1VISA

Crystal structure of mevalonate kinase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
SLIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate kinase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 106
structure length 314
sequence length 314
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1visA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1visA01
4YY3I 4GKKE 4M1KA 2VQFE 2HHHE 4USKA 4X65E 2HK2A 3V5RA 4JV5E 1KIJA 1KTVA 3LTOA 4JI8I 3PYGA 1S16A 4X64E 4NXNI 4LF5E 3ZM7A 2ZM6I 2E5LE 4DUZE 4DR1E 2UXBI 2UU9I 5LMNI 1QZRA 4LFBI 4XTJA 2NPFA 4LF4I 5BR8I 2BV3A 4LFCE 3T1HI 4LF9E 1WUUA 4PRVA 4DV5I 3T1YE 1IBMI 4HACB 3OTOI 5IWAI 4DR2E 2UXCI 4K0KI 1DARA 4DU7A 4B3SE 4JYAI 1J5EI 3LPSA 4FWDA 4DV0I 4DR7I 1S4EA 1N36I 4JI5I 4DR6I 3ZZ0A 1ZM4A 1N32I 2UXDI 1NHJA 2HFUA 1N33I 4GKJE 2UUAI 1HNWI 4DUYI 4JI2I 3ZKDA 1XMOE 4WUCA 1Z5BA 2X7IA 4FWGA 4B3RE 1D6TA 1MX0A 3PYFA 1Z59A 4DV2E 4P52A 3WU6A 1IBKE 4USMA 2X36A 3QT7A 1Z0BA 2UUBE 4KQVA 1Z0VA 4JI0E 4DV4E 3JAMC 4LF6I 1FNMA 1EA6A 4DR4I 4JI7I 5GMDA 1FWKA 1H74A 4HACA 3H4LA 4B3ME 1ZXMA 1HNZI 3J7AG 1ELOA 4GKKI 4JI1I 3HULA 2F4VE 2VQFI 2HHHI 1Z5AA 4X65I 2R3VA 1H73A 1XHKA 4LF7I 1HR0E 3K1JA 4DR3E 3K17A 2BM1A 4WUBA 4OX9E 4X64I 4MYUA 4LF5I 4DV3I 4NXME 4DUZI 2GS8A 2ZBKB 3D4JA 4FN5A 2DEJA 4LF8I 4ZVIA 3JAMQ 4X66E 4X62E 5LMUE 4LFCI 2VQEI 4DV1E 4LF9I 1FI4A 3J7AM 4DR2I 5IT9C 2DEIA 2A2DA 4AQYI 3QT8A 4B3SI 1XMQE 4JI8E 1FJGI 4P7AA 3ZZUA 4DV6I 4JI3E 1I94I 4JI4E 1KVKA 2OI2A 4UT4A 3J80C 2V2VA 1PVGA 1XNQI 4LF4E 3LNUA 2UUCE 1XNRE 4GKJI 2EFGA 4FW9A 5L3JA 4KHPI 4B3TI 4YHHE 2UXCE 2J7KA 4FWHA 3QT6A 1ZM2A 4B3RI 5GMEA 2HKJA 4Z7CA 1HNXI 2R42A 4DV2I 1RREA 1NZ0A 4JI5E 5IT9Q 1IBKI 4ED4A 4JI0I 2UUBI 2WW4A 4I3HA 2UXDE 4PRXA 3J81C 3QT5A 1Z0GA 1RR9A 2BM0A 1N33E 1ZXNA 1EI1A 1NHIA 4B3MI 3J80Q 1IBLE 4DV7E 4DPTA 3B82A 2VF3A 2HK3A 1ZM3A 1ZM9A 4MYTA 2F4VI 2HFSA 1N34E 2HKEA 1N0UA 4DR5E 4Z7YA 2Q2EB 1HR0I 4JI6E 3Q1QA 4DR3I 1Z0WA 1PIEA 4JV5I 4OX9I 1MG7A 4R1FA 3WU3A 1KKHA 4DPUA 3ZKBA 1U2RA 3ZZTA 2E5LI 4LFAE 1PKPA 3J81Q 4X66I 1VISA 1MU5A 3PYEA 5LMUI 4DR1I 4JI1E 1OJ4A 4DV1I 4YY3E 4LF7E 1NHHA 3PYDA 4DPYA 1B63A 3T1YI 1XMQI 4DV3E 4PU9A 5FLXQ 4JI3I 3F0NA 4JI4I 4NXNE 4UTGA 2ZM6E 3WU5A 4LF8E 3B8HA 2A2CA 3GONA 1BKNA 4HY1A 2UUCI 1XNRI 2UXBE 2UU9E 2VQEE 5LMNE 4LFBE 1H7UA 1FKAE 2V34A 5BR8E 4YHHI 3M6AA 3T1HE 4AQYE 4DV5E 1H7SA 4JG4A 4URLA 1IBME 3OTOE 5IWAE 1XMOI 1FJGE 4K0KE 4JYAE 1J5EE 4DV6E 4DV0E 1I94E 4DR7E 2V8PA 1B62A 3WU4A 1N36E 1Z0CA 4DR6E 1XNQE 1N32E 4DV4I 5A2QC 4DXLA 1A6FA 1UEKA 4DU8A 4KHPE 4B3TE 5LL6R 1IBLI 4DV7I 1Z0EA 2UUAE 1HNWE 4DUYE 4JI2E 4HYMA 1HNXE 3CWVA 1N34I 3B78A 1Z0TA 1Z5CA 4DPWA 2ZITA 1FWLA 4DR5I 4RPFA 4JI6I 5FLXC 2V2ZA 2CZ9A 2V2QA 1N0VC 2AJ4A 4LF6E 4HXZA 2XEXA 4DPXA 4WUDA 4NXMI 4LFAI 4JI7E 4DR4E 1H72C 4EMDA 1K47A 2E1RA 1HNZE 2LJPA 3V2UC 4X62I 5A2QQ
chains in the Genus database with same CATH superfamily
3Q83A 4GKKE 4LBPA 5KFHA 1D9FA 3IP0A 4DCJB 2VV5A 2LEAA 4MK9A 1S9EA 2KO1A 2GJ2A 3TVYA 2FDNA 1R31A 1GXTA 2C3YA 2VONA 3K5MA 2CKWA 3SSRA 1EHWA 2AJFE 1HWKA 1GTEA 1NJIT 4L76A 1D1UA 3LF0A 4DR5J 2RD5C 1IBMF 1WUUA 1L3KA 1A9NB 5HP1A 4PRVA 2I1RA 5F0UA 1J27A 4RBUA 5HK4A 1S6UA 1I94F 3OTBA 2V9KA 2V69A 4C11B 1QSLA 3SCKE 3CD0A 3R1LA 1N48A 4OLOA 4A8KA 4KYZA 2B7BB 3M6WA 3MOZA 1VQ7S 4MMOA 4EZ9A 4KHPF 2UXDI 3KJFB 1VQSA 3M2UB 3C15A 3WIVA 1RT3A 4I6WA 4QNJA 1VQ5S 4FF4A 1Y00A 3GIRA 4FW4A 3VGUA 2CQCA 3G6VA 2WHOA 4PG6A 5B7WA 1NKCA 2B8PA 5IOLA 4DQIA 1J2VA 1X4FA 3WU6A 1REVB 3POTA 2NSBA 2A0FB 2UXBJ 3CJ4A 4ZLJA 3OUYA 1FKOB 1R27B 4ZPDA 5DG8A 1QTNB 3IGNA 1RKJA 5E33A 4PXBA 1Q95G 1VRUB 3E01A 1NBEB 1ELOA 2DVIA 1HWUA 1YHQS 2XI2A 1XHKA 3SFUA 3H98A 1HR0E 3F73A 4TU7A 1JLAA 1M90T 4PXCA 2HBRB 1VLOA 4ED2A 2HHQA 3NWGA 4QWDA 2C22A 3RRKA 4DL4A 1WHWA 4X62E 2DNQA 2HG4A 4S0MA 1NK7A 4K8RA 6FDRA 2VB6A 1FI4A 1FJEB 2M9KA 4DG1A 4LQ9A 1QY7A 3IRXA 4ANCA 4Q43A 2ZDPA 3CT9A 1OQ6A 4L75A 1IUJA 1RT6B 4LOMA 4N41A 3BQ1A 1LOUA 3R5GA 5KFLA 4X4RA 3SV4A 4WZMA 2IY5B 3SCIE 2OJ3A 1IJEB 1L5UA 4LF4E 4PR6A 2EFGA 2HHPA 2E5IA 2K1RB 1JMTA 3TJAA 2AKWB 2VU5A 4FXWA 3EYZA 1SUQB 4Q8EA 1NXIA 2FHOB 3QJLA 3I9V9 4C0OC 1FRMA 3DM2B 3CDUA 2R7OA 2E5LJ 4IR9A 2OPSB 2NXJA 1WHVA 2C3UA 3THVA 2CVEA 1RKIA 1BHNA 3HFKA 4FW7A 4OV1A 3FBBA 3HHLD 2I5JA 4K7QA 2YKOA 3HSGA 1XC9A 4CI0B 2VJUA 3QQCD 5M2RA 2F4VF 1GX6A 4KPYA 2BE9B 3HHLA 2EVZA 1E3HA 1G6BA 2IFXA 3FNNA 2MKJA 3SDEA 3U1MA 4JI6E 4ANDA 1EETA 1S1TA 3DD6A 3SQOP 2G0CA 3CCZA 1X9MA 4L6V3 3SZ2A 1MG7A 1CJVA 4TU8A 4WJBA 2ZHAA 4Q0BA 2LXUA 2H48B 4F50A 1RWKB 5ETLA 4UQTA 3DRRA 5FD1A 2HMIB 2PFDA 3FMBA 4DN0A 2ZUAA 4JI1E 4Y0FA 1GMVA 2W01A 5HO4A 4KGMA 2DPIA 1KLMA 3KLHB 2UUBJ 4DPYA 1B63A 2CJKA 2B4OA 5E3QA 4ZPBA 5F0WA 1CC7A 3I5AA 3C6TB 5LMNF 4B3MJ 4YQWA 3M8YA 3I0RB 1XNRI 3TEGA 3G8QA 4AQYE 2JC0A 2CPJA 3OTOE 2OPQB 1E6VB 1KVJA 5IWAE 2LCWA 2YVSA 3W5YA 5C0XE 3KMSA 1HNIB 4EWTA 2JE6A 4M5KA 1B62A 1TUWA 1NM2A 1UWBB 3MM5A 3GV7B 3HDSA 2IOPA 2Z2LA 2V8DA 4DV7F 4DXLA 3KHLA 3QGIA 1MLAA 2WOMA 3PNIA 2QX0A 4EBEA 1U48A 5EL9A 3VV2B 3H8YA 2GVDB 4O3OA 4RPFA 2KU7A 3R7NB 1BQXA 2LQJA 2V2ZA 2UUCJ 3NNHA 2LQ8A 2DRDA 2CDRB 2FB0A 3KNAA 4UOFA 4GKKF 1RT5B 4JB8B 2NR0A 2F9JA 1DY3A 3QSYB 3CCUS 4A8MP 2VA3A 1E3PA 2XULA 2L3MA 5J2PA 3L7ZA 1AUDA 5C24A 2C2EA 1S72S 2LFVA 1ZPVA 2ZOMA 3TAPA 1S6PB 3ZM7A 3IS9A 3J81Y 4KR0B 2Z5BB 4H54A 2PT0A 4IG3B 3GSIA 4AIDA 4ZN1A 2R8GA 2IC3B 4ZVEA 4UQGA 3T1HI 2CG8A 3CXCR 2OKQA 5DNLA 4PG7A 4DX6A 1DARA 2ZBIA 2XO7A 2GMJA 2KJVA 4UZBA 5SUHA 2P8IA 4DR6F 4NLRA 2P5VA 4OL8A 1PBAA 2IERA 1D3WA 3M9MB 4G1IA 5A8WB 2F9DA 2BR0A 2BA9A 5CH7B 4L3KA 1XMOE 2FPHX 4EK2A 5J2MB 1S77D 4PYAA 2JLGA 4F4YA 3GMEA 2ZM6J 2CQ1A 1UEUA 3DLEA 2HZVA 2QFIA 1X31C 1U1NA 3E3XA 5KFDA 1RK8A 1HPZB 3MHYA 1M1HA 2W4CA 2R8HA 5KFKA 4UOCA 2QT7A 2VG6A 4XK8C 2G4BA 2MSTA 1HR0F 1J5EJ 1SJ1A 4V19X 3KLVA 3DLKA 2MLXA 3OL6A 2DR7A 2QLFB 2YH0A 4YB7A 4ID5A 4OKGA 2YX1A 5BYQA 1K8AT 1TV6B 4UOHA 5HI7A 5C2CA 5KFCA 1B3TA 2DH8A 2ZBKB 2HVDA 4ISAA 4LF8I 1Y4UA 3EGZA 3PS3A 1YH8A 4BHQA 3CCMS 2YNHB 3GMGA 3H0PA 5IT9C 4ZIVA 1TL4A 4LF6J 1AFJA 3ELHA 2R2UA 2VPXB 1HNZJ 3J80C 2PEHA 5E3CA 1YBAA 4K4VA 4XPCA 3TZWA 2KVQE 3EGWB 4M5JA 4IFDE 4IQMA 1IWGA 2J7KA 3G8SA 4DV2F 4IRKA 2RF2B 2BR2A 2XC9A 2V9WA 3PRVA 2M8HA 4RNOA 1T3NA 4ED4A 1SC1B 2LQ5A 3TANA 3OJUA 2IOQA 2ILZA 3J7YI 4JOUA 3CVKA 4IH7A 1IN0A 2ZZMA 1RTZA 2DY1A 1EI1A 2MHNA 2PEBA 4P73A 3BR9A 1X0FA 5G0RA 2NZ4A 2HK3A 1VRQC 1LW2A 1UEVA 1I94J 4Z7YA 2DHAA 1NJZA 2AGPA 3FSYA 1CULB 1VI7A 2WP8A 2HBZB 4KTQA 4GKJJ 5KG0A 4X66F 2HNYB 1U2RA 3AY0A 3ZZTA 4KHPJ 1MU5A 3GFXA 4B3RJ 3BV8A 4F25A 3ZTRA 1LWCA 3MEDA 2VESA 3FJ2A 2RU3A 2BRLA 4U67Q 2QZ8A 2BXJA 1G2EA 4KH1B 3SCJE 3GE9A 1SI9A 2CPZA 4O23A 3N6NA 2Y0SD 3FRYA 3A3OB 4N3OA 1WKLA 2DNHA 4HY1A 2UU9E 5M2PA 3OTOF 2HVHA 1H7UA 4LF2A 2OMLA 3R2CJ 4DV5E 4MKVA 4KFBB 3ZTQA 4WIQA 3R2DJ 5ETSA 4EBDA 2VZ9A 3BH7B 3AJ1A 5KFWA 1FWPA 2NSCA 1Z0CA 3W65A 5CZVA 1FNXH 4WU3A 5A2QC 1H7WA 1Q53A 1SQFA 4JI8J 4NLGA 4OHZA 1C0TB 4P74A 3TZXA 3SQGB 5F8LA 1W2IA 3TNVA 5DROA 2CIMA 2D9PA 4KB7A 2XS7A 4MIWA 3MMBA 2HZAA 3W9JA 5KT4A 1YJRA 2B6AA 1IM6A 2IJRA 2CZ9A 4HXZA 4H4MA 2YNGB 4LFAI 3C14A 4YHHJ 3OSPA 4WP8A 4NE9C 3T6BA 3HD2A 4DLEA 1VQYA 1WG5A 2ZKTA 3ZZRA 2DK2A 4HLBA 2BKOA 1LWFA 5HVGA 3RBXA 2ZE2A 4RUAA 2AW0A 1RACB 1KIJA 3BREA 1C4CA 2RQKA 3FBEA 2O1WA 3QZ8A 4U7UK 4LIRA 1U26A 1X4HA 4DL0C 1WEYA 1RHKB 3VZHA 3R5JB 3OVSA 3Q22A 1IKWA 2NPFA 4G6VB 1DURA 1SV5A 5KAKA 2IA6A 1RT2B 4FW3A 4QWAA 1IBMI 4JYAF 4DR2E 1HA1A 2Y1JA 2HNDA 4DR7F 4DU7A 4B3SE 2GGPB 4Q2LA 1FRIA 3KHHA 3J7A1 2VG5B 2Q79A 1EP4A 1TVRB 1OYDA 3AJ2A 4X4PA 4F26A 2HAIA 1S1UB 4YY3J 4EBCA 3KLGA 1S1XA 1NHJA 4DL6A 1NJYA 1S1WB 1WNEA 2XO6A 5C7PA 2N7CA 4ZP9A 3HHKA 1KHWA 2X7IA 2WSFC 5KG2A 2PO0B 1Z59A 3MD3A 1USUA 2FGOA 4IQXA 3A8JA 2C28A 3NLCA 1WI6A 2DNGA 3TI0A 3MFIA 2IESA 4IDKA 3EGVA 1ZAVA 4NA3A 3KNGA 2UVUA 1RTDB 5LMNJ 2NN6E 3M32B 1RAIB 3A12A 2RHSB 1RTJA 2VQFF 2HS4A 1VQ6S 2CXEA 2DGWA 3ZC4A 1NB7A 1NPPA 5C0XC 4ECUA 4LF5F 2GMLA 4RNMA 1RA6A 1N32J 5LSRA 3K17A 4OX9E 3QRRA 4ED6A 4QPXA 1T7PA 3VQTA 1NSAA 4LCGA 3D4JA 4FN5A 3CCWA 4WP3A 1NKBA 4ANEA 4CZCA 2FVPA 2IYGA 1S99A 3NGTA 4DL7A 3LOUA 5F9NA 3MM6B 4WK3A 1ZOTA 4L72B 4YDXA 5KOWA 2DIUA 4DL2A 2CZ4A 4M95A 5DRKA 4MKYA 1DZ5A 5FLXY 3KXDA 2ZH9A 4WU2A 1HHQA 1TFWA 1RAEB 1RU1A 3H90A 3KK2B 4GKKJ 1GMUA 4OHYA 5I3QA 1KRPA 5E2QA 3FSXA 3D1HA 4USWA 2WSEC 4QIEA 5AXNA 2EPIA 3M8PB 3X3UA 4R8UB 2EBGA 3VAFA 2N82B 2MZJA 5AT1B 3M4XA 1LNQA 2G0IA 2Q66A 4QYRA 4C0BA 5IT0A 1LK7A 1LWEA 3KMQA 5ETNA 1E6YA 1Y3KA 3MTKA 5IQ6A 1CBKA 3I0SA 5HMZA 4J9OA 1IBLE 2YWGA 2F4VI 3RB6A 1N34E 5B0AA 1HIYA 3UN2A 2BW2A 4LCFA 1WACA 3CCSS 3LUYA 3T41A 4QU6A 1Z0WA 3HSDA 1B0PA 2YWWA 4IRDA 4IOBA 3V81B 2KT2A 1MROA 5D0RA 5H9FK 3UN5A 3J7ZT 9RUBA 4F4XA 1JLCA 4OLPA 2E9TA 5D3GB 3AD9C 3KK1B 3I9ZA 3UDEA 2E7WA 2YY3A 3DRSB 1F2HA 2JX2A 4WF9Q 1FXLA 1XMQI 5I3PA 1VIXA 1UPMB 3D7SB 3RR7A 3OJSA 3CJ2A 2HZCA 4K2JA 2UU9F 3QAEA 4MKBA 1R3NA 5KFUA 5HQMA 1SJ4P 4ERDA 3RBZA 1D8YA 4B3OA 2CQGA 3VTIA 4FZVA 4FYWB 4YOEA 1UA1A 1HR0J 4CLPA 3M8WA 3WQPA 5C25B 4USUA 2ZBRA 2W24A 2Z2ZA 3CPWR 1SL0A 5KFBA 2CQDA 2MLZA 4RNHA 4F67A 1BWVA 4A8QA 1UL3A 1YRTA 2LEBA 1ZBTA 1XNQE 5D77A 3K0JA 2EWHA 4B3TE 4J3DA 4DV7I 5IS2A 3W5ZA 4EGLA 1CG2A 3DN9A 2H9ZA 5JXSA 2XMMA 2XB2D 3DOLA 3TR5A 2J76E 2LU1A 3GSDA 2ZDOA 4LF4J 3EPGA 3IG1A 1T9WA 5DO2A 3KJQB 3CO0P 4DR4E 2RKIA 1DQ8A 4FF1A 4QIGA 1R0AB 4DOZA 2GQ2A 4IFDC 3UE2A 1T9XA 4X4OA 5CYMA 3M8SA 3L4BC 4USKA 3QLHB 3ISND 4DV3F 2XS5A 1T3OA 3G6YA 1OY9A 1RI7A 2LQBA 4IFYB 4OO1E 1HHTP 2XLJA 1O0PA 3GTYX 2MYFA 4YUDA 3RRGA 5C0XB 2CRLA 2Y9HA 5BR8I 1Q8LA 3BQ2A 1F3VA 3HZEA 4JI6J 3HKMA 1UETA 4DV6F 3NL0A 3DKDA 5BXIA 1N36F 1F5AA 5D0EA 2R7UA 1WOOA 1HYSA 2R7QA 4CNZA 4DR6I 2QL5B 2MZ1A 4X4TA 2Z0GA 2YNIA 5A8RA 4JI1J 4NYZA 1A7GE 2XS2A 2HPUA 3VQSA 4F2SA 1HNWF 2H5EA 4A8WA 3OL7A 3W5XA 2E66A 3ZKDA 3V4IB 4DSEA 4P7TA 1CJTB 3VR1A 3C8YA 2GC8A 5HANA 5CCLA 1H38A 5KFGA 5C2GA 1QJHA 2OTJS 2BJ9A 5DJBA 5H9FJ 2ZD1A 5I4MA 2HQIA 1Z4UA 4CLFA 3JAMC 1CJUB 3SI8A 4AQYJ 4HVZA 3OFHA 5BJRA 3O5TB 4YB5A 3OTOJ 1R8PA 5IWAJ 3PX6A 2B5JA 3NOCA 2HBQB 1A6LA 3AHPA 2HHHF 2AV5A 5CAAA 5FJ4A 4U7CA 4WXWA 4UUWA 4X64F 4KKOB 2W9BB 3FMWA 4GO7X 4N76A 2JEGA 4A8FA 2XG8A 4DR1F 2JHEA 2QGFB 3G82A 4FXVA 3OR2B 2SXLA 2A6MA 4OZJA 4LFCF 1CC8A 1NK8A 3OHAA 5G4DA 2VQEI 4LF9I 1JWWA 1URNA 5L46A 2F65A 2W2MP 3DU6A 2PMZD 1L3VA 1CEZA 3D3CJ 1YKWA 5IQQA 1RHJB 1AYEA 2J9EA 1XERA 4NLTA 3LPYA 1EARA 4RL1A 2W2QP 4NBQA 1SIWB 2HWTA 1HARA 4QIFA 2DR5A 2YKQA 4DV2I 3I82A 4LT6A 5IT9Q 3UHMA 1IBKI 3FSIA 3M6VA 3ENWA 2QG9B 2C39B 1ROFA 4RUBA 3BBBA 1Z0GA 1N33E 5CYQB 9ATCB 2OGUA 1Q8BA 5E3AA 3V6KA 1N34F 3BJYA 3KHGA 3J80Q 3B82A 2NYIA 2VF3A 1NJXA 5GAHU 4B9VA 4GO5X 4CRJA 3HF5A 5K36E 1H2TZ 5CCMA 3M85G 1VDHA 4NXMF 1TL3B 1G4CA 1VC6A 2DNLA 3OXLA 3BGRB 2E5LI 1HHSA 4X66I 2ASJA 3AQOA 1BGXT 5E41A 3PYEA 2BX6A 2NQPA 1AXQA 3G6XA 4IZKA 3SBMA 2AMCB 1YK9A 4CQ1A 1PGZA 4HT5A 3HM9A 4TKTA 3LAKA 4JI3I 1X60A 3BGLA 3M1VB 4IFDB 2NN6C 1YSJA 3KFWX 3CC2S 3VAKA 2PA8D 1VFJA 2MY7A 2CWXA 2VFUA 3H2UB 2RUGA 2UXCF 2EG2A 2A10A 3GCXP 1K0TA 3BO3A 3L9ZA 5D4OA 2B4PA 1REGX 3MPUB 1WF1A 4URLA 2VFTA 2OPRB 1RCOB 2GA7A 2J6UA 3GLLA 1B64A 3KDOA 3M8QB 1QUVA 2HS3A 1MN9A 5F8IA 3QO9A 3QNWB 1UEKA 3W8PA 3Q6MA 5LL6R 1WKJA 5HQ8A 2JEJA 4NRTA 3W2WB 2GO8A 2BW7A 1SPBP 4CO2A 2BE7D 3EPIA 2XYPB 2PD1A 1WSVA 5F8GA 3TA0A 3DC2A 1Z0TA 5CQGA 2ZITA 3UWTA 1R7IA 3MFHA 4B08A 4KGZB 3OQ2A 3A13A 4RO0A 3BGFA 1WD6A 3Q8VA 3NBPA 3T5HA 3MMJA 1QE1B 1JLEA 5HATA 1SKWA 3PXGa 3CDWA 3BZQA 2YTCA 4I0WA 5E3PA 2JFDA 1DLOA 5A2QQ 4TU9A 3HKWA 1M1GA 2C38A 3B54A 5CHCB 4DL5A 1J5OA 2HGLA 3PJWA 2C1EB 2CNLB 1DTQA 4OQJA 4DPOA 1JNRB 3HD1A 4ZJQA 4ZCIA 1T03A 3BH6B 4NCGA 3AH6A 4NLDA 2NPIA 1FEEA 3IM8A 3HK2A 1RWMB 3SIPB 4PG4A 4KHRA 1D9DA 2RQMA 1TFYA 1U0HA 3W2VB 1XBWA 2MJNA 3TUJC 3TQ1A 3T1YE 4I68A 2F3JA 4HT7A 4DV0F 4RNFA 4HL9A 1K44A 1SH0A 2C37A 4JYAI 2GHWA 1QLNA 4A48A 3MR3A 4DR7I 3MEEB 1IQZA 3OSNA 1IR0A 2QL9B 4OI6A 4IR1A 5GMKa 2Y0BB 1ZM4A 5SZTA 3H2VE 2VFSA 4PUOB 3I4HX 2IM3A 1S9EB 4OYWA 1Y10A 3QBCA 3QAUA 1KQSR 4QIWD 3MAAB 3HFVA 4C3LA 1Z5BA 1Q86T 4A8OA 5HVHA 1ZTWA 3PIPQ 5F9LA 3W63A 2FJBB 2OMOA 4P52A 1YDLA 4USTA 2Z5CB 3BSOA 4EI2A 3W60A 1NK6A 3P49B 2UU9J 4DV4E 1N5YA 2J0QD 4M94A 4JI7F 3GP9A 1V9OA 3TVKA 4NZ6A 1FNMA 2HHWA 1EA6A 4EUVA 2XYHB 4DV5J 2OPPB 3H4LA 5D15A 1RADB 1U02A 4NCAA 1ZYQA 4X65F 1K73T 4KV8A 2VQFI 2R3VA 3JSYA 2EFNA 2GQQA 2DNRA 3MM7A 1W25A 2XBPA 4LF5I 4FS2A 1RT1A 3H25A 5DGBA 2DGOA 4EEYA 1SCJB 5FLXU 3TUIC 2DEJA 4ZVIA 2HNZA 1O51A 3K5OA 4CLSA 3POTB 4G1QB 2PNZB 3V6HA 3JTOA 4O3PA 5K8MA 4C8YA 4QIVA 5EGYA 3H1CA 5EHHA 4F7VA 1SJQA 5LT5A 4MKAA 4P7AA 1LW0B 3S01A 4PPDA 4B9NA 1RT7A 2GAGC 4OZ0A 4AFFA 2E5GA 4UY85 1FKPA 4O3NA 1FJCA 3B4TA 4M5LA 5HSPA 1XNRE 4Y34A 4MU4A 4NLQA 3QWUA 3FBFA 4FS1A 4BA2A 3N28A 4N8NA 3QT6A 3N0VA 2NN6B 1S0NA 4X4NA 4JI0F 3SCLE 3AFGA 4JI5E 1OY6A 1IKVA 1OWXA 4I2QB 5EN1A 4OO1C 3J81C 3ITHB 2CJXB 2H3EB 3IRXB 2ROGA 4LRAA 1VJWA 2KXFA 2BMBA 2KZMA 1HQEB 1Q8IA 4H4OA 3HVWA 2DTJA 4DR2J 4Y6IA 3PY8A 5HMWA 4B3SJ 2AJ2A 3A3NB 4MYTA 1GQEA 2MSSA 1KBRA 2ZVSA 3Q6NA 2P9EA 3D6TB 2LVWA 1Y60A 5A8KA 3DLGB 3M7VA 4M5IA 3RR8A 3S6EA 3PFEA 3OLBA 3IWXA 3MMCA 5DLFA 4DPUA 4FF3A 1WELA 3EJMA 2WBMA 3A8EA 4H4KC 3L7OA 1C2PA 3O1LA 3NGRA 1VK8A 4BLGA 3MM8A 1WG1A 4NRUA 4DV1I 5D4LA 2LKZA 4EU0A 3CUNA 2EW9A 3GLJA 4ZVUB 1YI2S 2J6TA 2EFQA 4XDDA 3PG9A 4Q45A 4OYPA 2GHVC 5L39A 3THPA 1UW9A 3DHXA 1CQMA 1OPZA 1YITS 1RCXB 1FKAE 4L3NA 3T1HE 2DHHA 4YS2A 4FYVB 4GQUA 3TARA 4OX9J 1FJGE 4PWWA 4I1TA 1S1VA 5HBMA 1WF0A 5L1LA 2WAQD 2UXDF 1X4BA 2XMTA 3WX4A 3IAM9 2DNNA 4DR1J 4IRCA 5H9EK 1Q16B 4FBTA 2P9CA 4GVLA 2C2NA 3KLIB 3UVJB 1RWUA 3CMQA 3EVMA 3EDRB 2AE8A 2D1CA 1HNXE 4OX8A 4EYIB 3Q2TC 4MK8A 4ETZA 4I7FA 2D3O1 4GVBA 5JEAD 1Q5YA 5E5NA 2G13A 1M0SA 2AT1B 1HNVB 2LDIA 3DOKA 2VBYA 2QC3A 5A6WA 4J37A 2K3KA 5JEAA 4HTJA 2XQCA 3Q8YA 2DNMA 1SC4B 5KFVA 3D6MB 4ZJOA 5GVQA 1VJQA 1AZSB 4JV5E 4OI3A 4USVA 4DFJA 4NXNF 3LTOA 4JI8I 3AA9A 2YKNA 1X0PA 1IBLJ 1QUPA 3BGOP 1KR4A 3C16A 5IM0A 2PIIA 4LVOP 1N34J 2GVZA 4ZCKA 2KVIA 4FNHA 4NPOA 2PO1B 4ZVSB 1MWYA 2HWIA 4OZ3A 4CWBA 5ETVA 2KJWA 1EQ0A 3GG0A 2AP6A 1N36I 4HI2A 4OV6A 2QTWA 3NMRA 3KG0A 4D3GA 1RT4A 4LSNB 2AYMA 4NLXA 2IMWP 2UUAF 4DUYF 5KOXA 3RYLA 3UI3A 3TO8A 4XIUA 1HNWI 5ELWA 1MX0A 4OYBA 4PWUA 1AFIA 2A6OA 3G6ES 2PMWA 5HROB 2W7AA 3PW4A 5KT3A 1TU0B 3GIKA 1SH2A 2N3OA 1MW7A 1NJWA 2DCUB 1WC6A 3TX0A 3ZZYA 5AXLA 2V6AA 4C11A 2UXCJ 2EFPA 1EKRA 3DYAA 1TKXA 3TZYA 1TL5A 3SSSA 2HHHI 4OO1B 3A4TA 4LF7I 2NZCA 1OPIA 1XNQJ 3M2UA 1VIOA 2YKMA 2J5AA 4X64I 1M5HA 4B3TJ 2CZVC 2GS8A 1WOPA 4O4GA 4RBVA 2LDYA 3JAMQ 1T9UA 2QE5A 4LFCI 1REVA 1NCLA 2LLZA 1YRXA 2WTFA 1TK8A 3QT8A 5ETRA 2FLNA 4ED3A 4CO3A 3TAMB 2DO4A 2GAHC 4DR4J 3WBZA 4B9LA 1VRUA 2RSQA 5H9EJ 1FX4A 4ICLB 2VFVA 2PO4A 3DLKB 4WTYA 3QFWA 2POKA 3E2EA 4ID5B 1Y4ZB 3SXLA 4ZPVR 1ZM2A 1T94A 3AXKA 1S6QB 2OEMA 2FHKA 2UVWA 3OXFA 3P3EA 3WC0A 4DUTA 3A1YG 5D8HB 1PYSB 2EEYA 4CLWA 4DFMA 2MZQA 1QAYA 2CQHA 2ZOFA 1ZXNA 5AJ3F 4AE5A 2FGCA 3HJVA 3N9UC 1SL2A 4NCBA 3IMQJ 2HKEA 1WJ9A 3G4SS 2E1PA 1WSRA 5L38A 2VDIA 5D4NA 4ECXA 3OTEA 2FY8A 1U1QA 3ZZZA 4TQRA 3ZZPA 3H20A 4PWDA 2K1RA 3LP1B 4NLUA 1XR5A 3VAMA 4LFAE 1SUQA 1VISA 3DRYA 5KFOA 2JEFA 4W98A 2OIHA 1SQEA 3DM2A 4CO4A 4UZCA 4LBHA 5AE2A 2QYGA 3TRGA 5K14A 3PW7A 2DBBA 3MR7A 2QA1A 4CTAB 2CNOB 2AX0A 4ZVQB 4MH8A 2NXUA 4CM0A 4AXIA 3OXGA 5B0CA 1RHUB 1S48A 1IBME 3NS6A 3NG8A 1I94E 1SC6A 2HMIA 5F8MA 4C7QA 1V6HA 1NDPA 1LWCB 1N56A 2B4UA 2ATLA 1HBNB 3MDFA 3OFGA 2WNRB 4DU8A 5K36B 4KHPE 2QLBB 2N3LA 3A3PB 3CDEA 2APOA 3GV8B 2MGZB 2JOQA 3C6TA 8AT1B 1Z5CA 2HGMA 1ZAXA 3KJVB 2ZBQA 3I0RA 3QGGA 3SFGA 5FLXC 1XR6A 4ED1A 1VYAA 3BKUA 2LA4A 5JVGQ 3G87A 2JH3A 2J9DE 1OYRA 2W7OA 4J9MA 2OPQA 1E6VA 1SVDA 1KQFB 3DLHA 3C6UB 1RQ0A 1UVLA 3FGVA 1HNIA 3GWCA 2DYAA 2FZKB 4X62I 2V4JB 2IBKA 1PKUA 1MWQA 3UDLA 3S8SA 1KONA 2MTLA 2MKKA 4LF8F 1QM9A 2JC1A 3R97A 2ZBPA 3CC4S 2AYEA 2VD3A 4ZVHA 4KO0B 4NZ0A 2GVDA 2L41A 2XY6A 2AYGA 2XY7A 4LF4I 2JFKA 3DGPB 3DOMA 1YJTA 1X9SA 3VZIA 1QSSA 1TP7A 4H4MB 4K0KI 3GR0A 4DEZA 4DV0I 3D6HB 1RT5A 3M30B 2IVFB 2WONB 3DDIA 4WYWA 3CCJS 4DQQA 4NX9A 3ONQA 4J91A 2CQ4A 1SB6A 3D66A 4WCEQ 2GV1A 3VHQA 2FLPA 2P2CB 2AGQA 4JI2I 2I0XA 3L3CA 5LJ3Y 1D6TA 1S6PA 1PAEX 1N5TA 1U45A 5DG9A 1P8GA 1H0HB 2DXFA 1S0MA 4IG3A 3D9BA 3VAIA 1WC0A 4KQVA 3KK3A 2IC3A 3IR6B 2HQCA 2BE2A 4JI7I 3FEXB 2C2ZB 1FWKA 3CF5Q 2C42A 1HD0A 2QIFA 4QW9A 1ZXMA 4C4WA 2ZH8A 1S0OA 3GQCA 3CD7A 4ENOA 1VQ9S 2E1MC 1FDDA 3D28A 4FP9A 4JI1I 2F4VE 1FVSA 1F1BB 2ZWPA 4X65I 2VG7B 4QOTA 4RW7B 4AL7A 5A8WA 5DDOC 4DZ6A 3CGIA 4U8YA 4CYUB 1RLDA 3DMJB 2N4CA 2CAJA 2COLA 2DR8A 3LO3A 4QWEA 2E5HA 2NYHA 1F60B 2FJVA 3W9IA 4FYDA 4YMEA 2WSCC 4ZOSA 2BJ1A 3U27A 3UR0A 3AAWB 5B0FA 1RAHB 4AQYI 5A0YB 3U1YA 1XMQE 1F0XA 3MEGB 1HPZA 4AM3A 2MQ8A 1U6FA 3NNAA 2KH9A 4USHA 1B7YB 1RTJB 3ISNC 1LKZA 4J90A 4R25A 2QV6A 4OZNA 2FJXA 5FDLB 4EFAC 2MKCA 2HBYB 2XMJA 3FQKA 2XHCA 3ENAA 3ENQA 1IWAA 3ZFVA 3D5MA 2VICA 3BPSP 1I5OB 4O3QA 4HHHA 3N79A 2WVDA 1T9TA 1TV6A 1S7HA 5KFMA 4WFAQ 4JI0I 4RW4B 5B0GA 2YNHA 2MDAA 4CNYA 2H4YB 3NKYA 1NHIA 5F3TA 1F2GA 2R7RA 1T02A 3T1YJ 4CT8A 3X1LB 3PO4A 4ETXA 1D9AA 3ULHA 4DV7E 1CLFA 1H6KX 3HLUA 1S79A 1ZM3A 4IZJB 1YGYA 2MEWA 4ELUA 5K5MA 4YR2A 1CPZA 3P3CA 5J1NA 1N0UA 2PMHA 3GV5B 3T3FA 4FBUA 4LFAF 2ZVIA 4ECWA 2YPYA 2YBVA 3PHTA 5GAHI 2ZKUA 3K85A 5KG1A 1X5SA 1R8CA 5LMUF 3J81Q 2RF2A 4AUKA 5HN0A 5FWKA 3C66A 3TZZA 3PR4A 2Y8WA 1KLNA 1N54B 3KLFB 5HVFA 4DV4J 3VGTA 4ES2A 3BB5A 2V2KA 1C1BA 5DQIA 4NEYA 1DAXA 2ZJQQ 4X2BA 4JV0A 2A2CA 2HFNA 3DRPB 1VRTB 2RU9A 4X4VA 1DFDA 5EWEA 2BBEA 5BR8E 4WPAA 4BC9A 1CULA 2VFRA 4DFPA 2CJ9A 5KG3A 4BS2A 3N6LA 2V94A 1XMOI 2DNKA 2DH9A 2JEAB 4J9UE 2Q1LA 2HNYA 1JLCB 2QMXA 4X4UA 2V8PA 2V4RA 3R7SB 1UFLA 4C48A 1X5PA 3KKFA 5CZXA 4DR6E 3EVOA 4F4ZA 4B9UA 3RAMA 1GXLA 1KOOA 4WK1A 1NZ8A 3MTJA 1FRJA 2HHXA 3R5AA 2NXNA 3IWLA 4F3OA 3L95X 4OI4A 2K06A 1YBTA 1NNDA 2Q6CA 3MECB 1P6TA 2FZCB 2CPFA 2IAJB 4F2RA 3I56S 1U09A 4IUFA 1U49A 2R8JA 1XNRJ 2IYIA 2E7XA 1TUGB 1BQMA 1IKXA 4BWJA 4JV2A 1UFKA 2BANB 3UPFA 4TQSA 1H72C 4KFBA 1TKTB 2ASYA 2MJUA 1U1OA 4A8SA 3FUYA 4C8ZA 2GQ0A 4JI5J 2PA3A 2JEBB 5K8OA 2HLTA 2NREA 5LM7E 4HKQA 2R8IA 3KHRA 3EWGA 4NXNI 3DXSX 2B56A 3M2RB 3PJXA 2XLKA 4J9QA 2G2OA 2E1AA 4LFBF 3T5LA 1C0TA 2QJ3A 3SQGA 4ZJLA 5GAGI 4LF9E 1WDDA 1ZA1B 3FFIB 2HQ3A 1K0VA 3G8TA 1W2BR 2PNLA 4NLOA 2YNGA 2W9CB 4CH1A 3CDIA 3MCNA 3IBCB 3CSKA 1IR1A 4NWBA 1QSYA 3DNCA 2VH7A 2EKYA 2UUAI 2AGOA 4DUYI 1ZH5A 4USIA 2DNOA 3WIUA 3PYFA 2KTQA 1PILA 1I51B 4DV2E 5J1EB 1IBKE 1OYPA 3NP5A 4WE1A 4USMA 3J7AN 3RU0A 3I4PA 3JQJA 1PO6A 3OLAA 1FE4A 2AZ1A 4LRDA 4NL5A 5KFIA 1RT2A 5KFAA 5F8HA 3T1HJ 1P9QC 3ETOA 3QRQA 4DI6A 3N6MA 3Q89A 2DD8S 1FJGJ 3BBFA 2GGPA 2CJQA 1HYSB 3D1OA 2MHEA 3KTQA 5F3ZA 2VG5A 2V4QA 4IKAA 3TUZC 3NZKA 1TVRA 3JB9k 1S1UA 1YJ7A 3GJQB 1R0BG 3D68A 1Y4SA 4ZN3A 2DO0A 2HHVA 4DUZI 5K8NA 2VPYB 1RHRB 2OHDA 1WG4A 1HNXJ 4X66E 2PO0A 1U1LA 5DM6Q 3LP2B 5DZ7A 5EDWA 2ZEJA 4C8KA 1XMQF 1P42A 4PPZA 3HT0A 3LQVA 4CDIA 4Z2XA 1RTDA 2DEIA 3H2LA 4CLLA 2XLIA 1QVGR 3M32A 2B4VA 2PE8A 2XMWA 2GW8A 1JLBA 2B5JB 3V6JA 2E29A 4JI3E 4PXEA 4WIIA 1PSDA 2IRUA 4DCPB 3FKBA 2C2MB 2OI2A 8ATCB 1HBMB 3AB2B 2OFHX 3CC7S 4B9TA 1C1CB 1D0EA 4L74A 1YIJS 5L3JA 4JV5J 3VAHA 2YWHA 1BD6A 3B4DA 3H4DA 1TELA 2HKJA 4P2FA 3DRXA 3H7HB 3ZNJ1 1QD1A 4IFVA 3EXCX 5B0EA 1Y11A 4P2XA 4ZVRB 5BYSA 2B43A 4PRXA 4U7UD 3MM6A 4IYQA 1NUEA 2M4MA 3K5NA 3TJ9A 2FC9A 2G2ZA 2AX1A 5EWFA 4MTPA 2ZNYA 5DS7A 3MD1A 5L9NA 2F63A 4DR3F 4P6QA 3VWSA 2KT3A 3GR1A 3IXQA 3KK2A 2Z2YB 4CO5A 3DI6B 2LQ9A 2KN4A 1HBUB 2JZ5A 3AOCA 5T7LB 2NXCA 5C5JA 4DS5A 3CDBA 3M8PA 4R8UA 4FW5A 4K4TA 4RW8B 2WB4A 3WZ0A 2ZUGA 3AA8A 2K3IA 2XMAA 2CVIA 4C0HA 1Q7YT 4YDDB 1I6JA 1NHHA 1B7FA 5IV4A 4DSFA 3M9OB 2X1FA 3R7BB 4NI2A 2XCPA 2HIYA 5DG7A 1TR0A 4O44B 2MQPA 2PDAA 2VJVA 2GFFA 5BR8F 2B7CB 4OJ1A 4K50A 3BO4A 4IH6A 6AT1B 2FUG9 1N8RT 3JXOA 2O01C 2YQ1A 2Y3YA 2V34A 3PDNA 3V6DA 1NK4A 3Q23A 3TJ8A 1YJWS 2E44A 4BDPA 4CLTA 1ZZNA 2HHUA 4LCHA 3MAHA 3VF0B 1B70B 4JYAE 4DR7E 3WU4A 3PM9A 4M5DA 5JEAF 3TUPA 1S12A 1KQKA 4V19J 5D3GA 4NA2A 3KK1A 2Y8YA 2XNRA 3KLEB 2D74B 3JQKA 4DWIA 2CJAA 4DR5F 2CQBA 3E8OA 2LA6A 2AWZA 2R7TA 3Q8SB 4FVMA 3BDPA 4ZPCA 2ZHOA 3IA0A 4NLSA 2AEMA 2V2QA 1N0VC 3SV3A 4DHVA 5C25A 2OP5A 1MU2B 2B3TB 1S0VA 5KG4A 4EMDA 2EC0A 2LJPA 4PXDA 2EC2A 1VOMA 3OL8A 2VQFE 3N01A 3BEGB 5CD4H 3QO9B 2F1DA 3Q8PB 4OZLA 3MCMA 3HFZB 3BSCA 1S16A 4YP3A 1RBOB 4LF5E 3RBDA 2ZH4A 2OFGX 2UXBF 4QR2A 1YVFA 2VQEF 4LF9F 5THWA 1FCAA 2UUTA 1QZRA 5DRQA 4ELVA 2JEIA 4LRFA 1GNKA 3NBPB 4URGA 4OJHA 4HACB 1YJ9S 5T41A 1ZAWA 3AOBA 2W8KA 2UUWA 1TUVA 3OVBA 4LFAJ 1L3TA 1DLOB 1H2VZ 4CH7A 2MY8A 2C38B 2I8EA 1Y3JA 1S6OA 1HQUA 4QR0A 3QLHA 1DTQB 2IMOA 1DHMA 2L9WA 5J2QB 1GT8A 2CQ2A 1R6LA 4MFBB 1IBKF 4RR5A 2ZH3A 3PX4A 2FHMA 1JXVA 4IFYA 5ETPA 4K4YA 1VHFA 5C0XD 3DDNA 4NCGB 1R0CB 2B9EA 3VVUA 3T1AA 2IDEA 3D2WA 1Z0BA 2LXFA 2AZ3A 1Z0VA 2C2KB 2DRAA 5C0XA 3K5PA 3PR5B 3OR1B 3FK4A 3O8WA 2YNFB 3R8YA 2D69A 2DNYA 2KM8C 4O3RA 3EM1A 1IBMJ 3HMJG 1IXKA 3CCQS 2IJFA 3LGNA 2QO3A 3R5CA 4QJVA 4LBIA 3RB4A 3PRYA 3K1JA 1PBUA 1MWZA 3LP0A 1TKZB 2E5LF 3EXYA 4WUBA 2IPOB 3FEZA 2J8AA 1HQ2A 2D3ZA 3CCRS 4OFZA 1SJ3P 1CJTA 1JKHB 1KC8T 1HK7A 3CTRA 2QEXS 5JEAC 1PJ6A 1Q1KA 2RT3A 4DV1E 2RIJA 3J7AM 4JI3F 1TMJA 4OJGA 1CJUA 3R5DA 5HJYA 2NUUG 2VUGA 1U6BA 4J9VA 3NCRA 3OD2A 4BA1B 1XNQI 3LNUA 2NXEA 2BQ3A 2I9SA 3P4UB 3GILA 4B3TI 4KKOA 1YZ7A 2XWYA 3JSRA 2P6SA 1Q5VA 2BKNA 4FPRA 3P8BB 3PVXA 1RHYA 3HVAA 2UUBF 1VQ4S 2G0JA 3OR2A 1WEXA 5E7OB 4M5MA 4TLRA 4YB1P 3P3GA 4B3MF 1N5QA 1V3RA 1RABB 1TAQA 4I4BA 5DDQC 1SIZA 3UNYA 4DPTA 3CDAA 4C98A 2BACA 2Z58B 4NYOA 5IC4B 1RUSA 1IKYA 2J9CA 3R3TA 2V0NA 5DM7Q 1CJKB 3I55S 3FC9A 4BA2B 2XGQA 1NHVA 2ZFHA 4J9NA 1Y9OA 5DNXA 2WVEA 4X4SA 3KUEA 5LMUI 4ZLPA 2IBOA 4PG8A 5EX0A 3OT9A 2W2OP 5U47A 1G3OA 1URRA 2C39A 5LXRA 4H4OB 3I5CA 4OZ2A 3NS7B 5CYQA 4DV3E 4PU9A 4JI4I 3WU5A 5HLFA 2NUHA 2UUCF 3TA2A 3FCWA 3Q8UA 1SH3A 5KFZA 2K7KA 1BKNA 2F4VJ 1QAJA 4EO8A 4DLGA 1KNZA 4QPTA 2XTJP 4JV1A 4PG5A 1TL3A 4IG0B 3M8RA 4I2PB 1M5PC 4DV6E 4OYMA 1QTMA 1N36E 4WKYA 1JK9B 1VQPS 3UD3P 3HO1A 1MNEA 1P27B 4PYDA 2BJ8A 1AT1B 1P9YA 4XPEA 4IFDD 3UD4P 3IN5A 3ET6B 3MF5A 1XMQJ 1HNWE 3MXHP 3GFZA 4IFDA 1TQLA 1FF2A 1DBDA 2ZH2A 5HMYA 1VC0A 1SC3B 1BQNA 2Y1LB 3PV8A 2QYCA 5HBMB 1CS4B 1X7VA 4HI1A 2MPUA 2OPRA 4F04B 1Z2LA 1LK5A 1L3SA 4FNIA 3J7Z5 2GQCA 1MSWD 2HHHE 3M8QA 5I3UB 1M5OC 3V5RA 2KM8B 4MU3A 1KTVA 3JYTB 4KIAA 2Z57B 2MKHA 2ZM6F 4KGVB 3RJMB 4DX7A 1YLXA 3IM9A 4X64E 3MMAB 3QSIA 2WVFA 3W2WA 1Q79A 1SJRA 4DV7J 3RRHA 4DSKA 5EUHA 5CA5A 4DR1E 5KFFA 3JAMY 1I1GA 4V1Ak 1YJNS 2JRSA 4LFBI 3AT1B 4WP9A 5I42B 4LFCE 3O44A 3D6FB 1Q8KA 1RBLA 4URSA 3OHBA 4KC5A 5GADU 2CQIA 2JT2A 5J2NB 4DX5A 4DFKA 1N6QB 2DISA 4IO9Q 1O8BA 1TL1B 2QFJA 1K1QA 5IT9U 4MDTA 1TZ0A 1RAAB 2EKNA 1NHKL 3KUHA 4HDHA 1N33I 4LMZA 5K20B 2R7SA 1RWPB 4RU9A 3QIPB 4FWGA 3J80U 3R6GB 5D0GA 2JJ4D 5LL6d 1KHVA 1ZA2B 2VBXA 4ZCMA 3HZGA 1XWLA 2GVZB 4LF6F 1RAFB 4C9DA 1AB8A 4WFBQ 3PKYA 3W2VA 5BR8J 3N5BA 1HNZF 4LRBA 2ALYB 3ILLA 3J7AG 3MEEA 2FYXA 3PHEA 4R5PB 3GYXB 4J5OA 1RT4B 4DR6J 1FESA 3LGHA 3M9NB 4PUOA 1XTZA 1OMSA 2OO4A 4FPIA 1FNOA 3DXBA 3FVYA 1HBOB 5A6PA 2Z2MA 4NXME 2QLJB 4F4AA 3MAAA 2M88A 3BKFA 4DV1F 2Z56B 2ATCB 3QRPA 1KEKA 1RYSA 1VHIA 1USVA 2PO2B 1UAWA 1WC3A 2JL9A 1T05B 1KDNA 3JSMB 3THTA 2HURA 3Q0AA 2Z5CA 1S97A 2FJEB 1WF2A 2Y1RI 1NH8A 4UF4A 3EGNA 4C8LA 2OPPA 4KGKA 1U0SA 4K59A 4A47A 4Y65A 3DYAB 1TKXB 1KVKA 4GKJF 4N8OA 3I5BA 4CLUA 2XM3A 4FW9A 2RS8A 2YKMB 4B3RF 2UXCE 1U1PA 4A8XA 4J9RA 4O4GB 3GZ7A 1UVIA 3W64A 3LANA 3GIJA 1R6MA 2O5DA 2DGVA 2F40A 3K89A 3VAGA 4G1QA 4JP8A 2PNZA 4ZLLA 3ZTOA 2VQEJ 3Q24A 4LF9J 1DTTB 2IVMA 3CJKB 3RW6A 1B0TA 1LW0A 4F3MA 3P6YC 5F8NA 2BJEA 2GNKA 1FT8A 4WTOB 5A2QU 1CSJA 2WZ1A 1C4AA 4N56A 4DR3I 4C3KA 3ETMA 2QMWA 5KFSA 4KSEB 4OX7A 2NN6D 2J0WA 4ZDNA 3HVTB 2R4FA 2CUYA 1EB0A 3WC2A 2NN6A 3L09A 3ZNUA 2V67A 3GPAA 1TKDA 4DV2J 3EDQB 4I2QA 4OYOA 1IBKJ 2XSJB 4JI8F 3ITHA 3T1YI 3ZO7A 1N88A 2WVBA 2NS1B 4LSZB 2G9OA 1HQEA 4B9SA 1T11A 4F36A 2GCFA 4ILMA 2FJAB 2XWXA 2AHOB 1I3OB 1OS5A 4YHHF 2BEFA 1R8HA 3DLGA 5EX3A 2O67A 2M8DB 1M1KT 4DSLA 5IT4A 4PWDB 1T95A 3M2VB 3TW0A 3MUVP 4K0KE 3CJ5A 1FFSB 2RHQB 5AXKA 2AIRB 2HRUA 4DV0E 4LJMA 1NK9A 1IJFB 1WWHA 4X66J 2KYXA 1Y5LB 5AXMA 1R6YA 4DV4I 2GJFA 2GX8A 1XJWB 1FK9B 2HFOA 5K8PA 2KRRA 2VC0A 5K14B 3MR6A 4JI2E 4IOAQ 4QW8A 3CWVA 3B78A 4MU1A 4HDGA 4JI3J 1NHUA 3PS1A 4DR5I 2FC8A 1GX5A 2VOOA 1FFWB 2RRBA 3GCWP 1XXEA 2OD4A 2KHDA 4QU7A 2CYYA 3H5XA 1XEZA 1WHXA 5L1JA 3PO5A 3K7RA 1UFWA 2R2TA 4JI7E 3IFEA 4RW6B 2OAUA 4CO1A 4YY3F 2E1RA 4LF7F 2IM2A 3CJ0A 5KFRA 3DU5A 4MQYA 2J8SA 1TL7B 4P75A 4X65E 3R5BA 2HK2A 3CEDA 3L7PA 4ZVGA 1T0TV 3C46A 4A8YA 3D3BJ 4KH0B 2EFVA 3KLIA 3OPKA 2RS2A 3UVJA 2AJ0A 4P2MA 2HFZA 2UXBI 4USJC 4QQBA 1RTIA 1PAUB 4J9KA 2BQRA 2XHWA 1WOSA 3TOQA 1JJ2R 3M6UA 1BUXA 1HI1A 2BA1G 2V8HA 1UW4A 3GG1A 2QMUB 4WKRA 1S9FA 1HNVA 5DETA 4JI5I 2BJDA 4NMLA 1N32F 2CG4A 2G1DA 3ZZ0A 1X9WA 4ELTA 4E8UA 1JB0C 1BE4A 1HMVA 5GAEU 2OUGA 1AZSA 1NSPA 1RAOA 1S59A 1FFGB 2PN6A 2BDPA 2VA2A 2K7JA 3NGKA 4JI0E 3DOMB 4E2FB 4OYXA 2PO1A 3JSBA 3OL9A 3K58A 4BWMA 3T6JA 1AROP 2OEJA 2N7YA 4RKUC 4JYAJ 1VS3A 3QZ7A 1LEOA 2PFFB 4DR7J 3CB4A 2ASLA 5C42B 4LSNA 4J9LA 1YRUA 4PQAA 1NPKA 4LSLB 2BABA 4M5GA 4FVCA 3OW2R 3NXZA 5HROA 3KK3B 4NLWA 1YX2A 1VCTA 1UP1A 4I6AA 1JLFB 3R9LA 2BE2B 1EZZB 2YKPA 2LYVA 1FJGI 3D0GE 1BC6A 4OO1D 2KYZA 2ASDA 3MM9B 2BKPA 8RUCA 3P76A 2H65B 1VQNS 2X3GA 1PVGA 3NGUA 2HAFA 4DZDA 4OO1A 1W7WA 3VALA 2VQFJ 4RW9B 2ROPA 1C0UB 1RDRA 2MKYA 3KJNB 4ALZA 4XDCA 4FWHA 4HTIA 1RWXB 4TY8B 1S9GA 1HNXI 4LF5J 2OD6A 2UZAA 2IRXA 2UUBI 2RE1A 2ZJRQ 2UXDE 4NLPA 2C3OA 3QT5A 1RTHA 2DJWA 1RR9A 1JLQB 4QR1A 4B3MI 1X5TA 2CADA 4H4KA 3TAMA 1X8DA 1KSPA 4LUBA 1NZAA 1N4LA 4ICLA 4LREA 1TK5A 4LQ3A 3LW5C 5KFNA 1UVKA 3G96A 4JV5I 2O3DA 4OIXA 4R0JA 4X62F 4ECYA 3DHWC 1S6QA 3NWRA 1ZZFA 3HHLC 1GAOA 4U9RA 2HYIB 1N52B 2HVEA 4DQPA 4G65A 5GAGU 1FDAA 3RW7A 4Q8FA 3PZPA 4NXNE 1BWEA 4PABA 4LF4F 4DF4A 3FZBA 3OFFA 2KB2A 2MLYA 3UCZP 2UUCI 1Q81T 4QNKA 1S49A 4K0KF 3B4MA 5E3RA 3M6AA 2DHGA 4K5RA 2HGNA 2HIQA 3LP1A 4QYZK 1RSCA 4C97A 4LR8A 4KY3A 3GB0A 4NOHA 2UV8G 4O4RA 3PKMA 4JI2F 4DV1J 1EQMA 1VBYA 4U3BA 1KFSA 4PQUA 1UZDA 1C1BB 1Z0EA 2UUAE 2XZWA 4DUYE 4Q7AA 5JVHQ 2RH3A 3P3DA 4JI6F 4U96A 3G71S 3RAXA 3PACA 5DRPA 5KT2A 2DY9A 4CTAA 2VL1A 5HP1B 3K2YA 3QMQA 3MAQA 3CULA 1HWLA 3LAMA 2H1YA 4K4ZA 2XEXA 3MZIA 3HSZA 2IVYA 4JI1F 2Q43A 1P1TA 1UKUA 1M5KC 4ZLNA 4P9SA 3JAMU 2IJNA 1V3ZA 4Q44A 5JUMA 4AL6A 5K36D 2VIHA 3C15B 4M1KA 1RT3B 4RJVA 3QFHA 4IS9A 1HBNA 5J1PA 2YXLA 1WC1A 2WNRA 3HVRA 5K36A 5T14A 2ZM6I 3W62A 4DUZE 2MGZA 4C8NA 3HHEA 3AJDA 4FYYB 2GO4A 2HQGA 4AQYF 4ZKAA 3KJVA 4LVNP 2BV3A 2WBRA 1KWMA 5IWAF 3OUYB 5C0XF 2KXNB 2XYGB 1BQMB 1IKXB 5HMXA 3E01B 1J5EI 2KG0A 3C6UA 1X4EA 1TAUA 4BCAA 4OX6A 3M05A 1FTRA 3OBIA 3FBCA 4X84A 2V4JA 1JLAB 1KQGB 4K4SA 5M2UA 1R89A 3D0HE 3TVZA 2MKSA 1F9EB 2VOPA 1HWJA 3HJCA 4DV3J 1U8WA 1ZPWX 1V5IB 1UDQA 3HJFA 5KFQA 2EI5A 3MPYA 4KO0A 4DG1B 2BJ3A 2P6TA 3DGPA 3MPWA 4LF6I 2N4DA 1OYSA 2IA0A 2VODA 5CABA 4R0EA 2LXIA 3IO1A 4RNNA 1HNZI 3ILIA 2EG1A 2AQ4A 3AXMA 3CNQP 3M30A 4DV6J 3BPDA 2WONA 1H73A 3BS9A 1N36J 2HEKA 2CJBA 2LU2A 2XZTB 4ZVPB 3CDJA 2BUNA 1D8ZA 4HR2A 1KS2A 4MYUA 4TXSA 3AD7C 2X1AA 4W90B 2FVQA 4YR0A 5ETKA 1HNWJ 1H7XA 4FKYA 3NY0A 4OZEA 3O6QA 1BLUA 2ADBA 1QVFR 4WE1B 3K57A 4ECRA 4QYZJ 3TA1A 1EX8A 5KFJA 2I5JB 4JUZA 1WEZA 1XK8A 2ZNZA 4DN9A 3CD6S 2H5JB 1RHMB 3HHLB 1UCNA 1I94I 4N77A 2FJDB 1S76D 3SDEB 1XR7A 3T9NA 1EETB 1S1TB 3EICA 2KHCA 1YHCA 4ZHRA 2J6SA 3CE8A 2VG7A 1CJVB 1XMOF 4GKJI 2HHHJ 3FQLA 3WHIA 4Q0BB 3TWZA 3DLBA 4KHPI 3GJSB 4LF7J 4RW7A 3NNCA 2JLEA 2MQNA 3DRRB 4B3RI 4CYUA 3DMJA 4P71A 2MQQA 2R42A 4WFXA 3MURP 4TY9A 4X64J 2ZC4A 2DGQA 2HQDA 1NK5A 1NEEA 2DHXA 2GHPA 5D6GA 1VQLS 4K2XA 1KLMB 3PS2A 5ITHA 2FLLA 3MCSA 2RDDA 4QWBA 2BM0A 4LFCJ 2M70A 2ABYA 5IV3A 5A0YA 1FRKA 2KFNA 1DRZA 3MEGA 1JLBB 1JLGA 1AW0A 2CPYA 2CQPA 3UQSA 5L9XA 5B08A 2HQFA 1RJJA 1FEHA 4UW2A 2QA4S 2Q2EB 3MUMP 4Q5VA 3TAQA 1QAXA 4ECZA 3WDOA 5FDLA 1PIEA 1IBCB 1NK0A 4Y00A 3BKTA 2J7UA 2DGSA 2JE6B 2EBEA 2R2SA 2W8LA 3ISZA 4KAIA 2ERRA 2UP1A 3MM5B 2E5JA 1UDNA 4IH5A 2O1TA 3P5TL 4IFVB 2AF6A 4RW4A 2BRKA 2WOMB 1JNZB 4IZJD 2U1AA 2RNEA 4LF8E 4IZJA 4Q2MA 5ETTA 4ZVTB 2OTLS 4IFDF 1GTHA 2RAQA 1VQ8S 3PJ9A 1JJHA 1DJ0A 4NASA 4YHHI 3BF4A 1PYOB 2BOAA 4J9PA 4JG4A 1GEHA 2JSXA 2AD9A 4KGXB 3QATA 3U1KA 2ZC3A 4NXMJ 1TK0A 4CIOA 2DITA 2WB1D 4DJBA 5J2PB 1M5SA 2AJQA 3L7ZB 5C24B 2HS0A 1FRLA 4NI2B 3KLFA 4CCHA 1Q78A 3IS9B 2H51B 4ZMMA 2QSWA 3UDCA 2MB0B 4PRFA 4WFZA 2YX7A 2ZOGA 2R7WA 2D3UA 3DRPA 1O5JA 1VRTA 2W25A 1NDLA 3ADAC 3V6DB 2AJ4A 3BSAA 2F8HA 2FHJD 2GO3A 1KVIA 2I6WA 2JEAA 1K47A 4U8VA 4M5DB 4B17A 2DHSA 5KT5A 4J9SA 4ED0A 4YY3I 3O3LA 2FHJA 2J7WA 2Z5EA 3V4MA 2DNPA 4DL3A 3S1TA 2YWEA 4DUZF 3IR7B 2RVJA 2G1HA 3DLLQ 2JVRA 1Y5YA 2B9XA 4FXDA 3VGVA 1H98A 3DLEB 2K2PA 1Z2ZA 2DXEA 4Y3CA 2G2YA 5LMNI 1QAIA 3T5JA 3LALA 4DV5F 3MECA 1OYEA 1LXJA 4HH1A 2IAJA 4DS4A 4O3SA 2OSRA 5KG6A 3FEYB 1FKOA 4ED8A 2HVZA 1WC4A 4RWWA 4WYLA 2VG6B 4AXJA 3IRWP 3BN7A 2BANA 3TQEA 2BA1D 1DQAA 2YX4A 1NO8A 1IR2A 1TKTA 7FD1A 4TVAB 4M8LA 2IM1A 1KD1T 1N32I 2FJWA 4X62J 5GADI 1R6VA 2JEBA 1NLKL 3GIMA 4RLEA 4I69A 4XTTA 4LPFA 2HWHA 3BM7A 1K9MT 4WZQA 1SJFA 3US5A 2FVSA 3M2RA 4YN3B 4ED5A 1R8BA 2E7VA 2D9OA 1HKAA 1HL6A 4M5HA 3RAQA 3KYLA 3ZZOA 3FFIA 1T9VA 3C2PA 2BQUA 3LPEA 3MR2A 2KRBA 1RT6A 3IWNC 4K0KJ 3IR5B 3J81U 1N5SA 4GKKI 2F7VA 4RBTA 4AD6A 2W9CA 1EKSA 4DV0J 1UWAA 3GJTB 3A8KA 2H5IB 1HQUB 1VK3A 4E0DA 2AJ1A 2W2NP 2JNJA 3L7UA 3HCXA 2YQ3A 4TN2A 1M5VC 1RYRA 2BR2B 1VBXA 1UMJA 4QZVB 2W4PA 4KE5A 2DCLA 2F8MA 1VR6A 3CMAS 3H40A 4JI2J 1B4SA 2BVZA 4RUHA 2OPSA 4IOCQ 4AL5A 5LMUE 2BA0G 5J1EA 1W26A 4DR2F 2FY1A 3M7NG 1RGVA 3QJJA 4B3SF 5IXUA 3F44A 3ICLA 5BYRA 1Y5NB 4ZITA 4U3DA 3CJRA 5G0RB 3ZZUA 3CCVS 4G1PA 3DDKA 2W9AA 4JI7J 4TLQA 1LW2B 4JI4E 1Y6ZA 3N5FA 1PJ5A 4ITSA 2V2VA 3G2XA 4HYKA 3OV7A 1SKUB 2WP8B 3LP0B 4X65J 5MLCV 1GK8A 1HFEL 4U6PA 2IHR1 1XN9A 3BSNA 4LF1A 1GH8A 3UFCX 5FIIA 1SBRA 2ZH5A 3R6LB 2NN6F 3MEDB 2UVRA 3QIDA 3LP2A 5KFPA 2YQ0A 2V5HG 1OSCA 2B9WA 3KLHA 4K5SA 2VASA 3Q8QB 2VPZB 3C19A 2CGEA 1JIHA 3BR8A 3SMZA 3JTNA 5ADZA 3PTWA 3PX0A 3BYPA 2H54B 1U25A 2XGPA 1U2FA 1HR0I 1OQ3A 4OX9F 1HBMA 4XO0A 1U1RA 3UDVA 1C1CA 1GMWD 4RZRA 2V68A 2RQ4A 3D67A 3PW0A 3FDSA 4F4WA 1S7IA 4CM2A 1GMWA 2Q3PA 2OLWA 1JX4A 4F0MA 1UWBA 2LMIA 3EVWA 4ATNA 4Y28C 3UW1A 4JI0J 3NGSA 3K8VA 2L08A 1SKSA 3MEKA 4ES3A 1T8EA 4ED7A 2PSZA 3F0NA 1MMNA 4LRCA 2CG9A 4CP5A 4UTGA 2PI5A 1YQHA 4GC6A 3J81j 1X4CA 3GONA 2ZH6A 4PZVA 1OO0B 2W1BA 3QJPA 3JTPA 1BY9A 3MMBB 2HFVA 4OZ5A 3EZ5A 5ETQA 4LFBE 1IKYB 2B6AB 4LR7A 1SKRA 3DLJA 1F6TA 3M6XA 4ZPTR 4GC7A 3DI6A 3C14B 1HBUA 4DBQA 5T7LA 2RB7A 1LWFB 4RW8A 2GIQA 4PEOA 2ZE2B 3LA0A 3RBEA 1IBLF 2CFXA 1A6FA 3NRBA 3I31A 1FA0A 4MIBA 1N5VA 2CNNB 2UV8A 2OSQA 4O44A 2CPHA 2Z5BA 2VHGA 5HLFB 2NLWA 4F3QA 7FDRA 1IKWB 4RX6A 4JI6I 1SV5B 3ILOA 3CO9A 3OTCA 1ACMB 3CJ3A 4WBFA 1GFWB 2A1BA 2XMUA 2HNDB 1WTBA 2X1BA 1U4BA 1YZ6A 2HHTA 2YWKA 3BDEA 2DGUA 4AIMA 3F41A 1R8AA 1XMOJ 3PCOB 3V2UC 1EP4B 2CJYB 1HW9A 1YTYA 3CCLS 2Q6BA 2RRAA 5MAOA 1VBZA 3KLGB 1S1XB 1VBKA 2R8KA 2LEPA 4IO1A 2UXDJ 1F3FA 2W7PA 1UJ6A 4RWXA 3KLEA 4FYXB 2EK1A 4B9MA 3I32A 4Y2KA 1FRHA 3D1QA 4OJ3A 5ETOA 3I87A 4LIWA 5J2MA 3G86A 1XQIA 4GMKA 3KWMA 4IDKB 3BBCA 1UZHA 3BN4A 4NMXA 1AA1B 2FZGB 3KG1A 4CLZA 3I6PA 3W66A 3OTOI 5IWAI 2O1UA 4JBCA 1BQNB 3HSJA 3LPSA 4FWDA 1MU2A 3Q2SC 1XNQF 4ZS6A 3MR5A 1RU2A 4N5SA 2I38A 4OZ1A 3PRDA 4B3TF 3H5YA 5KG5A 1S4FA 3PRBA 3I96A 1Q0NA 1ICEB 1U8SA 2RILA 3D54A 3UCGA 3BO2A 4PCQA 4CH0S 1OY8A 4NXNJ 3RG6A 2YKAA 5GAEI 4TNOA 2C2OB 4DR4F 1BXNA 4UOGA 1F9FA 1RBAA 1PC4A 5GMDA 4HACA 3SYZA 2U2FA 1S10A 4K4UA 4W92B 3ZTPA 4F4KA 2CPEA 2KFZA 5CD4A 1Z5AA 4HH0A 4K4XA 4Y2MA 3FZ2A 1VC5A 4OO1F 4DR3E 4KHMA 3EZUA 4Y2CA 5J2QA 2F8EX 4MJKA 4DMZA 1JJ4A 1FHTA 4MFBA 2UUAJ 4DUYJ 3MWBA 2D7SA 2C2DA 1FO1A 2ZZTA 4RU2A 2J9DA 4OYIA 3FCVA 1LWEB 1Q4RA 2KG1A 1E6YB 4PAAA 4JI4F 5DLGA 3I0SB 2ZJPQ 3OR1A 2XZDB 2YNFA 2MZTA 2B0GA 2Z4PA 2X51A 1YG0A 2RMLA 4I67A 2OELA 3CJTA 4UT4A 3NMAA 1UDSA 3MUTP 2V50A 2AU0A 1VQOS 3NCQA 3CJSA 2Y1IA 1TKZA 4DF8A 2MZSA 1MROB 4ILRA 5GMEA 4Z7CA 2JDJA 2F1FA 4OMFG 5DDRC 3C3LA 4DUZJ 3N4WA 1JKHA 2WW4A 2F5GA 2DT9A 2YWFA 4QWCA 1CQNA 5JEAE 1U7LA 4DDFA 2X3DA 2ZH1A 5F8JA 3OVAA 1JXLA 1WC5A 3PFOA 4ES1A 3PW5A 4B3OB 2HFSA 2QA2A 4NZ7A 4Y2IA 4DR5E 1JXEA 3HP6A 4BA1A 5B0DA 5F41A 3PIOQ 3QGPA 3OFEA 2PNMA 1WKKA 1LFPA 4ZP8A 3PEHA 1X4AA 5DZ6A 3U02A 5AE1A 1KKHA 4B02A 3HPOA 2ZH7A 4U95A 5AE3A 3T9ZA 4KJIA 5CXTA 3BGUA 4MK7A 4QBUA 4DX8H 1PC5A 3T19A 3PYDA 2M5YA 2QSFA 1PJ7A 3ILJA 2GZOA 5AJ3J 3DOLB 4CLKA 4TYBA 5LJ5Y 5DQHA 2VKRA 2UXBE 2VQEE 4P10A 3P06A 4I56A 2E9RX 3IG1B 1IM4A 1WHYA 2FIUA 2XNQA 5ETMA 1CJKA 1ZS6A 4F02A 1A0OB 5KT7A 3KDNA 2RKIB 2KZZA 4LR9A 2OH2A 4P2SA 2XMVA 1KTQA 1F5BA 1PYTA 6FD1A 5DQGA 4DSJA 5CYMB 2BOPA 1N33F 4ZPWR 2CDQA 4OYAA 4C3MA 1UVNA 3W3SA 4KRWA 2GO9A 1JJCB 2FVCA 1QDUB 2DIVA 1NRKA 1RB0A 3A8IA 5K36F 2M0GB 4Z37A 5IT9Y 1FWLA 4M5NA 4OI1A 2M52A 5KFTA 3E51A 4YB6A 2KXHA 3TEHB 4K4WA 4A4JA 3HXMA 4P7VA 2JLFA 3MOJB 2IIHA 3EZOA 2GMHA 4DCOB 4EYHB 4DPXA 4X4QA 4IG0A 3J80Y 2UVVA 1NMEB 4I2PA 3W61A 3G9CA 2WK4A 3CCTA 2YNIB 1LQ9A 5A8RB 2WW8A 1GXUA 3K5LA 2B8QA 4KPCA 3K59A 2RDIA 4EO6A 1NPRA 3HX9A 2VBWA 1S1WA 3PYGA 1VLYA 3ET6A 3P45B 2E5LE 3IGVA 1MMDA 2UU9I 2HVIA 3VGSA 3LWMA 2ZD1B 3H42A 5KT6A 4DV5I 3RZAA 3ENVA 2IM0A 1NH7A 2J65A 3D0IE 1HWIA 2ZWOA 4L73A 3CWJA 3FRZA 2XY5A 4UY8T 4NA1A 4N7TA 1CS4A 4AT1B 1FD2A 2QN6B 4WWSA 2O1VA 2AEFA 5L1IA 1MMLA 2FLOA 1ZETA 3KRNA 2F4FA 2YH1A 2O3ZA 3CW2C 5I3UA 4C8MA 3CCES 3JYTA 4WUCA 3G82B 5D0HA 1IQTA 4ZCLA 2DB1A 3IC1A 3MMAA 2MQLA 4MU0A 3UD5A 4FF2A 2KL8A 4LF8J 4ZIWA 4NYPA 1RTIB 1NU4A 2X36A 3QT7A 2JVOA 2X1GA 2UUBE 5KTQA 1Y5IB 2AYBA 2FQQB 1V3SA 5I42A 1B99A 1YWXA 1H74A 3IBFB 2VC1A 4ZVOB 4B3ME 2RRNA 5J2NA 1X4GA 1N6QA 4YFUA 3HULA 1TL1A 1TTHB 3JS9A 5K9FA 1X5OA 3KG4A 1HMVB 2BM1A 1F9HA 4OI2A 3UR3C 4DV3I 1Z1ZA 4YR3A 3QIPA 3ZTSA 5A2QY 3HKZD 3CIZA 3B6BA 1SQGA 2QLWA 3T1YF 1NKEA 4F8RA 4FKXA 2KFYA 2PGCA 2BA0D 2RJZA 1RISA 4DR2I 3M7ND 2QA4G 2A2DA 4O0NA 1ULRA 4B3SI 1S57A 3HT3A 2DR6A 4EZ6A 1L3UA 3R27A 5K36C 2JWNA 3QPIA 4DV6I 2C3PA 1UPPA 5L8RC 3DFEA 1FTCA 5D78A 1EJ7L 2I2YA 3GYGA 1FD8A 2VDHA 5H1SV 4R5PA 3TP2A 3EUNA 2UUCE 2ROEA 1LWXA 1WDTA 2FVRA 3J7YU 2PI4A 2MKIA 4BC7A 5HQLA 3V81A 1HBOA 4FDFA 2R9LA 1RREA 3GJRB 1F5CA 1VGYA 1NZ0A 3AQPA 4N47A 5JJBA 4IZKB 3GFHA 4DV4F 2R2RA 4ILLA 4I3HA 3MGJA 4KT0C 2PO2A 1Y7PA 5D4PA 1FERA 3DRSA 1OIAA 1T05A 3JSMA 2J0XA 3H5UA 1HI0P 3NOGA 2CWKA 2DNZA 4HHUA 4WFNQ 2DRBA 1WI8A 1FX2A 4ZPAA 3K8WA 4OHXA 2EXUA 2LECA 5RUBA 1KN6A 3RGIA 1RP5A 2CQ3A 5DDPC 3NGDA 4NLYA 1FVQA 4I64A 4A46A 3Q1QA 1UTAA 4OYZA 3NEKA 2KT5A 2AEJA 4YEAA 4OX9I 3QYYA 3SSQA 2W2PP 1VQMS 3CJ8A 1R43A 1S9GB 3LH2S 4OHVA 3GIIA 1UVJA 2ACMA 4DR1I 2V63A 3TX8A 1CVJA 4URQU 1H2UX 3MCOA 3HHDA 1MN7A 2FD2A 5CYJA 1RTHB 2O1PA 3SEOA 4AYBD 1U1MA 3JQMA 3H4BA 4ID8A 2RUSA 1DTTA 5FLXQ 2ACYA 3CJKA 5LOQA 4W4MA 2ZM6E 1ZTTA 7AT1B 4P72A 1XNRF 4FW6A 4DQSA 4WXOA 4QCLA 1U6ZA 5A76A 1JLEB 2QRRA 1WORA 3PW2A 5B09A 1FXDA 3P96A 1H7SA 4JI5F 1NSKL 1XIQA 1J5EE 3HVTA 3GFYA 2XSFA 3RTVA 2WRMA 1Y0HA 4OHWA 1FDBA 1R0AA 4MAKA 1J5OB 1UDOA 2DGXA 5LMUJ 2XSJA 5L1KA 5JMNA 2C3MA 1U2CA 1IBLI 2DR9A 1T03B 2FTRA 3KUGA 5HL7Q 3AOAA 4E98A 2XI3A 1N34I 3CD5A 1U24A 1NAQA 4JI4J 2P9GA 1RLCL 2RQCA 2DKOB 4DQRA 1LFWA 1U0HB 3Q86A 1JQGA 1FXRA 1RAGB 3M85D 2KKHA 4LF6E 2C37B 1FRXA 4WUDA 3R1HA 4NXMI 3U1LA 2HSEB 3NCPA 3BQ0A 2GJIA 3M2VA 2M3DA 4ZP6A 1HNZE 2YPZA 2NCKL 1KP6A 5E0OA 1UJ5A 5IC6B 1APSA 2PC6A 5KFYA 4MT1A 1EAYC 5KG7A 1LV5A 2CPIA 3EX7B 1HW8A 2DH7A 3MPVA 3NAHA 1FK9A 2KDOA 4PQUB 3S7RA 3V4IA 2MQMA 4ZA1A 1RE1B 1RWVB 3VCDA 1YBUA 1NDKA 1FKAF 2BJ7A 1H3DA 3T1HF 4XTJA 1Q82T 1N5YB 1FJGF 2CNKB 3TYTA 3UN3A 2UXCI 1D09B 3AB4B 3VAJA 1KOHA 1S4EA 1PCAA 4RW6A 1PG5B 3BYRA 4KV8B 1X4DA 1NB2A 2LP4A 3MM7B 3U7JA 2HW3A 1TL7A 2HFUA 3RB0A 3CIMA 4GKJE 2W9BA 1HNXF 2EK6A 1RT1B 1DQ9A 1FDNA 2ADCA 4ECSA 2HNZB 4B3RE 4BBYA 4HEA9 4RUCA 4UUXA 3OTDA 4M63A 2B51A 1VQKS 1RZMA 2R7XA 4LFBJ 3IAS9 4DR4I 1WTFA 1UVMA 2D3OR 1RT7B 1U47A 1RA7A 3UO0A 1BMQB 2MXYA 1FKPB 1FJ7A 3LWLA 2OEKA 5DGAA 1V5VA 1U1KA 1OSDA 4JV5F 2DPJA 2KI2A 1B0VA 1P1LA 1RWNB 3HHNB 3GYNA 1VMBA 2D41A 1N33J 2L9DA 3CMES 2HRTA 2K8GA 1IKVB 3KOAA 4GRSA 2Z8QA 4J7CA 1SL1A 1T9YA 3RUBL 4O0IA 3M8ZA 3MI7X 4ZP7A 3GU0A 4JI8E 4NEZA 1ITPA 1UA0A 1AUSL 3AODA 2B9YA 3Q8RB 1XMBA 1Q7LB 3HI9A 4I6YA 2A18A 2HLUA 5HJXA 2GIRA 3W7BA 1LXNA 1G1XA 5A8KB 2QL7B 2E1CA 5B0BA 3EE3A 3UCUP 5C42A 3MMCB 5LXYA 2XCAA 1HD1A 5EWGA 3QGHA 4YHHE 4KQZA 1RAJA 4OI0A 4NLVA 4PKDB 3BGRA 2DXDA 3QWPA 3MM8B 4LSLA 2VKZG 3DGVA 2C2RA 3NS5A 2CPXA 4ER8A 3NAIA 2M7SA 2CQ0A 2IDLA 1FE0A 2XMKA 1JLFA 2Z30B 1KFDA 2R7VA 2GIFA 2L48A 3M1VA 3LGMA 1RWWB 1ZM9A 1YJVA 2A3JA 2DGTA 2IRYA 3EMTA 1O6XA 3MM9A 2V8VA 3WX8A 4ZHRB 2MQOA 2MMYA 4CO0A 4R1FA 3PEJA 2CPDA 2W4DA 3WU3A 1HLWA 1NSQA 4RW9A 1S1VB 2L9NA 1C0UA 3ZKBA 1YJUA 1IVZA 1PKPA 4TY8A 1EIYB 1OJ4A 4ZVFA 4YY3E 4DSIA 3CJQA 4LF7E 2E9ZA 2QLXA 3DCAA 5KFXA 3W8GA 5IFMA 1JLQA 3F56A 3UNGC 1JLGB 2ZBCA 1RWOB 5IZHA 4C6AA 5KFEA 2ZZNA 3B8HA 3ZXWA 4MIAA 2HHSA 1G7CB 4XAKA 1UJ4A 2ZHBA 4I7FB 2O66A 5LMNE 4GVBB 2EFOA 4F0KA 1QE1A 3W9HA 1J5EF 4G3IA 4C8OA 4DR3J 4CLYA 3DOKB 5LSLA 4ECVA 5JEAB 4HHJA 5LSOA 2CA9A 1TMMA 2BYCA 2BZ2A 4KBIA 2WVCA 4WFYA 5DRRA 4F0HA 1N32E 4CT9A 3AD8C 3GCMA 1RXOB 2MZRA 4ECTA 3P5BP 4Y2AA 2RDJA 2M2BA 2VPWB 2YKNB 1SXLA 4D3HA 3O2IA 1K1SA 3W1YC 2VBZA 4HYMA 2V8GA 3C16B 5IM0B 1RHQB 5EKWA 3MPDA 4DPWA 5HAOA 2ALZA 3U1NA 1HI8A 1NDCA 4ZK7M 1S5ZA 2J0SD 3T5KA 3H5SA 4ECQA 2HRYA 2WCXA 4C2MA 3FCHA 2ILYA 3IBWA 4TYAA 3VVTA 2H4WB 3RB3A 3H59A
chains in the Genus database with same CATH topology
2GQ0A 4YY3I 4GKKE 2Z5EA 4M1KA 2VQFE 2HHHE 4USKA 4X65E 2HK2A 3V5RA 4JV5E 1KIJA 1KTVA 3LTOA 4JI8I 3PYGA 1S16A 4X64E 4NXNI 4LF5E 3ZM7A 2ZM6I 2E5LE 2O1WA 4DUZE 2Z5BB 4DR1E 2UXBI 2UU9I 5LMNI 1QZRA 4LFBI 4XTJA 2NPFA 4LF4I 5BR8I 2BV3A 4LFCE 3T1HI 4LF9E 1WUUA 4PRVA 4DV5I 3T1YE 1IBMI 4HACB 3OTOI 5IWAI 4DR2E 2O1UA 2UXCI 4K0KI 1DARA 4DU7A 4B3SE 2PNLA 4JYAI 1J5EI 3LPSA 4FWDA 4DV0I 4DR7I 1S4EA 1N36I 4JI5I 4DR6I 3ZZ0A 2O1VA 1ZM4A 1N32I 2UXDI 1NHJA 2HFUA 1N33I 4GKJE 2UUAI 1HNWI 4DUYI 4JI2I 3ZKDA 1XMOE 4WUCA 3HJCA 1Z5BA 2X7IA 4FWGA 4B3RE 1D6TA 1MX0A 3PYFA 1Z59A 1USUA 4DV2E 4P52A 3WU6A 1IBKE 4USMA 2X36A 3QT7A 1Z0BA 4KQVA 2UUBE 1Z0VA 4JI0E 2Z5CB 4DV4E 3JAMC 4LF6I 1FNMA 1EA6A 4DR4I 4JI7I 5GMDA 1FWKA 1H74A 4HACA 3H4LA 4B3ME 1ZXMA 1HNZI 3J7AG 1ELOA 4GKKI 4JI1I 3HULA 2F4VE 2VQFI 2HHHI 1Z5AA 4X65I 2R3VA 1H73A 3PRYA 1XHKA 4LF7I 1HR0E 3K1JA 4DR3E 3K17A 2BM1A 4WUBA 4OX9E 4X64I 4MYUA 4LF5I 4DV3I 1Y4SA 4NXME 4DUZI 2GS8A 2ZBKB 3D4JA 4FN5A 2DEJA 4LF8I 4ZVIA 3JAMQ 1Y4UA 4X66E 1HK7A 4X62E 1USVA 5LMUE 4LFCI 2VQEI 4DV1E 4LF9I 1FI4A 3J7AM 2Z5CA 4DR2I 5IT9C 2DEIA 2A2DA 4AQYI 3QT8A 4B3SI 1XMQE 4JI8E 1FJGI 4P7AA 3ZZUA 4DV6I 4JI3E 1I94I 4JI4E 1Y6ZA 1KVKA 2OI2A 4UT4A 3J80C 2V2VA 1PVGA 1XNQI 4LF4E 3LNUA 2UUCE 1XNRE 4GKJI 2EFGA 4FW9A 5L3JA 4KHPI 4B3TI 4YHHE 2UXCE 2J7KA 4FWHA 3QT6A 1ZM2A 4B3RI 5GMEA 2HKJA 4Z7CA 1HNXI 2R42A 4DV2I 1RREA 1NZ0A 4JI5E 5IT9Q 1IBKI 4ED4A 4IZKB 2IOQA 4JI0I 2UUBI 2WW4A 4I3HA 2UXDE 4PRXA 3J81C 3QT5A 1Z0GA 1RR9A 2BM0A 1N33E 1ZXNA 1EI1A 1NHIA 4B3MI 2CGEA 3J80Q 1IBLE 4DV7E 4DPTA 3B82A 2VF3A 2HK3A 1ZM3A 1ZM9A 4IZJB 4MYTA 2F4VI 2HFSA 1N34E 2HKEA 1N0UA 3Q6NA 4DR5E 4Z7YA 2Q2EB 1HR0I 4JI6E 3Q1QA 4DR3I 2PNMA 1Z0WA 1PIEA 4JV5I 4OX9I 1MG7A 4R1FA 3WU3A 1KKHA 4DPUA 3K85A 3ZKBA 1U2RA 3ZZTA 2E5LI 4LFAE 1PKPA 3J81Q 4X66I 1VISA 1MU5A 3PYEA 5FWKA 5LMUI 4DR1I 4JI1E 1OJ4A 4DV1I 2O1TA 4IZKA 4YY3E 4LF7E 1NHHA 3PYDA 4DPYA 1B63A 3T1YI 1XMQI 4IZJD 4DV3E 4PU9A 5FLXQ 4JI3I 2CG9A 3F0NA 4JI4I 4NXNE 4UTGA 2ZM6E 3WU5A 4LF8E 3B8HA 4IZJA 2A2CA 3GONA 4N3OA 1BKNA 4HY1A 2UUCI 1XNRI 2UXBE 2UU9E 2VQEE 5LMNE 4LFBE 3P06A 1H7UA 1FKAE 2V34A 5BR8E 4YHHI 3M6AA 3T1HE 4AQYE 4DV5E 1H7SA 4JG4A 4URLA 1IBME 3OTOE 5IWAE 1XMOI 1FJGE 4K0KE 4JYAE 1J5EE 4DV6E 4DV0E 1I94E 4DR7E 2V8PA 1B62A 3WU4A 1N36E 1Z0CA 4DR6E 1XNQE 2IOPA 1N32E 4DV4I 5A2QC 4DXLA 1A6FA 1UEKA 4DU8A 3Q6MA 4KHPE 4B3TE 5LL6R 1IBLI 4DV7I 1Z0EA 2UUAE 1HNWE 4DUYE 4JI2E 4HYMA 1HNXE 3CWVA 1N34I 3B78A 2Z5BA 1Z0TA 1Z5CA 4DPWA 2ZITA 1FWLA 4DR5I 4RPFA 4JI6I 5FLXC 2V2ZA 2CZ9A 2V2QA 1N0VC 2AJ4A 4LF6E 4HXZA 2XEXA 4DPXA 4WUDA 4NXMI 4LFAI 4JI7E 4DR4E 1H72C 4EMDA 1K47A 2E1RA 1HNZE 2LJPA 3V2UC 4X62I 5A2QQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 I;  4GKK E;  4M1K A;  2VQF E;  2HHH E;  4USK A;  4X65 E;  2HK2 A;  3V5R A;  4JV5 E;  1KIJ A;  1KTV A;  3LTO A;  4JI8 I;  3PYG A;  1S16 A;  4X64 E;  4NXN I;  4LF5 E;  3ZM7 A;  2ZM6 I;  2E5L E;  4DUZ E;  4DR1 E;  2UXB I;  2UU9 I;  5LMN I;  1QZR A;  4LFB I;  4XTJ A;  2NPF A;  4LF4 I;  5BR8 I;  2BV3 A;  4LFC E;  3T1H I;  4LF9 E;  1WUU A;  4PRV A;  4DV5 I;  3T1Y E;  1IBM I;  4HAC B;  3OTO I;  5IWA I;  4DR2 E;  2UXC I;  4K0K I;  1DAR A;  4DU7 A;  4B3S E;  4JYA I;  1J5E I;  3LPS A;  4FWD A;  4DV0 I;  4DR7 I;  1S4E A;  1N36 I;  4JI5 I;  4DR6 I;  3ZZ0 A;  1ZM4 A;  1N32 I;  2UXD I;  1NHJ A;  2HFU A;  1N33 I;  4GKJ E;  2UUA I;  1HNW I;  4DUY I;  4JI2 I;  3ZKD A;  1XMO E;  4WUC A;  1Z5B A;  2X7I A;  4FWG A;  4B3R E;  1D6T A;  1MX0 A;  3PYF A;  1Z59 A;  4DV2 E;  4P52 A;  3WU6 A;  1IBK E;  4USM A;  2X36 A;  3QT7 A;  1Z0B A;  2UUB E;  4KQV A;  1Z0V A;  4JI0 E;  4DV4 E;  3JAM C;  4LF6 I;  1FNM A;  1EA6 A;  4DR4 I;  4JI7 I;  5GMD A;  1FWK A;  1H74 A;  4HAC A;  3H4L A;  4B3M E;  1ZXM A;  1HNZ I;  3J7A G;  1ELO A;  4GKK I;  4JI1 I;  3HUL A;  2F4V E;  2VQF I;  2HHH I;  1Z5A A;  4X65 I;  2R3V A;  1H73 A;  1XHK A;  4LF7 I;  1HR0 E;  3K1J A;  4DR3 E;  3K17 A;  2BM1 A;  4WUB A;  4OX9 E;  4X64 I;  4MYU A;  4LF5 I;  4DV3 I;  4NXM E;  4DUZ I;  2GS8 A;  2ZBK B;  3D4J A;  4FN5 A;  2DEJ A;  4LF8 I;  4ZVI A;  3JAM Q;  4X66 E;  4X62 E;  5LMU E;  4LFC I;  2VQE I;  4DV1 E;  4LF9 I;  1FI4 A;  3J7A M;  4DR2 I;  5IT9 C;  2DEI A;  2A2D A;  4AQY I;  3QT8 A;  4B3S I;  1XMQ E;  4JI8 E;  1FJG I;  4P7A A;  3ZZU A;  4DV6 I;  4JI3 E;  1I94 I;  4JI4 E;  1KVK A;  2OI2 A;  4UT4 A;  3J80 C;  2V2V A;  1PVG A;  1XNQ I;  4LF4 E;  3LNU A;  2UUC E;  1XNR E;  4GKJ I;  2EFG A;  4FW9 A;  5L3J A;  4KHP I;  4B3T I;  4YHH E;  2UXC E;  2J7K A;  4FWH A;  3QT6 A;  1ZM2 A;  4B3R I;  5GME A;  2HKJ A;  4Z7C A;  1HNX I;  2R42 A;  4DV2 I;  1RRE A;  1NZ0 A;  4JI5 E;  5IT9 Q;  1IBK I;  4ED4 A;  4JI0 I;  2UUB I;  2WW4 A;  4I3H A;  2UXD E;  4PRX A;  3J81 C;  3QT5 A;  1Z0G A;  1RR9 A;  2BM0 A;  1N33 E;  1ZXN A;  1EI1 A;  1NHI A;  4B3M I;  3J80 Q;  1IBL E;  4DV7 E;  4DPT A;  3B82 A;  2VF3 A;  2HK3 A;  1ZM3 A;  1ZM9 A;  4MYT A;  2F4V I;  2HFS A;  1N34 E;  2HKE A;  1N0U A;  4DR5 E;  4Z7Y A;  2Q2E B;  1HR0 I;  4JI6 E;  3Q1Q A;  4DR3 I;  1Z0W A;  1PIE A;  4JV5 I;  4OX9 I;  1MG7 A;  4R1F A;  3WU3 A;  1KKH A;  4DPU A;  3ZKB A;  1U2R A;  3ZZT A;  2E5L I;  4LFA E;  1PKP A;  3J81 Q;  4X66 I;  1VIS A;  1MU5 A;  3PYE A;  5LMU I;  4DR1 I;  4JI1 E;  1OJ4 A;  4DV1 I;  4YY3 E;  4LF7 E;  1NHH A;  3PYD A;  4DPY A;  1B63 A;  3T1Y I;  1XMQ I;  4DV3 E;  4PU9 A;  5FLX Q;  4JI3 I;  3F0N A;  4JI4 I;  4NXN E;  4UTG A;  2ZM6 E;  3WU5 A;  4LF8 E;  3B8H A;  2A2C A;  3GON A;  1BKN A;  4HY1 A;  2UUC I;  1XNR I;  2UXB E;  2UU9 E;  2VQE E;  5LMN E;  4LFB E;  1H7U A;  1FKA E;  2V34 A;  5BR8 E;  4YHH I;  3M6A A;  3T1H E;  4AQY E;  4DV5 E;  1H7S A;  4JG4 A;  4URL A;  1IBM E;  3OTO E;  5IWA E;  1XMO I;  1FJG E;  4K0K E;  4JYA E;  1J5E E;  4DV6 E;  4DV0 E;  1I94 E;  4DR7 E;  2V8P A;  1B62 A;  3WU4 A;  1N36 E;  1Z0C A;  4DR6 E;  1XNQ E;  1N32 E;  4DV4 I;  5A2Q C;  4DXL A;  1A6F A;  1UEK A;  4DU8 A;  4KHP E;  4B3T E;  5LL6 R;  1IBL I;  4DV7 I;  1Z0E A;  2UUA E;  1HNW E;  4DUY E;  4JI2 E;  4HYM A;  1HNX E;  3CWV A;  1N34 I;  3B78 A;  1Z0T A;  1Z5C A;  4DPW A;  2ZIT A;  1FWL A;  4DR5 I;  4RPF A;  4JI6 I;  5FLX C;  2V2Z A;  2CZ9 A;  2V2Q A;  1N0V C;  2AJ4 A;  4LF6 E;  4HXZ A;  2XEX A;  4DPX A;  4WUD A;  4NXM I;  4LFA I;  4JI7 E;  4DR4 E;  1H72 C;  4EMD A;  1K47 A;  2E1R A;  1HNZ E;  2LJP A;  3V2U C;  4X62 I;  5A2Q Q; 
#chains in the Genus database with same CATH topology
 3Q83 A;  4GKK E;  4LBP A;  5KFH A;  1D9F A;  3IP0 A;  4DCJ B;  2VV5 A;  2LEA A;  4MK9 A;  1S9E A;  2KO1 A;  2GJ2 A;  3TVY A;  2FDN A;  1R31 A;  1GXT A;  2C3Y A;  2VON A;  3K5M A;  2CKW A;  3SSR A;  1EHW A;  2AJF E;  1HWK A;  1GTE A;  1NJI T;  4L76 A;  1D1U A;  3LF0 A;  4DR5 J;  2RD5 C;  1IBM F;  1WUU A;  1L3K A;  1A9N B;  5HP1 A;  4PRV A;  2I1R A;  5F0U A;  1J27 A;  4RBU A;  5HK4 A;  1S6U A;  1I94 F;  3OTB A;  2V9K A;  2V69 A;  4C11 B;  1QSL A;  3SCK E;  3CD0 A;  3R1L A;  1N48 A;  4OLO A;  4A8K A;  4KYZ A;  2B7B B;  3M6W A;  3MOZ A;  1VQ7 S;  4MMO A;  4EZ9 A;  4KHP F;  2UXD I;  3KJF B;  1VQS A;  3M2U B;  3C15 A;  3WIV A;  1RT3 A;  4I6W A;  4QNJ A;  1VQ5 S;  4FF4 A;  1Y00 A;  3GIR A;  4FW4 A;  3VGU A;  2CQC A;  3G6V A;  2WHO A;  4PG6 A;  5B7W A;  1NKC A;  2B8P A;  5IOL A;  4DQI A;  1J2V A;  1X4F A;  3WU6 A;  1REV B;  3POT A;  2NSB A;  2A0F B;  2UXB J;  3CJ4 A;  4ZLJ A;  3OUY A;  1FKO B;  1R27 B;  4ZPD A;  5DG8 A;  1QTN B;  3IGN A;  1RKJ A;  5E33 A;  4PXB A;  1Q95 G;  1VRU B;  3E01 A;  1NBE B;  1ELO A;  2DVI A;  1HWU A;  1YHQ S;  2XI2 A;  1XHK A;  3SFU A;  3H98 A;  1HR0 E;  3F73 A;  4TU7 A;  1JLA A;  1M90 T;  4PXC A;  2HBR B;  1VLO A;  4ED2 A;  2HHQ A;  3NWG A;  4QWD A;  2C22 A;  3RRK A;  4DL4 A;  1WHW A;  4X62 E;  2DNQ A;  2HG4 A;  4S0M A;  1NK7 A;  4K8R A;  6FDR A;  2VB6 A;  1FI4 A;  1FJE B;  2M9K A;  4DG1 A;  4LQ9 A;  1QY7 A;  3IRX A;  4ANC A;  4Q43 A;  2ZDP A;  3CT9 A;  1OQ6 A;  4L75 A;  1IUJ A;  1RT6 B;  4LOM A;  4N41 A;  3BQ1 A;  1LOU A;  3R5G A;  5KFL A;  4X4R A;  3SV4 A;  4WZM A;  2IY5 B;  3SCI E;  2OJ3 A;  1IJE B;  1L5U A;  4LF4 E;  4PR6 A;  2EFG A;  2HHP A;  2E5I A;  2K1R B;  1JMT A;  3TJA A;  2AKW B;  2VU5 A;  4FXW A;  3EYZ A;  1SUQ B;  4Q8E A;  1NXI A;  2FHO B;  3QJL A;  3I9V 9;  4C0O C;  1FRM A;  3DM2 B;  3CDU A;  2R7O A;  2E5L J;  4IR9 A;  2OPS B;  2NXJ A;  1WHV A;  2C3U A;  3THV A;  2CVE A;  1RKI A;  1BHN A;  3HFK A;  4FW7 A;  4OV1 A;  3FBB A;  3HHL D;  2I5J A;  4K7Q A;  2YKO A;  3HSG A;  1XC9 A;  4CI0 B;  2VJU A;  3QQC D;  5M2R A;  2F4V F;  1GX6 A;  4KPY A;  2BE9 B;  3HHL A;  2EVZ A;  1E3H A;  1G6B A;  2IFX A;  3FNN A;  2MKJ A;  3SDE A;  3U1M A;  4JI6 E;  4AND A;  1EET A;  1S1T A;  3DD6 A;  3SQO P;  2G0C A;  3CCZ A;  1X9M A;  4L6V 3;  3SZ2 A;  1MG7 A;  1CJV A;  4TU8 A;  4WJB A;  2ZHA A;  4Q0B A;  2LXU A;  2H48 B;  4F50 A;  1RWK B;  5ETL A;  4UQT A;  3DRR A;  5FD1 A;  2HMI B;  2PFD A;  3FMB A;  4DN0 A;  2ZUA A;  4JI1 E;  4Y0F A;  1GMV A;  2W01 A;  5HO4 A;  4KGM A;  2DPI A;  1KLM A;  3KLH B;  2UUB J;  4DPY A;  1B63 A;  2CJK A;  2B4O A;  5E3Q A;  4ZPB A;  5F0W A;  1CC7 A;  3I5A A;  3C6T B;  5LMN F;  4B3M J;  4YQW A;  3M8Y A;  3I0R B;  1XNR I;  3TEG A;  3G8Q A;  4AQY E;  2JC0 A;  2CPJ A;  3OTO E;  2OPQ B;  1E6V B;  1KVJ A;  5IWA E;  2LCW A;  2YVS A;  3W5Y A;  5C0X E;  3KMS A;  1HNI B;  4EWT A;  2JE6 A;  4M5K A;  1B62 A;  1TUW A;  1NM2 A;  1UWB B;  3MM5 A;  3GV7 B;  3HDS A;  2IOP A;  2Z2L A;  2V8D A;  4DV7 F;  4DXL A;  3KHL A;  3QGI A;  1MLA A;  2WOM A;  3PNI A;  2QX0 A;  4EBE A;  1U48 A;  5EL9 A;  3VV2 B;  3H8Y A;  2GVD B;  4O3O A;  4RPF A;  2KU7 A;  3R7N B;  1BQX A;  2LQJ A;  2V2Z A;  2UUC J;  3NNH A;  2LQ8 A;  2DRD A;  2CDR B;  2FB0 A;  3KNA A;  4UOF A;  4GKK F;  1RT5 B;  4JB8 B;  2NR0 A;  2F9J A;  1DY3 A;  3QSY B;  3CCU S;  4A8M P;  2VA3 A;  1E3P A;  2XUL A;  2L3M A;  5J2P A;  3L7Z A;  1AUD A;  5C24 A;  2C2E A;  1S72 S;  2LFV A;  1ZPV A;  2ZOM A;  3TAP A;  1S6P B;  3ZM7 A;  3IS9 A;  3J81 Y;  4KR0 B;  2Z5B B;  4H54 A;  2PT0 A;  4IG3 B;  3GSI A;  4AID A;  4ZN1 A;  2R8G A;  2IC3 B;  4ZVE A;  4UQG A;  3T1H I;  2CG8 A;  3CXC R;  2OKQ A;  5DNL A;  4PG7 A;  4DX6 A;  1DAR A;  2ZBI A;  2XO7 A;  2GMJ A;  2KJV A;  4UZB A;  5SUH A;  2P8I A;  4DR6 F;  4NLR A;  2P5V A;  4OL8 A;  1PBA A;  2IER A;  1D3W A;  3M9M B;  4G1I A;  5A8W B;  2F9D A;  2BR0 A;  2BA9 A;  5CH7 B;  4L3K A;  1XMO E;  2FPH X;  4EK2 A;  5J2M B;  1S77 D;  4PYA A;  2JLG A;  4F4Y A;  3GME A;  2ZM6 J;  2CQ1 A;  1UEU A;  3DLE A;  2HZV A;  2QFI A;  1X31 C;  1U1N A;  3E3X A;  5KFD A;  1RK8 A;  1HPZ B;  3MHY A;  1M1H A;  2W4C A;  2R8H A;  5KFK A;  4UOC A;  2QT7 A;  2VG6 A;  4XK8 C;  2G4B A;  2MST A;  1HR0 F;  1J5E J;  1SJ1 A;  4V19 X;  3KLV A;  3DLK A;  2MLX A;  3OL6 A;  2DR7 A;  2QLF B;  2YH0 A;  4YB7 A;  4ID5 A;  4OKG A;  2YX1 A;  5BYQ A;  1K8A T;  1TV6 B;  4UOH A;  5HI7 A;  5C2C A;  5KFC A;  1B3T A;  2DH8 A;  2ZBK B;  2HVD A;  4ISA A;  4LF8 I;  1Y4U A;  3EGZ A;  3PS3 A;  1YH8 A;  4BHQ A;  3CCM S;  2YNH B;  3GMG A;  3H0P A;  5IT9 C;  4ZIV A;  1TL4 A;  4LF6 J;  1AFJ A;  3ELH A;  2R2U A;  2VPX B;  1HNZ J;  3J80 C;  2PEH A;  5E3C A;  1YBA A;  4K4V A;  4XPC A;  3TZW A;  2KVQ E;  3EGW B;  4M5J A;  4IFD E;  4IQM A;  1IWG A;  2J7K A;  3G8S A;  4DV2 F;  4IRK A;  2RF2 B;  2BR2 A;  2XC9 A;  2V9W A;  3PRV A;  2M8H A;  4RNO A;  1T3N A;  4ED4 A;  1SC1 B;  2LQ5 A;  3TAN A;  3OJU A;  2IOQ A;  2ILZ A;  3J7Y I;  4JOU A;  3CVK A;  4IH7 A;  1IN0 A;  2ZZM A;  1RTZ A;  2DY1 A;  1EI1 A;  2MHN A;  2PEB A;  4P73 A;  3BR9 A;  1X0F A;  5G0R A;  2NZ4 A;  2HK3 A;  1VRQ C;  1LW2 A;  1UEV A;  1I94 J;  4Z7Y A;  2DHA A;  1NJZ A;  2AGP A;  3FSY A;  1CUL B;  1VI7 A;  2WP8 A;  2HBZ B;  4KTQ A;  4GKJ J;  5KG0 A;  4X66 F;  2HNY B;  1U2R A;  3AY0 A;  3ZZT A;  4KHP J;  1MU5 A;  3GFX A;  4B3R J;  3BV8 A;  4F25 A;  3ZTR A;  1LWC A;  3MED A;  2VES A;  3FJ2 A;  2RU3 A;  2BRL A;  4U67 Q;  2QZ8 A;  2BXJ A;  1G2E A;  4KH1 B;  3SCJ E;  3GE9 A;  1SI9 A;  2CPZ A;  4O23 A;  3N6N A;  2Y0S D;  3FRY A;  3A3O B;  4N3O A;  1WKL A;  2DNH A;  4HY1 A;  2UU9 E;  5M2P A;  3OTO F;  2HVH A;  1H7U A;  4LF2 A;  2OML A;  3R2C J;  4DV5 E;  4MKV A;  4KFB B;  3ZTQ A;  4WIQ A;  3R2D J;  5ETS A;  4EBD A;  2VZ9 A;  3BH7 B;  3AJ1 A;  5KFW A;  1FWP A;  2NSC A;  1Z0C A;  3W65 A;  5CZV A;  1FNX H;  4WU3 A;  5A2Q C;  1H7W A;  1Q53 A;  1SQF A;  4JI8 J;  4NLG A;  4OHZ A;  1C0T B;  4P74 A;  3TZX A;  3SQG B;  5F8L A;  1W2I A;  3TNV A;  5DRO A;  2CIM A;  2D9P A;  4KB7 A;  2XS7 A;  4MIW A;  3MMB A;  2HZA A;  3W9J A;  5KT4 A;  1YJR A;  2B6A A;  1IM6 A;  2IJR A;  2CZ9 A;  4HXZ A;  4H4M A;  2YNG B;  4LFA I;  3C14 A;  4YHH J;  3OSP A;  4WP8 A;  4NE9 C;  3T6B A;  3HD2 A;  4DLE A;  1VQY A;  1WG5 A;  2ZKT A;  3ZZR A;  2DK2 A;  4HLB A;  2BKO A;  1LWF A;  5HVG A;  3RBX A;  2ZE2 A;  4RUA A;  2AW0 A;  1RAC B;  1KIJ A;  3BRE A;  1C4C A;  2RQK A;  3FBE A;  2O1W A;  3QZ8 A;  4U7U K;  4LIR A;  1U26 A;  1X4H A;  4DL0 C;  1WEY A;  1RHK B;  3VZH A;  3R5J B;  3OVS A;  3Q22 A;  1IKW A;  2NPF A;  4G6V B;  1DUR A;  1SV5 A;  5KAK A;  2IA6 A;  1RT2 B;  4FW3 A;  4QWA A;  1IBM I;  4JYA F;  4DR2 E;  1HA1 A;  2Y1J A;  2HND A;  4DR7 F;  4DU7 A;  4B3S E;  2GGP B;  4Q2L A;  1FRI A;  3KHH A;  3J7A 1;  2VG5 B;  2Q79 A;  1EP4 A;  1TVR B;  1OYD A;  3AJ2 A;  4X4P A;  4F26 A;  2HAI A;  1S1U B;  4YY3 J;  4EBC A;  3KLG A;  1S1X A;  1NHJ A;  4DL6 A;  1NJY A;  1S1W B;  1WNE A;  2XO6 A;  5C7P A;  2N7C A;  4ZP9 A;  3HHK A;  1KHW A;  2X7I A;  2WSF C;  5KG2 A;  2PO0 B;  1Z59 A;  3MD3 A;  1USU A;  2FGO A;  4IQX A;  3A8J A;  2C28 A;  3NLC A;  1WI6 A;  2DNG A;  3TI0 A;  3MFI A;  2IES A;  4IDK A;  3EGV A;  1ZAV A;  4NA3 A;  3KNG A;  2UVU A;  1RTD B;  5LMN J;  2NN6 E;  3M32 B;  1RAI B;  3A12 A;  2RHS B;  1RTJ A;  2VQF F;  2HS4 A;  1VQ6 S;  2CXE A;  2DGW A;  3ZC4 A;  1NB7 A;  1NPP A;  5C0X C;  4ECU A;  4LF5 F;  2GML A;  4RNM A;  1RA6 A;  1N32 J;  5LSR A;  3K17 A;  4OX9 E;  3QRR A;  4ED6 A;  4QPX A;  1T7P A;  3VQT A;  1NSA A;  4LCG A;  3D4J A;  4FN5 A;  3CCW A;  4WP3 A;  1NKB A;  4ANE A;  4CZC A;  2FVP A;  2IYG A;  1S99 A;  3NGT A;  4DL7 A;  3LOU A;  5F9N A;  3MM6 B;  4WK3 A;  1ZOT A;  4L72 B;  4YDX A;  5KOW A;  2DIU A;  4DL2 A;  2CZ4 A;  4M95 A;  5DRK A;  4MKY A;  1DZ5 A;  5FLX Y;  3KXD A;  2ZH9 A;  4WU2 A;  1HHQ A;  1TFW A;  1RAE B;  1RU1 A;  3H90 A;  3KK2 B;  4GKK J;  1GMU A;  4OHY A;  5I3Q A;  1KRP A;  5E2Q A;  3FSX A;  3D1H A;  4USW A;  2WSE C;  4QIE A;  5AXN A;  2EPI A;  3M8P B;  3X3U A;  4R8U B;  2EBG A;  3VAF A;  2N82 B;  2MZJ A;  5AT1 B;  3M4X A;  1LNQ A;  2G0I A;  2Q66 A;  4QYR A;  4C0B A;  5IT0 A;  1LK7 A;  1LWE A;  3KMQ A;  5ETN A;  1E6Y A;  1Y3K A;  3MTK A;  5IQ6 A;  1CBK A;  3I0S A;  5HMZ A;  4J9O A;  1IBL E;  2YWG A;  2F4V I;  3RB6 A;  1N34 E;  5B0A A;  1HIY A;  3UN2 A;  2BW2 A;  4LCF A;  1WAC A;  3CCS S;  3LUY A;  3T41 A;  4QU6 A;  1Z0W A;  3HSD A;  1B0P A;  2YWW A;  4IRD A;  4IOB A;  3V81 B;  2KT2 A;  1MRO A;  5D0R A;  5H9F K;  3UN5 A;  3J7Z T;  9RUB A;  4F4X A;  1JLC A;  4OLP A;  2E9T A;  5D3G B;  3AD9 C;  3KK1 B;  3I9Z A;  3UDE A;  2E7W A;  2YY3 A;  3DRS B;  1F2H A;  2JX2 A;  4WF9 Q;  1FXL A;  1XMQ I;  5I3P A;  1VIX A;  1UPM B;  3D7S B;  3RR7 A;  3OJS A;  3CJ2 A;  2HZC A;  4K2J A;  2UU9 F;  3QAE A;  4MKB A;  1R3N A;  5KFU A;  5HQM A;  1SJ4 P;  4ERD A;  3RBZ A;  1D8Y A;  4B3O A;  2CQG A;  3VTI A;  4FZV A;  4FYW B;  4YOE A;  1UA1 A;  1HR0 J;  4CLP A;  3M8W A;  3WQP A;  5C25 B;  4USU A;  2ZBR A;  2W24 A;  2Z2Z A;  3CPW R;  1SL0 A;  5KFB A;  2CQD A;  2MLZ A;  4RNH A;  4F67 A;  1BWV A;  4A8Q A;  1UL3 A;  1YRT A;  2LEB A;  1ZBT A;  1XNQ E;  5D77 A;  3K0J A;  2EWH A;  4B3T E;  4J3D A;  4DV7 I;  5IS2 A;  3W5Z A;  4EGL A;  1CG2 A;  3DN9 A;  2H9Z A;  5JXS A;  2XMM A;  2XB2 D;  3DOL A;  3TR5 A;  2J76 E;  2LU1 A;  3GSD A;  2ZDO A;  4LF4 J;  3EPG A;  3IG1 A;  1T9W A;  5DO2 A;  3KJQ B;  3CO0 P;  4DR4 E;  2RKI A;  1DQ8 A;  4FF1 A;  4QIG A;  1R0A B;  4DOZ A;  2GQ2 A;  4IFD C;  3UE2 A;  1T9X A;  4X4O A;  5CYM A;  3M8S A;  3L4B C;  4USK A;  3QLH B;  3ISN D;  4DV3 F;  2XS5 A;  1T3O A;  3G6Y A;  1OY9 A;  1RI7 A;  2LQB A;  4IFY B;  4OO1 E;  1HHT P;  2XLJ A;  1O0P A;  3GTY X;  2MYF A;  4YUD A;  3RRG A;  5C0X B;  2CRL A;  2Y9H A;  5BR8 I;  1Q8L A;  3BQ2 A;  1