1VISA

Crystal structure of mevalonate kinase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
SLIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mevalonate kinase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 106
structure length 314
sequence length 314
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1visA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1visA01
4WUCA 4WUBA 3PYEA 4XTJA 4X65I 1J5EE 4JI7E 4EMDA 2ZM6I 4DV3I 2HFSA 3J80C 4LF7E 1PKPA 3J81Q 1S16A 2BM0A 1IBLI 4X66I 3QT7A 3QT6A 4DV5I 1FJGE 4M1KA 4B3RI 4B3ME 1ZXNA 1PIEA 4UTGA 2VQFE 4JYAI 2BM1A 4USKA 3CWVA 1HNWI 2UXDI 4DV6E 1XMOE 4LFCI 2DEIA 3T1YI 4KHPE 1MG7A 4OX9I 3PYFA 1N33I 4JV5E 1B62A 1RREA 2DEJA 1DARA 4LF5E 1IBKE 2XEXA 1FNMA 4DPUA 2E5LE 5LMNE 2HHHE 1NHJA 1RR9A 4JI0E 1NHHA 3OTOE 5LMUE 4DV4E 4DR3I 2ZITA 1Z0BA 4DR4E 2UUBE 1KIJA 1NZ0A 4DPWA 4JI4I 1NHIA 4PRVA 1XHKA 4K0KE 1B63A 5GMDA 4DV0I 4NXMI 1XNQI 4GKJI 2F4VI 4DUYE 1HR0I 1FWKA 1Z0GA 2UU9I 4DV1I 2UUCI 4LF8E 4Z7CA 2WW4A 2V8PA 5FLXC 4LFAI 4DPXA 5LL6R 5IT9Q 3WU5A 1HNZE 5GMEA 4LF6I 2GS8A 4FWGA 3B78A 5IWAI 4FWHA 4YHHE 2X36A 4HXZA 4DXLA 1EI1A 4DUZI 1IBME 1MX0A 3B82A 3HULA 1UEKA 3JAMQ 1XNRI 2X7IA 2VQEE 4DPTA 4JI6E 4HY1A 4LF9E 4X65E 4DR2I 3Q1QA 3QT5A 4RPFA 2EFGA 2ZM6E 4DV3E 1ZM4A 3H4LA 3JAMC 1BKNA 4MYTA 4URLA 4X66E 3J7AG 4DV5E 3ZZUA 4B3RE 4KQVA 1ELOA 3K17A 1KKHA 4JYAE 2UXDE 1HNWE 3J81C 1K47A 4LFCE 5L3JA 4DV2I 3T1YE 2ZBKB 2UXCI 4HYMA 4ZVIA 3LNUA 4OX9E 2HKEA 1I94I 4I3HA 1FI4A 1ZM3A 2CZ9A 2AJ4A 2HK3A 1N32I 4JI8I 3ZM7A 3T1HI 1Z0WA 2BV3A 4LFBI 1KTVA 2V2ZA 5BR8I 4P52A 4X62I 4B3TE 3LTOA 1MU5A 4DR3E 2HHHI 4JI5I 4P7AA 4X64I 4YY3I 2UUAI 4JI4E 3LPSA 4DR4I 1H72C 4PRXA 2R42A 3J7AM 4B3SI 4DU8A 4JI3I 1N0VC 4DV0E 4NXME 1XNQE 4GKJE 2F4VE 1ZM9A 4GKKI 4DR5I 1HR0E 2UU9E 4DV1E 2UUCE 4R1FA 4DR6I 4NXNI 2E1RA 1HNXI 4LFAE 1VISA 2Q2EB 4LF6E 3K1JA 3ZKDA 2VF3A 1N36I 4JI2I 5IWAE 1N34I 1H74A 2OI2A 4DR1I 5A2QQ 1Z0TA 4DUZE 5IT9C 3ZZTA 4LF4I 1Z5CA 1Z5BA 1XMQI 4AQYI 2V34A 3PYDA 3PYGA 1XNRE 1A6FA 2UXBI 4WUDA 3J80Q 4DR7I 1OJ4A 4JI1I 4FW9A 4DV7I 1WUUA 1J5EI 4DR2E 4JI7I 1ZM2A 5A2QC 1H73A 1IBLE 4LF7I 1FJGI 4B3MI 3GONA 2VQFI 4Z7YA 4USMA 4FWDA 4DV6I 1XMOI 2R3VA 3WU3A 1S4EA 4DV2E 4KHPI 1PVGA 2UXCE 1N33E 1ZXMA 1I94E 4FN5A 1QZRA 4JV5I 3B8HA 4PU9A 3ZKBA 4LF5I 1IBKI 4DPYA 1N32E 3ZZ0A 4JI8E 4JG4A 3T1HE 1EA6A 3M6AA 2E5LI 5LMNI 2V2QA 4LFBE 3F0NA 2A2DA 5BR8E 4JI0I 3OTOI 4X62E 1Z0CA 5LMUI 4DV4I 1Z0EA 2NPFA 4DU7A 4B3TI 4JI5E 4X64E 2UUBI 1Z0VA 4YY3E 3V5RA 2UUAE 1Z59A 2HFUA 3V2UC 4HACB 4K0KI 1N0UA 4B3SE 4JI3E 4ED4A 3D4JA 5FLXQ 2J7KA 4DUYI 4GKKE 4DR5E 2LJPA 4LF8I 2HK2A 2A2CA 1FKAE 1U2RA 4DR6E 4HACA 4NXNE 1HNXE 1HNZI 1N36E 4YHHI 4JI2E 1N34E 2V2VA 1Z5AA 4DR1E 3QT8A 1D6TA 1IBMI 1H7SA 1H7UA 4LF4E 4UT4A 1XMQE 4AQYE 1KVKA 4MYUA 2UXBE 1FWLA 2VQEI 4JI6I 4DR7E 4JI1E 3WU6A 4LF9I 4DV7E 2HKJA 3WU4A
chains in the Genus database with same CATH superfamily
3I87A 4UQGA 1LWEA 5LSLA 2RILA 1YRUA 4QOTA 1S49A 2E5GA 3TAMB 3J81Q 5IM0B 4M5GA 1XMOJ 4PXCA 1TAUA 5CD4H 4B3RI 3DLLQ 3IA0A 1ZXNA 2A1BA 3J81Y 1GNKA 2BX6A 4EZ6A 1VC0A 3CD7A 4LF5J 3BPDA 4RUHA 4JV5E 1NH7A 3RR7A 2MQNA 4EK2A 4TYAA 2OPSA 3M8ZA 4C8ZA 4IFDB 3I31A 3UCGA 1URRA 4RL1A 3TAQA 1FX4A 1XNQF 4DR4J 1WKLA 2VDHA 2XTJP 4B3SF 5L1LA 4NEYA 3UDEA 4WZMA 2WSCC 2RRBA 4DPWA 2HNDB 3BPSP 4LF6F 2NN6F 4ZVGA 1QY7A 4P74A 1R0AB 3M8SA 2W2MP 1R0CB 2LQ9A 3K5OA 1IQTA 4QIWD 2ROPA 4NXMI 5KFCA 1VQ4S 2FLPA 1RT7B 2W24A 3DLKB 2CJXB 2Z57B 2HEKA 1EZZB 2AMCB 2QV6A 4G65A 5C24A 5IT9Q 3FCHA 1CS4A 2RU9A 1C0UB 1P27B 2KJWA 1WOOA 2VQEJ 1KLNA 3BDEA 5FDLA 5KFOA 5IT9Y 3BO4A 5JEAB 1JXVA 2DNKA 4DV3J 1WF2A 1SKUB 1AW0A 3CIZA 5AJ3F 3JYTB 4FW6A 3IP0A 1RAIB 3TUJC 5HSPA 1RTHA 1HIYA 4B02A 1UVNA 3UCUP 4RNMA 2RDJA 4DN9A 3PW7A 4KJIA 4ECUA 5T7LB 3HO1A 4K4ZA 5DRKA 1UWBA 4F50A 1FT8A 4OI6A 1RT3B 3IXQA 3J81C 4EBDA 4KT0C 3PX0A 4LFBF 4Q43A 4P73A 3EUNA 2P2CB 2Q3PA 5FD1A 1OWXA 3ZTOA 4X4NA 3G71S 3F44A 1RWOB 3JTOA 5IXUA 1O6XA 5LJ3Y 4DQRA 3H4BA 1N32I 3PR4A 4LT6A 1R6YA 3S6EA 5DLFA 2LXUA 2R8GA 3DRSB 2RMLA 2YWHA 3M2RB 2RT3A 4I2PA 4DR3E 2RNEA 3T5JA 1FK9A 1XNQJ 8AT1B 4PCQA 2Z5BB 1HNVB 5C25B 2DGVA 3I5CA 3GG0A 1N0VC 3IWNC 4U9RA 4ED6A 3CCES 3MMAA 3L7UA 3OLAA 4IFYA 3GYXB 3LP1A 2CGEA 1AT1B 1Y00A 4DR6I 3ZZOA 2QA2A 5L9XA 4J9VA 3T9NA 2YWEA 4OI3A 3ZKDA 2KHDA 1U1RA 3OJSA 1RDRA 1Z0TA 3HPOA 5IT9C 4F3MA 4PR6A 1S77D 1U26A 2ZFHA 2EKYA 5A2QC 1HNWJ 4IO1A 3TA1A 4DSEA 1IWAA 1AZSB 2KVIA 4ZIVA 1RAGB 5AJ3J 4RO0A 2F8EX 3EICA 4MTPA 3QGGA 5D3GA 4F4KA 1CJUB 3PNIA 3AJDA 3AA9A 1N6QA 3I32A 1N33E 4DQPA 2RS8A 3FMBA 2DXFA 3R7SB 2W4PA 2XSJA 3MEEA 1I5OB 3FEYB 4LFBJ 2Q6BA 2QYGA 3G8TA 4DJBA 1EA6A 2J6UA 1KTQA 4KGVB 1X8DA 2AEMA 4ZVUB 2C3UA 3F0NA 3PEJA 1WKJA 1NJIT 4LIWA 4X62E 2VODA 1UA1A 5LMUI 4HYKA 3Q8VA 3OL8A 1N8RT 2F4VJ 3U1YA 1JKHA 1HHSA 4FXDA 2UU9J 3BQ1A 2YX1A 2QZ8A 2HG4A 4KO0A 4K0KI 4FF2A 4M5JA 5D0GA 4G6VB 4JI3E 2YKQA 1ICEB 5DLGA 3Q8PB 1S9EA 1LW0A 5C24B 4DR5E 1T7PA 3VAJA 3TA2A 4M5DB 3TEHB 1U8WA 2PA3A 2BA9A 3GG1A 1ZAXA 5FDLB 4Q2LA 5D0EA 3MCOA 1Z5AA 4P2XA 5LM7E 1RKJA 4Y6IA 3D1OA 3IRXA 3ONQA 4JI6I 4DR7E 3KUGA 1RTHB 1HK7A 3PXGa 1R8AA 2HKJA 2QA4S 2XSFA 1J5EE 2CPFA 4M5MA 2L41A 3PS2A 5M2PA 3EMTA 3Q89A 3CDJA 4WIQA 4MU0A 1IR2A 4TQRA 1YJ9S 4JV0A 1UWBB 2PO2B 4O4GA 4ES1A 1LEOA 1RCXB 1TTHB 1YITS 4USHA 4ECTA 4DWIA 2CNNB 4NYPA 3NMAA 2E7WA 3K59A 4UZBA 3UDVA 2W9BA 1VRTB 3VF0B 1QDUB 4ZVOB 3UCZP 1P42A 2HLUA 4RNNA 1Y4SA 2PMWA 2MZ1A 3MMCA 3HFVA 4QPTA 3SDEB 4OX6A 3MCMA 5LMNE 3KLFA 4I2PB 4CO0A 3L7PA 1FK9B 4ZPVR 1NSAA 3FVYA 2AJFE 4DV4E 4FNIA 2E1MC 2J0SD 2XO7A 4OX7A 4CLUA 2BR0A 3QRQA 1RWVB 1XHKA 4DBQA 4NXNJ 4K2XA 3T6BA 4IFYB 1TK8A 1WDTA 3LP1B 4DUZF 3O2IA 5IS2A 1RJJA 5AXMA 2F1DA 2CQCA 1RT6A 4Z7CA 2BR2A 1VQKS 3EGNA 2V8PA 3HSZA 4EO8A 4URGA 3MTJA 4DPXA 4QU6A 2DYAA 1R8BA 1UDOA 5KFXA 2XS7A 1UA0A 3DI6A 3PHTA 1Q95G 1TKTB 2D3UA 2Z4PA 3FSXA 4DCJB 3V4IA 3BM7A 2BXJA 4J90A 3A8JA 2XY7A 4ZN3A 3HX9A 3GCMA 3RJMB 2CPXA 4DV2F 8ATCB 4IQMA 1UVLA 1BKNA 2OP5A 2DCLA 2B7CB 2R7RA 3K17A 2B56A 2F7VA 1A9NB 2FVQA 3KWMA 2B6AB 2BA1G 4OYPA 3MUMP 4DFJA 1B3TA 4LSNA 2HHWA 2AF6A 3L7OA 5L46A 3Q24A 3T6JA 2QO3A 3PRBA 4JI5F 3MM7A 4MK9A 4J9LA 1RWKB 4YR0A 2I8EA 4M63A 2HWIA 4EBCA 1K44A 2CADA 2UP1A 1KTVA 1RUSA 3QQCD 2JFKA 1RACB 4B3TE 3DGVA 2W2NP 1C2PA 3HVTA 1JKHB 3BREA 2DNZA 1TFYA 2KVQE 1JLBA 3RU0A 5DQIA 2PD1A 4DR4I 4I67A 3GIMA 1S9EB 1S6QB 3M8WA 4DV0E 1WORA 4FXVA 2V2KA 2CG9A 3M8PA 3NY0A 3HHNB 5K8NA 5D4PA 3W5XA 4DV7F 4IZJD 2RSQA 4DUZJ 4L3KA 1N34I 2DNNA 3IRXB 1S97A 3W5YA 2EVZA 3BKUA 5F0WA 2GQQA 4IOBA 3PYDA 3R3TA 2ZKTA 3H42A 1M5OC 2AGPA 3GJTB 4DQSA 4FW9A 4DV6F 2VOOA 3DLEB 2JHEA 2DY1A 2WOMB 2AZ3A 4DS4A 1UEUA 4O4GB 3CCRS 3KMSA 4B9UA 2DHAA 2YPZA 3DC2A 2XI2A 2V4JA 1IKYA 4IRCA 3W2WB 4P7VA 4DV2J 2B43A 4DLEA 1R43A 4ELUA 3RBXA 2EFQA 3KJQB 2W9BB 2E5LF 2FVRA 1FERA 2XI3A 2ZC4A 3H0PA 2FVCA 2O67A 5MAOA 1TUVA 2KYZA 4I64A 1CEZA 2ZDPA 4B9LA 1ZH5A 1QAXA 3KLFB 3SYZA 3DCAA 5IT0A 2X1FA 3CULA 1WWHA 3BV8A 4B9TA 3LP2A 1UVMA 3WHIA 2VBWA 4JI5J 1NU4A 2PSZA 3MHYA 7AT1B 4BDPA 4N76A 5IC6B 2G0JA 2KT3A 3N6NA 2R7UA 5EGYA 1RSCA 3PIPQ 3KJVB 4QWCA 4XPCA 3V5RA 1XBWA 1UCNA 5RUBA 3V2UC 1N5TA 1FKPA 2DNOA 1N0UA 1RWUA 1USVA 1PGZA 4PQUA 1RT6B 3MUTP 5KG7A 3AA8A 2BR2B 3Q8UA 1RTJB 1NSKL 4TLQA 2BANB 4M8LA 2GX8A 4QU7A 5JXSA 1U2RA 4HACA 3G6ES 4LF9F 2MSSA 1HNXE 3ISZA 1S5ZA 2B9YA 3DI6B 4LMZA 1LWFA 2YQ0A 1HMVA 3DM2A 1YJNS 3CDBA 1N36E 1U25A 3CCJS 4G3IA 1DFDA 3HDSA 1DLOA 3GJSB 4DV7J 2DO0A 2ZOMA 1LV5A 2UXBE 5ITHA 4ALZA 3PW0A 2C2ZB 4KKOB 2FVPA 2HSEB 3KRNA 2I9SA 3T1YF 2XC9A 3O6QA 1RT5A 2N7CA 3DLJA 3Q83A 1T03A 4OX9F 2ASDA 4DV6J 4B3ME 2M88A 2RE1A 1HNWI 2YTCA 4LSNB 1TKDA 4IOAQ 4BC7A 3EXYA 3DHWC 3K5NA 5DGAA 5J2QA 5ETPA 3PHEA 1U1QA 1SC1B 1HARA 3CDUA 1YK9A 4CM2A 1VJWA 1CC7A 3GU0A 3L9ZA 2E5LJ 1DARA 4Y65A 1FVQA 1TV6A 2I5JA 4ZLNA 4CZCA 1IBKE 1VS3A 2OH2A 2Y1IA 4DPUA 3R5BA 3IAS9 4MDTA 3HVTB 3LWMA 1J27A 1XEZA 3K57A 1UETA 4YOEA 1JLBB 3OTOE 1SIWB 4L6V3 1N5SA 2ZITA 3JSBA 3GFXA 2ZC3A 4WJBA 1S0MA 2BE9B 2N4CA 3Q23A 4IRKA 2JC0A 2K2PA 2EK6A 2WVBA 2VBXA 2CQGA 2ROEA 3DOMA 2XHCA 5HMZA 2E9ZA 4ZPCA 4UUXA 2F4VI 1VOMA 4WIIA 4A8SA 5B08A 2UU9I 3L7ZA 2LFVA 3DXSX 1RT1A 2WW4A 3MFHA 5AXNA 4GVBA 1XMQJ 1J5OB 3THTA 1S10A 4DR2F 3J7YI 2N3OA 2QGFB 1B0PA 3RB0A 4HXZA 4DXLA 3GP9A 3A8IA 3IR6B 1WHXA 3MF5A 4LF9J 2IY5B 2HQFA 4P2MA 2VJVA 4A8OA 2LLZA 1F9HA 2MQOA 4CO1A 2UXCF 5L1JA 1IKYB 3UDCA 2VC1A 4A8QA 1TL1B 4X66E 1FRXA 2MLYA 4ZHRA 3T1YJ 3W61A 4RBUA 2DIVA 2JFDA 4L76A 2OD4A 2GHVC 1HWUA 1Q1KA 2HHTA 4OX9J 4LFCE 4OI1A 2GO8A 1XMBA 2FZCB 2ZBKB 2WRMA 4K8RA 4ED0A 4I3HA 2FY8A 3BH7B 1FI4A 2FC9A 3SZ2A 4Y2MA 1AB8A 3G2XA 3VHQA 1JK9B 3LP2B 5KFRA 5G4DA 2WZ1A 3CUNA 4AE5A 5KFYA 2M9KA 1RU1A 3NMRA 2R2UA 1N5YB 4F25A 4J9RA 2J0XA 3H2LA 4I1TA 3H2VE 2R7QA 3C66A 1FKPB 3CJ5A 2JNJA 4JI4E 4PQUB 2BKOA 3LPSA 5CYJA 2FJWA 4LF8J 4FVMA 3MWBA 2VG7A 3HF5A 1HNZJ 4OJ1A 1LWFB 2MHEA 4DV1E 3ZO7A 5KFVA 1IR0A 4R1FA 4NXNI 1QUVA 2R7TA 2O1VA 2GJFA 1CC8A 2MQLA 4ECRA 4JI7F 2G4BA 1DLOB 2RKIB 3TX8A 1MN7A 4C3KA 2CDRB 1FDAA 3ZNJ1 4I7FA 4WP8A 1EKSA 5B0CA 3D1HA 4DR2J 4J9KA 2DB1A 4ZMMA 2H1YA 1T03B 2BA0D 4B08A 2OPPB 4GO7X 2LQ5A 1H73A 3IR7B 3MPVA 2OFHX 4YQWA 4ZVSB 2AYMA 3AD8C 2GIQA 4F2SA 4UF4A 1RZMA 1YJTA 5JMNA 2UXCJ 1C1BB 4DLGA 3QFWA 3E01A 3VAKA 2LQ8A 3VAHA 1T9VA 4CO3A 2DHSA 4KHPI 4Q0BB 3QAUA 1ZXMA 1FFSB 1EQMA 4FF4A 2I5JB 3C15A 1FRIA 2CQIA 4RW6B 1RT4A 4DI6A 2M7SA 1WD6A 4FW7A 1MW7A 4GC7A 3NGSA 4JI8E 1KQSR 2M70A 2GGPB 2DR9A 5GAGI 3FRZA 3IMQJ 1CG2A 2C2MB 4OJGA 1OQ3A 1YX2A 1MWZA 1R8CA 2NPFA 3HHEA 2IIHA 4X64E 2YVSA 4OYAA 1MU2A 5KT5A 3ENAA 2ZWPA 2V8HA 2JEIA 4OI0A 3LF0A 1QAYA 4HH0A 3NS5A 4QR0A 3L7ZB 4GVBB 4DUYI 4OYBA 4J9QA 4O3SA 1VC5A 1N48A 2W01A 2CJAA 1Q7LB 1A7GE 3SSRA 4MMOA 3CCLS 2E29A 1WNEA 4P6QA 3TZZA 5C0XF 3PJXA 4OYXA 1M5HA 3NP5A 2KH9A 4AQYE 1DTQA 1VR6A 4JI7J 1AXQA 3TJ9A 3NGTA 3MURP 4P71A 4KY3A 2B0GA 5D4NA 1X4CA 5FWKA 4RWXA 8RUCA 2XYHB 2FGCA 4ECVA 1S16A 2C28A 3IG1B 4C3LA 3AAWB 3MR2A 1PIEA 4OIXA 1M1GA 5HANA 2B9XA 1XMOE 4MK8A 2VPZB 1JNZB 1UVIA 4RW4A 1OQ6A 3EDQB 4CYUB 3HK2A 4IZJA 2QMUB 3IM8A 4OZLA 4LF5E 1FNMA 1GFWB 4OO1C 2YQ3A 5EX3A 1M5KC 4ED5A 5D4OA 1OY9A 1WDDA 4GRSA 2VU5A 1FF2A 2CG4A 2IA0A 4NI2A 4DR4E 1F6TA 5E3RA 2VG7B 1NB2A 2QN6B 2VIHA 1Y3KA 5K36C 4MKAA 2W25A 1BE4A 1RISA 3CPWR 1FWKA 1JLFA 3EYZA 2F5GA 3WU5A 4I7FB 1RHJB 1QSLA 2FHMA 3I56S 3MDFA 1HWJA 2KU7A 5KFBA 4BCAA 3OJUA 4WTYA 1VHIA 2Z5EA 2VQEE 5HLFB 1RT2A 1L3UA 4FYVB 2GW8A 3LAMA 3H98A 4TY8B 3CW2C 2NUUG 3MEGB 1J2VA 1UFKA 3MPUB 4P2FA 4DL2A 4DV3E 3VGTA 4NMXA 1ZM4A 4C8MA 3MZIA 2VH7A 5KT6A 3QYYA 3U1MA 3J7AG 3E01B 2DY9A 4F0KA 2DD8S 5T41A 4RW8B 4PUOA 2BBEA 1WC3A 5CCLA 4LVOP 4WU2A 2DPIA 1HWIA 4R0EA 1RT4B 2CA9A 2V8DA 2BJ3A 5K8MA 4OO1D 2Z2LA 2CZ4A 4GQUA 2ZNYA 1ZAWA 1U6BA 3RTVA 3A3OB 4PWDA 4Q5VA 1H3DA 3OFEA 3C6TA 1VQYA 3GCXP 3EDRB 3KUEA 2BJEA 3PKMA 2RF2A 1T95A 2OJ3A 1Y60A 3IO1A 2GMJA 3M2UA 2HQDA 1U45A 2ZDOA 3U1LA 3MCSA 2GZOA 5K36D 5I3QA 2PIIA 5KG1A 2VICA 4JI2F 2DXDA 1T8EA 3KTQA 2UUCJ 1XNQE 3RUBL 2A18A 4Y00A 3R5AA 5DRRA 2YWFA 2J0WA 2O3DA 2X3GA 5EX0A 1UTAA 4I0WA 4PXDA 1DJ0A 4A8FA 3M6UA 4LF6E 3CO9A 2NN6E 4WCEQ 2WVFA 4YS2A 1UVKA 2AJQA 4KTQA 1DTQB 4QIFA 3RW7A 3RAQA 4KC5A 2A0FB 1JJCB 4LF4I 1XMQI 2V34A 1A6FA 1RTDA 2DHXA 3J80Q 1HBMB 5HJYA 3EPIA 4PABA 1CVJA 3DMJA 3VZHA 1ZM2A 5AE1A 5DQHA 2GIFA 1S1WA 3J80Y 3PIOQ 3R5JB 2D41A 4X4OA 3VTIA 3VQTA 4DQIA 3NAIA 4B9SA 3AFGA 4KFBA 1QSSA 1C4CA 2PC6A 4U8VA 1XR7A 4QBUA 2Y9HA 4RW4B 2B4PA 1SJRA 2BE2A 4NWBA 3TI0A 4J9OA 4IZJB 2VC0A 2MSTA 2BABA 4IFVA 1HQEA 4JI0F 4C2MA 2DGTA 3M7ND 4ZP7A 5AXKA 2V0NA 3JQJA 1NDPA 1RKIA 2DR6A 2JE6A 4M95A 4LFBE 3IC1A 1UJ5A 4LF1A 2HFVA 1CLFA 5KT2A 3UFCX 4KHMA 4C6AA 3RYLA 1QTMA 1RYSA 2HVIA 1Z0VA 3R8YA 4NCBA 3PEHA 5BXIA 3M1VA 1FO1A 4CLLA 4JB8B 1FTRA 4LCGA 4PEOA 4FNHA 4CLKA 2DPJA 1MMDA 4H4MA 3OL9A 3RBEA 4LF8I 4JI2J 4K4YA 1FKOA 2AE8A 4X65F 1KN6A 1HNZI 3MR5A 3AJ1A 4OLOA 1T05B 2RRNA 1UVJA 1D6TA 1H7SA 3AT1B 3BZQA 4UT4A 3ZFVA 3QRPA 3CJSA 3MGJA 5CQGA 4MYUA 5KT3A 1G3OA 1TMMA 1OSDA 2MKSA 1YG0A 3M8QA 1FJGJ 5B0DA 2OPQB 3TUPA 4AL6A 3J80C 5HROB 3R6LB 5E3AA 3JSRA 3KDOA 1N33F 2MTLA 2MZQA 1VRUA 2F8MA 2W4DA 4UY8T 3VZIA 3W62A 2R8KA 2Z0GA 3ITHB 1LWXA 2LXFA 4O23A 3ETMA 4DSLA 3D6FB 1MG7A 5HP1A 4MKYA 1UKUA 3MMBA 1VBZA 4WYLA 4PWDB 5H9EK 3V6HA 5C5JA 1S1UA 3OL7A 3C6TB 4DL3A 2KXNB 2D7SA 2E7XA 4JI0J 2RF2B 4N77A 3KKFA 2IRXA 1DBDA 2PO1B 3M2UB 3EZUA 3FBBA 4K4VA 2IOQA 2Y1RI 4A8YA 1LFWA 3NBPA 1HR0F 2IYGA 2KN4A 1X5PA 2CYYA 2Q79A 3I55S 2WK4A 1UL3A 5IWAF 4CLWA 1MWYA 4HT5A 1SJFA 1GX6A 4FYXB 4TVAB 1B63A 5DETA 1UAWA 1D8ZA 2IAJB 3IBWA 3CGIA 3W60A 2R2SA 2XCAA 4YHHJ 3H5YA 1KEKA 2XS2A 4L73A 1SKSA 1HNIA 5LL6R 2MJNA 1FD2A 4O44B 4OI2A 2GAGC 3OR1A 1RTDB 2JT2A 3V81B 1TFWA 3EXCX 3OTDA 1UEKA 3HKMA 3FSIA 3JAMQ 1NDCA 1S72S 3KG1A 4X65J 5GADU 3HZEA 2CFXA 3UD4P 1UW4A 1F3VA 4K4WA 2IM2A 3BR8A 5KFSA 3JAMY 2HQIA 1W26A 1U0HA 4KFBB 2HNYA 4EYHB 1N5VA 1SBRA 2DNQA 2BE2B 3SMZA 5KG2A 4WZQA 4WK3A 3P6YC 1WC4A 4I68A 2WP8A 1XR5A 2YWWA 2ASJA 3V6JA 1UJ4A 5F3ZA 2QLBB 4ZCIA 2JE6B 4B3OA 4DV4F 3HKZD 4AL5A 4Y28C 5C0XC 2A6MA 3T1HI 3IM9A 1F3FA 5KFDA 1T9XA 2ZBQA 1P1TA 1QD1A 2JL9A 1SB6A 1T94A 2Z2YB 2MQ8A 1YQHA 1LQ9A 3M1VB 2ZHBA 1T02A 2EK1A 4L75A 4DX7A 1YHQS 3HJCA 4CWBA 2XMAA 1LFPA 1TQLA 2MQPA 4OI4A 1H6KX 2FDNA 2H5IB 4LBPA 4KB7A 3OW2R 1HR0J 1FNOA 4E8UA 4B3SI 1E3PA 4H4MB 1HBNA 4CH1A 3NZKA 1FKOB 4XDCA 3DRYA 2RD5C 4M5KA 2C2DA 3UQSA 4JI1F 5IWAJ 2DRBA 4IDKB 4FYDA 2AD9A 1YBAA 1Z2ZA 2Y1LB 1GXLA 3DNCA 3K1JA 2JH3A 2YNHA 4EUVA 3J80U 4X4PA 4N5SA 1OS5A 4DUZE 3ZZTA 4EU0A 1Z5BA 2QEXS 1CULA 1MLAA 4CLFA 2PFFB 5M2UA 4YB7A 1T3NA 2W9AA 4WE1A 1NJXA 3MECB 2HVZA 2VFVA 2IFXA 1S0NA 3EGZA 2CPIA 3V4MA 4S0MA 2B8QA 3MR7A 2VQFI 5LT5A 2MZRA 2RS2A 4AIMA 5HP1B 2RUGA 1QSYA 4DV2E 3PY8A 2Q6CA 1YHCA 1TUGB 2WONA 2HLTA 2JEBA 2B3TB 3DRXA 5C0XD 1TL3B 1QZRA 2KG1A 4B3TF 4P10A 3TJAA 1NKCA 3BEGB 3UW1A 2J76E 3NBPB 2V5HG 1SC6A 3NGKA 4N41A 4CTAA 2KL8A 4JI5E 2POKA 2UUBI 4YMEA 4M5IA 1IKWA 4N8OA 1D3WA 1OYPA 4CNZA 1YRXA 3TVYA 3BYPA 2YBVA 3AOAA 4UZCA 2HIQA 1Y9OA 1JNRB 3SCLE 2MKYA 2YWGA 2GVZA 4ZVHA 4OO1A 5IQQA 3QT8A 1HQUB 2HZCA 4JI1J 1IBMI 1SUQA 4NLVA 3VGVA 3K5PA 1FRMA 4B3RF 1RCOB 1FE0A 3EVOA 3EX7B 2XG8A 4DV7E 4QYRA 4F7VA 4Y3CA 1NDLA 4ED1A 1W2BR 4KQZA 2DH7A 3ISND 4DN0A 3NS7B 5K36A 2ILYA 2FJVA 2C2KB 4EI2A 1QJHA 2JDJA 5HMYA 5CZXA 2VPYB 5DM7Q 4ZVQB 4DV6E 5ETMA 3K5LA 2QLJB 5F3TA 2JLEA 3LOUA 1JLQB 4KYZA 1WF1A 3CMES 2EBEA 5KT7A 5KFNA 2ZE2B 2AKWB 2J6SA 5CA5A 3HFKA 4XAKA 5L39A 2DGWA 3JSMA 1ZA2B 2BJ1A 3D68A 4ZPWR 2E5LE 5E3QA 4NXMF 5C42A 1K0VA 1NHJA 1RR9A 2CJYB 1IUJA 3WX8A 3Q8SB 4LBHA 3Q2SC 4QWEA 1NHIA 1HBNB 2WVEA 4NLQA 3UN5A 2CPYA 5GVQA 2IM3A 1N36F 4GKJI 2HHQA 3HSJA 3MI7X 2NXUA 3A3PB 1AFIA 3MM9A 3JAMU 4ECWA 2R2TA 2W8LA 3KK2A 2VASA 5JVHQ 1CULB 2LU2A 4UUWA 4IRDA 3UNGC 1F5CA 3HULA 1XNRI 3K5MA 3PS1A 1BQMB 2F63A 1F9EB 4HY1A 2VPWB 3T9ZA 4ZCLA 4LF9E 4ED2A 3QT5A 2EFGA 1HHQA 4ETXA 3LH2S 4B3RJ 1S99A 1FFWB 3FBEA 1GH8A 2EKNA 4NLOA 4K4SA 4OYOA 5A6PA 3M85G 2HRYA 2JZ5A 1Y5LB 1N32F 2CJ9A 3N6LA 2JEBB 2ASLA 3T1YE 5ETOA 2PMHA 2CQ0A 3LNUA 1ZYQA 2ZBCA 4OX9E 3DOKA 1U09A 3SCIE 1JJ4A 2PGCA 2EWHA 1LWCA 5DG9A 2E1AA 3O3LA 5DDOC 1EIYB 3W63A 2JEFA 4YR2A 1NM2A 5CH7B 4CTAB 2MKKA 5BR8I 2EFVA 2H65B 3BGFA 2W7OA 2XNRA 5B0FA 3W3SA 1YBTA 2WNRA 1FKAF 4DR6F 1IKWB 4I4BA 4YY3I 1QVGR 4NXMJ 4O3OA 1RXOB 2R42A 4X4TA 1Y3JA 3A1YG 2GVZB 4OO1B 2Q1LA 2PEHA 3UWTA 1SUQB 3R5DA 3KLHA 4X4SA 1XQIA 2JVRA 1RA6A 2U1AA 4DR1I 2KT2A 2VDIA 5EKWA 1IBLJ 1GXUA 4ERDA 1EP4A 5KFAA 1M5SA 4R25A 4DR2E 4U3BA 1RBOB 1PCAA 4LFCF 5K36B 5C2CA 1LW2A 5J1EA 3PX6A 3M2VA 5LSRA 2JEGA 3MOJB 2AIRB 4DS5A 1X9SA 2G1HA 2ZHOA 4URQU 4ITSA 1SQEA 5KFTA 2DNPA 3GONA 3GZ7A 2ZOGA 2L08A 4QWBA 2LCWA 2ZH1A 2JJ4D 2IVYA 4E0DA 1PVGA 3DYAA 1KOHA 2UXCE 4YEAA 2E9TA 5LMUF 1N32J 2NZCA 3VVTA 3AH6A 3IWXA 4N47A 5ELWA 1U1KA 3ILJA 4K0KF 2MB0B 2GHWA 2MZJA 4FPRA 3K8WA 3ZZRA 4J37A 4MIWA 5D4LA 1NK7A 2KFNA 1KP6A 1GMUA 1X31C 2O1TA 2RRAA 1L3TA 3B4TA 2J0QD 5B0BA 4AYBD 5A76A 3UHMA 1V5VA 5SZTA 1FRLA 2IMWP 4DR6J 1HHTP 4YR3A 2QYCA 2GIRA 4LQ9A 1FRJA 2CZVC 5DGBA 2UVUA 4JI6F 4F0MA 1C0TB 1YWXA 4FYWB 4OYWA 3KK2B 3DU6A 3VGUA 1Q8BA 4N8NA 3C6UA 3EVWA 3NGRA 1XTZA 1B7FA 5J2NA 3VGSA 2DH8A 3KYLA 3N79A 2YKPA 3CXCR 3R2CJ 1UZHA 4ID5A 4TLRA 3R1HA 1F2GA 5HO4A 5K8OA 2OPRA 3LA0A 2FYXA 1AA1B 2NYIA 1NJZA 2VKZG 1AUSL 2EW9A 4QZVB 1GX5A 3K0JA 3FEXB 5BYSA 4JI7E 2VG6A 2APOA 1QM9A 2DK2A 3BH6B 4IOCQ 1KR4A 4Z2XA 1R6MA 2DGOA 3TNVA 2BA1D 1E6YA 1FXLA 3FFIA 1UMJA 4JYAI 1Y7PA 5DDRC 3TAMA 3P76A 4WXOA 2GFFA 2J7UA 3UN2A 5IM0A 3DOKB 1EB0A 5DS7A 3DRPA 2OSRA 3AB2B 3W1YC 1SL1A 4YB6A 3SSSA 3H5UA 3J7A1 2XMKA 1NK8A 2IHR1 2LQBA 1YJUA 2EC2A 1NHKL 1NKEA 2DNGA 5KFHA 1VMBA 4Y2CA 1N54B 5LMUJ 2WNRB 2WAQD 1YJWS 5ETRA 2DGUA 2NSCA 2M8DB 2EC0A 2GAHC 4IFDA 4D3GA 1Q5VA 4K0KJ 2R8JA 2XGQA 1NPRA 3AD9C 2FC8A 2QLXA 4QIGA 2IERA 2E44A 2ZNZA 4CO5A 1D1UA 4TQSA 1SI9A 2HWHA 1MMNA 2XM3A 5ETVA 2L9NA 2NXCA 1R0AA 1NSQA 5A8WA 5F8MA 2YX4A 1YBUA 1R89A 3F56A 5M2RA 2H4YB 1PC4A 3HHLC 1WOPA 2DNYA 2OMOA 3CC7S 4OJ3A 3L4BC 4BA1B 3DLKA 4JI6J 3ZXWA 4ISAA 3DN9A 3OL6A 3A8EA 2VA3A 1OPZA 2MDAA 3ET6A 4ZVEA 4U7UD 1C0UA 2G13A 4LR9A 5J1EB 3HD1A 5CAAA 4OJHA 3D6TB 2CUYA 4P72A 5EN1A 3R7NB 3LGHA 5JEAA 4AXIA 3QWPA 2ALZA 2CVIA 2CPJA 3JYTA 4XDDA 3DYAB 3H20A 4JV5J 5DNLA 4LF5F 4F4YA 3CDAA 4KH0B 4HYMA 1RAEB 3GIJA 2ZVSA 1I94I 1RT3A 2M2BA 2V6AA 1U1MA 2E66A 2W2PP 2JX2A 3FGVA 1NJYA 2H5JB 2PNZA 1Q86T 5AE2A 3D6MB 4DR4F 1RLCL 2V63A 1Z0WA 2CG8A 3OBIA 3T5HA 5C2GA 4KR0B 1D9FA 2O1PA 1PJ5A 5KFQA 4P52A 3U27A 3GMEA 1PYSB 3QMQA 4G1IA 3LWLA 1Y6ZA 2V50A 3CTRA 4U95A 2CQ3A 1VK8A 3DRSA 3DOLA 3M2RA 2JVOA 1N34F 2J8SA 3IAM9 4O3NA 3G6XA 2O66A 1ZBTA 4DU8A 2R2RA 5F8HA 2DR8A 4KPCA 4ZS6A 1SJ4P 4GKKI 3F41A 4RJVA 4CO4A 3C6UB 2GCFA 3MAHA 1V6HA 7FD1A 2UUCE 2QL9B 3OTCA 2FGOA 2H4WB 1UZDA 1Z4UA 3IBFB 1RAOA 1NH8A 3SV4A 1RTZA 4CLZA 3GSDA 3BBFA 1JMTA 4QJVA 2ZWOA 3PYGA 5DZ7A 3HJVA 3MFIA 4OHXA 1XWLA 3EPGA 2AGQA 4Y34A 2KJVA 1ZTTA 2VKRA 2I6WA 4F4AA 1E6YB 3NNAA 3ENVA 2C38B 3F73A 4LF7I 2RDDA 1YJ7A 1IN0A 1M1HA 3OVAA 1P9QC 3DRPB 1Q4RA 1AZSA 1SJ3P 3CO0P 4F67A 5KG4A 3T41A 1CJUA 5BYQA 1G7CB 4F3OA 1R6LA 4PU9A 3CDWA 1PAUB 1FWPA 2J9CA 4R0JA 1RGVA 1RHKB 4HKQA 2XY5A 4PAAA 4NL5A 4UOFA 2VHGA 2OFGX 2QMWA 3UVJA 1KRPA 3DD6A 1YH8A 4FW3A 2YKNA 5F8LA 4WTOB 5FIIA 1P8GA 4AXJA 3DXBA 1P1LA 3PZPA 3TRGA 5A8WB 1DURA 2XGPA 2IBOA 3Q2TC 4YUDA 2NQPA 1UWAA 5C0XB 5HVFA 1N34J 1WHVA 3CJ3A 2ABYA 2XQCA 2HRTA 2FJBB 3FUYA 4JI2E 2XCPA 4YB1P 2DHGA 5KG6A 2YNGB 2B9EA 2MYFA 1FXDA 3ET6B 2HZAA 4M5DA 1SH2A 3QFHA 1TL5A 2ZH9A 1HNWF 4USWA 4MJKA 3J81j 3WU6A 1SH3A 3Q6NA 3NCQA 5KG5A 5IZHA 1TP7A 2M8HA 4ECXA 3IS9A 1HPZB 1GT8A 4AFFA 2ZM6I 2AHOB 4CLPA 4I6WA 4USJC 4QCLA 4UOGA 1IBLI 1TELA 3ZC4A 1Q82T 3QT7A 4DV5I 1FJGE 1WKKA 2HNZA 2KZMA 3GIRA 3K8VA 2NREA 1X4FA 2UXDI 1LKZA 3CJ4A 4KPYA 2DEIA 2ALYB 1HL6A 5I3UA 2PO2A 5KFPA 2QJ3A 4A8MP 4NCAA 2J9EA 1WJ9A 3G82B 2PNZB 1RBAA 2YNFB 2FUG9 3MD1A 2ROGA 4ZLPA 2VESA 2CNLB 2HHHJ 3M4XA 3NG8A 1NPKA 1VRTA 1NZ8A 3CEDA 2F4VF 4JI0E 1SL0A 1NHHA 3US5A 2VZ9A 4WFZA 3SDEA 2UU9F 2BZ2A 2M3DA 1TZ0A 3AQPA 3DOLB 3W65A 3BGOP 1KQGB 1BUXA 3N0VA 1BMQB 2GJ2A 4ZOSA 2CQBA 4QNKA 1G1XA 3M32B 3BB5A 2QTWA 5DDQC 1KC8T 4WYWA 1TVRA 2FLLA 1NB7A 4LFAI 2DGSA 4U6PA 1YI2S 1I1GA 5GMEA 3D66A 4DR7J 3GR0A 4YHHE 2X36A 1GMVA 3CCMS 2EEYA 2QIFA 4WPAA 2HRUA 1R8PA 3H2UB 2FHOB 3CDEA 2DO4A 4ZITA 1RTIB 2NCKL 4AUKA 2MQQA 2CWXA 3T5KA 1S4FA 4X65E 1TKTA 3CVKA 3OVSA 3KLVA 1GMWA 2FIUA 3GWCA 5J2MA 1K1QA 2H3EB 2IMOA 4RW9B 4ED7A 2Q66A 1ZZFA 2IYIA 4OKGA 4KGZB 4X4RA 3VAFA 2BACA 3IN5A 3AQOA 4FF1A 1KBRA 2ZZNA 3OHAA 2J9DE 1SPBP 3UI3A 2FQQB 2B6AA 4CRJA 3SQGA 1WC5A 1QLNA 3DLHA 5CYQB 1FHTA 3UVJB 2MGZB 2J8AA 2YKNB 1U1PA 2XLIA 4NXNF 3DDIA 1X0PA 2F8HA 4O0IA 2UUAI 4H4KA 3B4DA 4QR2A 2D9PA 2FLOA 1Q78A 3GYNA 1OIAA 2P6TA 3HI9A 3NRBA 4USIA 4H4OB 3K7RA 4O3QA 1HR0E 1B70B 3EZ5A 1S6QA 4CH0S 3CMQA 1V3ZA 4Y2IA 4Z37A 2W2QP 3V6DB 5IWAE 5L9NA 4QW8A 2A6OA 4ER8A 3RRGA 4LR7A 4NE9C 3HJFA 2FHKA 4FBTA 2RIJA 3IS9B 4K4TA 1SIZA 2X51A 3NGUA 2BOPA 2CJKA 1WUUA 4KHPF 4LJMA 2HNZB 4YDDB 2EG2A 3DLEA 2ATCB 7FDRA 2WOMA 5I3UB 4M5LA 4Z7YA 2C3MA 5IT4A 1TR0A 2FZGB 1MSWD 3WU3A 5KFGA 1NHUA 3M8RA 2ZHAA 3ILIA 1Z1ZA 3X1LB 3AXMA 3NNCA 3W2WA 2XLKA 2BQ3A 2UVVA 3HM9A 4NLYA 4JV5I 5HAOA 2I38A 3GV7B 5L1IA 3BSOA 5BYRA 4OLPA 3OTBA 2Y8WA 4DUYF 1LOUA 3C19A 2DKOB 2UVRA 4WFYA 2FVSA 4RW7B 1WOSA 5DG7A 1Z59A 3GMGA 3MR6A 2NXNA 3W8PA 1E6VA 2AYEA 1XJWB 1TVRB 5LSOA 2OMLA 2O01C 3NAHA 3D4JA 3KJVA 1RK8A 3N6MA 1FA0A 2P5VA 4Y0FA 4NZ7A 2DRDA 2HIYA 4USVA 2ADCA 2VFRA 3JQMA 3JQKA 4HDGA 4DEZA 1RTJA 3KLGB 1WSVA 2PFDA 4IR9A 2BANA 2VD3A 2MLXA 3CSKA 4J5OA 2P8IA 2GO4A 3ICLA 1PBAA 1WG5A 1N52B 2IA6A 2UVWA 1FWLA 2K3IA 4ZPTR 3OXLA 1RYRA 4JI1E 4AL7A 3ENWA 2CQDA 1NK6A 3WU4A 5J2MB 2N82B 1TMJA 4ZJQA 4U67Q 4LIRA 4KKOA 2OHDA 5CABA 2LDYA 5D15A 4M1KA 1IM4A 3PR5B 4MT1A 3CC2S 3O5TB 4UTGA 3WX4A 2WW8A 1HBUA 1KQKA 4KHPJ 3B6BA 1S1XA 3QLHB 1V5IB 1JIHA 4OZJA 1TK5A 3HHLA 3SQGB 2B5JA 5F41A 3PYFA 3CD6S 4EWTA 3KHHA 3KK3B 4MFBA 5LOQA 4I6AA 2Z8QA 1B62A 3KK1A 1GXTA 1R0BG 3EJMA 2R8IA 4FKXA 4B9NA 2ACMA 2YPYA 3VALA 1PKUA 3BGUA 3GCWP 4DR3I 1T3OA 1M90T 2BUNA 4OV6A 1NK0A 2BJ8A 4LQ3A 4K7QA 4FVCA 4DUYJ 1XERA 4PXEA 3H8YA 5GMDA 4P7TA 5I4MA 4X2BA 5GMKa 5KFLA 3ZZZA 1I6JA 1S1TA 3FMWA 4PPDA 1U02A 3I9V9 4DL7A 1VLOA 3QIPB 3MM6B 3IBCB 4K5SA 1J5OA 2E1CA 1JLCB 3L09A 1ULRA 3TZWA 2B7BB 3L95X 4ED8A 4DPTA 2NR0A 1OPIA 4IYQA 4U96A 2RVJA 2RDIA 1CJKA 4C0BA 1X5OA 3W9IA 2H51B 3NKYA 1X4HA 4RX6A 2RUSA 2X1GA 1JLAA 5E3PA 1QE1A 1QAIA 1BLUA 2WBMA 4B3RE 1QUPA 4BS2A 5K5MA 4OHYA 2NN6C 2QLFB 1TL1A 1Y11A 2QSFA 3H25A 1PYOB 3KFWX 1IBKJ 4ZVIA 3HT0A 1KVJA 4R8UA 5GAHI 3GJQB 2FJDB 1T9TA 1H7WA 2R7XA 1QAJA 3QGPA 4I69A 3CJRA 4CO2A 2NYHA 4WXWA 3THVA 4LPFA 2CQHA 4OZ2A 3MCNA 2V2ZA 1S9GB 4QNJA 3KJNB 4X62I 5DROA 1Q5YA 1MU5A 3ELHA 2HHHI 1E6VB 1BQNA 1BXNA 3GILA 2WVDA 4IS9A 1N5YA 1H72C 1OYSA 2DIUA 2BDPA 2D3O1 3FJ2A 4Q8EA 2C3YA 2XHWA 5DG8A 2VG5A 4ZDNA 4HL9A 4JI3I 1VRQC 4NXME 4DF4A 4LF4F 1XMQF 4JUZA 1ITPA 3W64A 1ZOTA 4LF2A 4IH7A 4DR5I 4NLDA 3TOQA 2YQ1A 2E1RA 3WIUA 4DPOA 5HQ8A 5AE3A 1BHNA 5LL6d 1PG5B 1SQGA 4ETZA 4TU7A 3POTA 2MLZA 2GMLA 3TUZC 4WUDA 3R5CA 4URSA 4DR7I 1RHRB 2BKPA 2RKIA 1S57A 3HFZB 4F26A 4CCHA 1PILA 4PPZA 5E0OA 5IOLA 1PJ7A 1J5EI 1IBLE 3TW0A 4C8LA 4K50A 1K9MT 2HVDA 3S7RA 1HBUB 1YSJA 1R3NA 2NN6D 1S1XB 9RUBA 1KFSA 2OGUA 4L74A 2OPPA 1TKXA 2W7AA 3HHLB 2B5JB 1HLWA 1KONA 4MFBB 3EGWB 3B4MA 5A8RA 3QNWB 1K1SA 3IWLA 5HK4A 3KK1B 4K4XA 1C1BA 2V67A 3I0RA 4EZ9A 5GAHU 2HBQB 1M5VC 3VVUA 4ZP8A 2DNHA 4CP5A 4DCOB 1PJ6A 3DFEA 5KOXA 5H9EJ 4Q0BA 2FTRA 2QL7B 1N32E 3R27A 2COLA 1WI6A 5LMNI 1E3HA 3CJ8A 3PW5A 1UPMB 4RW6A 3LALA 2V94A 3DGPA 2HS3A 4DV4I 2HVEA 2GGPA 1DAXA 4LF8F 3TP2A 3TAPA 5MLCV 2G9OA 1CBKA 2PMZD 2PEBA 5JJBA 1HNZF 2XB2D 4QQBA 2OELA 2IC3B 4PYAA 1S1TB 1FDDA 4IFDE 2OEKA 4NA2A 2HK2A 1FKAE 4DR6E 1S6PA 1SXLA 4ZP9A 4LF4J 1Z2LA 3EWGA 1U7LA 2O1WA 4DOZA 5F8JA 2KG0A 3RAMA 3HT3A 1BWEA 1CJKB 3HP6A 4CQ1A 3KDNA 2V4QA 1VQPS 3GFHA 4KGXB 2QT7A 1JLAB 3ENQA 5D77A 2A10A 1QE1B 5K14A 5JUMA 4FF3A 2BM0A 2RJZA 4ICLB 1U1NA 4F2RA 2C22A 4BC9A 2HBRB 2E9RX 2BM1A 3E2EA 5I3PA 1QTNB 4R8UB 4X84A 2KYXA 4CIOA 3IG1A 4P9SA 3I5AA 5F0UA 4KV8A 2IJFA 1ACMB 2XWYA 1TKZA 2DEJA 4ZVPB 3M6WA 1IKXB 4CYUA 2Z58B 3JS9A 1GK8A 1NK5A 2DXEA 1DRZA 1ZPWX 5HQLA 2FD2A 2GV1A 1HWLA 4ANDA 1BQNB 2QC3A 1TK0A 5LMUE 4OZ1A 4ENOA 3HMJG 3Q0AA 2R7SA 2VG5B 5AXLA 2DGQA 2HFZA 4K0KE 3ILOA 2JEAB 4DV0I 4YB5A 3MM8A 1L3SA 2N3LA 3PJWA 4A48A 2KO1A 1Y0HA 2K8GA 1U48A 3C16B 2WCXA 1IWGA 1RE1B 4WP3A 2VOPA 2Y0SD 3POTB 4ZLJA 3IGVA 4J3DA 3G9CA 3J7YU 3C14A 5T14A 3QWUA 4JI6E 1S1VB 3MXHP 2R8HA 3U1KA 3ZZPA 3P3CA 3W9JA 2I0XA 3J7AN 3PM9A 3RRHA 1WEZA 3WIVA 5HLFA 4MQYA 2ZUAA 2G0CA 4TY8A 1TKXB 4D3HA 3MEGA 3PX4A 4MU3A 5IFMA 3T1HF 3RAXA 5A8RB 4LSLA 4RR5A 5L38A 4PG4A 1OYDA 4DL5A 3EE3A 3I0RB 3ETOA 2YH1A 2QFIA 3DRRB 2KFYA 2XY6A 3UNYA 3RW6A 1NKBA 4J9NA 3KLIA 2DNMA 4CT8A 2HPUA 4CNYA 3OHBA 4RW8A 2Z30B 2HK3A 3PFOA 1HD0A 1T9YA 3BN7A 2WSFC 1WG4A 1P6TA 3DGPB 4O3PA 5E33A 1SKRA 2J65A 1SL2A 3ZZYA 2D74B 3LTOA 4ZJOA 2DR7A 4DFMA 4U7UK 4NLPA 1WI8A 4OYMA 3FQLA 3MD3A 1G6BA 4HT7A 2YKMA 3NL0A 1S6PB 2C42A 3W2VA 4TKTA 4DCPB 2PI4A 3P4UB 5FJ4A 3HZGA 1CJTA 1HNXI 3FNNA 4O3RA 4WKYA 1N36I 3TYTA 1S0VA 3RZAA 5A2QQ 4HDHA 2V8GA 1DHMA 2IBKA 2UXBI 2VQFF 1TU0B 2AJ2A 5K14B 4NLUA 3WC0A 1BGXT 5A2QY 3MUVP 3LPEA 1FFGB 3PCOB 1EX8A 3JTPA 3OD2A 1HBMA 3DLGB 3LP0B 4WF9Q 4B3MI 1IJEB 4DZDA 5KFUA 4R5PB 1WACA 4F4XA 4MAKA 2R3VA 1NZAA 5LJ5Y 2MKHA 5KFEA 3BGRA 3BSAA 3AODA 5B0GA 4KV8B 3T19A 1TKZB 3T3FA 2ERRA 2ACYA 2E5HA 3G6VA 3T1HJ 4I2QB 1IM6A 3BSNA 4MKVA 3B8HA 2UUBF 4Y2KA 3R6GB 1WTBA 1IBKI 5A8KA 1WEYA 2OO4A 4IUFA 2FHJD 2A2DA 3NEKA 3CCUS 4NYZA 2BW7A 3OTOI 3LANA 1KD1T 5GAGU 2J6TA 5J1PA 4RKUC 4B3SJ 2UUCF 3CWJA 1YGYA 3MM8B 2YH0A 4OZNA 2YXLA 1IBMF 1X4EA 1YIJS 4LF6J 5FLXQ 3ZTRA 3S01A 2MY7A 2LJPA 1OY8A 1SV5A 1OY6A 3M30B 4F36A 2GQ0A 1DY3A 2K1RA 5FLXY 1XK8A 2RAQA 3C14B 1N34E 4Y2AA 2ZVIA 1H98A 1D9DA 1HYSB 2HYIB 1LWEB 4ILRA 4NZ0A 2VFTA 2XMTA 3M9MB 1T05A 5DM6Q 4MKBA 3M85D 3HKWA 3GLJA 1DQ9A 4CI0B 2VQFJ 1FXRA 2F3JA 3ADAC 4X66I 4LRBA 2ZEJA 3CD0A 1R27B 5A0YA 4LSLB 3PFEA 1DZ5A 2OPQA 3DLBA 2OEJA 2BVZA 2R7OA 5HROA 4LFCI 4NX9A 2Z2MA 3KLIB 1F5AA 2QLWA 2OPSB 3D6HB 1JJ2R 2KRRA 2LYVA 2LQJA 3I4PA 4ED3A 3ITHA 2G0IA 1HA1A 5KG3A 4TYBA 3R97A 4PYDA 4GKJF 5CXTA 2UUBJ 2FZKB 2HHHE 5KAKA 3O44A 4HI1A 1UDNA 2PO1A 3M6XA 3DU5A 4JI4I 4FS2A 2HBYB 2NN6A 2YKMB 4X4QA 5DZ6A 2CJBA 2LEBA 4DL0C 1VQ6S 3TVZA 3W2VB 3GFYA 1CS4B 1CJTB 1XNRF 1L3KA 4DV1I 3GJRB 2XNQA 5FLXC 3HLUA 2C2OB 3RB4A 1IBMJ 3FBFA 2IAJA 3UD3P 1RI7A 1VBXA 1Y4ZB 3I96A 4YP3A 5IC4B 2ZJPQ 3B82A 3J81U 4O44A 4HTJA 4MK7A 1FJGF 1HQ2A 4HHUA 1T11A 4PZVA 4MH8A 3V81A 2EXUA 4B9MA 2AX0A 1RWWB 3PVXA 5HBMA 2M5YA 2D3OR 2HHXA 5BJRA 1OYEA 4FS1A 3KUHA 3TJ8A 4KQVA 4C4WA 3BGRB 1KKHA 1HNWE 1UPPA 2MXYA 2VL1A 5HATA 2UV8A 3KHRA 1ZS6A 1EETA 1SKWA 5BR8F 5H1SV 2YWKA 5D8HB 2CRLA 4PXBA 3AJ2A 3EGVA 3M9NB 1B0VA 1SJQA 5A8KB 3JXOA 2ZH6A 4EFAC 4YY3F 5KFZA 1ZAVA 3D67A 3G86A 2VBZA 1R8HA 4JI8I 4V19X 4C0HA 2BV3A 1NDKA 1S7IA 4O0NA 4XIUA 3RG6A 3LUYA 4P75A 1R7IA 2BYCA 3WQPA 4E98A 4H54A 4P7AA 4X64I 4DHVA 2LVWA 3MMAB 3OSPA 2I2YA 4GKJJ 3BDPA 3D5MA 4L3NA 5IT9U 1Y10A 4DR1F 2WTFA 3FEZA 4ES2A 1UW9A 1IJFB 1WF0A 4OYZA 1SV5B 4YHHF 1L5UA 2F4VE 2F1FA 2D69A 2G2YA 2HGLA 5E2QA 2K1RB 2UU9E 4RU9A 2Y1JA 5A2QU 4RUAA 1SC4B 1XNRJ 1V3RA 1H74A 1F2HA 2EFPA 2HURA 1N56A 3TZXA 4U3DA 4IDKA 4NASA 2QL5B 1NUEA 4AQYI 3GV5B 2C39A 4C8YA 2CNOB 3TQ1A 2KTQA 2IDEA 2LKZA 5D3GB 4ILLA 5A0YB 2IRYA 1N6QB 1MWQA 2L48A 3PW2A 3MECA 2IPOB 2VJUA 4J9PA 3VAMA 3TO8A 1LK5A 1XMOI 3LGNA 2XSJB 4KHRA 3MEEB 2KM8C 1VQ9S 2EFNA 4QYZJ 2VFSA 5EWEA 5DRQA 1M0SA 2DVIA 3H5SA 3ZKBA 4HH1A 4LF5I 3NGDA 2XULA 3N5BA 5CYMA 3KMQA 3ZZ0A 5BR8J 2C2NA 1KFDA 1SC3B 1TL3A 4Q7AA 5HJXA 3CJKA 1BQXA 3TARA 4YY3J 4LOMA 4KO0B 2PA8D 2NN6B 5FLXU 5DDPC 1LW0B 2HFUA 2YKOA 4JBCA 1FEHA 1W25A 4UOCA 5C7PA 1VQMS 1MROA 2BRKA 2PE8A 4M5NA 4LRCA 3C46A 2A2CA 2HWTA 3VAIA 4NXNE 4DR1J 3KLEA 2DRAA 4USUA 4WFXA 3RBDA 4OO1F 2V2VA 1F60B 2ZOFA 3FZ2A 4LVNP 3TX0A 2HAIA 4GMKA 4HHJA 2VQEI 2VA2A 4JYAF 2ZD1A 2FJAB 5HBMB 1IQZA 3BKFA 4C8OA 1HQUA 4WUBA 1RHYA 3D3CJ 1XN9A 4DV3I 1PKPA 3HVAA 5K36F 1NLKL 3OTEA 4LRAA 1S0OA 1EETB 2GO3A 5LXRA 1BC6A 3HSGA 2BJ7A 1MN9A 5HMXA 2XYPB 3EZOA 1S59A 4KHPE 3P8BB 3MMCB 4KE5A 1UJ6A 1WEXA 5CCMA 5EDWA 3EM1A 2AWZA 4K5RA 5H9FK 4N3OA 1RREA 1H2TZ 2OTJS 2YX7A 1I3OB 2PO4A 5K8PA 3B54A 1JLQA 4NRTA 2ZE2A 5ETKA 1MMLA 1NCLA 2HHSA 1VYAA 1U8SA 4DMZA 1RAHB 3W5ZA 2AEFA 2E5IA 4FP9A 1KIJA 1S9FA 3BJYA 1NZ0A 4IG3A 4PG6A 1OMSA 4PRVA 3VWSA 2VV5A 2FPHX 3P49B 5KT4A 3SFUA 1XNQI 2ZBPA 3OXFA 3QJJA 1UDQA 4DUYE 3TR5A 5KFMA 1YKWA 2CNKB 2XYGB 1U2FA 3V4IB 3QZ7A 1KLMA 4LF6I 2GS8A 4FWHA 2CQ1A 4XO0A 4RZRA 1WELA 4ZA1A 1I51B 1MX0A 3BR9A 2RQCA 2C39B 2N7YA 1SH0A 4OQJA 5ETSA 1HD1A 3BO2A 2FHJA 4EYIB 3E51A 3TVKA 2KI2A 4I56A 2X1AA 3Q1QA 5J2PA 2D1CA 4RPFA 4OZEA 3JAMC 2ASYA 1BQMA 1I94F 4JYAJ 1NPPA 3TZYA 2RU3A 1XXEA 1ELOA 2HHPA 3FRYA 3N28A 3GTYX 1K47A 4FYYB 1NMEB 3MM7B 1TUWA 2BQUA 4ZPBA 3ISNC 4CLTA 2HAFA 2HKEA 1O51A 3AXKA 3A8KA 2XMUA 5CYMB 1OYRA 4PWUA 2CZ9A 4RNFA 5CD4A 3CJKB 1VK3A 4ANEA 4F3QA 4MIBA 4LFBI 2HQ3A 2E5JA 4ZIWA 2DNRA 1X60A 4GKKF 1FE4A 3H4DA 1Q8KA 3KHGA 3IFEA 1FEEA 1RWNB 3M8PB 1MROB 3FC9A 1JX4A 1YJVA 2IDLA 2LECA 1JJHA 1BWVA 3KLEB 4ES3A 4PKDB 3C2PA 1Q8LA 2V8VA 3CCSS 1RWXB 5KFIA 5F8IA 1FDNA 4UY85 1YTYA 2OI2A 4LF7F 1UDSA 3RB6A 2C2RA 4ZVRB 2ZD1B 3K58A 5HN0A 2HFNA 1BY9A 3HXMA 1S76D 3QZ8A 4ZKAA 1VQLS 3MAQA 2V4JB 1ZPVA 3LPYA 2XLJA 3H5XA 4X4UA 2AYBA 1VBYA 1RBLA 1IR1A 3K89A 4XPEA 1ZETA 4ATNA 4KBIA 4USMA 4RBTA 2YY3A 1I94J 4Q44A 3QPIA 2CQ2A 1LXJA 5ETNA 1S12A 3R7BB 2HZVA 1O8BA 4BHQA 5D0HA 2XS5A 3QJLA 4WWSA 1SVDA 1IXKA 2F40A 3Q8RB 4IZKA 1NXIA 4DPYA 4NLGA 3QAEA 1SCJB 3M6AA 4C3MA 4DSIA 4ZCMA 2LMIA 1R31A 1VGYA 3GPAA 4TNOA 2KHCA 2MHNA 3I0SA 5DJBA 3N01A 4IG3B 1Z0EA 2EPIA 1FJEB 4X4VA 2AEJA 2F65A 3LAKA 1EHWA 1VJQA 4NLTA 1Q81T 3BYRA 1H2UX 4GKKJ 4HACB 1H2VZ 3MEKA 4KGMA 4RUCA 4ELVA 1JQGA 1HMVB 3DM2B 1RAJA 2CPEA 2QMXA 4ZVTB 3PG9A 1WHYA 3W7BA 1KLMB 3OXGA 1AUDA 4OHZA 2GMHA 3D0HE 1IKVA 4RBVA 2XZWA 1U1LA 2ZM6F 4LR8A 2KB2A 2LU1A 4A8WA 3Q8YA 1C0TA 1IBLF 2Z2ZA 1HI0P 1CSJA 4DV5F 1OO0B 3TWZA 4LF4E 1RT5B 1XMQE 2UXDF 1WC0A 5J2PB 4TXSA 4LF7J 5HI7A 4WUCA 4J9SA 4C0OC 1KHWA 4UW2A 4K2JA 2CVEA 3QO9A 3SV3A 2OIHA 5KFWA 3DDKA 5JVGQ 5J2QB 5A6WA 5E5NA 4OL8A 3PDNA 3MTKA 3J7ZT 3Q86A 1T9UA 1FDBA 3BBBA 2BMBA 1TV6B 3OFGA 1BD6A 3KNAA 2CQPA 3OT9A 5ETTA 2CPZA 1NNDA 1RWMB 1V3SA 2CKWA 1KOOA 1F1BB 1VIXA 1O5JA 4ZPAA 1YLXA 3ZTPA 4NLRA 4N56A 3N5FA 1NJWA 2GQCA 3DOMB 1Z0BA 4IFDF 3R1LA 2B4UA 5ADZA 2GA7A 2PN6A 3BO3A 3R9LA 4LFAF 2WB1D 2AJ0A 1RT1B 2LDIA 5AT1B 2HS4A 2KKHA 1N5QA 2LEAA 2Z5CA 1XIQA 1RP5A 3DHXA 4LF8E 4WK1A 2XWXA 1YRTA 4AT1B 3GQCA 2P9EA 3PRDA 1XR6A 2BE7D 1HNZE 5HMWA 3P96A 3DKDA 2IVMA 1DTTA 1GEHA 4DUZI 4A4JA 1PSDA 4PWWA 2M0GB 3RB3A 2ZM6J 4WP9A 3H7HB 4BA1A 4C48A 1L3VA 3FK4A 1VFJA 4ZHRB 3G4SS 1HW9A 4IG0A 4DV5J 1RB0A 4ANCA 5JEAF 3O8WA 2KDOA 2DHHA 3GV8B 1S6UA 2YKAA 1YDLA 2GJIA 4CDIA 2UXDJ 2ZZMA 4URLA 3C3LA 2CAJA 3M7VA 2Y8YA 1EKRA 2AQ4A 2IRUA 4QIEA 4BA2A 4DV2I 1YJRA 3HVWA 4HEA9 5EWGA 2NXJA 2NZ4A 3MR3A 4IZKB 1H0HB 1ZM3A 4RNHA 1FD8A 3FCVA 3HCXA 3OLBA 1JWWA 4DX5A 2UUAF 2QE5A 1NRKA 4DG1A 2ZKUA 3I0SB 3QIDA 2CXEA 3P45B 2EG1A 1EJ7L 1AROP 4FBUA 3P3DA 2HBZB 4J91A 2IM0A 2NPIA 4JI5I 3CNQP 2JWNA 4AD6A 3FZBA 3QATA 4W98A 1HWKA 2C3PA 2IJNA 3TEGA 3K85A 1U2CA 4B17A 3A12A 1IKVB 4LFAJ 5KOWA 2L9DA 4NA3A 4YN3B 5I42A 2O5DA 1WTFA 2ZH7A 3GFZA 2H54B 2KRBA 4PG7A 1CPZA 4M94A 4YDXA 2AT1B 1FJCA 1VHFA 1Z5CA 3M6VA 2HVHA 2V69A 2ZH3A 1WC1A 4FKYA 2ZJQQ 2D3ZA 5B0EA 4ILMA 4DV7I 3QO9B 4MU4A 1NHVA 1WHWA 4GO5X 4JV5F 3SQOP 1HKAA 2PO0A 3UR0A 1S79A 1CJVA 1C4AA 1JLGA 2C38A 3C15B 3NS6A 4FWDA 4DV6I 4IKAA 3JTNA 2KT5A 4U8YA 3THPA 2NS1B 3P3GA 3H90A 2K7JA 2B51A 4JV2A 1PBUA 5HQMA 4FN5A 4NZ6A 3PO5A 1NBEB 4QW9A 1EARA 5IV4A 3T1HE 3TA0A 4C8KA 2HGMA 3VR1A 2E5LI 3P06A 3N4WA 3Q22A 1UFLA 1HI1A 1MU2B 3QGIA 2AGOA 5E3CA 2HHUA 2E7VA 5DQGA 1PAEX 1PO6A 2UUAJ 4B9VA 3NNHA 3EVMA 1V9OA 3L3CA 1T0TV 3C8YA 5ETLA 2ZH8A 1S7HA 1X5TA 4DF8A 4NLXA 1ZZNA 2Z5CB 2Q43A 3VQSA 4B3SE 5KFKA 4OFZA 2GNKA 2J7KA 4NLWA 1X9MA 2WSEC 4JV1A 2QA1A 3HHKA 3D0GE 4W90B 3OUYA 2YNIA 3WC2A 2QRRA 3HSDA 5ETQA 3J7Z5 4FW4A 1DTTB 1JB0C 1Q7YT 3ZTSA 1D9AA 3NXZA 5C0XA 1SQFA 1FX2A 4QIVA 4IG0B 1NSPA 4LF9I 2YNGA 4ELTA 4F04B 3PYEA 3P5BP 5U47A 3ILLA 1APSA 4IQXA 2QG9B 5F9NA 2HGNA 2P9GA 4BA2B 3AD7C 1HPZA 2VQFE 3UE2A 3CWVA 4LRDA 2GHPA 1K8AT 4RWWA 4DUTA 1KQFB 3T1YI 3G96A 4ID8A 1LXNA 4ZCKA 4OX9I 2CJQA 4FXWA 4DR3F 2IVFB 2UUWA 1T9WA 1WC6A 2P9CA 2QA4G 4DG1B 1O0PA 3QSYB 3G82A 3CJ0A 4NI2B 2PNLA 2YNFA 3AOBA 3N9UC 4NYOA 1G4CA 5EWFA 3SBMA 2XMWA 2OLWA 3RGIA 1FESA 3D3BJ 4U7CA 3FQKA 2R9LA 2IM1A 2UUBE 1VQ8S 1JLFB 3CDIA 2KM8B 3HVRA 3UD5A 2AW0A 1LNQA 4PG8A 1U4BA 5I42B 1F9FA 2V4RA 5DRPA 1H7XA 3ULHA 3OFFA 5KG0A 1JXLA 2MJUA 3M32A 3PJ9A 4W92B 1RT2B 3BSCA 5GADI 1ZA1B 3PW4A 4ECQA 1IBME 2DGXA 3BN4A 4JOUA 2XMVA 4NEZA 2OKQA 2MKJA 1RADB 5GAEI 4DR2I 4OMFG 3T1AA 4WFAQ 3H1CA 2PO0B 2GQ2A 2K7KA 5DO2A 1RTIA 4EGLA 1CJVB 1JLGB 1U49A 4PUOB 2CQ4A 3TUIC 1NO8A 2SXLA 3WBZA 4NRUA 1VI7A 4PG5A 4RW9A 2UXCI 1C1CA 3NLCA 2QX0A 4LRFA 4X62F 4CH7A 2JLGA 1U47A 2HHHF 2ZH5A 1UP1A 4RNOA 2AJ4A 3I82A 4FPIA 4DFKA 2DBBA 1FRHA 3UDLA 1B4SA 4DR3J 4JI3F 3OPKA 2XMJA 5CYQA 3MPYA 4KIAA 4DR5F 2H9ZA 1UFWA 2LP4A 2K3KA 2MGZA 2V68A 4Q45A 1HBOA 3BS9A 2BJDA 4RU2A 1NEEA 1EQ0A 3KNGA 1YVFA 4OHWA 2DH9A 1FTCA 4GKJE 3OUYB 2YNIB 5KTQA 2F4FA 2UV8G 3CCQS 2E1PA 4DR7F 4C7QA 4P2SA 1NK9A 5HVGA 2D9OA 2IJRA 2R7VA 1FVSA 2W1BA 1VISA 1J5EF 2Q2EB 3GLLA 3K2YA 1VQSA 2HQGA 4HLBA 4H4OA 2R7WA 2DNLA 1VC6A 2HMIA 1RAAB 4N7TA 3DMJB 1RA7A 1XNRE 1MNEA 1GTEA 4Q8FA 3V6DA 1S1WB 2B4OA 2KXFA 3UN3A 1OJ4A 4DZ6A 5EL9A 2J7WA 2CDQA 4LCFA 4EEYA 3LGMA 4JI7I 1HI8A 1KS2A 4O4RA 5GAEU 1Q0NA 2BJ9A 3Q8QB 4IFDC 4HR2A 4DL4A 5CZVA 2EBGA 3G8QA 4TU9A 1X5SA 1HQEB 4IFVB 4KGKA 3KJFB 2H48B 3OQ2A 2M52A 1N33J 4IR1A 4ZPDA 5LMNF 2XO6A 2JC1A 3NOCA 2LXIA 4DSJA 3FKBA 2OD6A 4JG4A 3LO3A 4X62J 3G87A 4A8KA 3QRRA 2ZJRQ 4F02A 4ZP6A 5BR8E 3MOZA 4K4UA 3D54A 5F8NA 4MU1A 5J1NA 4DU7A 2MKIA 2RB7A 2J5AA 5JEAC 1VDHA 2KZZA 4YY3E 4IH6A 4JI3J 4JP8A 2B8PA 3I5BA 1TL7A 4QR1A 1VCTA 4DR5J 1PYTA 3GYGA 6AT1B 4RW7A 2HFOA 1WSRA 1GTHA 1A6LA 2BW2A 5THWA 2O3ZA 4M5HA 2AX1A 2O1UA 4DR1E 1S6OA 3M8QB 3PKYA 2B9WA 1M5PC 2R4FA 1J5EJ 3KLGA 3PTWA 4IFDD 3A4TA 3SIPB 1ZTWA 1Q79A 1KWMA 3UR3C 1VRUB 4W4MA 1OSCA 2FJEB 1KSPA 2J9DA 3QJPA 2BA0G 3QT6A 4NCGA 5L8RC 2CPHA 3MEDA 2RHQB 5CHCB 4XTTA 4EO6A 4USKA 5B0AA 3MMBB 1C1CB 1RLDA 2AJ1A 4YFUA 1S1UB 3U02A 2MQMA 3OFHA 4LBIA 1Q16B 3UPFA 1K0TA 3MAAA 3W8GA 3QLHA 3RBZA 3PS3A 5LMNJ 2VUGA 2JLFA 4G1QA 3O1LA 3KOAA 4LREA 2L9WA 1U24A 3KXDA 2DITA 4DV4J 3KK3A 4DV0F 5JEAD 3M9OB 3BQ0A 2RQMA 1HBOB 4UOHA 1REGX 3D2WA 1JXEA 3KHLA 2ZZTA 4J9UE 5F8GA 1XC9A 3HD2A 3MMJA 2GO9A 4ECYA 1HNIB 1DQAA 2I1RA 3NWGA 1Y4UA 1U1OA 1X4BA 3OR1B 4C11A 3R5GA 5EUHA 2Y3YA 2UUCI 3GB0A 4ZLLA 2XZDB 2HMIB 2GVDA 4F4ZA 2WB4A 2OTLS 4C8NA 2W2OP 2CWKA 1EI1A 4UQTA 2L3MA 1U0HB 1VQNS 1IBCB 2HNYB 1LK7A 1TAQA 5SUHA 1Y5YA 3QIPA 1VBKA 3MM6A 3CJQA 1JLCA 2AP6A 3SEOA 3H4LA 4OO1E 3VV2B 4MYTA 1B64A 2XZTB 4DL6A 3ZZUA 3SSQA 4E2FB 2C2EA 3IRWP 3VCDA 2WP8B 4JYAE 3BBCA 4ZJLA 5L3JA 4B3OB 4BBYA 3PO4A 3OR2A 3UO0A 3M8YA 2JRSA 3CC4S 3MPWA 3GR1A 5K36E 3CB4A 2WBRA 2C37A 2EI5A 4Q2MA 1URNA 2MMYA 4HVZA 4B3TJ 2MKCA 2H5EA 2XBPA 1X4DA 4RLEA 1X9WA 4XK8C 3IR5B 4F4WA 3GE9A 1TL7B 1FNXH 3CMAS 3WDOA 1HNXF 4OZ3A 4DV0J 1S9GA 1G2EA 3S1TA 4NA1A 2FB0A 2HS0A 2K06A 3CCZA 1VIOA 5E41A 4PRXA 3D7SB 1ROFA 3AHPA 1YZ6A 2AV5A 3U1NA 2G2ZA 2YNHB 2UXBF 1Q53A 3BGLA 4A47A 4A46A 4EBEA 1TL4A 1IVZA 1D0EA 5K9FA 3W66A 4JI2I 3CJ2A 4WE1B 4I6YA 1RWPB 4F0HA 1RQ0A 5EHHA 1RABB 2QFJA 4B3MF 4ECSA 3I6PA 4QWAA 4DFPA 1D09B 2LA6A 4BLGA 1KVIA 3SXLA 2BKNA 2RQ4A 2LEPA 4NCGB 1EAYC 3MEDB 2ZBRA 2OEMA 2V9KA 1FJGI 4NLSA 1B7YB 2WONB 2UUTA 4IO9Q 2VONA 1IBKF 5G0RA 1S4EA 1W7WA 3MAAB 3FSYA 4WU3A 3OTOF 4G1QB 1I94E 2Y0BB 4RUBA 4L72B 3TQEA 1M1KT 3OV7A 1GQEA 4OZ5A 1RHQB 2V2QA 2DTJA 3BF4A 3CCVS 3I4HX 1KDNA 3X3UA 2DJWA 4JI0I 1X7VA 4DSKA 3PRYA 3LQVA 1RU2A 2CIMA 1B99A 4ZVFA 2DCUB 1Y5IB 4AIDA 3KG4A 4KH1B 1QVFR 2QSWA 4ZN1A 1U6FA 3W9HA 2C3OA 2MZTA 3D0IE 2HHVA 4DX8H 4C11B 4ED4A 2DISA 3GSIA 3QBCA 3H59A 3RRKA 1HNXJ 4GKKE 2GVDB 2VFUA 3SFGA 1AYEA 1HFEL 4WFBQ 1N36J 3E8OA 4CT9A 2IC3A 2WHOA 2OAUA 4A8XA 1U0SA 2ILZA 2BRLA 4YHHI 5HL7Q 1KNZA 3I9ZA 4DDFA 2UXBJ 3H40A 3TANA 4DX6A 4X66F 2VBYA 4ECZA 1KVKA 1VLYA 3S8SA 2XMMA 1R6VA 4X65I 4XTJA 1X4AA 3GIIA 1CQNA 3MM5A 4EMDA 1X0FA 2HFSA 1B0TA 4B3MJ 1VQOS 4LF7E 4QWDA 4DQQA 2RHSB 3A3NB 4V19J 4H4KC 4V1Ak 2W9CA 3JB9k 3RR8A 4LSZB 4OZ0A 2AZ1A 3OR2B 2M4MA 2KXHA 1FRKA 1NAQA 9ATCB 3CCWA 5DNXA 4FDFA 2IESA 2NSBA 4ICLA 3FBCA 4NMLA 4WFNQ 4LCHA 4TU8A 3JSMB 2C37B 2RH3A 2A3JA 1N33I 5KFJA 3U7JA 5C42B 4K59A 4GC6A 5LXYA 4JI4F 2P6SA 3D1QA 2XEXA 3M7NG 4AM3A 1PC5A 3M05A 2PI5A 1JLEA 3OTOJ 3FDSA 4FW5A 2ZBIA 3PACA 4FZVA 4WKRA 1GMWD 2X1BA 2W7PA 1IKXA 2KFZA 3NCRA 4DV1F 4USTA 3A13A 4CM0A 4J7CA 2V9WA 4OV1A 2RQKA 1FCAA 2BEFA 2MPUA 1REVA 2OSQA 2ZH2A 2GC8A 2NLWA 3MM9B 3G8SA 1HR0I 1Z0GA 2LA4A 1VQ7S 1Q8IA 2OUGA 3NCPA 2JEAA 3CD5A 6FDRA 3SCKE 1F0XA 2C1EB 4FWGA 3B78A 5IWAI 4BWJA 4OHVA 4ZK7M 4PRFA 3BQ2A 1NK4A 5IQ6A 2EFOA 2X7IA 3C16A 2JEJA 2WVCA 2FLNA 3BKTA 3G6YA 1CQMA 3CJTA 4X66J 3OVBA 3D28A 4C98A 2ZM6E 1S1VA 1YZ7A 4G1PA 5G0RB 3IGNA 4DV5E 4LFCJ 3CF5Q 3Q6MA 3AB4B 3P5TL 5K20B 4QYZK 4CLYA 2UXDE 4JI8F 5D78A 5E7OB 4F8RA 3NWRA 1LWCB 2W4CA 1Y5NB 2B4VA 1VQ5S 4CLSA 5D6GA 5B7WA 4X64F 4QPXA 3QSIA 4DSFA 3PRVA 3NOGA 3DRRA 3SI8A 3ZM7A 5IV3A 2HW3A 2BQRA 1HW8A 2MY8A 3AOCA 2F9JA 3QGHA 2JSXA 4HI2A 4LUBA 2FY1A 4JI4J 1USUA 4C97A 4PQAA 2CPDA 4NOHA 2VB6A 2DR5A 1RHUB 3JSYA 4NBQA 3CE8A 3J7AM 2HNDA 4DV1J 1S48A 3GIKA 1W2IA 4AQYF 3KLHB 1ZM9A 2ZH4A 3CCTA 5KFFA 1U6ZA 3CT9A 1GAOA 2Z56B 3R2DJ 1RT7A 4LFAE 2VPXB 3CIMA 2ZUGA 3E3XA 2VF3A 3P3EA 5D0RA 3HHDA 1EP4B 3T5LA 3SCJE 6FD1A 2UZAA 2AU0A 4IH5A 3ZTQA 1LW2B 2IOPA 3M2VB 3MM5B 4KAIA 1A0OB 4JI1I 1XMOF 2PNMA 1SJ1A 3D9BA 3WZ0A 2W9CB 5C0XE 2X3DA 3FCWA 5L1KA 2ATLA 1KHVA 2F9DA 4J9MA 2ADBA 3ZNUA 2JOQA 4MIAA 5T7LA 2NUHA 3DLGA 3LP0A 3OSNA 5HVHA 5JEAE 3MPDA 3VAGA 1DQ8A 4TY9A 4R5PA 3AY0A 1D8YA 4JI8J 1JLEB 4NPOA 5H9FJ 1K73T 3KG0A 2AYGA 4I2QA 4KSEB 4OYIA 4X64J 2NXEA 2BOAA 1Z0CA 2FJXA 4B3TI 2DT9A 4BWMA 4OX8A 4KRWA 1RAFB 1REVB 1AFJA 2UUAE 3DDNA 2PT0A 2W8KA 5F9LA 2N4DA 2G1DA 1N88A 1P9YA 3HHLD 2Z5BA 4HTIA 1HNVA 5C25A 3LW5C 1X4GA 5J2NB 2VQEF 2U2FA 1N4LA 4HHHA 4ID5B 5B09A 1FJ7A 1H38A 2OPRB 1UEVA 4DV3F 4AQYJ 2PDAA 1RHMB 4WBFA 2VG6B 1H7UA 4GVLA 3M30A 4C9DA 2MZSA 2HQCA 1WG1A 2MEWA 4TN2A 1F5BA 3PV8A 3FFIB 2G2OA 3V6KA 1HYSA
chains in the Genus database with same CATH topology
4WUCA 4WUBA 3PYEA 4XTJA 4X65I 1J5EE 4JI7E 4EMDA 2ZM6I 4DV3I 2HFSA 3J80C 5FWKA 4LF7E 1PKPA 3J81Q 1S16A 2BM0A 1IBLI 4X66I 3QT7A 3QT6A 4DV5I 1FJGE 4M1KA 4B3RI 4B3ME 1ZXNA 1PIEA 4UTGA 2VQFE 4JYAI 2BM1A 4USKA 3CWVA 1HNWI 2UXDI 4DV6E 1XMOE 4LFCI 2DEIA 3T1YI 4KHPE 1MG7A 4OX9I 3PYFA 4IZJA 1N33I 4JV5E 1B62A 4N3OA 1RREA 2DEJA 1Y4SA 1DARA 4LF5E 1IBKE 2XEXA 1FNMA 4DPUA 2E5LE 5LMNE 2PNLA 2IOQA 2HHHE 1NHJA 1RR9A 4JI0E 1NHHA 3OTOE 5LMUE 4DV4E 4DR3I 2ZITA 1Z0BA 4DR4E 2UUBE 1KIJA 1NZ0A 4DPWA 4JI4I 1NHIA 4PRVA 1XHKA 4K0KE 1B63A 5GMDA 4DV0I 4NXMI 2Z5CA 1XNQI 4GKJI 2F4VI 1Y4UA 4DUYE 1HR0I 1FWKA 1Z0GA 2UU9I 4DV1I 2UUCI 4LF8E 4Z7CA 2WW4A 2V8PA 5FLXC 4LFAI 4DPXA 5LL6R 5IT9Q 3WU5A 1HNZE 5GMEA 4LF6I 2GS8A 4FWGA 3B78A 5IWAI 4FWHA 4YHHE 2X36A 4HXZA 4DXLA 1EI1A 4DUZI 1IBME 1MX0A 3B82A 3HULA 1UEKA 3JAMQ 1XNRI 2X7IA 2Z5EA 2VQEE 4DPTA 4JI6E 4HY1A 4LF9E 4X65E 4DR2I 3Q1QA 3QT5A 4RPFA 2EFGA 2ZM6E 4DV3E 1ZM4A 3H4LA 3JAMC 1BKNA 4MYTA 4URLA 4X66E 3J7AG 4DV5E 3ZZUA 3Q6MA 4B3RE 4KQVA 1ELOA 3K17A 1KKHA 4JYAE 2UXDE 1HNWE 3J81C 1K47A 4LFCE 5L3JA 4DV2I 3T1YE 2ZBKB 2UXCI 4HYMA 4ZVIA 3LNUA 4OX9E 2HKEA 1I94I 4I3HA 4IZKB 1FI4A 1ZM3A 2CZ9A 2AJ4A 2HK3A 1N32I 4JI8I 3ZM7A 3T1HI 1Z0WA 2BV3A 4LFBI 1KTVA 2V2ZA 5BR8I 4P52A 4X62I 4B3TE 3LTOA 1MU5A 1USUA 4DR3E 2HHHI 4JI5I 4P7AA 4X64I 1Y6ZA 4YY3I 2UUAI 4JI4E 3LPSA 3HJCA 4DR4I 1H72C 2Z5BB 4PRXA 2R42A 3J7AM 4B3SI 4DU8A 4JI3I 1N0VC 4DV0E 4NXME 1XNQE 4GKJE 3K85A 2F4VE 1ZM9A 2CG9A 4GKKI 4DR5I 1HR0E 2UU9E 4DV1E 2CGEA 2UUCE 4R1FA 4DR6I 4NXNI 2E1RA 2O1VA 4IZJD 1HNXI 4LFAE 1VISA 2Q2EB 4LF6E 3K1JA 3ZKDA 2VF3A 1N36I 4JI2I 5IWAE 1N34I 1H74A 2OI2A 4DR1I 5A2QQ 1Z0TA 4DUZE 5IT9C 3ZZTA 4LF4I 1Z5CA 1Z5BA 1XMQI 4AQYI 2V34A 3PYDA 3PYGA 1XNRE 1A6FA 2UXBI 4WUDA 2IOPA 3J80Q 4DR7I 1OJ4A 4JI1I 4FW9A 2PNMA 4DV7I 1WUUA 1J5EI 4DR2E 4JI7I 1ZM2A 5A2QC 1H73A 1IBLE 4LF7I 1FJGI 4B3MI 3GONA 2VQFI 4Z7YA 4USMA 4FWDA 4DV6I 1XMOI 2R3VA 3WU3A 1S4EA 4DV2E 4IZJB 4KHPI 1PVGA 2UXCE 1N33E 1ZXMA 1I94E 4FN5A 1QZRA 4JV5I 3B8HA 4PU9A 3ZKBA 4LF5I 4IZKA 1IBKI 4DPYA 1N32E 3ZZ0A 4JI8E 4JG4A 3T1HE 1EA6A 3M6AA 2E5LI 5LMNI 2V2QA 4LFBE 3P06A 3F0NA 2A2DA 5BR8E 4JI0I 3OTOI 4X62E 1Z0CA 5LMUI 4DV4I 1Z0EA 2NPFA 4DU7A 3PRYA 4B3TI 4JI5E 4X64E 2UUBI 1Z0VA 4YY3E 3V5RA 2O1TA 2UUAE 1Z59A 2HFUA 3V2UC 2Z5CB 4HACB 4K0KI 1N0UA 1USVA 4B3SE 4JI3E 4ED4A 3D4JA 2Z5BA 5FLXQ 2J7KA 4DUYI 4GKKE 4DR5E 2LJPA 4LF8I 2HK2A 2A2CA 1FKAE 1U2RA 4DR6E 4HACA 4NXNE 1HNXE 2GQ0A 1HNZI 1N36E 4YHHI 4JI2E 1N34E 2O1UA 2O1WA 2V2VA 1Z5AA 4DR1E 3QT8A 1D6TA 1IBMI 1H7SA 1H7UA 4LF4E 4UT4A 1XMQE 4AQYE 1KVKA 4MYUA 2UXBE 1FWLA 2VQEI 4JI6I 4DR7E 4JI1E 3WU6A 3Q6NA 1HK7A 4LF9I 4DV7E 2HKJA 3WU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUC A;  4WUB A;  3PYE A;  4XTJ A;  4X65 I;  1J5E E;  4JI7 E;  4EMD A;  2ZM6 I;  4DV3 I;  2HFS A;  3J80 C;  4LF7 E;  1PKP A;  3J81 Q;  1S16 A;  2BM0 A;  1IBL I;  4X66 I;  3QT7 A;  3QT6 A;  4DV5 I;  1FJG E;  4M1K A;  4B3R I;  4B3M E;  1ZXN A;  1PIE A;  4UTG A;  2VQF E;  4JYA I;  2BM1 A;  4USK A;  3CWV A;  1HNW I;  2UXD I;  4DV6 E;  1XMO E;  4LFC I;  2DEI A;  3T1Y I;  4KHP E;  1MG7 A;  4OX9 I;  3PYF A;  1N33 I;  4JV5 E;  1B62 A;  1RRE A;  2DEJ A;  1DAR A;  4LF5 E;  1IBK E;  2XEX A;  1FNM A;  4DPU A;  2E5L E;  5LMN E;  2HHH E;  1NHJ A;  1RR9 A;  4JI0 E;  1NHH A;  3OTO E;  5LMU E;  4DV4 E;  4DR3 I;  2ZIT A;  1Z0B A;  4DR4 E;  2UUB E;  1KIJ A;  1NZ0 A;  4DPW A;  4JI4 I;  1NHI A;  4PRV A;  1XHK A;  4K0K E;  1B63 A;  5GMD A;  4DV0 I;  4NXM I;  1XNQ I;  4GKJ I;  2F4V I;  4DUY E;  1HR0 I;  1FWK A;  1Z0G A;  2UU9 I;  4DV1 I;  2UUC I;  4LF8 E;  4Z7C A;  2WW4 A;  2V8P A;  5FLX C;  4LFA I;  4DPX A;  5LL6 R;  5IT9 Q;  3WU5 A;  1HNZ E;  5GME A;  4LF6 I;  2GS8 A;  4FWG A;  3B78 A;  5IWA I;  4FWH A;  4YHH E;  2X36 A;  4HXZ A;  4DXL A;  1EI1 A;  4DUZ I;  1IBM E;  1MX0 A;  3B82 A;  3HUL A;  1UEK A;  3JAM Q;  1XNR I;  2X7I A;  2VQE E;  4DPT A;  4JI6 E;  4HY1 A;  4LF9 E;  4X65 E;  4DR2 I;  3Q1Q A;  3QT5 A;  4RPF A;  2EFG A;  2ZM6 E;  4DV3 E;  1ZM4 A;  3H4L A;  3JAM C;  1BKN A;  4MYT A;  4URL A;  4X66 E;  3J7A G;  4DV5 E;  3ZZU A;  4B3R E;  4KQV A;  1ELO A;  3K17 A;  1KKH A;  4JYA E;  2UXD E;  1HNW E;  3J81 C;  1K47 A;  4LFC E;  5L3J A;  4DV2 I;  3T1Y E;  2ZBK B;  2UXC I;  4HYM A;  4ZVI A;  3LNU A;  4OX9 E;  2HKE A;  1I94 I;  4I3H A;  1FI4 A;  1ZM3 A;  2CZ9 A;  2AJ4 A;  2HK3 A;  1N32 I;  4JI8 I;  3ZM7 A;  3T1H I;  1Z0W A;  2BV3 A;  4LFB I;  1KTV A;  2V2Z A;  5BR8 I;  4P52 A;  4X62 I;  4B3T E;  3LTO A;  1MU5 A;  4DR3 E;  2HHH I;  4JI5 I;  4P7A A;  4X64 I;  4YY3 I;  2UUA I;  4JI4 E;  3LPS A;  4DR4 I;  1H72 C;  4PRX A;  2R42 A;  3J7A M;  4B3S I;  4DU8 A;  4JI3 I;  1N0V C;  4DV0 E;  4NXM E;  1XNQ E;  4GKJ E;  2F4V E;  1ZM9 A;  4GKK I;  4DR5 I;  1HR0 E;  2UU9 E;  4DV1 E;  2UUC E;  4R1F A;  4DR6 I;  4NXN I;  2E1R A;  1HNX I;  4LFA E;  1VIS A;  2Q2E B;  4LF6 E;  3K1J A;  3ZKD A;  2VF3 A;  1N36 I;  4JI2 I;  5IWA E;  1N34 I;  1H74 A;  2OI2 A;  4DR1 I;  5A2Q Q;  1Z0T A;  4DUZ E;  5IT9 C;  3ZZT A;  4LF4 I;  1Z5C A;  1Z5B A;  1XMQ I;  4AQY I;  2V34 A;  3PYD A;  3PYG A;  1XNR E;  1A6F A;  2UXB I;  4WUD A;  3J80 Q;  4DR7 I;  1OJ4 A;  4JI1 I;  4FW9 A;  4DV7 I;  1WUU A;  1J5E I;  4DR2 E;  4JI7 I;  1ZM2 A;  5A2Q C;  1H73 A;  1IBL E;  4LF7 I;  1FJG I;  4B3M I;  3GON A;  2VQF I;  4Z7Y A;  4USM A;  4FWD A;  4DV6 I;  1XMO I;  2R3V A;  3WU3 A;  1S4E A;  4DV2 E;  4KHP I;  1PVG A;  2UXC E;  1N33 E;  1ZXM A;  1I94 E;  4FN5 A;  1QZR A;  4JV5 I;  3B8H A;  4PU9 A;  3ZKB A;  4LF5 I;  1IBK I;  4DPY A;  1N32 E;  3ZZ0 A;  4JI8 E;  4JG4 A;  3T1H E;  1EA6 A;  3M6A A;  2E5L I;  5LMN I;  2V2Q A;  4LFB E;  3F0N A;  2A2D A;  5BR8 E;  4JI0 I;  3OTO I;  4X62 E;  1Z0C A;  5LMU I;  4DV4 I;  1Z0E A;  2NPF A;  4DU7 A;  4B3T I;  4JI5 E;  4X64 E;  2UUB I;  1Z0V A;  4YY3 E;  3V5R A;  2UUA E;  1Z59 A;  2HFU A;  3V2U C;  4HAC B;  4K0K I;  1N0U A;  4B3S E;  4JI3 E;  4ED4 A;  3D4J A;  5FLX Q;  2J7K A;  4DUY I;  4GKK E;  4DR5 E;  2LJP A;  4LF8 I;  2HK2 A;  2A2C A;  1FKA E;  1U2R A;  4DR6 E;  4HAC A;  4NXN E;  1HNX E;  1HNZ I;  1N36 E;  4YHH I;  4JI2 E;  1N34 E;  2V2V A;  1Z5A A;  4DR1 E;  3QT8 A;  1D6T A;  1IBM I;  1H7S A;  1H7U A;  4LF4 E;  4UT4 A;  1XMQ E;  4AQY E;  1KVK A;  4MYU A;  2UXB E;  1FWL A;  2VQE I;  4JI6 I;  4DR7 E;  4JI1 E;  3WU6 A;  4LF9 I;  4DV7 E;  2HKJ A;  3WU4 A; 
#chains in the Genus database with same CATH topology
 3I87 A;  4UQG A;  1LWE A;  5LSL A;  2RIL A;  1YRU A;  4QOT A;  1S49 A;  2E5G A;  3TAM B;  3J81 Q;  5IM0 B;  4M5G A;  1XMO J;  4PXC A;  1TAU A;  5CD4 H;  4B3R I;  3DLL Q;  3IA0 A;  1ZXN A;  2A1B A;  3J81 Y;  1GNK A;  2BX6 A;  4EZ6 A;  1VC0 A;  3CD7 A;  4LF5 J;  3BPD A;  4RUH A;  4JV5 E;  1NH7 A;  3RR7 A;  2MQN A;  4EK2 A;  4TYA A;  2OPS A;  3M8Z A;  4C8Z A;  4IFD B;  3I31 A;  3UCG A;  1URR A;  4RL1 A;  3TAQ A;  1FX4 A;  1XNQ F;  4DR4 J;  1WKL A;  2VDH A;  2XTJ P;  4B3S F;  5L1L A;  4NEY A;  3UDE A;  4WZM A;  2WSC C;  2RRB A;  4DPW A;  2HND B;  3BPS P;  4LF6 F;  2NN6 F;  4ZVG A;  1QY7 A;  4P74 A;  1R0A B;  3M8S A;  2W2M P;  1R0C B;  2LQ9 A;  3K5O A;  1IQT A;  4QIW D;  2ROP A;  4NXM I;  5KFC A;  1VQ4 S;  2FLP A;  1RT7 B;  2W24 A;  3DLK B;  2CJX B;  2Z57 B;  2HEK A;  1EZZ B;  2AMC B;  2QV6 A;  4G65 A;  5C24 A;  5IT9 Q;  3FCH A;  1CS4 A;  2RU9 A;  1C0U B;  1P27 B;  2KJW A;  1WOO A;  2VQE J;  1KLN A;  3BDE A;  5FDL A;  5KFO A;  5IT9 Y;  3BO4 A;  5JEA B;  1JXV A;  2DNK A;  4DV3 J;  1WF2 A;  1SKU B;  1AW0 A;  3CIZ A;  5AJ3 F;  3JYT B;  4FW6 A;  3IP0 A;  1RAI B;  3TUJ C;  5HSP A;  1RTH A;  1HIY A;  4B02 A;  1UVN A;  3UCU P;  4RNM A;  2RDJ A;  4DN9 A;  3PW7 A;  4KJI A;  4ECU A;  5T7L B;  3HO1 A;  4K4Z A;  5DRK A;  1UWB A;  4F50 A;  1FT8 A;  4OI6 A;  1RT3 B;  3IXQ A;  3J81 C;  4EBD A;  4KT0 C;  3PX0 A;  4LFB F;  4Q43 A;  4P73 A;  3EUN A;  2P2C B;  2Q3P A;  5FD1 A;  1OWX A;  3ZTO A;  4X4N A;  3G71 S;  3F44 A;  1RWO B;  3JTO A;  5IXU A;  1O6X A;  5LJ3 Y;  4DQR A;  3H4B A;  1N32 I;  3PR4 A;  4LT6 A;  1R6Y A;  3S6E A;  5DLF A;  2LXU A;  2R8G A;  3DRS B;  2RML A;  2YWH A;  3M2R B;  2RT3 A;  4I2P A;  4DR3 E;  2RNE A;  3T5J A;  1FK9 A;  1XNQ J;  8AT1 B;  4PCQ A;  2Z5B B;  1HNV B;  5C25 B;  2DGV A;  3I5C A;  3GG0 A;  1N0V C;  3IWN C;  4U9R A;  4ED6 A;  3CCE S;  3MMA A;  3L7U A;  3OLA A;  4IFY A;  3GYX B;  3LP1 A;  2CGE A;  1AT1 B;  1Y00 A;  4DR6 I;  3ZZO A;  2QA2 A;  5L9X A;  4J9V A;  3T9N A;  2YWE A;  4OI3 A;  3ZKD A;  2KHD A;  1U1R A;  3OJS A;  1RDR A;  1Z0T A;  3HPO A;  5IT9 C;  4F3M A;  4PR6 A;  1S77 D;  1U26 A;  2ZFH A;  2EKY A;  5A2Q C;  1HNW J;  4IO1 A;  3TA1 A;  4DSE A;  1IWA A;  1AZS B;  2KVI A;  4ZIV A;  1RAG B;  5AJ3 J;  4RO0 A;  2F8E X;  3EIC A;  4MTP A;  3QGG A;  5D3G A;  4F4K A;  1CJU B;  3PNI A;  3AJD A;  3AA9 A;  1N6Q A;  3I32 A;  1N33 E;  4DQP A;  2RS8 A;  3FMB A;  2DXF A;  3R7S B;  2W4P A;  2XSJ A;  3MEE A;  1I5O B;  3FEY B;  4LFB J;  2Q6B A;  2QYG A;  3G8T A;  4DJB A;  1EA6 A;  2J6U A;  1KTQ A;  4KGV B;  1X8D A;  2AEM A;  4ZVU B;  2C3U A;  3F0N A;  3PEJ A;  1WKJ A;  1NJI T;  4LIW A;  4X62 E;  2VOD A;  1UA1 A;  5LMU I;  4HYK A;  3Q8V A;  3OL8 A;  1N8R T;  2F4V J;  3U1Y A;  1JKH A;  1HHS A;  4FXD A;  2UU9 J;  3BQ1 A;  2YX1 A;  2QZ8 A;  2HG4 A;  4KO0 A;  4K0K I;  4FF2 A;  4M5J A;  5D0G A;  4G6V B;  4JI3 E;  2YKQ A;  1ICE B;  5DLG A;  3Q8P B;  1S9E A;  1LW0 A;  5C24 B;  4DR5 E;  1T7P A;  3VAJ A;  3TA2 A;  4M5D B;  3TEH B;  1U8W A;  2PA3 A;  2BA9 A;  3GG1 A;  1ZAX A;  5FDL B;  4Q2L A;  5D0E A;  3MCO A;  1Z5A A;  4P2X A;  5LM7 E;  1RKJ A;  4Y6I A;  3D1O A;  3IRX A;  3ONQ A;  4JI6 I;  4DR7 E;  3KUG A;  1RTH B;  1HK7 A;  3PXG a;  1R8A A;  2HKJ A;  2QA4 S;  2XSF A;  1J5E E;  2CPF A;  4M5M A;  2L41 A;  3PS2 A;  5M2P A;  3EMT A;  3Q89 A;  3CDJ A;  4WIQ A;  4MU0 A;  1IR2 A;  4TQR A;  1YJ9 S;  4JV0 A;  1UWB B;  2PO2 B;  4O4G A;  4ES1 A;  1LEO A;  1RCX B;  1TTH B;  1YIT S;  4USH A;  4ECT A;  4DWI A;  2CNN B;  4NYP A;  3NMA A;  2E7W A;  3K59 A;  4UZB A;  3UDV A;  2W9B A;  1VRT B;  3VF0 B;  1QDU B;  4ZVO B;  3UCZ P;  1P42 A;  2HLU A;  4RNN A;  1Y4S A;  2PMW A;  2MZ1 A;  3MMC A;  3HFV A;  4QPT A;  3SDE B;  4OX6 A;  3MCM A;  5LMN E;  3KLF A;  4I2P B;  4CO0 A;  3L7P A;  1FK9 B;  4ZPV R;  1NSA A;  3FVY A;  2AJF E;  4DV4 E;  4FNI A;  2E1M C;  2J0S D;  2XO7 A;  4OX7 A;  4CLU A;  2BR0 A;  3QRQ A;  1RWV B;  1XHK A;  4DBQ A;  4NXN J;  4K2X A;  3T6B A;  4IFY B;  1TK8 A;  1WDT A;  3LP1 B;  4DUZ F;  3O2I A;  5IS2 A;  1RJJ A;  5AXM A;  2F1D A;  2CQC A;  1RT6 A;  4Z7C A;  2BR2 A;  1VQK S;  3EGN A;  2V8P A;  3HSZ A;  4EO8 A;  4URG A;  3MTJ A;  4DPX A;  4QU6 A;  2DYA A;  1R8B A;  1UDO A;  5KFX A;  2XS7 A;  1UA0 A;  3DI6 A;  3PHT A;  1Q95 G;  1TKT B;  2D3U A;  2Z4P A;  3FSX A;  4DCJ B;  3V4I A;  3BM7 A;  2BXJ A;  4J90 A;  3A8J A;  2XY7 A;  4ZN3 A;  3HX9 A;  3GCM A;  3RJM B;  2CPX A;  4DV2 F;  8ATC B;  4IQM A;  1UVL A;  1BKN A;  2OP5 A;  2DCL A;  2B7C B;  2R7R A;  3K17 A;  2B56 A;  2F7V A;  1A9N B;  2FVQ A;  3KWM A;  2B6A B;  2BA1 G;  4OYP A;  3MUM P;  4DFJ A;  1B3T A;  4LSN A;  2HHW A;  2AF6 A;  3L7O A;  5L46 A;  3Q24 A;  3T6J A;  2QO3 A;  3PRB A;  4JI5 F;  3MM7 A;  4MK9 A;  4J9L A;  1RWK B;  4YR0 A;  2I8E A;  4M63 A;  2HWI A;  4EBC A;  1K44 A;  2CAD A;  2UP1 A;  1KTV A;  1RUS A;  3QQC D;  2JFK A;  1RAC B;  4B3T E;  3DGV A;  2W2N P;  1C2P A;  3HVT A;  1JKH B;  3BRE A;  2DNZ A;  1TFY A;  2KVQ E;  1JLB A;  3RU0 A;  5DQI A;  2PD1 A;  4DR4 I;  4I67 A;  3GIM A;  1S9E B;  1S6Q B;  3M8W A;  4DV0 E;  1WOR A;  4FXV A;  2V2K A;  2CG9 A;  3M8P A;  3NY0 A;  3HHN B;  5K8N A;  5D4P A;  3W5X A;  4DV7 F;  4IZJ D;  2RSQ A;  4DUZ J;  4L3K A;  1N34 I;  2DNN A;  3IRX B;  1S97 A;  3W5Y A;  2EVZ A;  3BKU A;  5F0W A;  2GQQ A;  4IOB A;  3PYD A;  3R3T A;  2ZKT A;  3H42 A;  1M5O C;  2AGP A;  3GJT B;  4DQS A;  4FW9 A;  4DV6 F;  2VOO A;  3DLE B;  2JHE A;  2DY1 A;  2WOM B;  2AZ3 A;  4DS4 A;  1UEU A;  4O4G B;  3CCR S;  3KMS A;  4B9U A;  2DHA A;  2YPZ A;  3DC2 A;  2XI2 A;  2V4J A;  1IKY A;  4IRC A;  3W2W B;  4P7V A;  4DV2 J;  2B43 A;  4DLE A;  1R43 A;  4ELU A;  3RBX A;  2EFQ A;  3KJQ B;  2W9B B;  2E5L F;  2FVR A;  1FER A;  2XI3 A;  2ZC4 A;  3H0P A;  2FVC A;  2O67 A;  5MAO A;  1TUV A;  2KYZ A;  4I64 A;  1CEZ A;  2ZDP A;  4B9L A;  1ZH5 A;  1QAX A;  3KLF B;  3SYZ A;  3DCA A;  5IT0 A;  2X1F A;  3CUL A;  1WWH A;  3BV8 A;  4B9T A;  3LP2 A;  1UVM A;  3WHI A;  2VBW A;  4JI5 J;  1NU4 A;  2PSZ A;  3MHY A;  7AT1 B;  4BDP A;  4N76 A;  5IC6 B;  2G0J A;  2KT3 A;  3N6N A;  2R7U A;  5EGY A;  1RSC A;  3PIP Q;  3KJV B;  4QWC A;  4XPC A;  3V5R A;  1XBW A;  1UCN A;  5RUB A;  3V2U C;  1N5T A;  1FKP A;  2DNO A;  1N0U A;  1RWU A;  1USV A;  1PGZ A;  4PQU A;  1RT6 B;  3MUT P;  5KG7 A;  3AA8 A;  2BR2 B;  3Q8U A;  1RTJ B;  1NSK L;  4TLQ A;  2BAN B;  4M8L A;  2GX8 A;  4QU7 A;  5JXS A;  1U2R A;  4HAC A;  3G6E S;  4LF9 F;  2MSS A;  1HNX E;  3ISZ A;  1S5Z A;  2B9Y A;  3DI6 B;  4LMZ A;  1LWF A;  2YQ0 A;  1HMV A;  3DM2 A;  1YJN S;  3CDB A;  1N36 E;  1U25 A;  3CCJ S;  4G3I A;  1DFD A;  3HDS A;  1DLO A;  3GJS B;  4DV7 J;  2DO0 A;  2ZOM A;  1LV5 A;  2UXB E;  5ITH A;  4ALZ A;  3PW0 A;  2C2Z B;  4KKO B;  2FVP A;  2HSE B;  3KRN A;  2I9S A;  3T1Y F;  2XC9 A;  3O6Q A;  1RT5 A;  2N7C A;  3DLJ A;  3Q83 A;  1T03 A;  4OX9 F;  2ASD A;  4DV6 J;  4B3M E;  2M88 A;  2RE1 A;  1HNW I;  2YTC A;  4LSN B;  1TKD A;  4IOA Q;  4BC7 A;  3EXY A;  3DHW C;  3K5N A;  5DGA A;  5J2Q A;  5ETP A;  3PHE A;  1U1Q A;  1SC1 B;  1HAR A;  3CDU A;  1YK9 A;  4CM2 A;  1VJW A;  1CC7 A;  3GU0 A;  3L9Z A;  2E5L J;  1DAR A;  4Y65 A;  1FVQ A;  1TV6 A;  2I5J A;  4ZLN A;  4CZC A;  1IBK E;  1VS3 A;  2OH2 A;  2Y1I A;  4DPU A;  3R5B A;  3IAS 9;  4MDT A;  3HVT B;  3LWM A;  1J27 A;  1XEZ A;  3K57 A;  1UET A;  4YOE A;  1JLB B;  3OTO E;  1SIW B;  4L6V 3;  1N5S A;  2ZIT A;  3JSB A;  3GFX A;  2ZC3 A;  4WJB A;  1S0M A;  2BE9 B;  2N4C A;  3Q23 A;  4IRK A;  2JC0 A;  2K2P A;  2EK6 A;  2WVB A;  2VBX A;  2CQG A;  2ROE A;  3DOM A;  2XHC A;  5HMZ A;  2E9Z A;  4ZPC A;  4UUX A;  2F4V I;  1VOM A;  4WII A;  4A8S A;  5B08 A;  2UU9 I;  3L7Z A;  2LFV A;  3DXS X;  1RT1 A;  2WW4 A;  3MFH A;  5AXN A;  4GVB A;  1XMQ J;  1J5O B;  3THT A;  1S10 A;  4DR2 F;  3J7Y I;  2N3O A;  2QGF B;  1B0P A;  3RB0 A;  4HXZ A;  4DXL A;  3GP9 A;  3A8I A;  3IR6 B;  1WHX A;  3MF5 A;  4LF9 J;  2IY5 B;  2HQF A;  4P2M A;  2VJV A;  4A8O A;  2LLZ A;  1F9H A;  2MQO A;  4CO1 A;  2UXC F;  5L1J A;  1IKY B;  3UDC A;  2VC1 A;  4A8Q A;  1TL1 B;  4X66 E;  1FRX A;  2MLY A;  4ZHR A;  3T1Y J;  3W61 A;  4RBU A;  2DIV A;  2JFD A;  4L76 A;  2OD4 A;  2GHV C;  1HWU A;  1Q1K A;  2HHT A;  4OX9 J;  4LFC E;  4OI1 A;  2GO8 A;  1XMB A;  2FZC B;  2ZBK B;  2WRM A;  4K8R A;  4ED0 A;  4I3H A;  2FY8 A;  3BH7 B;  1FI4 A;  2FC9 A;  3SZ2 A;  4Y2M A;  1AB8 A;  3G2X A;  3VHQ A;  1JK9 B;  3LP2 B;  5KFR A;  5G4D A;  2WZ1 A;  3CUN A;  4AE5 A;  5KFY A;  2M9K A;  1RU1 A;  3NMR A;  2R2U A;  1N5Y B;  4F25 A;  4J9R A;  2J0X A;  3H2L A;  4I1T A;  3H2V E;  2R7Q A;  3C66 A;  1FKP B;  3CJ5 A;  2JNJ A;  4JI4 E;  4PQU B;  2BKO A;  3LPS A;  5CYJ A;  2FJW A;  4LF8 J;  4FVM A;  3MWB A;  2VG7 A;  3HF5 A;  1HNZ J;  4OJ1 A;  1LWF B;  2MHE A;  4DV1 E;  3ZO7 A;  5KFV A;  1IR0 A;  4R1F A;  4NXN I;  1QUV A;  2R7T A;  2O1V A;  2GJF A;  1CC8 A;  2MQL A;  4ECR A;  4JI7 F;  2G4B A;  1DLO B;  2RKI B;  3TX8 A;  1MN7 A;  4C3K A;  2CDR B;  1FDA A;  3ZNJ 1;  4I7F A;  4WP8 A;  1EKS A;  5B0C A;  3D1H A;  4DR2 J;  4J9K A;  2DB1 A;  4ZMM A;  2H1Y A;  1T03 B;  2BA0 D;  4B08 A;  2OPP B;  4GO7 X;  2LQ5 A;  1H73 A;  3IR7 B;  3MPV A;  2OFH X;  4YQW A;  4ZVS B;  2AYM A;  3AD8 C;  2GIQ A;  4F2S A;  4UF4 A;  1RZM A;  1YJT A;  5JMN A;  2UXC J;  1C1B B;  4DLG A;  3QFW A;  3E01 A;  3VAK A;  2LQ8 A;  3VAH A;  1T9V A;  4CO3 A;  2DHS A;  4KHP I;  4Q0B B;  3QAU A;  1ZXM A;  1FFS B;  1EQM A;  4FF4 A;  2I5J B;  3C15 A;  1FRI A;  2CQI A;  4RW6 B;  1RT4 A;  4DI6 A;  2M7S A;  1WD6 A;  4FW7 A;  1MW7 A;  4GC7 A;  3NGS A;  4JI8 E;  1KQS R;  2M70 A;  2GGP B;  2DR9 A;  5GAG I;  3FRZ A;  3IMQ J;  1CG2 A;  2C2M B;  4OJG A;  1OQ3 A;  1YX2 A;  1MWZ A;  1R8C A;  2NPF A;  3HHE A;  2IIH A;  4X64 E;  2YVS A;  4OYA A;  1MU2 A;  5KT5 A;  3ENA A;  2ZWP A;  2V8H A;  2