4B3SI

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3sI00
2HKEA 3JAMC 4DV5E 2A2DA 3WU4A 4JI2E 3QT5A 3JAMQ 4DPYA 2UUAE 1IBME 1N0VC 4DV2E 4K0KI 2UXDE 1XNQI 4DUYI 4MYUA 4JV5E 4B3SE 4YHHE 4LF8I 2HFUA 3PYFA 2BV3A 2UUCI 4JI7I 5LMNE 1NHJA 4Z7CA 4LFCE 3K17A 4USKA 2VQEI 4NXNE 2UUBE 4DV6E 2HK3A 4PU9A 5GMDA 2UU9I 1Z5AA 1MG7A 1MX0A 1DARA 1KIJA 4JYAE 2ZBKB 4X62I 1D6TA 4DR4E 1XHKA 1Z0WA 2NPFA 4NXME 5IT9Q 4RPFA 3D4JA 4FW9A 5BR8I 1FWKA 4DPWA 1OJ4A 4WUBA 3ZZTA 1N36E 3PYGA 4JI6I 4DPTA 2F4VI 4JI6E 1H7UA 4WUDA 4JI0E 2HFSA 3LNUA 1HNWI 1IBLI 4B3TI 2EFGA 4DR6E 4LFBE 3J81Q 4FN5A 4NXMI 1ZXMA 1MU5A 4HXZA 4X65I 4YY3E 1XMQI 4B3RE 2CZ9A 1N34I 4HACB 2V8PA 2V34A 1Z5CA 1WUUA 2VQFI 2UXCE 4B3RI 4P52A 4DR7I 4WUCA 4DPUA 1J5EI 3J7AM 1B62A 1FJGE 1ELOA 1J5EE 1Z0GA 4JI8E 1IBLE 4DR7E 4JI4I 2V2ZA 3QT8A 2UXDI 4FWHA 3T1YI 2UXBE 5IWAI 5FLXC 2GS8A 3J80Q 4JI2I 1XMOI 1H72C 1N34E 2BM0A 1EA6A 1ZM2A 5BR8E 1NHHA 3OTOE 1QZRA 1Z0BA 4LFAE 4GKKE 1XNRE 1KVKA 3J7AG 4LFAI 1HNWE 2V2VA 4JYAI 3B82A 3PYEA 2A2CA 4B3TE 1Z0CA 3T1YE 4DV7I 3QT6A 3PYDA 2UU9E 4JI0I 3LPSA 1PKPA 3CWVA 4DR3I 2R3VA 3V2UC 4URLA 3ZKDA 4JI7E 4X64I 4DUZI 4AQYE 1FJGI 2ZM6E 4JI5E 4DR4I 3F0NA 4GKKI 4X62E 3B8HA 3OTOI 4DU7A 4P7AA 2UUAI 2E1RA 1Z0VA 2BM1A 5A2QC 5LL6R 5IWAE 2HKJA 2UUBI 2DEJA 2DEIA 1FI4A 4Z7YA 4YY3I 1HNZI 5LMNI 1I94E 3QT7A 2R42A 4ED4A 1XMQE 1B63A 4JI4E 4DR6I 4NXNI 2OI2A 5A2QQ 4B3SI 4USMA 4JI5I 1FNMA 4LFBI 4X64E 5LMUE 4DUZE 1Z5BA 4X66I 4HYMA 4YHHI 1IBMI 1Z59A 2X36A 1H74A 4JI1I 1HR0I 4LF6E 2VQFE 2F4VE 4DV7E 4DV0I 4DV2I 4JG4A 1N36I 5L3JA 3LTOA 1HNXE 4DV4E 4HY1A 4X65E 2J7KA 1ZM3A 4OX9E 2Q2EB 1IBKE 1K47A 2HK2A 1XMOE 1Z0EA 2WW4A 4DXLA 2UXBI 4LF9I 1BKNA 3ZZUA 2UUCE 4DV3I 3WU3A 4I3HA 4JI8I 4ZVIA 4LFCI 1KKHA 2ZITA 2AJ4A 3J80C 2VF3A 1RR9A 3B78A 1N32E 3ZM7A 4LF9E 1XNQE 4B3MI 2HHHI 4KQVA 1PIEA 1PVGA 4DUYE 1U2RA 2UXCI 4DU8A 1ZXNA 5GMEA 4K0KE 1S16A 4PRVA 3Q1QA 4DR2I 4MYTA 4DR5E 4DV5I 4DV4I 1ZM4A 1KTVA 4LF5E 1N33I 3WU5A 4KHPE 4UT4A 4DV0E 1FWLA 1FKAE 4LF8E 3T1HE 1NZ0A 4DV1I 4LF7E 5FLXQ 1Z0TA 4X66E 3J81C 2HHHE 5LMUI 3GONA 4DV1E 2LJPA 4UTGA 4LF7I 3V5RA 1EI1A 3ZKBA 1H73A 3ZZ0A 4LF5I 1N33E 1S4EA 1HNZE 4LF4I 4XTJA 4DR2E 4DR5I 1VISA 1N0UA 4GKJI 1IBKI 4GKJE 4B3ME 5IT9C 4LF4E 1NHIA 1UEKA 4EMDA 2V2QA 4HACA 4OX9I 4DPXA 4JI3I 4DR1E 4DV6I 2E5LI 2VQEE 2X7IA 2ZM6I 3H4LA 1N32I 4FWGA 4AQYI 4PRXA 4DR3E 1A6FA 2E5LE 4DR1I 4JI3E 4DV3E 4M1KA 4JV5I 3WU6A 3HULA 1HR0E 4JI1E 4LF6I 1H7SA 3K1JA 3M6AA 4R1FA 1XNRI 1ZM9A 1RREA 3T1HI 1HNXI 2XEXA 4KHPI 1I94I 4FWDA
chains in the Genus database with same CATH superfamily
4LPFA 2O1UA 2HKEA 3JAMC 4DV5E 2A2DA 3WU4A 4JI2E 3B4TA 3QT5A 5ELWA 5C0XF 4LCFA 3JAMQ 4DPYA 5K36B 2UUAE 1IBME 1N0VC 4DV2E 1Y6ZA 4K0KI 3UHMA 2UXDE 1XNQI 4DUYI 5K36E 4MYUA 4JV5E 4B3SE 4YHHE 4LF8I 2HFUA 4FW3A 3P3GA 3PYFA 2BV3A 2UUCI 3M7ND 4AIMA 4JI7I 5LMNE 1E3HA 1NHJA 4Z7CA 4LFCE 3K17A 4USKA 2VQEI 4NXNE 2UUBE 3U1YA 1XXEA 4DV6E 2HK3A 4PU9A 5GMDA 4BA1A 4IFDA 2UU9I 1Z5AA 1MG7A 1R6LA 4LCGA 1MX0A 3PRYA 4MU0A 1UDQA 4QNKA 2IESA 2PO0A 4OO1D 1DARA 4GQUA 1KIJA 4JYAE 5C0XC 2Z5BB 3Q6MA 3P3CA 2ZBKB 4X62I 1D6TA 4DR4E 1XHKA 1Z0WA 2NPFA 4NXME 3CDIA 5IT9Q 4RPFA 3D4JA 4FW9A 5BR8I 1FWKA 4DPWA 1OJ4A 5K36D 4WUBA 1OYSA 3ZZTA 2JEBB 2BR2A 1N36E 3PYGA 4JI6I 4U3BA 4DPTA 4AIDA 2F4VI 2PNZA 1H7UA 4JI6E 4WUDA 4JI0E 5EKWA 2HFSA 3LNUA 1HNWI 1IBLI 4B3TI 2EFGA 2WP8A 3KRNA 1YH8A 4IZJB 5DROA 4DR6E 4LFBE 3J81Q 4FN5A 4NXMI 4FW7A 2JEAB 5JEAC 1ZXMA 1MU5A 4HXZA 4X65I 2NN6B 4YY3E 2NN6F 2PNZB 1XMQI 4B3RE 2CZ9A 5JEAB 1N34I 4HACB 4FW6A 2V8PA 2V34A 1Z5CA 1WUUA 4OZEA 2VQFI 1RHYA 2JE6A 2UXCE 4B3RI 4P52A 4IFDC 4DR7I 4WUCA 4DPUA 3Q6NA 1J5EI 3J7AM 1B62A 2F1DA 3GMEA 1FJGE 1ELOA 1J5EE 1Z0GA 3K85A 4JI8E 1IBLE 4DR7E 2WNRB 4JI4I 2V2ZA 3QT8A 2UXDI 4FWHA 1VI7A 4IFDB 3P76A 3T1YI 2UXBE 2J65A 5IWAI 4BA2B 5DNLA 2NN6A 2GS8A 5FLXC 1Y5YA 3J80Q 5K36C 4JI2I 1XMOI 1H72C 1N34E 2BM0A 1EA6A 1ZM2A 5K36F 5BR8E 1NHHA 3OTOE 1QZRA 1Z0BA 2C38B 4LFAE 4GKKE 1XNRE 1KVKA 3J7AG 4LFAI 1HNWE 4OO1A 2V2VA 2CVEA 4JYAI 2PNLA 4IZJD 1YHCA 3B82A 3DD6A 2A2CA 3PYEA 4B3TE 1Z0CA 3T1YE 4DV7I 3QT6A 2PO1B 3PYDA 4MU1A 2UU9E 4JI0I 1E3PA 3LPSA 1PKPA 3CWVA 3GLLA 5DNXA 3V2UC 2R3VA 4DR3I 4URLA 3ZKDA 4JI7E 2C37A 4MDTA 2WP8B 4X64I 4DUZI 4AQYE 1FJGI 5C0XB 2ZM6E 4U3DA 4JI5E 4DR4I 3F0NA 4GKKI 2WNRA 4X62E 2Z5CB 3B8HA 3OTOI 4DU7A 4P7AA 2O1VA 1HK7A 2UUAI 2E1RA 5DRPA 1Z0VA 2BM1A 4IS9A 5A2QC 5LL6R 2BA1G 5IWAE 2HKJA 2GQ0A 2GO4A 2UUBI 2DEJA 2DEIA 1FI4A 2NN6D 4Z7YA 4YY3I 1HNZI 5LMNI 1I94E 3QT7A 2R42A 4ED4A 1XMQE 1B63A 4JI4E 4J3DA 3H1CA 4DR6I 4NXNI 2OI2A 2Z5BA 2BR2B 5A2QQ 4B3SI 4USMA 4JI5I 1FNMA 3P06A 4LFBI 4X64E 5LMUE 4DUZE 4MU4A 1Z5BA 4FW4A 4X66I 4HYMA 4YHHI 1IBMI 1Z59A 2X36A 1H74A 4JI1I 1HR0I 4LF6E 2C39B 3L7ZB 2VQFE 2F4VE 4DV7E 4DV0I 4DV2I 4JG4A 3HJCA 1N36I 5L3JA 2O3ZA 3LTOA 1HNXE 3PS3A 4DV4E 4HY1A 4X65E 2BA1D 4BA1B 2J7KA 1ZM3A 4QNJA 1UDSA 5JEAD 4OX9E 1OYPA 2Q2EB 5K36A 2VESA 2C39A 2JEBA 1R6MA 1IBKE 4MU3A 1K47A 2HK2A 1XMOE 3HKMA 4LOMA 1Z0EA 2WW4A 4DXLA 4OO1F 2UXBI 3M7NG 2JE6B 4LF9I 2PO0B 4IZKA 1BKNA 1Y4UA 3ZZUA 2UUCE 4DV3I 3WU3A 4I3HA 1Y60A 4NBQA 4JI8I 4ZVIA 4LFCI 1KKHA 2ZITA 2AJ4A 3J80C 3GCMA 1UDNA 2VF3A 1RR9A 3B78A 1N32E 3ZM7A 4LF9E 1XNQE 4B3MI 2HHHI 2JT2A 4BA2A 2NN6E 4KQVA 1PIEA 4IZJA 2NN6C 3PS2A 1PVGA 4DUYE 5C0XD 1U2RA 2O1TA 5JEAE 3M85D 3L7ZA 2UXCI 4DU8A 1Y4SA 1ZXNA 5GMEA 2IERA 4K0KE 2PO1A 1S16A 1USVA 4PRVA 5C0XA 3Q1QA 5FWKA 4MYTA 4DR2I 4DR5E 5DRRA 4DV5I 4DV4I 1ZM4A 4OKGA 1KTVA 4LF5E 1N33I 2GO3A 3WU5A 4KHPE 4UT4A 4DV0E 1FWLA 1FKAE 4LF8E 3T1HE 1NZ0A 3PS1A 2IOPA 4DV1I 4LF7E 5FLXQ 2Z5EA 3U1KA 2CG9A 1Z0TA 4MQYA 4X66E 4IFDE 3J81C 2HHHE 4OO1B 5LMUI 3M85G 3CDJA 3GONA 4DV1E 2LJPA 4UTGA 2C38A 4LF7I 3V5RA 4IFDF 4OO1E 2C37B 2BA0D 1UDOA 1USUA 1EI1A 4N3OA 1H73A 3ZKBA 3ZZ0A 4LF5I 1N33E 1S4EA 4IFDD 1HNZE 4LF4I 4XTJA 4DR2E 4DR5I 4FW5A 2PNMA 2IOQA 4OO1C 1VISA 1N0UA 4GKJI 1IBKI 4GKJE 4B3ME 5IT9C 3NZKA 4LF4E 1NHIA 1UEKA 4EMDA 2V2QA 4HACA 4OX9I 4DPXA 4AM3A 4DR1E 4DV6I 4JI3I 2E5LI 5DRQA 5EL9A 2VQEE 2X7IA 5JEAF 2ZM6I 2O1WA 4IZKB 3H4LA 1N32I 4FWGA 4AQYI 4PRXA 4DR3E 2JEAA 5C0XE 1A6FA 2CGEA 1OYRA 1P42A 2E5LE 4DR1I 4JI3E 4DV3E 4ISAA 4M1KA 4JV5I 3WU6A 3HULA 1HR0E 4JI1E 4LF6I 5JEAA 1H7SA 3K1JA 2Z5CA 2PO2A 3M6AA 2PO2B 4R1FA 2BA0G 1XNRI 1ZM9A 3P3EA 1RREA 3T1HI 1HNXI 2XEXA 4KHPI 4LCHA 2AE8A 1I94I 4FWDA
chains in the Genus database with same CATH topology
2O1UA 2HKEA 3JAMC 4DV5E 2A2DA 3WU4A 4JI2E 3QT5A 3JAMQ 4DPYA 2UUAE 1IBME 1N0VC 4DV2E 1Y6ZA 4K0KI 2UXDE 1XNQI 4DUYI 4MYUA 4JV5E 4B3SE 4YHHE 4LF8I 2HFUA 3PYFA 2BV3A 2UUCI 4JI7I 5LMNE 1NHJA 4Z7CA 4LFCE 3K17A 4USKA 2VQEI 4NXNE 2UUBE 4DV6E 2HK3A 4PU9A 5GMDA 2UU9I 1Z5AA 1MG7A 1MX0A 3PRYA 1DARA 1KIJA 4JYAE 2Z5BB 3Q6MA 2ZBKB 4X62I 1D6TA 4DR4E 1XHKA 1Z0WA 2NPFA 4NXME 5IT9Q 4RPFA 3D4JA 4FW9A 5BR8I 1FWKA 4DPWA 1OJ4A 4WUBA 3ZZTA 1N36E 3PYGA 4JI6I 4DPTA 2F4VI 1H7UA 4JI6E 4WUDA 4JI0E 2HFSA 3LNUA 1HNWI 1IBLI 4B3TI 2EFGA 4IZJB 4DR6E 4LFBE 3J81Q 4FN5A 4NXMI 1ZXMA 1MU5A 4HXZA 4X65I 4YY3E 1XMQI 4B3RE 2CZ9A 1N34I 4HACB 2V8PA 2V34A 1Z5CA 1WUUA 2VQFI 2UXCE 4B3RI 4P52A 4DR7I 4WUCA 4DPUA 3Q6NA 1J5EI 3J7AM 1B62A 1FJGE 1ELOA 1J5EE 1Z0GA 3K85A 4JI8E 1IBLE 4DR7E 4JI4I 2V2ZA 3QT8A 2UXDI 4FWHA 3T1YI 2UXBE 5IWAI 5FLXC 2GS8A 3J80Q 4JI2I 1XMOI 1H72C 1N34E 2BM0A 1EA6A 1ZM2A 5BR8E 1NHHA 3OTOE 1QZRA 1Z0BA 4LFAE 4GKKE 1XNRE 1KVKA 3J7AG 4LFAI 1HNWE 2V2VA 4JYAI 2PNLA 4IZJD 3B82A 3PYEA 2A2CA 4B3TE 1Z0CA 3T1YE 4DV7I 3QT6A 3PYDA 2UU9E 4JI0I 3LPSA 1PKPA 3CWVA 4DR3I 2R3VA 3V2UC 4URLA 3ZKDA 4JI7E 4X64I 4DUZI 4AQYE 1FJGI 2ZM6E 4JI5E 4DR4I 3F0NA 4GKKI 4X62E 2Z5CB 3B8HA 3OTOI 4DU7A 4P7AA 2O1VA 1HK7A 2UUAI 2E1RA 1Z0VA 2BM1A 5A2QC 5LL6R 5IWAE 2HKJA 2GQ0A 2UUBI 2DEJA 2DEIA 1FI4A 4Z7YA 4YY3I 1HNZI 5LMNI 1I94E 3QT7A 2R42A 4ED4A 1XMQE 1B63A 4JI4E 4DR6I 4NXNI 2OI2A 2Z5BA 5A2QQ 4B3SI 4USMA 4JI5I 1FNMA 3P06A 4LFBI 4X64E 5LMUE 4DUZE 1Z5BA 4X66I 4HYMA 4YHHI 1IBMI 1Z59A 2X36A 1H74A 4JI1I 1HR0I 4LF6E 2VQFE 2F4VE 4DV7E 4DV0I 4DV2I 4JG4A 1N36I 3HJCA 5L3JA 3LTOA 1HNXE 4DV4E 4HY1A 4X65E 2J7KA 1ZM3A 4OX9E 2Q2EB 1IBKE 1K47A 2HK2A 1XMOE 1Z0EA 2WW4A 4DXLA 2UXBI 4LF9I 4IZKA 1BKNA 1Y4UA 3ZZUA 2UUCE 4DV3I 3WU3A 4I3HA 4JI8I 4ZVIA 4LFCI 1KKHA 2ZITA 2AJ4A 3J80C 2VF3A 1RR9A 3B78A 1N32E 3ZM7A 4LF9E 1XNQE 4B3MI 2HHHI 4KQVA 1PIEA 4IZJA 1PVGA 4DUYE 1U2RA 2O1TA 2UXCI 4DU8A 1Y4SA 1ZXNA 5GMEA 4K0KE 1S16A 1USVA 4PRVA 3Q1QA 5FWKA 4MYTA 4DR2I 4DR5E 4DV5I 4DV4I 1ZM4A 1KTVA 4LF5E 1N33I 3WU5A 4KHPE 4UT4A 4DV0E 1FWLA 1FKAE 4LF8E 3T1HE 1NZ0A 2IOPA 4DV1I 4LF7E 5FLXQ 2Z5EA 2CG9A 1Z0TA 4X66E 3J81C 2HHHE 5LMUI 3GONA 4DV1E 2LJPA 4UTGA 4LF7I 3V5RA 1USUA 1EI1A 4N3OA 1H73A 3ZKBA 3ZZ0A 4LF5I 1N33E 1S4EA 1HNZE 4LF4I 4XTJA 4DR2E 4DR5I 2PNMA 2IOQA 1VISA 1N0UA 4GKJI 1IBKI 4GKJE 4B3ME 5IT9C 4LF4E 1NHIA 1UEKA 4EMDA 2V2QA 4HACA 4OX9I 4DPXA 4DR1E 4DV6I 4JI3I 2E5LI 2VQEE 2X7IA 2ZM6I 2O1WA 4IZKB 3H4LA 1N32I 4FWGA 4AQYI 4PRXA 4DR3E 1A6FA 2CGEA 2E5LE 4DR1I 4JI3E 4DV3E 4M1KA 4JV5I 3WU6A 3HULA 1HR0E 4JI1E 4LF6I 1H7SA 3K1JA 2Z5CA 3M6AA 4R1FA 1XNRI 1ZM9A 1RREA 3T1HI 1HNXI 2XEXA 4KHPI 1I94I 4FWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKE A;  3JAM C;  4DV5 E;  2A2D A;  3WU4 A;  4JI2 E;  3QT5 A;  3JAM Q;  4DPY A;  2UUA E;  1IBM E;  1N0V C;  4DV2 E;  4K0K I;  2UXD E;  1XNQ I;  4DUY I;  4MYU A;  4JV5 E;  4B3S E;  4YHH E;  4LF8 I;  2HFU A;  3PYF A;  2BV3 A;  2UUC I;  4JI7 I;  5LMN E;  1NHJ A;  4Z7C A;  4LFC E;  3K17 A;  4USK A;  2VQE I;  4NXN E;  2UUB E;  4DV6 E;  2HK3 A;  4PU9 A;  5GMD A;  2UU9 I;  1Z5A A;  1MG7 A;  1MX0 A;  1DAR A;  1KIJ A;  4JYA E;  2ZBK B;  4X62 I;  1D6T A;  4DR4 E;  1XHK A;  1Z0W A;  2NPF A;  4NXM E;  5IT9 Q;  4RPF A;  3D4J A;  4FW9 A;  5BR8 I;  1FWK A;  4DPW A;  1OJ4 A;  4WUB A;  3ZZT A;  1N36 E;  3PYG A;  4JI6 I;  4DPT A;  2F4V I;  4JI6 E;  1H7U A;  4WUD A;  4JI0 E;  2HFS A;  3LNU A;  1HNW I;  1IBL I;  4B3T I;  2EFG A;  4DR6 E;  4LFB E;  3J81 Q;  4FN5 A;  4NXM I;  1ZXM A;  1MU5 A;  4HXZ A;  4X65 I;  4YY3 E;  1XMQ I;  4B3R E;  2CZ9 A;  1N34 I;  4HAC B;  2V8P A;  2V34 A;  1Z5C A;  1WUU A;  2VQF I;  2UXC E;  4B3R I;  4P52 A;  4DR7 I;  4WUC A;  4DPU A;  1J5E I;  3J7A M;  1B62 A;  1FJG E;  1ELO A;  1J5E E;  1Z0G A;  4JI8 E;  1IBL E;  4DR7 E;  4JI4 I;  2V2Z A;  3QT8 A;  2UXD I;  4FWH A;  3T1Y I;  2UXB E;  5IWA I;  5FLX C;  2GS8 A;  3J80 Q;  4JI2 I;  1XMO I;  1H72 C;  1N34 E;  2BM0 A;  1EA6 A;  1ZM2 A;  5BR8 E;  1NHH A;  3OTO E;  1QZR A;  1Z0B A;  4LFA E;  4GKK E;  1XNR E;  1KVK A;  3J7A G;  4LFA I;  1HNW E;  2V2V A;  4JYA I;  3B82 A;  3PYE A;  2A2C A;  4B3T E;  1Z0C A;  3T1Y E;  4DV7 I;  3QT6 A;  3PYD A;  2UU9 E;  4JI0 I;  3LPS A;  1PKP A;  3CWV A;  4DR3 I;  2R3V A;  3V2U C;  4URL A;  3ZKD A;  4JI7 E;  4X64 I;  4DUZ I;  4AQY E;  1FJG I;  2ZM6 E;  4JI5 E;  4DR4 I;  3F0N A;  4GKK I;  4X62 E;  3B8H A;  3OTO I;  4DU7 A;  4P7A A;  2UUA I;  2E1R A;  1Z0V A;  2BM1 A;  5A2Q C;  5LL6 R;  5IWA E;  2HKJ A;  2UUB I;  2DEJ A;  2DEI A;  1FI4 A;  4Z7Y A;  4YY3 I;  1HNZ I;  5LMN I;  1I94 E;  3QT7 A;  2R42 A;  4ED4 A;  1XMQ E;  1B63 A;  4JI4 E;  4DR6 I;  4NXN I;  2OI2 A;  5A2Q Q;  4B3S I;  4USM A;  4JI5 I;  1FNM A;  4LFB I;  4X64 E;  5LMU E;  4DUZ E;  1Z5B A;  4X66 I;  4HYM A;  4YHH I;  1IBM I;  1Z59 A;  2X36 A;  1H74 A;  4JI1 I;  1HR0 I;  4LF6 E;  2VQF E;  2F4V E;  4DV7 E;  4DV0 I;  4DV2 I;  4JG4 A;  1N36 I;  5L3J A;  3LTO A;  1HNX E;  4DV4 E;  4HY1 A;  4X65 E;  2J7K A;  1ZM3 A;  4OX9 E;  2Q2E B;  1IBK E;  1K47 A;  2HK2 A;  1XMO E;  1Z0E A;  2WW4 A;  4DXL A;  2UXB I;  4LF9 I;  1BKN A;  3ZZU A;  2UUC E;  4DV3 I;  3WU3 A;  4I3H A;  4JI8 I;  4ZVI A;  4LFC I;  1KKH A;  2ZIT A;  2AJ4 A;  3J80 C;  2VF3 A;  1RR9 A;  3B78 A;  1N32 E;  3ZM7 A;  4LF9 E;  1XNQ E;  4B3M I;  2HHH I;  4KQV A;  1PIE A;  1PVG A;  4DUY E;  1U2R A;  2UXC I;  4DU8 A;  1ZXN A;  5GME A;  4K0K E;  1S16 A;  4PRV A;  3Q1Q A;  4DR2 I;  4MYT A;  4DR5 E;  4DV5 I;  4DV4 I;  1ZM4 A;  1KTV A;  4LF5 E;  1N33 I;  3WU5 A;  4KHP E;  4UT4 A;  4DV0 E;  1FWL A;  1FKA E;  4LF8 E;  3T1H E;  1NZ0 A;  4DV1 I;  4LF7 E;  5FLX Q;  1Z0T A;  4X66 E;  3J81 C;  2HHH E;  5LMU I;  3GON A;  4DV1 E;  2LJP A;  4UTG A;  4LF7 I;  3V5R A;  1EI1 A;  3ZKB A;  1H73 A;  3ZZ0 A;  4LF5 I;  1N33 E;  1S4E A;  1HNZ E;  4LF4 I;  4XTJ A;  4DR2 E;  4DR5 I;  1VIS A;  1N0U A;  4GKJ I;  1IBK I;  4GKJ E;  4B3M E;  5IT9 C;  4LF4 E;  1NHI A;  1UEK A;  4EMD A;  2V2Q A;  4HAC A;  4OX9 I;  4DPX A;  4JI3 I;  4DR1 E;  4DV6 I;  2E5L I;  2VQE E;  2X7I A;  2ZM6 I;  3H4L A;  1N32 I;  4FWG A;  4AQY I;  4PRX A;  4DR3 E;  1A6F A;  2E5L E;  4DR1 I;  4JI3 E;  4DV3 E;  4M1K A;  4JV5 I;  3WU6 A;  3HUL A;  1HR0 E;  4JI1 E;  4LF6 I;  1H7S A;  3K1J A;  3M6A A;  4R1F A;  1XNR I;  1ZM9 A;  1RRE A;  3T1H I;  1HNX I;  2XEX A;  4KHP I;  1I94 I;  4FWD A; 
#chains in the Genus database with same CATH topology
 4LPF A;  2O1U A;  2HKE A;  3JAM C;  4DV5 E;  2A2D A;  3WU4 A;  4JI2 E;  3B4T A;  3QT5 A;  5ELW A;  5C0X F;  4LCF A;  3JAM Q;  4DPY A;  5K36 B;  2UUA E;  1IBM E;  1N0V C;  4DV2 E;  1Y6Z A;  4K0K I;  3UHM A;  2UXD E;  1XNQ I;  4DUY I;  5K36 E;  4MYU A;  4JV5 E;  4B3S E;  4YHH E;  4LF8 I;  2HFU A;  4FW3 A;  3P3G A;  3PYF A;  2BV3 A;  2UUC I;  3M7N D;  4AIM A;  4JI7 I;  5LMN E;  1E3H A;  1NHJ A;  4Z7C A;  4LFC E;  3K17 A;  4USK A;  2VQE I;  4NXN E;  2UUB E;  3U1Y A;  1XXE A;  4DV6 E;  2HK3 A;  4PU9 A;  5GMD A;  4BA1 A;  4IFD A;  2UU9 I;  1Z5A A;  1MG7 A;  1R6L A;  4LCG A;  1MX0 A;  3PRY A;  4MU0 A;  1UDQ A;  4QNK A;  2IES A;  2PO0 A;  4OO1 D;  1DAR A;  4GQU A;  1KIJ A;  4JYA E;  5C0X C;  2Z5B B;  3Q6M A;  3P3C A;  2ZBK B;  4X62 I;  1D6T A;  4DR4 E;  1XHK A;  1Z0W A;  2NPF A;  4NXM E;  3CDI A;  5IT9 Q;  4RPF A;  3D4J A;  4FW9 A;  5BR8 I;  1FWK A;  4DPW A;  1OJ4 A;  5K36 D;  4WUB A;  1OYS A;  3ZZT A;  2JEB B;  2BR2 A;  1N36 E;  3PYG A;  4JI6 I;  4U3B A;  4DPT A;  4AID A;  2F4V I;  2PNZ A;  1H7U A;  4JI6 E;  4WUD A;  4JI0 E;  5EKW A;  2HFS A;  3LNU A;  1HNW I;  1IBL I;  4B3T I;  2EFG A;  2WP8 A;  3KRN A;  1YH8 A;  4IZJ B;  5DRO A;  4DR6 E;  4LFB E;  3J81 Q;  4FN5 A;  4NXM I;  4FW7 A;  2JEA B;  5JEA C;  1ZXM A;  1MU5 A;  4HXZ A;  4X65 I;  2NN6 B;  4YY3 E;  2NN6 F;  2PNZ B;  1XMQ I;  4B3R E;  2CZ9 A;  5JEA B;  1N34 I;  4HAC B;  4FW6 A;  2V8P A;  2V34 A;  1Z5C A;  1WUU A;  4OZE A;  2VQF I;  1RHY A;  2JE6 A;  2UXC E;  4B3R I;  4P52 A;  4IFD C;  4DR7 I;  4WUC A;  4DPU A;  3Q6N A;  1J5E I;  3J7A M;  1B62 A;  2F1D A;  3GME A;  1FJG E;  1ELO A;  1J5E E;  1Z0G A;  3K85 A;  4JI8 E;  1IBL E;  4DR7 E;  2WNR B;  4JI4 I;  2V2Z A;  3QT8 A;  2UXD I;  4FWH A;  1VI7 A;  4IFD B;  3P76 A;  3T1Y I;  2UXB E;  2J65 A;  5IWA I;  4BA2 B;  5DNL A;  2NN6 A;  2GS8 A;  5FLX C;  1Y5Y A;  3J80 Q;  5K36 C;  4JI2 I;  1XMO I;  1H72 C;  1N34 E;  2BM0 A;  1EA6 A;  1ZM2 A;  5K36 F;  5BR8 E;  1NHH A;  3OTO E;  1QZR A;  1Z0B A;  2C38 B;  4LFA E;  4GKK E;  1XNR E;  1KVK A;  3J7A G;  4LFA I;  1HNW E;  4OO1 A;  2V2V A;  2CVE A;  4JYA I;  2PNL A;  4IZJ D;  1YHC A;  3B82 A;  3DD6 A;  2A2C A;  3PYE A;  4B3T E;  1Z0C A;  3T1Y E;  4DV7 I;  3QT6 A;  2PO1 B;  3PYD A;  4MU1 A;  2UU9 E;  4JI0 I;  1E3P A;  3LPS A;  1PKP A;  3CWV A;  3GLL A;  5DNX A;  3V2U C;  2R3V A;  4DR3 I;  4URL A;  3ZKD A;  4JI7 E;  2C37 A;  4MDT A;  2WP8 B;  4X64 I;  4DUZ I;  4AQY E;  1FJG I;  5C0X B;  2ZM6 E;  4U3D A;  4JI5 E;  4DR4 I;  3F0N A;  4GKK I;  2WNR A;  4X62 E;  2Z5C B;  3B8H A;  3OTO I;  4DU7 A;  4P7A A;  2O1V A;  1HK7 A;  2UUA I;  2E1R A;  5DRP A;  1Z0V A;  2BM1 A;  4IS9 A;  5A2Q C;  5LL6 R;  2BA1 G;  5IWA E;  2HKJ A;  2GQ0 A;  2GO4 A;  2UUB I;  2DEJ A;  2DEI A;  1FI4 A;  2NN6 D;  4Z7Y A;  4YY3 I;  1HNZ I;  5LMN I;  1I94 E;  3QT7 A;  2R42 A;  4ED4 A;  1XMQ E;  1B63 A;  4JI4 E;  4J3D A;  3H1C A;  4DR6 I;  4NXN I;  2OI2 A;  2Z5B A;  2BR2 B;  5A2Q Q;  4B3S I;  4USM A;  4JI5 I;  1FNM A;  3P06 A;  4LFB I;  4X64 E;  5LMU E;  4DUZ E;  4MU4 A;  1Z5B A;  4FW4 A;  4X66 I;  4HYM A;  4YHH I;  1IBM I;  1Z59 A;  2X36 A;  1H74 A;  4JI1 I;  1HR0 I;  4LF6 E;  2C39 B;  3L7Z B;  2VQF E;  2F4V E;  4DV7 E;  4DV0 I;  4DV2 I;  4JG4 A;  3HJC A;  1N36 I;  5L3J A;  2O3Z A;  3LTO A;  1HNX E;  3PS3 A;  4DV4 E;  4HY1 A;  4X65 E;  2BA1 D;  4BA1 B;  2J7K A;  1ZM3 A;  4QNJ A;  1UDS A;  5JEA D;  4OX9 E;  1OYP A;  2Q2E B;  5K36 A;  2VES A;  2C39 A;  2JEB A;  1R6M A;  1IBK E;  4MU3 A;  1K47 A;  2HK2 A;  1XMO E;  3HKM A;  4LOM A;  1Z0E A;  2WW4 A;  4DXL A;  4OO1 F;  2UXB I;  3M7N G;  2JE6 B;  4LF9 I;  2PO0 B;  4IZK A;  1BKN A;  1Y4U A;  3ZZU A;  2UUC E;  4DV3 I;  3WU3 A;  4I3H A;  1Y60 A;  4NBQ A;  4JI8 I;  4ZVI A;  4LFC I;  1KKH A;  2ZIT A;  2AJ4 A;  3J80 C;  3GCM A;  1UDN A;  2VF3 A;  1RR9 A;  3B78 A;  1N32 E;  3ZM7 A;  4LF9 E;  1XNQ E;  4B3M I;  2HHH I;  2JT2 A;  4BA2 A;  2NN6 E;  4KQV A;  1PIE A;  4IZJ A;  2NN6 C;  3PS2 A;  1PVG A;  4DUY E;  5C0X D;  1U2R A;  2O1T A;  5JEA E;  3M85 D;  3L7Z A;  2UXC I;  4DU8 A;  1Y4S A;  1ZXN A;  5GME A;  2IER A;  4K0K E;  2PO1 A;  1S16 A;  1USV A;  4PRV A;  5C0X A;  3Q1Q A;  5FWK A;  4MYT A;  4DR2 I;  4DR5 E;  5DRR A;  4DV5 I;  4DV4 I;  1ZM4 A;  4OKG A;  1KTV A;  4LF5 E;  1N33 I;  2GO3 A;  3WU5 A;  4KHP E;  4UT4 A;  4DV0 E;  1FWL A;  1FKA E;  4LF8 E;  3T1H E;  1NZ0 A;  3PS1 A;  2IOP A;  4DV1 I;  4LF7 E;  5FLX Q;  2Z5E A;  3U1K A;  2CG9 A;  1Z0T A;  4MQY A;  4X66 E;  4IFD E;  3J81 C;  2HHH E;  4OO1 B;  5LMU I;  3M85 G;  3CDJ A;  3GON A;  4DV1 E;  2LJP A;  4UTG A;  2C38 A;  4LF7 I;  3V5R A;  4IFD F;  4OO1 E;  2C37 B;  2BA0 D;  1UDO A;  1USU A;  1EI1 A;  4N3O A;  1H73 A;  3ZKB A;  3ZZ0 A;  4LF5 I;  1N33 E;  1S4E A;  4IFD D;  1HNZ E;  4LF4 I;  4XTJ A;  4DR2 E;  4DR5 I;  4FW5 A;  2PNM A;  2IOQ A;  4OO1 C;  1VIS A;  1N0U A;  4GKJ I;  1IBK I;  4GKJ E;  4B3M E;  5IT9 C;  3NZK A;  4LF4 E;  1NHI A;  1UEK A;  4EMD A;  2V2Q A;  4HAC A;  4OX9 I;  4DPX A;  4AM3 A;  4DR1 E;  4DV6 I;  4JI3 I;  2E5L I;  5DRQ A;  5EL9 A;  2VQE E;  2X7I A;  5JEA F;  2ZM6 I;  2O1W A;  4IZK B;  3H4L A;  1N32 I;  4FWG A;  4AQY I;  4PRX A;  4DR3 E;  2JEA A;  5C0X E;  1A6F A;  2CGE A;  1OYR A;  1P42 A;  2E5L E;  4DR1 I;  4JI3 E;  4DV3 E;  4ISA A;  4M1K A;  4JV5 I;  3WU6 A;  3HUL A;  1HR0 E;  4JI1 E;  4LF6 I;  5JEA A;  1H7S A;  3K1J A;  2Z5C A;  2PO2 A;  3M6A A;  2PO2 B;  4R1F A;  2BA0 G;  1XNR I;  1ZM9 A;  3P3E A;  1RRE A;  3T1H I;  1HNX I;  2XEX A;  4KHP I;  4LCH A;  2AE8 A;  1I94 I;  4FWD A; 
#chains in the Genus database with same CATH homology
 2O1U A;  2HKE A;  3JAM C;  4DV5 E;  2A2D A;  3WU4 A;  4JI2 E;  3QT5 A;  3JAM Q;  4DPY A;  2UUA E;  1IBM E;  1N0V C;  4DV2 E;  1Y6Z A;  4K0K I;  2UXD E;  1XNQ I;  4DUY I;  4MYU A;  4JV5 E;  4B3S E;  4YHH E;  4LF8 I;  2HFU A;  3PYF A;  2BV3 A;  2UUC I;  4JI7 I;  5LMN E;  1NHJ A;  4Z7C A;  4LFC E;  3K17 A;  4USK A;  2VQE I;  4NXN E;  2UUB E;  4DV6 E;  2HK3 A;  4PU9 A;  5GMD A;  2UU9 I;  1Z5A A;  1MG7 A;  1MX0 A;  3PRY A;  1DAR A;  1KIJ A;  4JYA E;  2Z5B B;  3Q6M A;  2ZBK B;  4X62 I;  1D6T A;  4DR4 E;  1XHK A;  1Z0W A;  2NPF A;  4NXM E;  5IT9 Q;  4RPF A;  3D4J A;  4FW9 A;  5BR8 I;  1FWK A;  4DPW A;  1OJ4 A;  4WUB A;  3ZZT A;  1N36 E;  3PYG A;  4JI6 I;  4DPT A;  2F4V I;  1H7U A;  4JI6 E;  4WUD A;  4JI0 E;  2HFS A;  3LNU A;  1HNW I;  1IBL I;  4B3T I;  2EFG A;  4IZJ B;  4DR6 E;  4LFB E;  3J81 Q;  4FN5 A;  4NXM I;  1ZXM A;  1MU5 A;  4HXZ A;  4X65 I;  4YY3 E;  1XMQ I;  4B3R E;  2CZ9 A;  1N34 I;  4HAC B;  2V8P A;  2V34 A;  1Z5C A;  1WUU A;  2VQF I;  2UXC E;  4B3R I;  4P52 A;  4DR7 I;  4WUC A;  4DPU A;  3Q6N A;  1J5E I;  3J7A M;  1B62 A;  1FJG E;  1ELO A;  1J5E E;  1Z0G A;  3K85 A;  4JI8 E;  1IBL E;  4DR7 E;  4JI4 I;  2V2Z A;  3QT8 A;  2UXD I;  4FWH A;  3T1Y I;  2UXB E;  5IWA I;  5FLX C;  2GS8 A;  3J80 Q;  4JI2 I;  1XMO I;  1H72 C;  1N34 E;  2BM0 A;  1EA6 A;  1ZM2 A;  5BR8 E;  1NHH A;  3OTO E;  1QZR A;  1Z0B A;  4LFA E;  4GKK E;  1XNR E;  1KVK A;  3J7A G;  4LFA I;  1HNW E;  2V2V A;  4JYA I;  2PNL A;  4IZJ D;  3B82 A;  3PYE A;  2A2C A;  4B3T E;  1Z0C A;  3T1Y E;  4DV7 I;  3QT6 A;  3PYD A;  2UU9 E;  4JI0 I;  3LPS A;  1PKP A;  3CWV A;  4DR3 I;  2R3V A;  3V2U C;  4URL A;  3ZKD A;  4JI7 E;  4X64 I;  4DUZ I;  4AQY E;  1FJG I;  2ZM6 E;  4JI5 E;  4DR4 I;  3F0N A;  4GKK I;  4X62 E;  2Z5C B;  3B8H A;  3OTO I;  4DU7 A;  4P7A A;  2O1V A;  1HK7 A;  2UUA I;  2E1R A;  1Z0V A;  2BM1 A;  5A2Q C;  5LL6 R;  5IWA E;  2HKJ A;  2GQ0 A;  2UUB I;  2DEJ A;  2DEI A;  1FI4 A;  4Z7Y A;  4YY3 I;  1HNZ I;  5LMN I;  1I94 E;  3QT7 A;  2R42 A;  4ED4 A;  1XMQ E;  1B63 A;  4JI4 E;  4DR6 I;  4NXN I;  2OI2 A;  2Z5B A;  5A2Q Q;  4B3S I;  4USM A;  4JI5 I;  1FNM A;  3P06 A;  4LFB I;  4X64 E;  5LMU E;  4DUZ E;  1Z5B A;  4X66 I;  4HYM A;  4YHH I;  1IBM I;  1Z59 A;  2X36 A;  1H74 A;  4JI1 I;  1HR0 I;  4LF6 E;  2VQF E;  2F4V E;  4DV7 E;  4DV0 I;  4DV2 I;  4JG4 A;  1N36 I;  3HJC A;  5L3J A;  3LTO A;  1HNX E;  4DV4 E;  4HY1 A;  4X65 E;  2J7K A;  1ZM3 A;  4OX9 E;  2Q2E B;  1IBK E;  1K47 A;  2HK2 A;  1XMO E;  1Z0E A;  2WW4 A;  4DXL A;  2UXB I;  4LF9 I;  4IZK A;  1BKN A;  1Y4U A;  3ZZU A;  2UUC E;  4DV3 I;  3WU3 A;  4I3H A;  4JI8 I;  4ZVI A;  4LFC I;  1KKH A;  2ZIT A;  2AJ4 A;  3J80 C;  2VF3 A;  1RR9 A;  3B78 A;  1N32 E;  3ZM7 A;  4LF9 E;  1XNQ E;  4B3M I;  2HHH I;  4KQV A;  1PIE A;  4IZJ A;  1PVG A;  4DUY E;  1U2R A;  2O1T A;  2UXC I;  4DU8 A;  1Y4S A;  1ZXN A;  5GME A;  4K0K E;  1S16 A;  1USV A;  4PRV A;  3Q1Q A;  5FWK A;  4MYT A;  4DR2 I;  4DR5 E;  4DV5 I;  4DV4 I;  1ZM4 A;  1KTV A;  4LF5 E;  1N33 I;  3WU5 A;  4KHP E;  4UT4 A;  4DV0 E;  1FWL A;  1FKA E;  4LF8 E;  3T1H E;  1NZ0 A;  2IOP A;  4DV1 I;  4LF7 E;  5FLX Q;  2Z5E A;  2CG9 A;  1Z0T A;  4X66 E;  3J81 C;  2HHH E;  5LMU I;  3GON A;  4DV1 E;  2LJP A;  4UTG A;  4LF7 I;  3V5R A;  1USU A;  1EI1 A;  4N3O A;  1H73 A;  3ZKB A;  3ZZ0 A;  4LF5 I;  1N33 E;  1S4E A;  1HNZ E;  4LF4 I;  4XTJ A;  4DR2 E;  4DR5 I;  2PNM A;  2IOQ A;  1VIS A;  1N0U A;  4GKJ I;  1IBK I;  4GKJ E;  4B3M E;  5IT9 C;  4LF4 E;  1NHI A;  1UEK A;  4EMD A;  2V2Q A;  4HAC A;  4OX9 I;  4DPX A;  4DR1 E;  4DV6 I;  4JI3 I;  2E5L I;  2VQE E;  2X7I A;  2ZM6 I;  2O1W A;  4IZK B;  3H4L A;  1N32 I;  4FWG A;  4AQY I;  4PRX A;  4DR3 E;  1A6F A;  2CGE A;  2E5L E;  4DR1 I;  4JI3 E;  4DV3 E;  4M1K A;  4JV5 I;  3WU6 A;  3HUL A;  1HR0 E;  4JI1 E;  4LF6 I;  1H7S A;  3K1J A;  2Z5C A;  3M6A A;  4R1F A;  1XNR I;  1ZM9 A;  1RRE A;  3T1H I;  1HNX I;  2XEX A;  4KHP I;  1I94 I;  4FWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...