1VISA

Crystal structure of mevalonate kinase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
SLIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate kinase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 106
structure length 314
sequence length 314
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1visA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1visA01
4X62I 1ELOA 2LJPA 2DEJA 4M1KA 4JI7E 1N33E 3K1JA 3LPSA 4GKKE 4DU8A 4WUBA 3WU6A 4LF6E 4X65I 4B3SE 4HACB 5LMUI 4LF9E 4JI4I 1H7UA 4DPWA 4DU7A 1H74A 4JI0I 4URLA 3J80C 1N34E 3WU5A 2ZBKB 2DEIA 4X64I 5LMNE 4YHHI 1NHHA 5A2QQ 1XHKA 4DUZI 2A2DA 4HYMA 4DPYA 4LFCI 1NHIA 4JI6I 2F4VI 2UXDI 1QZRA 1ZM4A 2CZ9A 4DV3E 4LF7I 3T1HE 4DR3E 2UUCI 2VQEI 4JI1E 2GS8A 4B3RE 2HHHI 3D4JA 4JYAI 1MG7A 4B3TE 4DV0E 2ZM6E 1BKNA 1VISA 1HNZE 4LF4I 1ZXMA 3F0NA 4DR2E 3J7AM 1D6TA 1KKHA 2HFUA 2UUBI 4JV5I 1XNRE 1XMQI 2BM1A 4X65E 4DR7I 1S4EA 2J7KA 5LMUE 3Q1QA 4DUYI 5BR8I 4YY3I 5IT9Q 2Q2EB 2V8PA 3K17A 1ZM2A 4XTJA 3PYEA 4DV7E 4DR5I 1EI1A 3QT7A 4P7AA 1HNWI 2HKEA 2ZITA 2HK2A 4X64E 4I3HA 3B78A 2WW4A 2UXCI 3ZZ0A 4DXLA 1KIJA 1XMOI 2X7IA 3V2UC 3WU3A 1ZXNA 3PYGA 2HK3A 4LF5I 1N32I 1HNXI 1IBKI 1ZM3A 1Z59A 1IBLE 4JI6E 4USMA 2UXBI 3PYFA 4JI8E 4DV6I 5IT9C 4JG4A 4NXNI 3B82A 3ZKDA 2R42A 2E5LI 2A2CA 5L3JA 3GONA 1OJ4A 2UUCE 4FWDA 3OTOE 4R1FA 1IBMI 1ZM9A 2HHHE 4DV2E 4JYAE 4DV1E 4JI3E 2XEXA 1I94I 3LTOA 3V5RA 4DPUA 4AQYI 4KHPI 4NXME 1H73A 2UUAI 1Z0BA 4UT4A 2HFSA 4LF8I 2UUBE 1WUUA 1PKPA 4KQVA 4RPFA 1N33I 1RREA 1NHJA 2HKJA 5A2QC 3PYDA 4LFBE 4DUYE 5BR8E 3T1YI 4B3ME 4GKJI 3ZZUA 1J5EI 1K47A 4WUCA 2VQFE 4HY1A 1HR0E 4DV5E 4HACA 4X62E 2UXCE 1Z5CA 5LMNI 3ZKBA 1XMOE 5FLXQ 2R3VA 4Z7CA 1H72C 1MU5A 1N0VC 1B62A 2EFGA 4LFAI 4LF5E 1Z0WA 4DV4I 1HNXE 4DR6I 2BV3A 4PU9A 4DV6E 4JI4E 4FN5A 4JI0E 2E5LE 1H7SA 4DV3I 1Z0CA 4MYTA 4USKA 4X66I 4DR3I 3ZZTA 1S16A 1IBME 5FLXC 4JI1I 1N36I 1XNQI 4YHHE 3JAMQ 4DUZE 1UEKA 1Z5BA 1I94E 3ZM7A 2V34A 3LNUA 1KVKA 4AQYE 4UTGA 2V2ZA 4LFCE 2F4VE 2UXDE 4EMDA 2UU9I 1FWLA 4LF8E 4FWGA 4MYUA 2VF3A 1KTVA 4LF7E 5GMEA 4OX9I 4JI5I 1XNRI 3QT5A 4JI2I 2NPFA 4WUDA 3M6AA 2OI2A 2VQEE 1N0UA 4PRXA 3QT8A 3JAMC 2BM0A 3WU4A 5IWAI 4DPXA 4HXZA 2X36A 4Z7YA 1Z0VA 3J7AG 3T1YE 3J81Q 4GKJE 1FJGI 4DR1I 1J5EE 1Z5AA 4K0KI 1U2RA 1A6FA 1Z0EA 4DV7I 4DR4I 4LF4E 1DARA 4P52A 1B63A 4FWHA 4JI7I 4JV5E 1PIEA 1XMQE 4LFAE 4DV4E 4GKKI 4DR6E 4LF6I 1EA6A 4DR7E 4B3SI 3B8HA 1FWKA 1IBLI 3J81C 4LF9I 4DPTA 3H4LA 4JI8I 4YY3E 1N34I 2V2QA 5GMDA 4X66E 4DR5E 1HNWE 1MX0A 3OTOI 1N36E 1XNQE 2AJ4A 4DV2I 4DV1I 4ED4A 4JI3I 1N32E 1IBKE 2V2VA 1RR9A 4NXMI 2UXBE 2UU9E 4NXNE 3T1HI 4OX9E 4JI5E 4JI2E 1NZ0A 1Z0TA 3CWVA 1FI4A 5IWAE 4B3RI 2E1RA 4LFBI 1FJGE 4DR1E 1FNMA 1FKAE 5LL6R 4B3MI 3QT6A 4K0KE 4ZVIA 2VQFI 4B3TI 1PVGA 3J80Q 1HR0I 4KHPE 4DR4E 4DV0I 2ZM6I 4DV5I 1Z0GA 1HNZI 4FW9A 2UUAE 4PRVA 4DR2I 3HULA
chains in the Genus database with same CATH superfamily
3CCES 4OO1F 2UUAJ 1FWPA 1YJ7A 3Q0AA 1P42A 2DNRA 1P9YA 1S6QA 3NMAA 1H2TZ 4K8RA 2JLGA 4X4SA 1RHYA 5K8MA 3OHBA 3CDAA 1RT2A 4BWJA 4MKVA 4EWTA 4JI2F 5M2PA 4GKJJ 2MEWA 3Q2SC 1CPZA 1SH0A 4KE5A 2BRKA 2HW3A 2RQ4A 1SJRA 5EKWA 3JYTA 4O44B 2RJZA 2GO8A 2OFHX 2Y9HA 2C28A 1WTFA 4CLPA 4JI6I 4CLLA 1JXLA 2BQUA 4RW8A 3O2IA 2UVWA 1TL1A 4W92B 3DHWC 5SUHA 4ILMA 2VU5A 4MU4A 3BB5A 4XDDA 1L3KA 2NSBA 4ZP9A 1TKXB 4ATNA 2JX2A 2KXFA 1KHVA 4B3TE 2ASJA 3BKUA 2YWGA 4BS2A 1U1LA 2XZTB 1IKWA 5EX0A 4IZKB 4F0KA 4FS1A 1R0CB 2WVBA 1H7XA 3M1VB 5HROB 4JI2J 3T5KA 4FW7A 4DV3F 4NEYA 2B9XA 4FXWA 1R31A 2VFVA 2XO7A 4XTJA 4P7TA 2V4QA 2BRLA 1Q16B 2HKEA 2B8PA 3G82B 2VDHA 2YTCA 2X7IA 2VBXA 4TKTA 2HQCA 3KNGA 2BE7D 4USMA 4IFYB 5E3AA 5IT9Y 1KWMA 4CO2A 4NXNI 4DL6A 4OI3A 3U1LA 2AD9A 3MAAA 3AFGA 3DLGA 5L38A 2UUCE 3KLVA 1XXEA 2ZJPQ 3RR8A 2FIUA 4KKOA 3PR4A 1YHQS 2VJUA 2UUTA 3H4BA 4KHPI 4HTIA 4IKAA 1TUWA 4NXMJ 3H2VE 2B7BB 3ZTOA 4RNMA 1VFJA 1BLUA 1RHUB 2W4CA 1YRUA 4LJMA 4RPFA 3LGNA 2CPHA 2VDIA 3CTRA 2WAQD 4TU8A 4OO1B 1RREA 4NCGA 4WKYA 2PDAA 1S9EB 1RBOB 2HBYB 1HR0E 3OTOF 4B3MJ 1GXTA 3OSPA 1MSWD 4F0MA 4X62E 4YR0A 4F4AA 5LMNI 3W2VB 4HI1A 1YSJA 1RHMB 3OLAA 2ZH7A 1UETA 4DX8H 4DV6E 4FN5A 3P5TL 4WWSA 4CT8A 5IFMA 5DROA 3H2LA 3GIIA 4GQUA 3CGIA 4RW7B 2ZOMA 3JQJA 3DRYA 4JI1I 2VQFF 1K44A 1D09B 4ECXA 1R3NA 3E51A 3GPAA 5F0WA 3DCAA 1U49A 2HHVA 2PN6A 4X84A 1LWCB 1K8AT 3I96A 3VAJA 5GMKa 2W24A 2IESA 1MMNA 1HWJA 4MIWA 4OZLA 2A6OA 2DCLA 2BM0A 3FJ2A 4HXZA 3T3FA 4KBIA 4CLSA 1WOPA 1Z5AA 1AA1B 2SXLA 3A4TA 2VB6A 3MECB 3FSXA 3MGJA 3PEJA 2OPQB 2ZEJA 1F60B 4DV4E 4ZCMA 1A6LA 2QA2A 1UMJA 1HNIA 4DPTA 1FKOA 4OKGA 3IWNC 1RXOB 1Z1ZA 4QJVA 5GMDA 1RA7A 4CQ1A 2WTFA 2V4JB 2QA4S 1VRTB 1IKXB 1Q8KA 1W26A 2VPYB 4DV2I 2C1EB 2GIRA 1AW0A 3EWGA 1OIAA 5DRRA 2A3JA 2E44A 3TRGA 3KK1A 4WP8A 3BM7A 1IBKE 3BQ1A 2VFRA 2B4OA 2AX0A 5ETVA 2UXBE 2PO1B 3J7YI 3UN2A 1X4AA 4QIEA 1QSYA 4IR1A 1PCAA 3BZQA 5FD1A 2FJBB 3HHLA 2VJVA 4YY3F 2DGOA 4I7FB 2OSRA 4ILRA 1F3VA 1B3TA 3BGOP 3I31A 2D1CA 4C3KA 3ZNUA 1HA1A 3TX0A 1HNZI 4DL5A 2UUAE 5KFOA 3BQ2A 4DR2I 4QR1A 2E5JA 3M9OB 4P7VA 2IJNA 4B02A 4IFVA 4R0EA 5C2GA 2K7JA 4DF8A 2HQDA 1Q0NA 2Q79A 4DFKA 1BXNA 2E1CA 1JMTA 3HD2A 2F9JA 4QPXA 2PE8A 4LF9E 1HD0A 3S01A 2AT1B 4L73A 5GAGU 3VZIA 1OQ6A 3DKDA 5IWAF 5L9XA 4RX6A 1S1VB 5IM0A 3MR2A 2NR0A 4L76A 1R27B 2KL8A 1B7YB 4PWDA 1HMVA 3R5AA 2YBVA 1Y4SA 4OYAA 2UUWA 1MMLA 4LCFA 1M1GA 3DYAA 2HNDA 3UCUP 4M5JA 4IH6A 3L3CA 3GP9A 3HPOA 4B3RE 2K3IA 2CQ2A 3Q23A 1SQEA 2CQ4A 2KRRA 3CIMA 1VISA 3GJTB 2MQMA 2J7WA 2APOA 1QE1B 4FNHA 1NK9A 3TEHB 1FDDA 3OVSA 4IFDE 1VR6A 3PO4A 4NI2B 1XR6A 3EUNA 4I2QA 3N6NA 2M8DB 5KFCA 5IWAJ 2B6AA 1RHKB 1Q8IA 4DR3F 5SZTA 4M5IA 4CYUA 4IO1A 5A76A 5ETRA 2C2ZB 2HK2A 4DV7J 1J27A 3W2WB 4WBFA 1L3UA 3C3LA 3UFCX 2DGQA 2HK3A 3GV5B 2AV5A 2WVCA 3J7Z5 4OHZA 3MR5A 4M63A 5J2NA 2HIQA 1GXUA 5KG5A 2XCAA 1RAFB 2E5LI 1NK6A 2QZ8A 4IOAQ 3QQCD 4CZCA 5EHHA 2O3ZA 1TKZB 4DLEA 2R7UA 5K36A 4YB5A 5BYSA 4ZKAA 1CQNA 4MT1A 4ICLA 4NXME 2YWHA 4LF8I 1K0TA 3RBEA 2WOMA 1IBLF 4TYBA 1WOSA 4I6AA 2WRMA 1M5SA 3FK4A 3QGIA 4B3ME 1MMDA 4ZP6A 3PO5A 1PBUA 4F4WA 4HY1A 4UY85 1VK8A 1UVKA 2LEPA 1TL5A 2OMLA 5J2PA 2UV8A 2UXCE 3IN5A 1VQ6S 4NZ6A 1XERA 4N3OA 2RVJA 2NZ4A 1YH8A 3AQOA 5M2UA 5KFLA 3LPYA 3ZXWA 2ZC4A 1FRLA 2JOQA 4JI0J 2Z4PA 3EMTA 5F41A 3M6UA 4LSZB 3BSOA 4Q8FA 3H59A 1S16A 4DUTA 1Y00A 1QUVA 4GO5X 5CYQB 4FP9A 1WKJA 2PFDA 3AXKA 3JAMQ 3TUPA 1NPRA 4H4OB 3PY8A 2ZVIA 1Y10A 4MFBA 4J9UE 1S12A 1I94E 5D3GA 2PMHA 3JB9k 2EKYA 3HHDA 3ZTPA 3LOUA 4NZ0A 2XMWA 4ERDA 2IRUA 4N76A 2F4VJ 2VF3A 3IS9A 3D1QA 1HNXF 4L3NA 4LF7J 3DLJA 4EO6A 3W5ZA 4DF4A 4NYZA 4LT6A 1FKPB 3MM6B 3WU4A 5E2QA 4C0BA 3W66A 5EDWA 2VQEJ 3K58A 5KG2A 3UO0A 4M5GA 2OH2A 4UW2A 4OV1A 4I1TA 4BA1A 4K0KI 2G0JA 3M8YA 2AQ4A 2FVSA 1VI7A 4LF4J 1KFDA 2VZ9A 1RI7A 3OFGA 3TAMB 1R8CA 4RW4B 4Y34A 3VGVA 2FJXA 4DR6E 3J81C 4PG6A 5K20B 4IR9A 3C66A 2VASA 1YVFA 4FYWB 2YKPA 2V2QA 1W25A 4AL5A 4PR6A 3GWCA 1RK8A 3W7BA 2XSJB 3KNAA 1NO8A 1VMBA 2HNZA 4W90B 5KFDA 2C3YA 1HNXJ 4WFNQ 2BQ3A 1TMMA 4Y0FA 2X3DA 3ENQA 2V8DA 2DBBA 9RUBA 5GAHU 5KOXA 1WC1A 4NWBA 3OBIA 1BQMA 2AZ1A 3K8WA 3UVJA 1YJ9S 1FKAE 3IAM9 3SCIE 3C16A 3A1YG 1HR0I 3VCDA 4DR4E 1UZDA 4Q2LA 2G13A 2ZDPA 5A8KA 4KO0A 4RUCA 4X62I 4ECUA 3C15A 3LP2A 4JI7E 5G0RB 3V4IB 5DG7A 3AH6A 4DS5A 2E9ZA 2C37A 2KJVA 2JEAB 1NU4A 1O51A 2H9ZA 1NJZA 3I0RA 3VV2B 1Q1KA 2CPZA 5LXRA 2J8AA 4XPCA 2QT7A 3SQOP 1C0TB 3DRXA 4FW6A 1LK7A 4QIFA 2V68A 2ZBQA 2GGPA 3CCZA 3DOLA 3CD5A 3OXGA 3RRGA 2VG6B 3KHRA 2GNKA 2BVZA 3Q8SB 1FK9B 4URQU 2HHWA 3H1CA 4IFDC 1KLMB 3MZIA 4Q2MA 3K5LA 1DQAA 1H38A 3PS1A 1EZZB 3L4BC 4ZMMA 4MDTA 4A8SA 3WDOA 2XMUA 1GTHA 2CNLB 3LW5C 4I6WA 4RW9B 5F8JA 1W2IA 2ZOFA 4MKYA 1QTNB 2NXNA 2YH1A 3JQKA 3ZNJ1 3TUIC 3NAIA 2C3MA 4ZJOA 4KR0B 1ZA1B 2BE2A 3L7ZA 5L1IA 3Q89A 2GAGC 5BR8I 2DH7A 2BA1G 2V8PA 4N77A 1OY9A 4DV7E 1K9MT 3WQPA 5I42B 4KPCA 3KG0A 2R2SA 1DLOA 1SKSA 2KDOA 5E3PA 3SSQA 4DV0F 1XMOI 2AYBA 4FKXA 4ILLA 5HATA 2JEGA 1IBKI 2GJ2A 2UXBI 5L39A 3MM8B 3Q8QB 2ZH3A 1UFKA 2IDEA 4GVLA 2EG2A 2QGFB 2AP6A 5CYMB 4KGVB 4PQAA 2BJ3A 5GAEU 1IR0A 2DIUA 4B9SA 1LEOA 3SXLA 3BDEA 2P2CB 4RNFA 3NCQA 4KGXB 4FF1A 2IRYA 1SUQA 1Q8LA 1YI2S 2MZSA 1H98A 2UUAI 1MNEA 2CJQA 3IG1B 3DOMA 2CDRB 3I4PA 2KT3A 4WK1A 2VOPA 3G6ES 3HFKA 3VR1A 4DX5A 2IRXA 2PA3A 2DCUB 2OD6A 4DL7A 1E6YA 2CQPA 5KFRA 2W9CA 1M5KC 3D0GE 4GKJI 3DI6A 5KFBA 3GILA 3UHMA 5FDLB 3U02A 4IDKB 2HHHF 4PRFA 5DM6Q 4HACA 1FFWB 4DV0J 4DV1F 2RRNA 2HRYA 4WKRA 2I2YA 2CJKA 4JI3F 4UQTA 1X60A 1M5HA 3RZAA 1RT6B 3QZ8A 1SV5A 2RDDA 4ZP8A 4R8UA 4Z7CA 2UV8G 2ZNZA 5T41A 2OPSA 3W8GA 1NDLA 2UUBF 2BV3A 4HYKA 5F8MA 4K7QA 5GAGI 1TKTB 4JI0E 3CC2S 1RCOB 1VQLS 4MYTA 3M8QA 3BH6B 1RHJB 2HGLA 4LREA 1TR0A 1HBNA 5FLXC 1OO0B 4PG8A 3M6XA 2W2OP 1BMQB 1V5IB 4FKYA 4WTYA 5A8RA 4NL5A 6AT1B 3TYTA 2QC3A 1RE1B 4L3KA 2V69A 1TZ0A 2AJQA 4DZ6A 2AEJA 2F4VE 3CCUS 4ZLPA 2OTLS 3AD8C 4LF7E 3SCLE 3P49B 4JI2I 3QO9A 2VQEE 3D1OA 4DPXA 3QFHA 5IT9U 3J7AG 2YH0A 4UOCA 3T1YE 2HHHJ 1NK5A 4AT1B 3E01B 4QNJA 3I5AA 5JMNA 4P2SA 4LF4E 2C39B 1NB7A 2UVRA 1GH8A 1WSRA 2GV1A 2FC9A 4BBYA 4BC9A 2UUBJ 2R7SA 1RYRA 5JEAD 1FNXH 1MROB 4LRFA 1NM2A 4B9VA 2BANB 4L75A 3MTJA 1JLAA 2VG7A 1J5EF 4CDIA 4LQ3A 1W7WA 4MH8A 2O1TA 2CVEA 3FQLA 1RDRA 5T7LA 2IAJA 2ZZNA 5D15A 2XO6A 5LSOA 1YKWA 4NXMI 2RS2A 3BREA 3TZXA 3CEDA 4U9RA 3IBFB 2B43A 3RB3A 4K4ZA 3NG8A 1NEEA 4OX9E 2JC1A 3UN5A 1AFIA 2EI5A 1BD6A 1FI4A 3R8YA 1L3VA 3P3DA 2LQBA 5E3RA 1NPKA 4DR5F 4B9LA 4B3MI 4D3HA 3QT6A 3G2XA 4UQGA 3UR3C 1WWHA 1BQXA 1FJ7A 1UW9A 2D69A 4V19X 2QFIA 3DGPB 4CM2A 5LM7E 2B9EA 2LXUA 1HL6A 5C24B 5DZ6A 2UU9F 1CJUB 3WU6A 4B3SE 3Q6NA 4NRTA 2MSSA 4OJGA 3HVTA 1NCLA 2E9TA 4FF3A 3J80Y 1BC6A 3CCMS 1M90T 1J5EJ 2Z5EA 1TL3B 3RR7A 1N5QA 1HWIA 3MEEB 3KDOA 3MOZA 4J37A 2MY8A 1DY3A 2NXEA 5D0EA 2XMJA 2OSQA 5DRPA 1R0AA 4DPYA 3MAQA 1RP5A 2OLWA 3VQTA 1N33F 4JV2A 4FF4A 2BABA 4ZS6A 4NBQA 3ET6A 5KFNA 4LRBA 2I1RA 1RT7A 4NLTA 1IR2A 3D0IE 1X0PA 2Z0GA 1JLEA 3QLHA 2O3DA 3Q83A 5LJ3Y 1VBXA 5DLGA 4OZ1A 2YQ3A 4RKUC 1YK9A 2AGOA 4O3PA 2AYMA 1JKHA 2YPZA 5KFSA 2UU9J 3CJ4A 1H6KX 4QWAA 1SIZA 4OZNA 4TVAB 3W5XA 1UTAA 4ZN1A 3BGRB 3K89A 1GFWB 4X2BA 5DDQC 4B9TA 3LGHA 2L08A 3THPA 4WZMA 2B7CB 1LKZA 4PQUA 2WW4A 3DDNA 3ZZ0A 1RCXB 1WG5A 2KI2A 1VQ8S 1MU2A 4RL1A 2ZM6F 1KQFB 2C2EA 1S4FA 1UVIA 1ITPA 1N5YA 2R7XA 1JLFA 3NBPB 2CPXA 5E7OB 1R6VA 1EJ7L 3GCXP 4ZVQB 2W01A 3UWTA 2QEXS 1FEHA 3EDRB 5CYJA 2B8QA 3PJ9A 5J2QA 1GX6A 2V0NA 1X9SA 2DNPA 4Q0BA 3T6BA 2K3KA 3D6HB 5DQHA 4ES1A 4U7UK 5JVGQ 1T9UA 1WOOA 3MMCB 3GCMA 1HD1A 1NNDA 3M2UA 4OO1D 5GAHI 2N3LA 2PC6A 3Q8YA 5KFWA 1TV6B 3J81U 1VYAA 1C0UA 2GW8A 4A8XA 4O4GB 2OUGA 3CCLS 1FESA 1JXVA 4PABA 1KTQA 2ZM6J 1Q81T 2DR7A 3ZTSA 6FDRA 1DZ5A 2AGPA 1S6PA 5CAAA 4FW4A 1VRQC 3I9V9 1TL7B 3DRSB 1RWMB 1JX4A 1LWEA 3MMBB 5E0OA 1SJ4P 4PG5A 4LFBF 2IY5B 4IS9A 4WTOB 1KRPA 4DS4A 1SH3A 4ELVA 2AWZA 4L6V3 1Y11A 2F65A 3KWMA 2R2TA 4BA2B 2V2ZA 2XHWA 4WFZA 2GMJA 5KG3A 4TYAA 3CMES 4MYUA 4K4VA 1VQ9S 3NCPA 1KS2A 2RNEA 4RJVA 4Y28C 3NOCA 2GIFA 1YHCA 1RJJA 4WUDA 5IWAI 2F8HA 3P6YC 5C0XF 4Z7YA 2LEAA 3J81Q 3NY0A 3SFGA 2XULA 2Y1IA 3G8QA 2MQLA 3FEXB 3KLFB 4DV7I 2MZ1A 2EBGA 3CD7A 1FJEB 1WHYA 4EO8A 4OHXA 4FWHA 1OY6A 4AM3A 2RQKA 4Q7AA 1XMQJ 1CS4A 1FWKA 3D0HE 1WF0A 3MEKA 2N7CA 2FJVA 2B4PA 3TWZA 4NA3A 1PC5A 4KPYA 2AKWB 3CNQP 1HARA 2PO4A 3G6YA 4P2MA 5HLFB 1T94A 2AEMA 4C2MA 4A8MP 1OYSA 5AE3A 2C22A 2DH8A 2OPRB 1S57A 3IWXA 1U6FA 2YKNB 2CQBA 2QMXA 4P74A 2RHSB 3ZO7A 1NZ0A 2MLXA 4F25A 5GAEI 1JJCB 3MCNA 3FEYB 5CABA 5AE2A 4CO5A 3CD6S 2Z2ZA 2V50A 4NYOA 3P8BB 3RG6A 3M30B 2HBZB 4FF2A 5B0FA 1S0MA 4J9KA 4C4WA 1C1CA 4HR2A 4F0HA 3TAQA 3V81B 4C98A 3OTBA 1NSPA 2H51B 4PZVA 4E0DA 4U95A 2FY1A 2HVHA 4JI0I 2J9DA 5I3QA 3WU5A 2G2OA 2QO3A 2G0CA 1RHQB 4ZPAA 1U6ZA 1TUVA 3BGUA 1TL4A 3LGMA 3OQ2A 1RYSA 1U45A 4Y2IA 3T19A 1HK7A 3F44A 4ZLJA 1SC6A 2F4VI 3H98A 4NLGA 1URRA 3ENWA 4FXDA 1T03B 4JUZA 5F8GA 4LF7I 2CKWA 2HBQB 1H7WA 2B0GA 4ID8A 3QJJA 2O67A 3LP0B 1X4HA 3CCSS 1HWLA 2PI4A 1RABB 4OI6A 5A0YA 1N4LA 2VQEI 2DGSA 1N34F 2V8GA 3Q86A 3H8YA 1S99A 3D4JA 4DQQA 2PO0A 3GMGA 1RT5A 2BJEA 3RU0A 5FIIA 1JLCB 2JVOA 4I68A 5C0XB 2QMUB 2RU9A 2H5IB 1ZXMA 4LF4I 3KLGB 3OUYB 3M2VA 2MZTA 3MWBA 1NHUA 3KUEA 4ETZA 3MMAB 4KGZB 2GAHC 2IFXA 3OFFA 2PMZD 2MXYA 3LAKA 4Y6IA 1X31C 2YNFB 3SSSA 4F2SA 1ZYQA 4AUKA 1YWXA 5JEAA 5L46A 1TFWA 3L9ZA 3LP1A 1RAGB 2IA0A 2HVIA 1QSSA 5K36E 3Q8PB 4LSLA 1K73T 1B0PA 1KC8T 1HFEL 1LWFB 2AMCB 1Y3KA 4HT5A 2JEBB 2K06A 3PW2A 1HNXI 3G96A 3BGFA 4FNIA 4RWXA 4MAKA 3IC1A 1RT3B 1EP4B 3ELHA 2MKIA 2PNZB 1T05A 4X65F 3QFWA 3I87A 1N34J 1WI6A 3H25A 4RZRA 3M2RA 2BQRA 3PVXA 4YFUA 2OEJA 3R5BA 1Q53A 3SV4A 1V3RA 3NNAA 1Y60A 1RWXB 1USVA 3M8PB 4USHA 2GJFA 1RAOA 3LA0A 3V5RA 2KYZA 1HBMA 3QRPA 2J7UA 2Z5BB 2A6MA 5ETTA 1I1GA 3JTNA 3GYXB 2FLOA 3AJ1A 3MEGB 4I64A 2BA9A 1TQLA 4ZJLA 3P3GA 4DUYE 1UVLA 3PCOB 1MN7A 2VL1A 1PJ5A 1BUXA 3NGTA 1HI0P 5FLXQ 3KK3B 2NLWA 2DHAA 4MKBA 2AJFE 1N0VC 5HANA 2OHDA 3Q8VA 2HS0A 4RUHA 4X65J 3A8IA 2QSFA 4JI4J 2Y8YA 4J9QA 3NAHA 3QWUA 2HBRB 3CSKA 4OMFG 3M8SA 3H7HB 2QRRA 5CHCB 2GVZA 3M32A 2BR0A 1U1NA 2XM3A 1G2EA 5L1JA 4EZ6A 3HM9A 1IWGA 4U3DA 2R8HA 2VPZB 4U3BA 3OJUA 8AT1B 4CLTA 1D1UA 3HHLC 9ATCB 1HBUA 4IZKA 2W2QP 4NLOA 2Q43A 2ACMA 4USIA 1DAXA 3CJ2A 3CUNA 5K9FA 4PWWA 5HROA 4YHHF 2RU3A 4DUZF 3CCQS 1FRIA 2JFDA 2NYHA 3ISND 4AQYF 3A12A 4LFCF 1XMQE 1R8BA 4I0WA 1QAIA 2GA7A 4V1Ak 3G82A 2YWKA 4K50A 1KR4A 5ETOA 2AF6A 1OMSA 4DCPB 4DSJA 1VQSA 3JTOA 1YG0A 4IFYA 4DDFA 5A2QU 1FCAA 4B9NA 2W7AA 2KG0A 3D6MB 4HLBA 3BV8A 5DNLA 1SC3B 5EWEA 3JS9A 2ALYB 3LWLA 3W1YC 3OL8A 2HNYB 3OXFA 4BC7A 3JYTB 2DNMA 2C3UA 2NQPA 1U1RA 3ZTQA 2RQCA 4KB7A 1T11A 2ZH5A 4DR1E 1FNMA 1QAXA 3RB0A 4ECYA 4OO1A 2MYFA 4DV0I 4AQYJ 1S9EA 5C42B 5CCLA 1B99A 3JQMA 1ELOA 1N32F 1RADB 4H4MB 2IYIA 4J9RA 3MEDB 2PI5A 4WIQA 4UUXA 3W2VA 5B0AA 3MM7B 2HRUA 5DLFA 3PFOA 4CLFA 3QGGA 1D9AA 4F4ZA 1R7IA 4DSIA 4NZ7A 1U8SA 1YJNS 3T41A 1JIHA 2XMAA 3NCRA 4CNYA 5A2QQ 1I3OB 4YP3A 4DZDA 1J2VA 3PRVA 2IPOB 1IVZA 2X1GA 3GIRA 4F26A 2OFGX 3UE2A 1KVJA 2K1RB 1UZHA 2GX8A 5K14B 5I3UB 1LWCA 3I6PA 4QNKA 1RISA 1N54B 5KT6A 2IIHA 3FEZA 4W98A 4AL7A 2P9EA 4KTQA 5K36C 2HHHI 4F2RA 1JQGA 1KLNA 4MMOA 1HW9A 2ZFHA 2IVMA 1WNEA 3TARA 3BF4A 3UNYA 2UUBI 1GXLA 1UEVA 3CJQA 1GEHA 2DXEA 3ITHB 2J7KA 3K5NA 2PMWA 1LK5A 2ZH2A 3L09A 3G6VA 1RKJA 2HHUA 2ZITA 2C2KB 2Y8WA 3PDNA 3EZ5A 3DU6A 3IO1A 3QAEA 3FSYA 2DO0A 2DITA 1VRTA 1IKXA 4JI6E 1DRZA 1HIYA 4ZPVR 1XNRF 2HRTA 2KT2A 2R42A 5ETPA 5GVQA 2BOAA 4P71A 4JI8J 2DNYA 4IOBA 5LMUF 1DTQA 3OW2R 2I38A 2X1AA 1FRJA 2PO1A 2HLTA 3OL6A 4G3IA 4PAAA 3PKYA 4Y2MA 1VC6A 3J80U 3U1KA 1UKUA 1QDUB 4X64F 2YNIB 4ECVA 1M1HA 3N4WA 1OS5A 1SJFA 1UDQA 1ICEB 1HPZA 2DT9A 2YKOA 4I7FA 2Y1JA 2LVWA 3GQCA 3CDUA 4HHUA 2UZAA 1IBCB 4F4YA 1PKPA 3LAMA 3TA2A 1X7VA 5F9LA 2MQOA 2LLZA 2HKJA 4CH1A 1DFDA 4CH7A 4Q43A 1T9YA 1J5EI 4WUCA 5HMXA 2QFJA 2E7WA 3GJRB 4U96A 4YR3A 4FYVB 5HMWA 1RTJB 4DBQA 3HZEA 2DD8S 1ZAVA 4G6VB 3FDSA 2HFOA 1S1VA 1JXEA 2CQHA 1YIJS 3O3LA 3OFHA 4JI4E 4MK7A 3RRHA 2EWHA 1TVRB 5LMUJ 1FXLA 3AHPA 3HLUA 2MGZB 1NHVA 3S8SA 4ANDA 3V6JA 3ZZTA 2WVFA 2R7TA 2QYCA 3ZZPA 3EM1A 3CJ3A 4X64J 3HFZB 3TA0A 5DGAA 4LR8A 4Y65A 2VONA 3WX8A 4AE5A 4DG1B 1JLQB 3ULHA 3C2PA 2YVSA 4P10A 4PPDA 2Z2MA 3OHAA 4DI6A 1KHWA 3PIPQ 4F3QA 4EMDA 2UU9I 5DGBA 5ETNA 3AD9C 4C8NA 2XSFA 4MU1A 4K4WA 1GK8A 3NS5A 3TOQA 3M6AA 1Y4UA 2NN6F 5HAOA 1QE1A 4DQSA 2QMWA 3JAMY 3W9JA 1S59A 4OQJA 2XZWA 2MLYA 1WELA 2CAJA 1NK0A 3OJSA 2VIHA 4LCGA 1RWPB 4UOHA 1IBMF 2J0WA 4P52A 1Q4RA 5EL9A 5C5JA 1D3WA 2FHJD 1T7PA 4JV5J 2C2OB 1SC4B 3W2WA 1EA6A 4J9MA 2H4YB 2GCFA 2OPPB 3OFEA 2HZVA 1GMWA 2Z57B 4M5DB 4CTAB 1PJ6A 3GSIA 1IKYB 4PXCA 2L48A 1CC7A 3RB4A 2ATCB 2W9BB 3ONQA 1FO1A 2ZBRA 1TKZA 2A18A 3I5CA 2KM8C 1HHQA 4JV0A 2C38B 1Y5LB 1C4AA 4TY8B 4F7VA 4LFAF 2HQFA 4DMZA 3IA0A 4OX6A 4WFXA 3X1LB 4LVNP 1VLYA 1WTBA 1CJTA 4X66F 1IBMJ 1CLFA 2KFNA 4OHWA 4ZVIA 2QV6A 5CH7B 1XNQF 3DYAB 2ZM6I 1VBZA 4ZIVA 1GNKA 1Y3JA 2LJPA 2EFVA 2JLFA 3H5XA 1DTTB 2LXIA 1RQ0A 1TUGB 3G8TA 4ZPWR 3M7ND 2V8VA 4ED6A 3OV7A 4KH1B 5A8WB 5H9FJ 4MIAA 1UPPA 1TAUA 3KJFB 2EPIA 4OV6A 2HLUA 2KVQE 2KZZA 4J9LA 4EEYA 4WFAQ 3DRPB 4LFAJ 4A8QA 3DN9A 5CYQA 4RU2A 4A4JA 4H4OA 3PFEA 3PZPA 1NKEA 2RE1A 1YJRA 1Z2LA 2OEKA 3T1AA 4X66J 2QLWA 3K5OA 2MQPA 4LF2A 2NXUA 1XNQJ 2NN6B 3IMQJ 4OI2A 2MQ8A 1PILA 1BKNA 1FKPA 1HNZE 3MM6A 4C8YA 4DR2E 5D6GA 4PEOA 5K36B 1KKHA 2KB2A 5J1NA 1TK8A 3SDEB 1I51B 1XMQI 5J1PA 4ICLB 3MPDA 3T1HF 1N5TA 3KHGA 2DVIA 3Q1QA 4RW4A 3QZ7A 4OX7A 3PYEA 3QT7A 4QWEA 1FDNA 1F9HA 3X3UA 4DXLA 1D0EA 5EX3A 2ZKTA 1VQPS 3CJSA 3SV3A 3PYGA 3TO8A 2A0FB 3W64A 4TY9A 5L1KA 2LXFA 3HFVA 2Z58B 5HI7A 3PR5B 3PYFA 4JI8E 4HH0A 1ZAXA 4WU3A 3RBZA 4JG4A 4F4XA 5HVFA 3AA9A 1JJHA 2AIRB 3AB4B 5DRKA 1HYSB 3H2UB 2HHTA 5KOWA 2RB7A 4O0NA 5HBMB 3M85D 4FBUA 3D7SB 4ED0A 5F0UA 1H73A 1Z0BA 4A8YA 4UT4A 1XBWA 1SL0A 2ZH6A 1AXQA 3MMJA 3T1HJ 1RWWB 2GVDB 3E8OA 3N5FA 4LPFA 4ZLLA 3KJNB 3KFWX 4U67Q 1TK5A 4WK3A 3V4IA 4A8KA 1WC3A 2E7XA 4HDGA 2FTRA 2CJAA 2DNNA 2GHVC 4DV5J 4ZP7A 3NGKA 2DTJA 1X5OA 4Q45A 5KFQA 1SIWB 4QYZJ 3FMBA 4ZPBA 1Z0WA 2CFXA 1C0TA 3QGHA 1CQMA 3AA8A 2XZDB 3A3PB 2E5LE 2CZVC 5C2CA 2VG6A 1PAUB 1FK9A 1KLMA 4ID5B 4C0HA 4LBPA 1XR5A 4AYBD 2I9SA 1RAJA 2V34A 1HLWA 5CZVA 4LF8E 2JLEA 2WB1D 5IS2A 1GMVA 3FRZA 3RTVA 3IGVA 2XGPA 2AGQA 1SL1A 3PX0A 3UR0A 4PRXA 2HZCA 4ZJQA 1WC4A 1IXKA 5LT5A 5KT2A 1BGXT 4HT7A 3DLHA 3BN7A 2J9CA 2KT5A 3CIZA 4ITSA 1WHVA 4K4SA 3UVJB 4JV5E 2G9OA 3C16B 1EQ0A 1JB0C 1C1BB 4OI4A 4TXSA 4P6QA 3C6UB 3H4LA 4DR7J 1K1QA 1RAAB 3O1LA 1RTIB 3FZ2A 1LW2B 2CG9A 4NCBA 1N34I 1FD8A 1BQNB 4OHYA 2JT2A 1HNWJ 4R5PB 4OYOA 3SEOA 1S48A 2M2BA 4CO4A 2DHHA 1XK8A 5CYMA 2FHMA 1RR9A 4TLRA 2KO1A 4ISAA 2B4UA 1SH2A 4F04B 3BO3A 1FRMA 5HQLA 3F73A 4OIXA 3D9BA 3PJWA 1KBRA 1OSDA 3D6TB 3IG1A 2E1RA 4ZK7M 2LQ8A 3T5JA 2J9DE 3WBZA 4K0KE 2ZBPA 2R8KA 2X51A 3VALA 1N36F 4FYDA 4C0OC 1D9FA 2XMTA 1MLAA 4M1KA 2HYIB 3CWJA 2B51A 3WC0A 4IDKA 3K1JA 3I4HX 2E66A 3TVYA 3UQSA 4NXNF 2E5HA 4AL6A 1NDCA 4X65I 2YX4A 2IMWP 4JI4I 1RT6A 4A8FA 4DU7A 1NKBA 3W63A 1HWKA 2W7OA 4KIAA 1JNZB 1SI9A 2IHR1 3IR5B 2P6TA 2X3GA 3TX8A 1FX4A 2D74B 3PV8A 1TKTA 4IUFA 5KT7A 1RA6A 1RU1A 2RKIB 5H9EJ 2YNGA 3QSIA 2CZ9A 2FZGB 4GKKF 2M3DA 3OSNA 2CZ4A 4LF6F 3EGNA 4DV3J 1HKAA 3ICLA 2XLKA 2QLJB 2F8EX 1N36J 2DXFA 3S6EA 2MHEA 5JEAE 4K2JA 4DQRA 3I0SB 4EU0A 5LMNF 3NXZA 5C0XD 2VD3A 3VVUA 3VGUA 3QBCA 1S7IA 3E01A 5RUBA 3MTKA 2CQDA 3QRQA 4OZ0A 2GFFA 3CF5Q 2C39A 1QUPA 1B0TA 1U09A 1HQEB 2FYXA 2FHJA 3BSCA 2VHGA 4KRWA 4JI1F 2AE8A 1MROA 1EI1A 4YN3B 1VS3A 4FPRA 2HS3A 2BANA 1IR1A 4P72A 4YQWA 3TQEA 2PGCA 2WONB 1WF1A 4GKKJ 4LF6J 4MQYA 1Y6ZA 2RIJA 3ZKDA 4IQXA 5KFIA 3NNHA 2R9LA 4O0IA 3MAHA 5AT1B 3HJFA 4OZ5A 4LF1A 5IOLA 2MMYA 3OTOJ 2RF2A 3CO0P 4ECQA 4NLVA 3U1MA 3TA1A 3G8SA 4AQYI 4KHRA 2CWXA 1UAWA 2HFSA 3PACA 2ZE2B 4USWA 3PW0A 1OYEA 1RLCL 1WHWA 5A8RB 2QL5B 5KAKA 1HQ2A 5MAOA 5BR8E 1EETB 1F9FA 1XR7A 1CJUA 4DV5E 4BDPA 2VQFJ 2PO2B 4DV2F 2R2UA 4JYAF 4KC5A 4I67A 2RDJA 2XS7A 2L3MA 2HVDA 1XMOE 2WP8B 1NB2A 2I5JB 3NWGA 4M5HA 1NSAA 4O3NA 3A8EA 1RT4A 3HHNB 3QJPA 2XLIA 2NXJA 3MEEA 3VAFA 1J5OA 4MK9A 2LQ5A 4GMKA 3OR2B 3W9HA 2NREA 3GG1A 3FMWA 2K8GA 2XS2A 2Q6BA 3LH2S 2CPYA 1VQKS 3HDSA 3K5MA 5K5MA 3TR5A 1Y4ZB 4JBCA 1KVKA 2GMLA 3SQGB 2DRAA 4LR9A 1SJQA 3L7UA 2PEBA 1JLAB 4NMLA 1KQGB 1FWLA 4FWGA 4NYPA 4LF5F 1ZA2B 2J9EA 1WC0A 1V3ZA 2RT3A 3KLEB 2AYGA 2FVPA 4J3DA 2YKAA 2FPHX 3QT5A 5J2MB 2BJ7A 5G4DA 2IM1A 1N0UA 1VQOS 5H9FK 2Q6CA 2CNOB 4F50A 4GKJE 3GFZA 4ZVUB 4CO1A 4OYIA 3QJLA 1BHNA 4JYAJ 4ED5A 1PO6A 3VAIA 2IM3A 3BGRA 4WJBA 4NA1A 4URGA 5BJRA 2EG1A 1WEYA 1ROFA 5KT5A 4XDCA 3JSBA 1VIOA 2ZHOA 4C3LA 3MD1A 4DR7E 2F3JA 4FW5A 3TUJC 3J81Y 4JI8I 4YY3J 3ZZOA 1HNWE 4J7CA 3CDBA 1MX0A 1RB0A 1KDNA 2AW0A 5KG4A 2G2YA 1U48A 1NJXA 1Q8BA 4OO1E 3MCSA 4WE1B 3ILLA 3KJQB 3NMRA 1RBAA 4LF5J 4RNOA 1FJCA 5C25B 2GQ0A 2NS1B 5J1EB 2GO3A 2DNGA 4JI2E 3JSYA 4ANCA 1HNVB 3DD6A 1NHKL 3MMCA 5AJ3F 1U8WA 1CEZA 2HGNA 2OAUA 3QWPA 1T02A 3E3XA 1TV6A 4QOTA 3ILOA 3MF5A 2ZBIA 3A3OB 4O4GA 2FHKA 1VQ5S 4ENOA 1VLOA 3UDEA 3DHXA 4P73A 5LMUI 4JI5F 1H7UA 2E9RX 3ADAC 1H0HB 1TL7A 5JEAC 3DRSA 4D3GA 3NL0A 3BKFA 2B9YA 5HQ8A 1FJGF 2FLNA 4X64I 1N88A 2HFNA 3MMBA 3JAMU 2DYAA 1T3OA 3NKYA 4PYAA 4JOUA 3K57A 1G7CB 1X4FA 2A2DA 2P5VA 3IRWP 1WJ9A 1NHIA 2MKYA 3CJKA 4DV3E 2POKA 1MU2B 4BA2A 4RNHA 1OY8A 3H0PA 5AJ3J 4PUOB 5F8IA 3VGSA 4DR3J 4O3OA 3NEKA 4LMZA 5GADI 5LXYA 2C2NA 1R43A 1NAQA 5KFFA 3C46A 3CT9A 1HQUB 1P27B 4HL9A 3HHEA 2HFUA 5J2QB 2XNQA 4I4BA 2EK1A 4JV5I 4KV8B 4N41A 1ZOTA 5K8PA 2H4WB 4Y00A 3UN3A 3QRRA 2VH7A 5HK4A 4WXWA 4N47A 2LQJA 2RRBA 5DDRC 2XLJA 1FJGJ 3ISZA 1N5SA 2HSEB 2JEFA 2HAIA 4DSFA 3EGVA 2IA6A 5CCMA 1UJ5A 2JWNA 4B3TF 2GO4A 3NGRA 4M5NA 2KH9A 5CD4H 3IGNA 5HJXA 4K4XA 1YRXA 5HLFA 4USVA 1UEUA 2M88A 2WSEC 1IBLJ 2EFNA 1VBYA 5M2RA 4O3SA 3ENVA 3L7OA 2OPRA 3PW7A 3DLLQ 2YKNA 3IBWA 2FJAB 1Y5YA 3EGZA 4UF4A 4FWDA 3OTOE 2L41A 1IBMI 3EYZA 3PHEA 3JSMB 2VC0A 3R27A 4R25A 3R1HA 2OMOA 5F9NA 1UDOA 1CJKB 5D4OA 5EUHA 3ZC4A 4WP9A 3NLCA 4AIMA 1KD1T 4IYQA 3MFHA 4KH0B 2X1BA 5D0GA 2CUYA 3M30A 3CCRS 5KFGA 5DJBA 2ZC3A 4MTPA 3GCWP 3ZZUA 2IBOA 1P6TA 2VQFE 2UUCF 3AB2B 3V81A 2E5IA 4B3TJ 4FYYB 1H2UX 1CULB 1Z5CA 1SQGA 4LSNB 1CJVB 2V4RA 4QR0A 4CO3A 3P4UB 3TJAA 4EFAC 4EBDA 3M7NG 1D8ZA 2QA4G 4FVCA 5KFVA 2W2PP 1X4GA 2DY9A 2EFGA 3DRRB 4LFAI 3RW6A 2OTJS 1Q79A 1YJVA 1XTZA 3THTA 3KLHB 3AY0A 3KLIB 2F8MA 1NMEB 3GU0A 1Z0CA 4X66I 1VRUB 5THWA 3UNGC 3KK2B 4FZVA 3ZFVA 2CQ3A 2J65A 3D67A 1T03A 3ZZZA 5FLXY 1XNQI 1CS4B 1HR0F 1RAIB 1QJHA 1Z5BA 1S49A 3V6DB 1RSCA 4X62F 2YWFA 1P9QC 3C8YA 3J7YU 4FBTA 4K2XA 4HDHA 4J9PA 5HP1B 1YZ6A 3K7RA 4ZPDA 4RW6B 2FC8A 2ZVSA 1JLCA 5C0XA 1R6MA 4DV6F 1E6VB 1FEEA 3OUYA 2O1WA 1E3PA 4IG3B 1YJTA 2UUCJ 4PPZA 3VTIA 3HI9A 1JLGB 3MMAA 3HJCA 2FVRA 3D6FB 1UVMA 4OO1C 3TW0A 2VOOA 2YNFA 1ZBTA 2DK2A 4ZVHA 4OYBA 3RUBL 2YQ0A 1RBLA 1S72S 4MJKA 1PIEA 3NS6A 1UA0A 2YXLA 2GJIA 3BKTA 2CRLA 2D9PA 1LWFA 2M8HA 4YY3E 2CIMA 2JEBA 2HMIA 2Y0BB 3MPUB 5B09A 4DFMA 2Z5CB 2WSFC 1IN0A 1RT3A 3KXDA 1UWBA 3Q6MA 1EP4A 4KQZA 4PYDA 4LCHA 1WDTA 1O5JA 4G1IA 3Q8UA 2LP4A 1RKIA 2IC3B 4XPEA 4DV6J 4DV4F 3M8PA 3AD7C 3T1HI 2FHOB 4BHQA 4L74A 1FF2A 1PKUA 1TTHB 1Z0TA 2IDLA 3T6JA 3MUTP 1VQNS 5IWAE 2ZWPA 3CCTA 1IQZA 3OR1B 3FFIB 3M05A 3DMJB 1PVGA 2ILYA 4OZJA 1U7LA 4DV5I 2VG5A 2C3OA 2IM0A 2MSTA 2NXCA 2JEIA 3BSAA 1F1BB 2CVIA 1IBKF 3AOAA 5EWFA 4X4PA 2UXBF 1GQEA 1KONA 2AX1A 4IZJB 2DGVA 1QVFR 3H5SA 2QA1A 3RBXA 3KK3A 1B0VA 2OP5A 3MM9B 3KG1A 4ZVTB 3R2DJ 1PC4A 5B0GA 1LFPA 2F5GA 1ZAWA 1OYRA 2GQQA 3L95X 1X8DA 1ZH5A 2DR5A 3KHLA 1FRHA 2IM2A 4DV4J 4HKQA 3U1YA 1WF2A 3GZ7A 5B7WA 3HF5A 4XTTA 2QX0A 4DR3E 2KU7A 4LF9F 4X4VA 2JRSA 3DDKA 2G4BA 4C8OA 2LQ9A 5A2QY 2FLLA 3H5YA 3HJVA 2NN6D 3M9NB 1T05B 3JTPA 3U27A 1LXJA 1Z2ZA 5K36D 2R7RA 3BYRA 1PAEX 3FBBA 4EBEA 3D3BJ 5DZ7A 2M7SA 4ED7A 3PEHA 4RO0A 4DR7I 4YB7A 4KGMA 4PXEA 1REGX 3AOBA 3HK2A 2HWTA 2Q2EB 4ZIWA 3HKMA 4B3RF 2I8EA 4P7AA 3KUHA 1HNWI 4Z37A 4HH1A 4EI2A 3B78A 2QLFB 3H42A 2ZD1B 3LQVA 1KIJA 3QYYA 5DDPC 3V2UC 2HWHA 2ZHAA 4DL4A 2U2FA 4CNZA 2M5YA 2CG8A 1IBLE 2I0XA 1UWAA 4KFBB 4LF9J 4N7TA 4NLUA 4IFDF 4KT0C 1P8GA 4ECSA 4ZPTR 1AB8A 3GONA 3V4MA 3T9ZA 4R1FA 1NZAA 1V3SA 2HNYA 1S0OA 3AXMA 2O1PA 2B3TB 3DLEB 4DV1J 4JI3J 2ABYA 3ILIA 3RJMB 2U1AA 3CDIA 2GVZB 3M32B 1TELA 3MR7A 2NYIA 1I6JA 5D0RA 3M8ZA 2W2MP 2UXDF 2CPJA 3BDPA 5C42A 2DISA 1QAJA 5D8HB 3BPDA 2YY3A 1SL2A 1RWUA 2B5JB 4H4MA 4O4RA 2RAQA 5B08A 4B3RJ 2LA4A 2VV5A 1R0BG 3MEDA 3HT3A 3R7BB 5DDOC 4DN9A 5KFHA 3MM7A 1N6QB 2MPUA 1EKSA 1HBUB 3TVKA 4NXMF 3PTWA 4OJHA 4DL2A 4DX7A 1HNXE 1ZETA 3LUYA 3TJ9A 3D66A 4DV3I 3I82A 3OXLA 2YWEA 2M4MA 2P9CA 2ZH9A 4USKA 2VFSA 3SIPB 3G86A 1T9WA 2K1RA 4B3MF 3PM9A 1MWYA 1YBUA 1N36I 5K14A 5I3UA 1RHRB 4Y2AA 1FD2A 2CXEA 1PSDA 1UEKA 3E2EA 2UXCF 3DLKB 1RU2A 1Y5IB 4ZVSB 2UXDJ 1SXLA 1SKRA 5GMEA 1GTEA 5AXKA 2D3OR 3PKMA 1HBOB 5KT4A 1REVB 1NSKL 1CVJA 4B3OB 3MURP 3ITHA 1M5PC 4MK8A 5JUMA 3THVA 2B4VA 2GHPA 3SI8A 1I94F 4KAIA 4WZQA 3LWMA 2CJXB 3W8PA 2ZDOA 4GKKI 3DDIA 4LF6I 4NLPA 2YWWA 1MW7A 4I6YA 2ZJQQ 4KYZA 4WF9Q 2R7OA 2BKPA 4ANEA 1APSA 1HHTP 2WK4A 4DR5J 1V5VA 4IFDB 4AD6A 3OTOI 2H48B 1R6LA 4USUA 2UXCJ 1BY9A 1N8RT 3KDNA 4HI2A 3GSDA 2V9KA 4OYZA 2FGCA 7FD1A 3C14B 2LKZA 3IP0A 4NX9A 2ZHBA 3PJXA 3M6WA 3EICA 2YNIA 4DR6F 2FZCB 4ZCLA 3CXCR 3MD3A 2BW2A 1RAHB 1ZPWX 3CWVA 1S9FA 3T5HA 1IM6A 4E2FB 3QGPA 5LL6R 1OYDA 3TZWA 1VHIA 2H65B 4NEZA 2VQFI 4NOHA 3T5LA 1YJUA 3GV8B 1I94J 1AZSB 3HZGA 3TQ1A 4FW9A 1KQSR 4YR2A 1YJWS 2E5GA 1UDNA 5IQQA 1F9EB 3P45B 4A46A 2YKMB 4H54A 2P9GA 3R5GA 1N33J 3HSGA 4ECZA 5ETQA 1RTJA 2EC2A 1IM4A 1IKVB 3ISNC 2QL7B 3EVWA 2FDNA 1EHWA 2GC8A 2W25A 1DURA 1S97A 3CJ8A 1WEXA 2BBEA 2BJDA 3FBCA 2I6WA 1FKAF 4QBUA 1S10A 4CCHA 1TVRA 1YX2A 2K7KA 2XMMA 1NHHA 3MM5B 4DR4F 1S6UA 2MGZA 3FVYA 1M0SA 5F8LA 4ZN3A 4DL0C 2BX6A 4JI7F 5D4LA 4DR6J 2M0GB 1JLQA 4DG1A 1VK3A 2XBPA 5KT3A 2LU1A 1S9GA 3B4MA 4DN0A 3SBMA 4JYAI 1QVGR 2ASDA 1MG7A 2R7VA 4DV0E 3NGUA 3SFUA 2HZAA 4XAKA 1DTQB 2KYXA 2VICA 1XWLA 1U1OA 2JEJA 2DKOB 3BPSP 5DQGA 5DS7A 3EDQB 3KUGA 4DL3A 2KKHA 3BSNA 4K5SA 1HPZB 4RLEA 4YY3I 3C19A 3K5PA 4EBCA 2VC1A 4KSEB 5K8OA 2CQIA 1HI1A 3KYLA 2HAFA 3IRXB 4DR4J 1X9WA 3VQSA 4P2FA 4C11B 4CO0A 5KFPA 2OPPA 2R7WA 4WYWA 2J0QD 4P2XA 3RRKA 4M5DA 4CTAA 4JI7J 3FBFA 2HVZA 3W5YA 2XYHB 1LW0B 3VAGA 4LF5I 1IKYA 3FSIA 3QATA 5ETSA 5FJ4A 1QD1A 4RUBA 5IT9C 2W9BA 4ED3A 3B82A 4AIDA 3R7SB 5JXSA 1F2HA 1OJ4A 2YQ1A 2C38A 4EYHB 4TY8A 1RWOB 1DQ8A 4WPAA 2HHHE 3GYNA 4DV7F 2CA9A 3SSRA 4DV1E 4JI3E 1RUSA 1S1UB 1QLNA 1RT1B 3LTOA 4ZVOB 3PW4A 1KVIA 3BEGB 3VF0B 1F5BA 2UUBE 3I9ZA 4G1QA 1Y7PA 3HCXA 5LOQA 1NBEB 2RDIA 2CQ0A 2F7VA 2JE6A 2J6SA 3A8JA 3PRYA 5B0BA 1DTTA 4LFBJ 1K47A 3GYGA 3GFHA 4JB8B 5A8WA 3ZKBA 2DO4A 3W62A 3QSYB 4C48A 4A48A 4EYIB 3EPIA 3WZ0A 2EFQA 3I32A 5LL6d 1T0TV 4JV1A 3IR7B 2E1AA 2FY8A 2XHCA 4H4KA 2F4FA 1X5SA 3DRPA 4I2PB 5DRQA 2Y3YA 4DR3I 2MY7A 2E7VA 1IWAA 3P76A 1RLDA 1QTMA 3UW1A 2C2MB 4FDFA 1M1KT 4OYWA 3GLJA 1KEKA 4TQSA 3PW5A 3KRNA 1EARA 3LNUA 4UTGA 4F02A 4LRAA 2UXDE 3AJ2A 3IM9A 1S1TB 4Y2CA 4B17A 3HVAA 1VBKA 2NN6A 3IBCB 1RTDA 5KFYA 1VHFA 4IRDA 5CZXA 4JI5I 1U0HA 3HVRA 1HI8A 1UJ6A 1FRXA 2W2NP 2CQGA 4JI0F 1B7FA 4YB6A 3F56A 3SDEA 2IERA 1FJGI 1J5EE 2O1UA 2Z30B 2BMBA 1Z0EA 5D78A 2EW9A 3EZOA 3R5CA 5L9NA 3M4XA 5HO4A 2DPIA 1CJTB 2QG9B 1B63A 3PRDA 2CJBA 3H40A 4Y2KA 2F4VF 4HEA9 4K4UA 2DIVA 3LO3A 2DNQA 2BR2B 4LF7F 4L72B 1IBLI 3DM2B 4CT9A 5KFTA 1BWVA 1PYTA 5KFEA 2VQEF 3IXQA 1X5PA 4DR5E 2DNKA 1X9MA 4FVMA 3T1YF 4LBHA 3HSDA 4QW8A 2OKQA 2AJ4A 4RBUA 1XJWB 4LF4F 1UPMB 1RTHA 1HYSA 2DRBA 2V2VA 4X4TA 2VA3A 4GVBB 1F5AA 4RU9A 2UU9E 5HBMA 3FUYA 2QLXA 5MLCV 2HWIA 4QU7A 1IUJA 1V6HA 4ZPCA 3JXOA 2HURA 2B56A 3WC2A 1YITS 2WNRB 4PG7A 4J5OA 3OD2A 2KTQA 4CI0B 1S1WA 1OSCA 4DQPA 2IMOA 1SPBP 2GVDA 5KG7A 2W4PA 4B3TI 1F6TA 3T9NA 2AJ2A 2J6UA 1S77D 3HULA 5FLXU 2L9NA 5T14A 2BA0D 2NSCA 2DEJA 1Q7YT 3DOKB 1N33E 4M5LA 4OJ3A 2AJ0A 2DGXA 2WB4A 5KTQA 3QIPB 5D4NA 2JC0A 5EN1A 2H5EA 4OX9F 3I55S 3P5BP 2DH9A 3EE3A 1YZ7A 2VODA 3T1YJ 2WBMA 1BWEA 1OPIA 3R6LB 3HSZA 2LECA 2DEIA 1L3SA 5IC4B 4M95A 2EK6A 5BYQA 4ZHRB 1U6BA 1C2PA 1QM9A 4IG0A 3M7VA 4PXBA 3D2WA 4ID5A 5CQGA 5C7PA 4AXJA 4B9MA 2JVRA 3K85A 1D9DA 1RWKB 4B3SF 2AYEA 2UUCI 3EVOA 1U02A 2GS8A 2KXNB 3C6TB 1H2VZ 6FD1A 2ERRA 4OLOA 1B64A 4QWCA 2ZM6E 1JLBB 3K2YA 3J7AM 1FXDA 3R1LA 1O8BA 1ZZNA 2YNHB 4HHJA 1KQKA 1R89A 3KJVB 4OX9J 3HSJA 1S4EA 3WIVA 4K5RA 1X4BA 4O44A 2G2ZA 3BQ0A 2N4CA 1ZM2A 4RR5A 1S1XB 1RTZA 1C1BA 3B6BA 4AFFA 5F8NA 3C6UA 1NZ8A 3MR3A 2M70A 1RTIA 1LW2A 2ALZA 4U8YA 3WU3A 2UVVA 5DNXA 1BQNA 3KMQA 1G4CA 3EXCX 4R5PA 4YS2A 3N6LA 1Z59A 1SKUB 4DV6I 3QPIA 1TKXA 3RYLA 4B3SJ 3VGTA 3P3EA 4ETXA 4CP5A 2HIYA 2IBKA 1OPZA 4EK2A 1X5TA 3UD4P 1VIXA 4IRKA 1G1XA 1SJ1A 4X4UA 2XEXA 4UOGA 3M1VA 4XIUA 2Q3PA 1SVDA 3LANA 4CLWA 2V63A 4WCEQ 1YLXA 2FQQB 3POTB 5HVHA 1KN6A 2P6SA 5B0EA 2JJ4D 4CIOA 4BLGA 3GR1A 2DXDA 1VDHA 2YX1A 1NHJA 3BH7B 1X0FA 4NMXA 2Q66A 4UUWA 4LFBE 3R97A 2EXUA 3J81j 3AT1B 1XC9A 2QE5A 1UW4A 5F3TA 1S6QB 4BWMA 1WKLA 2NPIA 3V6KA 1RT2B 2DGUA 2W9AA 3QAUA 3B4TA 2Z56B 2D41A 4OHVA 4DV4I 2JHEA 4DCJB 3P3CA 3F41A 4CLUA 3PNIA 4J9OA 4KHMA 1U1QA 5C0XE 2RKIA 3IWLA 2BKNA 2VPWB 4ZVFA 2J76E 2V6AA 3PS2A 1SC1B 2MB0B 3GIKA 4RW8B 4YHHJ 1ULRA 4PCQA 4DUZJ 4RWWA 1TL1B 3GE9A 1NK4A 2X1FA 4B08A 4IH5A 2WW8A 4IOCQ 8RUCA 3CDWA 4LFCJ 1U24A 1KTVA 4O23A 1E3HA 3I0SA 1U2FA 1UVJA 3I56S 2N7YA 1FE0A 1R8PA 2MKKA 2VKZG 3VAHA 1UJ4A 1IKWB 1JJ4A 1U2RA 4ZVPB 3JSRA 2LU2A 3W61A 1HQEA 1P1TA 1EB0A 2FVQA 2BXJA 1NJYA 3FRYA 2COLA 2ILZA 2IOQA 4RW7A 4Q5VA 4LF9I 4X4OA 2ZNYA 2WONA 2EFPA 1NH8A 1BE4A 4QWBA 3PRBA 1FNOA 2GIQA 2ZJRQ 2XGQA 3O6QA 3OVBA 4WFYA 2XG8A 5ETLA 2MHNA 4DV1I 4JI3I 4YDDB 3B4DA 3MPVA 3W60A 3R9LA 3MAAB 1Q95G 1K1SA 1N32J 4N8OA 3RAMA 4IO9Q 1XQIA 2MQQA 2V94A 3DLGB 3AODA 4C3MA 4KKOB 1EQMA 3MECA 2HQIA 3BBCA 2ZE2A 2YNGB 4B3RI 1JWWA 1VJQA 2OPQA 2HPUA 5D4PA 1KOHA 5IXUA 1U26A 2D3ZA 4GRSA 1CSJA 1U1KA 2BDPA 3NNCA 4NCGB 1OWXA 2EC0A 1AT1B 1EETA 1G3OA 3K8VA 2PO2A 4ZDNA 1SQFA 3S1TA 2V4JA 3KTQA 3HMJG 4IZJD 2WP8A 4DPWA 2HQGA 2I5JA 3Q2TC 3M8RA 1N34E 4LIRA 1YBTA 3HX9A 3FKBA 3NS7B 2DNOA 1W2BR 2FLPA 1OYPA 3P06A 3OR2A 1NJWA 4Q44A 4X4NA 1T9XA 3KHHA 4LRDA 2ZOGA 2M9KA 3R7NB 5KFMA 2DR9A 5DETA 2CQCA 4U7CA 3G9CA 2IJRA 2CPEA 4IRCA 3OTEA 1B70B 3PS3A 2UXDI 1ZM4A 1T3NA 2BJ9A 5CD4A 4F3MA 4N56A 4LVOP 2VA2A 4DLGA 4OX8A 3SQGA 3GR0A 5DG9A 4F4KA 4NASA 5L8RC 3CE8A 2MQNA 3KLEA 3FCWA 3AOCA 5J2MA 3ENAA 5F8HA 2DHXA 3TAPA 1UVNA 1LNQA 4MKAA 1Z4UA 4TNOA 3R3TA 2V8HA 3MCOA 1D6TA 2RF2B 2RQMA 3ETMA 1GT8A 3TZZA 1LXNA 2JL9A 2LCWA 2V2KA 1XNRJ 3W3SA 4X65E 5E33A 1WHXA 3MHYA 4DSEA 3HHKA 3CC4S 4ED2A 5IT9Q 1UFWA 1D8YA 4DR5I 2XY6A 2CWKA 4AXIA 2BW7A 2UXCI 5HMZA 2G0IA 5AXLA 1HNIB 1Q82T 1FKOB 2FZKB 4C7QA 5ITHA 1WD6A 1VQ7S 2RUSA 5D77A 2LMIA 4WE1A 2A2CA 2CNKB 4DQIA 2FVCA 3KK1B 1RT4B 2F9DA 1VJWA 1EIYB 5A6PA 5C25A 1NSQA 1JJ2R 5J1EA 1J5OB 5LSLA 4WYLA 2Y0SD 1H3DA 3EGWB 3TZYA 4ZLNA 3GLLA 1HNVA 1I94I 5K36F 2V5HG 2EVZA 4DPUA 3R2CJ 2KN4A 4S0MA 3GTYX 4NI2A 2ROGA 3HHLB 2R8IA 2ROEA 4RBTA 1NXIA 1N33I 1C4CA 3GIJA 4DFJA 4A47A 5C0XC 5ELWA 1ZPVA 2BUNA 2CDQA 5KFZA 5A2QC 2ASLA 3PYDA 2C3PA 4URSA 3EPGA 4IFVB 2ACYA 3CJRA 1JK9B 1WEZA 1KOOA 2XMVA 4N5SA 2QIFA 3J7ZT 4OZ2A 8ATCB 4FXVA 1YBAA 4KGKA 2H5JB 1FA0A 4I56A 2HVEA 1B62A 3K59A 4DR6I 5IM0B 4DPOA 1SBRA 1WORA 1TP7A 2KVIA 3V6HA 3Q24A 1HMVB 4PWDB 3RAXA 3BS9A 1NKCA 2BOPA 2NUUG 1O6XA 4DUYF 3UDLA 2LDIA 2MKCA 4YHHE 2BJ1A 4E98A 4FPIA 4DUZE 4RNNA 3UCZP 2PIIA 2JH3A 2ZZMA 4PUOA 2JFKA 4AQYE 3A3NB 3D68A 4C97A 2HNDB 4LFCE 4DFPA 3DU5A 2CADA 1F0XA 3G71S 1OQ3A 4CRJA 4UY8T 3N28A 1HQUA 4K4YA 1AUDA 2OI2A 5HJYA 4OYXA 3ETOA 4Z2XA 2X36A 4PKDB 4KV8A 5FWKA 5ETKA 3TVZA 3RGIA 3KG4A 4DR4I 2IOPA 3CCWA 3J7A1 1WC5A 4I2QB 3NOGA 4QYRA 4JI7I 2B6AB 3M9MB 5E5NA 1FVSA 4CYUB 2MZRA 5B0DA 3B8HA 1MN9A 1U1PA 3DNCA 3TANA 4QU6A 4DUYJ 5BXIA 3UI3A 2XB2D 1K0VA 2L9DA 4J90A 4IFDD 5IC6B 3OTCA 5J2NB 4OZEA 2E1MC 4YEAA 3FCHA 1S6OA 1NLKL 1N32E 4OL8A 3TP2A 1XMBA 2BKOA 3SZ2A 1QAYA 1XMQF 3JSMA 2RHQB 1YQHA 4A8OA 3O8WA 3H20A 2DR6A 1P1LA 2AU0A 3LF0A 1CJKA 2Y1LB 1Q7LB 4LFBI 2D3UA 3TAMA 3CJKB 4NA2A 4LBIA 2BYCA 2CJYB 4QZVB 2WOMB 2ZH1A 3G87A 3M6VA 2R2RA 1AYEA 4ALZA 1L5UA 3MPWA 2ZKUA 3GB0A 1WG4A 3MUVP 4JP8A 2XMKA 3FC9A 3LPSA 2XSJA 1CULA 4LSNA 1CJVA 1FRKA 3RAQA 5J2PB 1IJEB 1F3FA 5LSRA 3J80C 2OEMA 5BYRA 3DRRA 4NLXA 2BE9B 2GHWA 2RMLA 2ZBKB 1FVQA 2EBEA 4DR1F 3KLHA 3KLIA 3OL7A 2BACA 2O5DA 1DQ9A 1VRUA 3KK2A 4DOZA 2KZMA 3UCGA 4M8LA 5KG0A 4QW9A 3W65A 1QZRA 2P8IA 3V6DA 4BCAA 5HN0A 3OTDA 4MFBB 2XCPA 2LFVA 1TFYA 5D3GB 4EUVA 3CVKA 4OYMA 5HP1A 4GC6A 4RW6A 2AJ1A 3IS9B 5G0RA 3CD0A 2MKJA 3BO4A 1E6VA 4IG3A 4NLQA 2JEAA 2DHGA 3F0NA 3ILJA 5ADZA 1LV5A 1JLGA 2EKNA 5A6WA 1VQMS 2CPIA 2FUG9 4ZVEA 3CCVS 4LRCA 5HVGA 2KG1A 1NK7A 1U4BA 1XNRE 2BM1A 1I5OB 4BA1B 5JJBA 2PSZA 3LALA 5LMUE 2RRAA 2A1BA 4HTJA 4ZVRB 4MU0A 1Q86T 2W7PA 4DR1J 3TEGA 2W4DA 4X64E 4I3HA 3BBFA 2D9OA 3D54A 3W9IA 1SJ3P 1A9NB 2Z5CA 3A13A 1S76D 3MR6A 2DNZA 1UCNA 1NDKA 4RW9A 2RH3A 1Q5VA 1TK0A 4GC7A 4LQ9A 5HSPA 3Q8RB 2O1VA 1B4SA 5D0HA 4WU2A 2FJEB 3BR9A 4QQBA 2HNZB 2GMHA 2IC3A 2XTJP 4F36A 4DJBA 3PHTA 4F8RA 2Q1LA 3N01A 4RBVA 1VQ4S 2IYGA 3FFIA 3OR1A 1NJIT 1PBAA 1Q5YA 1BQMB 3HVWA 4B9UA 3DMJA 2BEFA 4JI6F 4YOEA 1FXRA 2OIHA 1EAYC 5I42A 3MFIA 4CWBA 5A8KB 2KHCA 4KO0B 3T1YI 1X4CA 2BA0G 3C15B 3LP2B 5AE1A 4C8MA 3KKFA 1VGYA 1UL3A 3CB4A 4IZJA 3TI0A 2RUGA 3MM8A 2C37B 1U2CA 5EGYA 4FS2A 3MM9A 2J0SD 5IV4A 3I0RB 1MU5A 1M5VC 1NDPA 2KFZA 1IJFB 1NK8A 2KJWA 4PU9A 4NPOA 5F3ZA 1HW8A 3EX7B 2LDYA 2NN6E 1H7SA 1FERA 3CW2C 3H90A 4C9DA 4USJC 2Z2LA 4ELTA 4YUDA 2FJWA 2GGPB 3FQKA 3DOLB 2KM8B 3GG0A 3OVAA 1IBME 4CLKA 2F1DA 1Y9OA 1ACMB 3MCMA 4ED8A 2XS5A 2HMIB 1WSVA 1RWVB 4PWUA 1GMWD 1MWQA 4E8UA 5AXNA 1UWBB 4JI6J 2LA6A 3BO2A 5KFJA 2HGMA 4OX9I 2YKQA 5DO2A 4U6PA 5FDLA 4MIBA 4JI4F 4W4MA 3OT9A 2LEBA 2XNRA 3QT8A 1KP6A 2HHQA 2ASYA 3GFYA 1YTYA 2GO9A 3HD1A 3VHQA 4P75A 4C8LA 1VOMA 3TUZC 5H1SV 2BE2B 4DSKA 3L7ZB 3N5BA 2GQCA 2VUGA 1FE4A 4KHPF 4DWIA 4C8ZA 3PX4A 4LFAE 2MZJA 1ZTWA 4CLZA 2PNMA 2ZD1A 4B3SI 2VG5B 4QCLA 1DLOB 2W8LA 2O66A 4X66E 4QIGA 1S5ZA 2CG4A 3U7JA 4NLSA 4NLYA 4J91A 5IT0A 1XNQE 5KFKA 5B0CA 4KFBA 3CJ0A 1KFSA 2WVDA 1S7HA 1PYOB 4LR7A 3PX6A 3K0JA 3KOAA 1MWZA 4HVZA 3CPWR 5KG6A 3DXBA 5DQIA 1QSLA 4J9NA 3AQPA 3DLEA 3BYPA 1O0PA 4NXNJ 1CG2A 4MU3A 4J9VA 1SUQB 3MDFA 2HEKA 1FDBA 2C42A 1WG1A 3DOMB 2LYVA 2V67A 1RZMA 2UP1A 1A7GE 3NP5A 5I4MA 3UD5A 4KHPJ 4PRVA 2B5JA 2AZ3A 1T95A 1E6YB 3NGDA 2XC9A 2W9CB 1TAQA 1VCTA 3QNWB 1U1MA 3DI6B 3MPYA 4NLDA 3WHIA 5ETMA 4WUBA 1N6QA 3MUMP 4HACB 2MLZA 1GX5A 1DHMA 1H74A 4GO7X 1SV5B 4R8UB 2OPSB 2K2PA 2WZ1A 3D3CJ 2ZUGA 4YHHI 1XHKA 1FTRA 5LMNJ 4DUZI 3Q22A 2ZWOA 4Q8EA 2HG4A 3M8QB 3UDVA 4LFCI 5KFXA 3H5UA 1RAEB 2D3O1 1HBNB 2XY5A 3T1HE 4K4TA 2FB0A 3CULA 3DLKA 2CPDA 3SMZA 5IT4A 2ZH8A 3CMQA 3QMQA 2DRDA 2PT0A 3DGPA 4JI1J 2WCXA 1LQ9A 5C24A 3N9UC 3QO9B 2J5AA 1HBOA 1LFWA 3FNNA 4OFZA 1REVA 1SCJB 4B3OA 1PYSB 2J0XA 1TL3A 2EFOA 1TMJA 1PG5B 3WIUA 2D7SA 2NCKL 2YX7A 4G1PA 3VWSA 3HXMA 4F3OA 1USUA 3K17A 2XI2A 3EXYA 3N6MA 2ZUAA 2C2RA 4WP3A 3VVTA 4OZ3A 2XI3A 3D5MA 2WHOA 1HNZF 2F63A 4N8NA 4DR2F 1ZXNA 4V19J 3IR6B 1N32I 2OJ3A 4X4QA 2AEFA 4IFDA 2CJ9A 3SYZA 4U7UD 3N79A 3P96A 2VG7B 2WVEA 1R6YA 2RILA 2XWYA 1U25A 2Z8QA 4H4KC 5T7LB 4ES2A 2FD2A 2ZZTA 2IAJB 3C14A 4OI1A 7AT1B 5HMYA 1ZM9A 1N5VA 4DV2J 1SKWA 2AHOB 3UD3P 2MJUA 3AJDA 4TU7A 4WIIA 2ATLA 3VAMA 2NN6C 1T9TA 1AZSA 3GFXA 4JI8F 2FJDB 3S7RA 4NLRA 5IZHA 3CJTA 4LUBA 2YKMA 5IV3A 4M94A 4NE9C 3CDJA 1UFLA 3NBPA 1HNZJ 1IKVA 2J8SA 3DGVA 4QR2A 2IVFB 4DR2J 3KMSA 4NRUA 2R3VA 3CC7S 2N4DA 1H72C 3HVTB 2QJ3A 2GZOA 2HHXA 3PG9A 1VC0A 2VFUA 1ZS6A 3R6GB 3GV7B 3MM5A 3OL9A 3GMEA 2ZH4A 1FT8A 2W8KA 4CLYA 4YB1P 3HP6A 4UZBA 3UPFA 1VC5A 1WI8A 3VAKA 1X4DA 1RGVA 1R0AB 3B54A 2CPFA 1JNRB 2HS4A 2QTWA 3HT0A 4ECTA 4ECRA 2CNNB 3ET6B 4UOFA 1L3TA 3BR8A 3N0VA 1RT7B 3CCJS 4YDXA 1JLEB 3G4SS 3ZZYA 3QLHB 3H4DA 1XNRI 2NPFA 1YRTA 2E5LF 2MDAA 2RS8A 1JKHB 1Z0VA 5HQMA 1S0VA 1GAOA 1FFSB 4WXOA 1DARA 3DLBA 1N56A 2MKHA 1FTCA 5DG8A 1DJ0A 4QPTA 2G1HA 1CC8A 2WBRA 2QN6B 2VPXB 4ZITA 2QLBB 4QWDA 3DFEA 3IRXA 4LF8F 5HL7Q 3R5JB 1VQYA 4ZOSA 4C11A 4M5KA 4PQUB 1GMUA 1FHTA 2C2DA 3IFEA 1LW0A 2IJFA 4UZCA 5U47A 4ZCKA 4C6AA 2F40A 1N5YB 3US5A 1N36E 2KXHA 1JLFB 4ED4A 3MI7X 5CXTA 2Y1RI 3DXSX 4NCAA 4JV5F 4NXNE 2NUHA 4QYZK 2G1DA 1S1UA 1RT1A 3KLFA 3OLBA 2E5LJ 2OELA 4WFBQ 2XYGB 4Q0BB 3EJMA 4JI5J 4OI0A 3GJSB 1M5OC 3L7PA 1T9VA 5E3CA 2RSQA 1U0SA 3QIDA 2L9WA 3J80Q 4KHPE 4DEZA 3M2UB 1Z0GA 3CDEA 2BZ2A 1S9GB 3MXHP 3NZKA 4DX6A 1C0UB 2CYYA 2DY1A 4LIWA 4LF8J 3FGVA 2F1FA 3OPKA 2CQ1A 3O44A 3PIOQ 4GKKE 4DU8A 4LF6E 1X4EA 2J6TA 2ZBCA 2O01C 4C8KA 5K8NA 1EKRA 2VFTA 4URLA 1TU0B 2V9WA 1S6PB 2HHSA 3ZTRA 4TLQA 4OJ1A 4PG4A 4CH0S 5LJ5Y 5LMNE 4K0KF 4ES3A 1LOUA 1LWEB 2VBZA 4I2PA 3ZZRA 2DHSA 1FFGB 5I3PA 4HYMA 2VBYA 2DGTA 2DB1A 4X4RA 1PJ7A 1FX2A 2ROPA 2KRBA 1TKDA 3O5TB 1AUSL 1S1TA 3G6XA 3RW7A 1URNA 3RBDA 4JI1E 3TJ8A 3FBEA 1KSPA 1ZZFA 3NWRA 1S79A 2XY7A 2QSWA 3UDCA 5L1LA 1F2GA 2YPYA 1UDSA 2VBWA 2ADBA 2XWXA 2E29A 2VKRA 3NGSA 4IQMA 5KFAA 4FYXB 1Y0HA 1XEZA 2EEYA 5EWGA 2JDJA 1UA1A 4XO0A 4DUYI 2H1YA 4ED1A 4G1QB 2BR2A 4ZVGA 3TNVA 3DC2A 1HHSA 4K0KJ 4PXDA 2B9WA 3DM2A 2JE6B 5JEAF 3A8KA 1QY7A 2XQCA 3PXGa 3CMAS 1WC6A 3LP0A 1XN9A 1V9OA 4J9SA 1ZM3A 4DHVA 4A8WA 3I5BA 4HHHA 1FDAA 1EX8A 2A10A 5L3JA 4GVBA 4TN2A 1CBKA 3KLGA 1R8HA 1UP1A 4U8VA 4R0JA 2DNLA 4DV2E 4JYAE 2Z2YB 2JSXA 2WNRA 5KG1A 2DJWA 2UVUA 2JZ5A 3BBBA 2PFFB 3HHLD 5AXMA 1DBDA 3AAWB 2RD5C 1S0NA 3CO9A 1WUUA 2H3EB 3IM8A 2DPJA 1KNZA 4KQVA 2R7QA 5H9EK 2HFVA 2HFZA 1R8AA 4OYPA 3DOKA 3SCJE 1RTDB 2HHPA 1C1CB 4ECWA 2NZCA 3QIPA 1U0HB 3D1HA 1HR0J 2PEHA 3CJ5A 4K59A 4G65A 1RWNB 2GQ2A 2PNZA 1A0OB 1Y5NB 3FZBA 2DGWA 4X62J 2MKSA 2H54B 4RUAA 2MJNA 3EVMA 4LF5E 3HKWA 4F67A 2R4FA 4ZCIA 4ZHRA 1T8EA 1Q78A 2N3OA 3M85G 2QYGA 7FDRA 2Z5BA 2N82B 2XYPB 3LPEA 3R5DA 5BR8F 3EZUA 4ELUA 3NRBA 1XIQA 5E3QA 2PNLA 2R8GA 2E1PA 4DV5F 4USTA 3ZM7A 3M8WA 3MEGA 2MTLA 1U47A 2WSCC 1XMOF 3FCVA 2JNJA 3C6TA 3BGLA 5A0YB 1NH7A 3HKZD 1WDDA 4IH7A 2R8JA 2PO0B 1NUEA 1SB6A 1RT5B 2OO4A 1JLBA 3D28A 1N52B 1RTHB 4QIVA 4LOMA 3JAMC 5DM7Q 3M2VB 4DR1I 2YNHA 3KJVA 1PGZA 3RB6A 4QIWD 1AROP 2PA8D 1A6FA 2ADCA 1YDLA 4KY3A 1G6BA 4Y3CA 4ER8A 1S1WB 2OGUA 3IAS9 2BA1D 4KJIA 4P9SA 1WACA 1S1XA 3GIMA 2VESA 4FW3A 2UUAF 4M5MA 5JEAB 4EGLA 2KHDA 3LP1B 2KFYA 4LSLB 4CM0A 1LWXA 1WKKA 2CGEA 3J7AN 5JVHQ 2DR8A 4EZ9A 5BR8J 3GJQB 2HQ3A 1NRKA 4OLPA 5CA5A 4O3QA 4GKJF 2DNHA 3MOJB 1F5CA 4DSLA 1IQTA 2IVYA 1XMOJ 1NPPA 2OD4A 4YMEA 4ZA1A 5IQ6A 1IBKJ 3HO1A 3M2RB 2MZQA 2W1BA 2UXBJ 5KFUA 4JI5E 3U1NA 4DR7F 3WX4A 4IG0B 2FGOA 4TQRA 3POTA 4DCOB 1HBMB 4XK8C 4NLWA 3VZHA 3SCKE 3BJYA 2PD1A 1FJGE 1N48A 1HNWF 4I69A 2QL9B 2BJ8A 3BN4A 5GADU 2M52A 1HWUA 1AFJA 4O3RA 1YGYA 1RACB 5E41A 1ZTTA 4TU9A
chains in the Genus database with same CATH topology
4X62I 1ELOA 2LJPA 2DEJA 4M1KA 4JI7E 1N33E 3K1JA 3LPSA 4GKKE 4DU8A 4WUBA 3WU6A 4LF6E 4X65I 4B3SE 3Q6NA 4IZJB 4HACB 4IZJD 5LMUI 4LF9E 4JI4I 1H7UA 4DPWA 4DU7A 1H74A 4JI0I 4URLA 3J80C 1N34E 3WU5A 2Z5EA 2ZBKB 2DEIA 3P06A 4X64I 5LMNE 4YHHI 1NHHA 5A2QQ 1XHKA 4DUZI 1HK7A 1Y4SA 2A2DA 4HYMA 4DPYA 4LFCI 1NHIA 4JI6I 2F4VI 2UXDI 1QZRA 1ZM4A 2CZ9A 4DV3E 3K85A 4LF7I 3T1HE 4DR3E 2UUCI 2VQEI 4JI1E 2GS8A 4B3RE 2HHHI 3D4JA 4JYAI 1MG7A 4B3TE 4DV0E 2ZM6E 1BKNA 1VISA 1HNZE 4LF4I 1ZXMA 3F0NA 4DR2E 3J7AM 1D6TA 1KKHA 2HFUA 2UUBI 4IZKB 4JV5I 1XNRE 1XMQI 2BM1A 4X65E 4DR7I 1S4EA 2J7KA 5LMUE 3Q1QA 4DUYI 5BR8I 4YY3I 5IT9Q 2Q2EB 1USUA 2V8PA 3K17A 1ZM2A 4XTJA 3PYEA 4DV7E 4DR5I 1EI1A 3QT7A 4P7AA 1HNWI 2HKEA 2ZITA 2HK2A 4X64E 4I3HA 3B78A 2WW4A 2UXCI 3ZZ0A 4DXLA 1KIJA 1XMOI 2X7IA 3V2UC 3WU3A 1ZXNA 2Z5CA 3PYGA 2HK3A 4LF5I 1N32I 1HNXI 1IBKI 1ZM3A 1Z59A 1IBLE 4JI6E 4USMA 2UXBI 3PYFA 4JI8E 4DV6I 5IT9C 4JG4A 1Y6ZA 4NXNI 3B82A 3ZKDA 2R42A 2E5LI 2A2CA 2O1VA 5L3JA 3GONA 1OJ4A 2UUCE 4FWDA 3OTOE 4R1FA 1IBMI 1ZM9A 2HHHE 4DV2E 4JYAE 4DV1E 1USVA 4JI3E 2XEXA 1I94I 3LTOA 3V5RA 4DPUA 4AQYI 4KHPI 4NXME 1H73A 2UUAI 2Z5BB 1Z0BA 4UT4A 2HFSA 4LF8I 2UUBE 1WUUA 1PKPA 4KQVA 4RPFA 1N33I 1RREA 1NHJA 2HKJA 5A2QC 3PRYA 3PYDA 4LFBE 4DUYE 5BR8E 3T1YI 4B3ME 4GKJI 3ZZUA 1J5EI 1K47A 4WUCA 2VQFE 4HY1A 1HR0E 4DV5E 4IZJA 4HACA 4X62E 2UXCE 1Z5CA 5LMNI 3ZKBA 1XMOE 5FLXQ 2R3VA 4N3OA 4Z7CA 1H72C 1MU5A 1N0VC 1B62A 2EFGA 4LFAI 4LF5E 1Z0WA 4DV4I 1HNXE 4DR6I 2BV3A 4PU9A 4DV6E 4JI4E 4FN5A 4JI0E 2E5LE 1H7SA 4DV3I 1Z0CA 4MYTA 4USKA 4X66I 4DR3I 3ZZTA 1S16A 2Z5BA 1IBME 5FLXC 4JI1I 1N36I 1XNQI 4YHHE 2PNLA 3JAMQ 4DUZE 1UEKA 1Z5BA 1I94E 3ZM7A 2V34A 3LNUA 1KVKA 4AQYE 4UTGA 2V2ZA 4LFCE 2F4VE 2UXDE 4EMDA 2UU9I 1FWLA 4LF8E 4FWGA 4MYUA 2VF3A 1KTVA 4LF7E 5GMEA 4OX9I 4JI5I 1XNRI 3QT5A 4JI2I 2NPFA 4WUDA 3M6AA 1Y4UA 2OI2A 2O1WA 2VQEE 1N0UA 4PRXA 3QT8A 3JAMC 2BM0A 3WU4A 5IWAI 4DPXA 4HXZA 2X36A 4IZKA 4Z7YA 1Z0VA 3J7AG 3T1YE 3J81Q 4GKJE 1FJGI 4DR1I 1J5EE 1Z5AA 5FWKA 2O1UA 3HJCA 4K0KI 1U2RA 1A6FA 1Z0EA 4DV7I 4DR4I 4LF4E 2IOPA 1DARA 4P52A 1B63A 4FWHA 4JI7I 4JV5E 1PIEA 1XMQE 4LFAE 4DV4E 2PNMA 4GKKI 2IOQA 4DR6E 4LF6I 1EA6A 4DR7E 4B3SI 3B8HA 1FWKA 1IBLI 3J81C 4LF9I 4DPTA 3H4LA 4JI8I 4YY3E 2CG9A 1N34I 2CGEA 2V2QA 5GMDA 4X66E 4DR5E 1HNWE 2Z5CB 1MX0A 3Q6MA 3OTOI 1N36E 1XNQE 2AJ4A 4DV2I 2O1TA 4DV1I 4ED4A 4JI3I 1N32E 1IBKE 2V2VA 1RR9A 4NXMI 2UXBE 2UU9E 2GQ0A 4NXNE 3T1HI 4OX9E 4JI5E 4JI2E 1NZ0A 1Z0TA 3CWVA 1FI4A 5IWAE 4B3RI 2E1RA 4LFBI 1FJGE 4DR1E 1FNMA 1FKAE 5LL6R 4B3MI 3QT6A 4K0KE 4ZVIA 2VQFI 4B3TI 1PVGA 3J80Q 1HR0I 4KHPE 4DR4E 4DV0I 2ZM6I 4DV5I 1Z0GA 1HNZI 4FW9A 2UUAE 4PRVA 4DR2I 3HULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 I;  1ELO A;  2LJP A;  2DEJ A;  4M1K A;  4JI7 E;  1N33 E;  3K1J A;  3LPS A;  4GKK E;  4DU8 A;  4WUB A;  3WU6 A;  4LF6 E;  4X65 I;  4B3S E;  4HAC B;  5LMU I;  4LF9 E;  4JI4 I;  1H7U A;  4DPW A;  4DU7 A;  1H74 A;  4JI0 I;  4URL A;  3J80 C;  1N34 E;  3WU5 A;  2ZBK B;  2DEI A;  4X64 I;  5LMN E;  4YHH I;  1NHH A;  5A2Q Q;  1XHK A;  4DUZ I;  2A2D A;  4HYM A;  4DPY A;  4LFC I;  1NHI A;  4JI6 I;  2F4V I;  2UXD I;  1QZR A;  1ZM4 A;  2CZ9 A;  4DV3 E;  4LF7 I;  3T1H E;  4DR3 E;  2UUC I;  2VQE I;  4JI1 E;  2GS8 A;  4B3R E;  2HHH I;  3D4J A;  4JYA I;  1MG7 A;  4B3T E;  4DV0 E;  2ZM6 E;  1BKN A;  1VIS A;  1HNZ E;  4LF4 I;  1ZXM A;  3F0N A;  4DR2 E;  3J7A M;  1D6T A;  1KKH A;  2HFU A;  2UUB I;  4JV5 I;  1XNR E;  1XMQ I;  2BM1 A;  4X65 E;  4DR7 I;  1S4E A;  2J7K A;  5LMU E;  3Q1Q A;  4DUY I;  5BR8 I;  4YY3 I;  5IT9 Q;  2Q2E B;  2V8P A;  3K17 A;  1ZM2 A;  4XTJ A;  3PYE A;  4DV7 E;  4DR5 I;  1EI1 A;  3QT7 A;  4P7A A;  1HNW I;  2HKE A;  2ZIT A;  2HK2 A;  4X64 E;  4I3H A;  3B78 A;  2WW4 A;  2UXC I;  3ZZ0 A;  4DXL A;  1KIJ A;  1XMO I;  2X7I A;  3V2U C;  3WU3 A;  1ZXN A;  3PYG A;  2HK3 A;  4LF5 I;  1N32 I;  1HNX I;  1IBK I;  1ZM3 A;  1Z59 A;  1IBL E;  4JI6 E;  4USM A;  2UXB I;  3PYF A;  4JI8 E;  4DV6 I;  5IT9 C;  4JG4 A;  4NXN I;  3B82 A;  3ZKD A;  2R42 A;  2E5L I;  2A2C A;  5L3J A;  3GON A;  1OJ4 A;  2UUC E;  4FWD A;  3OTO E;  4R1F A;  1IBM I;  1ZM9 A;  2HHH E;  4DV2 E;  4JYA E;  4DV1 E;  4JI3 E;  2XEX A;  1I94 I;  3LTO A;  3V5R A;  4DPU A;  4AQY I;  4KHP I;  4NXM E;  1H73 A;  2UUA I;  1Z0B A;  4UT4 A;  2HFS A;  4LF8 I;  2UUB E;  1WUU A;  1PKP A;  4KQV A;  4RPF A;  1N33 I;  1RRE A;  1NHJ A;  2HKJ A;  5A2Q C;  3PYD A;  4LFB E;  4DUY E;  5BR8 E;  3T1Y I;  4B3M E;  4GKJ I;  3ZZU A;  1J5E I;  1K47 A;  4WUC A;  2VQF E;  4HY1 A;  1HR0 E;  4DV5 E;  4HAC A;  4X62 E;  2UXC E;  1Z5C A;  5LMN I;  3ZKB A;  1XMO E;  5FLX Q;  2R3V A;  4Z7C A;  1H72 C;  1MU5 A;  1N0V C;  1B62 A;  2EFG A;  4LFA I;  4LF5 E;  1Z0W A;  4DV4 I;  1HNX E;  4DR6 I;  2BV3 A;  4PU9 A;  4DV6 E;  4JI4 E;  4FN5 A;  4JI0 E;  2E5L E;  1H7S A;  4DV3 I;  1Z0C A;  4MYT A;  4USK A;  4X66 I;  4DR3 I;  3ZZT A;  1S16 A;  1IBM E;  5FLX C;  4JI1 I;  1N36 I;  1XNQ I;  4YHH E;  3JAM Q;  4DUZ E;  1UEK A;  1Z5B A;  1I94 E;  3ZM7 A;  2V34 A;  3LNU A;  1KVK A;  4AQY E;  4UTG A;  2V2Z A;  4LFC E;  2F4V E;  2UXD E;  4EMD A;  2UU9 I;  1FWL A;  4LF8 E;  4FWG A;  4MYU A;  2VF3 A;  1KTV A;  4LF7 E;  5GME A;  4OX9 I;  4JI5 I;  1XNR I;  3QT5 A;  4JI2 I;  2NPF A;  4WUD A;  3M6A A;  2OI2 A;  2VQE E;  1N0U A;  4PRX A;  3QT8 A;  3JAM C;  2BM0 A;  3WU4 A;  5IWA I;  4DPX A;  4HXZ A;  2X36 A;  4Z7Y A;  1Z0V A;  3J7A G;  3T1Y E;  3J81 Q;  4GKJ E;  1FJG I;  4DR1 I;  1J5E E;  1Z5A A;  4K0K I;  1U2R A;  1A6F A;  1Z0E A;  4DV7 I;  4DR4 I;  4LF4 E;  1DAR A;  4P52 A;  1B63 A;  4FWH A;  4JI7 I;  4JV5 E;  1PIE A;  1XMQ E;  4LFA E;  4DV4 E;  4GKK I;  4DR6 E;  4LF6 I;  1EA6 A;  4DR7 E;  4B3S I;  3B8H A;  1FWK A;  1IBL I;  3J81 C;  4LF9 I;  4DPT A;  3H4L A;  4JI8 I;  4YY3 E;  1N34 I;  2V2Q A;  5GMD A;  4X66 E;  4DR5 E;  1HNW E;  1MX0 A;  3OTO I;  1N36 E;  1XNQ E;  2AJ4 A;  4DV2 I;  4DV1 I;  4ED4 A;  4JI3 I;  1N32 E;  1IBK E;  2V2V A;  1RR9 A;  4NXM I;  2UXB E;  2UU9 E;  4NXN E;  3T1H I;  4OX9 E;  4JI5 E;  4JI2 E;  1NZ0 A;  1Z0T A;  3CWV A;  1FI4 A;  5IWA E;  4B3R I;  2E1R A;  4LFB I;  1FJG E;  4DR1 E;  1FNM A;  1FKA E;  5LL6 R;  4B3M I;  3QT6 A;  4K0K E;  4ZVI A;  2VQF I;  4B3T I;  1PVG A;  3J80 Q;  1HR0 I;  4KHP E;  4DR4 E;  4DV0 I;  2ZM6 I;  4DV5 I;  1Z0G A;  1HNZ I;  4FW9 A;  2UUA E;  4PRV A;  4DR2 I;  3HUL A; 
#chains in the Genus database with same CATH topology
 3CCE S;  4OO1 F;  2UUA J;  1FWP A;  1YJ7 A;  3Q0A A;  1P42 A;  2DNR A;  1P9Y A;  1S6Q A;  3NMA A;  1H2T Z;  4K8R A;  2JLG A;  4X4S A;  1RHY A;  5K8M A;  3OHB A;  3CDA A;  1RT2 A;  4BWJ A;  4MKV A;  4EWT A;  4JI2 F;  5M2P A;  4GKJ J;  2MEW A;  3Q2S C;  1CPZ A;  1SH0 A;  4KE5 A;  2BRK A;  2HW3 A;  2RQ4 A;  1SJR A;  5EKW A;  3JYT A;  4O44 B;  2RJZ A;  2GO8 A;  2OFH X;  2Y9H A;  2C28 A;  1WTF A;  4CLP A;  4JI6 I;  4CLL A;  1JXL A;  2BQU A;  4RW8 A;  3O2I A;  2UVW A;  1TL1 A;  4W92 B;  3DHW C;  5SUH A;  4ILM A;  2VU5 A;  4MU4 A;  3BB5 A;  4XDD A;  1L3K A;  2NSB A;  4ZP9 A;  1TKX B;  4ATN A;  2JX2 A;  2KXF A;  1KHV A;  4B3T E;  2ASJ A;  3BKU A;  2YWG A;  4BS2 A;  1U1L A;  2XZT B;  1IKW A;  5EX0 A;  4IZK B;  4F0K A;  4FS1 A;  1R0C B;  2WVB A;  1H7X A;  3M1V B;  5HRO B;  4JI2 J;  3T5K A;  4FW7 A;  4DV3 F;  4NEY A;  2B9X A;  4FXW A;  1R31 A;  2VFV A;  2XO7 A;  4XTJ A;  4P7T A;  2V4Q A;  2BRL A;  1Q16 B;  2HKE A;  2B8P A;  3G82 B;  2VDH A;  2YTC A;  2X7I A;  2VBX A;  4TKT A;  2HQC A;  3KNG A;  2BE7 D;  4USM A;  4IFY B;  5E3A A;  5IT9 Y;  1KWM A;  4CO2 A;  4NXN I;  4DL6 A;  4OI3 A;  3U1L A;  2AD9 A;  3MAA A;  3AFG A;  3DLG A;  5L38 A;  2UUC E;  3KLV A;  1XXE A;  2ZJP Q;  3RR8 A;  2FIU A;  4KKO A;  3PR4 A;  1YHQ S;  2VJU A;  2UUT A;  3H4B A;  4KHP I;  4HTI A;  4IKA A;  1TUW A;  4NXM J;  3H2V E;  2B7B B;  3ZTO A;  4RNM A;  1VFJ A;  1BLU A;  1RHU B;  2W4C A;  1YRU A;  4LJM A;  4RPF A;  3LGN A;  2CPH A;  2VDI A;  3CTR A;  2WAQ D;  4TU8 A;  4OO1 B;  1RRE A;  4NCG A;  4WKY A;  2PDA A;  1S9E B;  1RBO B;  2HBY B;  1HR0 E;  3OTO F;  4B3M J;  1GXT A;  3OSP A;  1MSW D;  4F0M A;  4X62 E;  4YR0 A;  4F4A A;  5LMN I;  3W2V B;  4HI1 A;  1YSJ A;  1RHM B;  3OLA A;  2ZH7 A;  1UET A;  4DX8 H;  4DV6 E;  4FN5 A;  3P5T L;  4WWS A;  4CT8 A;  5IFM A;  5DRO A;  3H2L A;  3GII A;  4GQU A;  3CGI A;  4RW7 B;  2ZOM A;  3JQJ A;  3DRY A;  4JI1 I;  2VQF F;  1K44 A;  1D09 B;  4ECX A;  1R3N A;  3E51 A;  3GPA A;  5F0W A;  3DCA A;  1U49 A;  2HHV A;  2PN6 A;  4X84 A;  1LWC B;  1K8A T;  3I96 A;  3VAJ A;  5GMK a;  2W24 A;  2IES A;  1MMN A;  1HWJ A;  4MIW A;  4OZL A;  2A6O A;  2DCL A;  2BM0 A;  3FJ2 A;  4HXZ A;  3T3F A;  4KBI A;  4CLS A;  1WOP A;  1Z5A A;  1AA1 B;  2SXL A;  3A4T A;  2VB6 A;  3MEC B;  3FSX A;  3MGJ A;  3PEJ A;  2OPQ B;  2ZEJ A;  1F60 B;  4DV4 E;  4ZCM A;  1A6L A;  2QA2 A;  1UMJ A;  1HNI A;  4DPT A;  1FKO A;  4OKG A;  3IWN C;  1RXO B;  1Z1Z A;  4QJV A;  5GMD A;  1RA7 A;  4CQ1 A;  2WTF A;  2V4J B;  2QA4 S;  1VRT B;  1IKX B;  1Q8K A;  1W26 A;  2VPY B;  4DV2 I;  2C1E B;  2GIR A;  1AW0 A;  3EWG A;  1OIA A;  5DRR A;  2A3J A;  2E44 A;  3TRG A;  3KK1 A;  4WP8 A;  3BM7 A;  1IBK E;  3BQ1 A;  2VFR A;  2B4O A;  2AX0 A;  5ETV A;  2UXB E;  2PO1 B;  3J7Y I;  3UN2 A;  1X4A A;  4QIE A;  1QSY A;  4IR1 A;  1PCA A;  3BZQ A;  5FD1 A;  2FJB B;  3HHL A;  2VJV A;  4YY3 F;  2DGO A;  4I7F B;  2OSR A;  4ILR A;  1F3V A;  1B3T A;  3BGO P;  3I31 A;  2D1C A;  4C3K A;  3ZNU A;  1HA1 A;  3TX0 A;  1HNZ I;  4DL5 A;  2UUA E;  5KFO A;  3BQ2 A;  4DR2 I;  4QR1 A;  2E5J A;  3M9O B;  4P7V A;  2IJN A;  4B02 A;  4IFV A;  4R0E A;  5C2G A;  2K7J A;  4DF8 A;  2HQD A;  1Q0N A;  2Q79 A;  4DFK A;  1BXN A;  2E1C A;  1JMT A;  3HD2 A;  2F9J A;  4QPX A;  2PE8 A;  4LF9 E;  1HD0 A;  3S01 A;  2AT1 B;  4L73 A;  5GAG U;  3VZI A;  1OQ6 A;  3DKD A;  5IWA F;  5L9X A;  4RX6 A;  1S1V B;  5IM0 A;  3MR2 A;  2NR0 A;  4L76 A;  1R27 B;  2KL8 A;  1B7Y B;  4PWD A;  1HMV A;  3R5A A;  2YBV A;  1Y4S A;  4OYA A;  2UUW A;  1MML A;  4LCF A;  1M1G A;  3DYA A;  2HND A;  3UCU P;  4M5J A;  4IH6 A;  3L3C A;  3GP9 A;  3HPO A;  4B3R E;  2K3I A;  2CQ2 A;  3Q23 A;  1SQE A;  2CQ4 A;  2KRR A;  3CIM A;  1VIS A;  3GJT B;  2MQM A;  2J7W A;  2APO A;  1QE1 B;  4FNH A;  1NK9 A;  3TEH B;  1FDD A;  3OVS A;  4IFD E;  1VR6 A;  3PO4 A;  4NI2 B;  1XR6 A;  3EUN A;  4I2Q A;  3N6N A;  2M8D B;  5KFC A;  5IWA J;  2B6A A;  1RHK B;  1Q8I A;  4DR3 F;  5SZT A;  4M5I A;  4CYU A;  4IO1 A;  5A76 A;  5ETR A;  2C2Z B;  2HK2 A;  4DV7 J;  1J27 A;  3W2W B;  4WBF A;  1L3U A;  3C3L A;  3UFC X;  2DGQ A;  2HK3 A;  3GV5 B;  2AV5 A;  2WVC A;  3J7Z 5;  4OHZ A;  3MR5 A;  4M63 A;  5J2N A;  2HIQ A;  1GXU A;  5KG5 A;  2XCA A;  1RAF B;  2E5L I;  1NK6 A;  2QZ8 A;  4IOA Q;  3QQC D;  4CZC A;  5EHH A;  2O3Z A;  1TKZ B;  4DLE A;  2R7U A;  5K36 A;  4YB5 A;  5BYS A;  4ZKA A;  1CQN A;  4MT1 A;  4ICL A;  4NXM E;  2YWH A;  4LF8 I;  1K0T A;  3RBE A;  2WOM A;  1IBL F;  4TYB A;  1WOS A;  4I6A A;  2WRM A;  1M5S A;  3FK4 A;  3QGI A;  4B3M E;  1MMD A;  4ZP6 A;  3PO5 A;  1PBU A;  4F4W A;  4HY1 A;  4UY8 5;  1VK8 A;  1UVK A;  2LEP A;  1TL5 A;  2OML A;  5J2P A;  2UV8 A;  2UXC E;  3IN5 A;  1VQ6 S;  4NZ6 A;  1XER A;  4N3O A;  2RVJ A;  2NZ4 A;  1YH8 A;  3AQO A;  5M2U A;  5KFL A;  3LPY A;  3ZXW A;  2ZC4 A;  1FRL A;  2JOQ A;  4JI0 J;  2Z4P A;  3EMT A;  5F41 A;  3M6U A;  4LSZ B;  3BSO A;  4Q8F A;  3H59 A;  1S16 A;  4DUT A;  1Y00 A;  1QUV A;  4GO5 X;  5CYQ B;  4FP9 A;  1WKJ A;  2PFD A;  3AXK A;  3JAM Q;  3TUP A;  1NPR A;  4H4O B;  3PY8 A;  2ZVI A;  1Y10 A;  4MFB A;  4J9U E;  1S12 A;  1I94 E;  5D3G A;  2PMH A;  3JB9 k;  2EKY A;  3HHD A;  3ZTP A;  3LOU A;  4NZ0 A;  2XMW A;  4ERD A;  2IRU A;  4N76 A;  2F4V J;  2VF3 A;  3IS9 A;  3D1Q A;  1HNX F;  4L3N A;  4LF7 J;  3DLJ A;  4EO6 A;  3W5Z A;  4DF4 A;  4NYZ A;  4LT6 A;  1FKP B;  3MM6 B;  3WU4 A;  5E2Q A;  4C0B A;  3W66 A;  5EDW A;  2VQE J;  3K58 A;  5KG2 A;  3UO0 A;  4M5G A;  2OH2 A;  4UW2 A;  4OV1 A;  4I1T A;  4BA1 A;  4K0K I;  2G0J A;  3M8Y A;  2AQ4 A;  2FVS A;  1VI7 A;  4LF4 J;  1KFD A;  2VZ9 A;  1RI7 A;  3OFG A;  3TAM B;  1R8C A;  4RW4 B;  4Y34 A;  3VGV A;  2FJX A;  4DR6 E;  3J81 C;  4PG6 A;  5K20 B;  4IR9 A;  3C66 A;  2VAS A;  1YVF A;  4FYW B;  2YKP A;  2V2Q A;  1W25 A;  4AL5 A;  4PR6 A;  3GWC A;  1RK8 A;  3W7B A;  2XSJ B;  3KNA A;  1NO8 A;  1VMB A;  2HNZ A;  4W90 B;  5KFD A;  2C3Y A;  1HNX J;  4WFN Q;  2BQ3 A;  1TMM A;  4Y0F A;  2X3D A;  3ENQ A;  2V8D A;  2DBB A;  9RUB A;  5GAH U;  5KOX A;  1WC1 A;  4NWB A;  3OBI A;  1BQM A;  2AZ1 A;  3K8W A;  3UVJ A;  1YJ9 S;  1FKA E;  3IAM 9;  3SCI E;  3C16 A;  3A1Y G;  1HR0 I;  3VCD A;  4DR4 E;  1UZD A;  4Q2L A;  2G13 A;  2ZDP A;  5A8K A;  4KO0 A;  4RUC A;  4X62 I;  4ECU A;  3C15 A;  3LP2 A;  4JI7 E;  5G0R B;  3V4I B;  5DG7 A;  3AH6 A;  4DS5 A;  2E9Z A;  2C37 A;  2KJV A;  2JEA B;  1NU4 A;  1O51 A;  2H9Z A;  1NJZ A;  3I0R A;  3VV2 B;  1Q1K A;  2CPZ A;  5LXR A;  2J8A A;  4XPC A;  2QT7 A;  3SQO P;  1C0T B;  3DRX A;  4FW6 A;  1LK7 A;  4QIF A;  2V68 A;  2ZBQ A;  2GGP A;  3CCZ A;  3DOL A;  3CD5 A;  3OXG A;  3RRG A;  2VG6 B;  3KHR A;  2GNK A;  2BVZ A;  3Q8S B;  1FK9 B;  4URQ U;  2HHW A;  3H1C A;  4IFD C;  1KLM B;  3MZI A;  4Q2M A;  3K5L A;  1DQA A;  1H38 A;  3PS1 A;  1EZZ B;  3L4B C;  4ZMM A;  4MDT A;  4A8S A;  3WDO A;  2XMU A;  1GTH A;  2CNL B;  3LW5 C;  4I6W A;  4RW9 B;  5F8J A;  1W2I A;  2ZOF A;  4MKY A;  1QTN B;  2NXN A;  2YH1 A;  3JQK A;  3ZNJ 1;  3TUI C;  3NAI A;  2C3M A;  4ZJO A;  4KR0 B;  1ZA1 B;  2BE2 A;  3L7Z A;  5L1I A;  3Q89 A;  2GAG C;  5BR8 I;  2DH7 A;  2BA1 G;  2V8P A;  4N77 A;  1OY9 A;  4DV7 E;  1K9M T;  3WQP A;  5I42 B;  4KPC A;  3KG0 A;  2R2S A;  1DLO A;  1SKS A;  2KDO A;  5E3P A;  3SSQ A;  4DV0 F;  1XMO I;  2AYB A;  4FKX A;  4ILL A;  5HAT A;  2JEG A;  1IBK I;  2GJ2 A;  2UXB I;  5L39 A;  3MM8 B;  3Q8Q B;  2ZH3 A;  1UFK A;  2IDE A;  4GVL A;  2EG2 A;  2QGF B;  2AP6 A;  5CYM B;  4KGV B;  4PQA A;  2BJ3 A;  5GAE U;  1IR0 A;  2DIU A;  4B9S A;  1LEO A;  3SXL A;  3BDE A;  2P2C B;  4RNF A;  3NCQ A;  4KGX B;  4FF1 A;  2IRY A;  1SUQ A;  1Q8L A;  1YI2 S;  2MZS A;  1H98 A;  2UUA I;  1MNE A;  2CJQ A;  3IG1 B;  3DOM A;  2CDR B;  3I4P A;  2KT3 A;  4WK1 A;  2VOP A;  3G6E S;  3HFK A;  3VR1 A;  4DX5 A;  2IRX A;  2PA3 A;  2DCU B;  2OD6 A;  4DL7 A;  1E6Y A;  2CQP A;  5KFR A;  2W9C A;  1M5K C;  3D0G E;  4GKJ I;  3DI6 A;  5KFB A;  3GIL A;  3UHM A;  5FDL B;  3U02 A;  4IDK B;  2HHH F;  4PRF A;  5DM6 Q;  4HAC A;  1FFW B;  4DV0 J;  4DV1 F;  2RRN A;  2HRY A;  4WKR A;  2I2Y A;  2CJK A;  4JI3 F;  4UQT A;  1X60 A;  1M5H A;  3RZA A;  1RT6 B;  3QZ8 A;  1SV5 A;  2RDD A;  4ZP8 A;  4R8U A;  4Z7C A;  2UV8 G;  2ZNZ A;  5T41 A;  2OPS A;  3W8G A;  1NDL A;  2UUB F;  2BV3 A;  4HYK A;  5F8M A;  4K7Q A;  5GAG I;  1TKT B;  4JI0 E;  3CC2 S;  1RCO B;  1VQL S;  4MYT A;  3M8Q A;  3BH6 B;  1RHJ B;  2HGL A;  4LRE A;  1TR0 A;  1HBN A;  5FLX C;  1OO0 B;  4PG8 A;  3M6X A;  2W2O P;  1BMQ B;  1V5I B;  4FKY A;  4WTY A;  5A8R A;  4NL5 A;  6AT1 B;  3TYT A;  2QC3 A;  1RE1 B;  4L3K A;  2V69 A;  1TZ0 A;  2AJQ A;  4DZ6 A;  2AEJ A;  2F4V E;  3CCU S;  4ZLP A;  2OTL S;  3AD8 C;  4LF7 E;  3SCL E;  3P49 B;  4JI2 I;  3QO9 A;  2VQE E;  3D1O A;  4DPX A;  3QFH A;  5IT9 U;  3J7A G;  2YH0 A;  4UOC A;  3T1Y E;  2HHH J;  1NK5 A;  4AT1 B;  3E01 B;  4QNJ A;  3I5A A;  5JMN A;  4P2S A;  4LF4 E;  2C39 B;  1NB7 A;  2UVR A;  1GH8 A;  1WSR A;  2GV1 A;  2FC9 A;  4BBY A;  4BC9 A;  2UUB J;  2R7S A;  1RYR A;  5JEA D;  1FNX H;  1MRO B;  4LRF A;  1NM2 A;  4B9V A;  2BAN B;  4L75 A;  3MTJ A;  1JLA A;  2VG7 A;  1J5E F;  4CDI A;  4LQ3 A;  1W7W A;  4MH8 A;  2O1T A;  2CVE A;  3FQL A;  1RDR A;  5T7L A;  2IAJ A;  2ZZN A;  5D15 A;  2XO6 A;  5LSO A;  1YKW A;  4NXM I;  2RS2 A;  3BRE A;  3TZX A;  3CED A;  4U9R A;  3IBF B;  2B43 A;  3RB3 A;  4K4Z A;  3NG8 A;  1NEE A;  4OX9 E;  2JC1 A;  3UN5 A;  1AFI A;  2EI5 A;  1BD6 A;  1FI4 A;  3R8Y A;  1L3V A;  3P3D A;  2LQB A;  5E3R A;  1NPK A;  4DR5 F;  4B9L A;  4B3M I;  4D3H A;  3QT6 A;  3G2X A;  4UQG A;  3UR3 C;  1WWH A;  1BQX A;  1FJ7 A;  1UW9 A;  2D69 A;  4V19 X;  2QFI A;  3DGP B;  4CM2 A;  5LM7 E;  2B9E A;  2LXU A;  1HL6 A;  5C24 B;  5DZ6 A;  2UU9 F;  1CJU B;  3WU6 A;  4B3S E;  3Q6N A;  4NRT A;  2MSS A;  4OJG A;  3HVT A;  1NCL A;  2