4B3SI

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3sI00
1J5EE 4DR5E 1HNWI 4FWDA 4HYMA 5GMEA 3ZM7A 1ZM3A 1J5EI 4LF5E 4DUYI 4M1KA 4URLA 3OTOI 1N0VC 2VQEI 4DV6E 2AJ4A 4JI8E 4YHHI 1Z5BA 4DR2E 4DV3E 3J80C 4DV4E 1PVGA 4JI8I 4YHHE 4LF4I 4PRXA 4LFCI 3J81C 4USMA 1H74A 1N0UA 3LNUA 4DV2E 1XMOE 4JI1E 4JI6E 4LF8I 1HNZI 3HULA 4JYAI 1UEKA 4B3TI 4DR5I 3QT5A 1HNWE 4ED4A 5IWAI 2UXDE 5FLXQ 2UUCI 4DPTA 3J80Q 5LMNE 2VQEE 1IBLI 1WUUA 4GKJI 2UXBI 1KVKA 5LMNI 2BM1A 2DEJA 1PIEA 1XNRE 1S4EA 3WU4A 4MYUA 2VF3A 1I94I 1H73A 1N33E 4LFCE 1FWKA 4AQYE 4FN5A 2UXCI 4JI2E 4JV5I 4I3HA 1S16A 4GKKE 4KHPI 4DR6E 1IBKE 3PYDA 4JI2I 2V2VA 2X36A 4DXLA 5IWAE 2WW4A 1XHKA 3QT7A 1FKAE 4DR6I 5LMUI 5A2QC 4FWGA 4DU8A 4JI3I 2UU9E 1EI1A 3T1YE 4KQVA 4DUZI 4YY3E 3JAMC 4DR7E 1XNQI 2Q2EB 4DR4I 1B63A 3J7AM 4UTGA 4JI4E 1NHIA 4AQYI 4B3RE 4DV0I 1KKHA 4WUCA 3ZZTA 4B3RI 1MU5A 2ZM6I 4LFBE 1Z59A 2UUAE 1Z5AA 3H4LA 4X62I 1XMOI 4JI1I 4DV2I 1IBME 3K17A 3GONA 2HHHI 1EA6A 2A2CA 1RREA 4RPFA 4K0KE 3V5RA 4NXNE 4FWHA 3OTOE 4DPYA 4DR3I 3F0NA 4Z7CA 4LF6E 1XNQE 1VISA 3K1JA 1XMQI 4DPUA 2BV3A 2E5LI 5IT9C 1I94E 1XMQE 4DV1E 1H7SA 4B3SE 2CZ9A 3T1HE 4DV5E 4X64I 1NHJA 4WUBA 2R3VA 4FW9A 4X65I 1Z0GA 2F4VE 3D4JA 4DV4I 3PYGA 2HHHE 1Z0VA 5L3JA 5GMDA 1ZM2A 2A2DA 4LFAI 1ZM4A 4GKJE 4DPXA 2E1RA 2UUCE 4X66I 4DUYE 2HFSA 4LF5I 1FJGI 3ZZUA 1D6TA 2UXBE 4HY1A 3LPSA 2XEXA 2BM0A 3ZZ0A 2VQFI 3J7AG 2R42A 3PYFA 2E5LE 4JI4I 4DV1I 4DR2I 4B3SI 4DR7I 4OX9I 2UXCE 3Q1QA 1BKNA 4EMDA 4OX9E 1KTVA 2UUBI 4JG4A 2UU9I 5FLXC 1A6FA 2HK2A 5BR8I 1QZRA 4JI0E 4X62E 1ZM9A 4DV7I 2HKEA 4ZVIA 1Z0CA 2NPFA 3WU6A 5BR8E 1Z5CA 3M6AA 2V2QA 3B78A 1IBMI 1H72C 1NHHA 4DR3E 4UT4A 2VQFE 1N34E 4LF9I 2ZBKB 1IBLE 4MYTA 4NXME 1N34I 3ZKBA 1HNXE 1Z0TA 3PYEA 1ZXMA 1XNRI 4JI5I 4LFBI 3LTOA 4DU7A 4DR4E 4B3TE 4PU9A 1NZ0A 4DR1E 1RR9A 2EFGA 4GKKI 1Z0BA 2UXDI 4PRVA 1K47A 4USKA 4LF4E 1FI4A 1KIJA 2X7IA 2DEIA 4LF8E 4X66E 3CWVA 2OI2A 4YY3I 4JYAE 3J81Q 4WUDA 1N36I 2HK3A 1Z0EA 4NXMI 1HNXI 4DV3I 2V8PA 3V2UC 1FJGE 1MX0A 4NXNI 2HFUA 1N36E 4JI5E 2GS8A 4XTJA 4DV0E 5LL6R 4DV5I 1OJ4A 1HNZE 1Z0WA 2V2ZA 2F4VI 1U2RA 4JV5E 2J7KA 4HACA 2UUAI 2ZM6E 1N32E 1B62A 4HACB 1H7UA 3T1YI 1IBKI 4LFAE 4LF7E 3T1HI 3WU5A 2V34A 4X64E 2ZITA 2UUBE 3B82A 1DARA 3B8HA 3WU3A 4JI7I 4JI0I 1ELOA 4DV7E 4JI3E 5IT9Q 3ZKDA 4HXZA 4B3MI 4JI7E 4DUZE 5LMUE 4LF6I 1FWLA 1MG7A 4P52A 1HR0E 4B3ME 4Z7YA 1ZXNA 4DV6I 4DPWA 3QT8A 1HR0I 1N33I 1FNMA 5A2QQ 1PKPA 2LJPA 4KHPE 4R1FA 4P7AA 4DR1I 4X65E 2HKJA 1N32I 3QT6A 4K0KI 4LF7I 4JI6I 3JAMQ 4LF9E
chains in the Genus database with same CATH superfamily
4MU1A 1J5EE 4DR5E 1HNWI 4FWDA 4LOMA 4HYMA 5GMEA 3PS3A 1UDSA 3ZM7A 2PO1A 1ZM3A 1J5EI 3Q6NA 1OYRA 4LF5E 4DUYI 4M1KA 4URLA 3OTOI 1N0VC 2VQEI 2JEBA 2F1DA 4DV6E 2NN6A 2AJ4A 4JI8E 4YHHI 2NN6B 1Z5BA 4MU3A 4DR2E 4DV3E 5C0XE 3J80C 4DV4E 3GLLA 1PVGA 3L7ZA 1Y60A 4U3DA 4JI8I 4YHHE 4OO1E 4LF4I 4PRXA 4LFCI 3J81C 2JEAA 2BA1D 4USMA 1H74A 1N0UA 3LNUA 4DV2E 1XMOE 4JI1E 4JI6E 4LF8I 2Z5CB 1HNZI 3HULA 4JYAI 1UEKA 4BA1B 4B3TI 4DR5I 3QT5A 1HNWE 5JEAE 4ED4A 5IWAI 5K36E 5EKWA 2UXDE 4IZJD 5FLXQ 2UUCI 4DPTA 2PNZB 3M7NG 4IFDB 3J80Q 5LMNE 2VQEE 2NN6D 1IBLI 1WUUA 4GKJI 2UXBI 1KVKA 5LMNI 2BM1A 2DEJA 1PIEA 1XNRE 2WNRB 1S4EA 3WU4A 5JEAF 1R6MA 4MYUA 2NN6E 2VF3A 1I94I 1H73A 1N33E 3GCMA 4LCHA 4LFCE 1FWKA 4AQYE 3HKMA 4FN5A 4GQUA 2UXCI 4JI2E 2C38B 4JV5I 2PO1B 4I3HA 2BA0D 1S16A 1XXEA 4GKKE 4KHPI 4DR6E 1IBKE 3PYDA 4JI2I 3DD6A 2V2VA 2X36A 4DXLA 5IWAE 2WW4A 1XHKA 3QT7A 1FKAE 4DR6I 1YHCA 5LMUI 5A2QC 4FWGA 4DU8A 2IOQA 4JI3I 1UDOA 2AE8A 4U3BA 2UU9E 2C37A 1EI1A 4MU0A 3T1YE 2C37B 4KQVA 4DUZI 3K85A 4YY3E 2Z5BB 2JEAB 3M85D 5FWKA 4QNJA 3JAMC 3UHMA 1XNQI 2Q2EB 4DR7E 4DR4I 2BR2A 1B63A 3J7AM 3P3EA 3NZKA 5EL9A 4MDTA 4UTGA 4JI4E 1NHIA 5K36C 4AQYI 5JEAC 4B3RE 4DV0I 1Y4UA 4NBQA 1KKHA 4WUCA 3ZZTA 4B3RI 2PNZA 4IFDA 1UDQA 1MU5A 5DRPA 2JE6B 2ZM6I 4LFBE 1Z59A 2UUAE 1Z5AA 3H4LA 5JEAA 4X62I 4JI1I 4DV2I 1XMOI 1IBME 3K17A 3GONA 2HHHI 1EA6A 2A2CA 1RREA 5K36B 2C39A 4RPFA 4K0KE 3V5RA 4NXNE 2C39B 4FWHA 5C0XF 1VI7A 5DROA 5C0XA 3OTOE 4DPYA 4DR3I 5DRRA 2C38A 3F0NA 3P3CA 4Z7CA 4LF6E 1XNQE 4OKGA 1VISA 3K1JA 1XMQI 4DPUA 2BV3A 4BA2A 4BA2B 1E3PA 2E5LI 1UDNA 5IT9C 1XMQE 1I94E 4DV1E 1H7SA 4B3SE 2CZ9A 3B4TA 3H1CA 3T1HE 4DV5E 4X64I 3U1KA 1NHJA 4WUBA 4OO1A 2R3VA 4FW9A 4X65I 1Z0GA 2F4VE 3D4JA 4LCFA 4DV4I 4LCGA 2JEBB 3PYGA 2HHHE 2IERA 1Z0VA 2IOPA 2NN6F 5L3JA 5GMDA 1ZM2A 2A2DA 4LFAI 1ZM4A 4GKJE 1P42A 4DPXA 2E1RA 2UUCE 3M7ND 3PRYA 4X66I 4DUYE 2HFSA 2PO2A 4LF5I 1FJGI 3ZZUA 4LPFA 1D6TA 2UXBE 4HY1A 3LPSA 2XEXA 2BM0A 2JT2A 4FW3A 3ZZ0A 2VQFI 3J7AG 2WP8B 2R42A 5K36D 2JE6A 3PYFA 2E5LE 2CG9A 4JI4I 4DV1I 4DR2I 4B3SI 2CGEA 4DR7I 4OX9I 2BA1G 4OO1F 2UXCE 3Q6MA 4J3DA 3Q1QA 2O1WA 3PS2A 1BKNA 5K36A 4EMDA 4OX9E 1USVA 1KTVA 2UUBI 4JG4A 2UU9I 1Y6ZA 5FLXC 1A6FA 4MQYA 2Z5EA 2HK2A 5BR8I 4IFDC 4AIMA 1QZRA 4IFDD 4JI0E 4AM3A 4IS9A 4X62E 1ZM9A 1HK7A 4DV7I 2HKEA 4ZVIA 1Z0CA 2NPFA 2WNRA 3WU6A 5BR8E 5C0XD 1Z5CA 3M6AA 2V2QA 3B78A 3P3GA 1IBMI 1H72C 1NHHA 4DR3E 4UT4A 2VQFE 1N34E 5C0XB 4LF9I 2ZBKB 4IZJB 3U1YA 1IBLE 3P06A 4OO1B 4IZJA 2GO3A 4MYTA 4NXME 1N34I 3ZKBA 1HNXE 1Z0TA 3PYEA 4ISAA 1ZXMA 2IESA 2O1UA 1XNRI 4JI5I 4LFBI 3LTOA 5DNXA 2GO4A 4DU7A 2NN6C 1E3HA 2CVEA 4DR4E 5K36F 4B3TE 4PU9A 2O1TA 1NZ0A 4DR1E 1RR9A 4QNKA 2EFGA 4GKKI 2PO0B 4FW5A 2J65A 1Y4SA 1Z0BA 2Z5BA 3CDJA 2UXDI 4PRVA 1K47A 4IFDE 1USUA 4USKA 4LF4E 2GQ0A 1FI4A 1KIJA 2X7IA 5ELWA 2DEIA 3M85G 4LF8E 4X66E 1R6LA 3CWVA 2OI2A 2PNLA 4YY3I 4JYAE 3J81Q 1OYPA 2PNMA 4WUDA 2PO2B 1N36I 2HK3A 1Z0EA 4NXMI 1HNXI 4DV3I 2V8PA 3V2UC 1FJGE 2WP8A 1MX0A 4NXNI 2HFUA 1N36E 4JI5E 2GS8A 4OO1D 4IZKA 1RHYA 4XTJA 4OO1C 4DV0E 4IZKB 5LL6R 2VESA 5C0XC 4DV5I 4FW4A 1OJ4A 3KRNA 4FW7A 1HNZE 1Z0WA 2V2ZA 2F4VI 1U2RA 2BA0G 4JV5E 2Z5CA 2J7KA 4HACA 2UUAI 2ZM6E 1N32E 1B62A 2BR2B 4HACB 1H7UA 4BA1A 3T1YI 1IBKI 4LFAE 4LF7E 3T1HI 3WU5A 5DRQA 2V34A 4X64E 2ZITA 2UUBE 3B82A 1DARA 3B8HA 3L7ZB 3WU3A 4JI7I 4JI0I 1ELOA 4DV7E 4JI3E 5IT9Q 3ZKDA 4HXZA 4B3MI 4JI7E 4DUZE 1YH8A 3GMEA 3P76A 5LMUE 4LF6I 5JEAB 1FWLA 1MG7A 2PO0A 4P52A 4OZEA 1HR0E 4B3ME 4Z7YA 1ZXNA 2O3ZA 4DV6I 4DPWA 3QT8A 1HR0I 5JEAD 1N33I 1FNMA 5A2QQ 1PKPA 4IFDF 1OYSA 2LJPA 3CDIA 4MU4A 4KHPE 4R1FA 4P7AA 5DNLA 4DR1I 4FW6A 2O1VA 4N3OA 4X65E 2HKJA 1N32I 3QT6A 4K0KI 4LF7I 3PS1A 1Y5YA 4JI6I 3JAMQ 3HJCA 4AIDA 4LF9E
chains in the Genus database with same CATH topology
1J5EE 4DR5E 1HNWI 4FWDA 4HYMA 5GMEA 3ZM7A 1ZM3A 1J5EI 3Q6NA 4LF5E 4DUYI 4M1KA 4URLA 3OTOI 1N0VC 2VQEI 4DV6E 2AJ4A 4JI8E 4YHHI 1Z5BA 4DR2E 4DV3E 3J80C 4DV4E 1PVGA 4JI8I 4YHHE 4LF4I 4PRXA 4LFCI 3J81C 4USMA 1H74A 1N0UA 3LNUA 4DV2E 1XMOE 4JI1E 4JI6E 4LF8I 2Z5CB 1HNZI 3HULA 4JYAI 1UEKA 4B3TI 4DR5I 3QT5A 1HNWE 4ED4A 5IWAI 2UXDE 4IZJD 5FLXQ 2UUCI 4DPTA 3J80Q 5LMNE 2VQEE 1IBLI 1WUUA 4GKJI 2UXBI 1KVKA 5LMNI 2BM1A 2DEJA 1PIEA 1XNRE 1S4EA 3WU4A 4MYUA 2VF3A 1I94I 1H73A 1N33E 4LFCE 1FWKA 4AQYE 4FN5A 2UXCI 4JI2E 4JV5I 4I3HA 1S16A 4GKKE 4KHPI 4DR6E 1IBKE 3PYDA 4JI2I 2V2VA 2X36A 4DXLA 5IWAE 2WW4A 1XHKA 3QT7A 1FKAE 4DR6I 5LMUI 5A2QC 4FWGA 4DU8A 2IOQA 4JI3I 2UU9E 1EI1A 3T1YE 4KQVA 4DUZI 3K85A 4YY3E 2Z5BB 5FWKA 3JAMC 4DR7E 1XNQI 2Q2EB 4DR4I 1B63A 3J7AM 4UTGA 4JI4E 1NHIA 4AQYI 4B3RE 4DV0I 1Y4UA 1KKHA 4WUCA 3ZZTA 4B3RI 1MU5A 2ZM6I 4LFBE 1Z59A 2UUAE 1Z5AA 3H4LA 4X62I 1XMOI 4JI1I 4DV2I 1IBME 3K17A 3GONA 2HHHI 1EA6A 2A2CA 1RREA 4RPFA 4K0KE 3V5RA 4NXNE 4FWHA 3OTOE 4DPYA 4DR3I 3F0NA 4Z7CA 4LF6E 1XNQE 1VISA 3K1JA 1XMQI 4DPUA 2BV3A 2E5LI 5IT9C 1I94E 1XMQE 4DV1E 1H7SA 4B3SE 2CZ9A 3T1HE 4DV5E 4X64I 1NHJA 4WUBA 2R3VA 4FW9A 4X65I 1Z0GA 2F4VE 3D4JA 4DV4I 3PYGA 2HHHE 1Z0VA 2IOPA 5L3JA 5GMDA 1ZM2A 2A2DA 4LFAI 1ZM4A 4GKJE 4DPXA 2E1RA 2UUCE 3PRYA 4X66I 4DUYE 2HFSA 4LF5I 1FJGI 3ZZUA 1D6TA 2UXBE 4HY1A 3LPSA 2XEXA 2BM0A 3ZZ0A 2VQFI 3J7AG 2R42A 3PYFA 2E5LE 2CG9A 4JI4I 4DV1I 4DR2I 4B3SI 2CGEA 4DR7I 4OX9I 2UXCE 3Q6MA 3Q1QA 2O1WA 1BKNA 4EMDA 4OX9E 1USVA 1KTVA 2UUBI 4JG4A 2UU9I 1Y6ZA 5FLXC 1A6FA 2Z5EA 2HK2A 5BR8I 1QZRA 4JI0E 4X62E 1ZM9A 1HK7A 4DV7I 2HKEA 4ZVIA 1Z0CA 2NPFA 3WU6A 5BR8E 1Z5CA 3M6AA 2V2QA 3B78A 1IBMI 1H72C 1NHHA 4DR3E 4UT4A 2VQFE 1N34E 4LF9I 2ZBKB 4IZJB 1IBLE 3P06A 4IZJA 4MYTA 4NXME 1N34I 3ZKBA 1HNXE 1Z0TA 3PYEA 1ZXMA 1XNRI 2O1UA 4JI5I 4LFBI 3LTOA 4DU7A 4DR4E 4B3TE 4PU9A 2O1TA 1NZ0A 4DR1E 1RR9A 2EFGA 4GKKI 1Y4SA 1Z0BA 2Z5BA 2UXDI 4PRVA 1K47A 1USUA 4USKA 4LF4E 2GQ0A 1FI4A 1KIJA 2X7IA 2DEIA 4LF8E 4X66E 3CWVA 2OI2A 2PNLA 4YY3I 4JYAE 3J81Q 2PNMA 4WUDA 1N36I 2HK3A 1Z0EA 4NXMI 1HNXI 4DV3I 2V8PA 3V2UC 1FJGE 1MX0A 4NXNI 2HFUA 1N36E 4JI5E 2GS8A 4IZKA 4XTJA 4DV0E 4IZKB 5LL6R 4DV5I 1OJ4A 1HNZE 1Z0WA 2V2ZA 2F4VI 1U2RA 4JV5E 2Z5CA 2J7KA 4HACA 2UUAI 2ZM6E 1N32E 1B62A 4HACB 1H7UA 3T1YI 1IBKI 4LFAE 4LF7E 3T1HI 3WU5A 2V34A 4X64E 2ZITA 2UUBE 3B82A 1DARA 3B8HA 3WU3A 4JI7I 4JI0I 1ELOA 4DV7E 4JI3E 5IT9Q 3ZKDA 4HXZA 4B3MI 4JI7E 4DUZE 5LMUE 4LF6I 1FWLA 1MG7A 4P52A 1HR0E 4B3ME 4Z7YA 1ZXNA 4DV6I 4DPWA 3QT8A 1HR0I 1N33I 1FNMA 5A2QQ 1PKPA 2LJPA 4KHPE 4R1FA 4P7AA 4DR1I 2O1VA 4N3OA 4X65E 2HKJA 1N32I 3QT6A 4K0KI 4LF7I 4JI6I 3JAMQ 3HJCA 4LF9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E E;  4DR5 E;  1HNW I;  4FWD A;  4HYM A;  5GME A;  3ZM7 A;  1ZM3 A;  1J5E I;  4LF5 E;  4DUY I;  4M1K A;  4URL A;  3OTO I;  1N0V C;  2VQE I;  4DV6 E;  2AJ4 A;  4JI8 E;  4YHH I;  1Z5B A;  4DR2 E;  4DV3 E;  3J80 C;  4DV4 E;  1PVG A;  4JI8 I;  4YHH E;  4LF4 I;  4PRX A;  4LFC I;  3J81 C;  4USM A;  1H74 A;  1N0U A;  3LNU A;  4DV2 E;  1XMO E;  4JI1 E;  4JI6 E;  4LF8 I;  1HNZ I;  3HUL A;  4JYA I;  1UEK A;  4B3T I;  4DR5 I;  3QT5 A;  1HNW E;  4ED4 A;  5IWA I;  2UXD E;  5FLX Q;  2UUC I;  4DPT A;  3J80 Q;  5LMN E;  2VQE E;  1IBL I;  1WUU A;  4GKJ I;  2UXB I;  1KVK A;  5LMN I;  2BM1 A;  2DEJ A;  1PIE A;  1XNR E;  1S4E A;  3WU4 A;  4MYU A;  2VF3 A;  1I94 I;  1H73 A;  1N33 E;  4LFC E;  1FWK A;  4AQY E;  4FN5 A;  2UXC I;  4JI2 E;  4JV5 I;  4I3H A;  1S16 A;  4GKK E;  4KHP I;  4DR6 E;  1IBK E;  3PYD A;  4JI2 I;  2V2V A;  2X36 A;  4DXL A;  5IWA E;  2WW4 A;  1XHK A;  3QT7 A;  1FKA E;  4DR6 I;  5LMU I;  5A2Q C;  4FWG A;  4DU8 A;  4JI3 I;  2UU9 E;  1EI1 A;  3T1Y E;  4KQV A;  4DUZ I;  4YY3 E;  3JAM C;  4DR7 E;  1XNQ I;  2Q2E B;  4DR4 I;  1B63 A;  3J7A M;  4UTG A;  4JI4 E;  1NHI A;  4AQY I;  4B3R E;  4DV0 I;  1KKH A;  4WUC A;  3ZZT A;  4B3R I;  1MU5 A;  2ZM6 I;  4LFB E;  1Z59 A;  2UUA E;  1Z5A A;  3H4L A;  4X62 I;  1XMO I;  4JI1 I;  4DV2 I;  1IBM E;  3K17 A;  3GON A;  2HHH I;  1EA6 A;  2A2C A;  1RRE A;  4RPF A;  4K0K E;  3V5R A;  4NXN E;  4FWH A;  3OTO E;  4DPY A;  4DR3 I;  3F0N A;  4Z7C A;  4LF6 E;  1XNQ E;  1VIS A;  3K1J A;  1XMQ I;  4DPU A;  2BV3 A;  2E5L I;  5IT9 C;  1I94 E;  1XMQ E;  4DV1 E;  1H7S A;  4B3S E;  2CZ9 A;  3T1H E;  4DV5 E;  4X64 I;  1NHJ A;  4WUB A;  2R3V A;  4FW9 A;  4X65 I;  1Z0G A;  2F4V E;  3D4J A;  4DV4 I;  3PYG A;  2HHH E;  1Z0V A;  5L3J A;  5GMD A;  1ZM2 A;  2A2D A;  4LFA I;  1ZM4 A;  4GKJ E;  4DPX A;  2E1R A;  2UUC E;  4X66 I;  4DUY E;  2HFS A;  4LF5 I;  1FJG I;  3ZZU A;  1D6T A;  2UXB E;  4HY1 A;  3LPS A;  2XEX A;  2BM0 A;  3ZZ0 A;  2VQF I;  3J7A G;  2R42 A;  3PYF A;  2E5L E;  4JI4 I;  4DV1 I;  4DR2 I;  4B3S I;  4DR7 I;  4OX9 I;  2UXC E;  3Q1Q A;  1BKN A;  4EMD A;  4OX9 E;  1KTV A;  2UUB I;  4JG4 A;  2UU9 I;  5FLX C;  1A6F A;  2HK2 A;  5BR8 I;  1QZR A;  4JI0 E;  4X62 E;  1ZM9 A;  4DV7 I;  2HKE A;  4ZVI A;  1Z0C A;  2NPF A;  3WU6 A;  5BR8 E;  1Z5C A;  3M6A A;  2V2Q A;  3B78 A;  1IBM I;  1H72 C;  1NHH A;  4DR3 E;  4UT4 A;  2VQF E;  1N34 E;  4LF9 I;  2ZBK B;  1IBL E;  4MYT A;  4NXM E;  1N34 I;  3ZKB A;  1HNX E;  1Z0T A;  3PYE A;  1ZXM A;  1XNR I;  4JI5 I;  4LFB I;  3LTO A;  4DU7 A;  4DR4 E;  4B3T E;  4PU9 A;  1NZ0 A;  4DR1 E;  1RR9 A;  2EFG A;  4GKK I;  1Z0B A;  2UXD I;  4PRV A;  1K47 A;  4USK A;  4LF4 E;  1FI4 A;  1KIJ A;  2X7I A;  2DEI A;  4LF8 E;  4X66 E;  3CWV A;  2OI2 A;  4YY3 I;  4JYA E;  3J81 Q;  4WUD A;  1N36 I;  2HK3 A;  1Z0E A;  4NXM I;  1HNX I;  4DV3 I;  2V8P A;  3V2U C;  1FJG E;  1MX0 A;  4NXN I;  2HFU A;  1N36 E;  4JI5 E;  2GS8 A;  4XTJ A;  4DV0 E;  5LL6 R;  4DV5 I;  1OJ4 A;  1HNZ E;  1Z0W A;  2V2Z A;  2F4V I;  1U2R A;  4JV5 E;  2J7K A;  4HAC A;  2UUA I;  2ZM6 E;  1N32 E;  1B62 A;  4HAC B;  1H7U A;  3T1Y I;  1IBK I;  4LFA E;  4LF7 E;  3T1H I;  3WU5 A;  2V34 A;  4X64 E;  2ZIT A;  2UUB E;  3B82 A;  1DAR A;  3B8H A;  3WU3 A;  4JI7 I;  4JI0 I;  1ELO A;  4DV7 E;  4JI3 E;  5IT9 Q;  3ZKD A;  4HXZ A;  4B3M I;  4JI7 E;  4DUZ E;  5LMU E;  4LF6 I;  1FWL A;  1MG7 A;  4P52 A;  1HR0 E;  4B3M E;  4Z7Y A;  1ZXN A;  4DV6 I;  4DPW A;  3QT8 A;  1HR0 I;  1N33 I;  1FNM A;  5A2Q Q;  1PKP A;  2LJP A;  4KHP E;  4R1F A;  4P7A A;  4DR1 I;  4X65 E;  2HKJ A;  1N32 I;  3QT6 A;  4K0K I;  4LF7 I;  4JI6 I;  3JAM Q;  4LF9 E; 
#chains in the Genus database with same CATH topology
 4MU1 A;  1J5E E;  4DR5 E;  1HNW I;  4FWD A;  4LOM A;  4HYM A;  5GME A;  3PS3 A;  1UDS A;  3ZM7 A;  2PO1 A;  1ZM3 A;  1J5E I;  3Q6N A;  1OYR A;  4LF5 E;  4DUY I;  4M1K A;  4URL A;  3OTO I;  1N0V C;  2VQE I;  2JEB A;  2F1D A;  4DV6 E;  2NN6 A;  2AJ4 A;  4JI8 E;  4YHH I;  2NN6 B;  1Z5B A;  4MU3 A;  4DR2 E;  4DV3 E;  5C0X E;  3J80 C;  4DV4 E;  3GLL A;  1PVG A;  3L7Z A;  1Y60 A;  4U3D A;  4JI8 I;  4YHH E;  4OO1 E;  4LF4 I;  4PRX A;  4LFC I;  3J81 C;  2JEA A;  2BA1 D;  4USM A;  1H74 A;  1N0U A;  3LNU A;  4DV2 E;  1XMO E;  4JI1 E;  4JI6 E;  4LF8 I;  2Z5C B;  1HNZ I;  3HUL A;  4JYA I;  1UEK A;  4BA1 B;  4B3T I;  4DR5 I;  3QT5 A;  1HNW E;  5JEA E;  4ED4 A;  5IWA I;  5K36 E;  5EKW A;  2UXD E;  4IZJ D;  5FLX Q;  2UUC I;  4DPT A;  2PNZ B;  3M7N G;  4IFD B;  3J80 Q;  5LMN E;  2VQE E;  2NN6 D;  1IBL I;  1WUU A;  4GKJ I;  2UXB I;  1KVK A;  5LMN I;  2BM1 A;  2DEJ A;  1PIE A;  1XNR E;  2WNR B;  1S4E A;  3WU4 A;  5JEA F;  1R6M A;  4MYU A;  2NN6 E;  2VF3 A;  1I94 I;  1H73 A;  1N33 E;  3GCM A;  4LCH A;  4LFC E;  1FWK A;  4AQY E;  3HKM A;  4FN5 A;  4GQU A;  2UXC I;  4JI2 E;  2C38 B;  4JV5 I;  2PO1 B;  4I3H A;  2BA0 D;  1S16 A;  1XXE A;  4GKK E;  4KHP I;  4DR6 E;  1IBK E;  3PYD A;  4JI2 I;  3DD6 A;  2V2V A;  2X36 A;  4DXL A;  5IWA E;  2WW4 A;  1XHK A;  3QT7 A;  1FKA E;  4DR6 I;  1YHC A;  5LMU I;  5A2Q C;  4FWG A;  4DU8 A;  2IOQ A;  4JI3 I;  1UDO A;  2AE8 A;  4U3B A;  2UU9 E;  2C37 A;  1EI1 A;  4MU0 A;  3T1Y E;  2C37 B;  4KQV A;  4DUZ I;  3K85 A;  4YY3 E;  2Z5B B;  2JEA B;  3M85 D;  5FWK A;  4QNJ A;  3JAM C;  3UHM A;  1XNQ I;  2Q2E B;  4DR7 E;  4DR4 I;  2BR2 A;  1B63 A;  3J7A M;  3P3E A;  3NZK A;  5EL9 A;  4MDT A;  4UTG A;  4JI4 E;  1NHI A;  5K36 C;  4AQY I;  5JEA C;  4B3R E;  4DV0 I;  1Y4U A;  4NBQ A;  1KKH A;  4WUC A;  3ZZT A;  4B3R I;  2PNZ A;  4IFD A;  1UDQ A;  1MU5 A;  5DRP A;  2JE6 B;  2ZM6 I;  4LFB E;  1Z59 A;  2UUA E;  1Z5A A;  3H4L A;  5JEA A;  4X62 I;  4JI1 I;  4DV2 I;  1XMO I;  1IBM E;  3K17 A;  3GON A;  2HHH I;  1EA6 A;  2A2C A;  1RRE A;  5K36 B;  2C39 A;  4RPF A;  4K0K E;  3V5R A;  4NXN E;  2C39 B;  4FWH A;  5C0X F;  1VI7 A;  5DRO A;  5C0X A;  3OTO E;  4DPY A;  4DR3 I;  5DRR A;  2C38 A;  3F0N A;  3P3C A;  4Z7C A;  4LF6 E;  1XNQ E;  4OKG A;  1VIS A;  3K1J A;  1XMQ I;  4DPU A;  2BV3 A;  4BA2 A;  4BA2 B;  1E3P A;  2E5L I;  1UDN A;  5IT9 C;  1XMQ E;  1I94 E;  4DV1 E;  1H7S A;  4B3S E;  2CZ9 A;  3B4T A;  3H1C A;  3T1H E;  4DV5 E;  4X64 I;  3U1K A;  1NHJ A;  4WUB A;  4OO1 A;  2R3V A;  4FW9 A;  4X65 I;  1Z0G A;  2F4V E;  3D4J A;  4LCF A;  4DV4 I;  4LCG A;  2JEB B;  3PYG A;  2HHH E;  2IER A;  1Z0V A;  2IOP A;  2NN6 F;  5L3J A;  5GMD A;  1ZM2 A;  2A2D A;  4LFA I;  1ZM4 A;  4GKJ E;  1P42 A;  4DPX A;  2E1R A;  2UUC E;  3M7N D;  3PRY A;  4X66 I;  4DUY E;  2HFS A;  2PO2 A;  4LF5 I;  1FJG I;  3ZZU A;  4LPF A;  1D6T A;  2UXB E;  4HY1 A;  3LPS A;  2XEX A;  2BM0 A;  2JT2 A;  4FW3 A;  3ZZ0 A;  2VQF I;  3J7A G;  2WP8 B;  2R42 A;  5K36 D;  2JE6 A;  3PYF A;  2E5L E;  2CG9 A;  4JI4 I;  4DV1 I;  4DR2 I;  4B3S I;  2CGE A;  4DR7 I;  4OX9 I;  2BA1 G;  4OO1 F;  2UXC E;  3Q6M A;  4J3D A;  3Q1Q A;  2O1W A;  3PS2 A;  1BKN A;  5K36 A;  4EMD A;  4OX9 E;  1USV A;  1KTV A;  2UUB I;  4JG4 A;  2UU9 I;  1Y6Z A;  5FLX C;  1A6F A;  4MQY A;  2Z5E A;  2HK2 A;  5BR8 I;  4IFD C;  4AIM A;  1QZR A;  4IFD D;  4JI0 E;  4AM3 A;  4IS9 A;  4X62 E;  1ZM9 A;  1HK7 A;  4DV7 I;  2HKE A;  4ZVI A;  1Z0C A;  2NPF A;  2WNR A;  3WU6 A;  5BR8 E;  5C0X D;  1Z5C A;  3M6A A;  2V2Q A;  3B78 A;  3P3G A;  1IBM I;  1H72 C;  1NHH A;  4DR3 E;  4UT4 A;  2VQF E;  1N34 E;  5C0X B;  4LF9 I;  2ZBK B;  4IZJ B;  3U1Y A;  1IBL E;  3P06 A;  4OO1 B;  4IZJ A;  2GO3 A;  4MYT A;  4NXM E;  1N34 I;  3ZKB A;  1HNX E;  1Z0T A;  3PYE A;  4ISA A;  1ZXM A;  2IES A;  2O1U A;  1XNR I;  4JI5 I;  4LFB I;  3LTO A;  5DNX A;  2GO4 A;  4DU7 A;  2NN6 C;  1E3H A;  2CVE A;  4DR4 E;  5K36 F;  4B3T E;  4PU9 A;  2O1T A;  1NZ0 A;  4DR1 E;  1RR9 A;  4QNK A;  2EFG A;  4GKK I;  2PO0 B;  4FW5 A;  2J65 A;  1Y4S A;  1Z0B A;  2Z5B A;  3CDJ A;  2UXD I;  4PRV A;  1K47 A;  4IFD E;  1USU A;  4USK A;  4LF4 E;  2GQ0 A;  1FI4 A;  1KIJ A;  2X7I A;  5ELW A;  2DEI A;  3M85 G;  4LF8 E;  4X66 E;  1R6L A;  3CWV A;  2OI2 A;  2PNL A;  4YY3 I;  4JYA E;  3J81 Q;  1OYP A;  2PNM A;  4WUD A;  2PO2 B;  1N36 I;  2HK3 A;  1Z0E A;  4NXM I;  1HNX I;  4DV3 I;  2V8P A;  3V2U C;  1FJG E;  2WP8 A;  1MX0 A;  4NXN I;  2HFU A;  1N36 E;  4JI5 E;  2GS8 A;  4OO1 D;  4IZK A;  1RHY A;  4XTJ A;  4OO1 C;  4DV0 E;  4IZK B;  5LL6 R;  2VES A;  5C0X C;  4DV5 I;  4FW4 A;  1OJ4 A;  3KRN A;  4FW7 A;  1HNZ E;  1Z0W A;  2V2Z A;  2F4V I;  1U2R A;  2BA0 G;  4JV5 E;  2Z5C A;  2J7K A;  4HAC A;  2UUA I;  2ZM6 E;  1N32 E;  1B62 A;  2BR2 B;  4HAC B;  1H7U A;  4BA1 A;  3T1Y I;  1IBK I;  4LFA E;  4LF7 E;  3T1H I;  3WU5 A;  5DRQ A;  2V34 A;  4X64 E;  2ZIT A;  2UUB E;  3B82 A;  1DAR A;  3B8H A;  3L7Z B;  3WU3 A;  4JI7 I;  4JI0 I;  1ELO A;  4DV7 E;  4JI3 E;  5IT9 Q;  3ZKD A;  4HXZ A;  4B3M I;  4JI7 E;  4DUZ E;  1YH8 A;  3GME A;  3P76 A;  5LMU E;  4LF6 I;  5JEA B;  1FWL A;  1MG7 A;  2PO0 A;  4P52 A;  4OZE A;  1HR0 E;  4B3M E;  4Z7Y A;  1ZXN A;  2O3Z A;  4DV6 I;  4DPW A;  3QT8 A;  1HR0 I;  5JEA D;  1N33 I;  1FNM A;  5A2Q Q;  1PKP A;  4IFD F;  1OYS A;  2LJP A;  3CDI A;  4MU4 A;  4KHP E;  4R1F A;  4P7A A;  5DNL A;  4DR1 I;  4FW6 A;  2O1V A;  4N3O A;  4X65 E;  2HKJ A;  1N32 I;  3QT6 A;  4K0K I;  4LF7 I;  3PS1 A;  1Y5Y A;  4JI6 I;  3JAM Q;  3HJC A;  4AID A;  4LF9 E; 
#chains in the Genus database with same CATH homology
 1J5E E;  4DR5 E;  1HNW I;  4FWD A;  4HYM A;  5GME A;  3ZM7 A;  1ZM3 A;  1J5E I;  3Q6N A;  4LF5 E;  4DUY I;  4M1K A;  4URL A;  3OTO I;  1N0V C;  2VQE I;  4DV6 E;  2AJ4 A;  4JI8 E;  4YHH I;  1Z5B A;  4DR2 E;  4DV3 E;  3J80 C;  4DV4 E;  1PVG A;  4JI8 I;  4YHH E;  4LF4 I;  4PRX A;  4LFC I;  3J81 C;  4USM A;  1H74 A;  1N0U A;  3LNU A;  4DV2 E;  1XMO E;  4JI1 E;  4JI6 E;  4LF8 I;  2Z5C B;  1HNZ I;  3HUL A;  4JYA I;  1UEK A;  4B3T I;  4DR5 I;  3QT5 A;  1HNW E;  4ED4 A;  5IWA I;  2UXD E;  4IZJ D;  5FLX Q;  2UUC I;  4DPT A;  3J80 Q;  5LMN E;  2VQE E;  1IBL I;  1WUU A;  4GKJ I;  2UXB I;  1KVK A;  5LMN I;  2BM1 A;  2DEJ A;  1PIE A;  1XNR E;  1S4E A;  3WU4 A;  4MYU A;  2VF3 A;  1I94 I;  1H73 A;  1N33 E;  4LFC E;  1FWK A;  4AQY E;  4FN5 A;  2UXC I;  4JI2 E;  4JV5 I;  4I3H A;  1S16 A;  4GKK E;  4KHP I;  4DR6 E;  1IBK E;  3PYD A;  4JI2 I;  2V2V A;  2X36 A;  4DXL A;  5IWA E;  2WW4 A;  1XHK A;  3QT7 A;  1FKA E;  4DR6 I;  5LMU I;  5A2Q C;  4FWG A;  4DU8 A;  2IOQ A;  4JI3 I;  2UU9 E;  1EI1 A;  3T1Y E;  4KQV A;  4DUZ I;  3K85 A;  4YY3 E;  2Z5B B;  5FWK A;  3JAM C;  4DR7 E;  1XNQ I;  2Q2E B;  4DR4 I;  1B63 A;  3J7A M;  4UTG A;  4JI4 E;  1NHI A;  4AQY I;  4B3R E;  4DV0 I;  1Y4U A;  1KKH A;  4WUC A;  3ZZT A;  4B3R I;  1MU5 A;  2ZM6 I;  4LFB E;  1Z59 A;  2UUA E;  1Z5A A;  3H4L A;  4X62 I;  1XMO I;  4JI1 I;  4DV2 I;  1IBM E;  3K17 A;  3GON A;  2HHH I;  1EA6 A;  2A2C A;  1RRE A;  4RPF A;  4K0K E;  3V5R A;  4NXN E;  4FWH A;  3OTO E;  4DPY A;  4DR3 I;  3F0N A;  4Z7C A;  4LF6 E;  1XNQ E;  1VIS A;  3K1J A;  1XMQ I;  4DPU A;  2BV3 A;  2E5L I;  5IT9 C;  1I94 E;  1XMQ E;  4DV1 E;  1H7S A;  4B3S E;  2CZ9 A;  3T1H E;  4DV5 E;  4X64 I;  1NHJ A;  4WUB A;  2R3V A;  4FW9 A;  4X65 I;  1Z0G A;  2F4V E;  3D4J A;  4DV4 I;  3PYG A;  2HHH E;  1Z0V A;  2IOP A;  5L3J A;  5GMD A;  1ZM2 A;  2A2D A;  4LFA I;  1ZM4 A;  4GKJ E;  4DPX A;  2E1R A;  2UUC E;  3PRY A;  4X66 I;  4DUY E;  2HFS A;  4LF5 I;  1FJG I;  3ZZU A;  1D6T A;  2UXB E;  4HY1 A;  3LPS A;  2XEX A;  2BM0 A;  3ZZ0 A;  2VQF I;  3J7A G;  2R42 A;  3PYF A;  2E5L E;  2CG9 A;  4JI4 I;  4DV1 I;  4DR2 I;  4B3S I;  2CGE A;  4DR7 I;  4OX9 I;  2UXC E;  3Q6M A;  3Q1Q A;  2O1W A;  1BKN A;  4EMD A;  4OX9 E;  1USV A;  1KTV A;  2UUB I;  4JG4 A;  2UU9 I;  1Y6Z A;  5FLX C;  1A6F A;  2Z5E A;  2HK2 A;  5BR8 I;  1QZR A;  4JI0 E;  4X62 E;  1ZM9 A;  1HK7 A;  4DV7 I;  2HKE A;  4ZVI A;  1Z0C A;  2NPF A;  3WU6 A;  5BR8 E;  1Z5C A;  3M6A A;  2V2Q A;  3B78 A;  1IBM I;  1H72 C;  1NHH A;  4DR3 E;  4UT4 A;  2VQF E;  1N34 E;  4LF9 I;  2ZBK B;  4IZJ B;  1IBL E;  3P06 A;  4IZJ A;  4MYT A;  4NXM E;  1N34 I;  3ZKB A;  1HNX E;  1Z0T A;  3PYE A;  1ZXM A;  1XNR I;  2O1U A;  4JI5 I;  4LFB I;  3LTO A;  4DU7 A;  4DR4 E;  4B3T E;  4PU9 A;  2O1T A;  1NZ0 A;  4DR1 E;  1RR9 A;  2EFG A;  4GKK I;  1Y4S A;  1Z0B A;  2Z5B A;  2UXD I;  4PRV A;  1K47 A;  1USU A;  4USK A;  4LF4 E;  2GQ0 A;  1FI4 A;  1KIJ A;  2X7I A;  2DEI A;  4LF8 E;  4X66 E;  3CWV A;  2OI2 A;  2PNL A;  4YY3 I;  4JYA E;  3J81 Q;  2PNM A;  4WUD A;  1N36 I;  2HK3 A;  1Z0E A;  4NXM I;  1HNX I;  4DV3 I;  2V8P A;  3V2U C;  1FJG E;  1MX0 A;  4NXN I;  2HFU A;  1N36 E;  4JI5 E;  2GS8 A;  4IZK A;  4XTJ A;  4DV0 E;  4IZK B;  5LL6 R;  4DV5 I;  1OJ4 A;  1HNZ E;  1Z0W A;  2V2Z A;  2F4V I;  1U2R A;  4JV5 E;  2Z5C A;  2J7K A;  4HAC A;  2UUA I;  2ZM6 E;  1N32 E;  1B62 A;  4HAC B;  1H7U A;  3T1Y I;  1IBK I;  4LFA E;  4LF7 E;  3T1H I;  3WU5 A;  2V34 A;  4X64 E;  2ZIT A;  2UUB E;  3B82 A;  1DAR A;  3B8H A;  3WU3 A;  4JI7 I;  4JI0 I;  1ELO A;  4DV7 E;  4JI3 E;  5IT9 Q;  3ZKD A;  4HXZ A;  4B3M I;  4JI7 E;  4DUZ E;  5LMU E;  4LF6 I;  1FWL A;  1MG7 A;  4P52 A;  1HR0 E;  4B3M E;  4Z7Y A;  1ZXN A;  4DV6 I;  4DPW A;  3QT8 A;  1HR0 I;  1N33 I;  1FNM A;  5A2Q Q;  1PKP A;  2LJP A;  4KHP E;  4R1F A;  4P7A A;  4DR1 I;  2O1V A;  4N3O A;  4X65 E;  2HKJ A;  1N32 I;  3QT6 A;  4K0K I;  4LF7 I;  4JI6 I;  3JAM Q;  3HJC A;  4LF9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...