4B3SI

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3sI00
4LF6E 4ZVIA 3WU6A 4JI2E 1MX0A 1Z0VA 4WUCA 4DV5E 1FWLA 4LF6I 1FI4A 3HULA 2HHHI 4DR3E 4JI2I 4DU7A 1HNWE 2HFSA 1N33I 3J81Q 4DV5I 4LF8E 4DPWA 3B8HA 2BM1A 4KQVA 4DR3I 4LFAE 4KHPE 1HNWI 4JI3E 1MG7A 4HACA 4LF8I 4FN5A 1Z0WA 2EFGA 3WU4A 4DV1E 1VISA 3PYFA 3ZZ0A 1A6FA 4LFAI 3ZKDA 4GKKE 3ZKBA 4JI3I 2X7IA 1XNQE 3F0NA 1S4EA 4B3TE 4X62E 4DR7E 4DV0E 2XEXA 1I94I 4X66I 2AJ4A 4NXMI 4DV1I 2F4VE 1QZRA 4USKA 3T1YI 1PVGA 4LF9E 3GONA 4JYAE 1U2RA 4DUZE 1HNZE 1ZXNA 1XNQI 1Z0TA 2VQEI 4DR2E 4B3TI 4X62I 4DR7I 4DV0I 1B63A 4DV3E 4JI4E 3H4LA 1Z0GA 2F4VI 4LF9I 4B3RE 1OJ4A 4JYAI 2V2QA 5LMUE 1HNZI 4DR2I 1ZXMA 4JI0E 4JI4I 3PYEA 1HR0E 1DARA 5LMUI 1FJGE 4JI0I 2R3VA 4DV4E 4DPUA 2LJPA 1HR0I 2WW4A 3QT6A 2HKEA 1ZM4A 4DXLA 1NHJA 3LPSA 2HK2A 4HYMA 4DV4I 4PU9A 2ZM6E 5IWAE 4X65E 2HHHE 3B78A 5FLXQ 3WU5A 1ZM9A 3PYDA 2NPFA 1N33E 4HXZA 1H72C 1NHIA 1S16A 4B3MI 4Z7YA 4JI5E 5LMNE 2ZM6I 5IWAI 1PIEA 3LTOA 3V5RA 4X65I 4MYUA 4FWHA 3QT5A 4DR6E 2UXDE 1PKPA 1IBKI 4PRVA 5A2QC 4UT4A 1NHHA 4FWDA 4JI5I 3V2UC 5LMNI 3J80Q 1MU5A 4DR6I 1H7SA 2UXDI 2UXCI 1H74A 1KKHA 4NXNE 4I3HA 5BR8E 1FNMA 1I94E 4X66E 2ZITA 4NXME 4LF4E 4PRXA 3T1YE 1RREA 4DU8A 2UUAE 2UUBI 2VQEE 2V2ZA 4DPXA 4MYTA 4NXNI 4WUBA 4LF5E 5BR8I 3Q1QA 1HNXE 4LF4I 2UUCI 5GMEA 2V2VA 4JI8I 1FKAE 1XMOE 3J7AG 2UUAI 4YY3E 2E1RA 4JG4A 4WUDA 3CWVA 4LF5I 1HNXI 4OX9I 4JI6I 2A2DA 1IBME 5L3JA 4GKJE 1EA6A 1EI1A 4JI7E 1XMOI 1Z5BA 4YY3I 1N0VC 1Z0EA 4P52A 4DR5I 4DV6E 2V34A 3J81C 4XTJA 1IBMI 4GKJI 1XMQI 2Q2EB 4DUYE 4FWGA 1N34I 4JI7I 4DV2I 3J80C 3ZM7A 1KTVA 4P7AA 2E5LE 4DV6I 2VF3A 4DUYI 2UXBI 3ZZUA 4URLA 2E5LI 4B3SE 4JI1E 4B3ME 3JAMQ 5IT9Q 4AQYI 2HK3A 1D6TA 2UU9E 3WU3A 1IBKE 2OI2A 4LFCE 2HKJA 4M1KA 4B3SI 1XHKA 1Z5CA 4JI1I 4DR1I 1B62A 2GS8A 4LF7E 4HY1A 3PYGA 2UU9I 4JV5I 2BM0A 2UXCE 1N32I 1Z0BA 1J5EE 4LFCI 4ED4A 1ZM3A 2J7KA 5LL6R 3LNUA 4LF7I 1H73A 1RR9A 4K0KE 4EMDA 2X36A 2VQFE 3B82A 3M6AA 2A2CA 1J5EI 3K17A 2UUBE 1Z59A 4R1FA 4K0KI 2UUCE 1KVKA 4JI8E 2VQFI 1FWKA 2DEIA 3QT8A 1KIJA 1N0UA 4RPFA 4HACB 4OX9E 4JI6E 4Z7CA 1WUUA 3JAMC 1UEKA 5IT9C 1NZ0A 4KHPI 5FLXC 4DR5E 3J7AM 1K47A 4DPTA 1XMQE 1N34E 4DV2E 1N36E 2CZ9A 4DV7E 4LFBE 4GKKI 1ELOA 2R42A 3OTOE 3D4JA 2BV3A 2UXBE 2ZBKB 1N36I 2HFUA 1ZM2A 5A2QQ 3K1JA 4DV7I 4X64E 1H7UA 4LFBI 3QT7A 3T1HE 1XNRE 4DUZI 4DR4E 4DPYA 5GMDA 3OTOI 4AQYE 4FW9A 4DV3I 4UTGA 4YHHE 4X64I 1Z5AA 3T1HI 4B3RI 1XNRI 4USMA 4DR1E 4DR4I 1IBLE 4JV5E 1BKNA 1N32E 3ZZTA 4YHHI 1Z0CA 1FJGI 2DEJA 2V8PA 1IBLI
chains in the Genus database with same CATH superfamily
3M85G 4LF6E 4ZVIA 3P3CA 3WU6A 4JI2E 2O1UA 1MX0A 1Y6ZA 1Z0VA 3GCMA 2IERA 4WUCA 5FWKA 4DV5E 1FWLA 3P3EA 1UDQA 4LF6I 1FI4A 3HULA 2HHHI 2JE6A 3CDJA 2PO0A 4DR3E 4JI2I 4DU7A 4U3DA 1HNWE 2HFSA 1N33I 3J81Q 4ISAA 1XXEA 4DV5I 4LF8E 4DPWA 2NN6F 3B8HA 2BM1A 5K36B 4N3OA 5DNXA 2BA1D 4KQVA 4DR3I 4LFAE 4KHPE 1HNWI 2CVEA 4JI3E 1MG7A 4HACA 4LF8I 4FN5A 1Z0WA 2EFGA 2PNZA 3WU4A 4DV1E 1VISA 3PYFA 3ZZ0A 1A6FA 2WNRA 4MU3A 3ZKDA 4LFAI 4GKKE 3ZKBA 4JI3I 2X7IA 1XNQE 3F0NA 1S4EA 4B3TE 4X62E 4DR7E 4BA1B 4DV0E 2XEXA 2BR2A 1I94I 4X66I 2AJ4A 2BR2B 4NXMI 4NBQA 3PS3A 4OO1A 4DV1I 2F4VE 1QZRA 4USKA 3K85A 1PVGA 3T1YI 4LF9E 3GONA 4JYAE 1U2RA 4DUZE 5JEAC 1HNZE 1ZXNA 1XNQI 1USUA 1Z0TA 2VQEI 4DR2E 4FW5A 4B3TI 5K36D 4X62I 4DR7I 4DV0I 1B63A 4DV3E 4JI4E 3H4LA 1Z0GA 3L7ZA 2PNLA 3PRYA 2F4VI 4LF9I 4B3RE 1OJ4A 2Z5CA 2V2QA 5LMUE 4JYAI 1HNZI 4GQUA 1RHYA 4IZKB 4DR2I 3HKMA 1HK7A 1ZXMA 4JI0E 3M7ND 4JI4I 4MU4A 3PYEA 1HR0E 2C39A 2Z5BB 5JEAF 1DARA 5LMUI 1FJGE 3H1CA 1VI7A 4JI0I 2JEAB 4IFDB 2R3VA 4DV4E 5DRQA 5ELWA 4DPUA 5C0XB 2LJPA 1HR0I 2WW4A 1R6MA 3QT6A 2HKEA 1Y4SA 2BA0G 1UDSA 1ZM4A 4IZJB 4DXLA 1NHJA 3LPSA 2HK2A 4HYMA 4DV4I 4PU9A 2ZM6E 5IWAE 5EL9A 4X65E 2HHHE 4AM3A 3B78A 5FLXQ 3WU5A 1ZM9A 3PYDA 2NPFA 1N33E 4HXZA 1H72C 1NHIA 3HJCA 1S16A 4B3MI 4Z7YA 4JI5E 5LMNE 2ZM6I 5IWAI 1PIEA 4MQYA 3LTOA 3V5RA 4X65I 3U1KA 4MYUA 4OO1E 4FWHA 3QT5A 4LCFA 4DR6E 2UXDE 4OO1C 1PKPA 4FW7A 1IBKI 4IFDD 4PRVA 5A2QC 2O1WA 4UT4A 5C0XD 1NHHA 4FWDA 4JI5I 3V2UC 5DRRA 5LMNI 2PO1B 5K36A 1YHCA 3J80Q 1P42A 1MU5A 3P76A 2GO3A 4DR6I 1H7SA 2UXDI 2UXCI 1H74A 1KKHA 2F1DA 4IZJD 3Q6MA 4LOMA 4J3DA 4NXNE 4I3HA 5BR8E 1FNMA 3B4TA 1I94E 4X66E 2ZITA 4NXME 1OYSA 4LF4E 4PRXA 2GO4A 3T1YE 4OO1F 2C38B 1RREA 4DU8A 2UUAE 2UUBI 2VQEE 4BA1A 2V2ZA 4DPXA 4MYTA 4NXNI 1E3PA 4WUBA 5EKWA 4LF5E 4BA2B 5BR8I 3Q1QA 1HNXE 2BA1G 1OYPA 2C37B 4LF4I 2NN6B 2UUCI 5JEAE 5GMEA 2V2VA 4JI8I 1FKAE 1XMOE 3J7AG 4FW3A 2UUAI 4YY3E 2E1RA 4JG4A 4WUDA 3CWVA 3U1YA 4LF5I 2CGEA 5DNLA 1HNXI 4OX9I 2O1VA 2WP8B 4JI6I 2A2DA 1IBME 5L3JA 4GKJE 1EA6A 1EI1A 4JI7E 1XMOI 1Z5BA 4IZKA 4YY3I 3P3GA 1N0VC 1Z0EA 4P52A 4DR5I 4DV6E 2V34A 3J81C 3Q6NA 4XTJA 2JT2A 1IBMI 4GKJI 1XMQI 2Q2EB 2Z5BA 4DUYE 4FWGA 1N34I 1Y4UA 4JI7I 4DV2I 3J80C 3ZM7A 2JEAA 1KTVA 4P7AA 4QNKA 4IFDA 2E5LE 1UDNA 2NN6D 3P06A 4DV6I 5C0XA 5K36E 2VF3A 5K36C 4DUYI 4FW6A 2UXBI 3ZZUA 1Y60A 4OZEA 1R6LA 4IZJA 4URLA 3M7NG 2JEBB 2E5LI 4B3SE 4JI1E 4B3ME 3JAMQ 5IT9Q 2J65A 4AQYI 2HK3A 3KRNA 2PO2B 1D6TA 2UU9E 5DROA 3WU3A 2O1TA 1IBKE 2O3ZA 2OI2A 5DRPA 4LFCE 2HKJA 4M1KA 4B3SI 1XHKA 1Z5CA 4JI1I 4DR1I 1B62A 2GS8A 4LF7E 4HY1A 3PYGA 5K36F 2UU9I 2NN6C 4JV5I 2BM0A 4MDTA 2UXCE 1N32I 1Z0BA 1J5EE 3GMEA 4LFCI 4ED4A 2PO1A 1ZM3A 2J7KA 5LL6R 3LNUA 4LF7I 1H73A 3DD6A 1RR9A 4K0KE 4EMDA 2X36A 2VQFE 3B82A 3M6AA 2A2CA 1J5EI 2JE6B 3K17A 2PO0B 3NZKA 2UUBE 1Z59A 4R1FA 1UDOA 2Z5EA 4K0KI 2UUCE 1KVKA 2C38A 4JI8E 5JEAD 4MU0A 2VQFI 1FWKA 2DEIA 3QT8A 4U3BA 1KIJA 4IFDE 1N0UA 4RPFA 4BA2A 2C37A 3GLLA 5C0XE 4IFDC 2NN6A 4HACB 4OX9E 4JI6E 4Z7CA 1WUUA 2VESA 5C0XC 2PNZB 3JAMC 1UEKA 5IT9C 1NZ0A 4KHPI 2WNRB 5FLXC 4DR5E 3J7AM 2WP8A 4LCHA 1K47A 4DPTA 4LCGA 1XMQE 1N34E 3PS1A 4DV2E 1N36E 2CZ9A 4DV7E 4OO1B 4LFBE 4GKKI 4OKGA 1ELOA 4IFDF 2R42A 5C0XF 3OTOE 3D4JA 2BV3A 4FW4A 2UXBE 2ZBKB 1N36I 2HFUA 1ZM2A 5A2QQ 3L7ZB 3K1JA 4DV7I 4X64E 3UHMA 1H7UA 2IOQA 4LFBI 3QT7A 3T1HE 1XNRE 4DUZI 4DR4E 4DPYA 2Z5CB 1E3HA 2BA0D 5GMDA 3OTOI 4AQYE 4FW9A 4DV3I 2IOPA 2PNMA 4UTGA 4AIDA 3M85D 2GQ0A 4YHHE 4X64I 4QNJA 1YH8A 2JEBA 1Z5AA 2C39B 2AE8A 3T1HI 4B3RI 1XNRI 4USMA 4DR1E 4DR4I 4IS9A 4LPFA 2PO2A 1OYRA 2CG9A 1IBLE 3CDIA 4OO1D 4JV5E 1BKNA 1N32E 3ZZTA 4YHHI 5JEAA 1Z0CA 5JEAB 4AIMA 3PS2A 1Y5YA 1FJGI 2DEJA 2V8PA 2NN6E 1USVA 4MU1A 1IBLI 2IESA
chains in the Genus database with same CATH topology
4LF6E 4ZVIA 3WU6A 4JI2E 2O1UA 1MX0A 1Y6ZA 1Z0VA 4WUCA 5FWKA 4DV5E 1FWLA 4LF6I 1FI4A 3HULA 2HHHI 4DR3E 4JI2I 4DU7A 1HNWE 2HFSA 1N33I 3J81Q 4DV5I 4LF8E 4DPWA 3B8HA 2BM1A 4N3OA 4KQVA 4DR3I 4LFAE 4KHPE 1HNWI 4JI3E 1MG7A 4HACA 4LF8I 4FN5A 1Z0WA 2EFGA 3WU4A 4DV1E 1VISA 3PYFA 3ZZ0A 1A6FA 4LFAI 3ZKDA 4GKKE 3ZKBA 4JI3I 2X7IA 1XNQE 3F0NA 1S4EA 4B3TE 4X62E 4DR7E 4DV0E 2XEXA 1I94I 4X66I 2AJ4A 4NXMI 4DV1I 2F4VE 1QZRA 4USKA 3K85A 1PVGA 3T1YI 4LF9E 3GONA 4JYAE 1U2RA 4DUZE 1HNZE 1ZXNA 1XNQI 1USUA 1Z0TA 2VQEI 4DR2E 4B3TI 4X62I 4DR7I 4DV0I 1B63A 4DV3E 4JI4E 3H4LA 1Z0GA 2PNLA 3PRYA 2F4VI 4LF9I 4B3RE 1OJ4A 2Z5CA 2V2QA 5LMUE 4JYAI 1HNZI 4IZKB 4DR2I 1HK7A 1ZXMA 4JI0E 4JI4I 3PYEA 1HR0E 2Z5BB 1DARA 5LMUI 1FJGE 4JI0I 2R3VA 4DV4E 4DPUA 2LJPA 1HR0I 2WW4A 3QT6A 2HKEA 1Y4SA 1ZM4A 4IZJB 4DXLA 1NHJA 3LPSA 2HK2A 4HYMA 4DV4I 4PU9A 2ZM6E 5IWAE 4X65E 2HHHE 3B78A 5FLXQ 3WU5A 1ZM9A 3PYDA 2NPFA 1N33E 4HXZA 1H72C 1NHIA 3HJCA 1S16A 4B3MI 4Z7YA 4JI5E 5LMNE 2ZM6I 5IWAI 1PIEA 3LTOA 3V5RA 4X65I 4MYUA 4FWHA 3QT5A 4DR6E 2UXDE 1PKPA 1IBKI 4PRVA 5A2QC 2O1WA 4UT4A 1NHHA 4FWDA 4JI5I 3V2UC 5LMNI 3J80Q 1MU5A 4DR6I 1H7SA 2UXDI 2UXCI 1H74A 1KKHA 4IZJD 3Q6MA 4NXNE 4I3HA 5BR8E 1FNMA 1I94E 4X66E 2ZITA 4NXME 4LF4E 4PRXA 3T1YE 1RREA 4DU8A 2UUAE 2UUBI 2VQEE 2V2ZA 4DPXA 4MYTA 4NXNI 4WUBA 4LF5E 5BR8I 3Q1QA 1HNXE 4LF4I 2UUCI 5GMEA 2V2VA 4JI8I 1FKAE 1XMOE 3J7AG 2UUAI 4YY3E 2E1RA 4JG4A 4WUDA 3CWVA 4LF5I 2CGEA 1HNXI 4OX9I 2O1VA 4JI6I 2A2DA 1IBME 5L3JA 4GKJE 1EA6A 1EI1A 4JI7E 1XMOI 1Z5BA 4IZKA 4YY3I 1N0VC 1Z0EA 4P52A 4DR5I 4DV6E 2V34A 3J81C 3Q6NA 4XTJA 1IBMI 4GKJI 1XMQI 2Q2EB 2Z5BA 4DUYE 4FWGA 1N34I 1Y4UA 4JI7I 4DV2I 3J80C 3ZM7A 1KTVA 4P7AA 2E5LE 3P06A 4DV6I 2VF3A 4DUYI 2UXBI 3ZZUA 4IZJA 4URLA 2E5LI 4B3SE 4JI1E 4B3ME 3JAMQ 5IT9Q 4AQYI 2HK3A 1D6TA 2UU9E 3WU3A 2O1TA 1IBKE 2OI2A 4LFCE 2HKJA 4M1KA 4B3SI 1XHKA 1Z5CA 4JI1I 4DR1I 1B62A 2GS8A 4LF7E 4HY1A 3PYGA 2UU9I 4JV5I 2BM0A 2UXCE 1N32I 1Z0BA 1J5EE 4LFCI 4ED4A 1ZM3A 2J7KA 5LL6R 3LNUA 4LF7I 1H73A 1RR9A 4K0KE 4EMDA 2X36A 2VQFE 3B82A 3M6AA 2A2CA 1J5EI 3K17A 2UUBE 1Z59A 4R1FA 2Z5EA 4K0KI 2UUCE 1KVKA 4JI8E 2VQFI 1FWKA 2DEIA 3QT8A 1KIJA 1N0UA 4RPFA 4HACB 4OX9E 4JI6E 4Z7CA 1WUUA 3JAMC 1UEKA 5IT9C 1NZ0A 4KHPI 5FLXC 4DR5E 3J7AM 1K47A 4DPTA 1XMQE 1N34E 4DV2E 1N36E 2CZ9A 4DV7E 4LFBE 4GKKI 1ELOA 2R42A 3OTOE 3D4JA 2BV3A 2UXBE 2ZBKB 1N36I 2HFUA 1ZM2A 5A2QQ 3K1JA 4DV7I 4X64E 1H7UA 2IOQA 4LFBI 3QT7A 3T1HE 1XNRE 4DUZI 4DR4E 4DPYA 2Z5CB 5GMDA 3OTOI 4AQYE 4FW9A 4DV3I 2IOPA 2PNMA 4UTGA 2GQ0A 4YHHE 4X64I 1Z5AA 3T1HI 4B3RI 1XNRI 4USMA 4DR1E 4DR4I 2CG9A 1IBLE 4JV5E 1BKNA 1N32E 3ZZTA 4YHHI 1Z0CA 1FJGI 2DEJA 2V8PA 1USVA 1IBLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 E;  4ZVI A;  3WU6 A;  4JI2 E;  1MX0 A;  1Z0V A;  4WUC A;  4DV5 E;  1FWL A;  4LF6 I;  1FI4 A;  3HUL A;  2HHH I;  4DR3 E;  4JI2 I;  4DU7 A;  1HNW E;  2HFS A;  1N33 I;  3J81 Q;  4DV5 I;  4LF8 E;  4DPW A;  3B8H A;  2BM1 A;  4KQV A;  4DR3 I;  4LFA E;  4KHP E;  1HNW I;  4JI3 E;  1MG7 A;  4HAC A;  4LF8 I;  4FN5 A;  1Z0W A;  2EFG A;  3WU4 A;  4DV1 E;  1VIS A;  3PYF A;  3ZZ0 A;  1A6F A;  4LFA I;  3ZKD A;  4GKK E;  3ZKB A;  4JI3 I;  2X7I A;  1XNQ E;  3F0N A;  1S4E A;  4B3T E;  4X62 E;  4DR7 E;  4DV0 E;  2XEX A;  1I94 I;  4X66 I;  2AJ4 A;  4NXM I;  4DV1 I;  2F4V E;  1QZR A;  4USK A;  3T1Y I;  1PVG A;  4LF9 E;  3GON A;  4JYA E;  1U2R A;  4DUZ E;  1HNZ E;  1ZXN A;  1XNQ I;  1Z0T A;  2VQE I;  4DR2 E;  4B3T I;  4X62 I;  4DR7 I;  4DV0 I;  1B63 A;  4DV3 E;  4JI4 E;  3H4L A;  1Z0G A;  2F4V I;  4LF9 I;  4B3R E;  1OJ4 A;  4JYA I;  2V2Q A;  5LMU E;  1HNZ I;  4DR2 I;  1ZXM A;  4JI0 E;  4JI4 I;  3PYE A;  1HR0 E;  1DAR A;  5LMU I;  1FJG E;  4JI0 I;  2R3V A;  4DV4 E;  4DPU A;  2LJP A;  1HR0 I;  2WW4 A;  3QT6 A;  2HKE A;  1ZM4 A;  4DXL A;  1NHJ A;  3LPS A;  2HK2 A;  4HYM A;  4DV4 I;  4PU9 A;  2ZM6 E;  5IWA E;  4X65 E;  2HHH E;  3B78 A;  5FLX Q;  3WU5 A;  1ZM9 A;  3PYD A;  2NPF A;  1N33 E;  4HXZ A;  1H72 C;  1NHI A;  1S16 A;  4B3M I;  4Z7Y A;  4JI5 E;  5LMN E;  2ZM6 I;  5IWA I;  1PIE A;  3LTO A;  3V5R A;  4X65 I;  4MYU A;  4FWH A;  3QT5 A;  4DR6 E;  2UXD E;  1PKP A;  1IBK I;  4PRV A;  5A2Q C;  4UT4 A;  1NHH A;  4FWD A;  4JI5 I;  3V2U C;  5LMN I;  3J80 Q;  1MU5 A;  4DR6 I;  1H7S A;  2UXD I;  2UXC I;  1H74 A;  1KKH A;  4NXN E;  4I3H A;  5BR8 E;  1FNM A;  1I94 E;  4X66 E;  2ZIT A;  4NXM E;  4LF4 E;  4PRX A;  3T1Y E;  1RRE A;  4DU8 A;  2UUA E;  2UUB I;  2VQE E;  2V2Z A;  4DPX A;  4MYT A;  4NXN I;  4WUB A;  4LF5 E;  5BR8 I;  3Q1Q A;  1HNX E;  4LF4 I;  2UUC I;  5GME A;  2V2V A;  4JI8 I;  1FKA E;  1XMO E;  3J7A G;  2UUA I;  4YY3 E;  2E1R A;  4JG4 A;  4WUD A;  3CWV A;  4LF5 I;  1HNX I;  4OX9 I;  4JI6 I;  2A2D A;  1IBM E;  5L3J A;  4GKJ E;  1EA6 A;  1EI1 A;  4JI7 E;  1XMO I;  1Z5B A;  4YY3 I;  1N0V C;  1Z0E A;  4P52 A;  4DR5 I;  4DV6 E;  2V34 A;  3J81 C;  4XTJ A;  1IBM I;  4GKJ I;  1XMQ I;  2Q2E B;  4DUY E;  4FWG A;  1N34 I;  4JI7 I;  4DV2 I;  3J80 C;  3ZM7 A;  1KTV A;  4P7A A;  2E5L E;  4DV6 I;  2VF3 A;  4DUY I;  2UXB I;  3ZZU A;  4URL A;  2E5L I;  4B3S E;  4JI1 E;  4B3M E;  3JAM Q;  5IT9 Q;  4AQY I;  2HK3 A;  1D6T A;  2UU9 E;  3WU3 A;  1IBK E;  2OI2 A;  4LFC E;  2HKJ A;  4M1K A;  4B3S I;  1XHK A;  1Z5C A;  4JI1 I;  4DR1 I;  1B62 A;  2GS8 A;  4LF7 E;  4HY1 A;  3PYG A;  2UU9 I;  4JV5 I;  2BM0 A;  2UXC E;  1N32 I;  1Z0B A;  1J5E E;  4LFC I;  4ED4 A;  1ZM3 A;  2J7K A;  5LL6 R;  3LNU A;  4LF7 I;  1H73 A;  1RR9 A;  4K0K E;  4EMD A;  2X36 A;  2VQF E;  3B82 A;  3M6A A;  2A2C A;  1J5E I;  3K17 A;  2UUB E;  1Z59 A;  4R1F A;  4K0K I;  2UUC E;  1KVK A;  4JI8 E;  2VQF I;  1FWK A;  2DEI A;  3QT8 A;  1KIJ A;  1N0U A;  4RPF A;  4HAC B;  4OX9 E;  4JI6 E;  4Z7C A;  1WUU A;  3JAM C;  1UEK A;  5IT9 C;  1NZ0 A;  4KHP I;  5FLX C;  4DR5 E;  3J7A M;  1K47 A;  4DPT A;  1XMQ E;  1N34 E;  4DV2 E;  1N36 E;  2CZ9 A;  4DV7 E;  4LFB E;  4GKK I;  1ELO A;  2R42 A;  3OTO E;  3D4J A;  2BV3 A;  2UXB E;  2ZBK B;  1N36 I;  2HFU A;  1ZM2 A;  5A2Q Q;  3K1J A;  4DV7 I;  4X64 E;  1H7U A;  4LFB I;  3QT7 A;  3T1H E;  1XNR E;  4DUZ I;  4DR4 E;  4DPY A;  5GMD A;  3OTO I;  4AQY E;  4FW9 A;  4DV3 I;  4UTG A;  4YHH E;  4X64 I;  1Z5A A;  3T1H I;  4B3R I;  1XNR I;  4USM A;  4DR1 E;  4DR4 I;  1IBL E;  4JV5 E;  1BKN A;  1N32 E;  3ZZT A;  4YHH I;  1Z0C A;  1FJG I;  2DEJ A;  2V8P A;  1IBL I; 
#chains in the Genus database with same CATH topology
 3M85 G;  4LF6 E;  4ZVI A;  3P3C A;  3WU6 A;  4JI2 E;  2O1U A;  1MX0 A;  1Y6Z A;  1Z0V A;  3GCM A;  2IER A;  4WUC A;  5FWK A;  4DV5 E;  1FWL A;  3P3E A;  1UDQ A;  4LF6 I;  1FI4 A;  3HUL A;  2HHH I;  2JE6 A;  3CDJ A;  2PO0 A;  4DR3 E;  4JI2 I;  4DU7 A;  4U3D A;  1HNW E;  2HFS A;  1N33 I;  3J81 Q;  4ISA A;  1XXE A;  4DV5 I;  4LF8 E;  4DPW A;  2NN6 F;  3B8H A;  2BM1 A;  5K36 B;  4N3O A;  5DNX A;  2BA1 D;  4KQV A;  4DR3 I;  4LFA E;  4KHP E;  1HNW I;  2CVE A;  4JI3 E;  1MG7 A;  4HAC A;  4LF8 I;  4FN5 A;  1Z0W A;  2EFG A;  2PNZ A;  3WU4 A;  4DV1 E;  1VIS A;  3PYF A;  3ZZ0 A;  1A6F A;  2WNR A;  4MU3 A;  3ZKD A;  4LFA I;  4GKK E;  3ZKB A;  4JI3 I;  2X7I A;  1XNQ E;  3F0N A;  1S4E A;  4B3T E;  4X62 E;  4DR7 E;  4BA1 B;  4DV0 E;  2XEX A;  2BR2 A;  1I94 I;  4X66 I;  2AJ4 A;  2BR2 B;  4NXM I;  4NBQ A;  3PS3 A;  4OO1 A;  4DV1 I;  2F4V E;  1QZR A;  4USK A;  3K85 A;  1PVG A;  3T1Y I;  4LF9 E;  3GON A;  4JYA E;  1U2R A;  4DUZ E;  5JEA C;  1HNZ E;  1ZXN A;  1XNQ I;  1USU A;  1Z0T A;  2VQE I;  4DR2 E;  4FW5 A;  4B3T I;  5K36 D;  4X62 I;  4DR7 I;  4DV0 I;  1B63 A;  4DV3 E;  4JI4 E;  3H4L A;  1Z0G A;  3L7Z A;  2PNL A;  3PRY A;  2F4V I;  4LF9 I;  4B3R E;  1OJ4 A;  2Z5C A;  2V2Q A;  5LMU E;  4JYA I;  1HNZ I;  4GQU A;  1RHY A;  4IZK B;  4DR2 I;  3HKM A;  1HK7 A;  1ZXM A;  4JI0 E;  3M7N D;  4JI4 I;  4MU4 A;  3PYE A;  1HR0 E;  2C39 A;  2Z5B B;  5JEA F;  1DAR A;  5LMU I;  1FJG E;  3H1C A;  1VI7 A;  4JI0 I;  2JEA B;  4IFD B;  2R3V A;  4DV4 E;  5DRQ A;  5ELW A;  4DPU A;  5C0X B;  2LJP A;  1HR0 I;  2WW4 A;  1R6M A;  3QT6 A;  2HKE A;  1Y4S A;  2BA0 G;  1UDS A;  1ZM4 A;  4IZJ B;  4DXL A;  1NHJ A;  3LPS A;  2HK2 A;  4HYM A;  4DV4 I;  4PU9 A;  2ZM6 E;  5IWA E;  5EL9 A;  4X65 E;  2HHH E;  4AM3 A;  3B78 A;  5FLX Q;  3WU5 A;  1ZM9 A;  3PYD A;  2NPF A;  1N33 E;  4HXZ A;  1H72 C;  1NHI A;  3HJC A;  1S16 A;  4B3M I;  4Z7Y A;  4JI5 E;  5LMN E;  2ZM6 I;  5IWA I;  1PIE A;  4MQY A;  3LTO A;  3V5R A;  4X65 I;  3U1K A;  4MYU A;  4OO1 E;  4FWH A;  3QT5 A;  4LCF A;  4DR6 E;  2UXD E;  4OO1 C;  1PKP A;  4FW7 A;  1IBK I;  4IFD D;  4PRV A;  5A2Q C;  2O1W A;  4UT4 A;  5C0X D;  1NHH A;  4FWD A;  4JI5 I;  3V2U C;  5DRR A;  5LMN I;  2PO1 B;  5K36 A;  1YHC A;  3J80 Q;  1P42 A;  1MU5 A;  3P76 A;  2GO3 A;  4DR6 I;  1H7S A;  2UXD I;  2UXC I;  1H74 A;  1KKH A;  2F1D A;  4IZJ D;  3Q6M A;  4LOM A;  4J3D A;  4NXN E;  4I3H A;  5BR8 E;  1FNM A;  3B4T A;  1I94 E;  4X66 E;  2ZIT A;  4NXM E;  1OYS A;  4LF4 E;  4PRX A;  2GO4 A;  3T1Y E;  4OO1 F;  2C38 B;  1RRE A;  4DU8 A;  2UUA E;  2UUB I;  2VQE E;  4BA1 A;  2V2Z A;  4DPX A;  4MYT A;  4NXN I;  1E3P A;  4WUB A;  5EKW A;  4LF5 E;  4BA2 B;  5BR8 I;  3Q1Q A;  1HNX E;  2BA1 G;  1OYP A;  2C37 B;  4LF4 I;  2NN6 B;  2UUC I;  5JEA E;  5GME A;  2V2V A;  4JI8 I;  1FKA E;  1XMO E;  3J7A G;  4FW3 A;  2UUA I;  4YY3 E;  2E1R A;  4JG4 A;  4WUD A;  3CWV A;  3U1Y A;  4LF5 I;  2CGE A;  5DNL A;  1HNX I;  4OX9 I;  2O1V A;  2WP8 B;  4JI6 I;  2A2D A;  1IBM E;  5L3J A;  4GKJ E;  1EA6 A;  1EI1 A;  4JI7 E;  1XMO I;  1Z5B A;  4IZK A;  4YY3 I;  3P3G A;  1N0V C;  1Z0E A;  4P52 A;  4DR5 I;  4DV6 E;  2V34 A;  3J81 C;  3Q6N A;  4XTJ A;  2JT2 A;  1IBM I;  4GKJ I;  1XMQ I;  2Q2E B;  2Z5B A;  4DUY E;  4FWG A;  1N34 I;  1Y4U A;  4JI7 I;  4DV2 I;  3J80 C;  3ZM7 A;  2JEA A;  1KTV A;  4P7A A;  4QNK A;  4IFD A;  2E5L E;  1UDN A;  2NN6 D;  3P06 A;  4DV6 I;  5C0X A;  5K36 E;  2VF3 A;  5K36 C;  4DUY I;  4FW6 A;  2UXB I;  3ZZU A;  1Y60 A;  4OZE A;  1R6L A;  4IZJ A;  4URL A;  3M7N G;  2JEB B;  2E5L I;  4B3S E;  4JI1 E;  4B3M E;  3JAM Q;  5IT9 Q;  2J65 A;  4AQY I;  2HK3 A;  3KRN A;  2PO2 B;  1D6T A;  2UU9 E;  5DRO A;  3WU3 A;  2O1T A;  1IBK E;  2O3Z A;  2OI2 A;  5DRP A;  4LFC E;  2HKJ A;  4M1K A;  4B3S I;  1XHK A;  1Z5C A;  4JI1 I;  4DR1 I;  1B62 A;  2GS8 A;  4LF7 E;  4HY1 A;  3PYG A;  5K36 F;  2UU9 I;  2NN6 C;  4JV5 I;  2BM0 A;  4MDT A;  2UXC E;  1N32 I;  1Z0B A;  1J5E E;  3GME A;  4LFC I;  4ED4 A;  2PO1 A;  1ZM3 A;  2J7K A;  5LL6 R;  3LNU A;  4LF7 I;  1H73 A;  3DD6 A;  1RR9 A;  4K0K E;  4EMD A;  2X36 A;  2VQF E;  3B82 A;  3M6A A;  2A2C A;  1J5E I;  2JE6 B;  3K17 A;  2PO0 B;  3NZK A;  2UUB E;  1Z59 A;  4R1F A;  1UDO A;  2Z5E A;  4K0K I;  2UUC E;  1KVK A;  2C38 A;  4JI8 E;  5JEA D;  4MU0 A;  2VQF I;  1FWK A;  2DEI A;  3QT8 A;  4U3B A;  1KIJ A;  4IFD E;  1N0U A;  4RPF A;  4BA2 A;  2C37 A;  3GLL A;  5C0X E;  4IFD C;  2NN6 A;  4HAC B;  4OX9 E;  4JI6 E;  4Z7C A;  1WUU A;  2VES A;  5C0X C;  2PNZ B;  3JAM C;  1UEK A;  5IT9 C;  1NZ0 A;  4KHP I;  2WNR B;  5FLX C;  4DR5 E;  3J7A M;  2WP8 A;  4LCH A;  1K47 A;  4DPT A;  4LCG A;  1XMQ E;  1N34 E;  3PS1 A;  4DV2 E;  1N36 E;  2CZ9 A;  4DV7 E;  4OO1 B;  4LFB E;  4GKK I;  4OKG A;  1ELO A;  4IFD F;  2R42 A;  5C0X F;  3OTO E;  3D4J A;  2BV3 A;  4FW4 A;  2UXB E;  2ZBK B;  1N36 I;  2HFU A;  1ZM2 A;  5A2Q Q;  3L7Z B;  3K1J A;  4DV7 I;  4X64 E;  3UHM A;  1H7U A;  2IOQ A;  4LFB I;  3QT7 A;  3T1H E;  1XNR E;  4DUZ I;  4DR4 E;  4DPY A;  2Z5C B;  1E3H A;  2BA0 D;  5GMD A;  3OTO I;  4AQY E;  4FW9 A;  4DV3 I;  2IOP A;  2PNM A;  4UTG A;  4AID A;  3M85 D;  2GQ0 A;  4YHH E;  4X64 I;  4QNJ A;  1YH8 A;  2JEB A;  1Z5A A;  2C39 B;  2AE8 A;  3T1H I;  4B3R I;  1XNR I;  4USM A;  4DR1 E;  4DR4 I;  4IS9 A;  4LPF A;  2PO2 A;  1OYR A;  2CG9 A;  1IBL E;  3CDI A;  4OO1 D;  4JV5 E;  1BKN A;  1N32 E;  3ZZT A;  4YHH I;  5JEA A;  1Z0C A;  5JEA B;  4AIM A;  3PS2 A;  1Y5Y A;  1FJG I;  2DEJ A;  2V8P A;  2NN6 E;  1USV A;  4MU1 A;  1IBL I;  2IES A; 
#chains in the Genus database with same CATH homology
 4LF6 E;  4ZVI A;  3WU6 A;  4JI2 E;  2O1U A;  1MX0 A;  1Y6Z A;  1Z0V A;  4WUC A;  5FWK A;  4DV5 E;  1FWL A;  4LF6 I;  1FI4 A;  3HUL A;  2HHH I;  4DR3 E;  4JI2 I;  4DU7 A;  1HNW E;  2HFS A;  1N33 I;  3J81 Q;  4DV5 I;  4LF8 E;  4DPW A;  3B8H A;  2BM1 A;  4N3O A;  4KQV A;  4DR3 I;  4LFA E;  4KHP E;  1HNW I;  4JI3 E;  1MG7 A;  4HAC A;  4LF8 I;  4FN5 A;  1Z0W A;  2EFG A;  3WU4 A;  4DV1 E;  1VIS A;  3PYF A;  3ZZ0 A;  1A6F A;  4LFA I;  3ZKD A;  4GKK E;  3ZKB A;  4JI3 I;  2X7I A;  1XNQ E;  3F0N A;  1S4E A;  4B3T E;  4X62 E;  4DR7 E;  4DV0 E;  2XEX A;  1I94 I;  4X66 I;  2AJ4 A;  4NXM I;  4DV1 I;  2F4V E;  1QZR A;  4USK A;  3K85 A;  1PVG A;  3T1Y I;  4LF9 E;  3GON A;  4JYA E;  1U2R A;  4DUZ E;  1HNZ E;  1ZXN A;  1XNQ I;  1USU A;  1Z0T A;  2VQE I;  4DR2 E;  4B3T I;  4X62 I;  4DR7 I;  4DV0 I;  1B63 A;  4DV3 E;  4JI4 E;  3H4L A;  1Z0G A;  2PNL A;  3PRY A;  2F4V I;  4LF9 I;  4B3R E;  1OJ4 A;  2Z5C A;  2V2Q A;  5LMU E;  4JYA I;  1HNZ I;  4IZK B;  4DR2 I;  1HK7 A;  1ZXM A;  4JI0 E;  4JI4 I;  3PYE A;  1HR0 E;  2Z5B B;  1DAR A;  5LMU I;  1FJG E;  4JI0 I;  2R3V A;  4DV4 E;  4DPU A;  2LJP A;  1HR0 I;  2WW4 A;  3QT6 A;  2HKE A;  1Y4S A;  1ZM4 A;  4IZJ B;  4DXL A;  1NHJ A;  3LPS A;  2HK2 A;  4HYM A;  4DV4 I;  4PU9 A;  2ZM6 E;  5IWA E;  4X65 E;  2HHH E;  3B78 A;  5FLX Q;  3WU5 A;  1ZM9 A;  3PYD A;  2NPF A;  1N33 E;  4HXZ A;  1H72 C;  1NHI A;  3HJC A;  1S16 A;  4B3M I;  4Z7Y A;  4JI5 E;  5LMN E;  2ZM6 I;  5IWA I;  1PIE A;  3LTO A;  3V5R A;  4X65 I;  4MYU A;  4FWH A;  3QT5 A;  4DR6 E;  2UXD E;  1PKP A;  1IBK I;  4PRV A;  5A2Q C;  2O1W A;  4UT4 A;  1NHH A;  4FWD A;  4JI5 I;  3V2U C;  5LMN I;  3J80 Q;  1MU5 A;  4DR6 I;  1H7S A;  2UXD I;  2UXC I;  1H74 A;  1KKH A;  4IZJ D;  3Q6M A;  4NXN E;  4I3H A;  5BR8 E;  1FNM A;  1I94 E;  4X66 E;  2ZIT A;  4NXM E;  4LF4 E;  4PRX A;  3T1Y E;  1RRE A;  4DU8 A;  2UUA E;  2UUB I;  2VQE E;  2V2Z A;  4DPX A;  4MYT A;  4NXN I;  4WUB A;  4LF5 E;  5BR8 I;  3Q1Q A;  1HNX E;  4LF4 I;  2UUC I;  5GME A;  2V2V A;  4JI8 I;  1FKA E;  1XMO E;  3J7A G;  2UUA I;  4YY3 E;  2E1R A;  4JG4 A;  4WUD A;  3CWV A;  4LF5 I;  2CGE A;  1HNX I;  4OX9 I;  2O1V A;  4JI6 I;  2A2D A;  1IBM E;  5L3J A;  4GKJ E;  1EA6 A;  1EI1 A;  4JI7 E;  1XMO I;  1Z5B A;  4IZK A;  4YY3 I;  1N0V C;  1Z0E A;  4P52 A;  4DR5 I;  4DV6 E;  2V34 A;  3J81 C;  3Q6N A;  4XTJ A;  1IBM I;  4GKJ I;  1XMQ I;  2Q2E B;  2Z5B A;  4DUY E;  4FWG A;  1N34 I;  1Y4U A;  4JI7 I;  4DV2 I;  3J80 C;  3ZM7 A;  1KTV A;  4P7A A;  2E5L E;  3P06 A;  4DV6 I;  2VF3 A;  4DUY I;  2UXB I;  3ZZU A;  4IZJ A;  4URL A;  2E5L I;  4B3S E;  4JI1 E;  4B3M E;  3JAM Q;  5IT9 Q;  4AQY I;  2HK3 A;  1D6T A;  2UU9 E;  3WU3 A;  2O1T A;  1IBK E;  2OI2 A;  4LFC E;  2HKJ A;  4M1K A;  4B3S I;  1XHK A;  1Z5C A;  4JI1 I;  4DR1 I;  1B62 A;  2GS8 A;  4LF7 E;  4HY1 A;  3PYG A;  2UU9 I;  4JV5 I;  2BM0 A;  2UXC E;  1N32 I;  1Z0B A;  1J5E E;  4LFC I;  4ED4 A;  1ZM3 A;  2J7K A;  5LL6 R;  3LNU A;  4LF7 I;  1H73 A;  1RR9 A;  4K0K E;  4EMD A;  2X36 A;  2VQF E;  3B82 A;  3M6A A;  2A2C A;  1J5E I;  3K17 A;  2UUB E;  1Z59 A;  4R1F A;  2Z5E A;  4K0K I;  2UUC E;  1KVK A;  4JI8 E;  2VQF I;  1FWK A;  2DEI A;  3QT8 A;  1KIJ A;  1N0U A;  4RPF A;  4HAC B;  4OX9 E;  4JI6 E;  4Z7C A;  1WUU A;  3JAM C;  1UEK A;  5IT9 C;  1NZ0 A;  4KHP I;  5FLX C;  4DR5 E;  3J7A M;  1K47 A;  4DPT A;  1XMQ E;  1N34 E;  4DV2 E;  1N36 E;  2CZ9 A;  4DV7 E;  4LFB E;  4GKK I;  1ELO A;  2R42 A;  3OTO E;  3D4J A;  2BV3 A;  2UXB E;  2ZBK B;  1N36 I;  2HFU A;  1ZM2 A;  5A2Q Q;  3K1J A;  4DV7 I;  4X64 E;  1H7U A;  2IOQ A;  4LFB I;  3QT7 A;  3T1H E;  1XNR E;  4DUZ I;  4DR4 E;  4DPY A;  2Z5C B;  5GMD A;  3OTO I;  4AQY E;  4FW9 A;  4DV3 I;  2IOP A;  2PNM A;  4UTG A;  2GQ0 A;  4YHH E;  4X64 I;  1Z5A A;  3T1H I;  4B3R I;  1XNR I;  4USM A;  4DR1 E;  4DR4 I;  2CG9 A;  1IBL E;  4JV5 E;  1BKN A;  1N32 E;  3ZZT A;  4YHH I;  1Z0C A;  1FJG I;  2DEJ A;  2V8P A;  1USV A;  1IBL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...