4B3SI

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3sI00
4B3RI 1FWLA 4X65E 1HNWI 1PKPA 4FW9A 3B78A 4JI7E 2HK3A 1Z0VA 2VQFE 4X64E 3JAMC 3WU4A 4NXNE 2F4VI 2E5LE 2A2CA 3T1YI 1Z0CA 3ZM7A 1H7UA 1ZM3A 1ZM2A 4OX9E 1MU5A 4B3SI 4HXZA 3J80C 4KQVA 4DR2E 2UXCI 4DV4E 1B63A 4DXLA 4JI0E 2R3VA 2BM1A 4FN5A 3LPSA 1N36I 4JI3E 1BKNA 4LF8I 2HHHI 4HY1A 5IWAI 2XEXA 1VISA 1N0UA 3OTOI 4LF9E 4DV3I 4DR6I 3ZZUA 4DV7E 1EI1A 4DV6E 3WU6A 4DV2I 1A6FA 2HKJA 1FNMA 4DPWA 2HKEA 1ELOA 1XMQI 5BR8E 3WU5A 1FWKA 1FJGE 4RPFA 4I3HA 4DUYE 1Z0TA 4DR7E 4B3RE 4LF4I 1NHIA 3K1JA 3K17A 4JI8I 4K0KI 1HR0I 2V2QA 3J7AG 4X66I 4DR1I 1Z0BA 2NPFA 4JV5I 4X62I 2VQEI 1FKAE 1DARA 2V34A 4B3SE 2UXCE 4URLA 3PYGA 1H73A 1K47A 4JI2I 2UUCI 4LF8E 1ZM4A 3M6AA 2HHHE 4HACA 5IWAE 2V8PA 3QT6A 3OTOE 4DV3E 4DR6E 3F0NA 4YY3I 2BM0A 3ZZ0A 4JI5I 3LTOA 3J80Q 4LFCI 4DU8A 1IBLI 2DEIA 4P7AA 5LMNI 4FWGA 1Z5AA 1FI4A 3QT8A 4LF5I 5IT9Q 1XMQE 1Z0GA 3WU3A 4DPYA 4DV1E 4WUCA 4B3TI 2E1RA 1H7SA 1KIJA 1KKHA 4JG4A 1B62A 4LF4E 2OI2A 1Z5BA 1N33I 4FWHA 4LF7I 4YHHI 4JI8E 4K0KE 4DV0I 2UUAI 5IT9C 5LMUI 1HR0E 1S16A 4DR3I 3QT7A 4FWDA 4JI6I 1NHJA 2UXDI 4DPUA 4DR4I 4DUZE 4PU9A 3ZKDA 4X66E 3LNUA 4DR1E 4PRVA 4DPXA 4MYTA 4DR5I 1MG7A 4JV5E 1IBMI 4JI1I 2V2ZA 2X7IA 3QT5A 4M1KA 4X62E 4X65I 1PVGA 2VQEE 1U2RA 2UUBI 4KHPI 4B3MI 1XMOI 4DU7A 1XNRI 4JI2E 1N0VC 2DEJA 2UUCE 1IBKI 1HNWE 2E5LI 5FLXC 4JYAI 1S4EA 4YY3E 1ZXMA 2ZM6I 3GONA 4JI5E 5A2QC 1I94I 4GKJI 4LFCE 1IBLE 5LMNE 3T1HI 2F4VE 5GMDA 4JI0I 4LF5E 4GKKI 1MX0A 3T1YE 1J5EI 3PYFA 3J81Q 1QZRA 4LF6I 3CWVA 1UEKA 4R1FA 4B3TE 4ZVIA 2J7KA 4LF9I 2VF3A 1Z0EA 2ZITA 1NZ0A 4AQYI 1N36E 4DV7I 1N33E 4LF7E 4EMDA 4YHHE 1ZXNA 4DV0E 1EA6A 2UUAE 5LMUE 3J81C 4DPTA 1PIEA 4MYUA 5LL6R 1XNQI 2UXDE 2UU9I 3B82A 4DR4E 4DR5E 5BR8I 2LJPA 4DV5I 4JI1E 4DV2E 4DR7I 2R42A 2HFSA 4JI4I 1N34I 2BV3A 2HK2A 2X36A 2UUBE 4KHPE 4NXMI 4B3ME 1XMOE 1XNRE 4LFAI 1IBKE 2A2DA 2ZBKB 2AJ4A 1N32I 4JYAE 1HNZI 2ZM6E 2CZ9A 4LFBI 1I94E 4GKJE 3PYDA 1RR9A 1HNXI 3T1HE 2UXBI 4HYMA 4GKKE 1J5EE 4LF6E 3V2UC 1WUUA 5FLXQ 2WW4A 4Z7CA 4Z7YA 5A2QQ 4JI7I 4WUBA 2GS8A 5GMEA 4AQYE 1Z5CA 2VQFI 4PRXA 4X64I 1D6TA 2HFUA 1XHKA 4NXNI 4XTJA 1XNQE 2UU9E 3ZKBA 4WUDA 1KTVA 2EFGA 4DV1I 4DV5E 1OJ4A 1H72C 1RREA 4OX9I 3D4JA 4DR2I 3B8HA 4DV4I 4JI4E 1N34E 4P52A 4UT4A 2Q2EB 4JI3I 4NXME 1Z0WA 1Z59A 4LFAE 3J7AM 4USKA 4DUZI 4DV6I 2V2VA 1N32E 1HNZE 3ZZTA 1NHHA 1H74A 4DR3E 4LFBE 4JI6E 3PYEA 3H4LA 1HNXE 4ED4A 3Q1QA 4HACB 5L3JA 2UXBE 1KVKA 3HULA 1FJGI 1IBME 3JAMQ 4UTGA 4USMA 1ZM9A 4DUYI 3V5RA
chains in the Genus database with same CATH superfamily
2PO2A 4B3RI 1FWLA 4X65E 1HNWI 3GCMA 4IFDA 2PNMA 3B4TA 1PKPA 4FW9A 3B78A 4JI7E 2HK3A 5K36C 5ELWA 1Z0VA 2VQFE 4X64E 3JAMC 3M7NG 1R6MA 3WU4A 4NXNE 2PNZB 2F4VI 2E5LE 3PS2A 2A2CA 5C0XD 5DROA 3T1YI 3HKMA 1Z0CA 3GLLA 3ZM7A 1H7UA 1XXEA 2IESA 1ZM3A 1ZM2A 4OX9E 3HJCA 1MU5A 4B3SI 4HXZA 3J80C 4KQVA 4DR2E 2NN6B 2UXCI 5K36B 4DV4E 1B63A 4DXLA 4JI0E 4FW5A 2R3VA 2BM1A 4FN5A 3LPSA 4FW3A 1N36I 4IFDD 4JI3E 1BKNA 4LF8I 2HHHI 5K36E 2NN6E 4HY1A 5IWAI 4OKGA 2XEXA 1VISA 1N0UA 3OTOI 2BA0G 5C0XF 4LF9E 2GQ0A 4DV3I 4DR6I 3ZZUA 4DV7E 2Z5BA 1EI1A 4BA2A 1E3PA 4DV6E 3WU6A 2C38B 4DV2I 1A6FA 3L7ZB 2HKJA 2AE8A 1FNMA 4IFDF 3K85A 4DPWA 2JEBA 2IOQA 2HKEA 4OO1A 3CDJA 1ELOA 2BA1D 1XMQI 4AM3A 5BR8E 4FW7A 3WU5A 1FWKA 1FJGE 1RHYA 4RPFA 4I3HA 4DUYE 1Z0TA 4DR7E 4B3RE 1UDQA 2O1UA 4LF4I 1NHIA 3K1JA 3K17A 1HK7A 3GMEA 4JI8I 4K0KI 1UDNA 2CVEA 1HR0I 4MDTA 2C37A 2V2QA 2PO1A 3J7AG 5C0XC 4X66I 4DR1I 1Z0BA 2NPFA 4BA1B 4LCHA 4JV5I 1R6LA 4OO1D 3PRYA 4X62I 2VQEI 1FKAE 1DARA 2V34A 4U3DA 4B3SE 2JE6A 2UXCE 4IFDC 4URLA 3PYGA 2IOPA 5JEAA 1H73A 3Q6MA 1K47A 4JI2I 2IERA 2BR2B 2UUCI 4LF8E 1ZM4A 3M6AA 2HHHE 4HACA 5IWAE 2V8PA 3QT6A 2WP8B 3OTOE 2WNRA 5FWKA 4DV3E 4DR6E 3F0NA 4YY3I 4OO1F 2BM0A 1P42A 5C0XE 2PO2B 3ZZ0A 4JI5I 3LTOA 1OYSA 3J80Q 4LFCI 4N3OA 4DU8A 1IBLI 3M7ND 2DEIA 4P7AA 5LMNI 2CGEA 4FWGA 4AIMA 5EL9A 1Z5AA 1FI4A 3QT8A 4LF5I 5IT9Q 4IZKA 1XMQE 1Z0GA 2PNZA 5JEAD 3WU3A 4DPYA 4DV1E 4WUCA 4B3TI 2E1RA 1H7SA 1KIJA 1KKHA 1Y4UA 4JG4A 1B62A 4LF4E 2PNLA 2OI2A 1Z5BA 3H1CA 1N33I 4FWHA 4LF7I 2NN6A 4YHHI 4JI8E 4K0KE 4DV0I 2UUAI 5IT9C 5LMUI 1HR0E 1S16A 4DR3I 1YHCA 3QT7A 4FWDA 3UHMA 2BA0D 5DRRA 4JI6I 1NHJA 4IZJB 2UXDI 1UDOA 4DPUA 3P3CA 5JEAF 4DR4I 4DUZE 4PU9A 3ZKDA 4X66E 3LNUA 4DR1E 4PRVA 4DPXA 4MYTA 4DR5I 1MG7A 4JV5E 1IBMI 4JI1I 2V2ZA 2X7IA 2Z5EA 3QT5A 4M1KA 4X62E 4X65I 3M85G 1PVGA 4QNJA 2VQEE 1U2RA 2C38A 2Z5BB 4BA2B 2UUBI 4KHPI 4B3MI 3L7ZA 1XMOI 4DU7A 1XNRI 2Z5CB 4JI2E 1N0VC 2DEJA 2F1DA 2UUCE 1IBKI 2JEAB 1HNWE 2NN6D 2E5LI 5FLXC 4JYAI 1S4EA 4YY3E 1ZXMA 2ZM6I 3GONA 4JI5E 5A2QC 4QNKA 3DD6A 1I94I 4GKJI 4LFCE 1IBLE 2C39A 5LMNE 3T1HI 2F4VE 5GMDA 4JI0I 1USUA 5JEAC 3PS3A 4LOMA 2C37B 4LF5E 4J3DA 2NN6F 4GKKI 1MX0A 1Y4SA 2PO0B 3T1YE 2JT2A 3PYFA 1J5EI 3J81Q 1QZRA 4LF6I 3CWVA 1UEKA 4R1FA 4BA1A 4B3TE 4ZVIA 2O1TA 2J7KA 4LF9I 2VF3A 1Z0EA 2ZITA 4FW6A 1NZ0A 1Y60A 4AQYI 1N36E 4DV7I 1N33E 4LF7E 4EMDA 5C0XB 4YHHE 1ZXNA 4DV0E 1EA6A 2UUAE 5LMUE 4MU0A 3J81C 4DPTA 1PIEA 2BR2A 4MYUA 5LL6R 1XNQI 2UXDE 2UU9I 3B82A 4DR4E 1USVA 4DR5E 2WP8A 5BR8I 4AIDA 4IFDB 2LJPA 4DV5I 4JI1E 4DV2E 4DR7I 1OYPA 2R42A 2HFSA 4JI4I 4U3BA 1N34I 1YH8A 2BV3A 2HK2A 2X36A 4IFDE 2UUBE 4KHPE 4ISAA 4NXMI 4B3ME 1XMOE 1XNRE 1Y6ZA 2NN6C 4LFAI 4MU4A 1IBKE 2A2DA 4IZKB 3NZKA 3P3EA 2ZBKB 2AJ4A 5K36A 1N32I 4JYAE 1HNZI 2ZM6E 2CZ9A 4LFBI 3U1YA 1I94E 4GKJE 4LCFA 3PYDA 1RR9A 1HNXI 4IS9A 3T1HE 3U1KA 4OO1C 2UXBI 4MU3A 4HYMA 4IZJA 5DNLA 4GKKE 1J5EE 2CG9A 3KRNA 4LF6E 3P06A 2GO4A 1WUUA 3V2UC 5FLXQ 2WW4A 5DNXA 3M85D 3PS1A 4Z7CA 1E3HA 4Z7YA 5A2QQ 4JI7I 4WUBA 2GS8A 5GMEA 4AQYE 4LCGA 1Z5CA 2VQFI 4MQYA 4PRXA 2GO3A 4NBQA 2JEBB 1UDSA 1VI7A 2HFUA 4X64I 1D6TA 5K36D 1XHKA 4OO1B 2Z5CA 4NXNI 2J65A 4XTJA 4OZEA 2VESA 1XNQE 2JEAA 2UU9E 3ZKBA 4WUDA 5DRQA 2BA1G 3CDIA 4OO1E 1KTVA 2EFGA 4DV1I 4DV5E 1OJ4A 1H72C 1RREA 4OX9I 3P3GA 3D4JA 4DR2I 4MU1A 4IZJD 3B8HA 4DV4I 4JI4E 1N34E 4P52A 5EKWA 4UT4A 2Q2EB 4JI3I 5K36F 2O3ZA 2PO1B 4NXME 1Z0WA 2C39B 1Z59A 4LPFA 4LFAE 5DRPA 2PO0A 3J7AM 1OYRA 4USKA 4DUZI 1Y5YA 4GQUA 3P76A 4DV6I 3Q6NA 2V2VA 1N32E 4FW4A 1HNZE 2JE6B 3ZZTA 1NHHA 1H74A 5JEAB 4DR3E 4LFBE 2O1WA 5C0XA 4JI6E 3PYEA 3H4LA 1HNXE 4ED4A 3Q1QA 4HACB 5L3JA 5JEAE 2UXBE 1KVKA 3HULA 1FJGI 2O1VA 1IBME 3JAMQ 2WNRB 4UTGA 4USMA 1ZM9A 4DUYI 3V5RA
chains in the Genus database with same CATH topology
4B3RI 1FWLA 4X65E 1HNWI 2PNMA 1PKPA 4FW9A 3B78A 4JI7E 2HK3A 1Z0VA 2VQFE 4X64E 3JAMC 3WU4A 4NXNE 2F4VI 2E5LE 2A2CA 3T1YI 1Z0CA 3ZM7A 1H7UA 1ZM3A 1ZM2A 4OX9E 3HJCA 1MU5A 4B3SI 4HXZA 4DR2E 3J80C 4KQVA 2UXCI 4DV4E 1B63A 4DXLA 4JI0E 2R3VA 2BM1A 4FN5A 3LPSA 1N36I 4JI3E 1BKNA 4LF8I 2HHHI 4HY1A 5IWAI 2XEXA 1VISA 1N0UA 3OTOI 4LF9E 2GQ0A 4DV3I 4DR6I 3ZZUA 4DV7E 2Z5BA 1EI1A 4DV6E 3WU6A 4DV2I 1A6FA 2HKJA 1FNMA 3K85A 4DPWA 2IOQA 2HKEA 1ELOA 1XMQI 5BR8E 3WU5A 1FWKA 1FJGE 4RPFA 4I3HA 4DUYE 1Z0TA 4DR7E 4B3RE 2O1UA 4LF4I 1NHIA 3K1JA 3K17A 1HK7A 4JI8I 4K0KI 1HR0I 2V2QA 3J7AG 4X66I 4DR1I 1Z0BA 2NPFA 4JV5I 3PRYA 4X62I 2VQEI 1FKAE 1DARA 2V34A 4B3SE 2UXCE 4URLA 3PYGA 2IOPA 1H73A 3Q6MA 1K47A 4JI2I 2UUCI 4LF8E 1ZM4A 3M6AA 2HHHE 4HACA 5IWAE 2V8PA 3QT6A 3OTOE 5FWKA 4DV3E 4DR6E 3F0NA 4YY3I 2BM0A 3ZZ0A 4JI5I 3LTOA 3J80Q 4LFCI 4N3OA 4DU8A 1IBLI 2DEIA 4P7AA 5LMNI 2CGEA 4FWGA 1Z5AA 1FI4A 3QT8A 4LF5I 5IT9Q 4IZKA 1XMQE 1Z0GA 3WU3A 4DPYA 4DV1E 4WUCA 4B3TI 2E1RA 1H7SA 1KIJA 1KKHA 1Y4UA 4JG4A 1B62A 4LF4E 2PNLA 2OI2A 1Z5BA 1N33I 4FWHA 4LF7I 4YHHI 4JI8E 4K0KE 4DV0I 2UUAI 5IT9C 5LMUI 1HR0E 1S16A 4DR3I 3QT7A 4FWDA 4JI6I 1NHJA 4IZJB 2UXDI 4DPUA 4DR4I 4DUZE 4PU9A 3ZKDA 4X66E 3LNUA 4DR1E 4PRVA 4DPXA 4MYTA 4DR5I 1MG7A 4JV5E 1IBMI 4JI1I 2V2ZA 2X7IA 2Z5EA 3QT5A 4M1KA 4X62E 4X65I 1PVGA 2VQEE 1U2RA 2Z5BB 2UUBI 4KHPI 4B3MI 1XMOI 4DU7A 1XNRI 2Z5CB 4JI2E 1N0VC 2DEJA 2UUCE 1IBKI 1HNWE 2E5LI 5FLXC 4JYAI 1S4EA 4YY3E 1ZXMA 2ZM6I 3GONA 4JI5E 5A2QC 1I94I 4GKJI 4LFCE 1IBLE 5LMNE 3T1HI 2F4VE 5GMDA 4JI0I 1USUA 4LF5E 4GKKI 1MX0A 1Y4SA 3T1YE 1J5EI 3PYFA 3J81Q 1QZRA 4LF6I 3CWVA 1UEKA 4R1FA 4B3TE 4ZVIA 2O1TA 2J7KA 4LF9I 2VF3A 1Z0EA 2ZITA 1NZ0A 4AQYI 1N36E 4DV7I 1N33E 4LF7E 4EMDA 4YHHE 1ZXNA 4DV0E 1EA6A 2UUAE 5LMUE 3J81C 4DPTA 1PIEA 4MYUA 5LL6R 1XNQI 2UXDE 2UU9I 3B82A 4DR4E 1USVA 4DR5E 5BR8I 2LJPA 4DV5I 4JI1E 4DV2E 4DR7I 2R42A 2HFSA 4JI4I 1N34I 2BV3A 2HK2A 2X36A 2UUBE 4KHPE 4NXMI 4B3ME 1XMOE 1XNRE 1Y6ZA 4LFAI 1IBKE 2A2DA 4IZKB 2ZBKB 2AJ4A 1N32I 4JYAE 1HNZI 2ZM6E 2CZ9A 4LFBI 1I94E 4GKJE 3PYDA 1RR9A 1HNXI 3T1HE 2UXBI 4HYMA 4IZJA 4GKKE 1J5EE 2CG9A 4LF6E 3P06A 3V2UC 1WUUA 5FLXQ 2WW4A 4Z7CA 4Z7YA 5A2QQ 4JI7I 4WUBA 2GS8A 5GMEA 4AQYE 1Z5CA 2VQFI 4PRXA 4X64I 1D6TA 2HFUA 1XHKA 2Z5CA 4NXNI 4XTJA 1XNQE 2UU9E 3ZKBA 4WUDA 1KTVA 2EFGA 4DV1I 4DV5E 1OJ4A 1H72C 1RREA 4OX9I 3D4JA 4DR2I 4IZJD 3B8HA 4DV4I 4JI4E 1N34E 4P52A 4UT4A 2Q2EB 4JI3I 4NXME 1Z0WA 1Z59A 4LFAE 3J7AM 4USKA 4DUZI 4DV6I 3Q6NA 2V2VA 1N32E 1HNZE 3ZZTA 1NHHA 1H74A 4DR3E 4LFBE 2O1WA 4JI6E 3PYEA 3H4LA 1HNXE 4ED4A 3Q1QA 4HACB 5L3JA 2UXBE 1KVKA 3HULA 1FJGI 2O1VA 1IBME 3JAMQ 4UTGA 4USMA 1ZM9A 4DUYI 3V5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R I;  1FWL A;  4X65 E;  1HNW I;  1PKP A;  4FW9 A;  3B78 A;  4JI7 E;  2HK3 A;  1Z0V A;  2VQF E;  4X64 E;  3JAM C;  3WU4 A;  4NXN E;  2F4V I;  2E5L E;  2A2C A;  3T1Y I;  1Z0C A;  3ZM7 A;  1H7U A;  1ZM3 A;  1ZM2 A;  4OX9 E;  1MU5 A;  4B3S I;  4HXZ A;  3J80 C;  4KQV A;  4DR2 E;  2UXC I;  4DV4 E;  1B63 A;  4DXL A;  4JI0 E;  2R3V A;  2BM1 A;  4FN5 A;  3LPS A;  1N36 I;  4JI3 E;  1BKN A;  4LF8 I;  2HHH I;  4HY1 A;  5IWA I;  2XEX A;  1VIS A;  1N0U A;  3OTO I;  4LF9 E;  4DV3 I;  4DR6 I;  3ZZU A;  4DV7 E;  1EI1 A;  4DV6 E;  3WU6 A;  4DV2 I;  1A6F A;  2HKJ A;  1FNM A;  4DPW A;  2HKE A;  1ELO A;  1XMQ I;  5BR8 E;  3WU5 A;  1FWK A;  1FJG E;  4RPF A;  4I3H A;  4DUY E;  1Z0T A;  4DR7 E;  4B3R E;  4LF4 I;  1NHI A;  3K1J A;  3K17 A;  4JI8 I;  4K0K I;  1HR0 I;  2V2Q A;  3J7A G;  4X66 I;  4DR1 I;  1Z0B A;  2NPF A;  4JV5 I;  4X62 I;  2VQE I;  1FKA E;  1DAR A;  2V34 A;  4B3S E;  2UXC E;  4URL A;  3PYG A;  1H73 A;  1K47 A;  4JI2 I;  2UUC I;  4LF8 E;  1ZM4 A;  3M6A A;  2HHH E;  4HAC A;  5IWA E;  2V8P A;  3QT6 A;  3OTO E;  4DV3 E;  4DR6 E;  3F0N A;  4YY3 I;  2BM0 A;  3ZZ0 A;  4JI5 I;  3LTO A;  3J80 Q;  4LFC I;  4DU8 A;  1IBL I;  2DEI A;  4P7A A;  5LMN I;  4FWG A;  1Z5A A;  1FI4 A;  3QT8 A;  4LF5 I;  5IT9 Q;  1XMQ E;  1Z0G A;  3WU3 A;  4DPY A;  4DV1 E;  4WUC A;  4B3T I;  2E1R A;  1H7S A;  1KIJ A;  1KKH A;  4JG4 A;  1B62 A;  4LF4 E;  2OI2 A;  1Z5B A;  1N33 I;  4FWH A;  4LF7 I;  4YHH I;  4JI8 E;  4K0K E;  4DV0 I;  2UUA I;  5IT9 C;  5LMU I;  1HR0 E;  1S16 A;  4DR3 I;  3QT7 A;  4FWD A;  4JI6 I;  1NHJ A;  2UXD I;  4DPU A;  4DR4 I;  4DUZ E;  4PU9 A;  3ZKD A;  4X66 E;  3LNU A;  4DR1 E;  4PRV A;  4DPX A;  4MYT A;  4DR5 I;  1MG7 A;  4JV5 E;  1IBM I;  4JI1 I;  2V2Z A;  2X7I A;  3QT5 A;  4M1K A;  4X62 E;  4X65 I;  1PVG A;  2VQE E;  1U2R A;  2UUB I;  4KHP I;  4B3M I;  1XMO I;  4DU7 A;  1XNR I;  4JI2 E;  1N0V C;  2DEJ A;  2UUC E;  1IBK I;  1HNW E;  2E5L I;  5FLX C;  4JYA I;  1S4E A;  4YY3 E;  1ZXM A;  2ZM6 I;  3GON A;  4JI5 E;  5A2Q C;  1I94 I;  4GKJ I;  4LFC E;  1IBL E;  5LMN E;  3T1H I;  2F4V E;  5GMD A;  4JI0 I;  4LF5 E;  4GKK I;  1MX0 A;  3T1Y E;  1J5E I;  3PYF A;  3J81 Q;  1QZR A;  4LF6 I;  3CWV A;  1UEK A;  4R1F A;  4B3T E;  4ZVI A;  2J7K A;  4LF9 I;  2VF3 A;  1Z0E A;  2ZIT A;  1NZ0 A;  4AQY I;  1N36 E;  4DV7 I;  1N33 E;  4LF7 E;  4EMD A;  4YHH E;  1ZXN A;  4DV0 E;  1EA6 A;  2UUA E;  5LMU E;  3J81 C;  4DPT A;  1PIE A;  4MYU A;  5LL6 R;  1XNQ I;  2UXD E;  2UU9 I;  3B82 A;  4DR4 E;  4DR5 E;  5BR8 I;  2LJP A;  4DV5 I;  4JI1 E;  4DV2 E;  4DR7 I;  2R42 A;  2HFS A;  4JI4 I;  1N34 I;  2BV3 A;  2HK2 A;  2X36 A;  2UUB E;  4KHP E;  4NXM I;  4B3M E;  1XMO E;  1XNR E;  4LFA I;  1IBK E;  2A2D A;  2ZBK B;  2AJ4 A;  1N32 I;  4JYA E;  1HNZ I;  2ZM6 E;  2CZ9 A;  4LFB I;  1I94 E;  4GKJ E;  3PYD A;  1RR9 A;  1HNX I;  3T1H E;  2UXB I;  4HYM A;  4GKK E;  1J5E E;  4LF6 E;  3V2U C;  1WUU A;  5FLX Q;  2WW4 A;  4Z7C A;  4Z7Y A;  5A2Q Q;  4JI7 I;  4WUB A;  2GS8 A;  5GME A;  4AQY E;  1Z5C A;  2VQF I;  4PRX A;  4X64 I;  1D6T A;  2HFU A;  1XHK A;  4NXN I;  4XTJ A;  1XNQ E;  2UU9 E;  3ZKB A;  4WUD A;  1KTV A;  2EFG A;  4DV1 I;  4DV5 E;  1OJ4 A;  1H72 C;  1RRE A;  4OX9 I;  3D4J A;  4DR2 I;  3B8H A;  4DV4 I;  4JI4 E;  1N34 E;  4P52 A;  4UT4 A;  2Q2E B;  4JI3 I;  4NXM E;  1Z0W A;  1Z59 A;  4LFA E;  3J7A M;  4USK A;  4DUZ I;  4DV6 I;  2V2V A;  1N32 E;  1HNZ E;  3ZZT A;  1NHH A;  1H74 A;  4DR3 E;  4LFB E;  4JI6 E;  3PYE A;  3H4L A;  1HNX E;  4ED4 A;  3Q1Q A;  4HAC B;  5L3J A;  2UXB E;  1KVK A;  3HUL A;  1FJG I;  1IBM E;  3JAM Q;  4UTG A;  4USM A;  1ZM9 A;  4DUY I;  3V5R A; 
#chains in the Genus database with same CATH topology
 2PO2 A;  4B3R I;  1FWL A;  4X65 E;  1HNW I;  3GCM A;  4IFD A;  2PNM A;  3B4T A;  1PKP A;  4FW9 A;  3B78 A;  4JI7 E;  2HK3 A;  5K36 C;  5ELW A;  1Z0V A;  2VQF E;  4X64 E;  3JAM C;  3M7N G;  1R6M A;  3WU4 A;  4NXN E;  2PNZ B;  2F4V I;  2E5L E;  3PS2 A;  2A2C A;  5C0X D;  5DRO A;  3T1Y I;  3HKM A;  1Z0C A;  3GLL A;  3ZM7 A;  1H7U A;  1XXE A;  2IES A;  1ZM3 A;  1ZM2 A;  4OX9 E;  3HJC A;  1MU5 A;  4B3S I;  4HXZ A;  3J80 C;  4KQV A;  4DR2 E;  2NN6 B;  2UXC I;  5K36 B;  4DV4 E;  1B63 A;  4DXL A;  4JI0 E;  4FW5 A;  2R3V A;  2BM1 A;  4FN5 A;  3LPS A;  4FW3 A;  1N36 I;  4IFD D;  4JI3 E;  1BKN A;  4LF8 I;  2HHH I;  5K36 E;  2NN6 E;  4HY1 A;  5IWA I;  4OKG A;  2XEX A;  1VIS A;  1N0U A;  3OTO I;  2BA0 G;  5C0X F;  4LF9 E;  2GQ0 A;  4DV3 I;  4DR6 I;  3ZZU A;  4DV7 E;  2Z5B A;  1EI1 A;  4BA2 A;  1E3P A;  4DV6 E;  3WU6 A;  2C38 B;  4DV2 I;  1A6F A;  3L7Z B;  2HKJ A;  2AE8 A;  1FNM A;  4IFD F;  3K85 A;  4DPW A;  2JEB A;  2IOQ A;  2HKE A;  4OO1 A;  3CDJ A;  1ELO A;  2BA1 D;  1XMQ I;  4AM3 A;  5BR8 E;  4FW7 A;  3WU5 A;  1FWK A;  1FJG E;  1RHY A;  4RPF A;  4I3H A;  4DUY E;  1Z0T A;  4DR7 E;  4B3R E;  1UDQ A;  2O1U A;  4LF4 I;  1NHI A;  3K1J A;  3K17 A;  1HK7 A;  3GME A;  4JI8 I;  4K0K I;  1UDN A;  2CVE A;  1HR0 I;  4MDT A;  2C37 A;  2V2Q A;  2PO1 A;  3J7A G;  5C0X C;  4X66 I;  4DR1 I;  1Z0B A;  2NPF A;  4BA1 B;  4LCH A;  4JV5 I;  1R6L A;  4OO1 D;  3PRY A;  4X62 I;  2VQE I;  1FKA E;  1DAR A;  2V34 A;  4U3D A;  4B3S E;  2JE6 A;  2UXC E;  4IFD C;  4URL A;  3PYG A;  2IOP A;  5JEA A;  1H73 A;  3Q6M A;  1K47 A;  4JI2 I;  2IER A;  2BR2 B;  2UUC I;  4LF8 E;  1ZM4 A;  3M6A A;  2HHH E;  4HAC A;  5IWA E;  2V8P A;  3QT6 A;  2WP8 B;  3OTO E;  2WNR A;  5FWK A;  4DV3 E;  4DR6 E;  3F0N A;  4YY3 I;  4OO1 F;  2BM0 A;  1P42 A;  5C0X E;  2PO2 B;  3ZZ0 A;  4JI5 I;  3LTO A;  1OYS A;  3J80 Q;  4LFC I;  4N3O A;  4DU8 A;  1IBL I;  3M7N D;  2DEI A;  4P7A A;  5LMN I;  2CGE A;  4FWG A;  4AIM A;  5EL9 A;  1Z5A A;  1FI4 A;  3QT8 A;  4LF5 I;  5IT9 Q;  4IZK A;  1XMQ E;  1Z0G A;  2PNZ A;  5JEA D;  3WU3 A;  4DPY A;  4DV1 E;  4WUC A;  4B3T I;  2E1R A;  1H7S A;  1KIJ A;  1KKH A;  1Y4U A;  4JG4 A;  1B62 A;  4LF4 E;  2PNL A;  2OI2 A;  1Z5B A;  3H1C A;  1N33 I;  4FWH A;  4LF7 I;  2NN6 A;  4YHH I;  4JI8 E;  4K0K E;  4DV0 I;  2UUA I;  5IT9 C;  5LMU I;  1HR0 E;  1S16 A;  4DR3 I;  1YHC A;  3QT7 A;  4FWD A;  3UHM A;  2BA0 D;  5DRR A;  4JI6 I;  1NHJ A;  4IZJ B;  2UXD I;  1UDO A;  4DPU A;  3P3C A;  5JEA F;  4DR4 I;  4DUZ E;  4PU9 A;  3ZKD A;  4X66 E;  3LNU A;  4DR1 E;  4PRV A;  4DPX A;  4MYT A;  4DR5 I;  1MG7 A;  4JV5 E;  1IBM I;  4JI1 I;  2V2Z A;  2X7I A;  2Z5E A;  3QT5 A;  4M1K A;  4X62 E;  4X65 I;  3M85 G;  1PVG A;  4QNJ A;  2VQE E;  1U2R A;  2C38 A;  2Z5B B;  4BA2 B;  2UUB I;  4KHP I;  4B3M I;  3L7Z A;  1XMO I;  4DU7 A;  1XNR I;  2Z5C B;  4JI2 E;  1N0V C;  2DEJ A;  2F1D A;  2UUC E;  1IBK I;  2JEA B;  1HNW E;  2NN6 D;  2E5L I;  5FLX C;  4JYA I;  1S4E A;  4YY3 E;  1ZXM A;  2ZM6 I;  3GON A;  4JI5 E;  5A2Q C;  4QNK A;  3DD6 A;  1I94 I;  4GKJ I;  4LFC E;  1IBL E;  2C39 A;  5LMN E;  3T1H I;  2F4V E;  5GMD A;  4JI0 I;  1USU A;  5JEA C;  3PS3 A;  4LOM A;  2C37 B;  4LF5 E;  4J3D A;  2NN6 F;  4GKK I;  1MX0 A;  1Y4S A;  2PO0 B;  3T1Y E;  2JT2 A;  3PYF A;  1J5E I;  3J81 Q;  1QZR A;  4LF6 I;  3CWV A;  1UEK A;  4R1F A;  4BA1 A;  4B3T E;  4ZVI A;  2O1T A;  2J7K A;  4LF9 I;  2VF3 A;  1Z0E A;  2ZIT A;  4FW6 A;  1NZ0 A;  1Y60 A;  4AQY I;  1N36 E;  4DV7 I;  1N33 E;  4LF7 E;  4EMD A;  5C0X B;  4YHH E;  1ZXN A;  4DV0 E;  1EA6 A;  2UUA E;  5LMU E;  4MU0 A;  3J81 C;  4DPT A;  1PIE A;  2BR2 A;  4MYU A;  5LL6 R;  1XNQ I;  2UXD E;  2UU9 I;  3B82 A;  4DR4 E;  1USV A;  4DR5 E;  2WP8 A;  5BR8 I;  4AID A;  4IFD B;  2LJP A;  4DV5 I;  4JI1 E;  4DV2 E;  4DR7 I;  1OYP A;  2R42 A;  2HFS A;  4JI4 I;  4U3B A;  1N34 I;  1YH8 A;  2BV3 A;  2HK2 A;  2X36 A;  4IFD E;  2UUB E;  4KHP E;  4ISA A;  4NXM I;  4B3M E;  1XMO E;  1XNR E;  1Y6Z A;  2NN6 C;  4LFA I;  4MU4 A;  1IBK E;  2A2D A;  4IZK B;  3NZK A;  3P3E A;  2ZBK B;  2AJ4 A;  5K36 A;  1N32 I;  4JYA E;  1HNZ I;  2ZM6 E;  2CZ9 A;  4LFB I;  3U1Y A;  1I94 E;  4GKJ E;  4LCF A;  3PYD A;  1RR9 A;  1HNX I;  4IS9 A;  3T1H E;  3U1K A;  4OO1 C;  2UXB I;  4MU3 A;  4HYM A;  4IZJ A;  5DNL A;  4GKK E;  1J5E E;  2CG9 A;  3KRN A;  4LF6 E;  3P06 A;  2GO4 A;  1WUU A;  3V2U C;  5FLX Q;  2WW4 A;  5DNX A;  3M85 D;  3PS1 A;  4Z7C A;  1E3H A;  4Z7Y A;  5A2Q Q;  4JI7 I;  4WUB A;  2GS8 A;  5GME A;  4AQY E;  4LCG A;  1Z5C A;  2VQF I;  4MQY A;  4PRX A;  2GO3 A;  4NBQ A;  2JEB B;  1UDS A;  1VI7 A;  2HFU A;  4X64 I;  1D6T A;  5K36 D;  1XHK A;  4OO1 B;  2Z5C A;  4NXN I;  2J65 A;  4XTJ A;  4OZE A;  2VES A;  1XNQ E;  2JEA A;  2UU9 E;  3ZKB A;  4WUD A;  5DRQ A;  2BA1 G;  3CDI A;  4OO1 E;  1KTV A;  2EFG A;  4DV1 I;  4DV5 E;  1OJ4 A;  1H72 C;  1RRE A;  4OX9 I;  3P3G A;  3D4J A;  4DR2 I;  4MU1 A;  4IZJ D;  3B8H A;  4DV4 I;  4JI4 E;  1N34 E;  4P52 A;  5EKW A;  4UT4 A;  2Q2E B;  4JI3 I;  5K36 F;  2O3Z A;  2PO1 B;  4NXM E;  1Z0W A;  2C39 B;  1Z59 A;  4LPF A;  4LFA E;  5DRP A;  2PO0 A;  3J7A M;  1OYR A;  4USK A;  4DUZ I;  1Y5Y A;  4GQU A;  3P76 A;  4DV6 I;  3Q6N A;  2V2V A;  1N32 E;  4FW4 A;  1HNZ E;  2JE6 B;  3ZZT A;  1NHH A;  1H74 A;  5JEA B;  4DR3 E;  4LFB E;  2O1W A;  5C0X A;  4JI6 E;  3PYE A;  3H4L A;  1HNX E;  4ED4 A;  3Q1Q A;  4HAC B;  5L3J A;  5JEA E;  2UXB E;  1KVK A;  3HUL A;  1FJG I;  2O1V A;  1IBM E;  3JAM Q;  2WNR B;  4UTG A;  4USM A;  1ZM9 A;  4DUY I;  3V5R A; 
#chains in the Genus database with same CATH homology
 4B3R I;  1FWL A;  4X65 E;  1HNW I;  2PNM A;  1PKP A;  4FW9 A;  3B78 A;  4JI7 E;  2HK3 A;  1Z0V A;  2VQF E;  4X64 E;  3JAM C;  3WU4 A;  4NXN E;  2F4V I;  2E5L E;  2A2C A;  3T1Y I;  1Z0C A;  3ZM7 A;  1H7U A;  1ZM3 A;  1ZM2 A;  4OX9 E;  3HJC A;  1MU5 A;  4B3S I;  4HXZ A;  4DR2 E;  3J80 C;  4KQV A;  2UXC I;  4DV4 E;  1B63 A;  4DXL A;  4JI0 E;  2R3V A;  2BM1 A;  4FN5 A;  3LPS A;  1N36 I;  4JI3 E;  1BKN A;  4LF8 I;  2HHH I;  4HY1 A;  5IWA I;  2XEX A;  1VIS A;  1N0U A;  3OTO I;  4LF9 E;  2GQ0 A;  4DV3 I;  4DR6 I;  3ZZU A;  4DV7 E;  2Z5B A;  1EI1 A;  4DV6 E;  3WU6 A;  4DV2 I;  1A6F A;  2HKJ A;  1FNM A;  3K85 A;  4DPW A;  2IOQ A;  2HKE A;  1ELO A;  1XMQ I;  5BR8 E;  3WU5 A;  1FWK A;  1FJG E;  4RPF A;  4I3H A;  4DUY E;  1Z0T A;  4DR7 E;  4B3R E;  2O1U A;  4LF4 I;  1NHI A;  3K1J A;  3K17 A;  1HK7 A;  4JI8 I;  4K0K I;  1HR0 I;  2V2Q A;  3J7A G;  4X66 I;  4DR1 I;  1Z0B A;  2NPF A;  4JV5 I;  3PRY A;  4X62 I;  2VQE I;  1FKA E;  1DAR A;  2V34 A;  4B3S E;  2UXC E;  4URL A;  3PYG A;  2IOP A;  1H73 A;  3Q6M A;  1K47 A;  4JI2 I;  2UUC I;  4LF8 E;  1ZM4 A;  3M6A A;  2HHH E;  4HAC A;  5IWA E;  2V8P A;  3QT6 A;  3OTO E;  5FWK A;  4DV3 E;  4DR6 E;  3F0N A;  4YY3 I;  2BM0 A;  3ZZ0 A;  4JI5 I;  3LTO A;  3J80 Q;  4LFC I;  4N3O A;  4DU8 A;  1IBL I;  2DEI A;  4P7A A;  5LMN I;  2CGE A;  4FWG A;  1Z5A A;  1FI4 A;  3QT8 A;  4LF5 I;  5IT9 Q;  4IZK A;  1XMQ E;  1Z0G A;  3WU3 A;  4DPY A;  4DV1 E;  4WUC A;  4B3T I;  2E1R A;  1H7S A;  1KIJ A;  1KKH A;  1Y4U A;  4JG4 A;  1B62 A;  4LF4 E;  2PNL A;  2OI2 A;  1Z5B A;  1N33 I;  4FWH A;  4LF7 I;  4YHH I;  4JI8 E;  4K0K E;  4DV0 I;  2UUA I;  5IT9 C;  5LMU I;  1HR0 E;  1S16 A;  4DR3 I;  3QT7 A;  4FWD A;  4JI6 I;  1NHJ A;  4IZJ B;  2UXD I;  4DPU A;  4DR4 I;  4DUZ E;  4PU9 A;  3ZKD A;  4X66 E;  3LNU A;  4DR1 E;  4PRV A;  4DPX A;  4MYT A;  4DR5 I;  1MG7 A;  4JV5 E;  1IBM I;  4JI1 I;  2V2Z A;  2X7I A;  2Z5E A;  3QT5 A;  4M1K A;  4X62 E;  4X65 I;  1PVG A;  2VQE E;  1U2R A;  2Z5B B;  2UUB I;  4KHP I;  4B3M I;  1XMO I;  4DU7 A;  1XNR I;  2Z5C B;  4JI2 E;  1N0V C;  2DEJ A;  2UUC E;  1IBK I;  1HNW E;  2E5L I;  5FLX C;  4JYA I;  1S4E A;  4YY3 E;  1ZXM A;  2ZM6 I;  3GON A;  4JI5 E;  5A2Q C;  1I94 I;  4GKJ I;  4LFC E;  1IBL E;  5LMN E;  3T1H I;  2F4V E;  5GMD A;  4JI0 I;  1USU A;  4LF5 E;  4GKK I;  1MX0 A;  1Y4S A;  3T1Y E;  1J5E I;  3PYF A;  3J81 Q;  1QZR A;  4LF6 I;  3CWV A;  1UEK A;  4R1F A;  4B3T E;  4ZVI A;  2O1T A;  2J7K A;  4LF9 I;  2VF3 A;  1Z0E A;  2ZIT A;  1NZ0 A;  4AQY I;  1N36 E;  4DV7 I;  1N33 E;  4LF7 E;  4EMD A;  4YHH E;  1ZXN A;  4DV0 E;  1EA6 A;  2UUA E;  5LMU E;  3J81 C;  4DPT A;  1PIE A;  4MYU A;  5LL6 R;  1XNQ I;  2UXD E;  2UU9 I;  3B82 A;  4DR4 E;  1USV A;  4DR5 E;  5BR8 I;  2LJP A;  4DV5 I;  4JI1 E;  4DV2 E;  4DR7 I;  2R42 A;  2HFS A;  4JI4 I;  1N34 I;  2BV3 A;  2HK2 A;  2X36 A;  2UUB E;  4KHP E;  4NXM I;  4B3M E;  1XMO E;  1XNR E;  1Y6Z A;  4LFA I;  1IBK E;  2A2D A;  4IZK B;  2ZBK B;  2AJ4 A;  1N32 I;  4JYA E;  1HNZ I;  2ZM6 E;  2CZ9 A;  4LFB I;  1I94 E;  4GKJ E;  3PYD A;  1RR9 A;  1HNX I;  3T1H E;  2UXB I;  4HYM A;  4IZJ A;  4GKK E;  1J5E E;  2CG9 A;  4LF6 E;  3P06 A;  3V2U C;  1WUU A;  5FLX Q;  2WW4 A;  4Z7C A;  4Z7Y A;  5A2Q Q;  4JI7 I;  4WUB A;  2GS8 A;  5GME A;  4AQY E;  1Z5C A;  2VQF I;  4PRX A;  4X64 I;  1D6T A;  2HFU A;  1XHK A;  2Z5C A;  4NXN I;  4XTJ A;  1XNQ E;  2UU9 E;  3ZKB A;  4WUD A;  1KTV A;  2EFG A;  4DV1 I;  4DV5 E;  1OJ4 A;  1H72 C;  1RRE A;  4OX9 I;  3D4J A;  4DR2 I;  4IZJ D;  3B8H A;  4DV4 I;  4JI4 E;  1N34 E;  4P52 A;  4UT4 A;  2Q2E B;  4JI3 I;  4NXM E;  1Z0W A;  1Z59 A;  4LFA E;  3J7A M;  4USK A;  4DUZ I;  4DV6 I;  3Q6N A;  2V2V A;  1N32 E;  1HNZ E;  3ZZT A;  1NHH A;  1H74 A;  4DR3 E;  4LFB E;  2O1W A;  4JI6 E;  3PYE A;  3H4L A;  1HNX E;  4ED4 A;  3Q1Q A;  4HAC B;  5L3J A;  2UXB E;  1KVK A;  3HUL A;  1FJG I;  2O1V A;  1IBM E;  3JAM Q;  4UTG A;  4USM A;  1ZM9 A;  4DUY I;  3V5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...