1VISA

Crystal structure of mevalonate kinase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
b'SLIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate kinase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 106
structure length 314
sequence length 314
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1visA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1visA01
2HK2A 1PVGA 4JYAI 1ELOA 2V2QA 4FWHA 1H7UA 4LF5I 4JI1I 2V2VA 4URLA 1PKPA 4JG4A 4GKKE 4P52A 2UUCI 1Z0WA 1NZ0A 1BKNA 1HNWE 4PRXA 4ZVIA 3D4JA 3V2UC 4B3TE 1A6FA 3ZM7A 2A2DA 3QT7A 4HY1A 4DV7E 2R42A 2UUBI 3PYEA 2X7IA 1FWLA 1I94I 3J80C 1Z0VA 4YHHI 1Z0EA 4JYAE 4Z7YA 4DR4I 4P7AA 4K0KI 4LF5E 1HR0E 4JI1E 2ZM6I 5L3JA 2HKJA 2X36A 1NHHA 2UUCE 3JAMQ 2ZBKB 4B3SI 1XNQI 1FKAE 2E5LE 4DR3I 4HXZA 1IBLI 1H72C 2HFSA 1S16A 1B62A 1OJ4A 4PU9A 5A2QC 2VQFI 1N33I 4DR6I 1H73A 3ZZTA 4JI4E 1U2RA 2UUBE 2AJ4A 2BM0A 3ZKDA 1I94E 4JI7I 4YHHE 1ZM4A 2XEXA 4DR4E 4K0KE 2UXDI 4B3RI 5IT9C 2ZM6E 4DPXA 3QT6A 1S4EA 2Q2EB 4HACB 4LF4I 4B3SE 1XNQE 4DV5I 5GMDA 1ZXMA 1XHKA 4LF6I 4OX9I 4DR3E 2VF3A 4X64I 1IBLE 1RREA 4FN5A 4DPWA 1FJGI 3LNUA 4JI8I 2CZ9A 4LFCI 2VQFE 1N33E 4DUZI 4DR6E 5LMNI 1XMQE 2BV3A 3ZZ0A 1DARA 4JI7E 3WU6A 4DV2I 3B78A 4DUYI 3QT8A 2A2CA 4MYUA 1N32I 4PRVA 4B3RE 4DV6I 4DV3I 1KKHA 4LF4E 1ZM3A 1MU5A 4DV5E 2LJPA 1QZRA 2DEJA 4Z7CA 3F0NA 4UT4A 4LF6E 4OX9E 4X64E 1N34I 4JI3I 3K17A 1FJGE 4JI8E 2GS8A 4DV4I 4LFCE 1MG7A 4DUZE 3J80Q 4MYTA 2F4VI 5LMNE 4LF9I 2OI2A 2UXCI 3LPSA 4JI5I 1ZXNA 4DPTA 4FW9A 4LFBI 4FWGA 4DV2E 1IBMI 5LL6R 4DUYE 3QT5A 1B63A 1N0VC 3LTOA 1IBKI 1N32E 2DEIA 3H4LA 4JV5I 4DV6E 1HNXI 5FLXC 4DV3E 4ED4A 4NXMI 1UEKA 4USMA 1Z0GA 1XMOI 3PYGA 1N34E 4DR2I 4JI3E 1VISA 1HNZI 1ZM2A 2ZITA 4DV4E 4JI2I 4DXLA 1Z5CA 2BM1A 2F4VE 4JI6I 1NHIA 4LF9E 4JI0I 5LMUI 4DV1I 4JI5E 1EI1A 3B82A 4LFBE 4EMDA 5IT9Q 1Z0CA 2HHHI 2UU9I 1J5EI 4YY3I 1IBME 1IBKE 4GKJI 4M1KA 4X62I 1XNRI 4JV5E 4X66I 4DR7I 1HNXE 2V8PA 2E1RA 4NXME 3PYFA 3CWVA 3J7AG 2R3VA 1XMOE 4DR2E 3WU5A 4UTGA 1KIJA 1HNZE 1FWKA 4JI2E 1H7SA 4DR5I 2WW4A 4JI6E 4JI0E 5LMUE 4AQYI 4DV1E 2HHHE 2UU9E 1J5EE 4YY3E 1Z5BA 3Q1QA 4GKJE 1N36I 2V2ZA 4HACA 4KQVA 4X62E 1XNRE 4B3TI 3J7AM 2UXDE 4X66E 4X65I 4DR7E 4LFAI 4WUDA 2UXBI 4DPUA 4LF7I 4NXNI 3J81C 2HK3A 3WU4A 4DR5E 1HR0I 4B3MI 1EA6A 1FI4A 1D6TA 1MX0A 4AQYE 1ZM9A 1RR9A 4DR1I 4KHPI 1Z0TA 3GONA 5FLXQ 2E5LI 3WU3A 4USKA 1WUUA 1N36E 4WUCA 4X65E 4I3HA 1Z5AA 4LFAE 4JI4I 3T1HI 2UXBE 3M6AA 5A2QQ 4LF7E 4NXNE 3PYDA 2HFUA 5IWAI 4B3ME 2UXCE 4R1FA 4DR1E 2J7KA 4KHPE 2V34A 1KTVA 4FWDA 3ZZUA 3JAMC 3OTOI 3V5RA 5BR8I 3K1JA 2EFGA 1K47A 2VQEI 1XMQI 3T1HE 3T1YI 3HULA 4LF8I 4DV0I 2UUAI 5GMEA 1Z59A 4DPYA 5IWAE 4XTJA 4DU8A 3ZKBA 4GKKI 4RPFA 2HKEA 2NPFA 3B8HA 1HNWI 1KVKA 1H74A 3OTOE 5BR8E 1Z0BA 1FNMA 1NHJA 4WUBA 3J81Q 4DV7I 2VQEE 1N0UA 3T1YE 4LF8E 4DU7A 4DV0E 2UUAE 1PIEA 4HYMA
chains in the Genus database with same CATH superfamily
4WU2A 4AXJA 4DX6A 3L9ZA 3AD7C 1H7UA 2O3ZA 2CNNB 2PN6A 1Q8LA 1PKPA 4O0IA 4GKKE 1N52B 1O5JA 1X31C 3FSYA 1S9GA 4OZ2A 3D4JA 4IO9Q 7AT1B 4JI1J 2ZHOA 3KJFB 2R7QA 3ZM7A 4DCPB 3NG8A 4HY1A 1FJEB 1CJVA 3QGGA 5DZ6A 2UUBI 2U2FA 5CYQB 3LH2S 5DQHA 4M5DB 4ZLNA 4MU4A 3T3FA 1AFJA 2CQCA 2FJXA 4BDPA 2Y0BB 4OHVA 1RKIA 3ULHA 4J9RA 2RVJA 5BXIA 1FK9B 1WACA 2JEBA 2KHDA 4B17A 4NYOA 1GXLA 1S6OA 3MM6A 1FKPA 1U48A 2HFSA 2J6SA 5T7LA 2E5JA 3OVAA 3EICA 2Y1JA 2DNGA 4L76A 4OI4A 2CADA 5KT5A 1XNQF 5D4PA 3SSQA 4CRJA 1ULRA 2MDAA 3GFZA 2DTJA 2YKQA 2DPIA 1FX4A 3Q24A 1N33J 1Q7YT 3AA9A 1O0PA 2PNMA 2KI2A 2QN6B 1B0VA 2DPJA 1KWMA 3M8SA 4X64I 4ECZA 2BE9B 4BWJA 2HRUA 2ADCA 2CZ9A 4B3RJ 2ZOGA 2WSCC 4M5LA 3GFHA 4C8LA 2UV8A 4YQWA 2VPZB 5CXTA 5EHHA 3NL0A 1FVQA 2IM2A 1LWFA 1SCJB 1Y7PA 2G9OA 3I6PA 3G96A 3LP2A 1OQ6A 2GAGC 3HD1A 5K9FA 4Z7CA 3KLEB 4PABA 2CUYA 3K85A 2L3MA 4B9SA 3T6JA 5A6WA 1TK0A 1F2HA 2V0NA 2J0QD 2MKSA 4JI5I 1ZXNA 1D0EA 4RU2A 5EWEA 1U02A 4OO1E 1NK4A 5LL6R 2OKQA 1N0VC 4DV4J 2C38B 1PILA 2AZ3A 4TNOA 2RF2A 3CULA 2Q1LA 4KBIA 3H59A 4IUFA 1DQ9A 1OPZA 3S8SA 3CCRS 1WKJA 3SDEA 1Z0GA 1RTDB 3PYGA 2LDYA 3CJKA 2FVQA 4DFKA 2XLKA 1RT7A 2ROGA 2DRDA 3NLCA 4B3SF 2C22A 5D0EA 5CYMB 5JEAA 1IBLF 1IBME 1HNZJ 3DOLA 3JTPA 1NJXA 3PFEA 1FESA 4CO5A 3TZXA 3CO9A 1X9WA 4NXME 4IOCQ 3VHQA 2HHHJ 2LU2A 2MPUA 3JSRA 3IRXA 2QO3A 3TVZA 3WU5A 4ED3A 1MW7A 4I68A 2QFIA 2M7SA 2W2PP 1KN6A 1XBWA 3KLHA 4IRKA 2UV8G 1LK7A 3LAMA 4WFNQ 2H4YB 1K9MT 1FDAA 4RZRA 3PRYA 3RW7A 4DR5J 3ADAC 3O8WA 3E01A 1Y5LB 3NOCA 2RQMA 4DLEA 4LFAI 2OPSA 3IA0A 4NZ7A 1YJNS 1NK7A 1LK5A 3CJ4A 2E9RX 3GJSB 4N7TA 4OZJA 1BHNA 5JUMA 1KC8T 3IM8A 1B64A 5FIIA 4E2FB 1RWOB 3DOKB 3GCMA 3WC2A 1SQGA 5KG5A 5IXUA 3MCSA 3OLAA 3AQPA 3CJ5A 1WEZA 1BC6A 4USTA 3P3EA 2GO3A 2FDNA 4RWWA 2BOAA 3JSYA 3VALA 1XJWB 3BDPA 5IWAI 4UOFA 2F65A 3KLIA 5KFOA 4JI4J 1QAXA 4LR7A 1L3VA 1ZTWA 2EPIA 3AB2B 1WNEA 2HPUA 2AT1B 2YKNB 2BJ9A 1S1XA 2DGOA 1C0UB 4ICLB 4LSLA 2MQMA 1T9VA 1C4CA 3HT3A 2ADBA 4F0HA 1DTQA 3RB4A 1U8WA 2UVRA 3T1YJ 3A8KA 4DV0J 3US5A 2ZFHA 1Q8KA 1UVLA 2DNZA 2DJWA 1OO0B 3KK1A 3BSCA 2MB0B 3NEKA 4UOGA 5BR8E 3FUYA 4AQYF 1HWJA 4ZKAA 1S49A 3TAMB 3G9CA 4CT9A 1HBMA 2ZH4A 4G1QA 5JVGQ 3CC4S 4KE5A 4QWEA 2APOA 1IWAA 2V4QA 2JEFA 2YNIB 3THPA 2AU0A 3QLHA 4USHA 1WF0A 5LM7E 5K8OA 5LSOA 2HNYB 4CO1A 2M9KA 3ZFVA 2CNOB 3GMGA 2CPXA 4B3MF 1TVRA 2F40A 4CO2A 2FD2A 3LWMA 1VR6A 3J80C 4HHUA 2YNFB 4Y3CA 3CF5Q 2IYIA 2G2YA 3PG9A 3C2PA 2BR2B 4R5PB 4K0KI 3OHBA 1HWKA 2LXIA 2IMOA 3FFIB 3T1HF 2XGPA 2RRNA 5HVGA 3BBFA 2HG4A 5ETNA 2HWIA 4WP9A 1MWQA 2BE2A 1Q8IA 4P6QA 2ZM6J 4KFBB 2C2ZB 4ELTA 4H54A 2XQCA 3DXBA 2WB4A 4DR3F 2VASA 2WK4A 4ISAA 1X4CA 4R8UB 4DF8A 3EZ5A 3TAQA 2QRRA 4JI2J 3OL6A 4K4ZA 2RB7A 4IOBA 2CNLB 1OPIA 4AD6A 3AOCA 1RT2A 4KSEB 2R2SA 4LF6I 1ZAWA 3PKYA 4PXEA 4EGLA 1RREA 3H25A 5DQIA 3I0RA 1V6HA 1P27B 4L6V3 1W25A 3QJLA 1VRQC 2PO0A 2OFGX 4Y65A 1TUVA 3NWRA 2EFPA 1FA0A 4K4YA 4MYUA 4C0OC 3OR1A 4DV7F 5C0XE 3M9NB 4NLPA 3D1OA 3MDFA 3D9BA 3DU6A 1DURA 1N36J 1MG7A 4DUZE 2J6TA 2RE1A 2FVSA 3ITHA 1NSAA 1VJQA 4FWGA 3RR8A 1FRIA 3DRRA 2DIVA 2DEIA 2GA7A 4D3HA 3N4WA 3B4MA 1KP6A 4HI1A 4MK9A 3AOAA 3OV7A 1A0OB 4LIWA 3ILIA 3ELHA 4NZ0A 2EK6A 2KH9A 5E3CA 4O3QA 4C8OA 1UVMA 5DS7A 1HQEB 4FP9A 4LRFA 2BOPA 3FJ2A 4JI2I 2BM1A 1JLCA 1NHIA 4I0WA 2ZC3A 1NJZA 3KLGB 1NDLA 3TJAA 1DJ0A 2AX1A 1IBKE 3QO9B 4DR6F 4ZITA 2PNZB 1N5QA 5A2QY 4WK3A 4USWA 1S1VB 1OYRA 1VQLS 3VR1A 1RLDA 1WF1A 4Q2LA 1JKHA 3HF5A 2HZCA 5KG3A 3RUBL 2HZVA 4OZ0A 2D69A 2B6AB 2JE6B 2HAIA 1B7YB 5D78A 1XN9A 1LFPA 3FSIA 3Q1QA 2KM8C 3CMAS 1N36I 2UXDE 2GHVC 2CQ0A 2MGZA 3GTYX 5DRPA 4X84A 4WFZA 1UMJA 5CHCB 4USIA 2DGSA 2K1RB 2MKHA 4M5NA 2IOPA 4YS2A 3KHHA 2J9DE 3Q8VA 2I9SA 1T95A 3MECA 3D0IE 3WC0A 1DBDA 3J80U 4LRCA 2NPIA 4QWDA 3D2WA 5BYQA 1FXRA 2KO1A 2NUUG 2C39A 5E3RA 1FVSA 4CLPA 3NNCA 4KHPJ 4I7FA 1QY7A 4WXOA 4ZPBA 4F4AA 2V63A 1S1TA 3PW5A 1YX2A 1RAGB 1Q0NA 2GJ2A 2LQBA 4BA2B 1KONA 3QAUA 2YKAA 2J7KA 2QL9B 2RAQA 3Q8RB 4ZMMA 1A9NB 2ZJQQ 5HQMA 1SPBP 2AE8A 4JP8A 1AA1B 3DNCA 4Y2KA 3G8SA 5A8WA 1VQMS 2W9BA 2B8QA 1U0HA 5L46A 4PG4A 1JX4A 1RADB 1XNQJ 1X4BA 3MTJA 4DL0C 5J2NB 5F9LA 3M2RB 3IC1A 3K5NA 5F8JA 3OSPA 3NCRA 1KSPA 5HBMA 4ZA1A 4RNHA 2VDHA 1SXLA 3CCZA 3I82A 3OXLA 1E6YB 2XM3A 4N76A 4QBUA 3TO8A 4YB7A 5F8MA 1AUDA 1P6TA 1HWUA 5KG2A 4RBVA 5DM7Q 2PSZA 4FW3A 5D77A 2BZ2A 1NHJA 1S9GB 5EDWA 5ETTA 2VQEE 1VBXA 1N0UA 4BCAA 3LF0A 1X5OA 3Q6MA 3KUEA 4LF5I 2PO2B 3EXYA 5KFSA 1YJWS 5HQ8A 4J9PA 2J8AA 2D3O1 3PJWA 3DYAA 3V2UC 3UN3A 2CPEA 3MM6B 1IKXB 4I67A 1OYPA 3K7RA 4ZPAA 2AYGA 7FDRA 1F3FA 2X51A 2O1PA 1N54B 3DRYA 3DRPA 2DNNA 5KFPA 2P9CA 2VONA 1BY9A 4X4RA 4A8KA 5KFLA 4ID5A 3AHPA 2UUCE 1XNQI 3UR0A 3J7A1 3MM9B 4YUDA 5IT9U 1V5IB 1XR7A 5L1LA 2LLZA 2V9KA 3MR7A 1T9TA 4DMZA 5CD4A 1JQGA 4B3SJ 3G87A 5F8HA 3TWZA 1F9HA 3TUIC 2OAUA 2JVRA 3VGUA 1I94E 4OYWA 4J9UE 3RB6A 1IBLJ 2KZZA 2XEXA 4DR4E 3RW6A 1XTZA 3HSZA 4Q44A 1Q8BA 4NA1A 1RHUB 4KTQA 2ATLA 1IKVB 2BKOA 2NN6F 3O2IA 2RNEA 3Q2TC 1HNVA 1TL5A 4U8YA 1U6FA 1FTCA 4N5SA 3GFYA 3LNUA 3M8PA 6AT1B 4ECVA 4ZCIA 4NRTA 3W2VA 3QZ8A 5C2GA 3MF5A 3UNGC 3ZZ0A 1S7IA 1UEVA 3HJCA 4RNMA 1HI8A 2FY8A 1HK7A 2CZVC 3S6EA 1Y4UA 3SSSA 2BA0D 5KT6A 3A3NB 1TL1B 1NDPA 2Z30B 5KTQA 3FKBA 2LJPA 4DV5E 2WB1D 2GW8A 2RF2B 1ZA2B 1JXLA 2IAJB 2N82B 3QIDA 2VESA 3LAKA 4JI3I 4CTAB 4Y34A 3K17A 1FJGE 2LKZA 2F9DA 3SDEB 3G86A 4F4XA 1RU1A 3KJNB 4F4KA 3LPSA 4OI1A 2KT3A 2M88A 5KFBA 5JEAE 2QA4G 2SXLA 4WF9Q 4DUYE 2W7PA 4F3QA 1X4DA 5DDQC 3AA8A 2F4VJ 1FX2A 2HW3A 4DQPA 4LCFA 2OUGA 2I2YA 4Q2MA 3D7SB 2LEPA 2KM8B 5IC6B 3PHTA 2FVPA 3HKWA 3DLKA 1U1KA 1CULB 3CE8A 4I6YA 1RBAA 4NXMF 3DMJA 4I6WA 3LGMA 1MN9A 3ZO7A 5F8GA 1EI1A 2DB1A 4DL4A 4LPFA 2ILZA 4FNIA 4ITSA 2DK2A 5DDOC 1AB8A 3MPVA 2U1AA 4DFJA 4X4NA 4C48A 2J76E 4KT0C 5LMUJ 2JEIA 2RS2A 2GQ0A 1C4AA 2R3VA 3TQEA 5K36D 2DGWA 1YG0A 1OWXA 3DN9A 2ZVIA 4H4KA 2MHEA 1V9OA 3P4UB 2AP6A 2DITA 1JWWA 3IMQJ 4N8OA 1HD0A 1CQNA 2Z5EA 2JOQA 3EM1A 5HROA 1KFSA 4RUCA 5CABA 1J5EE 4FBTA 2AD9A 2Z5CB 5DRQA 4X62E 4B3TI 3GCXP 3M2UB 4DR7E 4YR0A 1RUSA 4AQYJ 2WRMA 4I1TA 1PC5A 4O4GA 2UXBI 3R5CA 4YFUA 4U96A 3MEEB 3OFEA 1NK6A 2DCLA 2ZVSA 3NAIA 1HR0I 2YY3A 3AXMA 4YB1P 2CJQA 3I5AA 5DG9A 2F9JA 3W7BA 1Y6ZA 1GAOA 2YWEA 4ALZA 3KLIB 1ITPA 3WU3A 3UE2A 2L41A 2OHDA 5KFWA 1X5SA 4B3MJ 2I0XA 4X65E 4XIUA 1SVDA 2YNGA 5CYJA 3P5TL 4FXWA 3BGOP 4LSLB 2WVBA 3CD0A 1UVIA 1FFSB 1HNIB 1RAJA 4UUXA 2AJFE 4ENOA 2O1WA 3T1HJ 2UXCE 3MEDA 3HZGA 4IFVA 4MFBB 5HQLA 3GU0A 4ECWA 3QJJA 5ETLA 2WOMA 3K1JA 2QSWA 3KK1B 4PAAA 2FHKA 2ZKTA 3HHLD 3KJVB 4OKGA 2UU9F 3M85G 4ZVTB 4DR3J 4ES1A 1BQNA 3GIRA 5DLFA 1V5VA 4DPYA 5BR8F 1U4BA 3WQPA 2W4DA 1S97A 4KR0B 5HMXA 1USUA 3CJ8A 3RB3A 1ZOTA 4NCAA 3ZNUA 3PS1A 3H4BA 3S1TA 2FVCA 2DNQA 3TEGA 3V6DB 3CCQS 3H2VE 1HQUA 3PS2A 1OSCA 5KT3A 2VG7A 4H4OB 4HYMA 1FE0A 1HNWJ 1AFIA 3MAHA 4NCBA 2XMTA 3EMTA 3AD8C 4F4WA 3CW2C 4DV7J 2W4CA 3NGUA 1DQ8A 1LW2B 3AQOA 3CCVS 1EAYC 4EBCA 1SI9A 2MSTA 1R6YA 3UD5A 5B0GA 2J8SA 1RACB 4HEA9 1JNZB 2MQOA 4MIBA 1K73T 2BE2B 2MKIA 1FKOB 1NAQA 3HP6A 1R43A 4QNKA 2DBBA 2B5JA 5HVHA 3CEDA 2XYGB 2MXYA 2BE7D 4JI1E 1CS4B 3FC9A 3GV8B 2IERA 1UL3A 1H6KX 4DR3I 4OHWA 2QEXS 2HIYA 5M2PA 1FT8A 5HO4A 2VQFI 2PIIA 2AF6A 1CC8A 2YNHA 5FWKA 3OUYA 1QE1A 4AL6A 1TL7A 2ZH7A 4EUVA 3ZKDA 5U47A 3IO1A 3IG1A 4QIVA 4UY8T 2WBMA 4DR6J 1VC0A 4QPTA 2XSJB 3TX0A 3GWCA 3QT6A 3G8TA 3LGNA 4OX9I 4YDDB 4IKAA 2PDAA 2XULA 4HDGA 2YWWA 3RRGA 1JLQA 2HHUA 5KFEA 1N33E 4M8LA 2W2MP 2HBQB 3HFKA 4C11A 3TOQA 1EZZB 4DV2I 3MAAB 3NGKA 5K14B 2FQQB 4WXWA 4DUZF 2YKMB 4PRVA 1MMLA 1U7LA 4B3RE 1FRJA 3NOGA 4DV6I 4IG0A 3H5SA 4LVOP 2DEJA 3W62A 2BQRA 2MMYA 3FVYA 3NS7B 5I42A 1N34I 1QTMA 3UD4P 2GS8A 2J5AA 4XPEA 4Y2CA 1KQKA 2VBWA 4N8NA 7FD1A 4L74A 2Q6CA 4DS5A 1FNXH 3SQGB 2D3UA 1B63A 2A3JA 3VTIA 2ABYA 3UCZP 1RDRA 3H4LA 1HNXI 2IBOA 5FLXC 3CDEA 1PYOB 4C98A 2GHWA 1HI1A 4LFBJ 3MMCA 5D15A 3CC2S 4YHHF 3WX4A 2OMLA 1VJWA 1XMOI 3HSDA 5F8LA 2HQIA 4DV4E 3AT1B 1Z5CA 1S0MA 1VHFA 5GMKa 4P75A 4LUBA 5IT9Q 9RUBA 5C24B 4WZQA 2CPFA 3VAJA 3H90A 2EFQA 4M1KA 2VU5A 2V8PA 1U1RA 3P3CA 2VFRA 3O3LA 3JTNA 4HHJA 3J7AG 4QYZK 3R1HA 3ZZPA 1WG1A 4IR9A 1BGXT 1S59A 1F3VA 2RSQA 4OYBA 1HNZE 4GKJJ 2UXDF 2JT2A 3N9UC 3NKYA 2WW4A 3PRVA 2I6WA 1TV6B 5KFKA 3OD2A 1NKCA 2HHHE 2AQ4A 1Z5BA 4JI8F 2BUNA 2W9AA 4M5KA 3TUJC 2EC2A 2XLIA 4J9VA 1B0PA 3I4HX 5FJ4A 1WI6A 2ZBCA 4OZNA 2J9EA 1S4FA 1SL1A 4LF7I 4NXNI 5D0HA 1DQAA 3J81C 1U1LA 1BE4A 9ATCB 3FEZA 4DR5E 4LOMA 5ETPA 1PAEX 3FBBA 2E5LI 2NXJA 2E1CA 1U1MA 2YH1A 1CJUA 1PJ7A 2NLWA 4ZIVA 1WUUA 4WUCA 2W2NP 2FZCB 1YRUA 4CLYA 2W9BB 4DR1J 3R7NB 3UFCX 1U0HB 1TELA 3WX8A 3U7JA 2AYEA 2MJUA 1N5YB 4BS2A 1RCXB 2L48A 4KHRA 1NU4A 2F63A 1YIJS 3N01A 1QJHA 4GC6A 5HBMB 3MAQA 4JOUA 4ANCA 2HHPA 2W8LA 1DRZA 1KLMA 2AWZA 3M7NG 3Q8QB 3BQ2A 5B0DA 1WOSA 4LSZB 2K06A 2A6OA 1F60B 3F41A 2DHAA 2BW2A 4URGA 3ZZYA 3TVKA 2KXNB 2XMKA 1RP5A 2C2DA 2BJ3A 3W9JA 1JLFA 3UQSA 4QYZJ 2V8HA 4PUOA 2DISA 4MT1A 3T41A 2EFVA 1Z59A 2XG8A 4KH0B 3OFHA 1XNRF 4WKYA 4OX7A 4FF2A 4AUKA 2MHNA 2FVRA 5HMZA 1M0SA 4WCEQ 4GKKI 4Y2IA 2X1GA 3W9HA 4RPFA 5C25A 2CJXB 5J2PA 3P6YC 2AV5A 4X4TA 1Y10A 2OH2A 3LUYA 1DY3A 4WUBA 3DYAB 2ZH5A 3RAXA 3T1YE 1LFWA 2GVDA 4XAKA 4DV0E 5LXRA 4CLSA 1RT4B 4J7CA 1OS5A 5K5MA 1R6VA 1HPZA 1NZAA 4RUHA 2V2VA 4F2RA 2HLUA 3DRPB 2ZH3A 4O3NA 3W5ZA 4HYKA 1Q7LB 1D9AA 5I3UB 4TVAB 4ID5B 1NCLA 2HLTA 1PSDA 2HEKA 3BO2A 1SKRA 3IP0A 4CZCA 3K5MA 2MZJA 1R0AA 4PYAA 4LQ3A 2CXEA 3CDBA 3R5BA 5DM6Q 2RQKA 2HIQA 5B0EA 1WJ9A 1RTIB 5BYSA 1M5VC 1NHHA 4NASA 1RQ0A 5IV3A 4MK7A 5C0XD 3CMES 5B08A 1U26A 1HNVB 3QPIA 3J80Y 3JB9k 3NCQA 2VFUA 1AZSB 4NXMJ 2ROEA 3KDNA 3N28A 2YX7A 1YI2S 3QNWB 4HVZA 4U3BA 2R9LA 1JNRB 2ZM6E 1UVKA 3VCDA 3NMAA 4A4JA 3CDJA 3H7HB 3DLHA 4O3OA 2KTQA 2RDIA 3Q8SB 1EJ7L 5DLGA 2W1BA 1WG5A 4DPWA 2B56A 1Q1KA 2R2TA 3H0PA 4DDFA 4K5RA 1XMQE 2KXFA 3DKDA 3NBPA 2KYXA 4TLQA 1SQFA 4NLYA 4PQAA 1FJGF 3KHGA 2A2CA 4U3DA 5HATA 2DHSA 5JMNA 1ZM3A 4IFDE 2PD1A 1KHWA 4DN9A 3TQ1A 3TJ9A 4WE1B 3EGZA 1KS2A 3W61A 4UZBA 2OI2A 2EK1A 1S1WB 3DLKB 1QSYA 1UW9A 5T41A 2C2EA 4LR8A 1IBMI 5IV4A 2PO1A 3QT5A 3Q23A 2DH7A 1QSLA 1KOOA 2JEAA 4W4MA 5ETQA 4NXMI 3R6GB 4URQU 5J2QA 1HHSA 3H5XA 1UVNA 3CVKA 2IVFB 1Z2LA 2FLLA 3BZQA 2XY7A 5J1EA 4BHQA 3I9ZA 4LF9E 2D74B 2MZTA 4J91A 4DWIA 1LOUA 2C2KB 3BGLA 4QQBA 1NNDA 3HHNB 5HROB 4JB8B 4UOCA 2JLFA 2E1RA 3CT9A 5EKWA 1AUSL 1RK8A 4PR6A 4U67Q 2UU9J 2FZGB 3PRDA 4O4GB 2I5JB 4OJHA 4DR7F 2XMUA 3T9ZA 1WSRA 4FYYB 4IZJD 3Q83A 2R8HA 3ENQA 4CP5A 3NNHA 2BYCA 2NCKL 1YHQS 1EETA 2G4BA 2XYHB 1X5TA 4K4TA 1ZAXA 2NR0A 1DLOA 1LWXA 2QG9B 4CM2A 3GJTB 5A8KB 2XNRA 1VQNS 2KG0A 3WDOA 3M1VA 4IZKB 2GVZA 3GONA 4ILRA 3MEDB 2NSBA 4IFVB 2N3LA 3ZNJ1 2R7SA 1Q79A 3NY0A 2UXCF 4QW9A 3N79A 1Y4ZB 4PXBA 3R2CJ 4X4VA 2V6AA 4DSIA 3SCIE 2R7OA 3CGIA 3T6BA 2HFUA 2R8GA 3J81j 1SJRA 3SV3A 3U1MA 4F7VA 1K1QA 3TVYA 4P73A 4KHPE 3D68A 1BQMA 3KOAA 3NGRA 3QFWA 3V5RA 4ZIWA 1KLNA 1G3OA 4DN0A 5BR8I 3HHLA 1FJ7A 4RUAA 5A8RA 4PEOA 1SKUB 4YY3F 3CCES 2FLNA 4FF4A 4Y28C 1K1SA 1RA7A 4DL6A 1RT1A 4ZPWR 3DFEA 4QU6A 1VHIA 2UP1A 4DU8A 2BANA 4RJVA 2UUAJ 5K8PA 1F0XA 2EKYA 5L1IA 1I51B 3HD2A 2DGQA 3CJRA 4YR2A 4NOHA 3M9OB 3CCTA 3M8QA 4ELUA 4ERDA 4ZP6A 3P49B 5DG7A 2GX8A 2IJRA 1HWLA 4FNHA 3RRHA 4PQUB 3DI6B 3I32A 4JI1F 2YWKA 3IR6B 3EVMA 1XR6A 3PYEA 4OHXA 2AKWB 5GAEU 2WSFC 2YNHB 4HH1A 4N41A 1W2BR 3GB0A 1Y60A 2CQ3A 3OUYB 1Y9OA 1QE1B 2AIRB 1TL7B 3RB0A 4WPAA 2HKJA 1BUXA 2E1MC 3IG1B 1RT6B 2DNOA 4Y00A 4YHHJ 2OJ3A 5ETMA 3HJFA 5K8MA 4C9DA 1M5PC 1OJ4A 4PXDA 5A2QC 4WJBA 3CNQP 4E0DA 1VRTB 4F4ZA 3HKMA 1HIYA 4RR5A 4OO1A 5JEAD 2OEMA 4I2QA 2JZ5A 1QVGR 1N33F 3CCMS 3ZZZA 4C11B 1TL3B 2RU9A 3DHWC 1SC3B 2QLXA 1HMVA 4B3SE 1XHKA 2WP8B 2BKPA 2IC3A 1N5TA 4G6VB 4B9TA 1UA1A 1RHKB 3M6WA 1IBLE 1T05B 1WHYA 2UXDJ 2XS5A 3GE9A 4DUZI 2MKYA 2BV3A 4KKOA 1ROFA 1REVB 3K5PA 4JI7E 4OI2A 2ZJPQ 1FDDA 4JI8J 5M2UA 3HHKA 2ZDOA 2NYHA 3KHLA 4H4MA 2FIUA 2W7OA 2P6SA 1UETA 5THWA 2X1FA 4JYAF 1RWPB 1EP4B 4IG3A 2OD4A 3MMCB 3V6JA 2XGQA 5C2CA 2E5HA 5KFGA 4RW9A 3KLFB 5DROA 4J9MA 3KUHA 3FEXB 3BKUA 2F1FA 2O67A 1J5OB 4ELVA 1TKZB 4QIGA 4ZVHA 2FPHX 1IBKI 1OY8A 2LVWA 2VOPA 1RA6A 2MQNA 4ED4A 2CDQA 2IM1A 3MM8B 1FRMA 1R8BA 2ZZMA 2MSSA 3QWUA 4TY9A 5KFAA 4QR0A 3VAIA 3IAS9 5A0YB 1X0PA 3U27A 3E2EA 2F4VE 4NLUA 4NCGA 4GC7A 3RJMB 1NKBA 1Z0CA 2ZOMA 4ZN3A 4IRDA 2D3OR 1SH2A 4DV1J 3VWSA 5EGYA 3PYFA 2HHHF 3CWVA 2FY1A 3FK4A 4NMXA 3DLGA 3G6XA 1S1UB 1XNRJ 4X66J 5E41A 4KYZA 1P42A 1E6VB 5F8IA 5LMUE 4DZDA 2HHSA 1MWYA 5CH7B 2OGUA 3IR7B 4HACA 1EIYB 1CJUB 2RKIA 2KB2A 4U7UD 1IVZA 2GJFA 2E66A 2IRUA 2O1TA 1XEZA 3ENAA 2A1BA 3DLBA 4CH1A 2LA6A 3CJ0A 3IS9B 3H20A 1RWVB 1RWUA 2VICA 4AYBD 2BJDA 1RBLA 2XLJA 1U24A 4DV3F 2ROPA 1NBEB 3K89A 1NK8A 4AQYE 1ZM9A 5IM0B 1RTJA 1WI8A 4B9LA 2EXUA 3KYLA 2G1DA 3BBCA 3P06A 3MUTP 2GFFA 3MXHP 1Z5AA 1TZ0A 1M5HA 3RYLA 5C42A 5F3TA 2P2CB 4KC5A 1N88A 3M6UA 4ZLPA 4RO0A 2R4FA 4B3ME 4OZ5A 1NZ8A 3DOMA 4R1FA 4UZCA 3M6VA 4F50A 4KV8A 1R89A 4IR1A 2JRSA 4B9NA 4G3IA 1RXOB 5J2PB 4B3OB 5KG4A 2VQEI 1RAEB 3PJ9A 3T1HE 3P45B 3UPFA 4L72B 2OPPB 2HRYA 3O1LA 4QOTA 2NREA 5GMEA 1TAUA 1UFWA 4F0MA 2GQ2A 1EARA 3JSMA 3T1YF 2KVQE 4RLEA 3HHLC 3PR4A 2NPFA 3O44A 4URSA 4K4UA 2GMJA 3PCOB 2YX1A 1Z0BA 2CJYB 4MK8A 3VV2B 2RU3A 2HQ3A 4DZ6A 5D0GA 2HQFA 1R0AB 1ELOA 2GGPB 4NWBA 2XZWA 4C2MA 4EU0A 2CFXA 1TUGB 1FD2A 4URLA 3MPUB 5ELWA 1QAJA 1CEZA 2UUCI 3ILJA 2WTFA 3JQMA 1VLYA 1N6QB 4PRXA 2DNLA 2ZEJA 1WC1A 1HNWE 1FERA 3QATA 3I9V9 2FZKB 3C6TB 4DV7E 4NBQA 3PNIA 4TQSA 2E44A 4TY8A 3J7YU 2LQJA 1I94I 2BRKA 1MROB 4K8RA 2XMMA 2GNKA 4LBHA 4DR4I 2VD3A 1JLAA 4L73A 1RWWB 3MOZA 4YOEA 1RBOB 5L3JA 2Y0SD 1ZAVA 2X36A 5C0XA 3EDQB 3C46A 2D9PA 3W64A 4YN3B 3AJ1A 5IZHA 2ILYA 1K44A 2IBKA 3KK2B 3PZPA 2IHR1 4KPYA 1KVIA 1SV5A 1CJTB 2YTCA 2MZ1A 4TN2A 2HHWA 3ZZTA 1VRUB 3GFXA 3HHEA 3TAPA 4DG1A 3V81B 2XS7A 3N5FA 1YJRA 2DD8S 1XMQF 2YKOA 2V69A 1AW0A 4DV5I 1TMJA 2IDLA 5DG8A 1FJGI 3S01A 2HHTA 2XCPA 4FKYA 2K2PA 1G6BA 4DR6E 4OO1C 5F0WA 2Z2ZA 3C8YA 1HYSA 3THVA 2HHXA 3OJUA 1OMSA 5B09A 2MJNA 2HMIA 1UVJA 4DUYI 2XMJA 3KG1A 3WHIA 1FTRA 2PO1B 1M5OC 3BPSP 3L7ZA 4LF4E 2LMIA 2HWHA 4OZLA 1IR1A 3OQ2A 2ZWOA 5KFJA 1RT5A 1RT3B 2BJEA 5ETOA 1GQEA 4GVLA 1UDOA 1MMNA 2ZHAA 4BC9A 3BM7A 2LECA 1GMUA 3MMAA 1N32E 2VOOA 4LF9F 2HGNA 2UXCJ 3C66A 1S0NA 2EKNA 2Q6BA 3EGVA 2BR0A 2AMCB 2G13A 2PA3A 2B4OA 3LGHA 4P72A 5K36B 1LWEB 2HS4A 4WWSA 2J9DA 2VV5A 4ZVOB 2MZQA 4P74A 2QL7B 1FJCA 5FLXY 4LFBE 1KQSR 2DR9A 1J5EI 1CJKA 5DNLA 4ZS6A 3A3OB 5C5JA 3MR5A 1Q82T 4X62I 2KZMA 4DR7I 3PTWA 2VBYA 3X1LB 5HP1B 2L9DA 4E98A 4ED1A 1EETB 4YY3J 1S9FA 3DGPA 2F7VA 3N5BA 1RWKB 2JX2A 2DNYA 4K4XA 1C0TA 2XMAA 1USVA 2ZE2A 2ALZA 4IZJA 2KFYA 2V50A 4KGKA 3BQ0A 3ET6B 5KFCA 2HURA 1QSSA 4LFCF 3M1VB 1Q95G 1FEHA 3U1LA 4GKJE 4NLWA 2WNRA 2W2QP 4X65I 2A6MA 4WU3A 4BA1A 1HBNA 4RWXA 3F73A 3D1HA 4DL7A 2NZCA 3WU4A 2V4JB 5J1NA 4WBFA 3AY0A 5IQ6A 4F2SA 3NGDA 2DXDA 3PX4A 2L9WA 2VPYB 2O1UA 2VFTA 4C3LA 3J81Y 1HARA 3J7Z5 2ASDA 4KHPF 4Z37A 5IFMA 1FDBA 3HHLB 4ZVRB 2NS1B 1X4AA 5A8RB 4C3KA 1S6QA 3JYTA 2F5GA 1VDHA 3G8QA 4MQYA 4ER8A 4BC7A 1M1KT 2DR5A 5HAOA 1BXNA 1QD1A 1RT1B 3D1QA 2DR8A 3PR5B 1GH8A 4DR1E 1O6XA 2HVZA 1NHUA 3HX9A 3AB4B 4RW8B 2DNHA 4CM0A 5IS2A 2FJDB 4JI6F 2Q3PA 4LIRA 4JUZA 3EPGA 4L3KA 2ZD1A 3EGNA 2ZUAA 1T03A 1U6BA 2J7UA 2BA9A 3W1YC 2FLPA 2DR7A 5J2MA 2OP5A 2O3DA 1VI7A 2ATCB 5HJXA 2KXHA 2IM3A 3BGRA 4NLTA 2GV1A 3LALA 4DPOA 1K0TA 4M5JA 3NXZA 1Y5YA 2J0XA 2M8DB 2HNDA 3R7SB 2M2BA 3RZAA 3UN2A 2XI2A 4MMOA 2NN6E 4ZVSB 4GO5X 4FVMA 3U1NA 4JI1I 2CG9A 3Q22A 2PMWA 3HPOA 1F5BA 5E3AA 5G0RA 1Z0WA 2B4VA 4ZHRA 1X60A 3OXGA 3B4TA 2IRYA 4JYAJ 2JLEA 5KT7A 1XR5A 3G71S 1FHTA 2VC0A 1LEOA 2B9WA 2P9GA 3W66A 3OXFA 1U1PA 3A12A 2D7SA 3ILLA 2H51B 1RHQB 3JTOA 1IQTA 1G2EA 1IKYB 1QAYA 4OO1B 4QPXA 1IJEB 3JAMQ 4NLXA 1SC1B 2YWHA 4K2XA 4YMEA 4IFDD 4EYIB 4HXZA 1Z4UA 5L9NA 2IC3B 3C15A 4PU9A 2QL5B 2E1AA 1PCAA 1N33I 1UDQA 4DCOB 1H73A 1J2VA 3PO5A 2AJ4A 4PKDB 2W01A 3IXQA 3LO3A 2HVDA 2IM0A 5DGAA 3OTOF 5C0XC 3DDKA 1YWXA 3W2WB 3H4DA 1KR4A 3UN5A 4B3RI 2RDJA 2BQ3A 3ZZOA 4AIMA 4LF8F 3V4IB 4JI7F 3SYZA 1VBZA 3THTA 4H4MB 1D9DA 4FYVB 3TA2A 1ZXMA 5I3PA 3C19A 2OPRA 3DLEA 4BLGA 1A6LA 3M85D 3OR2A 3UD3P 4WIQA 3M30A 3E8OA 2Y3YA 3MWBA 2WSEC 2F8EX 4QR2A 2FHJA 3N6NA 4QR1A 1H38A 3CDWA 4B9VA 2BEFA 1F2GA 2YVSA 1H0HB 3CIZA 1QDUB 1GXUA 4QU7A 2VJVA 4ZVUB 2VG6A 4JV2A 2CQ1A 4ZP8A 3G6VA 4IOAQ 1KKHA 4RW6B 4NLVA 1SJFA 2ALYB 2KG1A 3GV7B 3I5CA 3CCLS 1REGX 2IOQA 4DV4I 1NPPA 2ZNYA 4DV3J 1NRKA 4NI2A 2EEYA 4X4UA 4OYZA 4Y6IA 2QMUB 2VKZG 5KT2A 4TYBA 4PWWA 1WF2A 2F4VF 3POTB 2CPIA 2JSXA 1YZ7A 1UEKA 2E29A 1TK5A 4PG5A 3D3BJ 1HNZI 4ZCKA 1LW0A 2F8MA 4KY3A 5CYQA 4C0BA 3GIMA 2R7RA 2HHHI 1LWCA 2XSFA 1XERA 1FK9A 5BYRA 1VQKS 3L95X 5LMUF 3MFHA 5JJBA 2LQ9A 1YJUA 2AEFA 3UI3A 2VODA 4K4SA 4J9NA 4DR2E 3RTVA 4IDKA 3HKZD 2E7VA 4P7VA 3P96A 4DR5I 2WZ1A 3H40A 2VKRA 1NPKA 1NUEA 3CJSA 2UU9E 3M7VA 2MKJA 3G2XA 2IIHA 1CVJA 1RTJB 5GVQA 1X0FA 4KQVA 1KQFB 4IO1A 1KDNA 3BH6B 1NSKL 1SJ4P 2PMHA 2YPYA 2V8VA 3R5AA 1S57A 4DQRA 1ZYQA 1WKLA 4EBEA 2HS3A 4QWCA 1YDLA 4C97A 2OELA 2FJEB 2KRRA 1R3NA 2V2KA 3MEGB 3DOMB 3ONQA 5KFMA 4CH7A 2QLBB 1W7WA 1UAWA 4OYMA 4KV8B 3W65A 4JI5F 3KLEA 1TKXB 4JI4I 3K5OA 3IBFB 3DHXA 3M6AA 3G6YA 3GG0A 3W8PA 2BA1G 4EO8A 4RNFA 1ZBTA 3G82B 1YGYA 4USUA 2H65B 3AOBA 4P2FA 1RE1B 5SZTA 1MU2B 4B08A 2CA9A 3JSMB 2IFXA 2C37A 1NB2A 3L7OA 2WVCA 5HMWA 3HVTB 1K47A 1UCNA 3R5JB 1G7CB 2X3GA 1PJ6A 1EKSA 3T1YI 4C7QA 4I4BA 3BKFA 2FUG9 4DV0I 3R9LA 3KHRA 1UWBB 4K4WA 1XMQJ 1JB0C 2J6UA 5LOQA 4HLBA 1DFDA 2LYVA 2GIQA 1GMVA 3MPWA 3TYTA 3PHEA 1YRXA 3OSNA 3CDIA 1UTAA 4X4PA 4WTYA 2QLWA 5RUBA 4U8VA 3W8GA 1BLUA 3BJYA 3GCWP 1HNWF 2UUAE 1PIEA 2HK2A 4OV1A 4TY8B 5CQGA 1NHVA 1JMTA 4LFAF 1PJ5A 3NS6A 4R0EA 3O6QA 4I2PB 4RW7B 1RWNB 1VQ4S 5C0XB 2B4PA 2JHEA 1LKZA 4B3TE 2DCUB 2A2DA 1FO1A 2NXUA 1FWLA 2YBVA 3UCUP 2O66A 1Z0VA 3DOKA 1QTNB 3IGNA 5GAGI 3CIMA 1HWIA 4P7AA 2XMWA 1HR0E 2ZM6I 4LF9J 1U1NA 3KRNA 2JFDA 4QWAA 4KPCA 2IMWP 3HVAA 1UFLA 2CPZA 3JQJA 4DL2A 4GVBB 2QLFB 1UDNA 2FB0A 5IWAF 1B3TA 2XY5A 5DDPC 3Q8YA 5IT0A 2ZBPA 3DRSB 5H1SV 1YZ6A 4DX8H 4YHHE 3KMQA 4MIAA 3DLLQ 2H1YA 3EVWA 3M7ND 4YEAA 3BO3A 5IT9C 4DPXA 1RHJB 3A1YG 4TU7A 2VPWB 4P71A 4ED5A 5GMDA 3SXLA 1RISA 1B0TA 3L7ZB 2YKNA 1T02A 1VQ7S 1C0UA 4ICLA 5KFDA 5JEAC 4LF4F 4IFYA 3P8BB 4PWDA 5KOWA 3Q86A 5L39A 1DHMA 2NXCA 4ZOSA 1U1QA 3AJDA 5HL7Q 5D8HB 3QT8A 1LXNA 1DTTB 5AXNA 4LFCJ 3M32A 1SL2A 4NX9A 2Z4PA 1XC9A 4OJ3A 3VQTA 2MQPA 3LW5C 2M3DA 5AE3A 3R2DJ 4E8UA 1N32F 2DNPA 4JI8E 4ZVEA 2N7CA 1N48A 5KFRA 4LF9I 3H2UB 3Q6NA 1XQIA 4MKBA 5KFZA 2HFVA 3Q8PB 1ICEB 1PG5B 2XZTB 2HNYA 1FFGB 1SKSA 1EKRA 2B7BB 1Y5NB 4LFBF 3IN5A 2PGCA 1SL0A 3R1LA 2ZNZA 1GMWD 1F5AA 4X4OA 1RHRB 4K0KF 1VQSA 3DM2B 3DGPB 3R5GA 2Q66A 4PYDA 1OY6A 1JJHA 3A8EA 1C0TB 5DNXA 1SIZA 3OLBA 2BR2A 4IZJB 2RMLA 3FFIA 5HMYA 5EX3A 2BDPA 2HNZA 4XPCA 4JI6J 3GQCA 4A8XA 1U0SA 2WNRB 4CLWA 3UW1A 4CH0S 3ZTSA 1KVJA 5H9FK 2HZAA 3NCPA 3PX0A 4KFBA 4BA1B 2C28A 1HBNB 4LF2A 4GKJF 1A7GE 4EO6A 5ADZA 1MMDA 4R8UA 4ZJLA 4DV1E 4LF6F 3CCSS 3CD7A 3EXCX 3B54A 1H2VZ 1NK0A 3BGUA 2YXLA 2AYBA 2HSEB 2XMVA 1XNRE 4X66E 1L3TA 3S7RA 3GYGA 2DNKA 5L1KA 2OMOA 4M5IA 1CJVB 3T5JA 3CJ3A 3TUPA 1S6QB 4XDDA 3GZ7A 3JYTB 1KRPA 1CPZA 4EEYA 2UVWA 2QA1A 2FLOA 2KRBA 4ZVFA 3D0GE 3GLJA 3TR5A 4KHPI 1UJ4A 4CDIA 2XBPA 3K59A 5HANA 2JEBB 3A13A 2M0GB 2WAQD 3NAHA 4ZPVR 1FKPB 4I3HA 4ZCLA 4DR1F 1KOHA 3R6LB 5E2QA 2FHMA 5T7LB 1YBUA 4ES2A 1X4HA 1PKUA 3TW0A 4OL8A 1HL6A 4OZ3A 1WEYA 3PV8A 4DQSA 4HHHA 4RBUA 1WG4A 4F36A 5KFNA 3JSBA 1YQHA 2IESA 4DJBA 2PNLA 2AJ0A 2GQCA 4Q43A 1H7XA 3O5TB 1K8AT 2HNDB 4FZVA 3RRKA 1S77D 1JLEA 5H9FJ 1HQEA 1TL4A 4RU9A 4KRWA 4A8YA 2CVIA 4D3GA 1HKAA 1WEXA 3OTOJ 3K58A 2D1CA 1NPRA 3TA0A 3PM9A 3KLGA 2N7YA 1LWFB 4LF8J 4JI7J 4OV6A 3FCWA 3QO9A 2R2UA 3LP2B 4CYUA 2PNZA 1R8HA 3B8HA 4U9RA 5G0RB 1KVKA 4WFYA 1HI0P 4TYAA 1FNMA 1S1VA 4IH6A 2CJKA 2YKPA 3D6FB 4BBYA 2KVIA 3M8RA 2HBRB 4LBPA 1X4EA 3H2LA 1PC4A 2JE6A 2EC0A 3KNGA 3KG0A 2AJ2A 4P52A 1LXJA 2ZWPA 2MTLA 1NZ0A 4NPOA 4K59A 4M5HA 4OYXA 2KN4A 3HO1A 1U25A 1F5CA 1TAQA 2MY7A 2IJNA 3F44A 3CJKB 1PGZA 2W7AA 2P8IA 3DXSX 2UUTA 5K36E 2K1RA 1E3HA 1RT7B 3MFIA 3QRQA 3OL9A 3HVWA 4R25A 3AFGA 3L09A 3MR6A 2OSRA 4NRUA 5JEAB 2E1PA 1TU0B 4FS1A 1I6JA 3DOLB 2UUBJ 4IFDA 4B3SI 2E5LE 3UCGA 4GMKA 4X4QA 1IBLI 3IRXB 1VQYA 4WYLA 4MKYA 3DLEB 4NZ6A 4P7TA 5GAEI 2F8HA 3OR2B 2MZSA 2IA0A 3X3UA 1GTHA 1RHYA 4JI7I 3EX7B 1ZTTA 3KLHB 4N3OA 1CSJA 4BA2A 1F9FA 1KTQA 2Q2EB 3E01B 2XZDB 2OPSB 4O3RA 2B4UA 3GYNA 4FN5A 4NA2A 4LMZA 3B4DA 4NLQA 5J2NA 3M2RA 3TARA 1WHXA 2QYGA 3HLUA 2DR6A 3BSNA 3LANA 3HCXA 2AW0A 1E6YA 3B78A 3V6KA 3I4PA 1M5SA 1MLAA 2HFOA 2A10A 2B9XA 1RGVA 3JQKA 3FRZA 1VC5A 4LF5F 1PO6A 1J27A 1P1TA 4C8YA 2MLYA 1LW0B 2F4VI 5LMNE 1R6LA 3BYPA 4DPTA 4KQZA 1WC6A 4DSEA 2PO2A 1NSQA 3OW2R 1RAHB 1LWCB 4FW7A 3IWLA 5E0OA 4JI5J 3EVOA 4F3MA 4USMA 1R31A 1S1XB 5DRRA 4PPZA 1IKXA 1L5UA 3IAM9 3TZWA 2VUGA 1DTQB 4IDKB 1RTZA 1D8ZA 5LMUI 1WKKA 1BMQB 4EMDA 4DR2F 3MGJA 1NK9A 3QSYB 4TU8A 2QFJA 1NO8A 3GLLA 2YWFA 4JV5E 2CQGA 3KJQB 3MM9A 4HDHA 1T9WA 2WBRA 4LSNA 1GNKA 1GK8A 2KFZA 4CIOA 3UDVA 1T0TV 4W90B 1KIJA 2BJ7A 4KGXB 5KFYA 3QFHA 1XIQA 1HBMB 1Y11A 4G1QB 2M52A 3LWLA 1BWEA 4HL9A 3HDSA 1NH7A 2M70A 4AQYI 3MCNA 1PYTA 5DGBA 1S99A 4YY3E 1YBAA 3QLHB 1IKVA 3SFUA 3UHMA 4F26A 2YQ0A 3FNNA 2RJZA 5B0CA 3KK3A 2V4RA 3M2VA 1TVRB 1Q5YA 2W9CA 1VBYA 2QA4S 1M1GA 4ZP9A 1F9EB 1GX5A 4B3MI 4LFAJ 2HVHA 2JFKA 1RLCL 4JI3F 3T1AA 1U09A 3HI9A 2HQDA 1TL1A 3M9MB 2DGUA 1UW4A 3CO0P 2PI4A 2C37B 2IAJA 1VK8A 3T1HI 1VQOS 4CTAA 2PC6A 5A2QQ 2NN6D 4ID8A 3I5BA 5F3ZA 2H48B 3BBBA 3D5MA 1RWXB 2J65A 5FD1A 2O01C 3PVXA 3PIOQ 3BSAA 3CJ2A 1RT2B 1FRHA 5IWAJ 4O3PA 1H7WA 1YKWA 1B4SA 3R8YA 2DHXA 1D9FA 1NDCA 3I0RB 4OZ1A 1CULA 2R7UA 2PO0B 3BF4A 2XWXA 3BSOA 4OO1D 3D0HE 5AJ3F 4XTJA 4GO7X 3LP1A 3I31A 3T5HA 4ED2A 1O8BA 3DRXA 1YITS 2C2RA 1TK8A 3OR1B 2UUAF 4UUWA 5E33A 1R8PA 4QIFA 2ERRA 3MM7A 4HKQA 4OX6A 2BJ1A 1HNWI 3PKMA 4DX7A 1S6PA 3AD9C 4P2SA 2WHOA 1DAXA 4DLGA 3MOJB 2KL8A 2BVZA 1T9XA 3ISNC 3IBWA 4DV7I 4LF4J 1XK8A 2VG5A 4YDXA 2Y8WA 2R8IA 1S7HA 3ITHB 1FE4A 4B3TF 4F0KA 1VQ8S 5FDLA 3OHAA 1H2UX 3DRRB 4JV1A 2UXBF 3W3SA 2Z5CA 1U49A 4O3SA 2X3DA 3M2UA 2C3MA 4ZVIA 3MPDA 1JLGA 1N32J 4OHZA 1HR0F 2VJUA 2CPJA 4OX8A 4ETXA 3FCHA 4FXVA 4UOHA 2R42A 3MEEA 2DGVA 1KHVA 1JLCB 3JXOA 4WYWA 3SMZA 4JYAE 1TP7A 4N47A 4CLLA 2XNQA 2JNJA 2QGFB 4LT6A 1NMEB 4J9QA 3UDEA 2OLWA 1H72C 4K0KJ 4UQGA 2FJBB 4DR6I 2F1DA 3J7YI 4DL3A 2ZOFA 1JKHB 4F25A 1X4GA 3SCJE 2BM0A 1IR0A 3EZUA 1FF2A 2CDRB 4IFYB 4PWDB 1U1OA 1HNIA 3M6XA 3CMQA 4IFDC 3NNAA 4MFBA 1ZA1B 3D6TB 3HFZB 4L3NA 1WHWA 1S4EA 3SBMA 3M32B 3L4BC 4LF4I 4QWBA 3ISZA 2MGZB 3ENWA 2IVYA 2ZH2A 4B9UA 5K20B 3CB4A 4Y2AA 3KJVA 2DYAA 3D54A 2DIUA 3ZTRA 4OLPA 3PDNA 3H1CA 4LF6J 1S5ZA 3MECB 4RL1A 1UZHA 1N32I 2QMXA 2LP4A 2M5YA 4H4KC 1MU5A 2RHQB 2C39B 1HBOA 4ZVPB 3V6DA 3BR9A 4I7FB 1VQPS 2R8JA 4M5MA 3GIIA 2AGPA 4H4OA 3ZZRA 1EX8A 1S1TB 3G6ES 2PFDA 1YTYA 2ACMA 3GSIA 3BO4A 2UVVA 4LFBI 2YQ3A 3MM5A 2BW7A 1T3NA 1KNZA 1FRLA 1LW2A 2CAJA 2BQUA 2HGMA 1Q53A 3PW2A 3FCVA 4DOZA 3H5UA 2B0GA 4MDTA 3ZTOA 1IN0A 5A8WB 4A8SA 1FRKA 4DV3E 1X5PA 2HNZB 1GMWA 5L8RC 4NLOA 2QTWA 1TKTA 3UVJA 1VISA 3QWPA 3ILOA 5HJYA 4UW2A 1FKOA 4MTPA 4LREA 3CC7S 4FYXB 3IBCB 3PEJA 4DBQA 2LU1A 2GC8A 2RUSA 2QV6A 5KG0A 1CS4A 4W98A 1NJYA 2VQFF 4WFXA 4B9MA 4GKJI 2Z56B 4KGMA 4OQJA 1D1UA 4DV1F 4CNYA 2QJ3A 1LV5A 1Y4SA 3OBIA 3MCOA 4Q45A 3BPDA 3TZYA 4X66F 4R0JA 4ED7A 1YVFA 3SEOA 3K8WA 4OX9F 2XSJA 2DKOB 2ZH9A 3J7AM 3QAEA 4LF1A 4WUDA 3EYZA 4DV2F 3LPEA 1R8AA 1IQZA 2KU7A 4EI2A 5IC4B 2LFVA 3CCUS 4USJC 1WD6A 2E7WA 1SQEA 4DV6F 5GAGU 1EA6A 1BWVA 1VIOA 3MAAA 4DR1I 5K14A 2JL9A 3HXMA 5IQQA 3VQSA 1N34F 2YKMA 2GO8A 1XWLA 2CGEA 2PE8A 1X4FA 3IWXA 3WZ0A 4CNZA 5LSLA 2MZRA 2EW9A 3CCJS 4NL5A 2YH0A 3W60A 4P2XA 2ZZTA 1BQXA 5CZVA 4NE9C 2EFNA 1JLEB 4J37A 3MMBA 1RTHA 1HNXF 2E7XA 1ZZFA 4V19J 2DY1A 3SQGA 1XMOF 4XDCA 2R7TA 1JXVA 5AT1B 3K2YA 4CYUB 3PO4A 3A8JA 3M8PB 3EJMA 2VDIA 3HULA 3W2VB 2UZAA 4BWMA 1YK9A 1R27B 4MAKA 3KFWX 3EGWB 5DJBA 4CI0B 1MN7A 1MNEA 5C24A 4U6PA 5HLFA 2QE5A 2K8GA 2IY5B 2AJ1A 2Z57B 4DSJA 3QBCA 3SFGA 1HW8A 4TXSA 4C8ZA 2LQ8A 4DU7A 3LPYA 3VAMA 1P1LA 1PVGA 2EG1A 3VVUA 3CPWR 1TV6A 3M8ZA 5K36F 2AEMA 4JG4A 1R7IA 3AXKA 2RRBA 2H5EA 4LF7F 4NXNF 5KT4A 2XCAA 2KT5A 3HZEA 3NWGA 3H8YA 4IFDB 3KXDA 4A46A 4LF5J 2NZ4A 1A6FA 1FXLA 3VAGA 4N77A 2XS2A 2K3IA 2E5LF 1HHTP 5EWGA 1T3OA 2HAFA 2J9CA 3DMJB 4OMFG 4Z7YA 3LP0A 3K8VA 3HVRA 3SSRA 3FMWA 1PBAA 4RNNA 5LL6d 2COLA 4OJGA 1HHQA 5EUHA 4A47A 2DRBA 1T11A 1B62A 5EL9A 1NM2A 1N5YA 3HSJA 1VFJA 2VH7A 3MI7X 4DR2J 4ZN1A 2J0SD 2GO9A 5AXMA 5LSRA 2XTJP 2Z2YB 2VFVA 4CWBA 4J9OA 1IM4A 5JXSA 4WP8A 4WTOB 3DDNA 2VF3A 3M4XA 4NA3A 2HYIB 2NSCA 1D8YA 2FYXA 3TZZA 4GKKF 5IT9Y 1H3DA 1C1CA 3QRPA 3EE3A 3R97A 2HVEA 3HJVA 2K7KA 2VZ9A 3Q89A 1Q86T 2HQCA 5LMNF 2QYCA 3ZC4A 2X1AA 4YR3A 3BREA 1S12A 1QZRA 4M95A 2N4CA 3VGTA 5AXKA 3CCWA 4UT4A 2FGOA 2YNGB 4OYIA 2CVEA 1H98A 2X1BA 4DS4A 5GADI 4Q5VA 2BKNA 3PW7A 4LFCE 1R0CB 4DL5A 3QZ7A 1RB0A 1RT4A 2C1EB 1Q81T 2BJ8A 2CQ2A 4DQIA 3QIPA 2V68A 4JI3J 3VZIA 1V3ZA 3LTOA 4K7QA 3A8IA 4FKXA 3BDEA 5KFTA 3UDLA 5I3UA 2WOMB 1PAUB 3PY8A 5EWFA 4DR2I 1ZM2A 4LSNB 1S48A 2FHOB 2ZITA 1HBUA 2EG2A 3UO0A 1RJJA 4JV5F 1S6UA 1KQGB 1BQNB 3D28A 3RBZA 1WTBA 4FPRA 3B82A 2NXEA 2Y1LB 2UU9I 3L7UA 4PXCA 1RTIA 5L1JA 2LA4A 2IA6A 4FYDA 2WVDA 1Y00A 4RX6A 2O1VA 2GCFA 3MCMA 2JWNA 1UEUA 2DH8A 4O0NA 4OYPA 2RQ4A 3KK3B 1YSJA 3M2VB 1HQUB 2L9NA 2OEJA 2VG7B 4Z2XA 1AZSA 2V94A 2F4FA 2H5IB 1QAIA 5GAHI 2EWHA 4Q8EA 5AJ3J 3H5YA 2W9CB 4JI6E 4JI0E 3U1YA 3L7PA 4EWTA 4WIIA 1ZETA 4EZ6A 1UZDA 2DHHA 2CG4A 2GHPA 5AXLA 1MWZA 2V2ZA 2OTLS 2R7XA 4ANEA 2Y8YA 4C8KA 4OO1F 1SH0A 3SIPB 2HK3A 2V9WA 4B3TJ 2CKWA 4ZCMA 2B5JB 1QM9A 2JH3A 1FI4A 1JXEA 3RBDA 4U95A 5A76A 4A8MP 5F0UA 3TP2A 2UXBJ 1VC6A 2GMHA 4KGZB 1JJCB 1S79A 2CPYA 1RAIB 1HR0J 3SQOP 4V1Ak 2MYFA 2A18A 2E9ZA 2NN6A 2LDIA 2OTJS 3FRYA 4LRAA 1IBMF 4WE1A 2UVUA 5A6PA 4DFMA 4OYOA 1S1WA 3P76A 3EWGA 5DDRC 4M94A 3MTKA 3L3CA 4AE5A 1KTVA 3LP1B 1Q78A 3ZZUA 3KWMA 2ZDPA 3DCAA 4F02A 3JAMC 3MM7B 2RUGA 4ILLA 1S6PB 2MKCA 4HT7A 1JLQB 4JV0A 1OYDA 1D09B 2JLGA 1CBKA 3GIKA 2UUAI 2VG5B 5D6GA 1VS3A 3QSIA 5KFXA 1C1BA 1IKWA 3ZKBA 5FDLB 3AAWB 5F41A 1TQLA 1HLWA 5BJRA 4IG0B 1KFDA 1H74A 4QYRA 3OTOE 1WC5A 5I42B 4IQMA 2JDJA 2R7WA 5M2RA 1JLGB 3C6UA 1ZPVA 2I5JA 3PW0A 4LF8E 2HBZB 2J0WA 1S9EA 2FHJD 1ZS6A 2B51A 3NZKA 1SUQA 3GSDA 1APSA 1PYSB 4Q7AA 1VLOA 2C3OA 3IM9A 4M63A 4P10A 5IT4A 1TMMA 4CT8A 5D4LA 3MURP 2BACA 3VVTA 4J9SA 1YJ9S 4NLGA 1GTEA 1PBUA 3OTCA 3CDUA 3HFVA 1FCAA 2GQQA 3KG4A 4YHHI 1TUWA 5A8KA 1NJWA 5K8NA 4J3DA 1EHWA 4IZKA 2ASLA 3CWJA 1LNQA 2JJ4D 2CJ9A 3TI0A 1WWHA 4UY85 3OTEA 2XC9A 3NS5A 2DRAA 4P2MA 2YQ1A 2DHGA 2BA1D 1G1XA 2AHOB 2R7VA 5B0AA 4KAIA 1U2RA 2UUBE 3CD6S 2RIJA 4LR9A 2VA3A 3UDCA 5AE1A 1CG2A 1L3UA 2VQFJ 2UXDI 2WCXA 4QCLA 3K0JA 3DU5A 3DDIA 3LQVA 2XHCA 1UPPA 4ZJQA 3OVBA 3QGPA 1NB7A 4JI8I 1HBOB 2H3EB 3NGTA 1DARA 4OX9J 3SI8A 1VBKA 4C8NA 5SUHA 3EDRB 1FEEA 2V8DA 3MM5B 2BRLA 4FYWB 2VIHA 2XY6A 3BR8A 3E51A 3MUVP 4DV2J 4X64E 4FVCA 1TKTB 4ZDNA 4DV6J 3UVJB 3J80Q 3GR0A 4AXIA 4LVNP 1Q5VA 3OTBA 1N34J 5KAKA 2C2MB 1RYRA 1KLMB 2E5IA 2OO4A 2RRAA 3GV5B 5CD4H 3WIVA 2G2OA 3SZ2A 4ZLLA 4GQUA 4PQUA 3DI6A 1HW9A 3KLVA 3JAMU 2G0CA 2PO4A 2NXNA 4DHVA 1JLFB 4PUOB 4C3MA 2FJVA 4DI6A 1HNXJ 1JK9B 4DV1I 4JI5E 1L3KA 5HVFA 1XMOJ 3B6BA 3C14A 1WC3A 1RT6A 5C25B 1XNRI 3MD1A 4X66I 2VC1A 5IOLA 1VQ6S 3SV4A 2XHWA 4FS2A 3CTRA 4J90A 3EUNA 2GVDB 2B7CB 1FWKA 2C42A 1NH8A 4UF4A 5C0XF 1VRTA 4AL7A 1RU2A 4TKTA 1HPZB 3NGSA 1KD1T 4HI2A 4CLKA 2G0IA 1TL3A 3R27A 2CQDA 1S10A 1LQ9A 4AT1B 2PT0A 1UKUA 3QYYA 4YB6A 2ZH1A 2WP8A 2XO7A 4EYHB 4ES3A 1T05A 2ZUGA 2LXUA 2LCWA 2Z0GA 3K5LA 1BD6A 3V4MA 4ECUA 4ECSA 1VK3A 4ECQA 4M5GA 4O23A 1REVA 2CWXA 2BX6A 3MMBB 1D6TA 4KH1B 1RTHB 1RR9A 1Y0HA 3RU0A 4LF7J 4NXNJ 1URRA 1WDTA 3QRRA 1UDSA 4ANDA 3H42A 2HS0A 1NJIT 3RBEA 2VBXA 2CPHA 5HI7A 5DETA 3PJXA 1JLBA 1P9QC 4LFAE 1YJ7A 3D66A 1EP4A 1HQ2A 4CQ1A 1IJFB 2E5LJ 2ZBIA 3KLFA 2BXJA 2FC9A 2FGCA 1IBKF 2XWYA 3PYDA 3MEKA 1J5OA 1TKZA 3NP5A 4X4SA 3PS3A 2BBEA 4FWDA 2NN6C 1SJ1A 5HLFB 4NYPA 1M90T 1KEKA 1X8DA 3BS9A 3MM8A 2EFGA 5CAAA 1NLKL 2CIMA 4KHMA 5KG7A 3GJQB 5A0YA 2WVEA 2GZOA 2CQIA 1CC7A 3NBPB 4PG6A 1GXTA 1ZH5A 2M8HA 5IWAE 2K7JA 1W2IA 1VOMA 2IJFA 4A8FA 2HKEA 5I4MA 4CLFA 3H98A 3CJQA 2MKKA 4PWUA 5E7OB 4HT5A 4GKKJ 3KUGA 3PEHA 1S1UA 1AXQA 2PFFB 1RWMB 4DUTA 1QUVA 1E6VA 2XI3A 2V2QA 3ZXWA 4ECRA 3MD3A 1UP1A 5D0RA 5LMNJ 1HD1A 3LP0B 2MY8A 2JEAB 5E3PA 2AX0A 1SJ3P 1URNA 1CLFA 4MH8A 3VAFA 2VB6A 5J2QB 4U7CA 1TFWA 3IS9A 1Q4RA 3D3CJ 1RZMA 5J1EB 3M05A 1OSDA 3I55S 1M5KC 1RKJA 1WSVA 4MU3A 4NLDA 1RABB 3OVSA 3ETOA 4I6AA 5IM0A 2V5HG 1GX6A 2ZJRQ 2ZBKB 1FKAE 4I64A 3CUNA 3GG1A 4ETZA 4JV5J 4FXDA 4A8QA 2Y1IA 2DXEA 4JI4E 4UQTA 5AE2A 4OJ1A 1XXEA 1IXKA 2OPQA 3FBEA 2AYMA 1IM6A 2GAHC 1C1CB 3OFFA 4F04B 4K0KE 2DY9A 4USVA 3G4SS 2VQEF 2CWKA 1X9SA 2KDOA 3MUMP 1Q16B 4XK8C 1TR0A 2Y1RI 2PI5A 1CQMA 4B3OA 3ENVA 3R7BB 4ZLJA 4ECTA 2OPPA 1DLOB 5LMNI 3J7AN 2I38A 3GR1A 3VAKA 1VQ5S 5MAOA 4G65A 2JVOA 3WU6A 2RDDA 3I0SA 1Z1ZA 3QIPB 1UJ6A 2GVZB 3N0VA 1H2TZ 4B02A 2QA2A 2N4DA 5D4OA 2W4PA 4LF6E 2PA8D 2QZ8A 2VA2A 4LBIA 2POKA 1JJ4A 5FLXU 3R5DA 4XTTA 1YHCA 3OTDA 3FEYB 4MYTA 2UUCF 1HBUB 2UXCI 3MHYA 2B9EA 2ASYA 2GGPA 4O44A 2D41A 4G1IA 1P9YA 3RGIA 2EFOA 4K50A 3KTQA 3FDSA 2R2RA 1BQMB 3ETMA 3PX6A 3ZTQA 4JV5I 1N8RT 2ZH8A 3Q8UA 2DXFA 4PZVA 2RD5C 1N6QA 3HSGA 3MPYA 4RBTA 5LJ5Y 1I94F 1VMBA 1IBMJ 2Z5BA 3C6TA 4DR4F 2DT9A 4AL5A 3RR7A 1U2CA 4F8RA 1OY9A 3W5XA 1MROA 3GILA 3GJRB 4YY3I 2LEAA 4YP3A 2BANB 4PRFA 1FFWB 4LRBA 1OYSA 5B7WA 4JI0F 2VHGA 1YJTA 3KK2A 4KIAA 3HT0A 4EFAC 5DO2A 2HGLA 1CJTA 1N56A 4WK1A 4JI2E 3ISND 2MQ8A 1VCTA 1VRUA 1O51A 3M8QB 3QQCD 4IYQA 2IRXA 4DV5F 1QLNA 4J9LA 3V81A 4C8MA 3J81U 2Z58B 1WDDA 1NXIA 4CO3A 5DRKA 5B0FA 2W2OP 1NSPA 1YBTA 3GIJA 3VF0B 3TANA 3OPKA 3IWNC 5JEAF 1TTHB 3W9IA 1ZPWX 4QZVB 1E3PA 1RAOA 4DUYF 2NN6B 1I1GA 5J1PA 1RAFB 2D9OA 3ZTPA 1G4CA 4CO0A 4DF4A 3OL7A 2KYZA 3TNVA 3P5BP 2Q79A 1TKDA 1KBRA 1WTFA 4ILMA 1FRXA 1FXDA 2BMBA 3TX8A 2CQHA 1N36E 3C16A 5ETSA 2ZBRA 2WONA 2MLXA 3SCLE 1AYEA 1RT3A 1V3RA 3OFGA 1F6TA 2AGOA 4OYAA 2C2OB 5HN0A 2KJWA 8RUCA 2DGTA 3KNAA 2PEHA 3UR3C 2EBGA 4RW4A 4GRSA 5H9EK 4I2QB 1SH3A 1T7PA 3FBFA 3MZIA 5G4DA 3HMJG 1RSCA 3J7ZT 1C1BB 5KG1A 1MSWD 2M4MA 1IKWB 3BN7A 1HMVB 5D3GA 4Q0BA 5ITHA 5EX0A 4QNJA 4C4WA 3IGVA 4MKAA 3K57A 5L9XA 3N6MA 2P6TA 4PG7A 1U8SA 5K36A 1LWEA 2H54B 1WOPA 1Y3JA 2Y9HA 1UFKA 1J5EF 4WKRA 2YWGA 3PACA 3C6UB 4KKOB 3KKFA 4X62F 4LCHA 1S9EB 5BR8J 2ZKUA 3BV8A 2N3OA 4CO4A 2D3ZA 2JC1A 1SUQB 2KHCA 4DSKA 2BA0G 4KO0A 2MEWA 4HH0A 4MU1A 2MQLA 2DO0A 5HP1A 1HA1A 3BH7B 4IG3B 5GADU 1UWAA 3EZOA 4RW9B 5LJ3Y 4G1PA 3TEHB 2PMZD 4IQXA 4JYAI 3A3PB 2E5GA 6FD1A 2P5VA 3VGSA 4X65F 1RI7A 4S0MA 3DD6A 5F8NA 3ET6A 2HFZA 2V67A 2HHVA 1FWPA 4A8WA 1BKNA 1T8EA 4Y2MA 2GMLA 1V3SA 2A0FB 3U02A 2FC8A 3QT7A 2JEGA 3HK2A 1W26A 4DX5A 2V4JA 3FQKA 4NCGB 1Z0EA 1GT8A 2HBYB 3CD5A 3P3DA 2EI5A 1IR2A 1R0BG 3GP9A 1RYSA 3CSKA 2IPOB 4LF5E 2G0JA 3GYXB 2CRLA 5H9EJ 5L38A 2UUBF 3BQ1A 2H4WB 4ZPCA 4EBDA 1SB6A 3DC2A 1GFWB 3M8WA 3RG6A 4QW8A 3DLGB 4W92B 2ZBQA 4NEYA 4M5DA 5GAHU 1YLXA 2F3JA 4OI3A 4RUBA 3OJSA 1ZM4A 2CJBA 2HWTA 3JS9A 4DSLA 2GIRA 4HACB 4RW8A 3SCKE 1XNQE 3KMSA 1XMBA 4QIWD 2RKIB 3GMEA 4K5SA 2OSQA 1VGYA 5KFQA 3I87A 5CA5A 4F67A 2ASJA 1DZ5A 4YB5A 1S0VA 1X7VA 3RAMA 4X64F 4QIEA 4XO0A 3DGVA 4TLRA 2OEKA 2XO6A 4DUZJ 3QMQA 2QC3A 4NLRA 1WC4A 4DV3I 2E9TA 3TUZC 4EZ9A 1B70B 2C3PA 4DSFA 2H5JB 2FJWA 5ETVA 4AFFA 1L3SA 4TU9A 2L08A 3D6HB 5C42B 4I56A 2GO4A 3FZBA 3QGIA 4NLSA 4DCJB 2HRTA 4FW9A 3N6LA 3R3TA 2RT3A 2V8GA 4OZEA 1I3OB 2O5DA 4OFZA 1WHVA 3C14B 1M1HA 3C3LA 4ATNA 2HQGA 2Z2LA 1WC0A 5HSPA 1R8CA 2QT7A 4OHYA 3I96A 1B99A 2WVFA 4JI3E 1IBKJ 2CPDA 1T9YA 4N56A 2AJQA 4KJIA 2C38A 4FW6A 2W8KA 3VZHA 3P3GA 1IKYA 3OL8A 3FSXA 4V19X 5CCLA 3CXCR 4DEZA 1D3WA 2GIFA 3FQLA 1NKEA 1RTDA 1ACMB 2CZ4A 1NK5A 3TA1A 4PCQA 5ETKA 4B3RF 5CYMA 4FPIA 4IH5A 1WOOA 4FW4A 4CLZA 4AM3A 2DNMA 1Z2ZA 3T19A 4ED6A 2VFSA 3W2WA 3MR3A 3W5YA 2EVZA 3I56S 3HHDA 3V4IA 1SC4B 2HHQA 2RHSB 2JC0A 5E3QA 2FTRA 4C0HA 3M8YA 1JLBB 2ZHBA 2CQPA 1U2FA 2VPXB 5DQGA 1FD8A 1UA0A 2KKHA 5LXYA 2W24A 2RH3A 1VIXA 5LT5A 1MX0A 1JLAB 4NEZA 2HFNA 2Z2MA 5FLXQ 3RBXA 3FBCA 4FF1A 5ETRA 4P9SA 4DV4F 5KFHA 2B8PA 1I5OB 4DFPA 4RW6A 1NDKA 3T5KA 3EPIA 2UXBE 4K4VA 1T9UA 1SV5B 2QIFA 1UPMB 2QMWA 3BEGB 3AJ2A 1TFYA 1N5SA 3GPAA 1YRTA 4DG1B 1S72S 4MJKA 3IRWP 2GJIA 2DO4A 1HNZF 3POTA 3TRGA 1F1BB 5KFIA 2LEBA 4CCHA 8ATCB 4ZPTR 1XMQI 1AT1B 2RILA 1GEHA 1HYSB 3PRBA 1EB0A 1SIWB 2MQQA 5HK4A 2HMIB 2C2NA 4AIDA 3Q0AA 2VQEJ 3JAMY 2IYGA 1RCOB 2XB2D 4ZVGA 2KT2A 5K36C 1RAAB 4DR5F 1RT5B 1EQ0A 3KDOA 4RNOA 1RHMB 3J81Q 1AROP 5D4NA 3PW4A 4PPDA 5KOXA 2KJVA 3BKTA 1IUJA 2G1HA 5KFVA 8AT1B 4FWHA 2C3UA 4WFBQ 3QJPA 2W25A 3U1KA 3MMAB 3V6HA 1FDNA 2Q43A 2IVMA 2LQ5A 4TQRA 3CDAA 3TAMA 3T9NA 2UUCJ 1FKAF 3IFEA 2CYYA 5KFUA 2X7IA 4F4YA 2CQ4A 2YNIA 5A2QU 2OD6A 2OPQB 2VL1A 2RQCA 1CJKB 4WP3A 4JI4F 3MEGA 4ECXA 5I3QA 2UUWA 1B7FA 1I94J 2YX4A 2XYPB 4CLTA 1N4LA 1JJ2R 3CJTA 1S76D 4ZK7M 4DR4J 1S16A 1TKXA 3FGVA 4I69A 4IS9A 2B3TB 4LRDA 2NUHA 4Q8FA 2YNFA 3G82A 2ZE2B 1U47A 3BYRA 4R5PA 2I1RA 3OT9A 1U45A 4X2BA 5EN1A 1MU2A 3RAQA 3I0SB 4JI0J 4DV0F 2LXFA 4DR3E 2J7WA 3HVTA 4MKVA 4LFCI 4HTJA 2VQFE 3MR2A 3FZ2A 4DV5J 3ICLA 1UWBA 3BN4A 3DLJA 4C6AA 3VAHA 3LOUA 1FJGJ 4JBCA 4O44B 1FNOA 4OLOA 2QLJB 1SC6A 4ZP7A 6FDRA 2R8KA 2CQBA 2OFHX 5DZ7A 5B0BA 1OYEA 4FW5A 3F0NA 4OX9E 4DUYJ 4HTIA 3AODA 1R6MA 4IRCA 4ECYA 4FF3A 2Z5BB 5KG6A 2HVIA 1IBCB 3NMRA 2OIHA 3F56A 4A48A 2P9EA 4DV2E 5E5NA 2WW8A 1QUPA 3BB5A 4O4RA 4I2PA 1SKWA 2KFNA 4RW7A 4DV6E 2AEJA 3E3XA 3T5LA 3FMBA 1C2PA 2ZD1B 2YPZA 1HFEL 1N34E 1T03B 2RS8A 2NQPA 4CLUA 3LA0A 1SBRA 2ZM6F 4OIXA 4DXLA 4U7UK 5J2MB 2B43A 2G2ZA 4JI6I 2MLZA 4EK2A 2H9ZA 2EBEA 4JI0I 4LQ9A 4NMLA 3BGRB 3MMJA 3PFOA 4JI2F 3PIPQ 2CNKB 1HNXE 5CZXA 4GVBA 4FDFA 2K3KA 4Y0FA 1J5EJ 1XMOE 4PG8A 1SJQA 4UTGA 1IWGA 1X9MA 4X62J 1H7SA 4DR7J 4HR2A 3W63A 3DRSA 4IFDF 2DGXA 5T14A 4WFAQ 5KFFA 1WORA 1T94A 1N5VA 2DH9A 4ZHRB 4OI0A 4NYZA 1JIHA 1VQ9S 4LJMA 2DVIA 4ED8A 3AH6A 3C16B 2WONB 4OI6A 4FBUA 4DPUA 3WBZA 1UJ5A 2ZH6A 2B9YA 4IH7A 1OQ3A 1N36F 1OIAA 5F9NA 4L75A 2ZC4A 2B6AA 4X65J 1QVFR 4MU0A 1NEEA 1S0OA 4DQQA 4RW4B 2AGQA 1DTTA 1Z0TA 2C3YA 2Z8QA 4USKA 2VBZA 2ACYA 3D6MB 5D3GB 4Q0BB 3C15B 2AZ1A 4LF7E 3UNYA 4NXNE 1NHKL 2I8EA 3A4TA 2CG8A 1WELA 3Q2SC 4RKUC 4ZVQB 1U6ZA 3IR5B 1YH8A 5C7PA 5MLCV 2BABA 1Y5IB 4J9KA 2V34A 2QSFA 4ZPDA 3OTOI 4KO0B 2OPRB 3NRBA 4ED0A 3VGVA 1K0VA 5CCMA 4MIWA 5JVHQ 2FJAB 3M30B 3BGFA 4LF8I 3DM2A 2NYIA 1YJVA 3QGHA 3UWTA 3TJ8A 3PXGa 2JEJA 2DNRA 4K2JA 4QJVA 4A8OA 2IDEA 3D67A 2VG6B 2ZZNA 4ZJOA 4KB7A 2QX0A 4KGVB 1VYAA 1Y3KA 4WZMA 4F3OA 4J5OA 3WIUA 1EQMA 2CJAA 3HM9A 2PEBA 1ZZNA 4LCGA 4NI2B 1P8GA 4X64J
chains in the Genus database with same CATH topology
2HK2A 1PVGA 4JYAI 1ELOA 2V2QA 3Q6MA 4FWHA 1H7UA 4LF5I 4JI1I 2CG9A 2V2VA 4URLA 1PKPA 4JG4A 2Z5CA 4GKKE 4P52A 2UUCI 1Z0WA 1NZ0A 1BKNA 1HNWE 4PRXA 4ZVIA 3D4JA 3V2UC 4B3TE 1A6FA 3ZM7A 2A2DA 3QT7A 4HY1A 4DV7E 2R42A 2UUBI 3PYEA 2X7IA 1FWLA 1I94I 3J80C 1Z0VA 4YHHI 1Z0EA 4JYAE 4Z7YA 4DR4I 4P7AA 4K0KI 4LF5E 1HR0E 4JI1E 2ZM6I 5L3JA 2HKJA 4IZKA 2X36A 1NHHA 2UUCE 3JAMQ 2ZBKB 4B3SI 1XNQI 1FKAE 2E5LE 4DR3I 4HXZA 1IBLI 1H72C 2HFSA 1S16A 1B62A 1OJ4A 4PU9A 5A2QC 2VQFI 1N33I 4DR6I 5FWKA 1H73A 3ZZTA 4JI4E 1U2RA 2UUBE 2AJ4A 2BM0A 3ZKDA 1I94E 4JI7I 4YHHE 1ZM4A 4N3OA 2XEXA 4DR4E 4K0KE 2UXDI 4B3RI 5IT9C 2ZM6E 4DPXA 3QT6A 1S4EA 2Q2EB 4HACB 4LF4I 4B3SE 1XNQE 2PNMA 4DV5I 5GMDA 1ZXMA 1XHKA 4LF6I 4OX9I 4DR3E 2VF3A 4X64I 1IBLE 1RREA 4FN5A 4DPWA 1FJGI 3LNUA 4JI8I 2CZ9A 4LFCI 2VQFE 1N33E 4DUZI 4DR6E 5LMNI 1XMQE 2BV3A 3ZZ0A 1DARA 3HJCA 4JI7E 1HK7A 3WU6A 4DV2I 3B78A 1Y4UA 4DUYI 3QT8A 2A2CA 4MYUA 1N32I 4PRVA 4B3RE 4DV6I 4DV3I 1KKHA 4LF4E 1ZM3A 1MU5A 4DV5E 2LJPA 1QZRA 2DEJA 4Z7CA 3F0NA 4UT4A 4LF6E 4OX9E 4X64E 1N34I 4JI3I 3K17A 1FJGE 4JI8E 2GS8A 2IOQA 4DV4I 4LFCE 3K85A 1MG7A 2Z5BB 4DUZE 3J80Q 4MYTA 2F4VI 5LMNE 4LF9I 2OI2A 2UXCI 3LPSA 3Q6NA 4JI5I 1ZXNA 4DPTA 4FW9A 4LFBI 4FWGA 4DV2E 1IBMI 5LL6R 4DUYE 3QT5A 1B63A 1N0VC 3LTOA 1IBKI 1N32E 2DEIA 3H4LA 4JV5I 4DV6E 1HNXI 5FLXC 4DV3E 4ED4A 4NXMI 1UEKA 4USMA 1Z0GA 1XMOI 2Z5BA 3PYGA 1N34E 4DR2I 4JI3E 1VISA 1HNZI 1ZM2A 2ZITA 4DV4E 4JI2I 4DXLA 1Z5CA 2BM1A 2F4VE 4JI6I 1NHIA 4LF9E 4JI0I 5LMUI 4DV1I 4JI5E 1EI1A 3B82A 4LFBE 4EMDA 5IT9Q 1Z0CA 2HHHI 2UU9I 1J5EI 4YY3I 1IBME 4IZJB 1IBKE 4GKJI 4M1KA 4X62I 1XNRI 4JV5E 4X66I 4DR7I 1HNXE 2V8PA 2E1RA 2O1VA 4NXME 3PYFA 1Y4SA 2GQ0A 3CWVA 3J7AG 2R3VA 1XMOE 4DR2E 3WU5A 4UTGA 1KIJA 1HNZE 1FWKA 4JI2E 1H7SA 4DR5I 1USVA 2WW4A 4JI6E 4JI0E 4IZJA 5LMUE 4AQYI 2Z5EA 4DV1E 2HHHE 4IZJD 1J5EE 4YY3E 2UU9E 1Z5BA 2Z5CB 3PRYA 3Q1QA 4GKJE 1N36I 2V2ZA 4HACA 4KQVA 4X62E 1XNRE 4B3TI 3J7AM 2UXDE 4X66E 4X65I 4DR7E 4LFAI 4WUDA 2UXBI 2O1TA 4DPUA 4LF7I 4NXNI 3J81C 2HK3A 3WU4A 2IOPA 4DR5E 1HR0I 4B3MI 1EA6A 1FI4A 1D6TA 1MX0A 4AQYE 1ZM9A 1RR9A 4DR1I 4KHPI 1Y6ZA 1Z0TA 4IZKB 2CGEA 3GONA 5FLXQ 2E5LI 2O1UA 3WU3A 4USKA 1WUUA 1N36E 4WUCA 3P06A 4X65E 4I3HA 1Z5AA 4LFAE 4JI4I 3T1HI 2UXBE 3M6AA 5A2QQ 4LF7E 4NXNE 3PYDA 2HFUA 5IWAI 4B3ME 2O1WA 2UXCE 4R1FA 4DR1E 2J7KA 4KHPE 2V34A 1KTVA 4FWDA 3ZZUA 3JAMC 3OTOI 3V5RA 2PNLA 5BR8I 3K1JA 2EFGA 1K47A 2VQEI 1XMQI 3T1HE 3T1YI 3HULA 4LF8I 4DV0I 2UUAI 5GMEA 1Z59A 4DPYA 5IWAE 4XTJA 1USUA 4DU8A 3ZKBA 4GKKI 4RPFA 2HKEA 2NPFA 3B8HA 1HNWI 1KVKA 1H74A 3OTOE 5BR8E 1Z0BA 1FNMA 1NHJA 4WUBA 3J81Q 4DV7I 2VQEE 1N0UA 3T1YE 4LF8E 4DU7A 4DV0E 2UUAE 1PIEA 4HYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK2 A;  1PVG A;  4JYA I;  1ELO A;  2V2Q A;  4FWH A;  1H7U A;  4LF5 I;  4JI1 I;  2V2V A;  4URL A;  1PKP A;  4JG4 A;  4GKK E;  4P52 A;  2UUC I;  1Z0W A;  1NZ0 A;  1BKN A;  1HNW E;  4PRX A;  4ZVI A;  3D4J A;  3V2U C;  4B3T E;  1A6F A;  3ZM7 A;  2A2D A;  3QT7 A;  4HY1 A;  4DV7 E;  2R42 A;  2UUB I;  3PYE A;  2X7I A;  1FWL A;  1I94 I;  3J80 C;  1Z0V A;  4YHH I;  1Z0E A;  4JYA E;  4Z7Y A;  4DR4 I;  4P7A A;  4K0K I;  4LF5 E;  1HR0 E;  4JI1 E;  2ZM6 I;  5L3J A;  2HKJ A;  2X36 A;  1NHH A;  2UUC E;  3JAM Q;  2ZBK B;  4B3S I;  1XNQ I;  1FKA E;  2E5L E;  4DR3 I;  4HXZ A;  1IBL I;  1H72 C;  2HFS A;  1S16 A;  1B62 A;  1OJ4 A;  4PU9 A;  5A2Q C;  2VQF I;  1N33 I;  4DR6 I;  1H73 A;  3ZZT A;  4JI4 E;  1U2R A;  2UUB E;  2AJ4 A;  2BM0 A;  3ZKD A;  1I94 E;  4JI7 I;  4YHH E;  1ZM4 A;  2XEX A;  4DR4 E;  4K0K E;  2UXD I;  4B3R I;  5IT9 C;  2ZM6 E;  4DPX A;  3QT6 A;  1S4E A;  2Q2E B;  4HAC B;  4LF4 I;  4B3S E;  1XNQ E;  4DV5 I;  5GMD A;  1ZXM A;  1XHK A;  4LF6 I;  4OX9 I;  4DR3 E;  2VF3 A;  4X64 I;  1IBL E;  1RRE A;  4FN5 A;  4DPW A;  1FJG I;  3LNU A;  4JI8 I;  2CZ9 A;  4LFC I;  2VQF E;  1N33 E;  4DUZ I;  4DR6 E;  5LMN I;  1XMQ E;  2BV3 A;  3ZZ0 A;  1DAR A;  4JI7 E;  3WU6 A;  4DV2 I;  3B78 A;  4DUY I;  3QT8 A;  2A2C A;  4MYU A;  1N32 I;  4PRV A;  4B3R E;  4DV6 I;  4DV3 I;  1KKH A;  4LF4 E;  1ZM3 A;  1MU5 A;  4DV5 E;  2LJP A;  1QZR A;  2DEJ A;  4Z7C A;  3F0N A;  4UT4 A;  4LF6 E;  4OX9 E;  4X64 E;  1N34 I;  4JI3 I;  3K17 A;  1FJG E;  4JI8 E;  2GS8 A;  4DV4 I;  4LFC E;  1MG7 A;  4DUZ E;  3J80 Q;  4MYT A;  2F4V I;  5LMN E;  4LF9 I;  2OI2 A;  2UXC I;  3LPS A;  4JI5 I;  1ZXN A;  4DPT A;  4FW9 A;  4LFB I;  4FWG A;  4DV2 E;  1IBM I;  5LL6 R;  4DUY E;  3QT5 A;  1B63 A;  1N0V C;  3LTO A;  1IBK I;  1N32 E;  2DEI A;  3H4L A;  4JV5 I;  4DV6 E;  1HNX I;  5FLX C;  4DV3 E;  4ED4 A;  4NXM I;  1UEK A;  4USM A;  1Z0G A;  1XMO I;  3PYG A;  1N34 E;  4DR2 I;  4JI3 E;  1VIS A;  1HNZ I;  1ZM2 A;  2ZIT A;  4DV4 E;  4JI2 I;  4DXL A;  1Z5C A;  2BM1 A;  2F4V E;  4JI6 I;  1NHI A;  4LF9 E;  4JI0 I;  5LMU I;  4DV1 I;  4JI5 E;  1EI1 A;  3B82 A;  4LFB E;  4EMD A;  5IT9 Q;  1Z0C A;  2HHH I;  2UU9 I;  1J5E I;  4YY3 I;  1IBM E;  1IBK E;  4GKJ I;  4M1K A;  4X62 I;  1XNR I;  4JV5 E;  4X66 I;  4DR7 I;  1HNX E;  2V8P A;  2E1R A;  4NXM E;  3PYF A;  3CWV A;  3J7A G;  2R3V A;  1XMO E;  4DR2 E;  3WU5 A;  4UTG A;  1KIJ A;  1HNZ E;  1FWK A;  4JI2 E;  1H7S A;  4DR5 I;  2WW4 A;  4JI6 E;  4JI0 E;  5LMU E;  4AQY I;  4DV1 E;  2HHH E;  2UU9 E;  1J5E E;  4YY3 E;  1Z5B A;  3Q1Q A;  4GKJ E;  1N36 I;  2V2Z A;  4HAC A;  4KQV A;  4X62 E;  1XNR E;  4B3T I;  3J7A M;  2UXD E;  4X66 E;  4X65 I;  4DR7 E;  4LFA I;  4WUD A;  2UXB I;  4DPU A;  4LF7 I;  4NXN I;  3J81 C;  2HK3 A;  3WU4 A;  4DR5 E;  1HR0 I;  4B3M I;  1EA6 A;  1FI4 A;  1D6T A;  1MX0 A;  4AQY E;  1ZM9 A;  1RR9 A;  4DR1 I;  4KHP I;  1Z0T A;  3GON A;  5FLX Q;  2E5L I;  3WU3 A;  4USK A;  1WUU A;  1N36 E;  4WUC A;  4X65 E;  4I3H A;  1Z5A A;  4LFA E;  4JI4 I;  3T1H I;  2UXB E;  3M6A A;  5A2Q Q;  4LF7 E;  4NXN E;  3PYD A;  2HFU A;  5IWA I;  4B3M E;  2UXC E;  4R1F A;  4DR1 E;  2J7K A;  4KHP E;  2V34 A;  1KTV A;  4FWD A;  3ZZU A;  3JAM C;  3OTO I;  3V5R A;  5BR8 I;  3K1J A;  2EFG A;  1K47 A;  2VQE I;  1XMQ I;  3T1H E;  3T1Y I;  3HUL A;  4LF8 I;  4DV0 I;  2UUA I;  5GME A;  1Z59 A;  4DPY A;  5IWA E;  4XTJ A;  4DU8 A;  3ZKB A;  4GKK I;  4RPF A;  2HKE A;  2NPF A;  3B8H A;  1HNW I;  1KVK A;  1H74 A;  3OTO E;  5BR8 E;  1Z0B A;  1FNM A;  1NHJ A;  4WUB A;  3J81 Q;  4DV7 I;  2VQE E;  1N0U A;  3T1Y E;  4LF8 E;  4DU7 A;  4DV0 E;  2UUA E;  1PIE A;  4HYM A; 
#chains in the Genus database with same CATH topology
 4WU2 A;  4AXJ A;  4DX6 A;  3L9Z A;  3AD7 C;  1H7U A;  2O3Z A;  2CNN B;  2PN6 A;  1Q8L A;  1PKP A;  4O0I A;  4GKK E;  1N52 B;  1O5J A;  1X31 C;  3FSY A;  1S9G A;  4OZ2 A;  3D4J A;  4IO9 Q;  7AT1 B;  4JI1 J;  2ZHO A;  3KJF B;  2R7Q A;  3ZM7 A;  4DCP B;  3NG8 A;  4HY1 A;  1FJE B;  1CJV A;  3QGG A;  5DZ6 A;  2UUB I;  2U2F A;  5CYQ B;  3LH2 S;  5DQH A;  4M5D B;  4ZLN A;  4MU4 A;  3T3F A;  1AFJ A;  2CQC A;  2FJX A;  4BDP A;  2Y0B B;  4OHV A;  1RKI A;  3ULH A;  4J9R A;  2RVJ A;  5BXI A;  1FK9 B;  1WAC A;  2JEB A;  2KHD A;  4B17 A;  4NYO A;  1GXL A;  1S6O A;  3MM6 A;  1FKP A;  1U48 A;  2HFS A;  2J6S A;  5T7L A;  2E5J A;  3OVA A;  3EIC A;  2Y1J A;  2DNG A;  4L76 A;  4OI4 A;  2CAD A;  5KT5 A;  1XNQ F;  5D4P A;  3SSQ A;  4CRJ A;  1ULR A;  2MDA A;  3GFZ A;  2DTJ A;  2YKQ A;  2DPI A;  1FX4 A;  3Q24 A;  1N33 J;  1Q7Y T;  3AA9 A;  1O0P A;  2PNM A;  2KI2 A;  2QN6 B;  1B0V A;  2DPJ A;  1KWM A;  3M8S A;  4X64 I;  4ECZ A;  2BE9 B;  4BWJ A;  2HRU A;  2ADC A;  2CZ9 A;  4B3R J;  2ZOG A;  2WSC C;  4M5L A;  3GFH A;  4C8L A;  2UV8 A;  4YQW A;  2VPZ B;  5CXT A;  5EHH A;  3NL0 A;  1FVQ A;  2IM2 A;  1LWF A;  1SCJ B;  1Y7P A;  2G9O A;  3I6P A;  3G96 A;  3LP2 A;  1OQ6 A;  2GAG C;  3HD1 A;  5K9F A;  4Z7C A;  3KLE B;  4PAB A;  2CUY A;  3K85 A;  2L3M A;  4B9S A;  3T6J A;  5A6W A;  1TK0 A;  1F2H A;  2V0N A;  2J0Q D;  2MKS A;  4JI5 I;  1ZXN A;  1D0E A;  4RU2 A;  5EWE A;  1U02 A;  4OO1 E;  1NK4 A;  5LL6 R;  2OKQ A;  1N0V C;  4DV4 J;  2C38 B;  1PIL A;  2AZ3 A;  4TNO A;  2RF2 A;  3CUL A;  2Q1L A;  4KBI A;  3H59 A;  4IUF A;  1DQ9 A;  1OPZ A;  3S8S A;  3CCR S;  1WKJ A;  3SDE A;  1Z0G A;  1RTD B;  3PYG A;  2LDY A;  3CJK A;  2FVQ A;  4DFK A;  2XLK A;  1RT7 A;  2ROG A;  2DRD A;  3NLC A;  4B3S F;  2C22 A;  5D0E A;  5CYM B;  5JEA A;  1IBL F;  1IBM E;  1HNZ J;  3DOL A;  3JTP A;  1NJX A;  3PFE A;  1FES A;  4CO5 A;  3TZX A;  3CO9 A;  1X9W A;  4NXM E;  4IOC Q;  3VHQ A;  2HHH J;  2LU2 A;  2MPU A;  3JSR A;  3IRX A;  2QO3 A;  3TVZ A;  3WU5 A;  4ED3 A;  1MW7 A;  4I68 A;  2QFI A;  2M7S A;  2W2P P;  1KN6 A;  1XBW A;  3KLH A;  4IRK A;  2UV8 G;  1LK7 A;  3LAM A;  4WFN Q;  2H4Y B;  1K9M T;  1FDA A;  4RZR A;  3PRY A;  3RW7 A;  4DR5 J;  3ADA C;  3O8W A;  3E01 A;  1Y5L B;  3NOC A;  2RQM A;  4DLE A;  4LFA I;  2OPS A;  3IA0 A;  4NZ7 A;  1YJN S;  1NK7 A;  1LK5 A;  3CJ4 A;  2E9R X;  3GJS B;  4N7T A;  4OZJ A;  1BHN A;  5JUM A;  1KC8 T;  3IM8 A;  1B64 A;  5FII A;  4E2F B;  1RWO B;  3DOK B;  3GCM A;  3WC2 A;  1SQG A;  5KG5 A;  5IXU A;  3MCS A;  3OLA A;  3AQP A;  3CJ5 A;  1WEZ A;  1BC6 A;  4UST A;  3P3E A;  2GO3 A;  2FDN A;  4RWW A;  2BOA A;  3JSY A;  3VAL A;  1XJW B;  3BDP A;  5IWA I;  4UOF A;  2F65 A;  3KLI A;  5KFO A;  4JI4 J;  1QAX A;  4LR7 A;  1L3V A;  1ZTW A;  2EPI A;  3AB2 B;  1WNE A;  2HPU A;  2AT1 B;  2YKN B;  2BJ9 A;  1S1X A;  2DGO A;  1C0U B;  4ICL B;  4LSL A;  2MQM A;  1T9V A;  1C4C A;  3HT3 A;  2ADB A;  4F0H A;  1DTQ A;  3RB4 A;  1U8W A;  2UVR A;  3T1Y J;  3A8K A;  4DV0 J;  3US5 A;  2ZFH A;  1Q8K A;  1UVL A;  2DNZ A;  2DJW A;  1OO0 B;  3KK1 A;  3BSC A;  2MB0 B;  3NEK A;  4UOG A;  5BR8 E;  3FUY A;  4AQY F;  1HWJ A;  4ZKA A;  1S49 A;  3TAM B;  3G9C A;  4CT9 A;  1HBM A;  2ZH4 A;  4G1Q A;  5JVG Q;  3CC4 S;  4KE5 A;  4QWE A;  2APO A;  1IWA A;  2V4Q A;  2JEF A;  2YNI B;  3THP A;  2AU0 A;  3QLH A;  4USH A;  1WF0 A;  5LM7 E;  5K8O A;  5LSO A;  2HNY B;  4CO1 A;  2M9K A;  3ZFV A;  2CNO B;  3GMG A;  2CPX A;  4B3M F;  1TVR A;  2F40 A;  4CO2 A;  2FD2 A;  3LWM A;  1VR6 A;  3J80 C;  4HHU A;  2YNF B;  4Y3C A;  3CF5 Q;  2IYI A;  2G2Y A;  3PG9 A;  3C2P A;  2BR2 B;  4R5P B;  4K0K I;  3OHB A;  1HWK A;  2LXI A;  2IMO A;  3FFI B;  3T1H F;  2XGP A;  2RRN A;  5HVG A;  3BBF A;  2HG4 A;  5ETN A;  2HWI A;  4WP9 A;  1MWQ A;  2BE2 A;  1Q8I A;  4P6Q A;  2ZM6 J;  4KFB B;  2C2Z B;  4ELT A;  4H54 A;  2XQC A;  3DXB A;  2WB4 A;  4DR3 F;  2VAS A;  2WK4 A;  4ISA A;  1X4C A;  4R8U B;  4DF8 A;  3EZ5 A;  3TAQ A;  2QRR A;  4JI2 J;  3OL6 A;  4K4Z A;  2RB7 A;  4IOB A;  2CNL B;  1OPI A;  4AD6 A;  3AOC A;  1RT2 A;  4KSE B;  2R2S A;  4LF6 I;  1ZAW A;  3PKY A;  4PXE A;  4EGL A;  1RRE A;  3H25 A;  5DQI A;  3I0R A;  1V6H A;  1P27 B;  4L6V 3;  1W25 A;  3QJL A;  1VRQ C;  2PO0 A;  2OFG X;  4Y65 A;  1TUV A;  3NWR A;  2EFP A;  1FA0 A;  4K4Y A;  4MYU A;  4C0O C;  3OR1 A;  4DV7 F;  5C0X E;  3M9N B;  4NLP A;  3D1O A;  3MDF A;  3D9B A;  3DU6 A;  1DUR A;  1N36 J;  1MG7 A;  4DUZ E;  2J6T A;  2RE1 A;  2FVS A;  3ITH A;  1NSA A;  1VJQ A;  4FWG A;  3RR8 A;  1FRI A;  3DRR A;  2DIV A;  2DEI A;  2GA7 A;  4D3H A;  3N4W A;  3B4M A;  1KP6 A;  4HI1 A;  4MK9 A;  3AOA A;  3OV7 A;  1A0O B;  4LIW A;  3ILI A;  3ELH A;  4NZ0 A;  2EK6 A;  2KH9 A;  5E3C A;  4O3Q A;  4C8O A;  1UVM A;  5DS7 A;  1HQE B;  4FP9 A;  4LRF A;  2BOP A;  3FJ2 A;  4JI2 I;  2BM1 A;  1JLC A;  1NHI A;  4I0W A;  2ZC3 A;  1NJZ A;  3KLG B;  1NDL A;  3TJA A;  1DJ0 A;  2AX1 A;  1IBK E;  3QO9 B;  4DR6 F;  4ZIT A;  2PNZ B;  1N5Q A;  5A2Q Y;  4WK3 A;  4USW A;  1S1V B;  1OYR A;  1VQL S;  3VR1 A;  1RLD A;  1WF1 A;  4Q2L A;  1JKH A;  3HF5 A;  2HZC A;  5KG3 A;  3RUB L;  2HZV A;  4OZ0 A;  2D69 A;  2B6A B;  2JE6 B;  2HAI A;  1B7Y B;  5D78 A;  1XN9 A;  1LFP A;  3FSI A;  3Q1Q A;  2KM8 C;  3CMA S;  1N36 I;  2UXD E;  2GHV C;  2CQ0 A;  2MGZ A;  3GTY X;  5DRP A;  4X84 A;  4WFZ A;  1UMJ A;  5CHC B;  4USI A;  2DGS A;  2K1R B;  2MKH A;  4M5N A;  2IOP A;  4YS2 A;  3KHH A;  2J9D E;  3Q8V A;  2I9S A;  1T95 A;  3MEC A;  3D0I E;  3WC0 A;  1DBD A;  3J80 U;  4LRC A;  2NPI A;  4QWD A;  3D2W A;  5BYQ A;  1FXR A;  2KO1 A;  2NUU G;  2C39 A;  5E3R A;  1FVS A;  4CLP A;  3NNC A;  4KHP J;  4I7F A;  1QY7 A;  4WXO A;  4ZPB A;  4F4A A;  2V63 A;  1S1T A;  3PW5 A;  1YX2 A;  1RAG B;  1Q0N A;  2GJ2 A;  2LQB A;  4BA2 B;  1KON A;  3QAU A;  2YKA A;  2J7K A;  2QL9 B;  2RAQ A;  3Q8R B;  4ZMM A;  1A9N B;  2ZJQ Q;  5HQM A;  1SPB P;  2AE8 A;  4JP8 A;  1AA1 B;  3DNC A;  4Y2K A;  3G8S A;  5A8W A;  1VQM S;  2W9B A;  2B8Q A;  1U0H A;  5L46 A;  4PG4 A;  1JX4 A;  1RAD B;  1XNQ J;  1X4B A;  3MTJ A;  4DL0 C;  5J2N B;  5F9L A;  3M2R B;  3IC1 A;  3K5N A;  5F8J A;  3OSP A;  3NCR A;  1KSP A;  5HBM A;  4ZA1 A;  4RNH A;  2VDH A;  1SXL A;  3CCZ A;  3I82 A;  3OXL A;  1E6Y B;  2XM3 A;  4N76 A;  4QBU A;  3TO8 A;  4YB7 A;  5F8M A;  1AUD A;  1P6T A;  1HWU A;  5KG2 A;  4RBV A;  5DM7 Q;  2PSZ A;  4FW3 A;  5D77 A;  2BZ2 A;  1NHJ A;  1S9G B;  5EDW A;  5ETT A;  2VQE E;  1VBX A;  1N0U A;  4BCA A;  3LF0 A;  1X5O A;  3Q6M A;  3KUE A;  4LF5 I;  2PO2 B;  3EXY A;  5KFS A;  1YJW S;  5HQ8 A;  4J9P A;  2J8A A;  2D3O 1;  3PJW A;  3DYA A;  3V2U C;  3UN3 A;  2CPE A;  3MM6 B;  1IKX B;  4I67 A;  1OYP A;  3K7R A;  4ZPA A;  2AYG A;  7FDR A;  1F3F A;  2X51 A;  2O1P A;  1N54 B;  3DRY A;  3DRP A;  2DNN A;  5KFP A;  2P9C A;  2VON A;  1BY9 A;  4X4R A;  4A8K A;  5KFL A;  4ID5 A;  3AHP A;  2UUC E;  1XNQ I;  3UR0 A;  3J7A 1;  3MM9 B;  4YUD A;  5IT9 U;  1V5I B;  1XR7 A;  5L1L A;  2LLZ A;  2V9K A;  3MR7 A;  1T9T A;  4DMZ A;  5CD4 A;  1JQG A;  4B3S J;  3G87 A;  5F8H A;  3TWZ A;  1F9H A;  3TUI C;  2OAU A;  2JVR A;  3VGU A;  1I94 E;  4OYW A;  4J9U E;  3RB6 A;  1IBL J;  2KZZ A;  2XEX A;  4DR4 E;  3RW6 A;  1XTZ A;  3HSZ A;  4Q44 A;  1Q8B A;  4NA1 A;  1RHU B;  4KTQ A;  2ATL A;  1IKV B;  2BKO A;  2NN6 F;  3O2I A;  2RNE A;  3Q2T C;  1HNV A;  1TL5 A;  4U8Y A;  1U6F A;  1FTC A;  4N5S A;  3GFY A;  3LNU A;  3M8P A;  6AT1 B;  4ECV A;  4ZCI A;  4NRT A;  3W2V A;  3QZ8 A;  5C2G A;  3MF5 A;  3UNG C;  3ZZ0 A;  1S7I A;  1UEV A;  3HJC A;  4RNM A;  1HI8 A;  2FY8 A;  1HK7 A;  2CZV C;  3S6E A;  1Y4U A;  3SSS A;  2BA0 D;  5KT6 A;  3A3N B;  1TL1 B;  1NDP A;  2Z30 B;  5KTQ A;  3FKB A;  2LJP A;  4DV5 E;  2WB1 D;  2GW8 A;  2RF2 B;  1ZA2 B;  1JXL A;  2IAJ B;  2N82 B;  3QID A;  2VES A;  3LAK A;  4JI3 I;  4CTA B;  4Y34 A;  3K17 A;  1FJG E;  2LKZ A;  2F9D A;  3SDE B;  3G86 A;  4F4X A;  1RU1 A;  3KJN B;  4F4K A;  3LPS A;  4OI1 A;  2KT3 A;  2M88 A;  5KFB A;  5JEA E;  2QA4 G;  2SXL A;  4WF9 Q;  4DUY E;  2W7P A;  4F3Q A;  1X4D A;  5DDQ C;  3AA8 A;  2F4V J;  1FX2 A;  2HW3 A;  4DQP A;  4LCF A;  2OUG A;  2I2Y A;  4Q2M A;  3D7S B;  2LEP A;  2KM8 B;  5IC6 B;  3PHT A;  2FVP A;  3HKW A;  3DLK A;  1U1K A;  1CUL B;  3CE8 A;  4I6Y A;  1RBA A;  4NXM F;  3DMJ A;  4I6W A;  3LGM A;  1MN9 A;  3ZO7 A;  5F8G A;  1EI1 A;  2DB1 A;  4DL4 A;  4LPF A;  2ILZ A;  4FNI A;  4ITS A;  2DK2 A;  5DDO C;  1AB8 A;  3MPV A;  2U1A A;  4DFJ A;  4X4N A;  4C48 A;  2J76 E;  4KT0 C;  5LMU J;  2JEI A;  2RS2 A;  2GQ0 A;  1C4A A;  2R3V A;  3TQE A;  5K36 D;  2DGW A;  1YG0 A;  1OWX A;  3DN9 A;  2ZVI A;  4H4K A;  2MHE A;  1V9O A;  3P4U B;  2AP6 A;  2DIT A;  1JWW A;  3IMQ J;  4N8O A;  1HD0 A;  1CQN A;  2Z5E A;  2JOQ A;  3EM1 A;  5HRO A;  1KFS A;  4RUC A;  5CAB A;  1J5E E;  4FBT A;  2AD9 A;  2Z5C B;  5DRQ A;  4X62 E;  4B3T I;  3GCX P;  3M2U B;  4DR7 E;  4YR0 A;  1RUS A;  4AQY J;  2WRM A;  4I1T A;  1PC5 A;  4O4G A;  2UXB I;  3R5C A;  4YFU A;  4U96 A;  3MEE B;  3OFE A;  1NK6 A;  2DCL A;  2ZVS A;  3NAI A;  1HR0 I;  2YY3 A;  3AXM A;  4YB1 P;  2CJQ A;  3I5A A;  5DG9 A;  2F9J A;  3W7B A;  1Y6Z A;  1GAO A;  2YWE A;  4ALZ A;  3KLI B;  1ITP A;  3WU3 A;  3UE2 A;  2L41 A;  2OHD A;  5KFW A;  1X5S A;  4B3M J;  2I0X A;  4X65 E;  4XIU A;  1SVD A;  2YNG A;  5CYJ A;  3P5T L;  4FXW A;  3BGO P;  4LSL B;  2WVB A;  3CD0 A;  1UVI A;  1FFS B;  1HNI B;  1RAJ A;  4UUX A;  2AJF E;  4ENO A;  2O1W A;  3T1H J;  2UXC E;  3MED A;  3HZG A;  4IFV A;  4MFB B;  5HQL A;  3GU0 A;  4ECW A;  3QJJ A;  5ETL A;  2WOM A;  3K1J A;  2QSW A;  3KK1 B;  4PAA A;  2FHK A;  2ZKT A;  3HHL D;  3KJV B;  4OKG A;  2UU9 F;  3M85 G;  4ZVT B;  4DR3 J;  4ES1 A;  1BQN A;  3GIR A;  5DLF A;  1V5V A;  4DPY A;  5BR8 F;  1U4B A;  3WQP A;  2W4D A;  1S97 A;  4KR0 B;  5HMX A;  1USU A;