4B3SI

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3sI00
4LF6I 4HY1A 4M1KA 1Z59A 3V5RA 4FW9A 3F0NA 4NXNI 3WU5A 3ZZUA 4LFBE 4DV3I 4GKJE 4JI7I 4DV5E 5IWAI 2J7KA 2LJPA 2VQEI 4HXZA 4LFCI 2HFSA 4URLA 3CWVA 4DV2I 1FWLA 4USKA 1ZM2A 4X64E 1XHKA 1Z0BA 3JAMC 4YHHI 1Z0CA 1QZRA 3T1YE 4DV0E 1HNWE 1H7SA 4X66I 2X7IA 2ZM6I 4DR3E 4JI1I 1N36I 2UXCE 1XMOE 4YHHE 5L3JA 2UXDE 4DPWA 4UTGA 1N0VC 3LPSA 1FI4A 3WU6A 3QT5A 4DR5E 4AQYI 2UUBI 4DV7E 1J5EI 2HHHE 4JV5I 4DV5I 1VISA 4XTJA 1XNRE 1XNQI 1Z5BA 4DR2I 4DR4I 4FN5A 2UU9I 1IBLE 4DPUA 4B3MI 1S16A 2R3VA 4UT4A 1IBKE 4X62E 1MX0A 4LF5E 3H4LA 1I94E 1HNXE 4JI3E 4PU9A 3J80Q 2F4VI 4DV6E 4JI0I 3T1HE 4GKKI 4EMDA 1HNWI 1RR9A 1IBKI 2A2DA 1N36E 4OX9E 4JI1E 5GMDA 2UXDI 4MYTA 4LF7E 4FWHA 5FLXQ 1Z0GA 4DV7I 2V2QA 4DUZE 3ZKBA 3QT7A 1FNMA 2HKJA 1MG7A 1ZM3A 4DV3E 4DV4I 2XEXA 1IBLI 4K0KI 3J7AM 4LFBI 2UUAE 1PKPA 4JI4E 2OI2A 3PYDA 3LTOA 1S4EA 3ZM7A 3Q1QA 1NHHA 1NHJA 4X64I 4DPXA 4DV2E 4P52A 3ZKDA 1ZM4A 4LF8E 4JI8E 1PIEA 1HNZE 3K17A 5FLXC 4X66E 4DR3I 2BM1A 1UEKA 1N32E 1MU5A 4JYAE 2VF3A 2DEJA 4MYUA 4DV1I 4ED4A 4PRXA 4KQVA 3T1YI 4DU8A 4DV0I 4K0KE 1XNQE 4JI6I 2E5LE 4DR4E 2HHHI 4X65I 4DPYA 1PVGA 4Z7CA 2A2CA 2BV3A 4X65E 2F4VE 2UUBE 3J80C 4JI0E 1NHIA 2V2VA 4DU7A 4DR5I 4AQYE 1N33I 4LFAI 3V2UC 5LMUE 1Z5CA 2E1RA 4DR1E 4PRVA 1ZXMA 1EI1A 4OX9I 1NZ0A 1FWKA 3ZZ0A 1H72C 1N32I 4FWGA 3LNUA 4X62I 4RPFA 4JG4A 2BM0A 1ZM9A 3J81Q 4YY3I 3ZZTA 2VQEE 4DV4E 4ZVIA 4DUYI 2HKEA 2EFGA 4DPTA 1A6FA 2CZ9A 4LF4I 1J5EE 4B3TE 4JV5E 1WUUA 3B78A 4KHPE 4HYMA 1KKHA 1B63A 1H74A 3D4JA 5LMUI 4GKJI 1ZXNA 4DR1I 4LFAE 4JI2E 4KHPI 1HNXI 4JI3I 4WUBA 5BR8E 2VQFI 4LFCE 1ELOA 1Z0EA 1H73A 1N34E 2HFUA 1OJ4A 1XNRI 1N0UA 4USMA 4DR2E 1HR0E 2HK2A 3HULA 1N34I 4B3RE 4YY3E 1K47A 1IBME 1D6TA 3QT8A 4JI8I 1DARA 4DR6E 2DEIA 5LL6R 1Z0VA 1KIJA 4JI7E 1FKAE 4DV6I 3T1HI 2E5LI 3QT6A 1KTVA 4HACA 4LF5I 4I3HA 1I94I 1KVKA 1RREA 1Z0TA 5IT9Q 2GS8A 4GKKE 1H7UA 4LF6E 4R1FA 1U2RA 4JI5E 1FJGE 4DR7E 5IWAE 2R42A 2VQFE 2X36A 4DXLA 2HK3A 4LF7I 4DUZI 4JI5I 1FJGI 3M6AA 2UXBI 3OTOI 2UUCE 4WUDA 4HACB 1XMQI 1Z5AA 4B3RI 4P7AA 4DR6I 2ZM6E 2UXBE 2UUCI 4DV1E 2UUAI 4NXME 4JI4I 5A2QC 1XMQE 4LF4E 4LF8I 2ZBKB 4B3TI 4WUCA 2UXCI 1Z0WA 2UU9E 4B3SI 3J81C 2V8PA 1HNZI 2V2ZA 3J7AG 2Q2EB 3PYEA 1B62A 4DR7I 3B82A 3PYFA 1BKNA 4JI2I 1N33E 3GONA 2ZITA 3OTOE 5LMNI 5BR8I 1EA6A 4JYAI 3WU3A 4B3ME 3WU4A 4JI6E 4FWDA 3JAMQ 2WW4A 1HR0I 3PYGA 5LMNE 1IBMI 5A2QQ 2AJ4A 4NXMI 5IT9C 4LF9E 3B8HA 4B3SE 5GMEA 2NPFA 4DUYE 1XMOI 2V34A 4NXNE 3K1JA 4Z7YA 4LF9I
chains in the Genus database with same CATH superfamily
4LF6I 4HY1A 3DD6A 5K36E 4M1KA 2PO1B 1Z59A 3V5RA 4FW9A 3F0NA 4NXNI 1Y60A 4OO1E 4MU1A 3WU5A 5JEAC 3ZZUA 4LFBE 4DV3I 4GKJE 4JI7I 4DV5E 5IWAI 2WP8A 4LOMA 2J7KA 2LJPA 2VQEI 4OO1C 4HXZA 4LFCI 2HFSA 4URLA 4FW7A 3CDIA 3CWVA 5DRQA 4DV2I 1FWLA 4FW5A 4USKA 1ZM2A 4X64E 1XHKA 1Z0BA 2GO3A 3JAMC 2BA0G 4YHHI 1Z0CA 1QZRA 3T1YE 4DV0E 3K85A 1HNWE 1H7SA 2JEBB 2X7IA 4X66I 2ZM6I 4QNKA 4JI1I 4DR3E 3PS3A 1N36I 4IS9A 2UXCE 2Z5CA 5DRPA 1XMOE 4YHHE 2BA1D 5L3JA 2UXDE 4DPWA 4UTGA 4LCFA 2PNZA 1N0VC 3LPSA 1FI4A 3WU6A 3QT5A 4DR5E 4AQYI 2BR2B 2JT2A 4DV7E 2UUBI 2PNMA 4OZEA 2CG9A 1J5EI 4N3OA 2HHHE 4JV5I 4DV5I 1VISA 5C0XD 4XTJA 2Z5BA 1XNRE 1XNQI 4GQUA 1Z5BA 4DR2I 4DR4I 4FN5A 2UU9I 1YH8A 1IBLE 3GCMA 2JEBA 4DPUA 4B3MI 3M7ND 1S16A 2R3VA 5DNLA 4UT4A 1IBKE 4X62E 1MX0A 3H4LA 4LF5E 1I94E 3H1CA 5DROA 1HNXE 4PU9A 4JI3E 3J80Q 3HKMA 3M85D 3M7NG 2F4VI 4DV6E 4JI0I 3T1HE 4LCGA 4GKKI 4EMDA 3P3EA 4AIDA 1HNWI 1RR9A 1IBKI 2A2DA 1N36E 4OX9E 4JI1E 5K36D 5GMDA 2UXDI 4MYTA 2WP8B 1OYPA 4U3BA 2GO4A 4IZJB 2VESA 4LF7E 2JEAB 4IZJA 5C0XF 4FWHA 5FLXQ 1Z0GA 1E3PA 4DV7I 2V2QA 4DUZE 3ZKBA 2IOPA 2NN6B 3QT7A 2Z5EA 1FNMA 2HKJA 4BA1B 1MG7A 1ZM3A 4DV3E 4DV4I 1HK7A 2XEXA 2O1WA 1IBLI 4K0KI 3J7AM 4LFBI 1UDOA 2UUAE 1PKPA 3PS2A 4JI4E 2NN6E 2J65A 3U1KA 4FW3A 2OI2A 3PYDA 3LTOA 2C39A 1S4EA 4BA2B 5K36A 3ZM7A 3Q1QA 1NHHA 2C38A 1NHJA 2NN6C 4X64I 4DPXA 4DV2E 4P52A 3ZKDA 5JEAE 4MU3A 1ZM4A 4LF8E 2O1TA 4JI8E 1PIEA 5JEAA 2CGEA 2PNZB 4IFDB 2PO0B 1HNZE 5EKWA 3K17A 5K36F 5FLXC 4X66E 4DR3I 2BM1A 5C0XE 1UEKA 2GQ0A 1N32E 2Z5CB 3M85G 1MU5A 4JYAE 2VF3A 4MDTA 3PS1A 2DEJA 4MYUA 4DV1I 3U1YA 4ED4A 4PRXA 4KQVA 2JE6A 3L7ZA 3T1YI 4DU8A 4DV0I 4K0KE 2C37B 1XNQE 4JI6I 2E5LE 3GLLA 4DR4E 2HHHI 4X65I 4DPYA 1PVGA 1UDQA 4Z7CA 1USVA 2A2CA 2PO0A 4IFDA 3P3GA 1YHCA 2BV3A 4X65E 4QNJA 2F4VE 1USUA 3J80C 4DR5I 1NHIA 2V2VA 4DU7A 4AQYE 2UUBE 4JI0E 1N33I 4LFAI 3V2UC 5LMUE 1Z5CA 2E1RA 4DR1E 4PRVA 2BA1G 4OO1D 1ZXMA 2BA0D 1EI1A 1R6MA 4BA2A 4OX9I 2IESA 1NZ0A 1FWKA 3ZZ0A 5EL9A 1H72C 1N32I 4FWGA 2PO2A 3CDJA 3LNUA 4X62I 4RPFA 4JG4A 2O1UA 1VI7A 2BM0A 4IZKA 2NN6A 1ZM9A 3NZKA 4IFDE 4AIMA 3J81Q 2O1VA 4IFDF 4YY3I 5K36C 1XXEA 2O3ZA 3ZZTA 2VQEE 4DV4E 4ZVIA 4DUYI 2HKEA 2EFGA 2WNRB 4DPTA 1A6FA 2CZ9A 1R6LA 4LF4I 5JEAD 1J5EE 4B3TE 2JEAA 2F1DA 4JV5E 1WUUA 3B78A 4KHPE 5DNXA 4HYMA 1KKHA 1B63A 1H74A 3D4JA 3PRYA 5ELWA 5LMUI 4GKJI 1ZXNA 4DR1I 4LFAE 4JI2E 4KHPI 4OO1F 1HNXI 4JI3I 2C37A 4WUBA 3P76A 4NBQA 5BR8E 2VQFI 4LFCE 1ELOA 1Z0EA 1H73A 1N34E 2HFUA 1OJ4A 1XNRI 1N0UA 4USMA 5C0XB 4DR2E 1HR0E 2HK2A 2Z5BB 3HULA 1UDNA 5DRRA 3Q6NA 1N34I 4B3RE 4YY3E 1K47A 2BR2A 1IBME 1D6TA 3QT8A 4JI8I 1DARA 4DR6E 4MU0A 2DEIA 4J3DA 5LL6R 5JEAB 4LPFA 1Z0VA 1KIJA 4AM3A 4FW6A 4JI7E 1FKAE 4DV6I 3T1HI 2E5LI 3QT6A 1KTVA 4HACA 4LF5I 4LCHA 4I3HA 1I94I 1KVKA 5K36B 1RREA 1Z0TA 4MQYA 5IT9Q 2GS8A 4GKKE 1Y5YA 1H7UA 4LF6E 4IZKB 5FWKA 4R1FA 1U2RA 4JI5E 1FJGE 4DR7E 5IWAE 2R42A 2VQFE 1RHYA 2X36A 2PO2B 3GMEA 4DXLA 3P3CA 4IZJD 1OYRA 2HK3A 1Y4UA 4BA1A 4LF7I 4DUZI 4JI5I 1FJGI 2IERA 1Y4SA 3B4TA 4FW4A 3M6AA 2UXBI 3OTOI 3KRNA 2NN6D 2UUCE 4WUDA 4HACB 1XMQI 1Z5AA 4B3RI 4P7AA 4DR6I 2ZM6E 1E3HA 2NN6F 2PO1A 2UXBE 2UUCI 2CVEA 2PNLA 4DV1E 2UUAI 4NXME 4JI4I 5A2QC 3UHMA 1XMQE 1UDSA 4OO1A 4LF4E 4LF8I 2ZBKB 4B3TI 4WUCA 2UXCI 1Z0WA 2UU9E 5JEAF 4B3SI 3J81C 5C0XA 4U3DA 2V8PA 1HNZI 2V2ZA 3J7AG 1OYSA 2JE6B 3L7ZB 3Q6MA 2Q2EB 3PYEA 4IFDD 1B62A 4DR7I 3P06A 2IOQA 3B82A 3PYFA 1BKNA 4ISAA 4JI2I 1N33E 3GONA 2ZITA 3OTOE 1Y6ZA 5LMNI 5BR8I 1EA6A 4JYAI 3WU3A 4B3ME 3WU4A 4JI6E 4IFDC 1P42A 4FWDA 3JAMQ 2WW4A 3HJCA 1HR0I 2C38B 2WNRA 3PYGA 5LMNE 1IBMI 5A2QQ 2AE8A 2AJ4A 2C39B 4NXMI 5IT9C 4LF9E 4MU4A 3B8HA 4B3SE 5GMEA 2NPFA 4DUYE 4OKGA 1XMOI 2V34A 5C0XC 4NXNE 3K1JA 4Z7YA 4OO1B 4LF9I
chains in the Genus database with same CATH topology
4LF6I 4HY1A 4M1KA 1Z59A 3V5RA 4FW9A 3F0NA 4NXNI 3WU5A 3ZZUA 4LFBE 4DV3I 4GKJE 4JI7I 4DV5E 5IWAI 2J7KA 2LJPA 2VQEI 4HXZA 4LFCI 2HFSA 4URLA 3CWVA 4DV2I 1FWLA 4USKA 1ZM2A 4X64E 1XHKA 1Z0BA 3JAMC 4YHHI 1Z0CA 1QZRA 3T1YE 4DV0E 3K85A 1HNWE 1H7SA 4X66I 2X7IA 2ZM6I 4DR3E 4JI1I 1N36I 2UXCE 2Z5CA 1XMOE 4YHHE 5L3JA 2UXDE 4DPWA 4UTGA 1N0VC 3LPSA 1FI4A 3WU6A 2UUBI 3QT5A 4DR5E 4AQYI 4DV7E 2PNMA 2CG9A 1J5EI 4N3OA 2HHHE 4JV5I 4DV5I 1VISA 4XTJA 2Z5BA 1XNRE 1XNQI 1Z5BA 4DR2I 4DR4I 4FN5A 2UU9I 1IBLE 4DPUA 4B3MI 1S16A 2R3VA 4UT4A 1IBKE 4X62E 1MX0A 3H4LA 4LF5E 1I94E 1HNXE 4JI3E 4PU9A 3J80Q 2F4VI 4DV6E 4JI0I 3T1HE 4GKKI 4EMDA 1HNWI 1RR9A 1IBKI 2A2DA 1N36E 4OX9E 4JI1E 5GMDA 2UXDI 4MYTA 4IZJB 4LF7E 4IZJA 4FWHA 5FLXQ 1Z0GA 4DV7I 2V2QA 4DUZE 3ZKBA 2IOPA 3QT7A 2Z5EA 1FNMA 2HKJA 1MG7A 1ZM3A 4DV3E 4DV4I 1HK7A 2XEXA 2O1WA 1IBLI 4K0KI 3J7AM 4LFBI 2UUAE 1PKPA 4JI4E 2OI2A 3PYDA 3LTOA 1S4EA 3ZM7A 3Q1QA 1NHHA 1NHJA 4X64I 4DPXA 4DV2E 4P52A 3ZKDA 1ZM4A 4LF8E 2O1TA 4JI8E 1PIEA 2CGEA 1HNZE 3K17A 5FLXC 4X66E 4DR3I 2BM1A 1UEKA 2GQ0A 1N32E 2Z5CB 1MU5A 4JYAE 2VF3A 2DEJA 4MYUA 4DV1I 4ED4A 4PRXA 4KQVA 3T1YI 4DU8A 4DV0I 4K0KE 1XNQE 4JI6I 2E5LE 4DR4E 2HHHI 4X65I 4DPYA 1PVGA 4Z7CA 1USVA 2A2CA 2BV3A 4X65E 2F4VE 1USUA 2UUBE 3J80C 1NHIA 2V2VA 4DU7A 4DR5I 4AQYE 4JI0E 1N33I 4LFAI 3V2UC 5LMUE 1Z5CA 2E1RA 4DR1E 4PRVA 1ZXMA 1EI1A 4OX9I 1NZ0A 1FWKA 3ZZ0A 1H72C 1N32I 4FWGA 3LNUA 4X62I 4RPFA 4JG4A 2O1UA 2BM0A 4IZKA 1ZM9A 3J81Q 2O1VA 4YY3I 3ZZTA 2VQEE 4DV4E 4ZVIA 4DUYI 2HKEA 2EFGA 4DPTA 1A6FA 2CZ9A 4LF4I 1J5EE 4B3TE 4JV5E 1WUUA 3B78A 4KHPE 4HYMA 1KKHA 1B63A 1H74A 3D4JA 3PRYA 5LMUI 4GKJI 1ZXNA 4DR1I 4LFAE 4JI2E 4KHPI 1HNXI 4JI3I 4WUBA 5BR8E 2VQFI 4LFCE 1ELOA 1Z0EA 1H73A 1N34E 2HFUA 1OJ4A 1XNRI 1N0UA 4USMA 4DR2E 1HR0E 2HK2A 2Z5BB 3HULA 3Q6NA 1N34I 4B3RE 4YY3E 1K47A 1IBME 1D6TA 3QT8A 4JI8I 1DARA 4DR6E 2DEIA 5LL6R 1Z0VA 1KIJA 4JI7E 1FKAE 4DV6I 3T1HI 2E5LI 3QT6A 1KTVA 4HACA 4LF5I 4I3HA 1I94I 1KVKA 1RREA 1Z0TA 5IT9Q 2GS8A 4GKKE 1H7UA 4LF6E 4IZKB 5FWKA 4R1FA 1U2RA 4JI5E 1FJGE 4DR7E 5IWAE 2R42A 2VQFE 2X36A 4DXLA 4IZJD 2HK3A 1Y4UA 4LF7I 4DUZI 4JI5I 1FJGI 1Y4SA 3M6AA 2UXBI 3OTOI 2UUCE 4WUDA 4HACB 1XMQI 1Z5AA 4B3RI 4P7AA 4DR6I 2ZM6E 2UXBE 2UUCI 2PNLA 4DV1E 2UUAI 4NXME 4JI4I 5A2QC 1XMQE 4LF4E 4LF8I 2ZBKB 4B3TI 4WUCA 2UXCI 1Z0WA 2UU9E 4B3SI 3J81C 2V8PA 1HNZI 2V2ZA 3J7AG 3Q6MA 2Q2EB 3PYEA 1B62A 4DR7I 3P06A 2IOQA 3B82A 3PYFA 1BKNA 4JI2I 1N33E 3GONA 2ZITA 3OTOE 1Y6ZA 5LMNI 5BR8I 1EA6A 4JYAI 3WU3A 4B3ME 3WU4A 4JI6E 4FWDA 3JAMQ 2WW4A 3HJCA 1HR0I 3PYGA 5LMNE 1IBMI 5A2QQ 2AJ4A 4NXMI 5IT9C 4LF9E 3B8HA 4B3SE 5GMEA 2NPFA 4DUYE 1XMOI 2V34A 4NXNE 3K1JA 4Z7YA 4LF9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 I;  4HY1 A;  4M1K A;  1Z59 A;  3V5R A;  4FW9 A;  3F0N A;  4NXN I;  3WU5 A;  3ZZU A;  4LFB E;  4DV3 I;  4GKJ E;  4JI7 I;  4DV5 E;  5IWA I;  2J7K A;  2LJP A;  2VQE I;  4HXZ A;  4LFC I;  2HFS A;  4URL A;  3CWV A;  4DV2 I;  1FWL A;  4USK A;  1ZM2 A;  4X64 E;  1XHK A;  1Z0B A;  3JAM C;  4YHH I;  1Z0C A;  1QZR A;  3T1Y E;  4DV0 E;  1HNW E;  1H7S A;  4X66 I;  2X7I A;  2ZM6 I;  4DR3 E;  4JI1 I;  1N36 I;  2UXC E;  1XMO E;  4YHH E;  5L3J A;  2UXD E;  4DPW A;  4UTG A;  1N0V C;  3LPS A;  1FI4 A;  3WU6 A;  3QT5 A;  4DR5 E;  4AQY I;  2UUB I;  4DV7 E;  1J5E I;  2HHH E;  4JV5 I;  4DV5 I;  1VIS A;  4XTJ A;  1XNR E;  1XNQ I;  1Z5B A;  4DR2 I;  4DR4 I;  4FN5 A;  2UU9 I;  1IBL E;  4DPU A;  4B3M I;  1S16 A;  2R3V A;  4UT4 A;  1IBK E;  4X62 E;  1MX0 A;  4LF5 E;  3H4L A;  1I94 E;  1HNX E;  4JI3 E;  4PU9 A;  3J80 Q;  2F4V I;  4DV6 E;  4JI0 I;  3T1H E;  4GKK I;  4EMD A;  1HNW I;  1RR9 A;  1IBK I;  2A2D A;  1N36 E;  4OX9 E;  4JI1 E;  5GMD A;  2UXD I;  4MYT A;  4LF7 E;  4FWH A;  5FLX Q;  1Z0G A;  4DV7 I;  2V2Q A;  4DUZ E;  3ZKB A;  3QT7 A;  1FNM A;  2HKJ A;  1MG7 A;  1ZM3 A;  4DV3 E;  4DV4 I;  2XEX A;  1IBL I;  4K0K I;  3J7A M;  4LFB I;  2UUA E;  1PKP A;  4JI4 E;  2OI2 A;  3PYD A;  3LTO A;  1S4E A;  3ZM7 A;  3Q1Q A;  1NHH A;  1NHJ A;  4X64 I;  4DPX A;  4DV2 E;  4P52 A;  3ZKD A;  1ZM4 A;  4LF8 E;  4JI8 E;  1PIE A;  1HNZ E;  3K17 A;  5FLX C;  4X66 E;  4DR3 I;  2BM1 A;  1UEK A;  1N32 E;  1MU5 A;  4JYA E;  2VF3 A;  2DEJ A;  4MYU A;  4DV1 I;  4ED4 A;  4PRX A;  4KQV A;  3T1Y I;  4DU8 A;  4DV0 I;  4K0K E;  1XNQ E;  4JI6 I;  2E5L E;  4DR4 E;  2HHH I;  4X65 I;  4DPY A;  1PVG A;  4Z7C A;  2A2C A;  2BV3 A;  4X65 E;  2F4V E;  2UUB E;  3J80 C;  4JI0 E;  1NHI A;  2V2V A;  4DU7 A;  4DR5 I;  4AQY E;  1N33 I;  4LFA I;  3V2U C;  5LMU E;  1Z5C A;  2E1R A;  4DR1 E;  4PRV A;  1ZXM A;  1EI1 A;  4OX9 I;  1NZ0 A;  1FWK A;  3ZZ0 A;  1H72 C;  1N32 I;  4FWG A;  3LNU A;  4X62 I;  4RPF A;  4JG4 A;  2BM0 A;  1ZM9 A;  3J81 Q;  4YY3 I;  3ZZT A;  2VQE E;  4DV4 E;  4ZVI A;  4DUY I;  2HKE A;  2EFG A;  4DPT A;  1A6F A;  2CZ9 A;  4LF4 I;  1J5E E;  4B3T E;  4JV5 E;  1WUU A;  3B78 A;  4KHP E;  4HYM A;  1KKH A;  1B63 A;  1H74 A;  3D4J A;  5LMU I;  4GKJ I;  1ZXN A;  4DR1 I;  4LFA E;  4JI2 E;  4KHP I;  1HNX I;  4JI3 I;  4WUB A;  5BR8 E;  2VQF I;  4LFC E;  1ELO A;  1Z0E A;  1H73 A;  1N34 E;  2HFU A;  1OJ4 A;  1XNR I;  1N0U A;  4USM A;  4DR2 E;  1HR0 E;  2HK2 A;  3HUL A;  1N34 I;  4B3R E;  4YY3 E;  1K47 A;  1IBM E;  1D6T A;  3QT8 A;  4JI8 I;  1DAR A;  4DR6 E;  2DEI A;  5LL6 R;  1Z0V A;  1KIJ A;  4JI7 E;  1FKA E;  4DV6 I;  3T1H I;  2E5L I;  3QT6 A;  1KTV A;  4HAC A;  4LF5 I;  4I3H A;  1I94 I;  1KVK A;  1RRE A;  1Z0T A;  5IT9 Q;  2GS8 A;  4GKK E;  1H7U A;  4LF6 E;  4R1F A;  1U2R A;  4JI5 E;  1FJG E;  4DR7 E;  5IWA E;  2R42 A;  2VQF E;  2X36 A;  4DXL A;  2HK3 A;  4LF7 I;  4DUZ I;  4JI5 I;  1FJG I;  3M6A A;  2UXB I;  3OTO I;  2UUC E;  4WUD A;  4HAC B;  1XMQ I;  1Z5A A;  4B3R I;  4P7A A;  4DR6 I;  2ZM6 E;  2UXB E;  2UUC I;  4DV1 E;  2UUA I;  4NXM E;  4JI4 I;  5A2Q C;  1XMQ E;  4LF4 E;  4LF8 I;  2ZBK B;  4B3T I;  4WUC A;  2UXC I;  1Z0W A;  2UU9 E;  4B3S I;  3J81 C;  2V8P A;  1HNZ I;  2V2Z A;  3J7A G;  2Q2E B;  3PYE A;  1B62 A;  4DR7 I;  3B82 A;  3PYF A;  1BKN A;  4JI2 I;  1N33 E;  3GON A;  2ZIT A;  3OTO E;  5LMN I;  5BR8 I;  1EA6 A;  4JYA I;  3WU3 A;  4B3M E;  3WU4 A;  4JI6 E;  4FWD A;  3JAM Q;  2WW4 A;  1HR0 I;  3PYG A;  5LMN E;  1IBM I;  5A2Q Q;  2AJ4 A;  4NXM I;  5IT9 C;  4LF9 E;  3B8H A;  4B3S E;  5GME A;  2NPF A;  4DUY E;  1XMO I;  2V34 A;  4NXN E;  3K1J A;  4Z7Y A;  4LF9 I; 
#chains in the Genus database with same CATH topology
 4LF6 I;  4HY1 A;  3DD6 A;  5K36 E;  4M1K A;  2PO1 B;  1Z59 A;  3V5R A;  4FW9 A;  3F0N A;  4NXN I;  1Y60 A;  4OO1 E;  4MU1 A;  3WU5 A;  5JEA C;  3ZZU A;  4LFB E;  4DV3 I;  4GKJ E;  4JI7 I;  4DV5 E;  5IWA I;  2WP8 A;  4LOM A;  2J7K A;  2LJP A;  2VQE I;  4OO1 C;  4HXZ A;  4LFC I;  2HFS A;  4URL A;  4FW7 A;  3CDI A;  3CWV A;  5DRQ A;  4DV2 I;  1FWL A;  4FW5 A;  4USK A;  1ZM2 A;  4X64 E;  1XHK A;  1Z0B A;  2GO3 A;  3JAM C;  2BA0 G;  4YHH I;  1Z0C A;  1QZR A;  3T1Y E;  4DV0 E;  3K85 A;  1HNW E;  1H7S A;  2JEB B;  2X7I A;  4X66 I;  2ZM6 I;  4QNK A;  4JI1 I;  4DR3 E;  3PS3 A;  1N36 I;  4IS9 A;  2UXC E;  2Z5C A;  5DRP A;  1XMO E;  4YHH E;  2BA1 D;  5L3J A;  2UXD E;  4DPW A;  4UTG A;  4LCF A;  2PNZ A;  1N0V C;  3LPS A;  1FI4 A;  3WU6 A;  3QT5 A;  4DR5 E;  4AQY I;  2BR2 B;  2JT2 A;  4DV7 E;  2UUB I;  2PNM A;  4OZE A;  2CG9 A;  1J5E I;  4N3O A;  2HHH E;  4JV5 I;  4DV5 I;  1VIS A;  5C0X D;  4XTJ A;  2Z5B A;  1XNR E;  1XNQ I;  4GQU A;  1Z5B A;  4DR2 I;  4DR4 I;  4FN5 A;  2UU9 I;  1YH8 A;  1IBL E;  3GCM A;  2JEB A;  4DPU A;  4B3M I;  3M7N D;  1S16 A;  2R3V A;  5DNL A;  4UT4 A;  1IBK E;  4X62 E;  1MX0 A;  3H4L A;  4LF5 E;  1I94 E;  3H1C A;  5DRO A;  1HNX E;  4PU9 A;  4JI3 E;  3J80 Q;  3HKM A;  3M85 D;  3M7N G;  2F4V I;  4DV6 E;  4JI0 I;  3T1H E;  4LCG A;  4GKK I;  4EMD A;  3P3E A;  4AID A;  1HNW I;  1RR9 A;  1IBK I;  2A2D A;  1N36 E;  4OX9 E;  4JI1 E;  5K36 D;  5GMD A;  2UXD I;  4MYT A;  2WP8 B;  1OYP A;  4U3B A;  2GO4 A;  4IZJ B;  2VES A;  4LF7 E;  2JEA B;  4IZJ A;  5C0X F;  4FWH A;  5FLX Q;  1Z0G A;  1E3P A;  4DV7 I;  2V2Q A;  4DUZ E;  3ZKB A;  2IOP A;  2NN6 B;  3QT7 A;  2Z5E A;  1FNM A;  2HKJ A;  4BA1 B;  1MG7 A;  1ZM3 A;  4DV3 E;  4DV4 I;  1HK7 A;  2XEX A;  2O1W A;  1IBL I;  4K0K I;  3J7A M;  4LFB I;  1UDO A;  2UUA E;  1PKP A;  3PS2 A;  4JI4 E;  2NN6 E;  2J65 A;  3U1K A;  4FW3 A;  2OI2 A;  3PYD A;  3LTO A;  2C39 A;  1S4E A;  4BA2 B;  5K36 A;  3ZM7 A;  3Q1Q A;  1NHH A;  2C38 A;  1NHJ A;  2NN6 C;  4X64 I;  4DPX A;  4DV2 E;  4P52 A;  3ZKD A;  5JEA E;  4MU3 A;  1ZM4 A;  4LF8 E;  2O1T A;  4JI8 E;  1PIE A;  5JEA A;  2CGE A;  2PNZ B;  4IFD B;  2PO0 B;  1HNZ E;  5EKW A;  3K17 A;  5K36 F;  5FLX C;  4X66 E;  4DR3 I;  2BM1 A;  5C0X E;  1UEK A;  2GQ0 A;  1N32 E;  2Z5C B;  3M85 G;  1MU5 A;  4JYA E;  2VF3 A;  4MDT A;  3PS1 A;  2DEJ A;  4MYU A;  4DV1 I;  3U1Y A;  4ED4 A;  4PRX A;  4KQV A;  2JE6 A;  3L7Z A;  3T1Y I;  4DU8 A;  4DV0 I;  4K0K E;  2C37 B;  1XNQ E;  4JI6 I;  2E5L E;  3GLL A;  4DR4 E;  2HHH I;  4X65 I;  4DPY A;  1PVG A;  1UDQ A;  4Z7C A;  1USV A;  2A2C A;  2PO0 A;  4IFD A;  3P3G A;  1YHC A;  2BV3 A;  4X65 E;  4QNJ A;  2F4V E;  1USU A;  3J80 C;  4DR5 I;  1NHI A;  2V2V A;  4DU7 A;  4AQY E;  2UUB E;  4JI0 E;  1N33 I;  4LFA I;  3V2U C;  5LMU E;  1Z5C A;  2E1R A;  4DR1 E;  4PRV A;  2BA1 G;  4OO1 D;  1ZXM A;  2BA0 D;  1EI1 A;  1R6M A;  4BA2 A;  4OX9 I;  2IES A;  1NZ0 A;  1FWK A;  3ZZ0 A;  5EL9 A;  1H72 C;  1N32 I;  4FWG A;  2PO2 A;  3CDJ A;  3LNU A;  4X62 I;  4RPF A;  4JG4 A;  2O1U A;  1VI7 A;  2BM0 A;  4IZK A;  2NN6 A;  1ZM9 A;  3NZK A;  4IFD E;  4AIM A;  3J81 Q;  2O1V A;  4IFD F;  4YY3 I;  5K36 C;  1XXE A;  2O3Z A;  3ZZT A;  2VQE E;  4DV4 E;  4ZVI A;  4DUY I;  2HKE A;  2EFG A;  2WNR B;  4DPT A;  1A6F A;  2CZ9 A;  1R6L A;  4LF4 I;  5JEA D;  1J5E E;  4B3T E;  2JEA A;  2F1D A;  4JV5 E;  1WUU A;  3B78 A;  4KHP E;  5DNX A;  4HYM A;  1KKH A;  1B63 A;  1H74 A;  3D4J A;  3PRY A;  5ELW A;  5LMU I;  4GKJ I;  1ZXN A;  4DR1 I;  4LFA E;  4JI2 E;  4KHP I;  4OO1 F;  1HNX I;  4JI3 I;  2C37 A;  4WUB A;  3P76 A;  4NBQ A;  5BR8 E;  2VQF I;  4LFC E;  1ELO A;  1Z0E A;  1H73 A;  1N34 E;  2HFU A;  1OJ4 A;  1XNR I;  1N0U A;  4USM A;  5C0X B;  4DR2 E;  1HR0 E;  2HK2 A;  2Z5B B;  3HUL A;  1UDN A;  5DRR A;  3Q6N A;  1N34 I;  4B3R E;  4YY3 E;  1K47 A;  2BR2 A;  1IBM E;  1D6T A;  3QT8 A;  4JI8 I;  1DAR A;  4DR6 E;  4MU0 A;  2DEI A;  4J3D A;  5LL6 R;  5JEA B;  4LPF A;  1Z0V A;  1KIJ A;  4AM3 A;  4FW6 A;  4JI7 E;  1FKA E;  4DV6 I;  3T1H I;  2E5L I;  3QT6 A;  1KTV A;  4HAC A;  4LF5 I;  4LCH A;  4I3H A;  1I94 I;  1KVK A;  5K36 B;  1RRE A;  1Z0T A;  4MQY A;  5IT9 Q;  2GS8 A;  4GKK E;  1Y5Y A;  1H7U A;  4LF6 E;  4IZK B;  5FWK A;  4R1F A;  1U2R A;  4JI5 E;  1FJG E;  4DR7 E;  5IWA E;  2R42 A;  2VQF E;  1RHY A;  2X36 A;  2PO2 B;  3GME A;  4DXL A;  3P3C A;  4IZJ D;  1OYR A;  2HK3 A;  1Y4U A;  4BA1 A;  4LF7 I;  4DUZ I;  4JI5 I;  1FJG I;  2IER A;  1Y4S A;  3B4T A;  4FW4 A;  3M6A A;  2UXB I;  3OTO I;  3KRN A;  2NN6 D;  2UUC E;  4WUD A;  4HAC B;  1XMQ I;  1Z5A A;  4B3R I;  4P7A A;  4DR6 I;  2ZM6 E;  1E3H A;  2NN6 F;  2PO1 A;  2UXB E;  2UUC I;  2CVE A;  2PNL A;  4DV1 E;  2UUA I;  4NXM E;  4JI4 I;  5A2Q C;  3UHM A;  1XMQ E;  1UDS A;  4OO1 A;  4LF4 E;  4LF8 I;  2ZBK B;  4B3T I;  4WUC A;  2UXC I;  1Z0W A;  2UU9 E;  5JEA F;  4B3S I;  3J81 C;  5C0X A;  4U3D A;  2V8P A;  1HNZ I;  2V2Z A;  3J7A G;  1OYS A;  2JE6 B;  3L7Z B;  3Q6M A;  2Q2E B;  3PYE A;  4IFD D;  1B62 A;  4DR7 I;  3P06 A;  2IOQ A;  3B82 A;  3PYF A;  1BKN A;  4ISA A;  4JI2 I;  1N33 E;  3GON A;  2ZIT A;  3OTO E;  1Y6Z A;  5LMN I;  5BR8 I;  1EA6 A;  4JYA I;  3WU3 A;  4B3M E;  3WU4 A;  4JI6 E;  4IFD C;  1P42 A;  4FWD A;  3JAM Q;  2WW4 A;  3HJC A;  1HR0 I;  2C38 B;  2WNR A;  3PYG A;  5LMN E;  1IBM I;  5A2Q Q;  2AE8 A;  2AJ4 A;  2C39 B;  4NXM I;  5IT9 C;  4LF9 E;  4MU4 A;  3B8H A;  4B3S E;  5GME A;  2NPF A;  4DUY E;  4OKG A;  1XMO I;  2V34 A;  5C0X C;  4NXN E;  3K1J A;  4Z7Y A;  4OO1 B;  4LF9 I; 
#chains in the Genus database with same CATH homology
 4LF6 I;  4HY1 A;  4M1K A;  1Z59 A;  3V5R A;  4FW9 A;  3F0N A;  4NXN I;  3WU5 A;  3ZZU A;  4LFB E;  4DV3 I;  4GKJ E;  4JI7 I;  4DV5 E;  5IWA I;  2J7K A;  2LJP A;  2VQE I;  4HXZ A;  4LFC I;  2HFS A;  4URL A;  3CWV A;  4DV2 I;  1FWL A;  4USK A;  1ZM2 A;  4X64 E;  1XHK A;  1Z0B A;  3JAM C;  4YHH I;  1Z0C A;  1QZR A;  3T1Y E;  4DV0 E;  3K85 A;  1HNW E;  1H7S A;  4X66 I;  2X7I A;  2ZM6 I;  4DR3 E;  4JI1 I;  1N36 I;  2UXC E;  2Z5C A;  1XMO E;  4YHH E;  5L3J A;  2UXD E;  4DPW A;  4UTG A;  1N0V C;  3LPS A;  1FI4 A;  3WU6 A;  2UUB I;  3QT5 A;  4DR5 E;  4AQY I;  4DV7 E;  2PNM A;  2CG9 A;  1J5E I;  4N3O A;  2HHH E;  4JV5 I;  4DV5 I;  1VIS A;  4XTJ A;  2Z5B A;  1XNR E;  1XNQ I;  1Z5B A;  4DR2 I;  4DR4 I;  4FN5 A;  2UU9 I;  1IBL E;  4DPU A;  4B3M I;  1S16 A;  2R3V A;  4UT4 A;  1IBK E;  4X62 E;  1MX0 A;  3H4L A;  4LF5 E;  1I94 E;  1HNX E;  4JI3 E;  4PU9 A;  3J80 Q;  2F4V I;  4DV6 E;  4JI0 I;  3T1H E;  4GKK I;  4EMD A;  1HNW I;  1RR9 A;  1IBK I;  2A2D A;  1N36 E;  4OX9 E;  4JI1 E;  5GMD A;  2UXD I;  4MYT A;  4IZJ B;  4LF7 E;  4IZJ A;  4FWH A;  5FLX Q;  1Z0G A;  4DV7 I;  2V2Q A;  4DUZ E;  3ZKB A;  2IOP A;  3QT7 A;  2Z5E A;  1FNM A;  2HKJ A;  1MG7 A;  1ZM3 A;  4DV3 E;  4DV4 I;  1HK7 A;  2XEX A;  2O1W A;  1IBL I;  4K0K I;  3J7A M;  4LFB I;  2UUA E;  1PKP A;  4JI4 E;  2OI2 A;  3PYD A;  3LTO A;  1S4E A;  3ZM7 A;  3Q1Q A;  1NHH A;  1NHJ A;  4X64 I;  4DPX A;  4DV2 E;  4P52 A;  3ZKD A;  1ZM4 A;  4LF8 E;  2O1T A;  4JI8 E;  1PIE A;  2CGE A;  1HNZ E;  3K17 A;  5FLX C;  4X66 E;  4DR3 I;  2BM1 A;  1UEK A;  2GQ0 A;  1N32 E;  2Z5C B;  1MU5 A;  4JYA E;  2VF3 A;  2DEJ A;  4MYU A;  4DV1 I;  4ED4 A;  4PRX A;  4KQV A;  3T1Y I;  4DU8 A;  4DV0 I;  4K0K E;  1XNQ E;  4JI6 I;  2E5L E;  4DR4 E;  2HHH I;  4X65 I;  4DPY A;  1PVG A;  4Z7C A;  1USV A;  2A2C A;  2BV3 A;  4X65 E;  2F4V E;  1USU A;  2UUB E;  3J80 C;  1NHI A;  2V2V A;  4DU7 A;  4DR5 I;  4AQY E;  4JI0 E;  1N33 I;  4LFA I;  3V2U C;  5LMU E;  1Z5C A;  2E1R A;  4DR1 E;  4PRV A;  1ZXM A;  1EI1 A;  4OX9 I;  1NZ0 A;  1FWK A;  3ZZ0 A;  1H72 C;  1N32 I;  4FWG A;  3LNU A;  4X62 I;  4RPF A;  4JG4 A;  2O1U A;  2BM0 A;  4IZK A;  1ZM9 A;  3J81 Q;  2O1V A;  4YY3 I;  3ZZT A;  2VQE E;  4DV4 E;  4ZVI A;  4DUY I;  2HKE A;  2EFG A;  4DPT A;  1A6F A;  2CZ9 A;  4LF4 I;  1J5E E;  4B3T E;  4JV5 E;  1WUU A;  3B78 A;  4KHP E;  4HYM A;  1KKH A;  1B63 A;  1H74 A;  3D4J A;  3PRY A;  5LMU I;  4GKJ I;  1ZXN A;  4DR1 I;  4LFA E;  4JI2 E;  4KHP I;  1HNX I;  4JI3 I;  4WUB A;  5BR8 E;  2VQF I;  4LFC E;  1ELO A;  1Z0E A;  1H73 A;  1N34 E;  2HFU A;  1OJ4 A;  1XNR I;  1N0U A;  4USM A;  4DR2 E;  1HR0 E;  2HK2 A;  2Z5B B;  3HUL A;  3Q6N A;  1N34 I;  4B3R E;  4YY3 E;  1K47 A;  1IBM E;  1D6T A;  3QT8 A;  4JI8 I;  1DAR A;  4DR6 E;  2DEI A;  5LL6 R;  1Z0V A;  1KIJ A;  4JI7 E;  1FKA E;  4DV6 I;  3T1H I;  2E5L I;  3QT6 A;  1KTV A;  4HAC A;  4LF5 I;  4I3H A;  1I94 I;  1KVK A;  1RRE A;  1Z0T A;  5IT9 Q;  2GS8 A;  4GKK E;  1H7U A;  4LF6 E;  4IZK B;  5FWK A;  4R1F A;  1U2R A;  4JI5 E;  1FJG E;  4DR7 E;  5IWA E;  2R42 A;  2VQF E;  2X36 A;  4DXL A;  4IZJ D;  2HK3 A;  1Y4U A;  4LF7 I;  4DUZ I;  4JI5 I;  1FJG I;  1Y4S A;  3M6A A;  2UXB I;  3OTO I;  2UUC E;  4WUD A;  4HAC B;  1XMQ I;  1Z5A A;  4B3R I;  4P7A A;  4DR6 I;  2ZM6 E;  2UXB E;  2UUC I;  2PNL A;  4DV1 E;  2UUA I;  4NXM E;  4JI4 I;  5A2Q C;  1XMQ E;  4LF4 E;  4LF8 I;  2ZBK B;  4B3T I;  4WUC A;  2UXC I;  1Z0W A;  2UU9 E;  4B3S I;  3J81 C;  2V8P A;  1HNZ I;  2V2Z A;  3J7A G;  3Q6M A;  2Q2E B;  3PYE A;  1B62 A;  4DR7 I;  3P06 A;  2IOQ A;  3B82 A;  3PYF A;  1BKN A;  4JI2 I;  1N33 E;  3GON A;  2ZIT A;  3OTO E;  1Y6Z A;  5LMN I;  5BR8 I;  1EA6 A;  4JYA I;  3WU3 A;  4B3M E;  3WU4 A;  4JI6 E;  4FWD A;  3JAM Q;  2WW4 A;  3HJC A;  1HR0 I;  3PYG A;  5LMN E;  1IBM I;  5A2Q Q;  2AJ4 A;  4NXM I;  5IT9 C;  4LF9 E;  3B8H A;  4B3S E;  5GME A;  2NPF A;  4DUY E;  1XMO I;  2V34 A;  4NXN E;  3K1J A;  4Z7Y A;  4LF9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...