1XNQE

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1xnqE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1xnqE02
2E5LI 4M2ZA 4JI2I 5IWAI 4DV7E 3PYDA 3T1HE 4NXME 2IHR1 4JYAE 5LL6R 1XMOI 2L2KB 4DR4I 4X62E 1N36I 2OI2A 2J7KA 4LF5I 4ZVIA 5BR8E 1I94E 4LF7E 3T1HI 1NHJA 3K17A 1Z5AA 4WUBA 2UUAE 2F4VE 1HNXE 2AJ4A 4DR7E 4DUZI 1X48A 3ZM7A 2Q2EB 5IWAE 4GKJI 2X7IA 1J5EI 3F0NA 4DPWA 2X36A 1STUA 2ZM6I 1S16A 2F4VI 4K0KI 1ZXMA 1RC7A 3LLHA 4JI6E 4DV0I 2JVAA 2LUQA 4WUCA 1VISA 2HFSA 4JI4E 1YYKA 4RPFA 2HKJA 3JAMC 1H73A 3B78A 3Q1QA 2VQEE 1RR9A 4LF4E 4JV5I 1IBLE 4GKKE 1KIJA 1X49A 1WHNA 4MYUA 2UXCI 2BV3A 3HULA 3LTOA 4I3HA 2DB2A 4USKA 2YT4A 4DV6I 3WU6A 3QT8A 3ADJA 3OTOE 4DR4E 2V2ZA 3PYGA 4X64I 1HNXI 4LFCI 4FWDA 3ZZUA 3LNUA 4Z7CA 2NUGA 5GMDA 2V8PA 5IT9C 1DI2A 1IBLI 4GKKI 2CPNA 2MDRA 1FNMA 2BM0A 2UUBE 5A2QQ 4DV5I 1HR0I 2A2CA 4X62I 4B3MI 4X8WA 1Z0TA 4JI7E 1BKNA 5LMUI 5LMNE 2HHHE 2E1RA 4WYQB 4DU8A 1A6FA 3VYYA 1XNRI 1H72C 4DV1I 4JG4A 4WUDA 2N3HA 3H4LA 2V2VA 3WU5A 4DUZE 3PYEA 2LRSA 3WU4A 3ADGA 4LFBE 3ADIA 3ZZTA 4JI1I 4P7AA 4AQYE 1NHHA 4URLA 4KHPE 2DEIA 4K0KE 1FJGE 2LJPA 1PVGA 2L3JA 2UUCI 1N32E 2UU9E 5L3JA 4B3SI 1HNZE 2A2DA 4LF6E 4LF9E 4LFAE 1ZXNA 4LF8I 3LPSA 2NUEA 4DR5I 3J7AG 1YZ9A 4NXMI 3J81C 2L2MA 2HK2A 4DV3I 1B62A 4JI3I 3CWVA 4UT4A 4DV6E 4HY1A 4EMDA 4NXNI 2ZM6E 4JI0I 1U2RA 1HNWI 4HXZA 2L33A 3J80C 5FLXC 4JI5E 5GMEA 1ZM3A 4DR2I 2V34A 4DPYA 3V5RA 2L2NA 2GS8A 4WFTA 2DMYA 4DR1I 1H7SA 4YHHI 4PRVA 3K1JA 3PYFA 4FW9A 4JI0E 4B3ME 4LF4I 4DV1E 2LUPB 2L3CA 1XMQI 4KHPI 1EI1A 2HKEA 1HNZI 4DXLA 1J26A 1X47A 2B7TA 2E5LE 3J7Yp 1WHQA 5FLXQ 4DPXA 5BR8I 1I94I 4X66E 4DR3E 1KKHA 4LF5E 4LF8E 1Z0VA 4DV2I 2DIXA 1HR0E 1KTVA 4USMA 1XMOE 4JYAI 1UILA 1MX0A 1Z0WA 1FI4A 1O0WA 1N36E 4R1FA 2UUCE 4DV4E 2LTSA 4KQVA 3ZZ0A 1N33I 5LMNI 4YY3E 2V2QA 1QU6A 1XNQI 1NZ0A 1Z5BA 4DUYE 4B3TE 2KHXA 3WU3A 1ZM4A 4MYTA 1H74A 3B8HA 4LFCE 4OX9E 4DPUA 2LTRA 3GONA 4B3RE 4JI2E 2NA2A 3VYXA 1Z0EA 4JI8I 1RREA 3JAMQ 1WUUA 1IBME 4PU9A 4JI1E 1FKAE 1Z0CA 1ELOA 4X66I 4DR3I 4NXNE 1J5EE 1EA6A 2UXBE 3T1YI 4DR1E 1NHIA 5CFFE 4JI6I 2XEXA 1PKPA 2LJHA 4DR7I 4DV0E 1KVKA 3QT7A 2ZITA 3D4JA 4B3TI 3OTOI 1S4EA 3C4TA 2EZ6A 1IBKE 4DV3E 4JI3E 2NPFA 3QT6A 5A2QC 1QZRA 2B3TB 1PIEA 2CZ9A 1EKZA 1Z5CA 3J7AM 2R3VA 1XNRE 4X64E 4DV2E 4P52A 4GKJE 4DKKA 4HYMA 1T4OA 4FWGA 2LBSB 4X65E 4YY3I 4DR5E 2UXDE 1XNQE 1RQ0A 1N34E 4XTJA 1MG7A 4DR6I 1ZM9A 4UTGA 2UUAI 2UXCE 2BM1A 2UUBI 3J81Q 3V2UC 3QT5A 4JV5E 1GQEA 4B3RI 4LFBI 1Z0BA 4DV7I 2N3GA 4OX9I 3ZKDA 4JI7I 3P1XA 1UEKA 1Z0GA 1IBMI 4DR6E 4ED4A 1H7UA 1ZM2A 4LF7I 4DU7A 4YHHE 1ZBTA 1FJGI 1UHZA 2WW4A 4AQYI 4DUYI 1XMQE 2DEJA 1YYWA 3M6AA 3HTXA 1HNWE 1N34I 5LMUE 2R42A 2HHHI 1D6TA 4LF6I 4M1KA 2NUFA 1DARA 4JI8E 1YYOA 1IBKI 1FWLA 4OOGC 2UU9I 4DR2E 2UXDI 3J80Q 1N0UA 2B7VA 2RSMA 2VQFI 2RTXA 1N33E 4X65I 4LF9I 4LFAI 4FN5A 4DV5E 3B82A 2HFUA 3T1YE 2UXBI 4DPTA 1N32I 4JI4I 5IT9Q 2HK3A 3ZKBA 1Z59A 3C4BA 2VQFE 2VQEI 4PRXA 1T4NA 4B3SE 2RS7A 3ADLA 4HACA 2RS6A 2ZBKB 4DV4I 1XHKA 4M30A 2JY9A 1T4LB 1MU5A 1B63A 4Z7YA 1OJ4A 1K47A 2EFGA 2VF3A 4JI5I 1N0VC 4FWHA 1FWKA 4HACB
chains in the Genus database with same CATH superfamily
2E5LI 2YWQA 3VK6A 4LU9A 2JR1A 4M2ZA 3AUZA 4JI2I 2RPCA 5IWAI 2EPOA 4DV7E 3PYDA 2CSHA 2CGEA 3T1HE 2V88A 1YPNA 3B4TA 4NXME 2IHR1 2JEAB 3EPLA 2EMHA 1UN6B 1MEYC 4JYAE 5LL6R 1XMOI 2L2KB 4DR4I 4X62E 2JP9A 1N36I 2EL6A 1AAYA 2VRDA 1DQ3A 1E3HA 2OI2A 2J7KA 2EMCA 4LF5I 4IFDB 4ZVIA 2GQ0A 2M7QA 4IFDC 5BR8E 1I94E 1G2FC 5FWKA 4M9VC 2Z5CB 2C39A 2PNZB 1DGCA 4FK5C 2EN7A 4BCAA 4LF7E 2O1VA 1A1JA 3T1HI 2Q8UA 1NHJA 5JEAA 5A6KA 3P3EA 3K17A 3MSWA 2CTDA 1Z5AA 4WUBA 2UUAE 4BBYA 3DF6A 5A6JA 4R2QA 1XXEA 5K36B 3F6GA 2BBGA 2F4VE 1ZR9A 4L5NC 4BMJA 2DSYA 2EMWA 1HNXE 2AJ4A 4DR7E 4DUZI 5KL2A 1X48A 3UK3C 3ZM7A 2Q2EB 2MKDA 5IWAE 4RH8A 2F1DA 4R2CA 4GKJI 2X7IA 5AE1A 2CT1A 1ZBQA 3P76A 1J5EI 4Q28A 2EOIA 4TUIA 3F0NA 4DPWA 1EH6A 2PO1A 2X36A 2WBTA 2N8XA 4OKGA 1STUA 2MC6A 3EQ1A 2ZM6I 1S16A 2MKNA 5KL3A 2F4VI 4K0KI 2BA0G 1ZXMA 1RC7A 2YTGA 3LLHA 4JI6E 3GMEA 4FW4A 5DNXA 4DV0I 2JVAA 4O5GA 2LUQA 4WUCA 1VISA 2YTPA 3CDIA 2HFSA 3MHSC 2E72A 5A6AA 4JI4E 1YYKA 4RPFA 2O1TA 4O43A 3JAMC 3KZZA 1PJSA 2HKJA 1H73A 5JEAF 3B78A 4F9AB 4OO1C 2EM6A 3HXLA 2VQEE 4LF4E 1RR9A 2GO4A 3Q1QA 1IBLE 4GKKE 4IFDA 1KIJA 1Y4SA 1X49A 1WHNA 1A1IA 4MYUA 2UXCI 2ENHA 2BV3A 3HULA 3LTOA 2WZOA 3ECRA 2C39B 3HJCA 4I3HA 2RSIA 2DB2A 1X6HA 2ODRC 2JWOA 2YT4A 2WCC3 1UDSA 4F6MA 4USKA 4DV6I 4AM3A 3WU6A 3QT8A 3ADJA 3OTOE 4DR4E 2V2ZA 1WXRA 1YUIA 3PYGA 4X64I 1HNXI 4LFCI 4R03A 3EPHA 4FWDA 2YTQA 3ZZUA 4U3DA 3LNUA 4Z7CA 3C6MA 2NUGA 5GMDA 2V8PA 5IT9C 5DRRA 1DI2A 3DJWA 1IBLI 4GKKI 2CPNA 2MDRA 1FNMA 2BM0A 1MGTA 2YU8A 2UUBE 2YTDA 5A2QQ 3PS2A 1JK1A 2EM4A 2EOXA 2EPUA 4BC9A 2C38A 4HACB 4DV5I 1HR0I 2IOQA 2A2CA 4X62I 1EH7A 4B3MI 4X8WA 1Z0TA 2YTNA 4JI7E 1BKNA 5LMUI 5LMNE 2HHHE 2E1RA 2LVHA 4WYQB 5A6BD 1T39A 1B69A 4DU8A 4Q35B 1A6FA 3VYYA 1JK2A 1TF3A 3M99B 1OYRA 2PO1B 5AC5A 4RHBB 1XNRI 1H72C 4BHCA 2EM7A 2DLKA 2EQ3A 2WP8B 4JG4A 4WUDA 1SFEA 3M85D 4DV1I 2N3HA 3H4LA 2V2VA 3HKMA 3THNA 3WU5A 2I9IA 2R1FA 2V8QB 4DUZE 4F2JC 5DROA 3PYEA 5LLQA 2NN6B 4MLQA 3F6HA 2LRSA 3GLLA 3IWCA 3WU4A 5JEAE 3ADGA 4LFBE 4R2EA 3ADIA 3ZZTA 2MDGA 2HGHA 4NZVA 2IESA 4JI1I 4P7AA 1YSAC 4P7DA 4AQYE 1NHHA 1TF6A 4KHPE 4URLA 2JYAA 2DEIA 4K0KE 1FJGE 2LJPA 1RMDA 2V87A 2R76A 2FGGA 5C0XF 3JTZA 3BF2A 4DMIA 1PVGA 2L3JA 4KZSA 2EORA 3IWDA 2UUCI 4MU1A 1N32E 2FV4B 2AE8A 2UU9E 2JPAA 5L3JA 4B3SI 2O3ZA 5KL4A 2WBUA 1X6FA 4GZNC 1HNZE 4LF6E 2A2DA 4LF9E 4LFAE 1Y5YA 2NN6A 1ZXNA 4IFDE 4OO1F 4LF8I 3LPSA 3BIDA 2EJ4A 2NUEA 1Z1BA 2LT7A 4DR5I 3KWRA 3J7AG 2C38B 4O24A 1YZ9A 2EPXA 2EN6A 2LMZA 4P78A 4NXMI 5K36A 2EMAA 2L2MA 3J81C 2DRPA 5K36F 4ZYDA 4WSPA 1A1HA 2HK2A 1B62A 4DV3I 3CWVA 4JI3I 2YSPA 2EM2A 4FW6A 2LV2A 3L7ZA 4UT4A 2PRTA 4DV6E 4HY1A 5JEAD 2EOSA 2EPNA 4EMDA 1ZU1A 4NXNI 4WSGA 1X3CA 3HPSA 2ZM6E 1IQOA 4JI0I 1U2RA 5AASA 1HNWI 2EOZA 3J80C 2L33A 4HXZA 2ODRD 3JU0A 4IS9A 4FW7A 2WP8A 2K4VA 5FLXC 4J3DA 2JXPA 3K6QA 4OO1B 3FIGA 4JI5E 1OYPA 5GMEA 2H36X 1ZM3A 4QNKA 3U1KA 4BHBA 4DR2I 2V34A 2NN6C 4DPYA 1RHYA 3V5RA 2L2NA 2GS8A 4WFTA 2GPIA 4JV5I 2V83A 1HK7A 2LO3A 2DMYA 4DR1I 1H7SA 4YHHI 3M85G 5IV8B 4PRVA 3K1JA 3L7ZB 3PYFA 3H1CA 4FW9A 1X5WA 4JI0E 4B3ME 4LF4I 4DV1E 2EPKX 2M1SA 2EL5A 2YTOA 2LUPB 3PS3A 2K7IA 5A69A 4OO1D 2BB8A 2L3CA 1XMQI 4KHPI 1EI1A 4F9CB 2HKEA 1HNZI 3VHTB 4DXLA 1J26A 1X47A 2EMLA 2B7TA 1GZ6A 5T6JA 2E5LE 1UDQA 2NABA 4O4KA 2D9HA 4IFDD 3J7Yp 2EQ0A 2EPRA 2EM3A 1WHQA 4R8OA 4GQUA 5FLXQ 5K36E 4DPXA 1Y6ZA 2LCEA 5BR8I 2EOOA 4X66E 4DR3E 1I94I 4I8OA 4LF5E 1KKHA 3PS1A 4LF8E 5ELWA 1Z0VA 4M0VA 5KL7A 2DIXA 4DV2I 1HR0E 1ZAAC 2EM8A 1KTVA 4USMA 1XMOE 3HPZA 3KZYA 1UILA 4R2DA 4L8NA 1MX0A 1Z0WA 4JYAI 2JEBB 1FI4A 1O0WA 5TSEA 2JOXA 1N36E 4R1FA 4OO1A 2UUCE 2YTIA 4DV4E 2LTSA 4KQVA 4LPFA 3ZZ0A 1N33I 3P3CA 2EM0A 2YRHA 5LMNI 4F6NA 5AE2A 4YY3E 5C0XE 1P42A 2V2QA 1QU6A 3QG5C 2EOYA 2EOMA 2VESA 1XNQI 2LJUA 1NZ0A 2GHFA 4DUYE 1Z5BA 4B3TE 2KHXA 3WU3A 2EOHA 4IZJD 1ZM4A 3MHHC 1USUA 5AC4A 4MYTA 1H74A 4GEQB 4OO1E 3B8HA 4LFCE 4OX9E 4DPUA 4HTGA 2V85A 2LTRA 1UDOA 3GONA 4QNJA 2EN4A 4J8ZA 4JI2E 4B3RE 2EOEA 2L8TA 2JEBA 2NA2A 3VYXA 1Z0EA 4JI8I 1RREA 1P47A 3JAMQ 1WUUA 1OYSA 1IBME 1PJTA 2A25A 4PU9A 1Y4UA 2BR2A 3K85A 4JI1E 1VI7A 2C37B 2EPZA 2DGCA 4NHRA 3EPJA 1YFHA 1UDNA 1FKAE 2EQ1A 4MLVA 5F3WA 1ELOA 1Z0CA 4X66I 4DR3I 2YTFA 4MDTA 3OMLA 3BBGA 4NXNE 4ISAA 2EM9A 2HJJA 2M9AA 2IERA 4FW5A 1J5EE 1WJPA 1EA6A 1A1KA 2UXBE 4DR1E 1NHIA 5CFFE 5C0XD 3T1YI 2EN8A 1G2DC 1A1GA 4JI6I 2XEXA 4BA2B 1YH8A 4X9JA 1LLMC 1UBDC 1IQSA 1PKPA 2LJHA 2LE2A 3CDJA 4DV0E 4DR7I 2G7HA 2CVEA 1KVKA 1PJQA 2YU5A 3QT7A 5C0XB 2ZITA 4ZYHA 3D4JA 4B3TI 4BC7A 1X6EA 1KJKA 3OTOI 2YRKA 1F2IG 1R6LA 4N4RB 5DRPA 1S4EA 3C4TA 4LTYA 2EZ6A 1IBKE 4DV3E 4JI3E 2NPFA 3TQMA 3QT6A 1TN9A 2EOJA 2NN6F 5A2QC 5EL9A 1QZRA 3BGHA 2O1WA 1YUJA 2BA1G 3KRNA 2B3TB 1PIEA 4BA1B 2L6MA 3M7ND 2EMBA 1NEIA 2EMKA 2CZ9A 2PO2A 1EKZA 4R2RA 2J65A 1Z5CA 2PO0B 2PNMA 3J7AM 2R3VA 2JE6A 2KONA 4X64E 4DV2E 1XNRE 1Y60A 4P52A 4R2AA 2EOFA 2HC5A 4DKKA 4GKJE 5EKWA 4MU0A 2YTEA 1PDAA 4HYMA 3LMLA 1T4OA 3ZOQB 4FWGA 2LBSB 5A6BA 4AIDA 2JOBA 4X65E 4YY3I 4F54A 5K36C 2J7JA 3NZKA 4DR5E 2B9DA 2V86A 2JT2A 1AH5A 4IZKA 2C37A 4WX9A 2UXDE 4MU4A 4IJDA 1XNQE 1RQ0A 4IZJA 1N34E 4XTJA 1E3PA 2EM5A 4TUGA 1MG7A 5AE3A 4DR6I 1ZM9A 4UTGA 2UUAI 2WNRA 4IFDF 3DD6A 2UXCE 2EE8A 3THOB 2BM1A 2UUBI 2EMZA 3J81Q 3V2UC 2PO0A 4AIMA 4JV5E 4ZYEA 3QT5A 1GQEA 4NBQA 4B3RI 4LFBI 1Z0BA 2JE6B 4LCHA 4DV7I 2N3GA 5DRQA 4OX9I 5ADZA 2GLIA 3ZKDA 4JI7I 4F9BB 5C0XC 2EPPA 3P1XA 2Z5BB 2PNLA 2ELZA 2EN3A 3IWBA 2EWLA 1UEKA 1GTKA 2E1MA 2EMIA 2FTXB 2VE7C 3L00A 2I13A 2KOUA 4DR6E 1Z0GA 1IBMI 4ED4A 1EH8A 4WXDA 5DNLA 1H7UA 1ZM2A 2VF1A 1NCSA 5JEAB 4LF7I 4DU7A 1SR9A 4YHHE 1ZBTA 4WXCA 2ELYA 2WBSA 2BA0D 2IOPA 1FJGI 1L4SA 4N3OA 1UHZA 2ENAA 2NN6D 2WW4A 4AQYI 4DUYI 1XMQE 4BA1A 2NN6E 4IZKB 2EPCA 3U1YA 2DEJA 2EN2A 1USVA 1A1FA 1WRJA 1YYWA 3M6AA 3HTXA 1HNWE 4FW3A 1N34I 2BA1D 4OZEA 2MC5A 4KWYA 5LMUE 2R42A 2HHHI 3M7NG 1BBOA 1D6TA 3PRYA 1QNTA 4LCGA 4M1KA 4LF6I 2RQLA 3P06A 2NUFA 1DARA 4JI8E 3RMPA 1YYOA 1IBKI 1FWLA 4OOGC 2UU9I 4DR2E 4IZJB 2UXDI 3J80Q 1N0UA 2B7VA 1N3GA 2EMYA 3HQ1A 2WNRB 2RSMA 2VQFI 2BR2B 3GCMA 2EPMX 3AV0A 2RTXA 1N33E 4X65I 1IMUA 4LF9I 4LFAI 1KYQA 4U3BA 2EMFA 4FN5A 4LOMA 4MU3A 4DV5E 3B82A 2HFUA 3T1YE 2UXBI 4DPTA 4HEIA 1N32I 4JI4I 2Z5BA 2JEAA 4ZYGA 5IT9Q 2EPAA 2HK3A 3ZKBA 1Z59A 3C4BA 3Q6MA 4BA2A 2DLQA 2V89A 2VQFE 2VQEI 2L92A 3P3GA 1T4NA 3Q6NA 5KL5A 5DNYA 4PRXA 1BBGA 4B3SE 1YHCA 2O1UA 5JEAC 2YZTA 4WPYA 5C0XA 2RS7A 2YTJA 3ADLA 2Z5EA 2PNZA 2Z5CA 2EL4A 2EMXA 4R2SA 1T38A 2EOQA 2EP3A 2F8BA 1BB8A 4HACA 4IS1C 2RS6A 4LCFA 2ENCA 2GO3A 2ZBKB 4MQYA 2CG9A 4DV4I 3H09A 1XHKA 1A1LA 4M30A 2YRMA 3UHMA 2JY9A 5KL6A 4R2PA 1T4LB 5IXMB 1MU5A 2PO2B 2EPLX 1B63A 4Z7YA 2EMGA 1OJ4A 1K47A 2ADRA 5K36D 2EFGA 2VF3A 4BS9A 2YPNA 4JI5I 2DMIA 1R6MA 1N0VC 4FWHA 2YSOA 3C6KA 3EPKA 2EN1A 1FWKA 2M4IA
chains in the Genus database with same CATH topology
2E5LI 3VK6A 4LU9A 2JR1A 4M2ZA 3AUZA 4JI2I 5IWAI 4DV7E 3PYDA 2CGEA 3T1HE 2V88A 4NXME 2IHR1 4JYAE 5LL6R 1XMOI 2L2KB 4DR4I 4X62E 1N36I 1DQ3A 2OI2A 2J7KA 4LF5I 4ZVIA 2GQ0A 2M7QA 5BR8E 1I94E 5FWKA 2Z5CB 4BCAA 4LF7E 2O1VA 3T1HI 1NHJA 3K17A 3MSWA 1Z5AA 4WUBA 2UUAE 4BBYA 3DF6A 3F6GA 2F4VE 4L5NC 4BMJA 2DSYA 1HNXE 2AJ4A 4DR7E 4DUZI 1X48A 3ZM7A 2Q2EB 5IWAE 4GKJI 2X7IA 5AE1A 1ZBQA 1J5EI 4Q28A 4TUIA 3F0NA 4DPWA 2X36A 1STUA 2MC6A 2ZM6I 1S16A 2F4VI 4K0KI 1ZXMA 1RC7A 3LLHA 4JI6E 4DV0I 2JVAA 2LUQA 4WUCA 1VISA 2HFSA 4JI4E 1YYKA 4RPFA 2O1TA 3JAMC 2HKJA 1H73A 3B78A 4F9AB 3HXLA 2VQEE 1RR9A 4LF4E 3Q1QA 4JV5I 1IBLE 4GKKE 1KIJA 1Y4SA 1X49A 1WHNA 4MYUA 2UXCI 2BV3A 3HULA 3LTOA 2WZOA 3HJCA 4I3HA 2DB2A 2ODRC 2JWOA 2YT4A 4USKA 4DV6I 3WU6A 3QT8A 3ADJA 3OTOE 4DR4E 2V2ZA 1WXRA 3PYGA 4X64I 1HNXI 4LFCI 4R03A 4FWDA 3ZZUA 3LNUA 4Z7CA 2NUGA 5GMDA 2V8PA 5IT9C 1DI2A 3DJWA 1IBLI 4GKKI 2CPNA 2MDRA 1FNMA 2BM0A 2UUBE 5A2QQ 4HACB 4BC9A 4DV5I 1HR0I 2IOQA 2A2CA 4X62I 4B3MI 4X8WA 1Z0TA 4JI7E 1BKNA 5LMUI 5LMNE 2HHHE 2E1RA 4WYQB 4DU8A 1A6FA 3VYYA 1XNRI 1H72C 4DV1I 4JG4A 4WUDA 2N3HA 3H4LA 2V2VA 3WU5A 2V8QB 4DUZE 3PYEA 3F6HA 2LRSA 3IWCA 3WU4A 3ADGA 4LFBE 3ADIA 3ZZTA 4JI1I 4P7AA 4P7DA 4AQYE 1NHHA 4URLA 4KHPE 2DEIA 4K0KE 1FJGE 2LJPA 2V87A 2FGGA 3JTZA 4DMIA 1PVGA 2L3JA 4KZSA 3IWDA 2UUCI 1N32E 2FV4B 2UU9E 5L3JA 4B3SI 1HNZE 2A2DA 4LF6E 4LF9E 4LFAE 1ZXNA 4LF8I 3LPSA 2NUEA 4DR5I 3KWRA 3J7AG 1YZ9A 2LMZA 4P78A 4NXMI 3J81C 2L2MA 4WSPA 2HK2A 4DV3I 1B62A 4JI3I 3CWVA 4UT4A 4DV6E 4HY1A 4EMDA 4NXNI 3HPSA 2ZM6E 4JI0I 1U2RA 5AASA 1HNWI 3J80C 2L33A 4HXZA 2ODRD 3JU0A 2K4VA 5FLXC 3K6QA 3FIGA 4JI5E 5GMEA 2H36X 1ZM3A 4DR2I 2V34A 4DPYA 3V5RA 2L2NA 2GS8A 4WFTA 2V83A 1HK7A 2DMYA 4DR1I 1H7SA 4YHHI 4PRVA 3K1JA 3PYFA 4FW9A 4JI0E 4B3ME 4LF4I 4DV1E 2M1SA 2LUPB 2L3CA 1XMQI 4KHPI 1EI1A 4F9CB 2HKEA 1HNZI 4DXLA 1J26A 1X47A 5T6JA 2B7TA 1GZ6A 2E5LE 3J7Yp 1WHQA 4R8OA 5FLXQ 4DPXA 1Y6ZA 5BR8I 1I94I 4X66E 4DR3E 4I8OA 1KKHA 4LF5E 4LF8E 1Z0VA 4M0VA 4DV2I 2DIXA 1HR0E 1KTVA 4USMA 1XMOE 3HPZA 4JYAI 1UILA 1MX0A 4L8NA 1Z0WA 1FI4A 1O0WA 1N36E 2JOXA 4R1FA 2UUCE 4DV4E 2LTSA 4KQVA 3ZZ0A 1N33I 5LMNI 5AE2A 4YY3E 2V2QA 1QU6A 1XNQI 1NZ0A 1Z5BA 4DUYE 4B3TE 2KHXA 3WU3A 4IZJD 1ZM4A 1USUA 4MYTA 1H74A 4GEQB 3B8HA 4LFCE 4OX9E 4DPUA 2V85A 2LTRA 3GONA 4J8ZA 4B3RE 4JI2E 2L8TA 2NA2A 3VYXA 1Z0EA 4JI8I 1RREA 3JAMQ 1WUUA 1IBME 4PU9A 1Y4UA 3K85A 4JI1E 1FKAE 1Z0CA 5F3WA 1ELOA 4X66I 4DR3I 3OMLA 4NXNE 1J5EE 1EA6A 2UXBE 3T1YI 4DR1E 1NHIA 5CFFE 4JI6I 2XEXA 1PKPA 2LJHA 2LE2A 4DR7I 4DV0E 2G7HA 1KVKA 3QT7A 2ZITA 3D4JA 4B3TI 4BC7A 3OTOI 1S4EA 3C4TA 4LTYA 2EZ6A 1IBKE 4DV3E 4JI3E 2NPFA 3QT6A 5A2QC 1QZRA 2O1WA 2B3TB 1PIEA 2L6MA 2CZ9A 1EKZA 1Z5CA 2PNMA 3J7AM 2R3VA 2KONA 4X64E 4DV2E 1XNRE 4P52A 4GKJE 4DKKA 4HYMA 1T4OA 3ZOQB 4FWGA 2LBSB 2JOBA 4X65E 4YY3I 4F54A 4IZKA 4DR5E 2B9DA 2V86A 2UXDE 1XNQE 1RQ0A 4IZJA 1N34E 4XTJA 4TUGA 1MG7A 5AE3A 4DR6I 1ZM9A 4UTGA 2UUAI 2UXCE 2BM1A 2UUBI 3J81Q 3V2UC 4JV5E 3QT5A 1GQEA 4B3RI 4LFBI 1Z0BA 4DV7I 2N3GA 4OX9I 5ADZA 3ZKDA 4JI7I 4F9BB 3P1XA 2Z5BB 2PNLA 3IWBA 2EWLA 1UEKA 2E1MA 1Z0GA 2FTXB 2VE7C 1IBMI 2KOUA 4DR6E 4ED4A 1H7UA 1ZM2A 2VF1A 4LF7I 4DU7A 1SR9A 4YHHE 1ZBTA 2IOPA 1FJGI 4N3OA 1UHZA 2WW4A 4AQYI 4DUYI 1XMQE 4IZKB 2DEJA 1USVA 1YYWA 3M6AA 3HTXA 1HNWE 1N34I 2MC5A 5LMUE 2R42A 2HHHI 1D6TA 3PRYA 4LF6I 4M1KA 3P06A 2NUFA 1DARA 4JI8E 3RMPA 1YYOA 1IBKI 1FWLA 4OOGC 2UU9I 4DR2E 4IZJB 2UXDI 2M4IA 3J80Q 1N0UA 2B7VA 3HQ1A 2RSMA 2VQFI 3AV0A 2RTXA 1N33E 4X65I 4LF9I 4LFAI 4FN5A 4DV5E 3B82A 2HFUA 3T1YE 2UXBI 4DPTA 1N32I 4JI4I 2Z5BA 5IT9Q 2HK3A 3ZKBA 1Z59A 3C4BA 3Q6MA 2V89A 2VQFE 2VQEI 2L92A 3Q6NA 1T4NA 4PRXA 5DNYA 4B3SE 2O1UA 2YZTA 4WPYA 2RS7A 3ADLA 2Z5EA 2Z5CA 2F8BA 4HACA 2RS6A 2ZBKB 2CG9A 4DV4I 3H09A 1XHKA 4M30A 2JY9A 1T4LB 1MU5A 1B63A 4Z7YA 1OJ4A 1K47A 2EFGA 2VF3A 4BS9A 4JI5I 1N0VC 4FWHA 1FWKA 3LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L I;  4M2Z A;  4JI2 I;  5IWA I;  4DV7 E;  3PYD A;  3T1H E;  4NXM E;  2IHR 1;  4JYA E;  5LL6 R;  1XMO I;  2L2K B;  4DR4 I;  4X62 E;  1N36 I;  2OI2 A;  2J7K A;  4LF5 I;  4ZVI A;  5BR8 E;  1I94 E;  4LF7 E;  3T1H I;  1NHJ A;  3K17 A;  1Z5A A;  4WUB A;  2UUA E;  2F4V E;  1HNX E;  2AJ4 A;  4DR7 E;  4DUZ I;  1X48 A;  3ZM7 A;  2Q2E B;  5IWA E;  4GKJ I;  2X7I A;  1J5E I;  3F0N A;  4DPW A;  2X36 A;  1STU A;  2ZM6 I;  1S16 A;  2F4V I;  4K0K I;  1ZXM A;  1RC7 A;  3LLH A;  4JI6 E;  4DV0 I;  2JVA A;  2LUQ A;  4WUC A;  1VIS A;  2HFS A;  4JI4 E;  1YYK A;  4RPF A;  2HKJ A;  3JAM C;  1H73 A;  3B78 A;  3Q1Q A;  2VQE E;  1RR9 A;  4LF4 E;  4JV5 I;  1IBL E;  4GKK E;  1KIJ A;  1X49 A;  1WHN A;  4MYU A;  2UXC I;  2BV3 A;  3HUL A;  3LTO A;  4I3H A;  2DB2 A;  4USK A;  2YT4 A;  4DV6 I;  3WU6 A;  3QT8 A;  3ADJ A;  3OTO E;  4DR4 E;  2V2Z A;  3PYG A;  4X64 I;  1HNX I;  4LFC I;  4FWD A;  3ZZU A;  3LNU A;  4Z7C A;  2NUG A;  5GMD A;  2V8P A;  5IT9 C;  1DI2 A;  1IBL I;  4GKK I;  2CPN A;  2MDR A;  1FNM A;  2BM0 A;  2UUB E;  5A2Q Q;  4DV5 I;  1HR0 I;  2A2C A;  4X62 I;  4B3M I;  4X8W A;  1Z0T A;  4JI7 E;  1BKN A;  5LMU I;  5LMN E;  2HHH E;  2E1R A;  4WYQ B;  4DU8 A;  1A6F A;  3VYY A;  1XNR I;  1H72 C;  4DV1 I;  4JG4 A;  4WUD A;  2N3H A;  3H4L A;  2V2V A;  3WU5 A;  4DUZ E;  3PYE A;  2LRS A;  3WU4 A;  3ADG A;  4LFB E;  3ADI A;  3ZZT A;  4JI1 I;  4P7A A;  4AQY E;  1NHH A;  4URL A;  4KHP E;  2DEI A;  4K0K E;  1FJG E;  2LJP A;  1PVG A;  2L3J A;  2UUC I;  1N32 E;  2UU9 E;  5L3J A;  4B3S I;  1HNZ E;  2A2D A;  4LF6 E;  4LF9 E;  4LFA E;  1ZXN A;  4LF8 I;  3LPS A;  2NUE A;  4DR5 I;  3J7A G;  1YZ9 A;  4NXM I;  3J81 C;  2L2M A;  2HK2 A;  4DV3 I;  1B62 A;  4JI3 I;  3CWV A;  4UT4 A;  4DV6 E;  4HY1 A;  4EMD A;  4NXN I;  2ZM6 E;  4JI0 I;  1U2R A;  1HNW I;  4HXZ A;  2L33 A;  3J80 C;  5FLX C;  4JI5 E;  5GME A;  1ZM3 A;  4DR2 I;  2V34 A;  4DPY A;  3V5R A;  2L2N A;  2GS8 A;  4WFT A;  2DMY A;  4DR1 I;  1H7S A;  4YHH I;  4PRV A;  3K1J A;  3PYF A;  4FW9 A;  4JI0 E;  4B3M E;  4LF4 I;  4DV1 E;  2LUP B;  2L3C A;  1XMQ I;  4KHP I;  1EI1 A;  2HKE A;  1HNZ I;  4DXL A;  1J26 A;  1X47 A;  2B7T A;  2E5L E;  3J7Y p;  1WHQ A;  5FLX Q;  4DPX A;  5BR8 I;  1I94 I;  4X66 E;  4DR3 E;  1KKH A;  4LF5 E;  4LF8 E;  1Z0V A;  4DV2 I;  2DIX A;  1HR0 E;  1KTV A;  4USM A;  1XMO E;  4JYA I;  1UIL A;  1MX0 A;  1Z0W A;  1FI4 A;  1O0W A;  1N36 E;  4R1F A;  2UUC E;  4DV4 E;  2LTS A;  4KQV A;  3ZZ0 A;  1N33 I;  5LMN I;  4YY3 E;  2V2Q A;  1QU6 A;  1XNQ I;  1NZ0 A;  1Z5B A;  4DUY E;  4B3T E;  2KHX A;  3WU3 A;  1ZM4 A;  4MYT A;  1H74 A;  3B8H A;  4LFC E;  4OX9 E;  4DPU A;  2LTR A;  3GON A;  4B3R E;  4JI2 E;  2NA2 A;  3VYX A;  1Z0E A;  4JI8 I;  1RRE A;  3JAM Q;  1WUU A;  1IBM E;  4PU9 A;  4JI1 E;  1FKA E;  1Z0C A;  1ELO A;  4X66 I;  4DR3 I;  4NXN E;  1J5E E;  1EA6 A;  2UXB E;  3T1Y I;  4DR1 E;  1NHI A;  5CFF E;  4JI6 I;  2XEX A;  1PKP A;  2LJH A;  4DR7 I;  4DV0 E;  1KVK A;  3QT7 A;  2ZIT A;  3D4J A;  4B3T I;  3OTO I;  1S4E A;  3C4T A;  2EZ6 A;  1IBK E;  4DV3 E;  4JI3 E;  2NPF A;  3QT6 A;  5A2Q C;  1QZR A;  2B3T B;  1PIE A;  2CZ9 A;  1EKZ A;  1Z5C A;  3J7A M;  2R3V A;  1XNR E;  4X64 E;  4DV2 E;  4P52 A;  4GKJ E;  4DKK A;  4HYM A;  1T4O A;  4FWG A;  2LBS B;  4X65 E;  4YY3 I;  4DR5 E;  2UXD E;  1XNQ E;  1RQ0 A;  1N34 E;  4XTJ A;  1MG7 A;  4DR6 I;  1ZM9 A;  4UTG A;  2UUA I;  2UXC E;  2BM1 A;  2UUB I;  3J81 Q;  3V2U C;  3QT5 A;  4JV5 E;  1GQE A;  4B3R I;  4LFB I;  1Z0B A;  4DV7 I;  2N3G A;  4OX9 I;  3ZKD A;  4JI7 I;  3P1X A;  1UEK A;  1Z0G A;  1IBM I;  4DR6 E;  4ED4 A;  1H7U A;  1ZM2 A;  4LF7 I;  4DU7 A;  4YHH E;  1ZBT A;  1FJG I;  1UHZ A;  2WW4 A;  4AQY I;  4DUY I;  1XMQ E;  2DEJ A;  1YYW A;  3M6A A;  3HTX A;  1HNW E;  1N34 I;  5LMU E;  2R42 A;  2HHH I;  1D6T A;  4LF6 I;  4M1K A;  2NUF A;  1DAR A;  4JI8 E;  1YYO A;  1IBK I;  1FWL A;  4OOG C;  2UU9 I;  4DR2 E;  2UXD I;  3J80 Q;  1N0U A;  2B7V A;  2RSM A;  2VQF I;  2RTX A;  1N33 E;  4X65 I;  4LF9 I;  4LFA I;  4FN5 A;  4DV5 E;  3B82 A;  2HFU A;  3T1Y E;  2UXB I;  4DPT A;  1N32 I;  4JI4 I;  5IT9 Q;  2HK3 A;  3ZKB A;  1Z59 A;  3C4B A;  2VQF E;  2VQE I;  4PRX A;  1T4N A;  4B3S E;  2RS7 A;  3ADL A;  4HAC A;  2RS6 A;  2ZBK B;  4DV4 I;  1XHK A;  4M30 A;  2JY9 A;  1T4L B;  1MU5 A;  1B63 A;  4Z7Y A;  1OJ4 A;  1K47 A;  2EFG A;  2VF3 A;  4JI5 I;  1N0V C;  4FWH A;  1FWK A;  4HAC B; 
#chains in the Genus database with same CATH topology
 2E5L I;  2YWQ A;  3VK6 A;  4LU9 A;  2JR1 A;  4M2Z A;  3AUZ A;  4JI2 I;  2RPC A;  5IWA I;  2EPO A;  4DV7 E;  3PYD A;  2CSH A;  2CGE A;  3T1H E;  2V88 A;  1YPN A;  3B4T A;  4NXM E;  2IHR 1;  2JEA B;  3EPL A;  2EMH A;  1UN6 B;  1MEY C;  4JYA E;  5LL6 R;  1XMO I;  2L2K B;  4DR4 I;  4X62 E;  2JP9 A;  1N36 I;  2EL6 A;  1AAY A;  2VRD A;  1DQ3 A;  1E3H A;  2OI2 A;  2J7K A;  2EMC A;  4LF5 I;  4IFD B;  4ZVI A;  2GQ0 A;  2M7Q A;  4IFD C;  5BR8 E;  1I94 E;  1G2F C;  5FWK A;  4M9V C;  2Z5C B;  2C39 A;  2PNZ B;  1DGC A;  4FK5 C;  2EN7 A;  4BCA A;  4LF7 E;  2O1V A;  1A1J A;  3T1H I;  2Q8U A;  1NHJ A;  5JEA A;  5A6K A;  3P3E A;  3K17 A;  3MSW A;  2CTD A;  1Z5A A;  4WUB A;  2UUA E;  4BBY A;  3DF6 A;  5A6J A;  4R2Q A;  1XXE A;  5K36 B;  3F6G A;  2BBG A;  2F4V E;  1ZR9 A;  4L5N C;  4BMJ A;  2DSY A;  2EMW A;  1HNX E;  2AJ4 A;  4DR7 E;  4DUZ I;  5KL2 A;  1X48 A;  3UK3 C;  3ZM7 A;  2Q2E B;  2MKD A;  5IWA E;  4RH8 A;  2F1D A;  4R2C A;  4GKJ I;  2X7I A;  5AE1 A;  2CT1 A;  1ZBQ A;  3P76 A;  1J5E I;  4Q28 A;  2EOI A;  4TUI A;  3F0N A;  4DPW A;  1EH6 A;  2PO1 A;  2X36 A;  2WBT A;  2N8X A;  4OKG A;  1STU A;  2MC6 A;  3EQ1 A;  2ZM6 I;  1S16 A;  2MKN A;  5KL3 A;  2F4V I;  4K0K I;  2BA0 G;  1ZXM A;  1RC7 A;  2YTG A;  3LLH A;  4JI6 E;  3GME A;  4FW4 A;  5DNX A;  4DV0 I;  2JVA A;  4O5G A;  2LUQ A;  4WUC A;  1VIS A;  2YTP A;  3CDI A;  2HFS A;  3MHS C;  2E72 A;  5A6A A;  4JI4 E;  1YYK A;  4RPF A;  2O1T A;  4O43 A;  3JAM C;  3KZZ A;  1PJS A;  2HKJ A;  1H73 A;  5JEA F;  3B78 A;  4F9A B;  4OO1 C;  2EM6 A;  3HXL A;  2VQE E;  4LF4 E;  1RR9 A;  2GO4 A;  3Q1Q A;  1IBL E;  4GKK E;  4IFD A;  1KIJ A;  1Y4S A;  1X49 A;  1WHN A;  1A1I A;  4MYU A;  2UXC I;  2ENH A;  2BV3 A;  3HUL A;  3LTO A;  2WZO A;  3ECR A;  2C39 B;  3HJC A;  4I3H A;  2RSI A;  2DB2 A;  1X6H A;  2ODR C;  2JWO A;  2YT4 A;  2WCC 3;  1UDS A;  4F6M A;  4USK A;  4DV6 I;  4AM3 A;  3WU6 A;  3QT8 A;  3ADJ A;  3OTO E;  4DR4 E;  2V2Z A;  1WXR A;  1YUI A;  3PYG A;  4X64 I;  1HNX I;  4LFC I;  4R03 A;  3EPH A;  4FWD A;  2YTQ A;  3ZZU A;  4U3D A;  3LNU A;  4Z7C A;  3C6M A;  2NUG A;  5GMD A;  2V8P A;  5IT9 C;  5DRR A;  1DI2 A;  3DJW A;  1IBL I;  4GKK I;  2CPN A;  2MDR A;  1FNM A;  2BM0 A;  1MGT A;  2YU8 A;  2UUB E;  2YTD A;  5A2Q Q;  3PS2 A;  1JK1 A;  2EM4 A;  2EOX A;  2EPU A;  4BC9 A;  2C38 A;  4HAC B;  4DV5 I;  1HR0 I;  2IOQ A;  2A2C A;  4X62 I;  1EH7 A;  4B3M I;  4X8W A;  1Z0T A;  2YTN A;  4JI7 E;  1BKN A;  5LMU I;  5LMN E;  2HHH E;  2E1R A;  2LVH A;  4WYQ B;  5A6B D;  1T39 A;  1B69 A;  4DU8 A;  4Q35 B;  1A6F A;  3VYY A;  1JK2 A;  1TF3 A;  3M99 B;  1OYR A;  2PO1 B;  5AC5 A;  4RHB B;  1XNR I;  1H72 C;  4BHC A;  2EM7 A;  2DLK A;  2EQ3 A;  2WP8 B;  4JG4 A;  4WUD A;  1SFE A;  3M85 D;  4DV1 I;  2N3H A;  3H4L A;  2V2V A;  3HKM A;  3THN A;  3WU5 A;  2I9I A;  2R1F A;  2V8Q B;  4DUZ E;  4F2J C;  5DRO A;  3PYE A;  5LLQ A;  2NN6 B;  4MLQ A;  3F6H A;  2LRS A;  3GLL A;  3IWC A;  3WU4 A;  5JEA E;  3ADG A;  4LFB E;  4R2E A;  3ADI A;  3ZZT A;  2MDG A;  2HGH A;  4NZV A;  2IES A;  4JI1 I;  4P7A A;  1YSA C;  4P7D A;  4AQY E;  1NHH A;  1TF6 A;  4KHP E;  4URL A;  2JYA A;  2DEI A;  4K0K E;  1FJG E;  2LJP A;  1RMD A;  2V87 A;  2R76 A;  2FGG A;  5C0X F;  3JTZ A;  3BF2 A;  4DMI A;  1PVG A;  2L3J A;  4KZS A;  2EOR A;  3IWD A;  2UUC I;  4MU1 A;  1N32 E;  2FV4 B;  2AE8 A;  2UU9 E;  2JPA A;  5L3J A;  4B3S I;  2O3Z A;  5KL4 A;  2WBU A;  1X6F A;  4GZN C;  1HNZ E;  4LF6 E;  2A2D A;  4LF9 E;  4LFA E;  1Y5Y A;  2NN6 A;  1ZXN A;  4IFD E;  4OO1 F;  4LF8 I;  3LPS A;  3BID A;  2EJ4 A;  2NUE A;  1Z1B A;  2LT7 A;  4DR5 I;  3KWR A;  3J7A G;  2C38 B;  4O24 A;  1YZ9 A;  2EPX A;  2EN6 A;  2LMZ A;  4P78 A;  4NXM I;  5K36 A;  2EMA A;  2L2M A;  3J81 C;  2DRP A;  5K36 F;  4ZYD A;  4WSP A;  1A1H A;  2HK2 A;  1B62 A;  4DV3 I;  3CWV A;  4JI3 I;  2YSP A;  2EM2 A;  4FW6 A;  2LV2 A;  3L7Z A;  4UT4 A;  2PRT A;  4DV6 E;  4HY1 A;  5JEA D;  2EOS A;  2EPN A;  4EMD A;  1ZU1 A;  4NXN I;  4WSG A;  1X3C A;  3HPS A;  2ZM6 E;  1IQO A;  4JI0 I;  1U2R A;  5AAS A;  1HNW I;  2EOZ A;  3J80 C;  2L33 A;  4HXZ A;  2ODR D;  3JU0 A;  4IS9 A;  4FW7 A;  2WP8 A;  2K4V A;  5FLX C;  4J3D A;  2JXP A;  3K6Q A;  4OO1 B;  3FIG A;  4JI5 E;  1OYP A;  5GME A;  2H36 X;  1ZM3 A;  4QNK A;  3U1K A;  4BHB A;  4DR2 I;  2V34 A;  2NN6 C;  4DPY A;  1RHY A;  3V5R A;  2L2N A;  2GS8 A;  4WFT A;  2GPI A;  4JV5 I;  2V83 A;  1HK7 A;  2LO3 A;  2DMY A;  4DR1 I;  1H7S A;  4YHH I;  3M85 G;  5IV8 B;  4PRV A;  3K1J A;  3L7Z B;  3PYF A;  3H1C A;  4FW9 A;  1X5W A;  4JI0 E;  4B3M E;  4LF4 I;  4DV1 E;  2EPK X;  2M1S A;  2EL5 A;  2YTO A;  2LUP B;  3PS3 A;  2K7I A;  5A69 A;  4OO1 D;  2BB8 A;  2L3C A;  1XMQ I;  4KHP I;  1EI1 A;  4F9C B;  2HKE A;  1HNZ I;  3VHT B;  4DXL A;  1J26 A;  1X47 A;  2EML A;  2B7T A;  1GZ6 A;  5T6J A;  2E5L E;  1UDQ A;  2NAB A;  4O4K A;  2D9H A;  4IFD D;  3J7Y p;  2EQ0 A;  2EPR A;  2EM3 A;  1WHQ A;  4R8O A;  4GQU A;  5FLX Q;  5K36 E;  4DPX A;  1Y6Z A;  2LCE A;  5BR8 I;  2EOO A;  4X66 E;  4DR3 E;  1I94 I;  4I8O A;  4LF5 E;  1KKH A;  3PS1 A;  4LF8 E;  5ELW A;  1Z0V A;  4M0V A;  5KL7 A;  2DIX A;  4DV2 I;  1HR0 E;  1ZAA C;  2EM8 A;  1KTV A;  4USM A;  1XMO E;  3HPZ A;  3KZY A;  1UIL A;  4R2D A;  4L8N A;  1MX0 A;  1Z0W A;  4JYA I;  2JEB B;  1FI4 A;  1O0W A;  5TSE A;  2JOX A;  1N36 E;  4R1F A;  4OO1 A;  2UUC E;  2YTI A;  4DV4 E;  2LTS A;  4KQV A;  4LPF A;  3ZZ0 A;  1N33 I;  3P3C A;  2EM0 A;  2YRH A;  5LMN I;  4F6N A;  5AE2 A;  4YY3 E;  5C0X E;  1P42 A;  2V2Q A;  1QU6 A;  3QG5 C;  2EOY A;  2EOM A;  2VES A;  1XNQ I;  2LJU A;  1NZ0 A;  2GHF A;  4DUY E;  1Z5B A;  4B3T E;  2KHX A;  3WU3 A;  2EOH A;  4IZJ D;  1ZM4 A;  3MHH C;  1USU A;  5AC4 A;  4MYT A;  1H74 A;  4GEQ B;  4OO1 E;  3B8H A;  4LFC E;  4OX9 E;  4DPU A;  4HTG A;  2V85 A;  2LTR A;  1UDO A;  3GON A;  4QNJ A;  2EN4 A;  4J8Z A;  4JI2 E;  4B3R E;  2EOE A;  2L8T A;  2JEB A;  2NA2 A;  3VYX A;  1Z0E A;  4JI8 I;  1RRE A;  1P47 A;  3JAM Q;  1WUU A;  1OYS A;  1IBM E;  1PJT A;  2A25 A;  4PU9 A;  1Y4U A;  2BR2 A;  3K85 A;  4JI1 E;  1VI7 A;  2C37 B;  2EPZ A;  2DGC A;  4NHR A;  3EPJ A;  1YFH A;  1UDN A;  1FKA E;  2EQ1 A;  4MLV A;  5F3W A;  1ELO A;  1Z0C A;  4X66 I;  4DR3 I;  2YTF A;  4MDT A;  3OML A;  3BBG A;  4NXN E;  4ISA A;  2EM9 A;  2HJJ A;  2M9A A;  2IER A;  4FW5 A;  1J5E E;  1WJP A;  1EA6 A;  1A1K A;  2UXB E;  4DR1 E;  1NHI A;  5CFF E;  5C0X D;  3T1Y I;  2EN8 A;  1G2D C;  1A1G A;  4JI6 I;  2XEX A;  4BA2 B;  1YH8 A;  4X9J A;  1LLM C;  1UBD C;  1IQS A;  1PKP A;  2LJH A;  2LE2 A;  3CDJ A;  4DV0 E;  4DR7 I;  2G7H A;  2CVE A;  1KVK A;  1PJQ A;  2YU5 A;  3QT7 A;  5C0X B;  2ZIT A;  4ZYH A;  3D4J A;  4B3T I;  4BC7 A;  1X6E A;  1KJK A;  3OTO I;  2YRK A;  1F2I G;  1R6L A;  4N4R B;  5DRP A;  1S4E A;  3C4T A;  4LTY A;  2EZ6 A;  1IBK E;  4DV3 E;  4JI3 E;  2NPF A;  3TQM A;  3QT6 A;  1TN9 A;  2EOJ A;  2NN6 F;  5A2Q C;  5EL9 A;  1QZR A;  3BGH A;  2O1W A;  1YUJ A;  2BA1 G;  3KRN A;  2B3T B;  1PIE A;  4BA1 B;  2L6M A;  3M7N D;  2EMB A;  1NEI A;  2EMK A;  2CZ9 A;  2PO2 A;  1EKZ A;  4R2R A;  2J65 A;  1Z5C A;  2PO0 B;  2PNM A;  3J7A M;  2R3V A;  2JE6 A;  2KON A;  4X64 E;  4DV2 E;  1XNR E;  1Y60 A;  4P52 A;  4R2A A;  2EOF A;  2HC5 A;  4DKK A;  4GKJ E;  5EKW A;  4MU0 A;  2YTE A;  1PDA A;  4HYM A;  3LML A;  1T4O A;  3ZOQ B;  4FWG A;  2LBS B;  5A6B A;  4AID A;  2JOB A;  4X65 E;  4YY3 I;  4F54 A;  5K36 C;  2J7J A;  3NZK A;  4DR5 E;  2B9D A;  2V86 A;  2JT2 A;  1AH5 A;  4IZK A;  2C37 A;  4WX9 A;  2UXD E;  4MU4 A;  4IJD A;  1XNQ E;  1RQ0 A;  4IZJ A;  1N34 E;  4XTJ A;  1E3P A;  2EM5 A;  4TUG A;  1MG7 A;  5AE3 A;  4DR6 I;  1ZM9 A;  4UTG A;  2UUA I;  2WNR A;  4IFD F;  3DD6 A;  2UXC E;  2EE8 A;  3THO B;  2BM1 A;  2UUB I;  2EMZ A;  3J81 Q;  3V2U C;  2PO0 A;  4AIM A;  4JV5 E;  4ZYE A;  3QT5 A;  1GQE A;  4NBQ A;  4B3R I;  4LFB I;  1Z0B A;  2JE6 B;  4LCH A;  4DV7 I;  2N3G A;  5DRQ A;  4OX9 I;  5ADZ A;  2GLI A;  3ZKD A;  4JI7 I;  4F9B B;  5C0X C;  2EPP A;  3P1X A;  2Z5B B;  2PNL A;  2ELZ A;  2EN3 A;  3IWB A;  2EWL A;  1UEK A;  1GTK A;  2E1M A;  2EMI A;  2FTX B;  2VE7 C;  3L00 A;  2I13 A;  2KOU A;  4DR6 E;  1Z0G A;  1IBM I;  4ED4 A;  1EH8 A;  4WXD A;  5DNL A;  1H7U A;  1ZM2 A;  2VF1 A;  1NCS A;  5JEA B;  4LF7 I;  4DU7 A;  1SR9 A;  4YHH E;  1ZBT A;  4WXC A;  2ELY A;  2WBS A;  2BA0 D;  2IOP A;  1FJG I;  1L4S A;  4N3O A;  1UHZ A;  2ENA A;  2NN6 D;  2WW4 A;  4AQY I;  4DUY I;  1XMQ E;  4BA1 A;  2NN6 E;  4IZK B;  2EPC A;  3U1Y A;  2DEJ A;  2EN2 A;  1USV A;  1A1F A;  1WRJ A;  1YYW A;  3M6A A;  3HTX A;  1HNW E;  4FW3 A;  1N34 I;  2BA1 D;  4OZE A;  2MC5 A;  4KWY A;  5LMU E;  2R42 A;  2HHH I;  3M7N G;  1BBO A;  1D6T A;  3PRY A;  1QNT A;  4LCG A;  4M1K A;  4LF6 I;  2RQL A;  3P06 A;  2NUF A;  1DAR A;  4JI8 E;  3RMP A;  1YYO A;  1IBK I;  1FWL A;  4OOG C;  2UU9 I;  4DR2 E;  4IZJ B;  2UXD I;  3J80 Q;  1N0U A;  2B7V A;  1N3G A;  2EMY A;  3HQ1 A;  2WNR B;  2RSM A;  2VQF I;  2BR2 B;  3GCM A;  2EPM X;  3AV0 A;  2RTX A;  1N33 E;  4X65 I;  1IMU A;  4LF9 I;  4LFA I;  1KYQ A;  4U3B A;  2EMF A;  4FN5 A;  4LOM A;  4MU3 A;  4DV5 E;  3B82 A;  2HFU A;  3T1Y E;  2UXB I;  4DPT A;  4HEI A;  1N32 I;  4JI4 I;  2Z5B A;  2JEA A;  4ZYG A;  5IT9 Q;  2EPA A;  2HK3 A;  3ZKB A;  1Z59 A;  3C4B A;  3Q6M A;  4BA2 A;  2DLQ A;  2V89 A;  2VQF E;  2VQE I;  2L92 A;  3P3G A;  1T4N A;  3Q6N A;  5KL5 A;  5DNY A;  4PRX A;  1BBG A;  4B3S E;  1YHC A;  2O1U A;  5JEA C;  2YZT A;  4WPY A;  5C0X A;  2RS7 A;  2YTJ A;  3ADL A;  2Z5E A;  2PNZ A;  2Z5C A;  2EL4 A;  2EMX A;  4R2S A;  1T38 A;  2EOQ A;  2EP3 A;  2F8B A;  1BB8 A;  4HAC A;  4IS1 C;  2RS6 A;  4LCF A;  2ENC A;  2GO3 A;  2ZBK B;  4MQY A;  2CG9 A;  4DV4 I;  3H09 A;  1XHK A;  1A1L A;  4M30 A;  2YRM A;  3UHM A;  2JY9 A;  5KL6 A;  4R2P A;  1T4L B;  5IXM B;  1MU5 A;  2PO2 B;  2EPL X;  1B63 A;  4Z7Y A;  2EMG A;  1OJ4 A;  1K47 A;  2ADR A;  5K36 D;  2EFG A;  2VF3 A;  4BS9 A;  2YPN A;  4JI5 I;  2DMI A;  1R6M A;  1N0V C;  4FWH A;  2YSO A;  3C6K A;  3EPK A;  2EN1 A;  1FWK A;  2M4I A; 
#chains in the Genus database with same CATH homology
 2E5L I;  3VK6 A;  4LU9 A;  2JR1 A;  4M2Z A;  3AUZ A;  4JI2 I;  5IWA I;  4DV7 E;  3PYD A;  2CGE A;  3T1H E;  2V88 A;  4NXM E;  2IHR 1;  4JYA E;  5LL6 R;  1XMO I;  2L2K B;  4DR4 I;  4X62 E;  1N36 I;  1DQ3 A;  2OI2 A;  2J7K A;  4LF5 I;  4ZVI A;  2GQ0 A;  2M7Q A;  5BR8 E;  1I94 E;  5FWK A;  2Z5C B;  4BCA A;  4LF7 E;  2O1V A;  3T1H I;  1NHJ A;  3K17 A;  3MSW A;  1Z5A A;  4WUB A;  2UUA E;  4BBY A;  3DF6 A;  3F6G A;  2F4V E;  4L5N C;  4BMJ A;  2DSY A;  1HNX E;  2AJ4 A;  4DR7 E;  4DUZ I;  1X48 A;  3ZM7 A;  2Q2E B;  5IWA E;  4GKJ I;  2X7I A;  5AE1 A;  1ZBQ A;  1J5E I;  4Q28 A;  4TUI A;  3F0N A;  4DPW A;  2X36 A;  1STU A;  2MC6 A;  2ZM6 I;  1S16 A;  2F4V I;  4K0K I;  1ZXM A;  1RC7 A;  3LLH A;  4JI6 E;  4DV0 I;  2JVA A;  2LUQ A;  4WUC A;  1VIS A;  2HFS A;  4JI4 E;  1YYK A;  4RPF A;  2O1T A;  3JAM C;  2HKJ A;  1H73 A;  3B78 A;  4F9A B;  3HXL A;  2VQE E;  1RR9 A;  4LF4 E;  3Q1Q A;  4JV5 I;  1IBL E;  4GKK E;  1KIJ A;  1Y4S A;  1X49 A;  1WHN A;  4MYU A;  2UXC I;  2BV3 A;  3HUL A;  3LTO A;  2WZO A;  3HJC A;  4I3H A;  2DB2 A;  2ODR C;  2JWO A;  2YT4 A;  4USK A;  4DV6 I;  3WU6 A;  3QT8 A;  3ADJ A;  3OTO E;  4DR4 E;  2V2Z A;  1WXR A;  3PYG A;  4X64 I;  1HNX I;  4LFC I;  4R03 A;  4FWD A;  3ZZU A;  3LNU A;  4Z7C A;  2NUG A;  5GMD A;  2V8P A;  5IT9 C;  1DI2 A;  3DJW A;  1IBL I;  4GKK I;  2CPN A;  2MDR A;  1FNM A;  2BM0 A;  2UUB E;  5A2Q Q;  4HAC B;  4BC9 A;  4DV5 I;  1HR0 I;  2IOQ A;  2A2C A;  4X62 I;  4B3M I;  4X8W A;  1Z0T A;  4JI7 E;  1BKN A;  5LMU I;  5LMN E;  2HHH E;  2E1R A;  4WYQ B;  4DU8 A;  1A6F A;  3VYY A;  1XNR I;  1H72 C;  4DV1 I;  4JG4 A;  4WUD A;  2N3H A;  3H4L A;  2V2V A;  3WU5 A;  2V8Q B;  4DUZ E;  3PYE A;  3F6H A;  2LRS A;  3IWC A;  3WU4 A;  3ADG A;  4LFB E;  3ADI A;  3ZZT A;  4JI1 I;  4P7A A;  4P7D A;  4AQY E;  1NHH A;  4URL A;  4KHP E;  2DEI A;  4K0K E;  1FJG E;  2LJP A;  2V87 A;  2FGG A;  3JTZ A;  4DMI A;  1PVG A;  2L3J A;  4KZS A;  3IWD A;  2UUC I;  1N32 E;  2FV4 B;  2UU9 E;  5L3J A;  4B3S I;  1HNZ E;  2A2D A;  4LF6 E;  4LF9 E;  4LFA E;  1ZXN A;  4LF8 I;  3LPS A;  2NUE A;  4DR5 I;  3KWR A;  3J7A G;  1YZ9 A;  2LMZ A;  4P78 A;  4NXM I;  3J81 C;  2L2M A;  4WSP A;  2HK2 A;  4DV3 I;  1B62 A;  4JI3 I;  3CWV A;  4UT4 A;  4DV6 E;  4HY1 A;  4EMD A;  4NXN I;  3HPS A;  2ZM6 E;  4JI0 I;  1U2R A;  5AAS A;  1HNW I;  3J80 C;  2L33 A;  4HXZ A;  2ODR D;  3JU0 A;  2K4V A;  5FLX C;  3K6Q A;  3FIG A;  4JI5 E;  5GME A;  2H36 X;  1ZM3 A;  4DR2 I;  2V34 A;  4DPY A;  3V5R A;  2L2N A;  2GS8 A;  4WFT A;  2V83 A;  1HK7 A;  2DMY A;  4DR1 I;  1H7S A;  4YHH I;  4PRV A;  3K1J A;  3PYF A;  4FW9 A;  4JI0 E;  4B3M E;  4LF4 I;  4DV1 E;  2M1S A;  2LUP B;  2L3C A;  1XMQ I;  4KHP I;  1EI1 A;  4F9C B;  2HKE A;  1HNZ I;  4DXL A;  1J26 A;  1X47 A;  5T6J A;  2B7T A;  1GZ6 A;  2E5L E;  3J7Y p;  1WHQ A;  4R8O A;  5FLX Q;  4DPX A;  1Y6Z A;  5BR8 I;  1I94 I;  4X66 E;  4DR3 E;  4I8O A;  1KKH A;  4LF5 E;  4LF8 E;  1Z0V A;  4M0V A;  4DV2 I;  2DIX A;  1HR0 E;  1KTV A;  4USM A;  1XMO E;  3HPZ A;  4JYA I;  1UIL A;  1MX0 A;  4L8N A;  1Z0W A;  1FI4 A;  1O0W A;  1N36 E;  2JOX A;  4R1F A;  2UUC E;  4DV4 E;  2LTS A;  4KQV A;  3ZZ0 A;  1N33 I;  5LMN I;  5AE2 A;  4YY3 E;  2V2Q A;  1QU6 A;  1XNQ I;  1NZ0 A;  1Z5B A;  4DUY E;  4B3T E;  2KHX A;  3WU3 A;  4IZJ D;  1ZM4 A;  1USU A;  4MYT A;  1H74 A;  4GEQ B;  3B8H A;  4LFC E;  4OX9 E;  4DPU A;  2V85 A;  2LTR A;  3GON A;  4J8Z A;  4B3R E;  4JI2 E;  2L8T A;  2NA2 A;  3VYX A;  1Z0E A;  4JI8 I;  1RRE A;  3JAM Q;  1WUU A;  1IBM E;  4PU9 A;  1Y4U A;  3K85 A;  4JI1 E;  1FKA E;  1Z0C A;  5F3W A;  1ELO A;  4X66 I;  4DR3 I;  3OML A;  4NXN E;  1J5E E;  1EA6 A;  2UXB E;  3T1Y I;  4DR1 E;  1NHI A;  5CFF E;  4JI6 I;  2XEX A;  1PKP A;  2LJH A;  2LE2 A;  4DR7 I;  4DV0 E;  2G7H A;  1KVK A;  3QT7 A;  2ZIT A;  3D4J A;  4B3T I;  4BC7 A;  3OTO I;  1S4E A;  3C4T A;  4LTY A;  2EZ6 A;  1IBK E;  4DV3 E;  4JI3 E;  2NPF A;  3QT6 A;  5A2Q C;  1QZR A;  2O1W A;  2B3T B;  1PIE A;  2L6M A;  2CZ9 A;  1EKZ A;  1Z5C A;  2PNM A;  3J7A M;  2R3V A;  2KON A;  4X64 E;  4DV2 E;  1XNR E;  4P52 A;  4GKJ E;  4DKK A;  4HYM A;  1T4O A;  3ZOQ B;  4FWG A;  2LBS B;  2JOB A;  4X65 E;  4YY3 I;  4F54 A;  4IZK A;  4DR5 E;  2B9D A;  2V86 A;  2UXD E;  1XNQ E;  1RQ0 A;  4IZJ A;  1N34 E;  4XTJ A;  4TUG A;  1MG7 A;  5AE3 A;  4DR6 I;  1ZM9 A;  4UTG A;  2UUA I;  2UXC E;  2BM1 A;  2UUB I;  3J81 Q;  3V2U C;  4JV5 E;  3QT5 A;  1GQE A;  4B3R I;  4LFB I;  1Z0B A;  4DV7 I;  2N3G A;  4OX9 I;  5ADZ A;  3ZKD A;  4JI7 I;  4F9B B;  3P1X A;  2Z5B B;  2PNL A;  3IWB A;  2EWL A;  1UEK A;  2E1M A;  1Z0G A;  2FTX B;  2VE7 C;  1IBM I;  2KOU A;  4DR6 E;  4ED4 A;  1H7U A;  1ZM2 A;  2VF1 A;  4LF7 I;  4DU7 A;  1SR9 A;  4YHH E;  1ZBT A;  2IOP A;  1FJG I;  4N3O A;  1UHZ A;  2WW4 A;  4AQY I;  4DUY I;  1XMQ E;  4IZK B;  2DEJ A;  1USV A;  1YYW A;  3M6A A;  3HTX A;  1HNW E;  1N34 I;  2MC5 A;  5LMU E;  2R42 A;  2HHH I;  1D6T A;  3PRY A;  4LF6 I;  4M1K A;  3P06 A;  2NUF A;  1DAR A;  4JI8 E;  3RMP A;  1YYO A;  1IBK I;  1FWL A;  4OOG C;  2UU9 I;  4DR2 E;  4IZJ B;  2UXD I;  2M4I A;  3J80 Q;  1N0U A;  2B7V A;  3HQ1 A;  2RSM A;  2VQF I;  3AV0 A;  2RTX A;  1N33 E;  4X65 I;  4LF9 I;  4LFA I;  4FN5 A;  4DV5 E;  3B82 A;  2HFU A;  3T1Y E;  2UXB I;  4DPT A;  1N32 I;  4JI4 I;  2Z5B A;  5IT9 Q;  2HK3 A;  3ZKB A;  1Z59 A;  3C4B A;  3Q6M A;  2V89 A;  2VQF E;  2VQE I;  2L92 A;  3Q6N A;  1T4N A;  4PRX A;  5DNY A;  4B3S E;  2O1U A;  2YZT A;  4WPY A;  2RS7 A;  3ADL A;  2Z5E A;  2Z5C A;  2F8B A;  4HAC A;  2RS6 A;  2ZBK B;  2CG9 A;  4DV4 I;  3H09 A;  1XHK A;  4M30 A;  2JY9 A;  1T4L B;  1MU5 A;  1B63 A;  4Z7Y A;  1OJ4 A;  1K47 A;  2EFG A;  2VF3 A;  4BS9 A;  4JI5 I;  1N0V C;  4FWH A;  1FWK A;  3LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...