1VISA

Crystal structure of mevalonate kinase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
SLIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Mevalonate kinase
total genus 106
structure length 314
sequence length 314
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1visA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1visA01
1IBMI 2A2CA 3T1HI 4KQVA 1WUUA 2UXBI 1EI1A 4Z7YA 1J5EI 4LF7I 2F4VE 3HULA 1K47A 4DV2E 1N36I 3GONA 1D6TA 1QZRA 4DR1I 4HY1A 1HNZI 3K17A 4OX9I 4UTGA 5LL6R 4JI8I 1I94I 2V2VA 2UUAI 4LF8E 4DV3E 4LFBI 4LF5I 4DV2I 2GS8A 2EFGA 2J7KA 3F0NA 2BV3A 1XNRI 4X64I 5IT9Q 4LFAE 1Z5CA 1ZXMA 4DV6E 1U2RA 4JG4A 3PYEA 1A6FA 4B3SE 5LMUE 5LMNE 4DPYA 3JAMQ 1HNXE 4YY3I 2VQFE 4URLA 4GKJI 5LMNI 1J5EE 1XNQE 4DV0E 2VQEI 3LTOA 4FWGA 4XTJA 4DV6I 4DUZE 1H7UA 3QT8A 4X66E 4LFAI 1PVGA 3OTOI 2HKJA 4X65E 4DV4I 4JI4E 1NZ0A 4I3HA 4JI0E 2ZBKB 2E5LE 5IWAE 5FLXQ 3M6AA 1KIJA 1IBLE 1UEKA 1Z0CA 2UUAE 1Z0EA 4JI7E 1H7SA 3J81C 1B63A 4FWDA 4AQYE 2A2DA 2UUBI 4DR2I 1MU5A 2UXCE 4FWHA 1XHKA 4HACA 4B3MI 4GKKE 5L3JA 4JI0I 1HR0I 1KKHA 1ZM4A 4DV5E 1HNWE 4JI4I 4DV7I 1BKNA 4X65I 3OTOE 1NHJA 3LNUA 4USMA 3B78A 4DR6E 1MX0A 2UXDE 2UXDI 4RPFA 4MYUA 4NXME 4DV0I 3QT5A 1XNQI 4FW9A 1FI4A 4LF4I 1ZM3A 3WU6A 4JI2E 4GKJE 3T1YE 1HR0E 3T1YI 4GKKI 4B3ME 2R3VA 3PYFA 1Z5BA 3WU4A 2UXBE 1ZXNA 3V2UC 4DR6I 3ZM7A 4DR7I 4R1FA 4NXNE 1XNRE 4DXLA 4DPXA 4ED4A 2OI2A 1ZM9A 5A2QQ 4UT4A 3PYDA 1Z0TA 1N33I 4PRXA 2VF3A 4JI8E 3J80C 1HNZE 4WUDA 5GMEA 2XEXA 1IBLI 5A2QC 4M1KA 4HYMA 3PYGA 4DR5I 2BM1A 4KHPE 4JI2I 1IBKI 1Z0GA 4JI5I 4Z7CA 4DPWA 4X64E 4WUCA 2HHHE 2HFUA 1H72C 1N32I 1FNMA 1PKPA 1RR9A 4DV7E 1HNWI 4DR5E 3J7AG 3Q1QA 1Z59A 4DPUA 1H73A 4YY3E 1XMOI 4LF5E 4DPTA 4JYAE 4DV3I 4LF8I 1ELOA 4DV1I 1N34I 2WW4A 2BM0A 2X36A 3B8HA 4DR1E 2DEIA 3K1JA 4EMDA 1DARA 3D4JA 1XMOE 4B3TI 4USKA 4LF9E 4YHHI 2DEJA 3JAMC 5BR8E 4B3RI 3ZZUA 1FJGE 1KVKA 4OX9E 1MG7A 4JI5E 1IBME 4JI1I 4DV1E 4DR3E 3QT7A 2X7IA 4JYAI 4KHPI 1H74A 1N36E 2ZM6E 2V8PA 1N0UA 1KTVA 1N32E 2HHHI 5LMUI 4B3SI 2HFSA 1NHIA 4FN5A 3T1HE 1FJGI 2HK2A 2V34A 1FWLA 1N0VC 2UU9I 5BR8I 4B3RE 3J80Q 3J81Q 1IBKE 2NPFA 4LF9I 3WU3A 2UUCE 3H4LA 1Z0BA 2Q2EB 4JV5E 1B62A 3B82A 2UXCI 1OJ4A 4LF6I 5IT9C 2HKEA 4P52A 1ZM2A 1EA6A 3LPSA 1N33E 4LF6E 4X62E 4JI7I 1PIEA 3ZKDA 4JI6I 4HXZA 4K0KI 3ZZTA 4LFCI 2E5LI 3CWVA 2LJPA 2F4VI 4LF7E 3V5RA 4LF4E 4PRVA 2CZ9A 4DR4I 4DUYI 4X66I 2V2ZA 4DR4E 1NHHA 1Z0WA 4DV5I 1S16A 5FLXC 3J7AM 4LFCE 2AJ4A 3QT6A 2VQFI 4K0KE 4JI6E 4DU7A 4DR3I 4DR2E 4JI3E 4JI1E 4NXMI 2UUBE 4AQYI 4P7AA 4DUYE 3WU5A 4YHHE 1FWKA 4PU9A 1XMQI 4ZVIA 4B3TE 4WUBA 2UUCI 4LFBE 4MYTA 4DV4E 1XMQE 3ZZ0A 4HACB 4NXNI 4DR7E 4X62I 1I94E 4DUZI 4DU8A 3ZKBA 1N34E 4JI3I 1VISA 2VQEE 2E1RA 1RREA 4JV5I 1FKAE 5IWAI 2R42A 1Z0VA 1Z5AA 5GMDA 2ZM6I 1HNXI 2ZITA 2V2QA 2UU9E 2HK3A 1S4EA
chains in the Genus database with same CATH superfamily
2ASDA 3T1HI 3ET6A 4ZP7A 1QAIA 5M2RA 5FDLB 2B4UA 2VKZG 5ITHA 2UUAJ 4QNJA 2CWXA 1B4SA 1EI1A 5I42A 1RWVB 1WEZA 3NGDA 2G0JA 2JNJA 1N8RT 2UVRA 1FESA 4Q2LA 5C0XF 1FRLA 1W25A 4QJVA 4JI4J 3UCZP 1NK4A 5DRQA 4LF7I 1JLGA 3KLFB 2F4VE 2VDHA 3OTDA 3TEHB 3HULA 1CJUB 4HT7A 4DR4J 1TL3A 3NEKA 2R7RA 3C19A 3I0RA 5GAGI 1URNA 5E3PA 2E5HA 2MQPA 5H9EK 3ZZRA 3IBCB 3FBCA 1D09B 4J9UE 2CYYA 2QA2A 2VBXA 4CLUA 2XLJA 1HNXJ 4LF8F 2BA0D 2XYPB 5ETQA 2U1AA 4HTJA 3T3FA 1HNZI 2VC0A 3Q6NA 5E33A 2CQ3A 4F4WA 1TL4A 5E2QA 4A8YA 2F4VJ 5CYJA 2I0XA 4ES2A 4ZVTB 1APSA 1PAUB 2OP5A 1T03A 2F65A 2F4FA 1KONA 2HAFA 2LQ9A 5GVQA 1VQNS 2O1WA 3FUYA 1DQ9A 3Q24A 2AJFE 3IMQJ 1KN6A 2UUAI 1JLFB 2CA9A 2PMHA 2VBYA 1HA1A 4UOCA 2VJUA 4DEZA 1IKYA 3GIMA 2UU9J 3H59A 4FBTA 1FO1A 4DR1E 2ADCA 5I3UB 4F4XA 4DV2I 3GJSB 1G6BA 1FVQA 1R27B 5A8KB 4M5IA 3M8SA 3HJCA 1WF2A 1S1TA 4USVA 2UVUA 2KG0A 4MAKA 3AFGA 2DGXA 2KT3A 1F3VA 2J6UA 1NSKL 2J8SA 3B4MA 4WFXA 3QFHA 1WF0A 4RBUA 2PT0A 4KBIA 3MOJB 2XSJB 5IT9Q 1RYRA 1P1TA 1Y6ZA 4LFAE 2DNNA 5HL7Q 1N5TA 3DHWC 2NXNA 1Q4RA 3HX9A 1Y7PA 1ZXMA 3PW2A 1R8PA 2ATLA 2VOOA 3AT1B 4JG4A 3PYEA 3H7HB 1VQ6S 5K8NA 5D3GA 1VBKA 4WFAQ 4J9LA 5F8MA 1VIXA 4C11A 4FDFA 4NXMJ 1KVJA 2A3JA 2GHPA 2VFTA 1QSYA 4NLYA 1HNXE 4ZN3A 1RAEB 1TELA 2EFNA 3CO0P 3PFOA 3ZC4A 5AT1B 4B9SA 3KDOA 3MEKA 1RXOB 3NWRA 4YY3I 3DLGB 3CJ4A 4DL6A 3HPOA 4AL7A 4LF1A 2WTFA 4USIA 4GKJI 1DTQA 3VGVA 3VAJA 3ONQA 1UZDA 1SL0A 2DR8A 2FJBB 2GNKA 3MUMP 3F44A 3EPIA 1XMQJ 5I3QA 2EBEA 3AD9C 3LP0A 7FDRA 1XNQE 1SH0A 5J2NA 3DM2B 4X65F 3BH7B 2C2DA 3T19A 1U4BA 2FIUA 4LPFA 4X64J 3SSQA 4ECQA 1Y9OA 3MMBB 1RKJA 2BX6A 2MZ1A 1RU2A 1K9MT 4DUZE 4G65A 4ELUA 4RZRA 2KTQA 1H7UA 3QT8A 4X66E 3LANA 2DXDA 4ZPBA 4J9NA 2CVIA 4LFAI 2AGQA 2YQ3A 1RTZA 5KT5A 3LF0A 4F4YA 3PFEA 2GO9A 3JTOA 1L3KA 3NMAA 4QZVB 2HKJA 1EKRA 1SUQB 2G2ZA 2Z58B 3GR0A 3VGSA 4ILMA 1RU1A 3QGIA 3HHNB 4DV4I 1RISA 1YLXA 2K1RA 3ENAA 5C24A 5JMNA 1XTZA 2JC1A 4CIOA 2JEJA 3M85G 4JI0E 3KUEA 2B8QA 2BUNA 3K57A 4OI4A 2GMJA 4IG0A 1RP5A 1EARA 4KRWA 5DZ6A 5AE3A 2WZ1A 5DDQC 5K8PA 5DG8A 4AL6A 3CJ5A 3L3CA 1KIJA 2OD4A 1YX2A 3EZOA 1E6VA 1RTHB 2V94A 3KDNA 3R5AA 4CM0A 4HKQA 3LA0A 3DLLQ 1KR4A 2DH9A 3CSKA 4ZLLA 2BA9A 2XWYA 1PJ6A 2UUAE 4R25A 3BGOP 3TRGA 4DL2A 1S9FA 1DURA 3J7AN 2MKSA 5KFIA 2F63A 1TL1A 1BY9A 3MPUB 4LF9J 2RT3A 4A47A 1JQGA 3QO9B 2H4WB 3A8IA 1IJEB 1S1TB 2DGTA 1NRKA 2YNFA 1Q95G 4OYOA 4F26A 5BJRA 1FFGB 1X0PA 1TV6B 3GCWP 1FD2A 2Q43A 3FQLA 4ANEA 5HMZA 2UUBI 2Z5CA 3UCGA 1RA7A 2M70A 2UXCE 2BKPA 4RNOA 2NXEA 4F67A 4FWHA 2R7XA 4IQMA 4LF4F 1SIWB 5C42A 4DHVA 4G1QA 5HMXA 5ETKA 4DSLA 2JEAA 2W2OP 4OZLA 2W9AA 4KE5A 3E01B 4YB7A 5L1KA 1XN9A 2LMIA 1UFWA 2I8EA 1CLFA 4WWSA 2ZBIA 5ETTA 2P2CB 4JI4I 3HCXA 2XMJA 2DXFA 2IDEA 2J9CA 2J0WA 1WC5A 5JXSA 4X65I 3PM9A 2KKHA 3BGFA 3IN5A 1NHJA 5AJ3F 4USMA 2OPPA 3PRDA 2OMLA 4ZN1A 4GKKF 4U7UK 4K0KF 2GFFA 5DGAA 3DXBA 5IS2A 2C3UA 2QE5A 4RPFA 1OPIA 4J9RA 1TAQA 3TUZC 4F3OA 2M2BA 2V8VA 5I4MA 3GIRA 3A3NB 3MMJA 4ATNA 5JEAE 2GIRA 5BYSA 5J1EB 1S77D 4DMZA 4DL3A 1PKUA 4UUWA 1BQNB 4DR6F 4IYQA 5BYQA 3BKFA 2UP1A 4K4VA 1VQPS 2YPYA 3W9JA 4F25A 1V9OA 2EI5A 4FXVA 4R0JA 5B09A 3CMAS 4NMLA 4B3MJ 2FC9A 3IC1A 3PYFA 4CCHA 2AX1A 3QGGA 3DI6B 1RT6B 1Z5BA 3HKZD 3U1NA 3BKTA 4DV3F 3HO1A 3KNAA 2MZRA 3WU4A 2ZC4A 2J8AA 2JFKA 3J80U 1RZMA 4GKJF 3UNYA 4USWA 1R6LA 4IZJA 2QN6B 1TL3B 1WHYA 2PMZD 1RBLA 3SFUA 3M2RB 1UPMB 4NBQA 2C2ZB 1HQEB 3QLHB 2WBRA 2X1GA 1LKZA 4USJC 3W2WB 5F9NA 2LXFA 2XQCA 4RJVA 4NRTA 2J5AA 1REVB 4ED3A 1VQ9S 1FRJA 1V5IB 2B3TB 1C0UA 2VB6A 4NCGB 5C25A 1N6QA 2OPQA 4CWBA 4DCPB 2W24A 2Y0BB 3AH6A 3I0SB 3R5JB 2IYGA 1FEEA 2AD9A 2P9CA 4C8MA 2CQ4A 4RBVA 2FVPA 1PJ5A 1WC3A 1SL1A 4PG7A 4O3RA 4C97A 2NXJA 4RW8A 2RUGA 1TFYA 2D3UA 2W8KA 1Q5VA 3DHXA 3I32A 1Q86T 3EZUA 3FZ2A 2ZHBA 4LBHA 2DNZA 3CCWA 2YTCA 3FSYA 4ETZA 4C0HA 2DRBA 4YUDA 1LNQA 1RT1A 4QR2A 2E29A 2I6WA 4UUXA 3LW5C 3RGIA 4U95A 2HRUA 2XY6A 3N0VA 1RT2B 1T05A 2OPRB 3CJKA 5A76A 5A8RB 4UF4A 2DNLA 3W1YC 2B9WA 4DG1B 1SKUB 2HBYB 4IKAA 3JQJA 3MAAB 3K5LA 2FLPA 1HK7A 5KFPA 2PEHA 5KFJA 1YRTA 3W2VB 4TU8A 1E6YA 4WUDA 5GMEA 4JV5F 1S1WA 2R8KA 3PEHA 5KG6A 3OR1A 4LBIA 2OSRA 3JSMB 2VQFJ 3D3BJ 4RR5A 4X2BA 1PCAA 3PYGA 4P2FA 2EW9A 4LF6J 2FB0A 2C2KB 3SFGA 4X66F 1N33J 2CUYA 3KLVA 3MFIA 4H4MB 2RRAA 2BM1A 2ZOMA 4CH1A 1N33F 4X4RA 2VICA 5KT3A 1Q7YT 1YG0A 1RTJA 1FDAA 1UWBB 2G0IA 2QLWA 4USHA 4Y65A 3NGTA 2B5JA 2RE1A 2YWKA 3PXGa 4CH0S 4K4TA 4K4XA 2VG6A 1IBKI 4I7FB 2HHHF 4TKTA 1YJRA 1CJTB 2IM1A 3EZ5A 2KHDA 1YHCA 4JI5I 2CJ9A 4LRAA 3IBFB 4Z7CA 1F5BA 1YJTA 2EFOA 3GLLA 2H9ZA 3OPKA 1S76D 1TVRA 5F41A 1RHUB 1X4CA 3R9LA 2R8IA 2WVDA 4DDFA 3D6FB 5F8LA 1RABB 3SI8A 1NZ8A 2CPFA 2H4YB 4OI3A 1FNMA 1ZA1B 2AW0A 3BB5A 3WC0A 3ILLA 3N4WA 4ANDA 4DN0A 2GQQA 1GTHA 5KG2A 2CJKA 5DNLA 3J7AG 5DM7Q 3Q1QA 1KOHA 3O44A 4O44B 4DPUA 3GJRB 4YY3E 2E66A 1LXJA 2FHJA 3QSYB 2BMBA 4DQQA 1XMOI 3VGTA 3NAIA 3MURP 4DF8A 4O4GB 4IDKA 2YX1A 4A8SA 2KRRA 2UZAA 4ZCMA 4LF5J 3MTKA 1JLEA 2HFNA 4J5OA 1NB2A 3MM5A 5M2UA 2H48B 2ZKTA 3ETOA 4P10A 2BJ3A 3SCIE 2C3YA 4PYAA 3TUIC 3H4DA 2HBRB 4J9QA 1S9EA 2WW4A 2XMAA 5LMUJ 3LQVA 2CKWA 1TK5A 4OKGA 2F3JA 2CJYB 4B3MI 5LSLA 2BM0A 1BGXT 2DISA 4YN3B 1HBMA 1H2UX 1RT4A 3MD3A 4KV8A 1UL3A 2ZUGA 2NR0A 4EMDA 4C98A 4C8OA 3W2WA 1DARA 2VHGA 1FJGJ 3R3TA 3LPEA 3B4DA 1ROFA 3E51A 3UD3P 1HBOA 3G6XA 4FNIA 4HR2A 1JXEA 2AZ1A 1RJJA 2PO4A 5I3UA 4LMZA 4X4NA 4DFPA 4PUOB 1EX8A 4O3QA 3V6HA 3HHLC 1Z2LA 2NXCA 4NXMF 4HH0A 4PQUA 1CQMA 2Y8WA 4DUYF 1EQMA 4P74A 5KFDA 3MR2A 4DLEA 4PRFA 4LF9E 1JXLA 2YNGA 1U24A 2HFOA 3SEOA 5C42B 5BR8E 1UWAA 2FZKB 2KFNA 4O0NA 4B3RI 3I4PA 2HIQA 3UW1A 1BWVA 4BA1B 3T5KA 3KLIA 2BZ2A 3D5MA 3LPYA 4J9SA 1SV5A 3H42A 2RQMA 4OX8A 3P49B 1ZOTA 4MIAA 1X9SA 1Z2ZA 1H2TZ 3BO3A 4EBEA 1KNZA 4Q45A 3CCRS 3E3XA 1QSSA 2QEXS 4Y2KA 4JI8J 2FLNA 1UA1A 1N32F 4EI2A 2CPEA 2X7IA 3ITHA 3SZ2A 3H5SA 4JYAI 1FTRA 2VPWB 4PXEA 2V63A 3A3PB 3CCES 2DR5A 2V4JB 5JVHQ 2BBEA 3OL8A 4KHPI 4TLQA 1SH2A 1NLKL 1XBWA 4MKAA 1QDUB 2DGQA 2XNQA 4OX9F 4X84A 4PZVA 2HS3A 5FLXY 2V8PA 1N0UA 2W1BA 1IBMF 2E1CA 4HDHA 5A2QU 3QQCD 1C0TB 2QA1A 1NK0A 2EFPA 2HHHI 1JJCB 3OR2B 1NPKA 2YX4A 3PDNA 3IR7B 4G1PA 3W61A 3PV8A 3TI0A 1N34J 4W92B 5HVHA 3TP2A 4TN2A 2GO4A 5THWA 3RZAA 2RQCA 4QIEA 3OUYB 1KLMA 2IA0A 4ZLJA 4U3BA 4HEA9 3R5BA 5HJYA 2LA4A 3T1HE 2B6AB 2CPZA 2XZDB 4PEOA 3NY0A 1RT6A 4Q43A 1Q8IA 2UU9I 1GAOA 2HWHA 3J81Q 1M1KT 1U49A 1N54B 2NSBA 1HNXF 3TVZA 3CJSA 4R5PB 1IQZA 2UVVA 2CXEA 4BA2B 2YH0A 1T8EA 1B7YB 2GJFA 2BABA 2P8IA 4ZVPB 5IFMA 3LP2A 3ZNJ1 3FSIA 4F4ZA 4WYLA 4DL5A 3N5BA 2UU9E 1QVFR 3IGVA 3THTA 3BKUA 1HPZB 3M8WA 2VA2A 3D6TB 3GIKA 4F36A 2IVMA 1E6VB 4BC7A 1X4BA 5L39A 2ZJPQ 1HQUB 2DTJA 1R0AA 1VRTA 4E2FB 1WNEA 2UXCI 2IJFA 1OJ4A 1X5PA 3MM8B 2XMVA 4NE9C 4O4GA 1RT7A 4CLZA 6AT1B 3F73A 3UCUP 3JB9k 2Y8YA 3LGNA 4LF6I 3D0IE 2QRRA 3GP9A 5KT4A 2F40A 2MQLA 1PILA 4J7CA 3LPSA 3VR1A 4CTAB 1N33E 1IBKJ 1CC8A 1T9YA 4F3MA 4NCBA 1U25A 5IXUA 2OIHA 3CEDA 4FYVB 2E1AA 4P2XA 4OI1A 2W4CA 1I1GA 1J5OB 4B3RE 3FKBA 4LQ9A 3EX7B 1N32I 2BE9B 2RVJA 3E01A 4NPOA 1D9DA 3L9ZA 1NNDA 4PXCA 2E5LI 2KYZA 3AXKA 5DDOC 3TAQA 4OZEA 3MPVA 4J9PA 3KG0A 4MK7A 5HP1A 2IDLA 2EXUA 1TUWA 3V5RA 1OY9A 2GA7A 4WFNQ 3GCMA 2H54B 4DV5J 5ADZA 1FRIA 4YR2A 3MFHA 3JSMA 4WFZA 4YB5A 5DS7A 2W7OA 2B43A 4AYBD 5B7WA 3D6HB 5D4OA 3HZEA 1F2HA 4ZP6A 1KQFB 4ZVSB 5EHHA 3MUVP 4GKKJ 1O51A 1RK8A 2CNLB 3EGWB 4HH1A 1UFKA 3V4MA 3M9MB 3CPWR 1U1NA 3FZBA 3R7NB 2LEBA 1O5JA 3PJ9A 2LKZA 2QMWA 2V2ZA 4HDGA 1TL7B 4CO1A 2UV8A 4DX6A 5FD1A 2IBKA 3KTQA 2XS5A 4QYZJ 1NHHA 2KT2A 1MLAA 1NB7A 5EX3A 5KT6A 5F8GA 2AYBA 2FTRA 2KZMA 1RAFB 1P27B 3MAAA 2LDYA 4IRDA 1HIYA 5FLXC 2JVOA 2WONA 3M8YA 3QT6A 1N56A 2B7BB 4DV6F 5G0RB 3D0HE 2GIQA 4B9TA 3BN7A 3RRGA 4LT6A 3DU5A 5J1PA 4B3SF 2C2RA 2MKKA 3PR4A 1JLGB 3FCVA 3KYLA 3P5TL 2NZ4A 1T95A 3HD2A 2D1CA 5IV4A 2RKIA 4B17A 1QUPA 2YNHB 2XI3A 5CHCB 4QR0A 4EGLA 4CZCA 5IM0A 2C3OA 3QLHA 3KUGA 3DGPA 2LA6A 4ID5A 4BWMA 4JI6F 4X66J 5D0RA 1H98A 2IC3B 2XGPA 5LL6d 3IWLA 4QQBA 5KFLA 2CJAA 5A6WA 4C3LA 3UPFA 2PN6A 1FRXA 3MM8A 4C9DA 2HS0A 1LFWA 2P6TA 2H3EB 1JNRB 1RGVA 4E98A 4JI3F 1XNQJ 1DQAA 2XO6A 2BYCA 3WBZA 1RUSA 4B3TE 4KAIA 5J2PA 1TMJA 3I82A 1Q0NA 1HNVA 1OYPA 1P1LA 1GXUA 2BQUA 3MECB 4NYPA 4HACB 2XMMA 3B6BA 4EU0A 3CD5A 4DR7E 3DOMA 3WX4A 4TVAB 2ZM6F 1VJQA 3CDWA 4PAAA 3GTYX 2HNYB 5F3TA 3RAMA 1VQMS 4DSIA 1REGX 4OFZA 2IBOA 3C6TB 3OQ2A 4QNKA 4WZQA 3IGNA 5JEAD 2ZOGA 1XMQF 1XK8A 1FKOB 2C37B 3B4TA 2L9DA 1UMJA 2YPZA 2KRBA 3CW2C 2FGCA 4TU9A 4JV5I 3SCKE 4LSLA 1N36J 1LFPA 1FKAE 2UXCJ 4PCQA 5IWAI 2R42A 2JJ4D 5ETVA 2E7XA 4LIRA 4DN9A 4BS2A 1Z0VA 1Z5AA 3HP6A 2HYIB 5GMDA 2ZM6I 2R7QA 4ZPCA 2HZCA 4F0HA 4X4SA 1D8YA 2QIFA 2LXUA 2DR7A 3TZWA 3TAMB 2NREA 4Y6IA 4ALZA 2H1YA 2PSZA 4WU2A 3CXCR 2YVSA 3BGLA 3IO1A 4F3QA 2O1UA 2Z5CB 1S1XA 1IBLJ 2ZWOA 1IBMI 2A2CA 4B3RJ 5FIIA 1JK9B 1S1VA 2RSQA 2YWHA 1CULA 1FFWB 1RHQB 1UFLA 3BS9A 3M4XA 3M6UA 4KC5A 3LALA 2KB2A 4NLOA 1NEEA 1OYEA 3FJ2A 3X3UA 1SV5B 2IVYA 1WOOA 4IZKA 1JJ4A 2UXBI 1XNRJ 1FE0A 4LVOP 3G96A 3MUTP 2KDOA 1AZSA 4WIQA 2AKWB 4LRFA 1N88A 2ROPA 3GV8B 2XBPA 1U0HB 2XS7A 3A1YG 3DLEA 5E3QA 2VPZB 1WC6A 1YQHA 1CQNA 2OPPB 3GONA 4IG0B 4KGVB 5EGYA 2CGEA 1N36I 1NO8A 3CE8A 4ZPTR 4NCGA 5DG7A 4FW5A 3K8VA 4C8LA 2Y9HA 2KM8C 2IOPA 1SUQA 2N3OA 4OL8A 4QOTA 1QZRA 4X4TA 5J2MB 1H6KX 2OPSB 4J37A 3O5TB 1EZZB 3C8YA 3QIPB 1N4LA 1J5EJ 2DPJA 4OX9I 1A6LA 2JLFA 3A3OB 5E41A 2IOQA 1I94I 1QTNB 2H65B 1M1HA 2DCUB 2POKA 4C7QA 2JLGA 1IBMJ 3AJDA 3CJQA 3MPDA 2D41A 2GVDB 3KHLA 5HN0A 2ZBCA 3EICA 1B0TA 4IFYB 2DGWA 2G2OA 3M8PA 4M63A 2DGVA 4LR7A 2C3MA 2IIHA 3JAMU 2AJ1A 4LF5I 1LXNA 3PHTA 3C6TA 2QFIA 1F6TA 4LSNB 4LSZB 2AZ3A 5CYMB 3JTPA 2CPIA 2GS8A 3FBFA 3KJVB 1BQNA 2EFGA 4O4RA 1V6HA 1NDLA 2DNGA 1LQ9A 2HQ3A 2J7KA 1X8DA 2HRTA 3NCRA 3S1TA 2PNZB 4FVCA 4OO1E 2BV3A 2ZH8A 3MXHP 1RQ0A 3V6DB 3VVTA 3K5PA 4X64I 5KFSA 3Q22A 2K3KA 4OIXA 3RBXA 2RRBA 4TY8A 1NK6A 3NNAA 2XMTA 2M8HA 2M5YA 1RCXB 4PG6A 4LBPA 3W5YA 5EKWA 4V1Ak 3G2XA 2M8DB 4MIWA 3BO2A 1U2RA 3DXSX 4DR1J 4DZDA 4DV6E 3L7ZA 4A8XA 4ECRA 3DRPB 1A6FA 1RLDA 3TAPA 3SXLA 1HHTP 1FERA 3IG1B 4B3SE 1TKTA 4CLPA 3CNQP 3CTRA 2CJXB 5KG5A 1SJFA 4LFAF 1UVLA 1L3TA 3JAMQ 3N9UC 2A6MA 3C6UB 1YK9A 3HFZB 1IUJA 1MN9A 2WVEA 4NZ0A 5SZTA 4TU7A 2VQFE 1CG2A 2R7OA 1RADB 2Z2LA 4QU6A 1QVGR 1WDDA 1UDSA 3OVAA 2H51B 3PX0A 3TYTA 5L1JA 5LMNI 1J5EE 4UZBA 2ZZMA 4WPAA 2BQRA 1Y4UA 1LWFA 2R7SA 2HFZA 2ZDOA 4DV0E 2GVZA 3N5FA 3FNNA 2V2KA 4MU3A 4FWGA 5DQHA 1VCTA 3ZTQA 1U1RA 1WG5A 2XCAA 2G2YA 1HMVA 3BM7A 2JEBB 3KG4A 9RUBA 1FD8A 4RW4A 1X0FA 1DAXA 3TEGA 1RT2A 3G71S 1QTMA 3N28A 1IWGA 3KHHA 3NG8A 4ZP9A 2ZC3A 4FW6A 4ED0A 4OZ3A 2HNZA 2FVSA 4C4WA 5D8HB 4I3HA 1U8SA 1FJCA 5DZ7A 1F9EB 1ZS6A 1RI7A 4C0OC 2HVEA 5C24B 4FF2A 4NLWA 4YOEA 2ZBKB 3EXYA 4MQYA 1KHVA 4C8ZA 3I0RB 5C7PA 2Y1IA 2B8PA 3X1LB 1EQ0A 4P2SA 2VQEF 1NHVA 1GMVA 3AOCA 3WHIA 2BR0A 2FHJD 3CJRA 4XO0A 4IRKA 1Z0CA 1IBLE 4ERDA 1UDNA 4OHYA 1B63A 4JI7E 1NK8A 2G1DA 1HFEL 1PSDA 3I87A 2W7PA 3CMES 3Q2SC 3H1CA 4AXJA 3O8WA 4A8FA 1X31C 1BC6A 1YGYA 3TA2A 2FJWA 1FVSA 2O66A 3RRKA 4OYZA 2O01C 4R5PA 5AXLA 1R31A 3KK2B 3BGRA 3IRXB 3DCAA 4MJKA 2YKNB 5B08A 1SJQA 3G9CA 2NN6E 2VKRA 2DPIA 2HEKA 4IRCA 1Y00A 4TXSA 1SQEA 1JLQA 2UU9F 4C3MA 3QJJA 3Q89A 2U2FA 1QAXA 1QM9A 1CJVA 2HNDA 2QX0A 3DOLA 2A10A 3JXOA 1S5ZA 3CJKB 3U1LA 3UQSA 1R89A 3THVA 2IYIA 2GMLA 2J0QD 2EBGA 2P6SA 1Y5IB 1U1QA 1I3OB 1WOSA 1FXDA 4DV7I 1CS4B 3T5HA 5CCMA 2D9PA 2PA8D 2ZDPA 4LF7J 3RJMB 5F8JA 2O1VA 4LCGA 3M7VA 2N82B 3AA9A 3B78A 3RW7A 2CQ0A 1LWXA 1VRUA 4NMXA 1T03B 2JL9A 3D54A 4WZMA 4ECXA 4CNYA 3CCVS 4CM2A 4IOBA 4ZK7M 3M6WA 2KN4A 2V69A 2ZVIA 1XJWB 3QNWB 4QIGA 3UD4P 2EFVA 1MX0A 2UXDE 5EL9A 4ZITA 5KFVA 3AB4B 1DJ0A 5RUBA 3N6MA 2HHQA 4DV0I 1FI4A 5G4DA 2N7YA 5J1EA 5K8MA 1ZM3A 2JLEA 4C48A 2MHEA 2X3DA 2Z30B 3IAM9 4N56A 4CYUA 4JI2E 1NPPA 5B0AA 3UR0A 1LW0A 3T1YE 3FCHA 2HFVA 2QL9B 3E8OA 4P6QA 1CEZA 1GNKA 3FC9A 2AGPA 2V8GA 5IQ6A 2MY8A 3EVWA 4RBTA 2DR9A 5U47A 3EGZA 1CJKA 5M2PA 4MFBB 3MCSA 4ZIVA 2M0GB 3H5YA 5FJ4A 1FDDA 1TUGB 2H5IB 3NGUA 2FJVA 2CPDA 3VGUA 4WFBQ 5J1NA 4M5KA 1TL7A 1MROB 4QWCA 3J7A1 2CDRB 5ETLA 1IKWB 4X4QA 2C22A 2K1RB 1YDLA 2UUCJ 3V2UC 2NUUG 4NEZA 1EETB 5GADI 3LWLA 1T9UA 4OO1F 3NOCA 3LP1A 2WP8A 2A18A 4DR6I 2Z56B 2MB0B 2PD1A 4JI6J 4FBUA 4LOMA 1RT4B 2IJRA 1RWMB 2KL8A 2MZSA 2VFSA 3KK3B 3CC2S 3DRSA 5E5NA 2Z5BB 4NXNE 5CD4H 2BA0G 3TA0A 5GAHU 1S4FA 2C3PA 1VYAA 2DT9A 2I9SA 2YWGA 2W8LA 4JI0J 1NHKL 1FXLA 1G2EA 4F4AA 4ETXA 4LSNA 2OGUA 1UP1A 4WK1A 5HVGA 5K20B 2LEAA 1M5SA 2Y0SD 3AA8A 5J2NB 3M9NB 3HHLD 2MQQA 2RKIB 1G7CB 2MZJA 3BQ1A 1DRZA 2CQBA 4DSKA 2QT7A 2HHTA 2F8HA 4FVMA 1J5OA 2YNGB 1WC4A 5KOXA 2XNRA 4OO1B 3PYDA 1VHFA 3MGJA 2HVHA 3FEZA 4PRXA 2QYGA 2BANA 2HWIA 2L3MA 2J6TA 2R9LA 3VHQA 4UY85 2HQDA 2IERA 4EK2A 1M90T 4K2JA 5DM6Q 1S9GB 2MKCA 5K5MA 4ES1A 2ZBPA 3C6UA 4J91A 2OTJS 2WK4A 3J81C 1E6YB 1IQTA 1SB6A 3MAHA 4CLSA 4JI5J 1TU0B 2GAHC 2Z57B 4ECZA 2CG4A 3O6QA 2LFVA 2R4FA 4G3IA 5HMWA 2VJVA 4QR1A 4QYZK 3FMWA 3L7ZB 1WSRA 1RWWB 2D3ZA 3MD1A 4P9SA 1X4EA 1CJVB 3DOLB 2GHVC 4N5SA 2A1BA 3M30A 4J9VA 4JI2I 4BA2A 4KHPE 1RTJB 4FW3A 1YZ6A 4MIBA 3TARA 1LWFB 2QO3A 4OZJA 4I68A 4LQ3A 1P42A 5L9NA 1C1BB 3UWTA 1FDNA 1UTAA 5E3AA 2DO0A 3FEYB 2F9DA 4DR5F 1S6PA 1VRQC 1XMBA 2AMCB 4C0BA 1IWAA 2XSFA 1OWXA 4IFVA 4NX9A 4PG5A 4ZHRB 3OR1B 1HD0A 2FD2A 5KFWA 1XR6A 3M8QB 1KC8T 3JYTB 1HBNA 1FDBA 3CC7S 3A4TA 3PKMA 2L9NA 4OZ2A 3H2VE 3ZNUA 5JUMA 3OJSA 4DV7E 2ZHOA 3HHDA 1IJFB 3M85D 1E3PA 2GC8A 1S7IA 2QLFB 1IR0A 4FKXA 3EDRB 4CO0A 4DBQA 5EDWA 1FNXH 4N41A 1H73A 2RD5C 1F5CA 4LRCA 4L3NA 2RILA 4YQWA 4TQSA 4NI2B 4DFKA 4DPTA 1U1MA 3RBZA 2IM2A 4DV3I 4X64F 1TR0A 1FEHA 1HQUA 3DRSB 4GVBA 1ELOA 2QGFB 4MH8A 4DR5J 4PPDA 3TR5A 4U7UD 2OFHX 4EZ9A 2O5DA 1LEOA 4NA1A 4O3OA 3KK2A 2P9GA 3KRNA 2G1HA 1SC4B 4DZ6A 3NGKA 2WHOA 3R2DJ 4IFDD 1OY6A 5K8OA 4OHXA 2HHVA 5C0XD 1RHKB 2CADA 2VD3A 3MMCA 4BA1A 1VK8A 4RLEA 4ZOSA 1FRKA 1VJWA 3I6PA 4OO1D 2A6OA 4HHHA 2DNQA 8AT1B 1G3OA 2HIYA 3Q8QB 4D3GA 3D4JA 2RDJA 4X66I 1XMOE 4JI1F 2UXDF 5E3RA 4JI1J 4B3TI 4K5RA 2FJEB 1OPZA 5CZVA 1M0SA 1T0TV 5J2MA 4WIIA 2OPSA 2PEBA 3F41A 4HHUA 4Y0FA 1NDCA 1HWUA 4QWBA 5EWEA 4DSEA 3EJMA 2PO1B 1RLCL 2CQDA 2RS8A 1S49A 4NRUA 4DLGA 3RAXA 3PIOQ 1PC5A 3M1VA 1FJGE 1KVKA 3QJPA 3R27A 5D78A 1FHTA 3T9NA 4QW9A 2XM3A 1VLOA 3M32A 3PTWA 3QIDA 3I56S 1NKCA 4JI5E 3NGRA 1HNZJ 3QYYA 3NS6A 4QBUA 3PZPA 4W90B 1VS3A 4CLTA 3ZTPA 1NMEB 4DV4F 1UEVA 1S0VA 3IR6B 1QUVA 1SXLA 4H54A 5CH7B 3KOAA 2B6AA 4ZJOA 3CD0A 3G82B 3QSIA 4PYDA 4RUBA 2XTJP 2NZCA 3QWUA 3PW5A 2AEFA 1CULB 1HHSA 2WONB 3AAWB 4XK8C 3OL9A 2KFZA 3H0PA 1KTVA 1R6VA 2AEMA 3C14B 4RW7A 1RWPB 4DV2J 2BW2A 4RWWA 4LF6F 2HNYA 4LUBA 2FZGB 1YZ7A 3OR2A 1XNRF 1C1CA 1B64A 2P5VA 4EO6A 3R5GA 4B3SI 2WSFC 1WHVA 4RW6B 5DQGA 4DJBA 3LGMA 4FNHA 1BUXA 2JDJA 2RRNA 4FN5A 4O3NA 5DDPC 1J2VA 3KLHB 5A8WB 8RUCA 2QFJA 3T6JA 2N4CA 1JNZB 2ZE2A 3AB2B 7AT1B 3I55S 3J80Q 2N7CA 3RB6A 5DRRA 1XERA 4UQGA 3VAKA 5EUHA 3ISNC 2E5IA 5LMNJ 3U7JA 1Y5YA 2JT2A 1C0TA 4C8YA 2V68A 1D0EA 3H4LA 2GAGC 1S0NA 1I6JA 1CJUA 1NSPA 1RAHB 1VGYA 4UZCA 3DGPB 4UOGA 2KG1A 4DS4A 3GG1A 1HWJA 2EG1A 3R6GB 1UETA 4PXBA 1RTHA 2IJNA 3M1VB 3KK3A 1Y60A 4L74A 1YTYA 2KO1A 4LFAJ 4Z37A 4TYAA 5C25B 4P73A 4Q2MA 3KK1A 2CZ4A 3CD6S 2IPOB 4IZKB 3OTBA 4CNZA 1IBCB 4KH1B 5L38A 3K89A 4P52A 4RUCA 5C2CA 1EA6A 1RHYA 2JH3A 4U7CA 3VAGA 1DY3A 4DV2F 2JOQA 4KHPF 4ZLPA 2OH2A 3CMQA 2Z5EA 4X62E 4LF6E 4KV8B 1FKOA 1PIEA 1SJ1A 2F1FA 2HGMA 4OI6A 2EG2A 3J81U 1Y0HA 5T7LB 4DV3J 1KQGB 3VTIA 4JI6I 3SCLE 4N76A 5JEAA 2NS1B 4RL1A 2ILYA 3DDNA 1JLCA 1FRMA 5KFYA 2X3GA 4LFCI 4K0KI 1WHXA 1WSVA 3KLGB 2ZJQQ 4PABA 1D1UA 2LJPA 3OL6A 4WP3A 1HWKA 1T94A 2BKNA 1WDTA 2ZNYA 3OXFA 4JV0A 2KH9A 2VFUA 2HHWA 4NLRA 2FDNA 3DRXA 1S6QB 4RW9A 4AM3A 3PW0A 4LJMA 3AHPA 4L73A 1UVKA 2MPUA 2DO4A 1NH8A 1D9FA 3NBPA 1CSJA 5EN1A 2ZD1A 3K7RA 4ZVGA 3TVYA 1RTIB 2DNKA 1GXLA 2YWFA 3GFXA 2BE2A 4I2PB 4NOHA 4NYZA 1H7XA 3MZIA 3KHRA 4JUZA 4DQSA 2HMIA 3ISND 4B3OB 4OJ1A 1FA0A 4DR3J 2F8EX 4FW4A 1WC0A 1XQIA 2YKQA 4QIFA 4ISAA 2BVZA 4JV1A 3K8WA 2UUBJ 4Q0BB 1Z0WA 2KXHA 2BJ9A 3I9V9 3QMQA 2GIFA 4MT1A 1SJ3P 2PNZA 3PX4A 3C2PA 3HSGA 1S16A 2HLUA 1MU2B 3DOKA 1YJNS 2MKHA 1CJTA 1HMVB 4JV2A 3J7AM 2FJDB 3DC2A 3ZFVA 2DHGA 4BCAA 2AU0A 2PFDA 1TKDA 4LFCJ 2HVDA 3FCWA 4DU7A 4CRJA 2FC8A 4GVBB 5D4NA 2OHDA 4N8NA 4DUTA 1KWMA 2QYCA 3P4UB 3QWPA 5H9FK 3PRYA 2PO1A 2KHCA 3QAUA 3W3SA 2UUBE 3D2WA 5LXRA 2DHXA 2CRLA 3ZTSA 5IM0B 3D66A 5LSOA 4ED1A 2HGLA 4DUYE 3OLAA 4LF9F 3RTVA 3CDAA 2HZVA 1AT1B 2VPYB 3A8KA 2F9JA 1C4CA 3OD2A 3D1QA 4Q8FA 2HQCA 4C8NA 1HR0I 4JP8A 5LXYA 3M8PB 4RU9A 2XGQA 1B3TA 5CZXA 4FYDA 2CNKB 3DRPA 3W9IA 2C2MB 2RUSA 4OHVA 5DG9A 2IMWP 1HW8A 1U6ZA 1Q81T 4S0MA 2V67A 4DX8H 2JWNA 3GYGA 1Y3KA 3BBBA 4YDDB 3BQ2A 3MHYA 4F2SA 1HNWI 3O2IA 1Q79A 5IQQA 2V4JA 1YRUA 2IAJA 4NLGA 4V19J 4DV4E 1S0OA 2UUCI 4LFBE 3ZZ0A 1VMBA 4TYBA 3V6DA 1VRTB 2KZZA 2F1DA 5JJBA 3TZZA 3RBDA 1YHQS 3QRQA 1AB8A 1YWXA 1YBAA 2EWHA 5B0CA 3OVSA 3BZQA 1P9YA 4HLBA 3CVKA 3OFGA 5CYMA 2LQ8A 4CLFA 3KJVA 2G13A 4DUZI 1VDHA 1YH8A 1MW7A 2HHHJ 2C1EB 2ZEJA 3HVTB 5D6GA 5IWAF 4YP3A 3ZKBA 4FYWB 3EVMA 1VISA 4B3SJ 1KLNA 3MPWA 4A8QA 1Q8KA 1WKLA 2Z2MA 2QC3A 2D9OA 3R7BB 1RHMB 4X4UA 1RREA 4P2MA 2PFFB 8ATCB 4DPOA 1UPPA 2F8MA 3H5UA 3TO8A 3U1MA 1Y4ZB 4ZMMA 4HI1A 1X5OA 3L7OA 4J9MA 4DF4A 1W2BR 3DDKA 3MEGA 4ILRA 3CCLS 3BF4A 4YB1P 1HNXI 3M7NG 3OFFA 1W2IA 2FHOB 3W5ZA 1C1CB 4IOCQ 2CPHA 3GFZA 4JI3J 2MQNA 3GYNA 4AQYJ 2MLZA 2GGPA 2R2SA 1KFSA 1S4EA 4OJ3A 1DBDA 2V50A 3BEGB 3PKYA 4YMEA 2EPIA 1Y5LB 2Z0GA 3E2EA 2V4RA 4KQVA 2IM3A 1WUUA 4PG8A 4K0KJ 4RO0A 4K7QA 4PWWA 1SCJB 1RT7B 1X4DA 4QIWD 1NBEB 2IRUA 3HMJG 5E3CA 4QWEA 4LF8J 2LQJA 4LR8A 3AODA 2PO0A 1H2VZ 2IM0A 2XMKA 3P6YC 3O1LA 2XY5A 2BE7D 4OYMA 4Z7YA 3OTOF 2C28A 3GMEA 1J5EI 2B51A 2W7AA 2IRXA 4H4OA 2MXYA 2O67A 1XR7A 3BSCA 5A2QY 3H4BA 4X4PA 1KLMB 1X5SA 3JQMA 2PO2B 1K44A 5AXNA 5A8WA 4DV2E 1BWEA 4X62F 1RB0A 5C0XE 4ILLA 3SMZA 1S12A 1OYDA 4JOUA 3UN5A 3M05A 5CQGA 4RNNA 1F9FA 2W2QP 3A12A 2J9DA 5KFRA 3MM5B 3Q8SB 2KM8B 2WAQD 1HBUB 1R6YA 2VG7A 3DMJB 1Y3JA 1S79A 2MZQA 3ICLA 3OXGA 5CABA 2G9OA 4PQUB 4HY1A 3HJFA 2E9RX 4B9NA 1NSAA 3GWCA 3ADAC 4K4UA 4QCLA 1RAAB 3ELHA 1WWHA 3UDLA 4ZCIA 4URGA 3BJYA 3P96A 2IA6A 4CYUB 2FVCA 1U1PA 1VC5A 3PW4A 2MKYA 3CDUA 4LF8E 1RT1B 1GX6A 1TKZA 3T1AA 1U2FA 1R0CB 2QMUB 1YJUA 3M2UA 4OX6A 3GV5B 4RW8B 3MR5A 2YWEA 4EEYA 2DNHA 4J90A 3DLKB 1L5UA 4DS5A 1S72S 2RNEA 4O3PA 3WIVA 2XLKA 3W8PA 3F0NA 3GYXB 5KFBA 1IM6A 1PC4A 1XNRI 3L7PA 4ZVEA 3IFEA 5LMUF 1AUDA 3W2VA 4Q44A 5EX0A 3MMCB 1YJ9S 1NU4A 2IAJB 3P06A 2VESA 5LMNF 2WP8B 4FW7A 2FHMA 3NGSA 3CJ0A 1Z5CA 3VAMA 4FPRA 2W2PP 5F3ZA 4FPIA 4FS2A 2E5LE 2E7WA 2W4DA 5JVGQ 2HLTA 4FZVA 1QSLA 3OUYA 2O1TA 2NQPA 2RU9A 4ZLNA 5LOQA 2GHWA 5IZHA 3TAMA 3TWZA 1VQ7S 2FY1A 4M95A 3RW6A 3TUPA 2B4PA 5K14A 2PNMA 1Z4UA 2BOAA 1M5VC 3C3LA 2VU5A 2ILZA 4O0IA 1HI8A 4ZHRA 3NAHA 3H25A 1HQ2A 2LYVA 3UE2A 1U48A 1T02A 1YBUA 2BE2B 5DDRC 2EKNA 2ROEA 1SKRA 5DLGA 4ED5A 2YKPA 5HK4A 5JEAB 1YIJS 4URQU 3JYTA 1GMWA 4NCAA 3C46A 3H5XA 4F7VA 2B5JB 3NNHA 3PS2A 4FP9A 2MLXA 2UV8G 2VQEI 3G6YA 2AYGA 3LTOA 1MWYA 1FRHA 2VQFF 2YQ1A 5LT5A 4LRDA 3BBCA 4HI2A 1S1VB 1VBYA 2KFYA 3W62A 2NUHA 1K0VA 2RB7A 3PNIA 2QJ3A 2HQIA 2MYFA 4GVLA 1HI0P 4LFBF 4CT9A 2MKIA 1J5EF 1R6MA 1NJYA 4LF7E 3M6VA 1R7IA 2M52A 1SQGA 1X5TA 4DR7F 1MMDA 3KWMA 2HVIA 4X65E 2CPJA 4OZ5A 4WF9Q 1SIZA 2OFGX 4KO0B 1NZ0A 4JI4E 3U1KA 1LWEB 3CB4A 3P3DA 2WB4A 3R5DA 4DUZF 3GQCA 1WJ9A 1OIAA 5GMKa 5IWAE 2WNRB 2WOMB 3H2UB 1QY7A 5HVFA 3R1LA 4JI7J 3M6AA 1AXQA 5FLXQ 1YKWA 2QL5B 2XULA 3OLBA 1DHMA 1N5YA 1SPBP 5CCLA 1UEKA 3LAKA 3PRBA 4H4KA 2J7UA 4ZVOB 1Z0EA 1DTTB 2DHHA 5KTQA 3KLEA 1VQ5S 1H7SA 2XYHB 1T7PA 3OSPA 3DI6A 3PS3A 4TY9A 4EWTA 4Z2XA 1XNRE 4UW2A 2V5HG 1GH8A 1NSQA 4NZ7A 3HFVA 3MCOA 2VG5B 4O3SA 1AA1B 2YY3A 1NJIT 1IKVA 4N77A 3CDIA 2DXEA 1UVJA 3J80Y 4OHZA 4G6VB 1MU5A 2AQ4A 1PBAA 3MEDA 5B0GA 3TW0A 4HACA 5KFMA 3UDVA 1RAIB 3EMTA 1R0BG 2G4BA 1KVIA 1UVIA 1U1KA 3I5AA 4H4MA 4CO4A 5DLFA 4GKJJ 4Q8EA 4GKKE 3G86A 3MEGB 2VASA 1FF2A 1FT8A 5IC4B 3RRHA 2LVWA 1S57A 4ZCLA 1T05B 4JI0I 4NZ6A 1S1UB 2BJ7A 5L3JA 1KKHA 1Q53A 2CDQA 1ZM4A 3Q23A 3KJNB 3OW2R 1HNWE 2MGZA 4W4MA 1I94J 1A9NB 4BBYA 5HO4A 5JEAF 1PYTA 4M5HA 1RHJB 1Y4SA 4EBDA 3LNUA 1PJ7A 3P8BB 1NJZA 3BGRB 4FS1A 1QAJA 3OT9A 2BDPA 2VFRA 2DHSA 1TUVA 1JB0C 1TZ0A 3H90A 1H3DA 1VQLS 2O1PA 3C14A 3UVJB 2Z2ZA 4MYUA 3KLIB 1OSDA 4NL5A 4U8VA 2W9CA 4DV4J 1F60B 1WKJA 3TANA 3LP0B 1Q1KA 2BA1D 2DGOA 1ZPWX 4FW9A 1XNQI 4YFUA 1YSJA 5K36A 1WD6A 3AQOA 4DI6A 3WU6A 1FX4A 3C16A 4A46A 4GKJE 3ET6B 4KGXB 1HR0E 5F0UA 5AJ3J 2IHR1 4PWUA 3MWBA 1HKAA 3UFCX 5HQLA 1VQ8S 3BPDA 1G1XA 1VC6A 4GKKI 1ZPVA 2R3VA 4NXNF 2HBZB 4IZJD 1HBUA 1F0XA 2VG7B 3A8JA 4RNHA 3RG6A 1A0OB 3J7Z5 3RR8A 5JEAC 1R8AA 3BDEA 4UY8T 1FK9B 2PGCA 3VAFA 2GO3A 4IH5A 4RX6A 1HNVB 4HT5A 4DX5A 2LDIA 5IT4A 3WC2A 2J7WA 3UO0A 4DR2J 3OV7A 4WE1B 1ZXNA 4MKBA 4K4SA 1WOPA 2JE6B 3MTJA 5KFEA 3THPA 4ENOA 2Q1LA 2X1FA 2RF2A 3NKYA 3G4SS 4G1QB 2JEAB 1LW0B 3D67A 4R8UA 2B9YA 3ZM7A 2Q3PA 5C0XB 2YQ0A 4F0KA 1R0AB 5IWAJ 3KLEB 5D77A 2DJWA 2XG8A 4DXLA 4QIVA 2LP4A 3MR3A 3PVXA 1ACMB 5CXTA 3RBEA 1KP6A 2YNFB 3W66A 4QWAA 3HVAA 4JI8F 1N32J 4H4OB 1TKXB 2BR2A 3MPYA 2GZOA 1S6UA 1BD6A 1VI7A 1ZM9A 2FJAB 2OI2A 3CT9A 5KG7A 2CQCA 3OHBA 4B9MA 3GMGA 1RSCA 2HVZA 2QMXA 2YKNA 3ISZA 4ECVA 2AE8A 5A2QQ 3HXMA 2XY7A 4MTPA 1LK7A 3Q8YA 4FYYB 2AYMA 4UT4A 4F4KA 2HS4A 4Y2IA 4U6PA 1N33I 3D7SB 2VF3A 5MLCV 4KT0C 3DRRB 3SYZA 4EUVA 1H38A 2HG4A 4RNFA 2EK1A 4PUOA 1K1SA 1DLOA 4B3RF 2GQCA 3J80C 1HNZE 2HNZB 2ACYA 4KPYA 1VQYA 1T9TA 2VL1A 2ZH4A 1AFJA 3TQEA 4DSFA 4DL4A 3K5OA 4USUA 2DITA 3M2VB 1F2GA 2XEXA 4Y2CA 3HKMA 4AIMA 3PRVA 3ZZPA 1X9WA 5A2QC 1HBMB 3TJAA 4HYMA 4WXOA 1URRA 3FK4A 3DFEA 2IESA 3GIIA 4NLUA 3TA1A 3QZ8A 5A0YB 1EJ7L 1M5HA 3FBEA 1OS5A 1O6XA 3HLUA 4ANCA 4A8KA 4CLYA 4ELTA 3P3GA 4DR5I 2BRKA 3DRYA 2C42A 1FKPA 1GXTA 1LOUA 2APOA 2BEFA 3DM2A 4NLPA 3TJ9A 5HQMA 2ASJA 3VVUA 2LECA 4BDPA 1Z0GA 4NLXA 2F7VA 5HP1B 1XEZA 2DIVA 1U7LA 5KT2A 3H40A 1WF1A 1P8GA 3BPSP 4M5MA 4UQTA 4J9KA 2DH8A 4K59A 5H9EJ 1XIQA 1YJVA 2QZ8A 2MQOA 1RT3B 1YI2S 4Y3CA 1UVNA 1AW0A 3BN4A 3KUHA 3D68A 3GB0A 1LWEA 3K59A 3G6ES 1U02A 2BXJA 1HBNB 2P9EA 5K9FA 3SV3A 4WUCA 4A8WA 1UA0A 2HFUA 2HHHE 2ZH5A 1PKPA 1RR9A 1RAGB 1F9HA 4DR5E 3ZZOA 1T9WA 3RB3A 5KFFA 4K8RA 3HT3A 3NWGA 4PQAA 4DOZA 1U0HA 4CT8A 1NM2A 1U09A 1HWLA 4DL0C 1Z59A 4I4BA 1WG4A 4K4WA 2CQGA 3P3CA 3R7SB 5HSPA 4MDTA 4MU1A 4JYAE 2BJ8A 4ICLA 1W7WA 2D3O1 2VBWA 4ZIWA 2C38A 4LF8I 1AFIA 4IR9A 1UJ6A 1IM4A 2DB1A 3SQOP 2BQ3A 3I96A 5I42B 5B0EA 2FYXA 4W98A 5SUHA 1N34I 2XYGB 3CIMA 3MEEB 3NS7B 3OFEA 3HT0A 4YY3F 3HI9A 3VAHA 5IT9Y 1HNWF 2QSFA 2X36A 3GFHA 3B8HA 1SC1B 2IFXA 1TMMA 4DV6J 3T1YF 4NA2A 3K0JA 1ZTWA 1C2PA 4B9UA 3K1JA 3P76A 4IFYA 3IBWA 5HATA 3T5JA 3NMRA 1SI9A 1WKKA 2N3LA 3IG1A 1D8ZA 1Q16B 1ZZFA 2FY8A 4U9RA 5A8RA 2ADBA 3NS5A 4KHMA 2RS2A 1VQSA 1IVZA 1U26A 1PBUA 1S1UA 3TVKA 5J2PB 4CTAA 4X4OA 2FVRA 2J6SA 4OX9J 2O3DA 3MCNA 4WFYA 3SCJE 5AXKA 4DV1F 4ER8A 3TX8A 2EEYA 2DEJA 3LO3A 3BSOA 5D15A 2RMLA 4ZPVR 1JLQB 1NAQA 1ULRA 2NSCA 2W25A 2XMUA 3EM1A 3M8ZA 2AIRB 2E1MC 4LIWA 4ZVFA 5IC6B 3S7RA 4L76A 4GO5X 2RDDA 2DNRA 4AUKA 5AE1A 3KLGA 4AIDA 1SJ4P 5KFUA 5CYQB 5F8NA 3M32B 1IKYB 2J0XA 3MF5A 5K36B 4DL7A 3EWGA 1AZSB 3DU6A 3OJUA 4DR3E 3M7ND 4XTTA 3TQ1A 4IG3A 1JMTA 2I38A 2CWKA 2KVQE 1NCLA 3LP1B 3I4HX 1SVDA 5G0RA 1GMUA 1T3NA 1ITPA 1MMNA 2ZE2B 1S10A 2K7KA 2C37A 5DROA 1I94F 1FWPA 3CCZA 4ZKAA 3HK2A 1JWWA 4IFDB 1UZHA 3IWXA 2OELA 2MQMA 4LF2A 5HAOA 5L9XA 3EUNA 4CQ1A 2XB2D 3DKDA 1N32E 2RQ4A 3HDSA 2PO0B 1PYOB 2PIIA 3D9BA 3M8RA 4DSJA 4KGKA 3QZ7A 2CNNB 1YITS 3P3EA 2DHAA 3CCUS 4EYIB 2JE6A 1XR5A 2HFSA 3SSRA 1RA6A 2E5GA 2MKJA 3ZTOA 1PGZA 4OI0A 3DD6A 1NHIA 1HHQA 1V5VA 1Q7LB 3M6XA 4WP8A 3KK1B 1FJGI 2CAJA 1ZAVA 2HK2A 1X4HA 3HHLB 1GT8A 1N0VC 1FWLA 4P7TA 4CO5A 5KOWA 1YJWS 3R1HA 1MN7A 1IBKE 1Y11A 2NPFA 1Z1ZA 1LWCB 2CQIA 1VC0A 4QU7A 1IR1A 2UUCE 2Q2EB 2MHNA 4YHHJ 3D6MB 3MM9A 2GJ2A 2DGSA 2DVIA 2YKOA 3OTEA 1BMQB 5E7OB 1B0VA 2BACA 2JVRA 1N5YB 2OPQB 1T9XA 3K5NA 1B62A 1TL5A 1FE4A 2RH3A 2G0CA 4V19X 5IT0A 4DG1A 1M5OC 2NYIA 1TFWA 2F4VF 5IT9C 3ZZYA 2ATCB 4IZJB 1H0HB 1RT5A 4KB7A 3OVBA 5DRPA 4R0EA 2ACMA 4LSLB 3AJ2A 5KFKA 2OUGA 3W63A 3FRYA 4CLLA 1E3HA 5ETPA 1FCAA 1EP4A 2HRYA 3CJ3A 4M5DB 2UXDJ 1DFDA 4M5GA 4ZDNA 1BQMA 1GQEA 4HXZA 2EVZA 2OAUA 3EXCX 4OHWA 4PR6A 3ZZTA 3QATA 3CWVA 2VZ9A 1ZBTA 2QLBB 2EKYA 3MDFA 3ENWA 4KYZA 4MK9A 4C3KA 4C6AA 3UI3A 4CLWA 1SBRA 5GAEI 4I7FA 5EWGA 3GILA 3L7UA 1RTDB 1MU2A 3D1OA 2WRMA 1Q5YA 5D4LA 2MLYA 1NH7A 4CO2A 4URSA 2CZVC 1B7FA 3VF0B 4LF4E 4PRVA 3AJ1A 5B0DA 2VG5A 4EO8A 2ZHAA 4ZVHA 3GV7B 2CZ9A 3SDEA 4DR4I 1KHWA 2F4VI 3MECA 3W8GA 3W9HA 1PAEX 4L75A 2Q66A 4DUYI 3TX0A 4AE5A 4XDCA 2PMWA 3KMQA 3NZKA 4I2PA 2CQPA 5F9LA 3TZXA 4JYAF 4OV6A 1LW2A 4ZS6A 2MSSA 3UHMA 1VQKS 2M7SA 5L1IA 3QFWA 5H1SV 2WSCC 1TKTB 1HPZA 2DNYA 2QA4S 1K8AT 4DV5I 5GAGU 2B0GA 1S59A 4IH7A 5EWFA 3MAQA 2XI2A 2WB1D 3NLCA 4RW7B 4N47A 4LFCE 4DR4F 4IFVB 3PR5B 4K0KE 1NKBA 2VDIA 1EHWA 2FZCB 3MM6A 2R8GA 3IA0A 4JI6E 2PC6A 3POTA 4DR1I 4I56A 3L95X 2DK2A 3MMAB 1W26A 2QLXA 4KY3A 2EC0A 4DR2E 3VZHA 4I2QA 4JI3E 4JI1E 4NA3A 1UWBA 1Y10A 3CCTA 3CGIA 4I64A 2PA3A 2L48A 2KI2A 2CJQA 2RU3A 1XXEA 3JSRA 4IOAQ 1F5AA 1ZH5A 4AQYI 4P7AA 3ILJA 3CDEA 3AD8C 3C66A 3M9OB 2R7VA 1AYEA 2GX8A 4KIAA 3C15B 3WU5A 2YNIA 3AQPA 3LOUA 2M3DA 4KFBA 2H5JB 4YHHE 2W01A 3D3CJ 1XNQF 3N6LA 1X9MA 3PJWA 1HR0J 2LQBA 4DUZJ 1FJGF 1TTHB 2QSWA 3CWJA 3Q83A 3QGPA 3H2LA 1AUSL 2IMOA 5C5JA 4JI2J 4JI5F 5HLFA 1ICEB 1RWOB 4I67A 4K4YA 3DGVA 1RKIA 2JSXA 4DR3F 4YB6A 4ED2A 1XMQE 3S8SA 2LCWA 2X1BA 3BYPA 2WBMA 1N48A 1VQ4S 4B9VA 4DR6J 4NXNI 5DNXA 3MM7A 1GMWD 4GMKA 2ZH1A 7FD1A 4YY3J 2RDIA 1BE4A 4B08A 3VQTA 3OTOJ 4RU2A 2AJQA 4LCFA 4X62I 2WSEC 3AD7C 1BQXA 1NDPA 3UDCA 4J9OA 3N6NA 4BC9A 5A8KA 4ED7A 3DRRA 3V81B 4B3TF 4JI0F 2Y1LB 5KFQA 3OXLA 2XLIA 3HVRA 2AYEA 4IFDC 4I0WA 2YBVA 4IG3B 4PPZA 4ECUA 2VONA 4ID8A 1OMSA 2ZJRQ 2XC9A 3I5CA 4IO1A 2ROGA 2DKOB 1R8HA 2E1RA 2YH1A 1IKXA 3T5LA 4OYPA 2XZTB 1K73T 4ZPAA 2FJXA 3OTCA 3WIUA 4AXIA 3I5BA 4MKYA 2UXBF 3DLJA 3DLGA 2B56A 1PO6A 1UVMA 3NXZA 1KOOA 4AD6A 4F50A 3SQGA 5CD4A 4EZ6A 2DNOA 4ECYA 1WI6A 3P45B 2ZITA 1OSCA 3GZ7A 2HGNA 3MR7A 5D4PA 1IBKF 3HKWA 2BA1G 4U3DA 2DY9A 2ZKUA 2ZOFA 1DLOB 3D1HA 3HHEA 4J3DA 3PX6A 2HK3A 4OYIA 3KG1A 4NLDA 3SV4A 2XHCA 4F04B 2JEIA 3NBPB 4RWXA 4GO7X 1ZYQA 1JLBB 4KKOB 2XS2A 2J65A 3GLJA 4EBCA 1HI1A 2H5EA 3N01A 3ENQA 3P5BP 4BHQA 3MR6A 1TK0A 3RR7A 4F2RA 1QE1B 3MI7X 1FX2A 1HW9A 3NL0A 1KS2A 3EE3A 3U27A 3BSNA 4ECWA 1UDOA 4OYXA 3ETMA 4OMFG 3OFHA 1LK5A 1CPZA 4L6V3 4XDDA 2DH7A 1TV6A 3TOQA 4A8OA 3BREA 1RCOB 3WQPA 2UUTA 2ZVSA 2Q6CA 4IO9Q 2NN6A 2OSQA 4O44A 1K47A 4BWJA 5KG1A 2DR6A 2WNRA 5T7LA 5AXMA 3T6BA 2YKAA 1H7WA 2AWZA 5DGBA 3JAMY 4AL5A 5C0XA 4ICLB 2CPYA 2BOPA 2K3IA 1G4CA 1D6TA 3I9ZA 1VK3A 2CG8A 1BHNA 2J9DE 3VZIA 2W9CB 4WK3A 1WI8A 2M4MA 1FXRA 1SH3A 2CQ2A 2GQ2A 3CJ2A 3L4BC 4LF4J 2HWTA 4LCHA 3K17A 1VHIA 4UTGA 5HBMA 4JI8I 4KQZA 3PEJA 3GU0A 4NLSA 2JEGA 3ZTRA 4LF7F 3Q0AA 4B3MF 4OO1A 2V2VA 6FD1A 1NHUA 1YRXA 4NWBA 1WORA 1V3SA 2HNDB 3Q8RB 3JQKA 4JV5J 2YWWA 3BYRA 2AEJA 3CF5Q 4FXWA 4DV3E 3RB4A 3NNCA 4LFBI 5B0FA 5LJ5Y 1A7GE 2XMWA 3GFYA 2IVFB 2HHUA 1X60A 3JTNA 4CI0B 1MWZA 2V4QA 5KG4A 5KT7A 3UN2A 4WXWA 4DFMA 4PWDB 1RWKB 3V6KA 1S48A 2QV6A 4IR1A 4IFDF 4KR0B 3S6EA 1X7VA 2AF6A 1QJHA 1S1WB 2DY1A 2OD6A 4FXDA 1OYRA 2JX2A 4OYBA 2I5JB 1XMOJ 1VFJA 3RYLA 1VBZA 1WEYA 5KFCA 3AY0A 2FUG9 4TQRA 2AX0A 2E1PA 2OEJA 2UUWA 4XAKA 3M8QA 2QG9B 4LFCF 2EC2A 1HD1A 5K36F 3T41A 4XPEA 1EB0A 4DQRA 1VR6A 4OLPA 1ZETA 4DCOB 1RHRB 2VQEJ 1LW2B 2HHPA 2ZNZA 5LMUE 4C11B 3PO5A 4DR2F 2B9XA 3BSAA 3GR1A 5LMNE 3IRXA 1JIHA 3JSBA 4DPYA 4DV0F 2UUBF 3UR3C 1S99A 2OKQA 3DYAB 3NP5A 3EYZA 2YX7A 3SSSA 4A8MP 1U47A 2VODA 2VFVA 4IFDA 4Q7AA 4URLA 3FBBA 3A13A 1DZ5A 4TNOA 1T3OA 4KGZB 5ELWA 4I2QB 4B3TJ 2HZAA 5KFZA 4YHHF 4DCJB 1M5KC 4PXDA 2W2MP 4CDIA 4K50A 1TKXA 2BR2B 3ENVA 4YR0A 2D3OR 4LVNP 1VBXA 3PW7A 4XTJA 3J81j 1GTEA 1U45A 2YNHA 3G87A 1KQSR 1NZAA 4GC6A 3R5CA 5FDLA 3HSJA 1O0PA 4MU0A 4DV6I 3L09A 3KLHA 1YBTA 5K14B 1DTTA 4DUYJ 4DFJA 3UDEA 2E5LF 4M94A 2Z5BA 1PVGA 2DRAA 4RNMA 2E9ZA 3GCXP 2R2RA 4ZCKA 1I51B 1RBOB 2K8GA 4R8UB 3CJTA 2Z4PA 5LM7E 3OTOI 1P9QC 3I0SA 5MAOA 1FNOA 2DRDA 3PG9A 1NK5A 1EAYC 5B0BA 5DRKA 2X51A 1WACA 5HBMB 2KJWA 5D0GA 3LP2B 2B4VA 3QBCA 5HANA 1HNIA 5L46A 1V3ZA 4RW4B 2MZTA 3W5XA 1KEKA 3PY8A 2NN6F 3BQ0A 2ZH7A 2BJEA 4QPTA 2UXCF 2M88A 1F3FA 1HLWA 3FMBA 5HROB 3Q8VA 4P71A 1YJ7A 4JI4F 2ZWPA 1M5PC 3FGVA 2E5LJ 2CJBA 3PS1A 1QLNA 2FQQB 3MCMA 4FWDA 2KXFA 4OZ1A 2LU1A 1CC7A 3M2UB 3QO9A 1P6TA 4AQYE 1X4GA 2ZBRA 3UN3A 1LWCA 4NASA 2A2DA 2RIJA 3BBFA 3KLFA 5KG3A 2PNLA 2VC1A 5C0XC 3J7ZT 3G82A 4DR2I 4QYRA 4OJHA 1SC6A 3MM7B 4KSEB 5AE2A 3TUJC 1NJWA 3DN9A 1GFWB 4JI7F 1RBAA 3R97A 2AV5A 1XHKA 5KAKA 2XO7A 3IS9B 1U1LA 4WCEQ 3D0GE 1XC9A 2R7TA 3UNGC 4MU4A 1MSWD 2N4DA 3H98A 5CYQA 3SIPB 4EFAC 3JSYA 3KHGA 4DV0J 2HSEB 2Z2YB 4RUHA 4DV5E 1ZAXA 3R6LB 5DQIA 5DO2A 2NN6C 4OYAA 1SKWA 1BKNA 3K85A 3ITHB 4Y2MA 3OTOE 3MOZA 4CLKA 5F8IA 1U2CA 3K5MA 3OHAA 4DR6E 1VQOS 1RWUA 1DQ8A 1K1QA 3CDJA 2UXDI 3FFIB 3CCMS 3UVJA 2VIHA 1R8CA 4KTQA 3QRRA 4HYKA 3I31A 3DMJA 4NXME 3J7YI 1NPRA 4MKVA 1NUEA 3JS9A 1S9EB 3QT5A 4HTIA 3CUNA 1JJ2R 2FLOA 4AT1B 4LF4I 2GVZB 1HR0F 1KDNA 3DLKA 4OQJA 4CO3A 3GIJA 1RTDA 2ALYB 3HFKA 1JLBA 2B9EA 1REVA 2NCKL 2WVCA 3NOGA 4KKOA 3ILIA 2GO8A 5K36C 1KTQA 1KSPA 3T1YI 4B3ME 4KPCA 1HBOB 5IV3A 2WW8A 4F8RA 2VOPA 2LQ5A 3IM9A 5F0WA 4ZJQA 1T9VA 1JXVA 5I3PA 4JI2F 3H8YA 5ETOA 1S0MA 2D7SA 3IP0A 2X1AA 5D3GB 2CNOB 5IT9U 4N3OA 1N36F 1B0PA 1NXIA 1QAYA 2EFQA 4WE1A 5KFXA 1RWNB 3W65A 1R8BA 2RQKA 5LJ3Y 4I1TA 1IXKA 2ZH6A 2VUGA 1SKSA 2C39B 4IFDE 4NEYA 5KG0A 3IS9A 3T1HJ 1S7HA 3F56A 4WKYA 4DR7I 4R1FA 3EPGA 3C15A 2Q6BA 2V8DA 2YNIB 4KFBB 5A6PA 3CD7A 3T9ZA 1Q78A 3HVTA 4DPXA 4ECTA 3VV2B 1DTQB 2LEPA 2CPXA 5KFNA 4ED4A 5FWKA 2F5GA 1X4AA 2OEMA 2ABYA 1Y5NB 3Q8UA 4X65J 4FF1A 2KVIA 5K36E 4ES3A 1ZZNA 2BRLA 1UAWA 2VH7A 4JB8B 5C2GA 1RAOA 1PYSB 2Y1RI 3MMBA 3PIPQ 4ZPWR 1R3NA 3HHKA 1VOMA 5T14A 3QAEA 3J81Y 3PO4A 4DQPA 3EGVA 2HPUA 2NN6D 5LSRA 1Z0TA 2CQ1A 3BGUA 3HHLA 2MTLA 3VWSA 4FYXB 3AOAA 2ZM6J 4B3OA 4JI8E 6FDRA 3V81A 4OZ0A 1JKHB 4A48A 2KXNB 2BJ1A 4F02A 2BJDA 2GGPB 4FKYA 4WP9A 3ULHA 3VCDA 2YKMA 2XCPA 4K5SA 2W2NP 2R7UA 3DYAA 2I5JA 3H20A 3IWNC 3M2VA 2KYXA 2NYHA 2AT1B 3BR9A 4N7TA 1M1GA 3TZYA 2ASLA 4KJIA 1IBLI 1QD1A 4M1KA 2PI5A 4NXNJ 3GG0A 2DBBA 3HJVA 1U1OA 3OBIA 4OZNA 1SQFA 2FGOA 3HF5A 3O3LA 4NYOA 5FLXU 2UXBJ 1NK9A 2ZD1B 3CJ8A 3G6VA 4DQIA 2R2UA 1JLCB 2R2TA 1TL1B 1SJRA 4NLVA 4JBCA 2JZ5A 2WOMA 4CH7A 3ZO7A 2MJNA 2JEBA 1IKVB 3TNVA 4DV7F 3CO9A 4LR9A 1XWLA 3DOKB 2D74B 3KKFA 4XPCA 5CAAA 1VRUB 3N79A 1LV5A 1WTBA 1EP4B 4DPWA 4NLTA 2C39A 1V3RA 2J76E 2OEKA 3CC4S 3RB0A 1N5SA 2HBQB 4X64E 2HMIB 1H72C 2Y1JA 1GX5A 2DCLA 1N5QA 1HNIB 1RT5B 2C2OB 3AXMA 4ZVUB 4YR3A 1ZAWA 2MGZB 3G8SA 3K58A 1USVA 2HQFA 3IAS9 4AQYF 3U1YA 4M5LA 2CVEA 5L1LA 4LF5E 2ZUAA 4AFFA 4E0DA 1UJ4A 4M8LA 1UW9A 3CIZA 1JJHA 1WEXA 4C2MA 2MQ8A 4UOHA 4ZJLA 3HM9A 1TQLA 5GAHI 3Q8PB 1C0UB 4ZP8A 1N6QB 2XZWA 5D0HA 1N5VA 3CCSS 1CJKB 2PE8A 4KH0B 1QE1A 4ZPDA 3S01A 3IRWP 3V4IA 4DV1I 2NPIA 1N52B 1UW4A 1XMOF 3Q2TC 3M2RA 1OQ3A 1IN0A 1HNWJ 4G1IA 4DV5F 1OYSA 2GW8A 1WG1A 2BKOA 4ZVQB 2CIMA 2QL7B 1HL6A 1J27A 3SDEB 1RYSA 2DEIA 5K36D 5KFTA 4XIUA 3HZGA 5HROA 1JLFA 3G8QA 4MK8A 1NDKA 3G8TA 2Z8QA 3HVWA 2C2EA 5BR8F 4FF4A 1WHWA 1RE1B 3AOBA 3QGHA 1CS4A 1JKHA 1PG5B 4P7VA 2DNMA 2OPRA 5GAEU 4WBFA 1EIYB 1FK9A 2LLZA 9ATCB 4USKA 4YS2A 3VAIA 2V8HA 2FVQA 1UDQA 1ZTTA 4YHHI 4UOFA 3J7YU 3JAMC 4HHJA 4ELVA 4N8OA 1RAJA 2XSJA 4HVZA 4U8YA 4M5JA 3DLBA 1RTIA 3ZZUA 1WC1A 2V6AA 3RUBL 1VIOA 3EGNA 1UCNA 4OX9E 1MG7A 1OY8A 3SQGB 5BR8J 2J0SD 5J2QB 1IBME 4DX7A 4JI1I 4DV1E 2M9KA 4L3KA 2WCXA 4WJBA 3OSNA 3D28A 3QT7A 3LAMA 2ZFHA 3WZ0A 5DETA 1TK8A 4D3HA 2AJ2A 2B7CB 1FJ7A 5HMYA 3BR8A 4MMOA 4ECSA 3IXQA 1H74A 3LH2S 3BV8A 3ZXWA 2RF2B 4PWDA 1N36E 2ZM6E 2FHKA 2KT5A 2QTWA 5A0YA 4DWIA 1BLUA 2DD8S 2JEFA 3DOMB 5IOLA 3T1HF 3UD5A 2KJVA 3FDSA 1N34F 1AROP 5HQ8A 3GSIA 1GEHA 2I1RA 1JLAB 2HQGA 3FEXB 2W9BB 5LMUI 2MSTA 3KJFB 3PHEA 4H4KC 5H9FJ 1Q8BA 2OTLS 2HHSA 4LRBA 4B02A 4QWDA 3NRBA 2NN6B 2MY7A 1IKWA 5GADU 1FKAF 4JYAJ 2CG9A 3QRPA 2DYAA 1OO0B 2R8HA 1U8WA 1IKXB 2JHEA 3Q6MA 2V34A 4Y00A 1ZA2B 4LFBJ 1UJ5A 5BR8I 1RWXB 2OLWA 2V9KA 2VV5A 3FRZA 3MMAA 3PJXA 2FLLA 4ED6A 3QJLA 4GRSA 3TJ8A 4LF9I 1JLEB 2UVWA 2AGOA 3WU3A 1FKPB 3ZZZA 1Z0BA 1WELA 4DV7J 4K4ZA 3IR5B 2WVFA 3CCQS 3MEEA 4OX7A 5L8RC 1HNZF 2W4PA 4P72A 4X4VA 2MJUA 3DDIA 4M5DA 1MNEA 3NCPA 1L3UA 4JV5E 1S1XB 3U02A 3BH6B 3EVOA 3KNGA 3OL7A 4KGMA 3CCJS 1L3SA 1HWIA 4IUFA 2C38B 3B82A 5KFOA 1Q8LA 2RAQA 4HL9A 2UUCF 4IS9A 4OYWA 4NI2A 1OQ6A 4A4JA 2XWXA 2V0NA 1TVRB 1BXNA 2JC0A 2HKEA 1ZM2A 5ETSA 3IM8A 5BXIA 3W60A 5KFHA 1HYSA 2LXIA 3HSDA 1JX4A 2PDAA 3FQKA 5KFGA 3WX8A 2GCFA 4KHPJ 5ETMA 4LREA 2V9WA 4JI7I 3MEDB 5HJXA 4TY8B 2R8JA 3ZKDA 2ASYA 4U96A 4Y28C 5KFAA 1CVJA 4CP5A 1RT3A 3M30B 1HARA 1KRPA 1FJEB 3BO4A 2MEWA 3PACA 2RJZA 4Y2AA 2E9TA 4P75A 1C1BA 3R2CJ 2LU2A 3CDBA 2RHSB 2GV1A 1F1BB 1UKUA 2NLWA 3Q86A 4OLOA 4M5NA 2I2YA 3CULA 4DR4E 1SC3B 3RU0A 4IDKB 4RUAA 4WYWA 5CA5A 2GQ0A 3VALA 2ZH3A 4I6WA 2COLA 4ED8A 1D3WA 2YXLA 4LF5F 2QLJB 3DLHA 4USTA 4ZVRB 1O8BA 3HSZA 2BANB 4KO0A 1BQMB 1KBRA 3KXDA 3QIPA 4IQXA 1JLAA 5E0OA 1CBKA 2SXLA 4RKUC 2W9BA 4DV1J 1B70B 1K0TA 2OO4A 3NCQA 1KD1T 3W64A 4I6AA 2IRYA 2YKMB 3A8EA 1S9GA 4I69A 4QW8A 5HI7A 1NKEA 2ZH9A 1S6PB 3QPIA 2IC3A 2AP6A 2QA4G 1KFDA 2C2NA 2GJIA 2AJ4A 4FF3A 2VQFI 1UEUA 3W7BA 4PG4A 2RHQB 4DR1F 3US5A 4IH6A 3V4IB 1SL2A 4X62J 2L41A 1RDRA 3POTB 3WDOA 3KFWX 3VQSA 3GE9A 2VPXB 4KHRA 3LWMA 3FSXA 2JRSA 4QPXA 4DR3I 2D69A 4K2XA 3B54A 2KU7A 2EK6A 2L08A 5D0EA 4WKRA 3KJQB 1YVFA 2O3ZA 4NXMI 1D9AA 1I5OB 2FPHX 2JFDA 3DLEB 2CQHA 1Q82T 2VA3A 2PO2A 1HQEA 1EETA 2CFXA 2K2PA 3GJQB 1TKZB 4I6YA 1KQKA 2MMYA 2ERRA 2WVBA 1C4AA 2GVDA 3T1YJ 2ZZNA 1RACB 2ALZA 3GJTB 4WU3A 2VBZA 2IY5B 4ITSA 1FTCA 1FWKA 4PU9A 3LUYA 2HURA 4YDXA 1XMQI 3LGHA 1X4FA 3MM6B 1NK7A 4ZA1A 1TAUA 1USUA 4ZVIA 4C8KA 1FFSB 4MFBA 1T11A 1HYSB 2E7VA 4U67Q 5LL6R 2B4OA 5HLFB 2HAIA 4OI2A 4OV1A 1S6QA 4RW9B 2DGUA 4WUBA 1MROA 4L72B 2OJ3A 4OO1C 4MYTA 1EKSA 2ZZTA 2K7JA 2DIUA 2E44A 4GC7A 1WTFA 1U6BA 4ID5B 3PCOB 1S97A 2ZBQA 4DR7J 2R7WA 5ETNA 2ZH2A 1I94E 3V6JA 3KMSA 5F8HA 3ILOA 3FVYA 2VG6B 4DU8A 1N34E 1L3VA 2A0FB 3GSDA 2MDAA 3C16B 4TLRA 4JI3I 2VQEE 2GMHA 2Q79A 5DJBA 1NJXA 1IBLF 3HD1A 4EYHB 1VLYA 1TP7A 2AJ0A 2XHWA 2K06A 3SBMA 2UUAF 3DNCA 5T41A 2OMOA 3K2YA 4GQUA 3FFIA 1IR2A 1MMLA 1U0SA 2AHOB 4OJGA 3RAQA 4NLQA 4Q5VA 5J2QA 3GPAA 5BYRA 4Y34A 2L9WA 4O23A 1S6OA 4YEAA 4F0MA 4RW6A 1U6FA 2BW7A 2Y3YA 1GK8A 2V2QA 4WTYA 4E8UA 5ETRA 4PKDB 2J9EA 2NXUA 3BDPA 2DNPA 2PI4A 1MWQA 4B9LA 4Q0BA 2HHXA 4BLGA 4WTOB 3MM9B 1B99A 3R8YA 3EDQB 2HW3A 2UXBE 2E5JA 1R43A
chains in the Genus database with same CATH topology
2O1UA 1IBMI 2Z5CB 2A2CA 3T1HI 4KQVA 1WUUA 4IZKA 1EI1A 2UXBI 4Z7YA 1J5EI 4LF7I 2F4VE 3HULA 1K47A 4DV2E 1N36I 3GONA 2CGEA 2IOPA 1D6TA 1QZRA 4DR1I 4HY1A 1HNZI 3Q6NA 3K17A 5FWKA 4UTGA 5LL6R 4JI8I 4OX9I 1I94I 2IOQA 2O1WA 2V2VA 2UUAI 4LF8E 4DV3E 4LFBI 4LF5I 4DV2I 2GS8A 3HJCA 2EFGA 2J7KA 3F0NA 2BV3A 1XNRI 4X64I 5IT9Q 3P06A 1Y6ZA 4LFAE 1Z5CA 1ZXMA 4DV6E 1U2RA 4JG4A 3PYEA 1A6FA 2O1TA 4B3SE 5LMUE 2PNMA 5LMNE 4DPYA 3JAMQ 1HNXE 4YY3I 2VQFE 4URLA 4GKJI 5LMNI 1J5EE 1Y4UA 1XNQE 4DV0E 2VQEI 3LTOA 4FWGA 4XTJA 4DV6I 4DUZE 1H7UA 3QT8A 4X66E 2Z5BA 4LFAI 1PVGA 3OTOI 2HKJA 4X65E 4DV4I 4JI4E 1NZ0A 4I3HA 4JI0E 2ZBKB 2E5LE 5IWAE 5FLXQ 3M6AA 1KIJA 1IBLE 1UEKA 1Z0CA 2UUAE 1Z0EA 4JI7E 1H7SA 3J81C 1B63A 4FWDA 4AQYE 2A2DA 2UUBI 2PNLA 4DR2I 2Z5CA 1MU5A 2UXCE 4FWHA 1XHKA 4HACA 4B3MI 4GKKE 5L3JA 4JI0I 1HR0I 1KKHA 1ZM4A 4DV5E 1HNWE 4JI4I 4DV7I 3K85A 1BKNA 2O1VA 4X65I 3OTOE 1NHJA 1Y4SA 3LNUA 4USMA 3B78A 4DR6E 1MX0A 2UXDE 2UXDI 4RPFA 4MYUA 4NXME 4DV0I 3QT5A 1XNQI 4FW9A 1FI4A 4LF4I 1ZM3A 3WU6A 4JI2E 4GKJE 3T1YE 1HR0E 3T1YI 4GKKI 4B3ME 2R3VA 3PYFA 4IZJD 1Z5BA 3WU4A 2UXBE 4IZJA 4N3OA 1ZXNA 3V2UC 4DR6I 3ZM7A 4DR7I 4R1FA 4NXNE 1XNRE 2Z5BB 4DXLA 4DPXA 4ED4A 2OI2A 1ZM9A 5A2QQ 4UT4A 3PYDA 1Z0TA 1N33I 4PRXA 2VF3A 4JI8E 3J80C 1HNZE 1HK7A 4WUDA 5GMEA 2XEXA 1IBLI 5A2QC 4M1KA 4HYMA 3PYGA 4DR5I 2BM1A 4KHPE 4JI2I 1IBKI 1Z0GA 4JI5I 4Z7CA 4DPWA 4X64E 4WUCA 2HHHE 2HFUA 1H72C 1N32I 1FNMA 1PKPA 1RR9A 4DV7E 1HNWI 4DR5E 3J7AG 1USVA 3Q1QA 1Z59A 4DPUA 1H73A 4YY3E 1XMOI 4LF5E 4DPTA 4JYAE 4DV3I 4LF8I 1ELOA 4DV1I 1N34I 2WW4A 2BM0A 2X36A 3B8HA 4DR1E 2DEIA 3K1JA 4EMDA 1DARA 3D4JA 1XMOE 4B3TI 4USKA 4LF9E 4YHHI 2DEJA 3JAMC 5BR8E 4B3RI 3ZZUA 1FJGE 1KVKA 4OX9E 1MG7A 4JI5E 1IBME 4JI1I 4DV1E 4DR3E 3QT7A 2X7IA 4JYAI 4KHPI 1H74A 1N36E 2ZM6E 2V8PA 1N0UA 1KTVA 1N32E 2HHHI 5LMUI 4B3SI 2HFSA 1NHIA 4FN5A 2CG9A 3T1HE 1FJGI 2HK2A 3Q6MA 2V34A 1FWLA 1N0VC 2UU9I 5BR8I 4B3RE 3J80Q 3J81Q 1IBKE 2NPFA 4LF9I 3WU3A 2UUCE 3H4LA 1Z0BA 2Q2EB 4JV5E 1B62A 3B82A 2UXCI 1OJ4A 4IZKB 4LF6I 5IT9C 2HKEA 4P52A 1ZM2A 1EA6A 3LPSA 1N33E 2Z5EA 4IZJB 4LF6E 4X62E 4JI7I 1PIEA 3ZKDA 4JI6I 4HXZA 4K0KI 3ZZTA 4LFCI 2E5LI 3CWVA 2LJPA 2F4VI 4LF7E 3V5RA 4LF4E 4PRVA 2CZ9A 4DR4I 4DUYI 4X66I 2GQ0A 2V2ZA 4DR4E 1NHHA 1Z0WA 4DV5I 1S16A 5FLXC 3J7AM 4LFCE 2AJ4A 3QT6A 2VQFI 4K0KE 4JI6E 4DU7A 3PRYA 4DR3I 4DR2E 4JI3E 4JI1E 4NXMI 2UUBE 4AQYI 4P7AA 4DUYE 3WU5A 4YHHE 1FWKA 4PU9A 1XMQI 1USUA 4ZVIA 4B3TE 4WUBA 2UUCI 4LFBE 4MYTA 4DV4E 1XMQE 3ZZ0A 4HACB 4NXNI 4DR7E 4X62I 1I94E 4DUZI 4DU8A 3ZKBA 1N34E 4JI3I 1VISA 2VQEE 2E1RA 1RREA 4JV5I 1FKAE 5IWAI 2R42A 1Z0VA 1Z5AA 5GMDA 2ZM6I 1HNXI 2ZITA 2V2QA 2UU9E 2HK3A 1S4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM I;  2A2C A;  3T1H I;  4KQV A;  1WUU A;  2UXB I;  1EI1 A;  4Z7Y A;  1J5E I;  4LF7 I;  2F4V E;  3HUL A;  1K47 A;  4DV2 E;  1N36 I;  3GON A;  1D6T A;  1QZR A;  4DR1 I;  4HY1 A;  1HNZ I;  3K17 A;  4OX9 I;  4UTG A;  5LL6 R;  4JI8 I;  1I94 I;  2V2V A;  2UUA I;  4LF8 E;  4DV3 E;  4LFB I;  4LF5 I;  4DV2 I;  2GS8 A;  2EFG A;  2J7K A;  3F0N A;  2BV3 A;  1XNR I;  4X64 I;  5IT9 Q;  4LFA E;  1Z5C A;  1ZXM A;  4DV6 E;  1U2R A;  4JG4 A;  3PYE A;  1A6F A;  4B3S E;  5LMU E;  5LMN E;  4DPY A;  3JAM Q;  1HNX E;  4YY3 I;  2VQF E;  4URL A;  4GKJ I;  5LMN I;  1J5E E;  1XNQ E;  4DV0 E;  2VQE I;  3LTO A;  4FWG A;  4XTJ A;  4DV6 I;  4DUZ E;  1H7U A;  3QT8 A;  4X66 E;  4LFA I;  1PVG A;  3OTO I;  2HKJ A;  4X65 E;  4DV4 I;  4JI4 E;  1NZ0 A;  4I3H A;  4JI0 E;  2ZBK B;  2E5L E;  5IWA E;  5FLX Q;  3M6A A;  1KIJ A;  1IBL E;  1UEK A;  1Z0C A;  2UUA E;  1Z0E A;  4JI7 E;  1H7S A;  3J81 C;  1B63 A;  4FWD A;  4AQY E;  2A2D A;  2UUB I;  4DR2 I;  1MU5 A;  2UXC E;  4FWH A;  1XHK A;  4HAC A;  4B3M I;  4GKK E;  5L3J A;  4JI0 I;  1HR0 I;  1KKH A;  1ZM4 A;  4DV5 E;  1HNW E;  4JI4 I;  4DV7 I;  1BKN A;  4X65 I;  3OTO E;  1NHJ A;  3LNU A;  4USM A;  3B78 A;  4DR6 E;  1MX0 A;  2UXD E;  2UXD I;  4RPF A;  4MYU A;  4NXM E;  4DV0 I;  3QT5 A;  1XNQ I;  4FW9 A;  1FI4 A;  4LF4 I;  1ZM3 A;  3WU6 A;  4JI2 E;  4GKJ E;  3T1Y E;  1HR0 E;  3T1Y I;  4GKK I;  4B3M E;  2R3V A;  3PYF A;  1Z5B A;  3WU4 A;  2UXB E;  1ZXN A;  3V2U C;  4DR6 I;  3ZM7 A;  4DR7 I;  4R1F A;  4NXN E;  1XNR E;  4DXL A;  4DPX A;  4ED4 A;  2OI2 A;  1ZM9 A;  5A2Q Q;  4UT4 A;  3PYD A;  1Z0T A;  1N33 I;  4PRX A;  2VF3 A;  4JI8 E;  3J80 C;  1HNZ E;  4WUD A;  5GME A;  2XEX A;  1IBL I;  5A2Q C;  4M1K A;  4HYM A;  3PYG A;  4DR5 I;  2BM1 A;  4KHP E;  4JI2 I;  1IBK I;  1Z0G A;  4JI5 I;  4Z7C A;  4DPW A;  4X64 E;  4WUC A;  2HHH E;  2HFU A;  1H72 C;  1N32 I;  1FNM A;  1PKP A;  1RR9 A;  4DV7 E;  1HNW I;  4DR5 E;  3J7A G;  3Q1Q A;  1Z59 A;  4DPU A;  1H73 A;  4YY3 E;  1XMO I;  4LF5 E;  4DPT A;  4JYA E;  4DV3 I;  4LF8 I;  1ELO A;  4DV1 I;  1N34 I;  2WW4 A;  2BM0 A;  2X36 A;  3B8H A;  4DR1 E;  2DEI A;  3K1J A;  4EMD A;  1DAR A;  3D4J A;  1XMO E;  4B3T I;  4USK A;  4LF9 E;  4YHH I;  2DEJ A;  3JAM C;  5BR8 E;  4B3R I;  3ZZU A;  1FJG E;  1KVK A;  4OX9 E;  1MG7 A;  4JI5 E;  1IBM E;  4JI1 I;  4DV1 E;  4DR3 E;  3QT7 A;  2X7I A;  4JYA I;  4KHP I;  1H74 A;  1N36 E;  2ZM6 E;  2V8P A;  1N0U A;  1KTV A;  1N32 E;  2HHH I;  5LMU I;  4B3S I;  2HFS A;  1NHI A;  4FN5 A;  3T1H E;  1FJG I;  2HK2 A;  2V34 A;  1FWL A;  1N0V C;  2UU9 I;  5BR8 I;  4B3R E;  3J80 Q;  3J81 Q;  1IBK E;  2NPF A;  4LF9 I;  3WU3 A;  2UUC E;  3H4L A;  1Z0B A;  2Q2E B;  4JV5 E;  1B62 A;  3B82 A;  2UXC I;  1OJ4 A;  4LF6 I;  5IT9 C;  2HKE A;  4P52 A;  1ZM2 A;  1EA6 A;  3LPS A;  1N33 E;  4LF6 E;  4X62 E;  4JI7 I;  1PIE A;  3ZKD A;  4JI6 I;  4HXZ A;  4K0K I;  3ZZT A;  4LFC I;  2E5L I;  3CWV A;  2LJP A;  2F4V I;  4LF7 E;  3V5R A;  4LF4 E;  4PRV A;  2CZ9 A;  4DR4 I;  4DUY I;  4X66 I;  2V2Z A;  4DR4 E;  1NHH A;  1Z0W A;  4DV5 I;  1S16 A;  5FLX C;  3J7A M;  4LFC E;  2AJ4 A;  3QT6 A;  2VQF I;  4K0K E;  4JI6 E;  4DU7 A;  4DR3 I;  4DR2 E;  4JI3 E;  4JI1 E;  4NXM I;  2UUB E;  4AQY I;  4P7A A;  4DUY E;  3WU5 A;  4YHH E;  1FWK A;  4PU9 A;  1XMQ I;  4ZVI A;  4B3T E;  4WUB A;  2UUC I;  4LFB E;  4MYT A;  4DV4 E;  1XMQ E;  3ZZ0 A;  4HAC B;  4NXN I;  4DR7 E;  4X62 I;  1I94 E;  4DUZ I;  4DU8 A;  3ZKB A;  1N34 E;  4JI3 I;  1VIS A;  2VQE E;  2E1R A;  1RRE A;  4JV5 I;  1FKA E;  5IWA I;  2R42 A;  1Z0V A;  1Z5A A;  5GMD A;  2ZM6 I;  1HNX I;  2ZIT A;  2V2Q A;  2UU9 E;  2HK3 A;  1S4E A; 
#chains in the Genus database with same CATH topology
 2ASD A;  3T1H I;  3ET6 A;  4ZP7 A;  1QAI A;  5M2R A;  5FDL B;  2B4U A;  2VKZ G;  5ITH A;  2UUA J;  4QNJ A;  2CWX A;  1B4S A;  1EI1 A;  5I42 A;  1RWV B;  1WEZ A;  3NGD A;  2G0J A;  2JNJ A;  1N8R T;  2UVR A;  1FES A;  4Q2L A;  5C0X F;  1FRL A;  1W25 A;  4QJV A;  4JI4 J;  3UCZ P;  1NK4 A;  5DRQ A;  4LF7 I;  1JLG A;  3KLF B;  2F4V E;  2VDH A;  3OTD A;  3TEH B;  3HUL A;  1CJU B;  4HT7 A;  4DR4 J;  1TL3 A;  3NEK A;  2R7R A;  3C19 A;  3I0R A;  5GAG I;  1URN A;  5E3P A;  2E5H A;  2MQP A;  5H9E K;  3ZZR A;  3IBC B;  3FBC A;  1D09 B;  4J9U E;  2CYY A;  2QA2 A;  2VBX A;  4CLU A;  2XLJ A;  1HNX J;  4LF8 F;  2BA0 D;  2XYP B;  5ETQ A;  2U1A A;  4HTJ A;  3T3F A;  1HNZ I;  2VC0 A;  3Q6N A;  5E33 A;  2CQ3 A;  4F4W A;  1TL4 A;  5E2Q A;  4A8Y A;  2F4V J;  5CYJ A;  2I0X A;  4ES2 A;  4ZVT B;  1APS A;  1PAU B;  2OP5 A;  1T03 A;  2F65 A;  2F4F A;  1KON A;  2HAF A;  2LQ9 A;  5GVQ A;  1VQN S;  2O1W A;  3FUY A;  1DQ9 A;  3Q24 A;  2AJF E;  3IMQ J;  1KN6 A;  2UUA I;  1JLF B;  2CA9 A;  2PMH A;  2VBY A;  1HA1 A;  4UOC A;  2VJU A;  4DEZ A;  1IKY A;  3GIM A;  2UU9 J;  3H59 A;  4FBT A;  1FO1 A;  4DR1 E;  2ADC A;  5I3U B;  4F4X A;  4DV2 I;  3GJS B;  1G6B A;  1FVQ A;  1R27 B;  5A8K B;  4M5I A;  3M8S A;  3HJC A;  1WF2 A;  1S1T A;  4USV A;  2UVU A;  2KG0 A;  4MAK A;  3AFG A;  2DGX A;  2KT3 A;  1F3V A;  2J6U A;  1NSK L;  2J8S A;  3B4M A;  4WFX A;  3QFH A;  1WF0 A;  4RBU A;  2PT0 A;  4KBI A;  3MOJ B;  2XSJ B;  5IT9 Q;  1RYR A;  1P1T A;  1Y6Z A;  4LFA E;  2DNN A;  5HL7 Q;  1N5T A;  3DHW C;  2NXN A;  1Q4R A;  3HX9 A;  1Y7P A;  1ZXM A;  3PW2 A;  1R8P A;  2ATL A;  2VOO A;  3AT1 B;  4JG4 A;  3PYE A;  3H7H B;  1VQ6 S;  5K8N A;  5D3G A;  1VBK A;  4WFA Q;  4J9L A;  5F8M A;  1VIX A;  4C11 A;  4FDF A;  4NXM J;  1KVJ A;  2A3J A;  2GHP A;  2VFT A;  1QSY A;  4NLY A;  1HNX E;  4ZN3 A;  1RAE B;  1TEL A;  2EFN A;  3CO0 P;  3PFO A;  3ZC4 A;  5AT1 B;  4B9S A;  3KDO A;  3MEK A;  1RXO B;  3NWR A;  4YY3 I;  3DLG B;  3CJ4 A;  4DL6 A;  3HPO A;  4AL7 A;  4LF1 A;  2WTF A;  4USI A;  4GKJ I;  1DTQ A;  3VGV A;  3VAJ A;  3ONQ A;  1UZD A;  1SL0 A;  2DR8 A;  2FJB B;  2GNK A;  3MUM P;  3F44 A;  3EPI A;  1XMQ J;  5I3Q A;  2EBE A;  3AD9 C;  3LP0 A;  7FDR A;  1XNQ E;  1SH0 A;  5J2N A;  3DM2 B;  4X65 F;  3BH7 B;  2C2D A;  3T19 A;  1U4B A;  2FIU A;  4LPF A;  4X64 J;  3SSQ A;  4ECQ A;  1Y9O A;  3MMB B;  1RKJ A;  2BX6 A;  2MZ1 A;  1RU2 A;  1K9M T;  4DUZ E;  4G65 A;  4ELU A;  4RZR A;  2KTQ A;  1H7U A;  3QT8 A;  4X66 E;  3LAN A;  2DXD A;  4ZPB A;  4J9N A;  2CVI A;  4LFA I;  2AGQ A;  2YQ3 A;  1RTZ A;  5KT5 A;  3LF0 A;  4F4Y A;  3PFE A;  2GO9 A;  3JTO A;  1L3K A;  3NMA A;  4QZV B;  2HKJ A;  1EKR A;  1SUQ B;  2G2Z A;  2Z58 B;  3GR0 A;  3VGS A;  4ILM A;  1RU1 A;  3QGI A;  3HHN B;  4DV4 I;  1RIS A;  1YLX A;  2K1R A;  3ENA A;  5C24 A;  5JMN A;  1XTZ A;  2JC1 A;  4CIO A;  2JEJ A;  3M85 G;  4JI0 E;  3KUE A;  2B8Q A;  2BUN A;  3K57 A;  4OI4 A;  2GMJ A;  4IG0 A;  1RP5 A;  1EAR A;  4KRW A;  5DZ6 A;  5AE3 A;  2WZ1 A;  5DDQ C;  5K8P A;  5DG8 A;  4AL6 A;  3CJ5 A;  3L3C A;  1KIJ A;  2OD4 A;  1YX2 A;  3EZO A;  1E6V A;  1RTH B;  2V94 A;  3KDN A;  3R5A A;  4CM0 A;  4HKQ A;  3LA0 A;  3DLL Q;  1KR4 A;  2DH9 A;  3CSK A;  4ZLL A;  2BA9 A;  2XWY A;  1PJ6 A;  2UUA E;  4R25 A;  3BGO P;  3TRG A;  4DL2 A;  1S9F A;  1DUR A;  3J7A N;  2MKS A;  5KFI A;  2F63 A;  1TL1 A;  1BY9 A;  3MPU B;  4LF9 J;  2RT3 A;  4A47 A;  1JQG A;  3QO9 B;  2H4W B;  3A8I A;  1IJE B;  1S1T B;  2DGT A;  1NRK A;  2YNF A;  1Q95 G;  4OYO A;  4F26 A;  5BJR A;  1FFG B;  1X0P A;  1TV6 B;  3GCW P;  1FD2 A;  2Q43 A;  3FQL A;  4ANE A;  5HMZ A;  2UUB I;  2Z5C A;  3UCG A;  1RA7 A;  2M70 A;  2UXC E;  2BKP A;  4RNO A;  2NXE A;  4F67 A;  4FWH A;  2R7X A;  4IQM A;  4LF4 F;  1SIW B;  5C42 A;  4DHV A;  4G1Q A;  5HMX A;  5ETK A;  4DSL A;  2JEA A;  2W2O P;  4OZL A;  2W9A A;  4KE5 A;  3E01 B;  4YB7 A;  5L1K A;  1XN9 A;  2LMI A;  1UFW A;  2I8E A;  1CLF A;  4WWS A;  2ZBI A;  5ETT A;  2P2C B;  4JI4 I;  3HCX A;  2XMJ A;  2DXF A;  2IDE A;  2J9C A;  2J0W A;  1WC5 A;  5JXS A;  4X65 I;  3PM9 A;  2KKH A;  3BGF A;  3IN5 A;  1NHJ A;  5AJ3 F;  4USM A;  2OPP A;  3PRD A;  2OML A;  4ZN1 A;  4GKK F;  4U7U K;  4K0K F;  2GFF A;  5DGA A;  3DXB A;  5IS2 A;  2C3U A;  2QE5 A;  4RPF A;  1OPI A;  4J9R A;  1TAQ A;  3TUZ C;  4F3O A;  2M2B A;  2V8V A;  5I4M A;  3GIR A;  3A3N B;  3MMJ A;  4ATN A;  5JEA E;  2GIR A;  5BYS A;  5J1E B;  1S77 D;  4DMZ A;  4DL3 A;  1PKU A;  4UUW A;  1BQN B;  4DR6 F;  4IYQ A;  5BYQ A;  3BKF A;  2UP1 A;  4K4V A;  1VQP S;  2YPY A;  3W9J A;  4F25 A;  1V9O A;  2EI5 A;  4FXV A;  4R0J A;  5B09 A;  3CMA S;  4NML A;  4B3M J;  2FC9 A;  3IC1 A;  3PYF A;  4CCH A;  2AX1 A;  3QGG A;  3DI6 B;  1RT6 B;  1Z5B A;  3HKZ D;  3U1N A;  3BKT A;  4DV3 F;  3HO1 A;  3KNA A;  2MZR A;  3WU4 A;  2ZC4 A;  2J8A A;  2JFK A;  3J80 U;  1RZM A;  4GKJ F;  3UNY A;  4USW A;  1R6L A;  4IZJ A;  2QN6 B;  1TL3 B;  1WHY A;  2PMZ D;  1RBL A;  3SFU A;  3M2R B;  1UPM B;  4NBQ A;  2C2Z B;  1HQE B;  3QLH B;  2WBR A;  2X1G A;  1LKZ A;  4USJ C;  3W2W B;  5F9N A;  2LXF A;  2XQC A;  4RJV A;  4NRT A;  2J5A A;  1REV B;  4ED3 A;  1VQ9 S;  1FRJ A;  1V5I B;  2B3T B;  1C0U A;  2VB6 A;  4NCG B;  5C25 A;  1N6Q A;  2OPQ A;  4CWB A;  4DCP B;  2W24 A;  2Y0B B;  3AH6 A;  3I0S B;  3R5J B;  2IYG A;  1FEE A;  2AD9 A;  2P9C A;  4C8M A;  2CQ4 A;  4RBV A;  2FVP A;  1PJ5 A;  1WC3 A;  1SL1 A;  4PG7 A;  4O3R A;  4C97 A;  2NXJ A;  4RW8 A;  2RUG A;  1TFY A;  2D3U A;  2W8K A;  1Q5V A;  3DHX A;  3I32 A;  1Q86 T;  3EZU A;  3FZ2 A;  2ZHB A;  4LBH A;  2DNZ A;  3CCW A;  2YTC A;  3FSY A;  4ETZ A;  4C0H A;  2DRB A;  4YUD A;  1LNQ A;  1RT1 A;  4QR2 A;  2E29 A;  2I6W A;  4UUX A;  3LW5 C;  3RGI A;  4U95 A;  2HRU A;  2XY6 A;  3N0V A;  1RT2 B;  1T05 A;  2OPR B;  3CJK A;  5A76 A;  5A8R B;  4UF4 A;  2DNL A;  3W1Y C;  2B9W A;  4DG1 B;  1SKU B;  2HBY B;  4IKA A;  3JQJ A;  3MAA B;  3K5L A;  2FLP A;  1HK7 A;  5KFP A;  2PEH A;  5KFJ A;  1YRT A;  3W2V B;  4TU8 A;  1E6Y A;  4WUD A;  5GME A;  4JV5 F;  1S1W A;  2R8K A;  3PEH A;  5KG6 A;  3OR1 A;  4LBI A;  2OSR A;  3JSM B;  2VQF J;  3D3B J;  4RR5 A;  4X2B A;  1PCA A;  3PYG A;  4P2F A;  2EW9 A;  4LF6 J;  2FB0 A;  2C2K B;  3SFG A;  4X66 F;  1N33 J;  2CUY A;  3KLV A;  3MFI A;  4H4M B;  2RRA A;  2BM1 A;  2ZOM A;  4CH1 A;  1N33 F;  4X4R A;  2VIC A;  5KT3 A;  1Q7Y T;  1YG0 A;  1RTJ A;  1FDA A;  1UWB B;  2G0I A;  2QLW A;  4USH A;  4Y65 A;  3NGT A;  2B5J A;  2RE1 A;  2YWK A;  3PXG a;  4CH0 S;  4K4T A;  4K4X A;  2VG6 A;  1IBK I;  4I7F B;  2HHH F;  4TKT A;  1YJR A;  1CJT B;  2IM1 A;  3EZ5 A;  2KHD A;  1YHC A;  4JI5 I;  2CJ9 A;  4LRA A;  3IBF B;  4Z7C A;  1F5B A;  1YJT A;  2EFO A;  3GLL A;  2H9Z A;  3OPK A;  1S76 D;  1TVR A;  5F41 A;  1RHU B;  1X4C A;  3R9L A;  2R8I A;  2WVD A;  4DDF A;  3D6F B;  5F8L A;  1RAB B;  3SI8 A;  1NZ8 A;  2CPF A;  2H4Y B;  4OI3 A;  1FNM A;  1ZA1 B;  2AW0 A;  3BB5 A;  3WC0 A;  3ILL A;  3N4W A;  4AND A;  4DN0 A;  2GQQ A;  1GTH A;  5KG2 A;  2CJK A;  5DNL A;  3J7A G;  5DM7 Q;  3Q1Q A;  1KOH A;  3O44 A;  4O44 B;  4DPU A;  3GJR B;  4YY3 E;  2E66 A;  1LXJ A;  2FHJ A;  3QSY B;  2BMB A;  4DQQ A;  1XMO I;  3VGT A;  3NAI A;  3MUR P;  4DF8 A;  4O4G B;  4IDK A;  2YX1 A;  4A8S A;  2KRR A;  2UZA A;  4ZCM A;  4LF5 J;  3MTK A;  1JLE A;  2HFN A;  4J5O A;  1NB2 A;  3MM5 A;  5M2U A;  2H48 B;  2ZKT A;  3ETO A;  4P10 A;  2BJ3 A;  3SCI E;  2C3Y A;  4PYA A;  3TUI C;  3H4D A;  2HBR B;  4J9Q A;  1S9E A;  2WW4 A;  2XMA A;  5LMU J;  3LQV A;  2CKW A;  1TK5 A;  4OKG A;  2F3J A;  2CJY B;  4B3M I;  5LSL A;  2BM0 A;  1BGX T;  2DIS A;  4YN3 B;  1HBM A;  1H2U X;  1RT4 A;  3MD3 A;  4KV8 A;  1UL3 A;  2ZUG A;  2NR0 A;  4EMD A;  4C98 A;  4C8O A;  3W2W A;  1DAR A;  2VHG A;  1FJG J;  3R3T A;  3LPE A;  3B4D A;  1ROF A;  3E51 A;  3UD3 P;  1HBO A;  3G6X A;  4FNI A;  4HR2 A;  1JXE A;  2AZ1 A;  1RJJ A;  2PO4 A;  5I3U A;  4LMZ A;  4X4N A;  4DFP A;  4PUO B;  1EX8 A;  4O3Q A;  3V6H A;  3HHL C;  1Z2L A;  2NXC A;  4NXM F;  4HH0 A;  4PQU A;  1CQM A;  2Y8W A;  4DUY F;  1EQM A;  4P74 A;  5KFD A;  3MR2 A;  4DLE A;  4PRF A;  4LF9 E;  1JXL A;  2YNG A;  1U24 A;  2HFO A;  3SEO A;  5C42 B;  5BR8 E;  1UWA A;  2FZK B;  2KFN A;  4O0N A;  4B3R I;  3I4P A;  2HIQ A;  3UW1 A;  1BWV A;  4BA1 B;  3T5K A;  3KLI A;  2BZ2 A;  3D5M A;  3LPY A;  4J9S A;  1SV5 A;  3H42 A;  2RQM A;  4OX8 A;  3P49 B;  1ZOT A;  4MIA A;  1X9S A;  1Z2Z A;  1H2T Z;  3BO3 A;  4EBE A;  1KNZ A;  4Q45 A;  3CCR S;  3E3X A;  1QSS A;  2QEX S;  4Y2K A;  4JI8 J;  2FLN A;  1UA1 A;  1N32 F;  4EI2 A;  2CPE A;  2X7I A;  3ITH A;  3SZ2 A;  3H5S A;  4JYA I;  1FTR A;  2VPW B;  4PXE A;  2V63 A;  3A3P B;  3CCE S;  2DR5 A;  2V4J B;  5JVH Q;  2BBE A;  3OL8 A;  4KHP I;  4TLQ A;  1SH2 A;  1NLK L;  1XBW A;  4MKA A;  1QDU B;  2DGQ A;  2XNQ A;  4OX9 F;  4X84 A;  4PZV A;  2HS3 A;  5FLX Y;  2V8P A;  1N0U A;  2W1B A;  1IBM F;  2E1C A;  4HDH A;  5A2Q U;  3QQC D;  1C0T B;  2QA1 A;  1NK0 A;  2EFP A;  2HHH I;  1JJC B;  3OR2 B;  1NPK A;  2YX4 A;  3PDN A;  3IR7 B;  4G1P A;  3W61 A;  3PV8 A;  3TI0 A;  1N34 J;  4W92 B;  5HVH A;  3TP2 A;  4TN2 A;  2GO4 A;  5THW A;  3RZA A;  2RQC A;  4QIE A;  3OUY B;  1KLM A;  2IA0 A;  4ZLJ A;  4U3B A;  4HEA 9;  3R5B A;  5HJY A;  2LA4 A;  3T1H E;  2B6A B;  2CPZ A;  2XZD B;  4PEO A;  3NY0 A;  1RT6 A;  4Q43 A;  1Q8I A;  2UU9 I;  1GAO A;  2HWH A;  3J81 Q;  1M1K T;  1U49 A;  1N54 B;  2NSB A;  1HNX F;  3TVZ A;  3CJS A;  4R5P B;  1IQZ A;  2UVV A;  2CXE A;  4BA2 B;  2YH0 A;  1T8E A;  1B7Y B;  2GJF A;  2BAB A;  2P8I A;  4ZVP B;  5IFM A;  3LP2 A;  3ZNJ 1;  3FSI A;  4F4Z A;  4WYL A;  4DL5 A;  3N5B A;  2UU9 E;  1QVF R;  3IGV A;  3THT A;  3BKU A;  1HPZ B;  3M8W A;  2VA2 A;  3D6T B;  3GIK A;  4F36 A;  2IVM A;  1E6V B;  4BC7 A;  1X4B A;  5L39 A;  2ZJP Q;  1HQU B;  2DTJ A;  1R0A A;  1VRT A;  4E2F B;  1WNE A;  2UXC