4DV1E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv1E02
2L2KB 4GKKI 3LLHA 1Z5CA 1A6FA 2B7TA 4HY1A 2UXCI 2UUCI 3GONA 4NXNI 1RC7A 1NHHA 4KQVA 2A2DA 1IBMI 4JI4I 1UEKA 3JAMC 4LF8I 4M1KA 1S4EA 3B78A 5LMNE 3J80C 1ZXMA 1Z59A 2UU9E 4JI7I 4DR6E 3C4TA 1T4OA 5BR8I 1D6TA 2OI2A 2UXBE 2CPNA 2UUBE 3WU5A 4JV5E 3H4LA 4LF4E 4OX9E 5FLXC 3Q1QA 4GKKE 1ZM9A 3ZM7A 2UXCE 3B8HA 2UUCE 1RQ0A 1XMOE 4FWGA 2X7IA 4YHHI 4JI1I 1IBME 3ZKDA 4JI4E 4X66I 4LF6I 4LF8E 2LTRA 4NXMI 2XEXA 4JI7E 1DI2A 5L3JA 4JYAI 5BR8E 1N32I 4Z7CA 1FWKA 2LUQA 4B3RI 1ZM3A 4DV6I 4YHHE 4JI1E 1FJGI 1VISA 4JI0I 5A2QQ 2X36A 2DIXA 4WFTA 4DU8A 4X64E 3QT5A 4HXZA 4X66E 2R3VA 4ZVIA 5IT9C 4NXME 4LF5I 2IHR1 4HACB 2B7VA 1X47A 4JYAE 1HR0I 1X49A 2ZBKB 3HULA 3J81C 4DV3I 5IWAI 1BKNA 3PYDA 3V5RA 2LUPB 3QT8A 5CFFE 3J7AG 3T1YE 4DV6E 2A2CA 4DU7A 2HK2A 4LFBI 1FI4A 2LTSA 1MG7A 2E5LI 4B3TI 1FJGE 4JI0E 2YT4A 1FWLA 1K47A 1EKZA 2HKEA 2WW4A 3J80Q 1QZRA 1YYWA 1ZM4A 1N36I 1H74A 1XHKA 4LF5E 4DPUA 3F0NA 3HTXA 1N0VC 1KVKA 1HR0E 2V34A 4DV3E 5IWAE 1PIEA 4FW9A 3ADIA 4JI6I 5FLXQ 2CZ9A 4LFBE 3ZZUA 4FWHA 3B82A 1KKHA 2E5LE 1Z5BA 2HHHI 1O0WA 2NUFA 1RR9A 2BV3A 4X65I 4OX9I 4DV4I 2KHXA 2VQEI 1N36E 3VYXA 1J5EE 4B3MI 1PKPA 3V2UC 4DV2I 4WYQB 4DR2I 4MYUA 3PYGA 4JG4A 3QT6A 3ADJA 3PYFA 4JI6E 4K0KI 4NXNE 1XNQI 4LFCI 3WU4A 3PYEA 4FN5A 2BM1A 2HHHE 4X65E 2UXDI 5IT9Q 4DV4E 2VQEE 4PRXA 2R42A 1XMQI 1B62A 2LJPA 1FKAE 4B3ME 4GKJI 3QT7A 4DV2E 4DR2E 3J81Q 4Z7YA 2E1RA 1RREA 1NHJA 2LJHA 2L3CA 4MYTA 4JI2I 4M2ZA 1XNQE 1UILA 4DR1I 4DPTA 4M30A 1HNXI 1MX0A 4LFCE 4JI5I 4LF6E 1Z0CA 4FWDA 1IBKI 4HACA 2JVAA 1HNZI 1I94I 4JI3I 1U2RA 1H73A 1XMQE 3D4JA 1QU6A 1N32E 2NA2A 3LTOA 4DKKA 4DPXA 2L3JA 4B3RE 4LF9I 2RSMA 2L2MA 4I3HA 4DV0I 4JI2E 4DR7I 4RPFA 4DR1E 3OTOI 2GS8A 4DPWA 2F4VI 4JI5E 2RS7A 3JAMQ 2UUAI 2L2NA 3K1JA 1ZBTA 1IBKE 1T4LB 1HNZE 2V2QA 1I94E 2AJ4A 4XTJA 4JI3E 4AQYI 3M6AA 1ZXNA 2LRSA 2N3GA 2RTXA 2HFSA 2V2ZA 4B3SI 1FNMA 1B63A 4LF9E 1N34I 2L33A 4R1FA 4DV0E 1H72C 1N0UA 4DR7E 4USKA 3OTOE 4B3TE 2F4VE 4DR4I 1NZ0A 2UUAE 4WUCA 1Z5AA 3J7AM 1GQEA 1WHQA 1ELOA 3ADLA 4URLA 4LFAI 4DV5I 4AQYE 1OJ4A 1Z0BA 1XMOI 2HFUA 1YYOA 4B3SE 1N34E 3C4BA 1YZ9A 2ZITA 2V2VA 4YY3I 2ZM6I 3ZZ0A 2VQFI 1X48A 4JI8I 1KIJA 2HKJA 4PRVA 1H7SA 4DV1I 2NPFA 4DR4E 4DPYA 4X62I 1S16A 3WU6A 4DUYI 2DB2A 3LNUA 1KTVA 1ZM2A 2EZ6A 2DEIA 1J26A 1MU5A 4LFAE 4DV5E 5LMUI 4DV7I 4X64I 2Q2EB 2RS6A 1IBLI 3CWVA 4EMDA 4YY3E 4K0KE 2ZM6E 2B3TB 2VQFE 2LBSB 4JI8E 1N33I 1PVGA 4DUZI 2EFGA 3T1HI 3WU3A 4DV1E 2V8PA 4X8WA 4X62E 4UT4A 2MDRA 3T1YI 4DUYE 2NUEA 2UXDE 1EI1A 2JY9A 3LPSA 1EA6A 4HYMA 1UHZA 3ZZTA 1Z0WA 5LMUE 4GKJE 4DR5I 4LF7I 2NUGA 4DV7E 1WHNA 2BM0A 4DXLA 1IBLE 3ZKBA 4KHPI 4WUBA 5GMEA 4DR3I 3J7Yp 1HNXE 3P1XA 1N33E 4DUZE 2DEJA 3ADGA 3T1HE 1HNWI 1XNRI 4UTGA 3K17A 1NHIA 4WUDA 1DARA 1STUA 1Z0EA 2HK3A 5A2QC 1H7UA 4DR5E 4LF7E 5LL6R 2VF3A 5LMNI 5GMDA 2DMYA 4P7AA 4PU9A 2UU9I 4P52A 4KHPE 1Z0GA 1Z0TA 4DR6I 4DR3E 4ED4A 1J5EI 1T4NA 1WUUA 4USMA 4OOGC 2J7KA 1HNWE 2N3HA 2UXBI 1YYKA 1XNRE 2UUBI 4JV5I 3VYYA 4LF4I 1Z0VA
chains in the Genus database with same CATH superfamily
2RPCA 2PO2B 2L2KB 4GKKI 4LPFA 5A6JA 4WXDA 3LLHA 1Z5CA 2DGCA 5A6KA 2B7TA 1A6FA 2NN6E 4HY1A 2UXCI 3M7ND 2UUCI 3GONA 4NXNI 1A1HA 2O1TA 1JK1A 2O3ZA 1RC7A 4GZNC 1NHHA 4KQVA 3BIDA 2A2DA 1IBMI 3GCMA 4OZEA 4JI4I 1UEKA 4NBQA 2DLKA 3JAMC 4LF8I 4M1KA 4XTJA 1S4EA 3B78A 5LMNE 2WNRB 3J80C 2EOOA 1ZXMA 4F54A 2EPPA 4WSPA 1XXEA 3THNA 1GZ6A 2UU9E 5T6JA 5AC5A 1Z59A 4JI7I 4U3DA 2L6MA 2RQLA 4DR6E 2G7HA 3C4TA 4R8OA 1T4OA 5BR8I 4ZYHA 2GPIA 2YTGA 2I13A 1D6TA 3HQ1A 3GLLA 4MDTA 5DNXA 2OI2A 2UXBE 2CPNA 2UUBE 3WU5A 1UDSA 4JV5E 3H4LA 3EQ1A 4LF4E 5FLXC 4OX9E 3Q1QA 5DRQA 4GKKE 1TF6A 2Q8UA 5IXMB 1ZM9A 2BA1D 3ZM7A 3M85G 2M4IA 2UXCE 3B8HA 2UUCE 1RQ0A 1XMOE 4FWGA 2X7IA 1OYSA 2O1VA 1A1FA 1Y60A 4YHHI 2LCEA 4JI1I 1IBME 1P47A 3ZKDA 4JI4E 3HJCA 2EP3A 2VF1A 4X66I 4LF6I 4LF8E 2LTRA 4IFDD 3ZOQB 4M0VA 4NXMI 2EORA 4FW5A 2EMCA 3L7ZB 1WRJA 3IWCA 2XEXA 4JI7E 2YTEA 1DI2A 2MKDA 5L3JA 3MHHC 3BF2A 4J8ZA 4JYAI 2YTNA 2JEAB 4KZSA 5BR8E 4BHCA 1N32I 4Z7CA 1FWKA 2LUQA 3M7NG 3K6QA 4B3RI 1Z1BA 1ZM3A 2JE6B 4DV6I 2GLIA 5KL5A 1UBDC 4L5NC 5ADZA 3UHMA 3P76A 4YHHE 2EOXA 3EPKA 2JR1A 3QG5C 4JI1E 1VISA 1SFEA 4JI0I 2DIXA 4WFTA 2X36A 4DU8A 5A2QQ 4X64E 2EPAA 3QT5A 4HXZA 2EMFA 4X66E 1WJPA 4FW4A 2R3VA 2LT7A 4M9VC 4ZVIA 1EH7A 5AE2A 5IT9C 1YFHA 4NXME 2EM0A 2JOXA 2BA0D 2IHR1 4LF5I 4IS1C 4HACB 2LVHA 2LO3A 1AH5A 2LMZA 1X47A 2B7VA 4LU9A 4IZKA 4MU1A 4JYAE 2EQ3A 2O1WA 4AIMA 1X49A 2ZBKB 1HR0I 3UK3C 3HULA 2GO4A 3J81C 2BA1G 4DV3I 1UN6B 5IWAI 1BKNA 3PYDA 3P3GA 5A6AA 2LUPB 3V5RA 3QT8A 5CFFE 3J7AG 2PO0A 2E1MA 2EJ4A 3T1YE 4DV6E 2V85A 4IFDA 2V89A 1UDOA 2A2CA 4DU7A 3F6GA 5K36A 2HK2A 2WBSA 4LFBI 4BC7A 2YRKA 1FI4A 2LTSA 1MG7A 2C37A 2MDGA 5JEAD 3Q6NA 2E5LI 4B3TI 1FJGE 2PO1B 4JI0E 2YT4A 1FWLA 2NABA 3AV0A 1TF3A 1K47A 4BA1A 1EKZA 2HKEA 2WW4A 2EM4A 2BBGA 1QZRA 2JT2A 3J80Q 1YYWA 1ZM4A 5C0XC 3JU0A 1H74A 2C39B 1XHKA 4LF5E 2EE8A 1N36I 5C0XF 5K36E 4QNKA 4DPUA 4OO1D 3F0NA 4N3OA 2J7JA 3HTXA 5DROA 2C38B 1RHYA 5LLQA 1N0VC 2ODRC 1KVKA 1HR0E 4QNJA 2JOBA 2V34A 4DV3E 4HTGA 5IWAE 2I9IA 1PIEA 3BBGA 2PO2A 2HJJA 5A6BD 4FW9A 3ADIA 1RMDA 2H36X 2BR2B 5FLXQ 4JI6I 2EN8A 4ISAA 3U1YA 3KRNA 2CZ9A 2Z5CB 5DRPA 4LFBE 3ZZUA 1A1IA 4FWHA 3B82A 2BA0G 1KKHA 2E5LE 2MKNA 2EN7A 2HGHA 2WNRA 4TUGA 1Z5BA 2EMKA 2HHHI 1O0WA 2DLQA 3KZZA 2NUFA 1RR9A 2BV3A 2IOQA 4X65I 4OX9I 4LCGA 4RH8A 4DV4I 2KHXA 2VQEI 1N36E 3ECRA 3VYXA 1EH6A 2EOQA 1YSAC 1LLMC 1L4SA 1J5EE 4O43A 2YWQA 4R2AA 2IERA 4B3MI 1PKPA 2M1SA 2R1FA 2WP8B 3V2UC 4DV2I 4WYQB 4DR2I 2EOMA 3THOB 4MYUA 5JEAA 4O4KA 3PYGA 4BA2B 2ENHA 2V86A 4JG4A 4WXCA 5AE1A 3QT6A 1E3PA 4BBYA 3ADJA 3PYFA 4JI6E 3GMEA 2EOIA 4K0KI 5AASA 4NXNE 1GTKA 4MU4A 1XNQI 2EM5A 1VI7A 4LFCI 4OO1A 4F6MA 3BGHA 2Z5BB 1IQSA 2L8TA 5C0XB 5JEAE 3CDIA 3P3CA 3WU4A 1KYQA 4BMJA 3B4TA 4J3DA 4MU0A 2EPCA 3PYEA 4FN5A 3L7ZA 2BM1A 2HHHE 2EMXA 2E72A 2LV2A 5K36D 2YTIA 5A6BA 4X65E 1Y6ZA 2UXDI 2EPKX 2JEBB 5IT9Q 4DV4E 4NHRA 2VQEE 1R6MA 4PRXA 2ADRA 2R42A 2O1UA 1XMQI 2M9AA 2JEAA 2YTFA 4OO1E 2FV4B 1B62A 3LMLA 2LJPA 4MLQA 2EQ1A 2CVEA 1FKAE 1X6HA 4B3ME 4GKJI 3JTZA 2YU8A 2IOPA 4DV2E 3QT7A 4DR2E 1WXRA 4TUIA 2JE6A 4Z7YA 2E1RA 2EOFA 3J81Q 4IFDC 1RREA 5DNYA 1NHJA 1E3HA 4IFDF 2EPMX 2WCC3 5TSEA 2LJHA 3VHTB 1N3GA 2L3CA 4MYTA 2K7IA 3PRYA 4JI2I 2ENAA 3DJWA 4M2ZA 1XNQE 1UILA 4X9JA 4DR1I 1X6EA 2YTDA 4M30A 4DPTA 1HNXI 1MX0A 4LFCE 4IZJD 4JI5I 2EPRA 2JP9A 5AC4A 1X3CA 4MQYA 3IWDA 4LF6E 2JPAA 2GHFA 2N8XA 4P7DA 1Z0CA 1KJKA 4FWDA 4DMIA 1IBKI 2NN6C 2EPNA 4HACA 2JVAA 2YTOA 4MU3A 1HNZI 2NN6F 5KL3A 5DRRA 2LJUA 2YTQA 1I94I 2EQ0A 4O24A 3OMLA 4JI3I 4R2PA 1U2RA 4P78A 1H73A 1XMQE 4F9CB 3D4JA 4O5GA 1QU6A 1N32E 2ENCA 1F2IG 3C6MA 2NA2A 3LTOA 4DKKA 4DPXA 2L3JA 4B3RE 2JWOA 4LF9I 2EPXA 2RSMA 3H1CA 2EPUA 1X6FA 1FJGI 2EMIA 1ZR9A 3KWRA 2L2MA 1PJTA 1T38A 4FW3A 4I3HA 4DV0I 4JI2E 4DR7I 1Y4UA 4RPFA 1A1KA 4DR1E 2JYAA 3KZYA 3OTOI 2GS8A 3FIGA 2PO1A 4DPWA 3Q6MA 3MSWA 2F4VI 4JI5E 1YUIA 1ZBQA 1ZU1A 2EN4A 2EPZA 2RS7A 2EM9A 2PNZB 4LCHA 3JAMQ 2UUAI 4LTYA 2L2NA 3PS3A 2PNMA 2EL5A 2EOZA 3K1JA 1ZBTA 3HXLA 1IBKE 1T4LB 1JK2A 2Z5EA 4F2JC 1HNZE 2EMZA 3H09A 1I94E 2V2QA 2V87A 1R6LA 2AJ4A 4JI3E 2C38A 4BS9A 2EOJA 1BB8A 4L8NA 4FW7A 5C0XD 4AQYI 4IFDB 1PJQA 3M6AA 4AIDA 1ZXNA 2LRSA 2N3GA 2RTXA 2HFSA 2V2ZA 5JEAC 4IZJA 3K85A 4B3SI 4ZYGA 1OYRA 2EMLA 1FNMA 3PS1A 1USUA 4DUYI 4BC9A 1B63A 4LF9E 1N34I 3L00A 2EM6A 2LE2A 3F6HA 1EH8A 2DRPA 4R2EA 2BR2A 4FW6A 2L33A 2R76A 4R1FA 2Z5CA 2EN3A 4DV0E 1AAYA 1H72C 2J65A 1N0UA 1X5WA 2K4VA 4DR7E 4OO1C 3RMPA 4USKA 4OO1F 2NN6B 4BCAA 1SR9A 3OTOE 5EKWA 4B3TE 2F4VE 3EPHA 1UDNA 5ELWA 5FWKA 4DR4I 1NZ0A 1A1JA 1USVA 2UUAE 2YSPA 4WSGA 2EM7A 5KL2A 4WUCA 1Z5AA 3J7AM 1GQEA 1WHQA 1ELOA 2YRMA 3ADLA 2F1DA 4URLA 4LFAI 4DV5I 4AQYE 1HK7A 1OJ4A 2ELZA 1Z0BA 4F6NA 3EPJA 2WP8A 1XMOI 2HFUA 1YYOA 2EN1A 4BA2A 4RHBB 1A1LA 4B3SE 2IESA 3DD6A 2EPOA 1N34E 3C4BA 4IJDA 4WPYA 1YZ9A 2ZITA 2V2VA 1A1GA 4OKGA 4YY3I 2ZM6I 3HKMA 3ZZ0A 2VQFI 1X48A 1YH8A 3PS2A 2EN6A 2MC5A 2EL4A 2Z5BA 4JI8I 5C0XA 1KIJA 4FK5C 5IV8B 4GEQB 2HKJA 1UDQA 4PRVA 4MLVA 2EOSA 1H7SA 4DV1I 2NPFA 1PJSA 2KONA 4DR4E 4DPYA 4X62I 1S16A 2WZOA 4R2SA 3WU6A 2EMBA 2EL6A 2DB2A 2YRHA 2JEBA 2EOEA 2RSIA 3M99B 1TN9A 2GQ0A 3LNUA 5JEAB 1KTVA 1ZM2A 4Q35B 2EZ6A 4R03A 4R2DA 5C0XE 2DEIA 1J26A 1MU5A 4LFAE 4DV5E 1PDAA 2EMAA 2EMYA 2EN2A 4WX9A 2ELYA 5LMUI 1BBGA 1MGTA 4F9BB 4DV7I 2VE7C 5EL9A 2YZTA 2EPLX 4R2CA 4OO1B 4X64I 1MEYC 2Q2EB 4IS9A 2RS6A 1IBLI 2F8BA 2KOUA 4U3BA 5K36C 2EOYA 3CWVA 4EMDA 4YY3E 4K0KE 1G2DC 2ZM6E 2B3TB 5K36F 4NZVA 1IMUA 1Y5YA 2VQFE 2EMGA 2DSYA 2LBSB 5F3WA 4JI8E 4LOMA 4HEIA 1N33I 1PVGA 4DUZI 2EFGA 2EMWA 1DQ3A 3T1HI 3P06A 2PRTA 3WU3A 4DV1E 2V8PA 3MHSC 2EM2A 4X8WA 2CSHA 2FGGA 4X62E 2VESA 4UT4A 2MDRA 2EM3A 3T1YI 2DMIA 4DUYE 2NUEA 2UXDE 3NZKA 2NN6D 1EI1A 2JY9A 4Q28A 3LPSA 1EA6A 4HYMA 1UHZA 2CG9A 2FTXB 2V83A 2EM8A 1YPNA 4BHBA 4KWYA 3ZZTA 1Z0WA 5LMUE 4GKJE 4GQUA 4DR5I 2EWLA 4LF7I 2NUGA 4DV7E 1WHNA 2YSOA 1ZAAC 2M7QA 5KL6A 2BM0A 1G2FC 4DXLA 1IBLE 3ZKBA 2A25A 2YTPA 4KHPI 1BBOA 4WUBA 5GMEA 4DR3I 2PNLA 3CDJA 1DGCA 4R2RA 3J7Yp 1HNXE 2CT1A 3VK6A 1YHCA 2GO3A 2AE8A 2YPNA 3P1XA 1N33E 4DUZE 2DEJA 3ADGA 2PNZA 1P42A 4IZKB 3T1HE 1HNWI 2V88A 2D9HA 4LCFA 1NEIA 3DF6A 2WBUA 4UTGA 2EOHA 1XNRI 2C39A 2YTJA 3HPZA 3K17A 2HC5A 4F9AB 1NCSA 3HPSA 2PO0B 4ZYDA 1NHIA 4AM3A 4WUDA 3EPLA 5A69A 4R2QA 1Y4SA 3AUZA 1DARA 2YU5A 1T39A 1STUA 2WBTA 1OYPA 2CGEA 5K36B 5A2QC 1Z0EA 2ODRD 1H7UA 2HK3A 2JXPA 5JEAF 4DR5E 5AE3A 5DNLA 3C6KA 5LL6R 4LF7E 3M85D 2C37B 3P3EA 2VF3A 1YUJA 5LMNI 2CTDA 5GMDA 3U1KA 4IFDE 1QNTA 2DMYA 4P7AA 2MC6A 2B9DA 4ZYEA 4PU9A 2UU9I 4P52A 4BA1B 5KL4A 4KHPE 1Z0GA 1Z0TA 2NN6A 4DR6I 4DR3E 4ED4A 1J5EI 1T4NA 1B69A 4N4RB 1WUUA 4USMA 3TQMA 4OOGC 3IWBA 2J7KA 2EMHA 2L92A 2VRDA 2V8QB 1IQOA 1HNWE 2N3HA 2UXBI 1YYKA 1XNRE 2UUBI 5KL7A 4JV5I 3VYYA 4IZJB 4LF4I 1Z0VA 2BB8A 4I8OA
chains in the Genus database with same CATH topology
2L2KB 4GKKI 3LLHA 1Z5CA 1A6FA 2B7TA 4HY1A 2UXCI 2UUCI 3GONA 4NXNI 2O1TA 1RC7A 1NHHA 4KQVA 2A2DA 1IBMI 4JI4I 1UEKA 3JAMC 4LF8I 4M1KA 1S4EA 3B78A 5LMNE 3J80C 1ZXMA 4F54A 4WSPA 1Z59A 2UU9E 1GZ6A 5T6JA 4JI7I 2L6MA 4DR6E 2G7HA 3C4TA 4R8OA 1T4OA 5BR8I 1D6TA 3HQ1A 2OI2A 2UXBE 2CPNA 2UUBE 3WU5A 4JV5E 3H4LA 4LF4E 5FLXC 4OX9E 3Q1QA 4GKKE 1ZM9A 3ZM7A 2M4IA 2UXCE 3B8HA 2UUCE 1RQ0A 1XMOE 4FWGA 2X7IA 2O1VA 4YHHI 4JI1I 1IBME 3ZKDA 4JI4E 3HJCA 2VF1A 4X66I 4LF6I 4LF8E 2LTRA 3ZOQB 4M0VA 4NXMI 3IWCA 2XEXA 4JI7E 1DI2A 5L3JA 4JYAI 4J8ZA 4KZSA 5BR8E 1N32I 4Z7CA 1FWKA 2LUQA 3K6QA 4B3RI 1ZM3A 4DV6I 4L5NC 5ADZA 4YHHE 2JR1A 4JI1E 1VISA 4JI0I 5A2QQ 1FJGI 2DIXA 4WFTA 2X36A 4DU8A 4X64E 3QT5A 4HXZA 4X66E 2R3VA 4ZVIA 5AE2A 5IT9C 4NXME 4LF5I 2JOXA 2IHR1 4HACB 2LMZA 1X47A 2B7VA 4LU9A 4IZKA 4JYAE 2O1WA 1HR0I 1X49A 2ZBKB 3HULA 3J81C 4DV3I 5IWAI 1BKNA 3PYDA 3V5RA 2LUPB 3QT8A 5CFFE 3J7AG 2E1MA 3T1YE 4DV6E 2V85A 2V89A 2A2CA 4DU7A 3F6GA 2HK2A 4LFBI 4BC7A 1FI4A 2LTSA 1MG7A 3Q6NA 2E5LI 4B3TI 1FJGE 4JI0E 2YT4A 1FWLA 3AV0A 1K47A 1EKZA 2HKEA 2WW4A 3J80Q 1QZRA 1YYWA 1ZM4A 1N36I 3JU0A 1H74A 1XHKA 4LF5E 4DPUA 3F0NA 4N3OA 3HTXA 1N0VC 2ODRC 1KVKA 1HR0E 2JOBA 2V34A 4DV3E 5IWAE 1PIEA 4FW9A 3ADIA 2H36X 4JI6I 5FLXQ 2CZ9A 2Z5CB 4LFBE 3ZZUA 4FWHA 3B82A 1KKHA 2E5LE 4TUGA 1Z5BA 2HHHI 1O0WA 2NUFA 2IOQA 1RR9A 2BV3A 4X65I 4OX9I 4DV4I 2KHXA 2VQEI 1N36E 3VYXA 1J5EE 4B3MI 1PKPA 2M1SA 3V2UC 4DV2I 4WYQB 4DR2I 4MYUA 3PYGA 2V86A 4JG4A 5AE1A 3QT6A 4BBYA 3ADJA 3PYFA 4JI6E 4K0KI 5AASA 4NXNE 1XNQI 4LFCI 2Z5BB 2L8TA 3WU4A 4BMJA 3PYEA 4FN5A 2BM1A 2HHHE 4X65E 1Y6ZA 2UXDI 5IT9Q 4DV4E 2VQEE 4PRXA 2R42A 2O1UA 1XMQI 2FV4B 1B62A 3LMLA 2LJPA 1FKAE 4B3ME 4GKJI 3JTZA 2IOPA 4DV2E 3QT7A 4DR2E 1WXRA 4TUIA 3J81Q 4Z7YA 2E1RA 1RREA 5DNYA 1NHJA 2LJHA 2L3CA 4MYTA 3PRYA 4JI2I 3DJWA 4M2ZA 1XNQE 1UILA 4DR1I 4DPTA 4M30A 1HNXI 1MX0A 4LFCE 4IZJD 4JI5I 3IWDA 4LF6E 4P7DA 1Z0CA 4FWDA 4DMIA 1IBKI 4HACA 2JVAA 1HNZI 1I94I 3OMLA 4JI3I 1U2RA 4P78A 1H73A 1XMQE 4F9CB 3D4JA 1QU6A 1N32E 2NA2A 3LTOA 4DKKA 4DPXA 2L3JA 4B3RE 2JWOA 4LF9I 2RSMA 3KWRA 2L2MA 4I3HA 4DV0I 4JI2E 4DR7I 1Y4UA 4RPFA 4DR1E 3OTOI 2GS8A 3FIGA 4DPWA 3Q6MA 3MSWA 2F4VI 4JI5E 1ZBQA 2RS7A 3JAMQ 2UUAI 4LTYA 2L2NA 2PNMA 3K1JA 1ZBTA 3HXLA 1IBKE 1T4LB 2Z5EA 1HNZE 3H09A 1I94E 2V2QA 2V87A 2AJ4A 4XTJA 4JI3E 4BS9A 4AQYI 4L8NA 3M6AA 1ZXNA 2LRSA 2N3GA 2RTXA 2HFSA 2V2ZA 4IZJA 3K85A 4B3SI 1FNMA 1USUA 4BC9A 1B63A 4LF9E 1N34I 2LE2A 3F6HA 2L33A 4R1FA 2Z5CA 4DV0E 1H72C 1N0UA 2K4VA 4DR7E 3RMPA 4USKA 4BCAA 1SR9A 3OTOE 4B3TE 2F4VE 4DR4I 5FWKA 1NZ0A 1USVA 2UUAE 4WUCA 1Z5AA 3J7AM 1GQEA 1WHQA 1ELOA 3ADLA 4URLA 4LFAI 4DV5I 4AQYE 1HK7A 1OJ4A 1Z0BA 1XMOI 2HFUA 1YYOA 4B3SE 1N34E 3C4BA 4WPYA 1YZ9A 2ZITA 2V2VA 4YY3I 2ZM6I 3ZZ0A 2VQFI 1X48A 2MC5A 2Z5BA 4JI8I 1KIJA 4GEQB 2HKJA 4PRVA 1H7SA 4DV1I 2NPFA 4DR4E 2KONA 4DPYA 4X62I 1S16A 2WZOA 3WU6A 4DUYI 2DB2A 2GQ0A 3LNUA 1KTVA 1ZM2A 2EZ6A 4R03A 2DEIA 1J26A 1MU5A 4LFAE 4DV5E 5LMUI 4F9BB 4DV7I 2VE7C 2YZTA 4X64I 2Q2EB 2RS6A 1IBLI 2F8BA 2KOUA 3CWVA 4EMDA 4YY3E 4K0KE 2ZM6E 2B3TB 2VQFE 2DSYA 2LBSB 5F3WA 4JI8E 1N33I 1PVGA 4DUZI 2EFGA 1DQ3A 3T1HI 3P06A 3WU3A 4DV1E 2V8PA 4X8WA 2FGGA 4X62E 4UT4A 2MDRA 3T1YI 4DUYE 2NUEA 2UXDE 1EI1A 2JY9A 4Q28A 3LPSA 1EA6A 4HYMA 1UHZA 2CG9A 2FTXB 2V83A 3ZZTA 1Z0WA 5LMUE 4GKJE 4DR5I 2EWLA 4LF7I 2NUGA 4DV7E 1WHNA 2M7QA 2BM0A 4DXLA 1IBLE 3ZKBA 4KHPI 4WUBA 5GMEA 4DR3I 2PNLA 3J7Yp 1HNXE 3VK6A 3P1XA 1N33E 4DUZE 2DEJA 3ADGA 4IZKB 3T1HE 1HNWI 2V88A 1XNRI 4UTGA 3DF6A 3HPZA 3K17A 4F9AB 3HPSA 1NHIA 4WUDA 1Y4SA 3AUZA 1DARA 2CGEA 1STUA 5A2QC 1Z0EA 2ODRD 1H7UA 2HK3A 4DR5E 5AE3A 5LL6R 4LF7E 2VF3A 5LMNI 5GMDA 2DMYA 4P7AA 2MC6A 2B9DA 4PU9A 2UU9I 4P52A 4KHPE 1Z0GA 1Z0TA 4DR6I 4DR3E 4ED4A 1J5EI 1T4NA 1WUUA 4USMA 4OOGC 3IWBA 2J7KA 2L92A 2V8QB 1HNWE 2N3HA 2UXBI 1YYKA 1XNRE 2UUBI 4JV5I 3VYYA 4IZJB 4LF4I 1Z0VA 4I8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2K B;  4GKK I;  3LLH A;  1Z5C A;  1A6F A;  2B7T A;  4HY1 A;  2UXC I;  2UUC I;  3GON A;  4NXN I;  1RC7 A;  1NHH A;  4KQV A;  2A2D A;  1IBM I;  4JI4 I;  1UEK A;  3JAM C;  4LF8 I;  4M1K A;  1S4E A;  3B78 A;  5LMN E;  3J80 C;  1ZXM A;  1Z59 A;  2UU9 E;  4JI7 I;  4DR6 E;  3C4T A;  1T4O A;  5BR8 I;  1D6T A;  2OI2 A;  2UXB E;  2CPN A;  2UUB E;  3WU5 A;  4JV5 E;  3H4L A;  4LF4 E;  4OX9 E;  5FLX C;  3Q1Q A;  4GKK E;  1ZM9 A;  3ZM7 A;  2UXC E;  3B8H A;  2UUC E;  1RQ0 A;  1XMO E;  4FWG A;  2X7I A;  4YHH I;  4JI1 I;  1IBM E;  3ZKD A;  4JI4 E;  4X66 I;  4LF6 I;  4LF8 E;  2LTR A;  4NXM I;  2XEX A;  4JI7 E;  1DI2 A;  5L3J A;  4JYA I;  5BR8 E;  1N32 I;  4Z7C A;  1FWK A;  2LUQ A;  4B3R I;  1ZM3 A;  4DV6 I;  4YHH E;  4JI1 E;  1FJG I;  1VIS A;  4JI0 I;  5A2Q Q;  2X36 A;  2DIX A;  4WFT A;  4DU8 A;  4X64 E;  3QT5 A;  4HXZ A;  4X66 E;  2R3V A;  4ZVI A;  5IT9 C;  4NXM E;  4LF5 I;  2IHR 1;  4HAC B;  2B7V A;  1X47 A;  4JYA E;  1HR0 I;  1X49 A;  2ZBK B;  3HUL A;  3J81 C;  4DV3 I;  5IWA I;  1BKN A;  3PYD A;  3V5R A;  2LUP B;  3QT8 A;  5CFF E;  3J7A G;  3T1Y E;  4DV6 E;  2A2C A;  4DU7 A;  2HK2 A;  4LFB I;  1FI4 A;  2LTS A;  1MG7 A;  2E5L I;  4B3T I;  1FJG E;  4JI0 E;  2YT4 A;  1FWL A;  1K47 A;  1EKZ A;  2HKE A;  2WW4 A;  3J80 Q;  1QZR A;  1YYW A;  1ZM4 A;  1N36 I;  1H74 A;  1XHK A;  4LF5 E;  4DPU A;  3F0N A;  3HTX A;  1N0V C;  1KVK A;  1HR0 E;  2V34 A;  4DV3 E;  5IWA E;  1PIE A;  4FW9 A;  3ADI A;  4JI6 I;  5FLX Q;  2CZ9 A;  4LFB E;  3ZZU A;  4FWH A;  3B82 A;  1KKH A;  2E5L E;  1Z5B A;  2HHH I;  1O0W A;  2NUF A;  1RR9 A;  2BV3 A;  4X65 I;  4OX9 I;  4DV4 I;  2KHX A;  2VQE I;  1N36 E;  3VYX A;  1J5E E;  4B3M I;  1PKP A;  3V2U C;  4DV2 I;  4WYQ B;  4DR2 I;  4MYU A;  3PYG A;  4JG4 A;  3QT6 A;  3ADJ A;  3PYF A;  4JI6 E;  4K0K I;  4NXN E;  1XNQ I;  4LFC I;  3WU4 A;  3PYE A;  4FN5 A;  2BM1 A;  2HHH E;  4X65 E;  2UXD I;  5IT9 Q;  4DV4 E;  2VQE E;  4PRX A;  2R42 A;  1XMQ I;  1B62 A;  2LJP A;  1FKA E;  4B3M E;  4GKJ I;  3QT7 A;  4DV2 E;  4DR2 E;  3J81 Q;  4Z7Y A;  2E1R A;  1RRE A;  1NHJ A;  2LJH A;  2L3C A;  4MYT A;  4JI2 I;  4M2Z A;  1XNQ E;  1UIL A;  4DR1 I;  4DPT A;  4M30 A;  1HNX I;  1MX0 A;  4LFC E;  4JI5 I;  4LF6 E;  1Z0C A;  4FWD A;  1IBK I;  4HAC A;  2JVA A;  1HNZ I;  1I94 I;  4JI3 I;  1U2R A;  1H73 A;  1XMQ E;  3D4J A;  1QU6 A;  1N32 E;  2NA2 A;  3LTO A;  4DKK A;  4DPX A;  2L3J A;  4B3R E;  4LF9 I;  2RSM A;  2L2M A;  4I3H A;  4DV0 I;  4JI2 E;  4DR7 I;  4RPF A;  4DR1 E;  3OTO I;  2GS8 A;  4DPW A;  2F4V I;  4JI5 E;  2RS7 A;  3JAM Q;  2UUA I;  2L2N A;  3K1J A;  1ZBT A;  1IBK E;  1T4L B;  1HNZ E;  2V2Q A;  1I94 E;  2AJ4 A;  4XTJ A;  4JI3 E;  4AQY I;  3M6A A;  1ZXN A;  2LRS A;  2N3G A;  2RTX A;  2HFS A;  2V2Z A;  4B3S I;  1FNM A;  1B63 A;  4LF9 E;  1N34 I;  2L33 A;  4R1F A;  4DV0 E;  1H72 C;  1N0U A;  4DR7 E;  4USK A;  3OTO E;  4B3T E;  2F4V E;  4DR4 I;  1NZ0 A;  2UUA E;  4WUC A;  1Z5A A;  3J7A M;  1GQE A;  1WHQ A;  1ELO A;  3ADL A;  4URL A;  4LFA I;  4DV5 I;  4AQY E;  1OJ4 A;  1Z0B A;  1XMO I;  2HFU A;  1YYO A;  4B3S E;  1N34 E;  3C4B A;  1YZ9 A;  2ZIT A;  2V2V A;  4YY3 I;  2ZM6 I;  3ZZ0 A;  2VQF I;  1X48 A;  4JI8 I;  1KIJ A;  2HKJ A;  4PRV A;  1H7S A;  4DV1 I;  2NPF A;  4DR4 E;  4DPY A;  4X62 I;  1S16 A;  3WU6 A;  4DUY I;  2DB2 A;  3LNU A;  1KTV A;  1ZM2 A;  2EZ6 A;  2DEI A;  1J26 A;  1MU5 A;  4LFA E;  4DV5 E;  5LMU I;  4DV7 I;  4X64 I;  2Q2E B;  2RS6 A;  1IBL I;  3CWV A;  4EMD A;  4YY3 E;  4K0K E;  2ZM6 E;  2B3T B;  2VQF E;  2LBS B;  4JI8 E;  1N33 I;  1PVG A;  4DUZ I;  2EFG A;  3T1H I;  3WU3 A;  4DV1 E;  2V8P A;  4X8W A;  4X62 E;  4UT4 A;  2MDR A;  3T1Y I;  4DUY E;  2NUE A;  2UXD E;  1EI1 A;  2JY9 A;  3LPS A;  1EA6 A;  4HYM A;  1UHZ A;  3ZZT A;  1Z0W A;  5LMU E;  4GKJ E;  4DR5 I;  4LF7 I;  2NUG A;  4DV7 E;  1WHN A;  2BM0 A;  4DXL A;  1IBL E;  3ZKB A;  4KHP I;  4WUB A;  5GME A;  4DR3 I;  3J7Y p;  1HNX E;  3P1X A;  1N33 E;  4DUZ E;  2DEJ A;  3ADG A;  3T1H E;  1HNW I;  1XNR I;  4UTG A;  3K17 A;  1NHI A;  4WUD A;  1DAR A;  1STU A;  1Z0E A;  2HK3 A;  5A2Q C;  1H7U A;  4DR5 E;  4LF7 E;  5LL6 R;  2VF3 A;  5LMN I;  5GMD A;  2DMY A;  4P7A A;  4PU9 A;  2UU9 I;  4P52 A;  4KHP E;  1Z0G A;  1Z0T A;  4DR6 I;  4DR3 E;  4ED4 A;  1J5E I;  1T4N A;  1WUU A;  4USM A;  4OOG C;  2J7K A;  1HNW E;  2N3H A;  2UXB I;  1YYK A;  1XNR E;  2UUB I;  4JV5 I;  3VYY A;  4LF4 I;  1Z0V A; 
#chains in the Genus database with same CATH topology
 2RPC A;  2PO2 B;  2L2K B;  4GKK I;  4LPF A;  5A6J A;  4WXD A;  3LLH A;  1Z5C A;  2DGC A;  5A6K A;  2B7T A;  1A6F A;  2NN6 E;  4HY1 A;  2UXC I;  3M7N D;  2UUC I;  3GON A;  4NXN I;  1A1H A;  2O1T A;  1JK1 A;  2O3Z A;  1RC7 A;  4GZN C;  1NHH A;  4KQV A;  3BID A;  2A2D A;  1IBM I;  3GCM A;  4OZE A;  4JI4 I;  1UEK A;  4NBQ A;  2DLK A;  3JAM C;  4LF8 I;  4M1K A;  4XTJ A;  1S4E A;  3B78 A;  5LMN E;  2WNR B;  3J80 C;  2EOO A;  1ZXM A;  4F54 A;  2EPP A;  4WSP A;  1XXE A;  3THN A;  1GZ6 A;  2UU9 E;  5T6J A;  5AC5 A;  1Z59 A;  4JI7 I;  4U3D A;  2L6M A;  2RQL A;  4DR6 E;  2G7H A;  3C4T A;  4R8O A;  1T4O A;  5BR8 I;  4ZYH A;  2GPI A;  2YTG A;  2I13 A;  1D6T A;  3HQ1 A;  3GLL A;  4MDT A;  5DNX A;  2OI2 A;  2UXB E;  2CPN A;  2UUB E;  3WU5 A;  1UDS A;  4JV5 E;  3H4L A;  3EQ1 A;  4LF4 E;  5FLX C;  4OX9 E;  3Q1Q A;  5DRQ A;  4GKK E;  1TF6 A;  2Q8U A;  5IXM B;  1ZM9 A;  2BA1 D;  3ZM7 A;  3M85 G;  2M4I A;  2UXC E;  3B8H A;  2UUC E;  1RQ0 A;  1XMO E;  4FWG A;  2X7I A;  1OYS A;  2O1V A;  1A1F A;  1Y60 A;  4YHH I;  2LCE A;  4JI1 I;  1IBM E;  1P47 A;  3ZKD A;  4JI4 E;  3HJC A;  2EP3 A;  2VF1 A;  4X66 I;  4LF6 I;  4LF8 E;  2LTR A;  4IFD D;  3ZOQ B;  4M0V A;  4NXM I;  2EOR A;  4FW5 A;  2EMC A;  3L7Z B;  1WRJ A;  3IWC A;  2XEX A;  4JI7 E;  2YTE A;  1DI2 A;  2MKD A;  5L3J A;  3MHH C;  3BF2 A;  4J8Z A;  4JYA I;  2YTN A;  2JEA B;  4KZS A;  5BR8 E;  4BHC A;  1N32 I;  4Z7C A;  1FWK A;  2LUQ A;  3M7N G;  3K6Q A;  4B3R I;  1Z1B A;  1ZM3 A;  2JE6 B;  4DV6 I;  2GLI A;  5KL5 A;  1UBD C;  4L5N C;  5ADZ A;  3UHM A;  3P76 A;  4YHH E;  2EOX A;  3EPK A;  2JR1 A;  3QG5 C;  4JI1 E;  1VIS A;  1SFE A;  4JI0 I;  2DIX A;  4WFT A;  2X36 A;  4DU8 A;  5A2Q Q;  4X64 E;  2EPA A;  3QT5 A;  4HXZ A;  2EMF A;  4X66 E;  1WJP A;  4FW4 A;  2R3V A;  2LT7 A;  4M9V C;  4ZVI A;  1EH7 A;  5AE2 A;  5IT9 C;  1YFH A;  4NXM E;  2EM0 A;  2JOX A;  2BA0 D;  2IHR 1;  4LF5 I;  4IS1 C;  4HAC B;  2LVH A;  2LO3 A;  1AH5 A;  2LMZ A;  1X47 A;  2B7V A;  4LU9 A;  4IZK A;  4MU1 A;  4JYA E;  2EQ3 A;  2O1W A;  4AIM A;  1X49 A;  2ZBK B;  1HR0 I;  3UK3 C;  3HUL A;  2GO4 A;  3J81 C;  2BA1 G;  4DV3 I;  1UN6 B;  5IWA I;  1BKN A;  3PYD A;  3P3G A;  5A6A A;  2LUP B;  3V5R A;  3QT8 A;  5CFF E;  3J7A G;  2PO0 A;  2E1M A;  2EJ4 A;  3T1Y E;  4DV6 E;  2V85 A;  4IFD A;  2V89 A;  1UDO A;  2A2C A;  4DU7 A;  3F6G A;  5K36 A;  2HK2 A;  2WBS A;  4LFB I;  4BC7 A;  2YRK A;  1FI4 A;  2LTS A;  1MG7 A;  2C37 A;  2MDG A;  5JEA D;  3Q6N A;  2E5L I;  4B3T I;  1FJG E;  2PO1 B;  4JI0 E;  2YT4 A;  1FWL A;  2NAB A;  3AV0 A;  1TF3 A;  1K47 A;  4BA1 A;  1EKZ A;  2HKE A;  2WW4 A;  2EM4 A;  2BBG A;  1QZR A;  2JT2 A;  3J80 Q;  1YYW A;  1ZM4 A;  5C0X C;  3JU0 A;  1H74 A;  2C39 B;  1XHK A;  4LF5 E;  2EE8 A;  1N36 I;  5C0X F;  5K36 E;  4QNK A;  4DPU A;  4OO1 D;  3F0N A;  4N3O A;  2J7J A;  3HTX A;  5DRO A;  2C38 B;  1RHY A;  5LLQ A;  1N0V C;  2ODR C;  1KVK A;  1HR0 E;  4QNJ A;  2JOB A;  2V34 A;  4DV3 E;  4HTG A;  5IWA E;  2I9I A;  1PIE A;  3BBG A;  2PO2 A;  2HJJ A;  5A6B D;  4FW9 A;  3ADI A;  1RMD A;  2H36 X;  2BR2 B;  5FLX Q;  4JI6 I;  2EN8 A;  4ISA A;  3U1Y A;  3KRN A;  2CZ9 A;  2Z5C B;  5DRP A;  4LFB E;  3ZZU A;  1A1I A;  4FWH A;  3B82 A;  2BA0 G;  1KKH A;  2E5L E;  2MKN A;  2EN7 A;  2HGH A;  2WNR A;  4TUG A;  1Z5B A;  2EMK A;  2HHH I;  1O0W A;  2DLQ A;  3KZZ A;  2NUF A;  1RR9 A;  2BV3 A;  2IOQ A;  4X65 I;  4OX9 I;  4LCG A;  4RH8 A;  4DV4 I;  2KHX A;  2VQE I;  1N36 E;  3ECR A;  3VYX A;  1EH6 A;  2EOQ A;  1YSA C;  1LLM C;  1L4S A;  1J5E E;  4O43 A;  2YWQ A;  4R2A A;  2IER A;  4B3M I;  1PKP A;  2M1S A;  2R1F A;  2WP8 B;  3V2U C;  4DV2 I;  4WYQ B;  4DR2 I;  2EOM A;  3THO B;  4MYU A;  5JEA A;  4O4K A;  3PYG A;  4BA2 B;  2ENH A;  2V86 A;  4JG4 A;  4WXC A;  5AE1 A;  3QT6 A;  1E3P A;  4BBY A;  3ADJ A;  3PYF A;  4JI6 E;  3GME A;  2EOI A;  4K0K I;  5AAS A;  4NXN E;  1GTK A;  4MU4 A;  1XNQ I;  2EM5 A;  1VI7 A;  4LFC I;  4OO1 A;  4F6M A;  3BGH A;  2Z5B B;  1IQS A;  2L8T A;  5C0X B;  5JEA E;  3CDI A;  3P3C A;  3WU4 A;  1KYQ A;  4BMJ A;  3B4T A;  4J3D A;  4MU0 A;  2EPC A;  3PYE A;  4FN5 A;  3L7Z A;  2BM1 A;  2HHH E;  2EMX A;  2E72 A;  2LV2 A;  5K36 D;  2YTI A;  5A6B A;  4X65 E;  1Y6Z A;  2UXD I;  2EPK X;  2JEB B;  5IT9 Q;  4DV4 E;  4NHR A;  2VQE E;  1R6M A;  4PRX A;  2ADR A;  2R42 A;  2O1U A;  1XMQ I;  2M9A A;  2JEA A;  2YTF A;  4OO1 E;  2FV4 B;  1B62 A;  3LML A;  2LJP A;  4MLQ A;  2EQ1 A;  2CVE A;  1FKA E;  1X6H A;  4B3M E;  4GKJ I;  3JTZ A;  2YU8 A;  2IOP A;  4DV2 E;  3QT7 A;  4DR2 E;  1WXR A;  4TUI A;  2JE6 A;  4Z7Y A;  2E1R A;  2EOF A;  3J81 Q;  4IFD C;  1RRE A;  5DNY A;  1NHJ A;  1E3H A;  4IFD F;  2EPM X;  2WCC 3;  5TSE A;  2LJH A;  3VHT B;  1N3G A;  2L3C A;  4MYT A;  2K7I A;  3PRY A;  4JI2 I;  2ENA A;  3DJW A;  4M2Z A;  1XNQ E;  1UIL A;  4X9J A;  4DR1 I;  1X6E A;  2YTD A;  4M30 A;  4DPT A;  1HNX I;  1MX0 A;  4LFC E;  4IZJ D;  4JI5 I;  2EPR A;  2JP9 A;  5AC4 A;  1X3C A;  4MQY A;  3IWD A;  4LF6 E;  2JPA A;  2GHF A;  2N8X A;  4P7D A;  1Z0C A;  1KJK A;  4FWD A;  4DMI A;  1IBK I;  2NN6 C;  2EPN A;  4HAC A;  2JVA A;  2YTO A;  4MU3 A;  1HNZ I;  2NN6 F;  5KL3 A;  5DRR A;  2LJU A;  2YTQ A;  1I94 I;  2EQ0 A;  4O24 A;  3OML A;  4JI3 I;  4R2P A;  1U2R A;  4P78 A;  1H73 A;  1XMQ E;  4F9C B;  3D4J A;  4O5G A;  1QU6 A;  1N32 E;  2ENC A;  1F2I G;  3C6M A;  2NA2 A;  3LTO A;  4DKK A;  4DPX A;  2L3J A;  4B3R E;  2JWO A;  4LF9 I;  2EPX A;  2RSM A;  3H1C A;  2EPU A;  1X6F A;  1FJG I;  2EMI A;  1ZR9 A;  3KWR A;  2L2M A;  1PJT A;  1T38 A;  4FW3 A;  4I3H A;  4DV0 I;  4JI2 E;  4DR7 I;  1Y4U A;  4RPF A;  1A1K A;  4DR1 E;  2JYA A;  3KZY A;  3OTO I;  2GS8 A;  3FIG A;  2PO1 A;  4DPW A;  3Q6M A;  3MSW A;  2F4V I;  4JI5 E;  1YUI A;  1ZBQ A;  1ZU1 A;  2EN4 A;  2EPZ A;  2RS7 A;  2EM9 A;  2PNZ B;  4LCH A;  3JAM Q;  2UUA I;  4LTY A;  2L2N A;  3PS3 A;  2PNM A;  2EL5 A;  2EOZ A;  3K1J A;  1ZBT A;  3HXL A;  1IBK E;  1T4L B;  1JK2 A;  2Z5E A;  4F2J C;  1HNZ E;  2EMZ A;  3H09 A;  1I94 E;  2V2Q A;  2V87 A;  1R6L A;  2AJ4 A;  4JI3 E;  2C38 A;  4BS9 A;  2EOJ A;  1BB8 A;  4L8N A;  4FW7 A;  5C0X D;  4AQY I;  4IFD B;  1PJQ A;  3M6A A;  4AID A;  1ZXN A;  2LRS A;  2N3G A;  2RTX A;  2HFS A;  2V2Z A;  5JEA C;  4IZJ A;  3K85 A;  4B3S I;  4ZYG A;  1OYR A;  2EML A;  1FNM A;  3PS1 A;  1USU A;  4DUY I;  4BC9 A;  1B63 A;  4LF9 E;  1N34 I;  3L00 A;  2EM6 A;  2LE2 A;  3F6H A;  1EH8 A;  2DRP A;  4R2E A;  2BR2 A;  4FW6 A;  2L33 A;  2R76 A;  4R1F A;  2Z5C A;  2EN3 A;  4DV0 E;  1AAY A;  1H72 C;  2J65 A;  1N0U A;  1X5W A;  2K4V A;  4DR7 E;  4OO1 C;  3RMP A;  4USK A;  4OO1 F;  2NN6 B;  4BCA A;  1SR9 A;  3OTO E;  5EKW A;  4B3T E;  2F4V E;  3EPH A;  1UDN A;  5ELW A;  5FWK A;  4DR4 I;  1NZ0 A;  1A1J A;  1USV A;  2UUA E;  2YSP A;  4WSG A;  2EM7 A;  5KL2 A;  4WUC A;  1Z5A A;  3J7A M;  1GQE A;  1WHQ A;  1ELO A;  2YRM A;  3ADL A;  2F1D A;  4URL A;  4LFA I;  4DV5 I;  4AQY E;  1HK7 A;  1OJ4 A;  2ELZ A;  1Z0B A;  4F6N A;  3EPJ A;  2WP8 A;  1XMO I;  2HFU A;  1YYO A;  2EN1 A;  4BA2 A;  4RHB B;  1A1L A;  4B3S E;  2IES A;  3DD6 A;  2EPO A;  1N34 E;  3C4B A;  4IJD A;  4WPY A;  1YZ9 A;  2ZIT A;  2V2V A;  1A1G A;  4OKG A;  4YY3 I;  2ZM6 I;  3HKM A;  3ZZ0 A;  2VQF I;  1X48 A;  1YH8 A;  3PS2 A;  2EN6 A;  2MC5 A;  2EL4 A;  2Z5B A;  4JI8 I;  5C0X A;  1KIJ A;  4FK5 C;  5IV8 B;  4GEQ B;  2HKJ A;  1UDQ A;  4PRV A;  4MLV A;  2EOS A;  1H7S A;  4DV1 I;  2NPF A;  1PJS A;  2KON A;  4DR4 E;  4DPY A;  4X62 I;  1S16 A;  2WZO A;  4R2S A;  3WU6 A;  2EMB A;  2EL6 A;  2DB2 A;  2YRH A;  2JEB A;  2EOE A;  2RSI A;  3M99 B;  1TN9 A;  2GQ0 A;  3LNU A;  5JEA B;  1KTV A;  1ZM2 A;  4Q35 B;  2EZ6 A;  4R03 A;  4R2D A;  5C0X E;  2DEI A;  1J26 A;  1MU5 A;  4LFA E;  4DV5 E;  1PDA A;  2EMA A;  2EMY A;  2EN2 A;  4WX9 A;  2ELY A;  5LMU I;  1BBG A;  1MGT A;  4F9B B;  4DV7 I;  2VE7 C;  5EL9 A;  2YZT A;  2EPL X;  4R2C A;  4OO1 B;  4X64 I;  1MEY C;  2Q2E B;  4IS9 A;  2RS6 A;  1IBL I;  2F8B A;  2KOU A;  4U3B A;  5K36 C;  2EOY A;  3CWV A;  4EMD A;  4YY3 E;  4K0K E;  1G2D C;  2ZM6 E;  2B3T B;  5K36 F;  4NZV A;  1IMU A;  1Y5Y A;  2VQF E;  2EMG A;  2DSY A;  2LBS B;  5F3W A;  4JI8 E;  4LOM A;  4HEI A;  1N33 I;  1PVG A;  4DUZ I;  2EFG A;  2EMW A;  1DQ3 A;  3T1H I;  3P06 A;  2PRT A;  3WU3 A;  4DV1 E;  2V8P A;  3MHS C;  2EM2 A;  4X8W A;  2CSH A;  2FGG A;  4X62 E;  2VES A;  4UT4 A;  2MDR A;  2EM3 A;  3T1Y I;  2DMI A;  4DUY E;  2NUE A;  2UXD E;  3NZK A;  2NN6 D;  1EI1 A;  2JY9 A;  4Q28 A;  3LPS A;  1EA6 A;  4HYM A;  1UHZ A;  2CG9 A;  2FTX B;  2V83 A;  2EM8 A;  1YPN A;  4BHB A;  4KWY A;  3ZZT A;  1Z0W A;  5LMU E;  4GKJ E;  4GQU A;  4DR5 I;  2EWL A;  4LF7 I;  2NUG A;  4DV7 E;  1WHN A;  2YSO A;  1ZAA C;  2M7Q A;  5KL6 A;  2BM0 A;  1G2F C;  4DXL A;  1IBL E;  3ZKB A;  2A25 A;  2YTP A;  4KHP I;  1BBO A;  4WUB A;  5GME A;  4DR3 I;  2PNL A;  3CDJ A;  1DGC A;  4R2R A;  3J7Y p;  1HNX E;  2CT1 A;  3VK6 A;  1YHC A;  2GO3 A;  2AE8 A;  2YPN A;  3P1X A;  1N33 E;  4DUZ E;  2DEJ A;  3ADG A;  2PNZ A;  1P42 A;  4IZK B;  3T1H E;  1HNW I;  2V88 A;  2D9H A;  4LCF A;  1NEI A;  3DF6 A;  2WBU A;  4UTG A;  2EOH A;  1XNR I;  2C39 A;  2YTJ A;  3HPZ A;  3K17 A;  2HC5 A;  4F9A B;  1NCS A;  3HPS A;  2PO0 B;  4ZYD A;  1NHI A;  4AM3 A;  4WUD A;  3EPL A;  5A69 A;  4R2Q A;  1Y4S A;  3AUZ A;  1DAR A;  2YU5 A;  1T39 A;  1STU A;  2WBT A;  1OYP A;  2CGE A;  5K36 B;  5A2Q C;  1Z0E A;  2ODR D;  1H7U A;  2HK3 A;  2JXP A;  5JEA F;  4DR5 E;  5AE3 A;  5DNL A;  3C6K A;  5LL6 R;  4LF7 E;  3M85 D;  2C37 B;  3P3E A;  2VF3 A;  1YUJ A;  5LMN I;  2CTD A;  5GMD A;  3U1K A;  4IFD E;  1QNT A;  2DMY A;  4P7A A;  2MC6 A;  2B9D A;  4ZYE A;  4PU9 A;  2UU9 I;  4P52 A;  4BA1 B;  5KL4 A;  4KHP E;  1Z0G A;  1Z0T A;  2NN6 A;  4DR6 I;  4DR3 E;  4ED4 A;  1J5E I;  1T4N A;  1B69 A;  4N4R B;  1WUU A;  4USM A;  3TQM A;  4OOG C;  3IWB A;  2J7K A;  2EMH A;  2L92 A;  2VRD A;  2V8Q B;  1IQO A;  1HNW E;  2N3H A;  2UXB I;  1YYK A;  1XNR E;  2UUB I;  5KL7 A;  4JV5 I;  3VYY A;  4IZJ B;  4LF4 I;  1Z0V A;  2BB8 A;  4I8O A; 
#chains in the Genus database with same CATH homology
 2L2K B;  4GKK I;  3LLH A;  1Z5C A;  1A6F A;  2B7T A;  4HY1 A;  2UXC I;  2UUC I;  3GON A;  4NXN I;  2O1T A;  1RC7 A;  1NHH A;  4KQV A;  2A2D A;  1IBM I;  4JI4 I;  1UEK A;  3JAM C;  4LF8 I;  4M1K A;  1S4E A;  3B78 A;  5LMN E;  3J80 C;  1ZXM A;  4F54 A;  4WSP A;  1Z59 A;  2UU9 E;  1GZ6 A;  5T6J A;  4JI7 I;  2L6M A;  4DR6 E;  2G7H A;  3C4T A;  4R8O A;  1T4O A;  5BR8 I;  1D6T A;  3HQ1 A;  2OI2 A;  2UXB E;  2CPN A;  2UUB E;  3WU5 A;  4JV5 E;  3H4L A;  4LF4 E;  5FLX C;  4OX9 E;  3Q1Q A;  4GKK E;  1ZM9 A;  3ZM7 A;  2M4I A;  2UXC E;  3B8H A;  2UUC E;  1RQ0 A;  1XMO E;  4FWG A;  2X7I A;  2O1V A;  4YHH I;  4JI1 I;  1IBM E;  3ZKD A;  4JI4 E;  3HJC A;  2VF1 A;  4X66 I;  4LF6 I;  4LF8 E;  2LTR A;  3ZOQ B;  4M0V A;  4NXM I;  3IWC A;  2XEX A;  4JI7 E;  1DI2 A;  5L3J A;  4JYA I;  4J8Z A;  4KZS A;  5BR8 E;  1N32 I;  4Z7C A;  1FWK A;  2LUQ A;  3K6Q A;  4B3R I;  1ZM3 A;  4DV6 I;  4L5N C;  5ADZ A;  4YHH E;  2JR1 A;  4JI1 E;  1VIS A;  4JI0 I;  5A2Q Q;  1FJG I;  2DIX A;  4WFT A;  2X36 A;  4DU8 A;  4X64 E;  3QT5 A;  4HXZ A;  4X66 E;  2R3V A;  4ZVI A;  5AE2 A;  5IT9 C;  4NXM E;  4LF5 I;  2JOX A;  2IHR 1;  4HAC B;  2LMZ A;  1X47 A;  2B7V A;  4LU9 A;  4IZK A;  4JYA E;  2O1W A;  1HR0 I;  1X49 A;  2ZBK B;  3HUL A;  3J81 C;  4DV3 I;  5IWA I;  1BKN A;  3PYD A;  3V5R A;  2LUP B;  3QT8 A;  5CFF E;  3J7A G;  2E1M A;  3T1Y E;  4DV6 E;  2V85 A;  2V89 A;  2A2C A;  4DU7 A;  3F6G A;  2HK2 A;  4LFB I;  4BC7 A;  1FI4 A;  2LTS A;  1MG7 A;  3Q6N A;  2E5L I;  4B3T I;  1FJG E;  4JI0 E;  2YT4 A;  1FWL A;  3AV0 A;  1K47 A;  1EKZ A;  2HKE A;  2WW4 A;  3J80 Q;  1QZR A;  1YYW A;  1ZM4 A;  1N36 I;  3JU0 A;  1H74 A;  1XHK A;  4LF5 E;  4DPU A;  3F0N A;  4N3O A;  3HTX A;  1N0V C;  2ODR C;  1KVK A;  1HR0 E;  2JOB A;  2V34 A;  4DV3 E;  5IWA E;  1PIE A;  4FW9 A;  3ADI A;  2H36 X;  4JI6 I;  5FLX Q;  2CZ9 A;  2Z5C B;  4LFB E;  3ZZU A;  4FWH A;  3B82 A;  1KKH A;  2E5L E;  4TUG A;  1Z5B A;  2HHH I;  1O0W A;  2NUF A;  2IOQ A;  1RR9 A;  2BV3 A;  4X65 I;  4OX9 I;  4DV4 I;  2KHX A;  2VQE I;  1N36 E;  3VYX A;  1J5E E;  4B3M I;  1PKP A;  2M1S A;  3V2U C;  4DV2 I;  4WYQ B;  4DR2 I;  4MYU A;  3PYG A;  2V86 A;  4JG4 A;  5AE1 A;  3QT6 A;  4BBY A;  3ADJ A;  3PYF A;  4JI6 E;  4K0K I;  5AAS A;  4NXN E;  1XNQ I;  4LFC I;  2Z5B B;  2L8T A;  3WU4 A;  4BMJ A;  3PYE A;  4FN5 A;  2BM1 A;  2HHH E;  4X65 E;  1Y6Z A;  2UXD I;  5IT9 Q;  4DV4 E;  2VQE E;  4PRX A;  2R42 A;  2O1U A;  1XMQ I;  2FV4 B;  1B62 A;  3LML A;  2LJP A;  1FKA E;  4B3M E;  4GKJ I;  3JTZ A;  2IOP A;  4DV2 E;  3QT7 A;  4DR2 E;  1WXR A;  4TUI A;  3J81 Q;  4Z7Y A;  2E1R A;  1RRE A;  5DNY A;  1NHJ A;  2LJH A;  2L3C A;  4MYT A;  3PRY A;  4JI2 I;  3DJW A;  4M2Z A;  1XNQ E;  1UIL A;  4DR1 I;  4DPT A;  4M30 A;  1HNX I;  1MX0 A;  4LFC E;  4IZJ D;  4JI5 I;  3IWD A;  4LF6 E;  4P7D A;  1Z0C A;  4FWD A;  4DMI A;  1IBK I;  4HAC A;  2JVA A;  1HNZ I;  1I94 I;  3OML A;  4JI3 I;  1U2R A;  4P78 A;  1H73 A;  1XMQ E;  4F9C B;  3D4J A;  1QU6 A;  1N32 E;  2NA2 A;  3LTO A;  4DKK A;  4DPX A;  2L3J A;  4B3R E;  2JWO A;  4LF9 I;  2RSM A;  3KWR A;  2L2M A;  4I3H A;  4DV0 I;  4JI2 E;  4DR7 I;  1Y4U A;  4RPF A;  4DR1 E;  3OTO I;  2GS8 A;  3FIG A;  4DPW A;  3Q6M A;  3MSW A;  2F4V I;  4JI5 E;  1ZBQ A;  2RS7 A;  3JAM Q;  2UUA I;  4LTY A;  2L2N A;  2PNM A;  3K1J A;  1ZBT A;  3HXL A;  1IBK E;  1T4L B;  2Z5E A;  1HNZ E;  3H09 A;  1I94 E;  2V2Q A;  2V87 A;  2AJ4 A;  4XTJ A;  4JI3 E;  4BS9 A;  4AQY I;  4L8N A;  3M6A A;  1ZXN A;  2LRS A;  2N3G A;  2RTX A;  2HFS A;  2V2Z A;  4IZJ A;  3K85 A;  4B3S I;  1FNM A;  1USU A;  4BC9 A;  1B63 A;  4LF9 E;  1N34 I;  2LE2 A;  3F6H A;  2L33 A;  4R1F A;  2Z5C A;  4DV0 E;  1H72 C;  1N0U A;  2K4V A;  4DR7 E;  3RMP A;  4USK A;  4BCA A;  1SR9 A;  3OTO E;  4B3T E;  2F4V E;  4DR4 I;  5FWK A;  1NZ0 A;  1USV A;  2UUA E;  4WUC A;  1Z5A A;  3J7A M;  1GQE A;  1WHQ A;  1ELO A;  3ADL A;  4URL A;  4LFA I;  4DV5 I;  4AQY E;  1HK7 A;  1OJ4 A;  1Z0B A;  1XMO I;  2HFU A;  1YYO A;  4B3S E;  1N34 E;  3C4B A;  4WPY A;  1YZ9 A;  2ZIT A;  2V2V A;  4YY3 I;  2ZM6 I;  3ZZ0 A;  2VQF I;  1X48 A;  2MC5 A;  2Z5B A;  4JI8 I;  1KIJ A;  4GEQ B;  2HKJ A;  4PRV A;  1H7S A;  4DV1 I;  2NPF A;  4DR4 E;  2KON A;  4DPY A;  4X62 I;  1S16 A;  2WZO A;  3WU6 A;  4DUY I;  2DB2 A;  2GQ0 A;  3LNU A;  1KTV A;  1ZM2 A;  2EZ6 A;  4R03 A;  2DEI A;  1J26 A;  1MU5 A;  4LFA E;  4DV5 E;  5LMU I;  4F9B B;  4DV7 I;  2VE7 C;  2YZT A;  4X64 I;  2Q2E B;  2RS6 A;  1IBL I;  2F8B A;  2KOU A;  3CWV A;  4EMD A;  4YY3 E;  4K0K E;  2ZM6 E;  2B3T B;  2VQF E;  2DSY A;  2LBS B;  5F3W A;  4JI8 E;  1N33 I;  1PVG A;  4DUZ I;  2EFG A;  1DQ3 A;  3T1H I;  3P06 A;  3WU3 A;  4DV1 E;  2V8P A;  4X8W A;  2FGG A;  4X62 E;  4UT4 A;  2MDR A;  3T1Y I;  4DUY E;  2NUE A;  2UXD E;  1EI1 A;  2JY9 A;  4Q28 A;  3LPS A;  1EA6 A;  4HYM A;  1UHZ A;  2CG9 A;  2FTX B;  2V83 A;  3ZZT A;  1Z0W A;  5LMU E;  4GKJ E;  4DR5 I;  2EWL A;  4LF7 I;  2NUG A;  4DV7 E;  1WHN A;  2M7Q A;  2BM0 A;  4DXL A;  1IBL E;  3ZKB A;  4KHP I;  4WUB A;  5GME A;  4DR3 I;  2PNL A;  3J7Y p;  1HNX E;  3VK6 A;  3P1X A;  1N33 E;  4DUZ E;  2DEJ A;  3ADG A;  4IZK B;  3T1H E;  1HNW I;  2V88 A;  1XNR I;  4UTG A;  3DF6 A;  3HPZ A;  3K17 A;  4F9A B;  3HPS A;  1NHI A;  4WUD A;  1Y4S A;  3AUZ A;  1DAR A;  2CGE A;  1STU A;  5A2Q C;  1Z0E A;  2ODR D;  1H7U A;  2HK3 A;  4DR5 E;  5AE3 A;  5LL6 R;  4LF7 E;  2VF3 A;  5LMN I;  5GMD A;  2DMY A;  4P7A A;  2MC6 A;  2B9D A;  4PU9 A;  2UU9 I;  4P52 A;  4KHP E;  1Z0G A;  1Z0T A;  4DR6 I;  4DR3 E;  4ED4 A;  1J5E I;  1T4N A;  1WUU A;  4USM A;  4OOG C;  3IWB A;  2J7K A;  2L92 A;  2V8Q B;  1HNW E;  2N3H A;  2UXB I;  1YYK A;  1XNR E;  2UUB I;  4JV5 I;  3VYY A;  4IZJ B;  4LF4 I;  1Z0V A;  4I8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...