4B3SI

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3sI00
1FKAE 4X62I 1H72C 4JI8E 3WU6A 4WUBA 4JI0E 4AQYI 1HNZI 2UXDI 1ZM9A 4X66I 1ZM4A 3B8HA 1PVGA 3QT8A 2X36A 1XMQE 1PIEA 5GMDA 4OX9E 4DV5E 1KTVA 3GONA 2CZ9A 4FWGA 2OI2A 4DPUA 2F4VI 4JI7E 3LTOA 4LFCI 4DV4E 4JI4I 4DR6I 4DPXA 2AJ4A 4LF5E 2VQEI 3OTOE 4DR7E 4X66E 1HNWE 1FNMA 1IBKI 4DR3E 1IBLI 4LF8E 1N33E 4YY3I 2ZITA 4X64E 4DV3E 3PYFA 1XMOE 2Q2EB 4ED4A 2R3VA 4DUZE 2E5LI 4R1FA 5IT9Q 2A2DA 4DXLA 5FLXC 4JV5E 2HHHE 4JI3E 4P7AA 4NXME 4HACB 1PKPA 1Z0TA 1IBMI 4DV6E 4DV7I 4GKKI 3D4JA 4JI6I 4HY1A 4B3MI 4DR1E 4LFBE 2UU9I 1N32I 5LMNE 4JI2E 4B3TI 2V2QA 5IWAI 4RPFA 1N0UA 3JAMQ 4JI1I 4YHHI 1EI1A 4LF7I 4HACA 1DARA 1N34I 2UXBI 4LF9I 4DUYI 3M6AA 2HFSA 2VQFE 2HK2A 3V5RA 2EFGA 4DR2E 4LF6E 1RR9A 3QT6A 4GKJE 3J81C 2UUBI 1N36E 1XNRE 2VF3A 1NHJA 1HNXE 1MG7A 1ZXNA 3Q1QA 1J5EI 3T1YI 2ZM6I 4B3RI 1I94I 5A2QQ 4DV1I 3PYGA 4DV0I 1FJGI 1U2RA 2E1RA 3ZZ0A 1FWKA 4JYAI 1QZRA 2XEXA 1FWLA 2V8PA 3B82A 2UXCI 3WU4A 1XNQI 1NHHA 1HR0I 2X7IA 2BM0A 1H73A 1UEKA 4X62E 4AQYE 1HNZE 1J5EE 2BV3A 4KHPI 2UXDE 4JI5I 1WUUA 4P52A 4UT4A 5BR8I 4PU9A 1MX0A 1B62A 4X65I 5GMEA 4DR4I 4DV2I 3J80Q 2F4VE 4USMA 5LMUI 4LFCE 3WU5A 3ZZTA 1B63A 2UUCI 4JI4E 1Z5CA 2UUAI 4DR6E 3H4LA 4MYUA 1ZXMA 4KQVA 2VQEE 3K17A 4LFAI 1IBKE 1Z0GA 3V2UC 1K47A 2HFUA 1IBLE 4YY3E 4WUCA 1EA6A 4K0KI 5L3JA 2R42A 3T1HI 4NXNI 1NHIA 2E5LE 3ZKDA 5IT9C 3LPSA 1H7UA 1Z59A 2HKJA 4DPYA 4ZVIA 4JI8I 3WU3A 1NZ0A 4DR5I 1IBME 4JI0I 4DV7E 4GKKE 5LL6R 2HK3A 4JI6E 4JG4A 4B3ME 2UU9E 1N32E 4OX9I 4B3TE 4DV5I 1H7SA 4WUDA 5IWAE 1Z0CA 4JI1E 2DEJA 4YHHE 4JI7I 4LF7E 3LNUA 2DEIA 1N34E 4PRXA 2UXBE 4LF9E 2GS8A 1D6TA 4DUYE 4B3SI 4DR5E 2A2CA 2V34A 2J7KA 1VISA 4LF5I 3OTOI 4DR7I 4FN5A 2UUBE 1HNWI 3QT5A 4DR3I 3PYEA 4LF8I 4HXZA 1N33I 4HYMA 3T1YE 2HKEA 2ZM6E 4B3RE 5A2QC 1I94E 4X64I 4DV3I 1S16A 4DV1E 1XMOI 1N0VC 4DV0E 1KVKA 4FWHA 4DUZI 1FJGE 4DPWA 1RREA 3J7AM 1ELOA 4B3SE 4JYAE 3B78A 4JV5I 2UXCE 2HHHI 5FLXQ 4JI3I 1XNQE 4NXMI 1XHKA 4USKA 1HR0E 4DV6I 4DPTA 4DR1I 4KHPE 4EMDA 4JI5E 1Z5BA 4LFBI 4DU8A 4URLA 4UTGA 1ZM2A 5LMNI 4JI2I 1FI4A 5BR8E 1H74A 3HULA 4X65E 2WW4A 1ZM3A 4LF4I 4DR4E 1A6FA 3J80C 4DV2E 2V2ZA 1MU5A 4XTJA 3CWVA 5LMUE 2BM1A 2VQFI 2LJPA 1OJ4A 4DR2I 4LF6I 2NPFA 2UUCE 2V2VA 1KIJA 2UUAE 3PYDA 4GKJI 4Z7YA 2ZBKB 1N36I 1XNRI 1Z0VA 3J81Q 1KKHA 3K1JA 4PRVA 3J7AG 1HNXI 4I3HA 1Z0BA 3ZZUA 1Z0EA 3F0NA 4LFAE 4DU7A 3QT7A 1S4EA 4FW9A 1Z5AA 1XMQI 1BKNA 4LF4E 4M1KA 3JAMC 4K0KE 4Z7CA 3T1HE 4MYTA 4NXNE 4FWDA 1Z0WA 3ZM7A 3ZKBA 4DV4I
chains in the Genus database with same CATH superfamily
1FKAE 4X62I 1H72C 5K36C 4JI8E 3WU6A 2C37A 4WUBA 2PNLA 4JI0E 4AQYI 4LCGA 1HNZI 1USVA 2UXDI 4MU4A 1ZM9A 1Y5YA 4X66I 1ZM4A 2PNZA 3B8HA 1PVGA 3QT8A 2X36A 2NN6E 4AIMA 1XMQE 1PIEA 5GMDA 4U3DA 4OX9E 3H1CA 5K36D 4DV5E 1KTVA 3GONA 2C38A 4FW3A 2CZ9A 4FWGA 2OI2A 4DPUA 2F4VI 4JI7E 3LTOA 5C0XC 4LFCI 3M7ND 4OO1C 4DV4E 5JEAC 2O1WA 4IZKB 4JI4I 4DR6I 4DPXA 2AJ4A 4LF5E 1RHYA 2VQEI 2CGEA 3OTOE 4DR7E 3PS3A 4X66E 4AIDA 4N3OA 3CDIA 1HNWE 5C0XD 1FNMA 1IBKI 4DR3E 4OO1D 5JEAD 1IBLI 4LF8E 1N33E 4YY3I 4BA1B 2O1TA 2ZITA 5EL9A 2BA0G 4MU0A 4X64E 4LCHA 4DV3E 4IZKA 3PYFA 1XMOE 2Q2EB 5K36B 4ED4A 2R3VA 4DUZE 2E5LI 4R1FA 5IT9Q 2CG9A 2A2DA 4DXLA 5FLXC 4JV5E 2HHHE 2NN6A 4JI3E 4P7AA 4NXME 4HACB 3M85G 2J65A 1PKPA 1Z0TA 1IBMI 4DV6E 4DV7I 4GKKI 4BA1A 3D4JA 4JI6I 2Z5CB 4HY1A 1Y4UA 4B3MI 4DR1E 5K36A 4LFBE 2UU9I 1N32I 3L7ZA 5C0XB 5LMNE 4JI2E 4B3TI 4OO1B 5DRQA 5JEAB 2V2QA 5IWAI 4RPFA 1N0UA 3JAMQ 3U1YA 4JI1I 4YHHI 1EI1A 3P3EA 4LF7I 4HACA 1DARA 1N34I 4FW5A 4FW6A 2UXBI 4LF9I 4DUYI 3M6AA 2HFSA 2VQFE 2HK2A 2JEBB 2O1VA 3V5RA 2EFGA 4DR2E 4LF6E 1RR9A 3QT6A 5C0XA 4GKJE 2WNRA 3J81C 4OO1A 2UUBI 1N36E 5JEAA 1XNRE 2VF3A 1NHJA 2WP8B 1OYRA 1HNXE 1MG7A 1ZXNA 3Q1QA 1J5EI 3P3GA 3T1YI 4GQUA 2IOPA 5EKWA 2ZM6I 4B3RI 1OYPA 1I94I 2GO4A 1R6LA 5A2QQ 4DV1I 3PYGA 2JEBA 4DV0I 1FJGI 1U2RA 2E1RA 3ZZ0A 1FWKA 5DNXA 4JYAI 1QZRA 2XEXA 5K36E 2WP8A 1FWLA 2O3ZA 2V8PA 3B82A 2UXCI 3WU4A 1XNQI 1NHHA 1HR0I 2X7IA 2BM0A 1H73A 1UEKA 4X62E 5DROA 1YHCA 4AQYE 1HNZE 1J5EE 2BV3A 4KHPI 2UXDE 4JI5I 2GO3A 2JT2A 1WUUA 3U1KA 2JE6B 4P52A 4UT4A 5BR8I 2IOQA 4MU3A 1Y60A 4PU9A 1MX0A 1B62A 1P42A 4X65I 1YH8A 5GMEA 2PO0B 5C0XE 5DRRA 4DR4I 1OYSA 1Y4SA 4OO1E 5JEAE 2PNMA 4DV2I 2Z5BB 4BA2B 3J80Q 2F4VE 4LPFA 4USMA 2NN6F 5LMUI 4LFCE 3B4TA 4ISAA 3PS2A 3WU5A 3ZZTA 1B63A 2UUCI 2IESA 4JI4E 1Z5CA 2UUAI 4AM3A 3K85A 4DR6E 4OKGA 3H4LA 4MYUA 1ZXMA 2JE6A 4KQVA 2VQEE 2IERA 3K17A 2BA1G 2PO0A 4LFAI 1IBKE 1Z0GA 2PO2B 3V2UC 1K47A 2HFUA 1IBLE 2Z5BA 4BA2A 3P3CA 4YY3E 4WUCA 1EA6A 4K0KI 4IFDF 5L3JA 2R42A 3T1HI 4NXNI 3PS1A 1NHIA 1Y6ZA 2E5LE 3ZKDA 5IT9C 1E3HA 3LPSA 1H7UA 1Z59A 2HKJA 2PO2A 4DPYA 2VESA 4ZVIA 2Z5CA 4JI8I 3WU3A 1NZ0A 4DR5I 1IBME 4JI0I 4DV7E 4GKKE 5DNLA 5LL6R 3M7NG 2HK3A 2BA0D 4U3BA 4JI6E 4FW4A 4JG4A 2C37B 3GLLA 4B3ME 2UU9E 1N32E 5DRPA 4OX9I 1UDOA 4NBQA 4B3TE 4DV5I 1H7SA 4WUDA 2NN6C 5IWAE 1Z0CA 2Z5EA 4JI1E 2DEJA 4YHHE 3M85D 4JI7I 1XXEA 3LNUA 4LF7E 2DEIA 1N34E 3HKMA 4PRXA 2UXBE 4LF9E 2GS8A 1D6TA 4DUYE 4B3SI 3PRYA 4MQYA 4DR5E 2A2CA 2V34A 2J7KA 1VISA 2NN6D 2O1UA 4LF5I 3OTOI 4DR7I 4FN5A 2UUBE 1HNWI 3P76A 3QT5A 4DR3I 3PYEA 2PO1B 4LF8I 4HXZA 1N33I 4HYMA 3T1YE 2HKEA 4QNJA 4IFDC 3P06A 2ZM6E 4B3RE 5A2QC 1I94E 4X64I 4DV3I 1S16A 3DD6A 4DV1E 1XMOI 1N0VC 4J3DA 4DV0E 1KVKA 4FWHA 3HJCA 4DUZI 2F1DA 4DPWA 1FJGE 3GMEA 1RREA 3J7AM 1UDQA 1ELOA 4B3SE 1E3PA 4JYAE 4IFDD 3B78A 4JV5I 2UXCE 2HHHI 5FLXQ 2PO1A 4JI3I 1XNQE 4NXMI 1XHKA 4IZJD 4USKA 1HR0E 4QNKA 4DV6I 4IS9A 4IFDE 1UDNA 2NN6B 2AE8A 4DPTA 5K36F 4DR1I 4KHPE 4EMDA 4JI5E 1Z5BA 4LFBI 4DU8A 4URLA 4UTGA 1USUA 1ZM2A 5LMNI 4JI2I 1VI7A 1FI4A 5BR8E 1H74A 2C39B 3HULA 3L7ZB 4X65E 3UHMA 3KRNA 2WW4A 1ZM3A 3CDJA 4LF4I 4DR4E 1A6FA 3J80C 4DV2E 2V2ZA 1MU5A 4XTJA 3CWVA 5LMUE 2BM1A 2VQFI 2LJPA 1OJ4A 4DR2I 4LF6I 2CVEA 2NPFA 2UUCE 2V2VA 1KIJA 2JEAB 5C0XF 2UUAE 3PYDA 4GKJI 4LCFA 4Z7YA 4IFDB 4OO1F 2GQ0A 2ZBKB 5ELWA 5JEAF 1N36I 1XNRI 1Z0VA 3J81Q 1KKHA 4IZJB 3K1JA 4FW7A 1R6MA 2C39A 4OZEA 4PRVA 3J7AG 4MDTA 4MU1A 1HNXI 2BR2B 4I3HA 1Z0BA 2WNRB 3ZZUA 1HK7A 1Z0EA 3F0NA 4LFAE 3Q6NA 1UDSA 4DU7A 3QT7A 1S4EA 4FW9A 1Z5AA 1XMQI 4LOMA 1BKNA 4LF4E 2PNZB 4M1KA 2JEAA 3JAMC 4K0KE 4Z7CA 4IFDA 3T1HE 4MYTA 3GCMA 4NXNE 3NZKA 4IZJA 5FWKA 3Q6MA 2BA1D 4FWDA 2C38B 2BR2A 1Z0WA 3ZM7A 3ZKBA 4DV4I
chains in the Genus database with same CATH topology
1FKAE 4X62I 1H72C 4JI8E 3WU6A 4WUBA 2PNLA 4JI0E 4AQYI 1HNZI 1USVA 2UXDI 1ZM9A 4X66I 1ZM4A 3B8HA 1PVGA 3QT8A 2X36A 1XMQE 1PIEA 5GMDA 4OX9E 4DV5E 1KTVA 3GONA 2CZ9A 4FWGA 2OI2A 4DPUA 2F4VI 4JI7E 3LTOA 4LFCI 4DV4E 2O1WA 4IZKB 4JI4I 4DR6I 4DPXA 2AJ4A 4LF5E 2VQEI 2CGEA 3OTOE 4DR7E 4X66E 4N3OA 1HNWE 1FNMA 1IBKI 4DR3E 1IBLI 4LF8E 1N33E 4YY3I 2O1TA 2ZITA 4X64E 4DV3E 4IZKA 3PYFA 1XMOE 2Q2EB 4ED4A 2R3VA 4DUZE 2E5LI 4R1FA 5IT9Q 2CG9A 2A2DA 4DXLA 5FLXC 4JV5E 2HHHE 4JI3E 4P7AA 4NXME 4HACB 1PKPA 1Z0TA 1IBMI 4DV6E 4DV7I 4GKKI 3D4JA 4JI6I 2Z5CB 4HY1A 1Y4UA 4B3MI 4DR1E 4LFBE 2UU9I 1N32I 5LMNE 4JI2E 4B3TI 2V2QA 5IWAI 4RPFA 1N0UA 3JAMQ 4JI1I 4YHHI 1EI1A 4LF7I 4HACA 1DARA 1N34I 2UXBI 4LF9I 4DUYI 3M6AA 2HFSA 2VQFE 2HK2A 2O1VA 3V5RA 2EFGA 4DR2E 4LF6E 1RR9A 3QT6A 4GKJE 3J81C 2UUBI 1N36E 1XNRE 2VF3A 1NHJA 1HNXE 1MG7A 1ZXNA 3Q1QA 1J5EI 3T1YI 2IOPA 2ZM6I 4B3RI 1I94I 5A2QQ 4DV1I 3PYGA 4DV0I 1FJGI 1U2RA 2E1RA 3ZZ0A 1FWKA 4JYAI 1QZRA 2XEXA 1FWLA 2V8PA 3B82A 2UXCI 3WU4A 1XNQI 1NHHA 1HR0I 2X7IA 2BM0A 1H73A 1UEKA 4X62E 4AQYE 1HNZE 1J5EE 2BV3A 4KHPI 2UXDE 4JI5I 1WUUA 4P52A 4UT4A 5BR8I 2IOQA 4PU9A 1MX0A 1B62A 4X65I 5GMEA 4DR4I 1Y4SA 2PNMA 4DV2I 2Z5BB 3J80Q 2F4VE 4USMA 5LMUI 4LFCE 3WU5A 3ZZTA 1B63A 2UUCI 4JI4E 1Z5CA 2UUAI 4DR6E 3K85A 3H4LA 4MYUA 1ZXMA 4KQVA 2VQEE 3K17A 4LFAI 1IBKE 1Z0GA 3V2UC 1K47A 2HFUA 1IBLE 2Z5BA 4YY3E 4WUCA 1EA6A 4K0KI 5L3JA 2R42A 3T1HI 4NXNI 1NHIA 1Y6ZA 2E5LE 3ZKDA 5IT9C 3LPSA 1H7UA 1Z59A 2HKJA 4DPYA 4ZVIA 2Z5CA 4JI8I 3WU3A 1NZ0A 4DR5I 1IBME 4JI0I 4DV7E 4GKKE 5LL6R 2HK3A 4JI6E 4JG4A 4B3ME 2UU9E 1N32E 4OX9I 4B3TE 4DV5I 1H7SA 4WUDA 5IWAE 1Z0CA 2Z5EA 4JI1E 2DEJA 4YHHE 4JI7I 4LF7E 3LNUA 2DEIA 1N34E 4PRXA 2UXBE 4LF9E 2GS8A 1D6TA 4DUYE 4B3SI 3PRYA 4DR5E 2A2CA 2V34A 2J7KA 1VISA 2O1UA 4LF5I 3OTOI 4DR7I 4FN5A 2UUBE 1HNWI 3QT5A 4DR3I 3PYEA 4LF8I 4HXZA 1N33I 4HYMA 3T1YE 2HKEA 2ZM6E 3P06A 4B3RE 5A2QC 1I94E 4X64I 4DV3I 1S16A 4DV1E 1XMOI 1N0VC 4DV0E 1KVKA 4FWHA 3HJCA 4DUZI 1FJGE 4DPWA 1RREA 3J7AM 1ELOA 4B3SE 4JYAE 3B78A 4JV5I 2UXCE 2HHHI 5FLXQ 4JI3I 1XNQE 4NXMI 1XHKA 4IZJD 4USKA 1HR0E 4DV6I 4DPTA 4DR1I 4KHPE 4EMDA 4JI5E 1Z5BA 4LFBI 4DU8A 4URLA 4UTGA 1USUA 1ZM2A 5LMNI 4JI2I 1FI4A 5BR8E 1H74A 3HULA 4X65E 2WW4A 1ZM3A 4LF4I 4DR4E 1A6FA 3J80C 4DV2E 2V2ZA 1MU5A 4XTJA 3CWVA 5LMUE 2BM1A 2VQFI 2LJPA 1OJ4A 4DR2I 4LF6I 2NPFA 2UUCE 2V2VA 1KIJA 2UUAE 3PYDA 4GKJI 4Z7YA 2GQ0A 2ZBKB 1N36I 1XNRI 1Z0VA 3J81Q 1KKHA 4IZJB 3K1JA 4PRVA 3J7AG 1HNXI 4I3HA 1Z0BA 3ZZUA 1HK7A 1Z0EA 3F0NA 4LFAE 3Q6NA 4DU7A 3QT7A 1S4EA 4FW9A 1Z5AA 1XMQI 1BKNA 4LF4E 4M1KA 3JAMC 4K0KE 4Z7CA 3T1HE 4MYTA 4NXNE 4IZJA 5FWKA 3Q6MA 4FWDA 1Z0WA 3ZM7A 3ZKBA 4DV4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKA E;  4X62 I;  1H72 C;  4JI8 E;  3WU6 A;  4WUB A;  4JI0 E;  4AQY I;  1HNZ I;  2UXD I;  1ZM9 A;  4X66 I;  1ZM4 A;  3B8H A;  1PVG A;  3QT8 A;  2X36 A;  1XMQ E;  1PIE A;  5GMD A;  4OX9 E;  4DV5 E;  1KTV A;  3GON A;  2CZ9 A;  4FWG A;  2OI2 A;  4DPU A;  2F4V I;  4JI7 E;  3LTO A;  4LFC I;  4DV4 E;  4JI4 I;  4DR6 I;  4DPX A;  2AJ4 A;  4LF5 E;  2VQE I;  3OTO E;  4DR7 E;  4X66 E;  1HNW E;  1FNM A;  1IBK I;  4DR3 E;  1IBL I;  4LF8 E;  1N33 E;  4YY3 I;  2ZIT A;  4X64 E;  4DV3 E;  3PYF A;  1XMO E;  2Q2E B;  4ED4 A;  2R3V A;  4DUZ E;  2E5L I;  4R1F A;  5IT9 Q;  2A2D A;  4DXL A;  5FLX C;  4JV5 E;  2HHH E;  4JI3 E;  4P7A A;  4NXM E;  4HAC B;  1PKP A;  1Z0T A;  1IBM I;  4DV6 E;  4DV7 I;  4GKK I;  3D4J A;  4JI6 I;  4HY1 A;  4B3M I;  4DR1 E;  4LFB E;  2UU9 I;  1N32 I;  5LMN E;  4JI2 E;  4B3T I;  2V2Q A;  5IWA I;  4RPF A;  1N0U A;  3JAM Q;  4JI1 I;  4YHH I;  1EI1 A;  4LF7 I;  4HAC A;  1DAR A;  1N34 I;  2UXB I;  4LF9 I;  4DUY I;  3M6A A;  2HFS A;  2VQF E;  2HK2 A;  3V5R A;  2EFG A;  4DR2 E;  4LF6 E;  1RR9 A;  3QT6 A;  4GKJ E;  3J81 C;  2UUB I;  1N36 E;  1XNR E;  2VF3 A;  1NHJ A;  1HNX E;  1MG7 A;  1ZXN A;  3Q1Q A;  1J5E I;  3T1Y I;  2ZM6 I;  4B3R I;  1I94 I;  5A2Q Q;  4DV1 I;  3PYG A;  4DV0 I;  1FJG I;  1U2R A;  2E1R A;  3ZZ0 A;  1FWK A;  4JYA I;  1QZR A;  2XEX A;  1FWL A;  2V8P A;  3B82 A;  2UXC I;  3WU4 A;  1XNQ I;  1NHH A;  1HR0 I;  2X7I A;  2BM0 A;  1H73 A;  1UEK A;  4X62 E;  4AQY E;  1HNZ E;  1J5E E;  2BV3 A;  4KHP I;  2UXD E;  4JI5 I;  1WUU A;  4P52 A;  4UT4 A;  5BR8 I;  4PU9 A;  1MX0 A;  1B62 A;  4X65 I;  5GME A;  4DR4 I;  4DV2 I;  3J80 Q;  2F4V E;  4USM A;  5LMU I;  4LFC E;  3WU5 A;  3ZZT A;  1B63 A;  2UUC I;  4JI4 E;  1Z5C A;  2UUA I;  4DR6 E;  3H4L A;  4MYU A;  1ZXM A;  4KQV A;  2VQE E;  3K17 A;  4LFA I;  1IBK E;  1Z0G A;  3V2U C;  1K47 A;  2HFU A;  1IBL E;  4YY3 E;  4WUC A;  1EA6 A;  4K0K I;  5L3J A;  2R42 A;  3T1H I;  4NXN I;  1NHI A;  2E5L E;  3ZKD A;  5IT9 C;  3LPS A;  1H7U A;  1Z59 A;  2HKJ A;  4DPY A;  4ZVI A;  4JI8 I;  3WU3 A;  1NZ0 A;  4DR5 I;  1IBM E;  4JI0 I;  4DV7 E;  4GKK E;  5LL6 R;  2HK3 A;  4JI6 E;  4JG4 A;  4B3M E;  2UU9 E;  1N32 E;  4OX9 I;  4B3T E;  4DV5 I;  1H7S A;  4WUD A;  5IWA E;  1Z0C A;  4JI1 E;  2DEJ A;  4YHH E;  4JI7 I;  4LF7 E;  3LNU A;  2DEI A;  1N34 E;  4PRX A;  2UXB E;  4LF9 E;  2GS8 A;  1D6T A;  4DUY E;  4B3S I;  4DR5 E;  2A2C A;  2V34 A;  2J7K A;  1VIS A;  4LF5 I;  3OTO I;  4DR7 I;  4FN5 A;  2UUB E;  1HNW I;  3QT5 A;  4DR3 I;  3PYE A;  4LF8 I;  4HXZ A;  1N33 I;  4HYM A;  3T1Y E;  2HKE A;  2ZM6 E;  4B3R E;  5A2Q C;  1I94 E;  4X64 I;  4DV3 I;  1S16 A;  4DV1 E;  1XMO I;  1N0V C;  4DV0 E;  1KVK A;  4FWH A;  4DUZ I;  1FJG E;  4DPW A;  1RRE A;  3J7A M;  1ELO A;  4B3S E;  4JYA E;  3B78 A;  4JV5 I;  2UXC E;  2HHH I;  5FLX Q;  4JI3 I;  1XNQ E;  4NXM I;  1XHK A;  4USK A;  1HR0 E;  4DV6 I;  4DPT A;  4DR1 I;  4KHP E;  4EMD A;  4JI5 E;  1Z5B A;  4LFB I;  4DU8 A;  4URL A;  4UTG A;  1ZM2 A;  5LMN I;  4JI2 I;  1FI4 A;  5BR8 E;  1H74 A;  3HUL A;  4X65 E;  2WW4 A;  1ZM3 A;  4LF4 I;  4DR4 E;  1A6F A;  3J80 C;  4DV2 E;  2V2Z A;  1MU5 A;  4XTJ A;  3CWV A;  5LMU E;  2BM1 A;  2VQF I;  2LJP A;  1OJ4 A;  4DR2 I;  4LF6 I;  2NPF A;  2UUC E;  2V2V A;  1KIJ A;  2UUA E;  3PYD A;  4GKJ I;  4Z7Y A;  2ZBK B;  1N36 I;  1XNR I;  1Z0V A;  3J81 Q;  1KKH A;  3K1J A;  4PRV A;  3J7A G;  1HNX I;  4I3H A;  1Z0B A;  3ZZU A;  1Z0E A;  3F0N A;  4LFA E;  4DU7 A;  3QT7 A;  1S4E A;  4FW9 A;  1Z5A A;  1XMQ I;  1BKN A;  4LF4 E;  4M1K A;  3JAM C;  4K0K E;  4Z7C A;  3T1H E;  4MYT A;  4NXN E;  4FWD A;  1Z0W A;  3ZM7 A;  3ZKB A;  4DV4 I; 
#chains in the Genus database with same CATH topology
 1FKA E;  4X62 I;  1H72 C;  5K36 C;  4JI8 E;  3WU6 A;  2C37 A;  4WUB A;  2PNL A;  4JI0 E;  4AQY I;  4LCG A;  1HNZ I;  1USV A;  2UXD I;  4MU4 A;  1ZM9 A;  1Y5Y A;  4X66 I;  1ZM4 A;  2PNZ A;  3B8H A;  1PVG A;  3QT8 A;  2X36 A;  2NN6 E;  4AIM A;  1XMQ E;  1PIE A;  5GMD A;  4U3D A;  4OX9 E;  3H1C A;  5K36 D;  4DV5 E;  1KTV A;  3GON A;  2C38 A;  4FW3 A;  2CZ9 A;  4FWG A;  2OI2 A;  4DPU A;  2F4V I;  4JI7 E;  3LTO A;  5C0X C;  4LFC I;  3M7N D;  4OO1 C;  4DV4 E;  5JEA C;  2O1W A;  4IZK B;  4JI4 I;  4DR6 I;  4DPX A;  2AJ4 A;  4LF5 E;  1RHY A;  2VQE I;  2CGE A;  3OTO E;  4DR7 E;  3PS3 A;  4X66 E;  4AID A;  4N3O A;  3CDI A;  1HNW E;  5C0X D;  1FNM A;  1IBK I;  4DR3 E;  4OO1 D;  5JEA D;  1IBL I;  4LF8 E;  1N33 E;  4YY3 I;  4BA1 B;  2O1T A;  2ZIT A;  5EL9 A;  2BA0 G;  4MU0 A;  4X64 E;  4LCH A;  4DV3 E;  4IZK A;  3PYF A;  1XMO E;  2Q2E B;  5K36 B;  4ED4 A;  2R3V A;  4DUZ E;  2E5L I;  4R1F A;  5IT9 Q;  2CG9 A;  2A2D A;  4DXL A;  5FLX C;  4JV5 E;  2HHH E;  2NN6 A;  4JI3 E;  4P7A A;  4NXM E;  4HAC B;  3M85 G;  2J65 A;  1PKP A;  1Z0T A;  1IBM I;  4DV6 E;  4DV7 I;  4GKK I;  4BA1 A;  3D4J A;  4JI6 I;  2Z5C B;  4HY1 A;  1Y4U A;  4B3M I;  4DR1 E;  5K36 A;  4LFB E;  2UU9 I;  1N32 I;  3L7Z A;  5C0X B;  5LMN E;  4JI2 E;  4B3T I;  4OO1 B;  5DRQ A;  5JEA B;  2V2Q A;  5IWA I;  4RPF A;  1N0U A;  3JAM Q;  3U1Y A;  4JI1 I;  4YHH I;  1EI1 A;  3P3E A;  4LF7 I;  4HAC A;  1DAR A;  1N34 I;  4FW5 A;  4FW6 A;  2UXB I;  4LF9 I;  4DUY I;  3M6A A;  2HFS A;  2VQF E;  2HK2 A;  2JEB B;  2O1V A;  3V5R A;  2EFG A;  4DR2 E;  4LF6 E;  1RR9 A;  3QT6 A;  5C0X A;  4GKJ E;  2WNR A;  3J81 C;  4OO1 A;  2UUB I;  1N36 E;  5JEA A;  1XNR E;  2VF3 A;  1NHJ A;  2WP8 B;  1OYR A;  1HNX E;  1MG7 A;  1ZXN A;  3Q1Q A;  1J5E I;  3P3G A;  3T1Y I;  4GQU A;  2IOP A;  5EKW A;  2ZM6 I;  4B3R I;  1OYP A;  1I94 I;  2GO4 A;  1R6L A;  5A2Q Q;  4DV1 I;  3PYG A;  2JEB A;  4DV0 I;  1FJG I;  1U2R A;  2E1R A;  3ZZ0 A;  1FWK A;  5DNX A;  4JYA I;  1QZR A;  2XEX A;  5K36 E;  2WP8 A;  1FWL A;  2O3Z A;  2V8P A;  3B82 A;  2UXC I;  3WU4 A;  1XNQ I;  1NHH A;  1HR0 I;  2X7I A;  2BM0 A;  1H73 A;  1UEK A;  4X62 E;  5DRO A;  1YHC A;  4AQY E;  1HNZ E;  1J5E E;  2BV3 A;  4KHP I;  2UXD E;  4JI5 I;  2GO3 A;  2JT2 A;  1WUU A;  3U1K A;  2JE6 B;  4P52 A;  4UT4 A;  5BR8 I;  2IOQ A;  4MU3 A;  1Y60 A;  4PU9 A;  1MX0 A;  1B62 A;  1P42 A;  4X65 I;  1YH8 A;  5GME A;  2PO0 B;  5C0X E;  5DRR A;  4DR4 I;  1OYS A;  1Y4S A;  4OO1 E;  5JEA E;  2PNM A;  4DV2 I;  2Z5B B;  4BA2 B;  3J80 Q;  2F4V E;  4LPF A;  4USM A;  2NN6 F;  5LMU I;  4LFC E;  3B4T A;  4ISA A;  3PS2 A;  3WU5 A;  3ZZT A;  1B63 A;  2UUC I;  2IES A;  4JI4 E;  1Z5C A;  2UUA I;  4AM3 A;  3K85 A;  4DR6 E;  4OKG A;  3H4L A;  4MYU A;  1ZXM A;  2JE6 A;  4KQV A;  2VQE E;  2IER A;  3K17 A;  2BA1 G;  2PO0 A;  4LFA I;  1IBK E;  1Z0G A;  2PO2 B;  3V2U C;  1K47 A;  2HFU A;  1IBL E;  2Z5B A;  4BA2 A;  3P3C A;  4YY3 E;  4WUC A;  1EA6 A;  4K0K I;  4IFD F;  5L3J A;  2R42 A;  3T1H I;  4NXN I;  3PS1 A;  1NHI A;  1Y6Z A;  2E5L E;  3ZKD A;  5IT9 C;  1E3H A;  3LPS A;  1H7U A;  1Z59 A;  2HKJ A;  2PO2 A;  4DPY A;  2VES A;  4ZVI A;  2Z5C A;  4JI8 I;  3WU3 A;  1NZ0 A;  4DR5 I;  1IBM E;  4JI0 I;  4DV7 E;  4GKK E;  5DNL A;  5LL6 R;  3M7N G;  2HK3 A;  2BA0 D;  4U3B A;  4JI6 E;  4FW4 A;  4JG4 A;  2C37 B;  3GLL A;  4B3M E;  2UU9 E;  1N32 E;  5DRP A;  4OX9 I;  1UDO A;  4NBQ A;  4B3T E;  4DV5 I;  1H7S A;  4WUD A;  2NN6 C;  5IWA E;  1Z0C A;  2Z5E A;  4JI1 E;  2DEJ A;  4YHH E;  3M85 D;  4JI7 I;  1XXE A;  3LNU A;  4LF7 E;  2DEI A;  1N34 E;  3HKM A;  4PRX A;  2UXB E;  4LF9 E;  2GS8 A;  1D6T A;  4DUY E;  4B3S I;  3PRY A;  4MQY A;  4DR5 E;  2A2C A;  2V34 A;  2J7K A;  1VIS A;  2NN6 D;  2O1U A;  4LF5 I;  3OTO I;  4DR7 I;  4FN5 A;  2UUB E;  1HNW I;  3P76 A;  3QT5 A;  4DR3 I;  3PYE A;  2PO1 B;  4LF8 I;  4HXZ A;  1N33 I;  4HYM A;  3T1Y E;  2HKE A;  4QNJ A;  4IFD C;  3P06 A;  2ZM6 E;  4B3R E;  5A2Q C;  1I94 E;  4X64 I;  4DV3 I;  1S16 A;  3DD6 A;  4DV1 E;  1XMO I;  1N0V C;  4J3D A;  4DV0 E;  1KVK A;  4FWH A;  3HJC A;  4DUZ I;  2F1D A;  4DPW A;  1FJG E;  3GME A;  1RRE A;  3J7A M;  1UDQ A;  1ELO A;  4B3S E;  1E3P A;  4JYA E;  4IFD D;  3B78 A;  4JV5 I;  2UXC E;  2HHH I;  5FLX Q;  2PO1 A;  4JI3 I;  1XNQ E;  4NXM I;  1XHK A;  4IZJ D;  4USK A;  1HR0 E;  4QNK A;  4DV6 I;  4IS9 A;  4IFD E;  1UDN A;  2NN6 B;  2AE8 A;  4DPT A;  5K36 F;  4DR1 I;  4KHP E;  4EMD A;  4JI5 E;  1Z5B A;  4LFB I;  4DU8 A;  4URL A;  4UTG A;  1USU A;  1ZM2 A;  5LMN I;  4JI2 I;  1VI7 A;  1FI4 A;  5BR8 E;  1H74 A;  2C39 B;  3HUL A;  3L7Z B;  4X65 E;  3UHM A;  3KRN A;  2WW4 A;  1ZM3 A;  3CDJ A;  4LF4 I;  4DR4 E;  1A6F A;  3J80 C;  4DV2 E;  2V2Z A;  1MU5 A;  4XTJ A;  3CWV A;  5LMU E;  2BM1 A;  2VQF I;  2LJP A;  1OJ4 A;  4DR2 I;  4LF6 I;  2CVE A;  2NPF A;  2UUC E;  2V2V A;  1KIJ A;  2JEA B;  5C0X F;  2UUA E;  3PYD A;  4GKJ I;  4LCF A;  4Z7Y A;  4IFD B;  4OO1 F;  2GQ0 A;  2ZBK B;  5ELW A;  5JEA F;  1N36 I;  1XNR I;  1Z0V A;  3J81 Q;  1KKH A;  4IZJ B;  3K1J A;  4FW7 A;  1R6M A;  2C39 A;  4OZE A;  4PRV A;  3J7A G;  4MDT A;  4MU1 A;  1HNX I;  2BR2 B;  4I3H A;  1Z0B A;  2WNR B;  3ZZU A;  1HK7 A;  1Z0E A;  3F0N A;  4LFA E;  3Q6N A;  1UDS A;  4DU7 A;  3QT7 A;  1S4E A;  4FW9 A;  1Z5A A;  1XMQ I;  4LOM A;  1BKN A;  4LF4 E;  2PNZ B;  4M1K A;  2JEA A;  3JAM C;  4K0K E;  4Z7C A;  4IFD A;  3T1H E;  4MYT A;  3GCM A;  4NXN E;  3NZK A;  4IZJ A;  5FWK A;  3Q6M A;  2BA1 D;  4FWD A;  2C38 B;  2BR2 A;  1Z0W A;  3ZM7 A;  3ZKB A;  4DV4 I; 
#chains in the Genus database with same CATH homology
 1FKA E;  4X62 I;  1H72 C;  4JI8 E;  3WU6 A;  4WUB A;  2PNL A;  4JI0 E;  4AQY I;  1HNZ I;  1USV A;  2UXD I;  1ZM9 A;  4X66 I;  1ZM4 A;  3B8H A;  1PVG A;  3QT8 A;  2X36 A;  1XMQ E;  1PIE A;  5GMD A;  4OX9 E;  4DV5 E;  1KTV A;  3GON A;  2CZ9 A;  4FWG A;  2OI2 A;  4DPU A;  2F4V I;  4JI7 E;  3LTO A;  4LFC I;  4DV4 E;  2O1W A;  4IZK B;  4JI4 I;  4DR6 I;  4DPX A;  2AJ4 A;  4LF5 E;  2VQE I;  2CGE A;  3OTO E;  4DR7 E;  4X66 E;  4N3O A;  1HNW E;  1FNM A;  1IBK I;  4DR3 E;  1IBL I;  4LF8 E;  1N33 E;  4YY3 I;  2O1T A;  2ZIT A;  4X64 E;  4DV3 E;  4IZK A;  3PYF A;  1XMO E;  2Q2E B;  4ED4 A;  2R3V A;  4DUZ E;  2E5L I;  4R1F A;  5IT9 Q;  2CG9 A;  2A2D A;  4DXL A;  5FLX C;  4JV5 E;  2HHH E;  4JI3 E;  4P7A A;  4NXM E;  4HAC B;  1PKP A;  1Z0T A;  1IBM I;  4DV6 E;  4DV7 I;  4GKK I;  3D4J A;  4JI6 I;  2Z5C B;  4HY1 A;  1Y4U A;  4B3M I;  4DR1 E;  4LFB E;  2UU9 I;  1N32 I;  5LMN E;  4JI2 E;  4B3T I;  2V2Q A;  5IWA I;  4RPF A;  1N0U A;  3JAM Q;  4JI1 I;  4YHH I;  1EI1 A;  4LF7 I;  4HAC A;  1DAR A;  1N34 I;  2UXB I;  4LF9 I;  4DUY I;  3M6A A;  2HFS A;  2VQF E;  2HK2 A;  2O1V A;  3V5R A;  2EFG A;  4DR2 E;  4LF6 E;  1RR9 A;  3QT6 A;  4GKJ E;  3J81 C;  2UUB I;  1N36 E;  1XNR E;  2VF3 A;  1NHJ A;  1HNX E;  1MG7 A;  1ZXN A;  3Q1Q A;  1J5E I;  3T1Y I;  2IOP A;  2ZM6 I;  4B3R I;  1I94 I;  5A2Q Q;  4DV1 I;  3PYG A;  4DV0 I;  1FJG I;  1U2R A;  2E1R A;  3ZZ0 A;  1FWK A;  4JYA I;  1QZR A;  2XEX A;  1FWL A;  2V8P A;  3B82 A;  2UXC I;  3WU4 A;  1XNQ I;  1NHH A;  1HR0 I;  2X7I A;  2BM0 A;  1H73 A;  1UEK A;  4X62 E;  4AQY E;  1HNZ E;  1J5E E;  2BV3 A;  4KHP I;  2UXD E;  4JI5 I;  1WUU A;  4P52 A;  4UT4 A;  5BR8 I;  2IOQ A;  4PU9 A;  1MX0 A;  1B62 A;  4X65 I;  5GME A;  4DR4 I;  1Y4S A;  2PNM A;  4DV2 I;  2Z5B B;  3J80 Q;  2F4V E;  4USM A;  5LMU I;  4LFC E;  3WU5 A;  3ZZT A;  1B63 A;  2UUC I;  4JI4 E;  1Z5C A;  2UUA I;  4DR6 E;  3K85 A;  3H4L A;  4MYU A;  1ZXM A;  4KQV A;  2VQE E;  3K17 A;  4LFA I;  1IBK E;  1Z0G A;  3V2U C;  1K47 A;  2HFU A;  1IBL E;  2Z5B A;  4YY3 E;  4WUC A;  1EA6 A;  4K0K I;  5L3J A;  2R42 A;  3T1H I;  4NXN I;  1NHI A;  1Y6Z A;  2E5L E;  3ZKD A;  5IT9 C;  3LPS A;  1H7U A;  1Z59 A;  2HKJ A;  4DPY A;  4ZVI A;  2Z5C A;  4JI8 I;  3WU3 A;  1NZ0 A;  4DR5 I;  1IBM E;  4JI0 I;  4DV7 E;  4GKK E;  5LL6 R;  2HK3 A;  4JI6 E;  4JG4 A;  4B3M E;  2UU9 E;  1N32 E;  4OX9 I;  4B3T E;  4DV5 I;  1H7S A;  4WUD A;  5IWA E;  1Z0C A;  2Z5E A;  4JI1 E;  2DEJ A;  4YHH E;  4JI7 I;  4LF7 E;  3LNU A;  2DEI A;  1N34 E;  4PRX A;  2UXB E;  4LF9 E;  2GS8 A;  1D6T A;  4DUY E;  4B3S I;  3PRY A;  4DR5 E;  2A2C A;  2V34 A;  2J7K A;  1VIS A;  2O1U A;  4LF5 I;  3OTO I;  4DR7 I;  4FN5 A;  2UUB E;  1HNW I;  3QT5 A;  4DR3 I;  3PYE A;  4LF8 I;  4HXZ A;  1N33 I;  4HYM A;  3T1Y E;  2HKE A;  2ZM6 E;  3P06 A;  4B3R E;  5A2Q C;  1I94 E;  4X64 I;  4DV3 I;  1S16 A;  4DV1 E;  1XMO I;  1N0V C;  4DV0 E;  1KVK A;  4FWH A;  3HJC A;  4DUZ I;  1FJG E;  4DPW A;  1RRE A;  3J7A M;  1ELO A;  4B3S E;  4JYA E;  3B78 A;  4JV5 I;  2UXC E;  2HHH I;  5FLX Q;  4JI3 I;  1XNQ E;  4NXM I;  1XHK A;  4IZJ D;  4USK A;  1HR0 E;  4DV6 I;  4DPT A;  4DR1 I;  4KHP E;  4EMD A;  4JI5 E;  1Z5B A;  4LFB I;  4DU8 A;  4URL A;  4UTG A;  1USU A;  1ZM2 A;  5LMN I;  4JI2 I;  1FI4 A;  5BR8 E;  1H74 A;  3HUL A;  4X65 E;  2WW4 A;  1ZM3 A;  4LF4 I;  4DR4 E;  1A6F A;  3J80 C;  4DV2 E;  2V2Z A;  1MU5 A;  4XTJ A;  3CWV A;  5LMU E;  2BM1 A;  2VQF I;  2LJP A;  1OJ4 A;  4DR2 I;  4LF6 I;  2NPF A;  2UUC E;  2V2V A;  1KIJ A;  2UUA E;  3PYD A;  4GKJ I;  4Z7Y A;  2GQ0 A;  2ZBK B;  1N36 I;  1XNR I;  1Z0V A;  3J81 Q;  1KKH A;  4IZJ B;  3K1J A;  4PRV A;  3J7A G;  1HNX I;  4I3H A;  1Z0B A;  3ZZU A;  1HK7 A;  1Z0E A;  3F0N A;  4LFA E;  3Q6N A;  4DU7 A;  3QT7 A;  1S4E A;  4FW9 A;  1Z5A A;  1XMQ I;  1BKN A;  4LF4 E;  4M1K A;  3JAM C;  4K0K E;  4Z7C A;  3T1H E;  4MYT A;  4NXN E;  4IZJ A;  5FWK A;  3Q6M A;  4FWD A;  1Z0W A;  3ZM7 A;  3ZKB A;  4DV4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...