;  1HNX E;  2O1T A;  2HJJ A;  4KWY A;  4DMI A;  1QZR A;  4X8W A;  2V88 A;  1I94 E;  4LF5 E;  2BV3 A;  2WBT A;  4DKK A;  2LO3 A;  4OO1 B;  2NPF A;  2R76 A;  2HFS A;  1A1K A;  2NUE A;  2LJP A;  1XXE A;  3KZY A;  2EPC A;  1NHJ A;  2V8Q B;  4JV5 I;  4R2E A;  5IT9 Q;  2NN6 D;  4NXM E;  1Z59 A;  4BA1 A;  2EN4 A;  1ZBT A;  1ZM9 A;  3P76 A;  2DLK A;  3DD6 A;  5K36 F;  2YZT A;  1IQO A;  2F4V E;  4DR6 E;  1N3G A;  5FWK A;  4JI6 I;  2ZIT A;  1G2F C;  3EPK A;  1FJG I;  3HPS A;  2NN6 E;  3MHS C;  4O5G A;  3GME A;  4WUB A;  1AAY A;  4JI4 E;  3L7Z B;  2UXB I;  1IBL I;  2DSY A;  1Y4U A;  2NN6 F;  4FW5 A;  1YPN A;  2WNR A;  3JU0 A;  2BM1 A;  4ISA A;  2EOF A;  3B82 A;  5DNX A;  5IWA I;  3BBG A;  3KWR A;  5KL2 A;  1N36 E;  1U2R A;  4OKG A;  4DR2 I;  4JI0 E;  4JI3 E;  2EOX A;  4I3H A;  3Q1Q A;  2C38 B;  1JK2 A;  1YYW A;  4L5N C;  1XMQ E;  2EPK X;  2V86 A;  4AQY E;  4JYA E;  4DR1 I;  2EL6 A;  2UUA E;  4IJD A;  3J81 Q;  2ODR C;  4IZK B;  2YSP A;  5KL4 A;  3H4L A;  2JP9 A;  2EL5 A;  4Z7C A;  5AE1 A;  5A69 A;  4O4K A;  2HGH A;  3IWC A;  1SFE A;  2EN6 A;  2YTP A;  3ADL A;  2L33 A;  1AH5 A;  1S4E A;  4OX9 E;  1Z0E A;  2HFU A;  3PRY A;  2Z5E A;  4FW3 A;  4MLV A;  3CDJ A;  2ODR D;  4UTG A;  5L3J A;  2EMC A;  2EL4 A;  2EOS A;  4GKJ E;  1Z5A A;  3EPJ A;  1ZXN A;  4DXL A;  4U3B A;  2GO4 A;  4K0K E;  3CWV A;  1XNR I;  4OO1 D;  4IZJ A;  5A6B D;  4DV0 I;  1HR0 E;  2NUF A;  3GLL A;  3OTO I;  2WBU A;  2JEB B;  4P7A A;  5A2Q C;  3C4T A;  2DIX A;  4ZYD A;  2EML A;  2RS7 A;  2JVA A;  1N0U A;  2V2Z A;  4OO1 E;  1N32 E;  5JEA B;  3T1Y E;  2O1V A;  4B3M I;  1YYO A;  4AM3 A;  1IBM I;  2AJ4 A;  4DV2 I;  2UXD I;  2EN3 A;  1K47 A;  2EN1 A;  1NCS A;  3L00 A;  4RH8 A;  3THO B;  3QT5 A;  1X3C A;  1NZ0 A;  3WU4 A;  3V2U C;  4WPY A;  2M1S A;  2UXC I;  1A1G A;  5C0X B;  2EOQ A;  2PNL A;  2EPA A;  4BS9 A;  4R1F A;  4B3T E;  2RS6 A;  4HY1 A;  2J7K A;  4P7D A;  2KHX A;  2K4V A;  2BA1 D;  2CT1 A;  2LJU A;  1E3H A;  2PO2 B;  4MYT A;  2VQF I;  3BGH A;  4WYQ B;  4QNJ A;  3VHT B;  5DNY A;  1DQ3 A;  2Q8U A;  2YTD A;  2A2C A;  2EOH A;  1WUU A;  2L92 A;  2NN6 A;  2N3G A;  3MHH C;  2VRD A;  2GHF A;  1P47 A;  1RHY A;  2EMG A;  3GON A;  4FWH A;  4WSP A; 
#chains in the Genus database with same CATH homology
 4DV7 I;  1FKA E;  4B3S E;  2V87 A;  4Z7Y A;  2LE2 A;  4FWG A;  3K1J A;  2LJH A;  3V5R A;  4Q28 A;  1ZXM A;  4JV5 E;  5IT9 C;  4LF8 I;  3ZKB A;  3PYD A;  4LF4 I;  1KIJ A;  4JI6 E;  1EKZ A;  1RR9 A;  4KHP I;  1X49 A;  1FJG E;  2G7H A;  2UUC E;  4WUD A;  1J5E I;  2LTR A;  4KZS A;  1RC7 A;  1HK7 A;  4LFA I;  2PNM A;  5GMD A;  3C4B A;  3ZZT A;  1VIS A;  3ZOQ B;  4X65 I;  4R03 A;  1GQE A;  2Z5B B;  3ZKD A;  4FN5 A;  4HYM A;  3HTX A;  2JOX A;  4ED4 A;  3T1H I;  3ZZ0 A;  1H7S A;  3DJW A;  3FIG A;  2B3T B;  1T4O A;  2KON A;  4F9B B;  1NHH A;  4LF7 E;  1OJ4 A;  3B8H A;  4DUZ I;  3J81 C;  4DR7 I;  2E1R A;  3AUZ A;  2HKJ A;  2JY9 A;  1Z0B A;  2MC6 A;  4X62 I;  5GME A;  4FWD A;  4TUG A;  2R42 A;  1PVG A;  1XNR E;  1FI4 A;  3OTO E;  2CGE A;  2UU9 I;  4WFT A;  1ZBQ A;  2EWL A;  4M30 A;  1HNW I;  4JI8 E;  4LFB I;  2CPN A;  3M6A A;  4N3O A;  2L3J A;  1IBM E;  4LFC I;  1WHN A;  4DV2 E;  4YY3 E;  4DR5 I;  4DV3 I;  3WU3 A;  4BC7 A;  3LTO A;  2L2N A;  2ZM6 I;  4YHH E;  4DV4 E;  1XMO I;  4IZK A;  4DR4 E;  4DV1 E;  1Z0V A;  1PKP A;  1MG7 A;  2O1U A;  4JI5 E;  2DMY A;  2IHR 1;  1USV A;  2R3V A;  1STU A;  1N34 I;  2VF3 A;  2DEI A;  3HJC A;  2HK3 A;  1ZM4 A;  1YZ9 A;  4ZVI A;  1DAR A;  1XNQ I;  2EZ6 A;  4R8O A;  4JI7 E;  1Z0G A;  2NUG A;  2E5L E;  2O1W A;  1MX0 A;  1H74 A;  4DV5 I;  1HNX I;  2HHH I;  3ADI A;  5BR8 E;  4DU7 A;  2GS8 A;  1I94 I;  4X64 I;  2V34 A;  3HQ1 A;  1XHK A;  3JTZ A;  4DR3 E;  5AE2 A;  2FGG A;  1A6F A;  4NXM I;  3Q6M A;  2Q2E B;  4B3R E;  4LF8 E;  4F9C B;  4OOG C;  1N33 I;  4LF4 E;  2F4V I;  4DR6 I;  2Z5C B;  4PU9 A;  4UT4 A;  4KHP E;  1ELO A;  2OI2 A;  4JG4 A;  4JI4 I;  1T4N A;  1NHI A;  2B7T A;  4LFA E;  1H7U A;  4LF9 E;  4USK A;  1RRE A;  1Z5B A;  5LMN I;  4DPX A;  5F3W A;  3J80 Q;  1O0W A;  4X65 E;  1N36 I;  2LUQ A;  2CZ9 A;  3LML A;  2E1M A;  1XMQ I;  3T1H E;  4AQY I;  4RPF A;  1B62 A;  4HAC B;  5CFF E;  4X66 I;  1USU A;  4WUC A;  4MYU A;  3H09 A;  2LBS B;  4DV6 I;  1RQ0 A;  4FW9 A;  3VK6 A;  5ADZ A;  1J26 A;  4LF6 I;  3PYG A;  1YYK A;  2FTX B;  3ZZU A;  3VYY A;  4M1K A;  4GKJ I;  5LMU I;  1ZM3 A;  4K0K I;  1X47 A;  3K85 A;  1HR0 I;  2M7Q A;  2UU9 E;  2UXB E;  1IBL E;  2L6M A;  1MU5 A;  2VQE I;  1FWL A;  1UIL A;  1UEK A;  4LFB E;  4M2Z A;  1Y4S A;  3QT6 A;  5IWA E;  4NXN I;  5FLX Q;  2Z5B A;  3ZM7 A;  4LFC E;  4DR2 E;  4DR5 E;  2JOB A;  1D6T A;  4DV3 E;  3AV0 A;  4DR1 E;  2ZM6 E;  3LLH A;  3B78 A;  4BBY A;  3LPS A;  4BMJ A;  3PYE A;  1Z0C A;  1N34 E;  4JI1 I;  2V83 A;  4M0V A;  3WU6 A;  2JR1 A;  1KVK A;  2IOQ A;  1XNQ E;  3J7Y p;  4P78 A;  2LTS A;  4DV0 E;  3JAM Q;  4DV5 E;  2KOU A;  1UHZ A;  4LTY A;  3F6G A;  2B9D A;  2UUB I;  4B3S I;  4X64 E;  4GKK I;  2L8T A;  1SR9 A;  4XTJ A;  2X36 A;  5AE3 A;  2VF1 A;  4F54 A;  2RSM A;  4B3M E;  2V85 A;  4I8O A;  2LUP B;  3J7A G;  1IBK I;  4DPW A;  2UXD E;  4JI2 I;  4PRV A;  3P1X A;  2HKE A;  1N33 E;  2WZO A;  2UXC E;  2YT4 A;  2UUC I;  3F0N A;  2DB2 A;  4DUY I;  2L3C A;  1KKH A;  3OML A;  1QU6 A;  1WXR A;  2MDR A;  3ADJ A;  3WU5 A;  5LMN E;  2LRS A;  3HPZ A;  2VQF E;  3QT7 A;  3J80 C;  1H73 A;  2JWO A;  2A2D A;  1PIE A;  3Q6N A;  1HNZ I;  1FNM A;  2X7I A;  4BC9 A;  2V8P A;  1T4L B;  4X66 E;  4LF7 I;  4LF5 I;  1KTV A;  4DV7 E;  2L2K B;  2FV4 B;  2EFG A;  4J8Z A;  4EMD A;  1ZM2 A;  4DV6 E;  1GZ6 A;  2ZBK B;  4HXZ A;  4BCA A;  2LMZ A;  2CG9 A;  4LF6 E;  2V2Q A;  4PRX A;  2WW4 A;  5LMU E;  4LU9 A;  2V89 A;  2Z5C A;  4IZJ B;  4KQV A;  3D4J A;  5T6J A;  3HUL A;  3QT8 A;  1J5E E;  1N0V C;  3F6H A;  3ADG A;  2BM0 A;  2XEX A;  2H36 X;  2VQE E;  1B63 A;  4JI8 I;  1H72 C;  4NXN E;  5FLX C;  3J7A M;  1EI1 A;  4JI0 I;  3LNU A;  4URL A;  4YY3 I;  1DI2 A;  4JI3 I;  3DF6 A;  1Z0T A;  1X48 A;  4JYA I;  4HAC A;  2UUA I;  4DU8 A;  4YHH I;  4DUZ E;  4DV4 I;  2B7V A;  3P06 A;  4DPY A;  4DR4 I;  4L8N A;  4USM A;  4DR7 E;  4DV1 I;  4JI5 I;  3HXL A;  2L2M A;  1FWK A;  4P52 A;  4OX9 I;  2V2V A;  4X62 E;  4JI1 E;  4DPU A;  2GQ0 A;  2HK2 A;  1Y6Z A;  4JI7 I;  2E5L I;  2F8B A;  1WHQ A;  3JAM C;  5A2Q Q;  5BR8 I;  3K17 A;  5LL6 R;  2UUB E;  2NA2 A;  1BKN A;  4GKK E;  3VYX A;  1HNW E;  4DPT A;  1N32 I;  4TUI A;  3T1Y I;  4DR3 I;  4F9A B;  1Z5C A;  4IZJ D;  1IBK E;  4JI2 E;  4B3R I;  2N3H A;  1XMO E;  2RTX A;  1Z0W A;  1EA6 A;  3IWB A;  2MC5 A;  3MSW A;  4B3T I;  4DUY E;  3RMP A;  3PYF A;  3IWD A;  2M4I A;  4LF9 I;  1S16 A;  2DEJ A;  2VE7 C;  2IOP A;  3K6Q A;  5AAS A;  1HNZ E;  2HHH E;  2O1T A;  4GEQ B;  1HNX E;  4DMI A;  1QZR A;  4X8W A;  2V88 A;  1I94 E;  4LF5 E;  2BV3 A;  4DKK A;  2NPF A;  2LJP A;  2HFS A;  2NUE A;  1NHJ A;  2V8Q B;  4JV5 I;  5IT9 Q;  4NXM E;  1Z59 A;  1ZBT A;  1ZM9 A;  2YZT A;  2F4V E;  4DR6 E;  5FWK A;  4JI6 I;  2ZIT A;  1FJG I;  3HPS A;  4WUB A;  4JI4 E;  2UXB I;  1IBL I;  2DSY A;  1Y4U A;  3JU0 A;  2BM1 A;  3B82 A;  5IWA I;  3KWR A;  1N36 E;  1U2R A;  4DR2 I;  4JI0 E;  4JI3 E;  4I3H A;  3Q1Q A;  1YYW A;  4L5N C;  1XMQ E;  4AQY E;  2V86 A;  4DR1 I;  4JYA E;  2UUA E;  3J81 Q;  2ODR C;  4IZK B;  3H4L A;  4Z7C A;  5AE1 A;  3IWC A;  3ADL A;  2L33 A;  1S4E A;  4OX9 E;  1Z0E A;  2HFU A;  3PRY A;  2Z5E A;  2ODR D;  4UTG A;  5L3J A;  4GKJ E;  1Z5A A;  1ZXN A;  4DXL A;  4K0K E;  3CWV A;  1XNR I;  4IZJ A;  4DV0 I;  1HR0 E;  2NUF A;  3OTO I;  4P7A A;  5A2Q C;  3C4T A;  2DIX A;  2RS7 A;  2JVA A;  1N0U A;  2V2Z A;  1N32 E;  3T1Y E;  2O1V A;  4B3M I;  1YYO A;  1IBM I;  2AJ4 A;  4DV2 I;  2UXD I;  1K47 A;  3WU4 A;  3QT5 A;  1NZ0 A;  3V2U C;  4WPY A;  2M1S A;  2UXC I;  2PNL A;  4R1F A;  4BS9 A;  4B3T E;  2RS6 A;  4HY1 A;  2J7K A;  4P7D A;  2KHX A;  2K4V A;  4MYT A;  2VQF I;  4WYQ B;  5DNY A;  1DQ3 A;  2A2C A;  1WUU A;  2L92 A;  2N3G A;  4FWH A;  3GON A;  4WSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...