4DV1E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 32
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv1E02
3LTOA 4K0KI 4GKJI 2V2VA 3J80Q 2UU9I 2RTXA 2UXDI 2RS7A 4JI4E 2E1RA 4JI2I 4X66E 4DV2I 2L3JA 2R42A 3ZZTA 2L3CA 1XNQI 1ZM3A 2LUPB 4DV3I 2EZ6A 2HKJA 4KHPE 4LFCE 4B3TE 2UXDE 1PIEA 4DV7I 4Z7YA 4B3SE 2B7VA 4R1FA 2ZM6I 1N32E 4DV4E 3T1YI 3J81Q 2UXBI 1XNQE 4DV5E 1X49A 2HK3A 1N33I 1ZM4A 4KHPI 4DV6I 4DV7E 2DMYA 1IBKE 2JY9A 2ZBKB 4GKJE 2NUEA 1EI1A 4B3RI 2UU9E 3T1YE 4WUDA 1I94I 2NUFA 1UEKA 1NHJA 2Q2EB 1EKZA 2UUAI 2A2CA 4K0KE 1HNWI 4LF8E 2BV3A 4P52A 4DR5E 1X48A 4B3TI 2NUGA 4I3HA 2A2DA 2OI2A 1YYKA 4USKA 2NA2A 4FWHA 4WUCA 3QT8A 1Z5BA 4DV0I 2MDRA 4DR7I 1OJ4A 3B82A 4B3MI 4LFCI 4DR5I 1S16A 2EFGA 2UXCE 4FN5A 2VQFI 2BM1A 4AQYE 3C4BA 3Q1QA 2UXBE 3JAMQ 4DU7A 5LMNI 4YHHI 3P1XA 4UT4A 2BM0A 4DR7E 4Z7CA 3K1JA 3J7AG 4YY3I 3WU3A 5IWAE 4WUBA 4ED4A 2VQFE 1O0WA 4JI1E 3PYEA 4B3RE 1HNWE 4XTJA 1UHZA 1STUA 1BKNA 4DPUA 1WHNA 4JI0I 1I94E 5A2QC 2DEJA 3J7AM 4GKKE 4DPWA 1KIJA 2RSMA 2JVAA 1XMOE 2F4VI 2WW4A 2X36A 3WU6A 4HXZA 4LFBI 4JI7E 2V8PA 5GMDA 1Z0GA 4HY1A 1DARA 3OTOI 3V5RA 1YYOA 4MYUA 1UILA 4YHHE 4LF4E 1T4OA 4DV3E 2UXCI 2YT4A 4OX9E 2F4VE 1XMOI 4AQYI 4YY3E 3LPSA 3B78A 2DEIA 4B3SI 1PVGA 1FWLA 1D6TA 3J81C 4DU8A 1A6FA 3ZZUA 1WHQA 4JI0E 4DV5I 2CPNA 2CZ9A 4GKKI 1FI4A 4M1KA 2V2QA 4DV6E 1NHIA 1T4LB 2E5LI 4PU9A 4JI3I 1PKPA 3ADJA 1K47A 1VISA 1RQ0A 4JV5E 4JI7I 5GMEA 1Z0WA 2L2KB 3PYGA 4DKKA 4X62I 1WUUA 3OTOE 3ZKDA 3HULA 4JI6I 4DV1I 1H74A 4LF8I 4JI3E 4M2ZA 4FWDA 1X47A 3QT7A 2LRSA 4DR6I 4LF4I 1DI2A 4DV0E 1Z59A 4KQVA 2AJ4A 1H7UA 4NXNI 4NXMI 4B3ME 3J7Yp 1EA6A 2B7TA 1B63A 1YYWA 4DR2E 1MX0A 4DUYI 5BR8E 4DUZI 4OOGC 4HACA 5CFFE 3ZZ0A 1B62A 5FLXC 4LFAE 1RREA 2N3HA 3JAMC 2IHR1 2J7KA 4X8WA 1QZRA 2RS6A 1FWKA 1Z0EA 5IWAI 1XMQI 3LLHA 2LUQA 3D4JA 1ZXMA 1J5EE 4DUZE 5BR8I 1GQEA 4JI1I 3M6AA 4JI6E 4JV5I 1J26A 3T1HE 4FWGA 5IT9C 4URLA 3VYYA 2L2MA 3WU5A 4LF5I 4WFTA 1T4NA 3QT6A 2UUCI 4DV1E 1NZ0A 1ZXNA 2N3GA 4USMA 3ADGA 4LFBE 2GS8A 2HK2A 4HYMA 4DUYE 4DR6E 2LJPA 2KHXA 1N36I 2VF3A 1H7SA 3ZKBA 4NXNE 4NXME 5IT9Q 1HNZI 4DR2I 2X7IA 4OX9I 1XMQE 1FKAE 4HACB 4UTGA 3ADLA 1N36E 4RPFA 4LFAI 1KVKA 3VYXA 5A2QQ 1S4EA 1Z5CA 1KKHA 5FLXQ 1QU6A 2HHHE 3J80C 4M30A 1KTVA 3C4TA 2E5LE 3T1HI 4ZVIA 2L2NA 2V2ZA 3LNUA 4LF6I 5LMUI 4LF5E 4P7AA 4X62E 2UUCE 2HFUA 1H72C 4MYTA 3V2UC 4X65E 2DIXA 2R3VA 4DPTA 5L3JA 1HR0I 1Z0CA 3B8HA 1HNXE 1N34I 3ADIA 2VQEE 1MG7A 2XEXA 4JI8I 1FJGI 1Z5AA 1XHKA 4DV4I 3K17A 1Z0TA 2UUBI 4DR1E 5LL6R 4EMDA 2HHHI 1N0VC 1ELOA 1NHHA 2B3TB 1IBKI 1XNRE 4DR4E 4JI8E 5LMUE 2UUBE 4JG4A 2DB2A 2ZITA 3ZM7A 1J5EI 4DPYA 2UUAE 4DR3I 1IBLI 4LF6E 1FNMA 1HR0E 4DR4I 2LJHA 3QT5A 1N34E 1HNXI 4PRXA 1H73A 2VQEI 4JI2E 1IBME 1YZ9A 2L33A 4X65I 4DV2E 4LF9E 1Z0VA 1FJGE 4PRVA 4DR3E 1U2RA 4DR1I 2HFSA 1MU5A 1Z0BA 4JI4I 2LTSA 4DXLA 3F0NA 4JI5E 1ZBTA 2V34A 4X64E 4WYQB 1XNRI 5LMNE 4LF9I 1RR9A 1N32I 2LTRA 1HNZE 4JYAI 1ZM9A 2NPFA 3WU4A 3GONA 4DPXA 4LF7E 1IBLE 3H4LA 4FW9A 4JI5I 2HKEA 2ZM6E 4X64I 1ZM2A 4X66I 1RC7A 3HTXA 1IBMI 4JYAE 3PYDA 1N33E 2LBSB 3PYFA 1N0UA 3CWVA 4LF7I
chains in the Genus database with same CATH superfamily
3KWRA 3OMLA 4ZYGA 3LTOA 4GKJI 4K0KI 2V2VA 3HQ1A 2J65A 3J80Q 3HPZA 2EPUA 2RTXA 2DLQA 2UU9I 2UXDI 2PO2B 2EOEA 2RS7A 4JI4E 1DQ3A 2V83A 2E1RA 3BBGA 4X66E 2JT2A 4JI2I 2YSPA 4BC7A 4DV2I 2L3JA 5K36E 2R42A 5KL5A 3PRYA 2EOZA 2R1FA 4WXDA 5LLQA 3ZZTA 3EPHA 3KZZA 5KL2A 2JPAA 2L3CA 1XNQI 2MC5A 1ZM3A 2LUPB 4DV3I 2EZ6A 1PDAA 2HKJA 4KHPE 2RSIA 4LFCE 4B3TE 2EOFA 2UXDE 1PIEA 4DV7I 4Z7YA 2LE2A 4B3SE 3B4TA 5DRQA 4WSGA 2B7VA 4AIMA 2YTOA 4R1FA 2ZM6I 1N32E 3H09A 2MC6A 4DV4E 3J81Q 3T1YI 2UXBI 2CSHA 2EM2A 5KL3A 1XNQE 4DV5E 1X49A 2EMYA 3RMPA 1X3CA 2HK3A 1N33I 1ZM4A 1YH8A 4KHPI 4R2AA 4DV6I 2MKNA 4F9AB 2EOJA 5KL6A 4DV7E 4J3DA 2DMYA 2V8QB 2F1DA 2N8XA 1IBKE 2JY9A 4NHRA 4GKJE 2ZBKB 2NUEA 2EN4A 1EI1A 3K85A 4MU4A 4GQUA 2JEAA 2UU9E 4B3RI 5A6BA 4X9JA 3T1YE 4WUDA 3BF2A 3ECRA 3GLLA 2KONA 4IZJB 4OKGA 2WCC3 1I94I 2NUFA 1UEKA 4FW6A 1NHJA 3JU0A 1EKZA 2Q2EB 4BHBA 1USUA 2YTEA 2UUAI 2EM3A 5A6JA 2A2CA 4K0KE 2V86A 2C39B 5DNXA 1HNWI 2FGGA 1TF3A 2PNZB 4LF8E 2BV3A 4BMJA 4R03A 5T6JA 4DR5E 3EPLA 2C38A 4P52A 1X48A 3HPSA 3M99B 4B3TI 2DRPA 2NUGA 2LV2A 5DRRA 2A2DA 4I3HA 4LPFA 2OI2A 1YYKA 1WXRA 1DGCA 3JTZA 4USKA 2NA2A 4FWHA 4MDTA 1AAYA 3QT8A 1GTKA 1A1IA 4MU1A 4WUCA 1Z5BA 3THNA 1MGTA 2EPPA 2MDRA 4DV0I 2WZOA 2EM6A 2JYAA 2PRTA 5JEAF 4DR7I 1OJ4A 4O24A 3B82A 4B3MI 2EPXA 4LFCI 4DMIA 4IFDD 5K36D 2EM0A 4BA1B 4DR5I 1S16A 2EFGA 2UXCE 4FN5A 5C0XC 2BM1A 2VQFI 4AQYE 2EOIA 4IFDB 3C4BA 2EM4A 3Q1QA 2EPCA 1NCSA 2UXBE 3JAMQ 4DU7A 5LMNI 1YFHA 4YHHI 2EJ4A 3P06A 3P1XA 3DF6A 4LOMA 2EE8A 2EN6A 4UT4A 2BM0A 4F6MA 4DR7E 2PO0B 4Z7CA 2ODRC 2DGCA 4NBQA 2FTXB 2BA1D 3U1KA 3K1JA 2GPIA 2V88A 1ZBQA 2EMWA 3J7AG 4YY3I 1EH7A 1B69A 5IWAE 4WUBA 5JEAC 3WU3A 4ED4A 5A6KA 2VQFE 4M9VC 4TUIA 2VE7C 3Q6NA 1O0WA 4OO1E 2ENHA 2Z5CA 2LT7A 4JI1E 4B3RE 1HNWE 1MEYC 3PYEA 4XTJA 1UHZA 4IZJD 1STUA 1ZU1A 1BKNA 4DPUA 1WHNA 4JI0I 1I94E 5A2QC 2DEJA 3J7AM 5A69A 5EL9A 2LJUA 4GKKE 5JEAA 2PNLA 4DPWA 1F2IG 2EPMX 1KIJA 4WX9A 2RSMA 5C0XA 2JVAA 4IZKA 2NN6A 2J7JA 5TSEA 1JK1A 1XMOE 4MU0A 5C0XB 2F4VI 1G2DC 2EOQA 1OYSA 2NN6B 5IV8B 2EM9A 2WW4A 2X36A 4HXZA 3WU6A 4LFBI 2EL5A 2I9IA 4JI7E 2EMAA 1NEIA 2V8PA 5GMDA 1Z0GA 1G2FC 4HY1A 4F9BB 2PO1A 2Z5EA 2EP3A 1DARA 1BBOA 3OTOI 3PS3A 2YTNA 3V5RA 1YYOA 4MYUA 1UILA 2PO1B 4YHHE 4LF4E 3M7ND 4L8NA 1T4OA 2EOHA 4DV3E 2UXCI 2YT4A 3MHHC 2DMIA 4OX9E 2F4VE 1XMOI 4AQYI 2KOUA 4YY3E 2JOXA 5ADZA 3LPSA 3L00A 5C0XD 5C0XF 3B78A 1UDNA 2DEIA 4B3SI 4LU9A 1PVGA 2YRHA 1X6HA 1L4SA 1FWLA 4O5GA 1D6TA 5AASA 4MLVA 4Q35B 3J81C 2YZTA 4J8ZA 2O1WA 2DLKA 4DU8A 1A6FA 2EOXA 1WHQA 4JI0E 3ZZUA 2RPCA 4GEQB 4DV5I 2CPNA 1XMQI 2CZ9A 4GKKI 2R76A 1E3HA 1FI4A 3PS2A 2V2QA 3VHTB 4DV6E 2K4VA 4M1KA 1NHIA 2V87A 2NN6C 2ENCA 2DSYA 2Z5CB 4LCHA 2EWLA 4BHCA 2EMHA 1T4LB 2E5LI 2E72A 4PU9A 4JI3I 3F6HA 1PKPA 2ENAA 3ADJA 1K47A 1RQ0A 1VISA 4JV5E 5JEAE 2YPNA 3CWVA 4JI7I 5GMEA 1Z0WA 4ISAA 2L2KB 4IFDC 4BS9A 3PYGA 4DKKA 4RHBB 3L7ZB 4X62I 2EMFA 2L6MA 4WSPA 4IS1C 1WUUA 3OTOE 1UDOA 3L7ZA 1Y5YA 1GZ6A 4FW5A 4BA1A 4O43A 3ZKDA 3HULA 4R2RA 4JI6I 4DV1I 2LVHA 1H74A 3HKMA 5DNYA 4LF8I 2GLIA 4IFDA 4JI3E 2NN6F 3P76A 3Q6MA 2HC5A 2ODRD 4WXCA 4M2ZA 1KYQA 2E1MA 4N4RB 4FWDA 1X47A 3QT7A 2LRSA 4DR6I 4U3DA 4LF4I 3QG5C 1DI2A 2JEBB 2O1TA 2PO0A 4DV0E 1Z59A 4KQVA 4OO1F 2WBSA 3GCMA 1Y4SA 2IESA 4R2QA 2AJ4A 2JEBA 1H7UA 4NXNI 4NXMI 2WBTA 1A1GA 4B3ME 3J7Yp 1EA6A 2B7TA 4TUGA 1B63A 1YYWA 4DR2E 1RMDA 4NZVA 1MX0A 4DUYI 5BR8E 4DUZI 4OOGC 2EPAA 2GQ0A 4HACA 2B9DA 2EMIA 4WPYA 4IFDF 5CFFE 2F8BA 1B62A 5FLXC 3ZZ0A 2EOYA 4LFAE 1RREA 4BA2B 2N3HA 3JAMC 2EN8A 2IHR1 3AUZA 4F6NA 4MLQA 5A6BD 4X8WA 1P42A 1QZRA 2J7KA 4R2CA 2L8TA 2M1SA 1YUJA 2WNRA 1SR9A 1TN9A 2RS6A 3HXLA 1FWKA 1Z0EA 5IWAI 2JR1A 1A1JA 3LLHA 2LUQA 2V85A 2GHFA 1ZXMA 3D4JA 1J5EE 1UN6B 4OO1A 2C38B 5K36A 4DUZE 5BR8I 1GQEA 4JI1I 3M6AA 4JI6E 4JV5I 5K36B 2EMBA 3AV0A 2EPRA 2EN7A 1J26A 3T1HE 5F3WA 2CVEA 4FWGA 2MDGA 5IT9C 1Z1BA 2ELYA 4URLA 2EPKX 2BA0G 1A1LA 2EQ1A 3VYYA 4P78A 2EOSA 1R6MA 1SFEA 2L2MA 1YPNA 4ZYDA 2ELZA 3WU5A 1IQOA 4LF5I 2A25A 4OO1C 4WFTA 1T4NA 3UK3C 3QT6A 5C0XE 3M85D 2UUCI 1A1HA 4DV1E 2LCEA 1HK7A 1NZ0A 1TF6A 1ZXNA 2EMKA 4R2SA 2N3GA 5IXMB 4USMA 1VI7A 3ADGA 2JXPA 3U1YA 2FV4B 4LFBE 2IOPA 2JP9A 2L92A 1ZR9A 2GS8A 2HK2A 4HYMA 2IERA 4DUYE 4DR6E 2LJPA 4M0VA 4R2PA 2KHXA 4GZNC 1N36I 2VF3A 1KJKA 3F6GA 1H7SA 2CTDA 2EM8A 2JOBA 4BC9A 2EOMA 3H1CA 4LCGA 3ZKBA 4NXNE 4NXME 1PJTA 1T38A 4OZEA 5IT9Q 1UDSA 2YWQA 1X6EA 1HNZI 5EKWA 4DR2I 2X7IA 2V89A 1RHYA 2NABA 2BA1G 4KWYA 2GO4A 3HJCA 4QNJA 4OX9I 5K36C 5DRPA 2G7HA 4R8OA 1T39A 1XMQE 4OO1D 4F9CB 2CG9A 1FKAE 1R6LA 4HACB 4N3OA 4UTGA 2RQLA 3ADLA 2IOQA 1N36E 2YTIA 1P47A 4RPFA 3KZYA 4LFAI 2Z5BB 1KVKA 5FWKA 3VYXA 5A2QQ 1S4EA 1Z5CA 1KKHA 5FLXQ 1QU6A 2HHHE 3J80C 1EH6A 4IZKB 1IQSA 4M30A 1WJPA 1KTVA 3C4TA 2YU5A 1A1KA 2E5LE 2EPZA 3T1HI 5K36F 4ZVIA 2L2NA 2BR2B 2V2ZA 2EMZA 3CDJA 1Y4UA 3LNUA 5AE1A 4LF6I 5LMUI 1PJSA 3DJWA 1N3GA 2CT1A 2EQ0A 4LF5E 5AC4A 4P7AA 2JEAB 4X62E 3DD6A 2UUCE 2I13A 2HFUA 2YTGA 1H72C 4FW3A 4MYTA 3V2UC 3LMLA 4KZSA 4X65E 2LO3A 1E3PA 2EMGA 2M7QA 2VRDA 4Q28A 4R2DA 2DIXA 2O1VA 3M7NG 2R3VA 4IFDE 4DPTA 5L3JA 1BBGA 5ELWA 2YTFA 4MQYA 1HR0I 4BBYA 2PNZA 1Z0CA 3B8HA 2EN2A 1HNXE 3ADIA 1N34I 1Y60A 2VQEE 1MG7A 2XEXA 2PNMA 4F2JC 1OYPA 2EPNA 2GO3A 2BBGA 2NN6E 4JI8I 3C6KA 2EN1A 3EQ1A 1Z5AA 1FJGI 1XHKA 4DV4I 5AE3A 2EM5A 1ZAAC 3K17A 1Z0TA 4FW4A 4LTYA 2HJJA 1X5WA 4P7DA 2UUBI 4DR1E 4OO1B 1BB8A 2YTQA 5LL6R 4EMDA 2YTPA 3FIGA 1N0VC 3MHSC 4FK5C 2HHHI 1WRJA 1EH8A 4LCFA 3P3EA 5A6AA 3IWDA 1ELOA 1NHHA 4U3BA 2B3TB 4AM3A 2O3ZA 1X6FA 2EMXA 2YTDA 1IBKI 3IWCA 2EL6A 1XNRE 4DR4E 2BA0D 3GMEA 4JI8E 2WP8A 2M9AA 5LMUE 5AC5A 2JWOA 3C6MA 2WP8B 2M4IA 2UUBE 4JG4A 2DB2A 2ZITA 1YHCA 1PJQA 5KL4A 3ZM7A 1J5EI 2K7IA 4DPYA 2UUAE 2C37B 2VF1A 4DR3I 3IWBA 1IBLI 2O1UA 2EQ3A 2BR2A 1LLMC 2EOOA 3K6QA 4LF6E 1FNMA 2C37A 4F54A 1HR0E 4ZYEA 4DR4I 2LJHA 3EPJA 2BB8A 3QT5A 1N34E 2EORA 2PO2A 4PRXA 5JEAD 1H73A 1HNXI 1YUIA 4RH8A 4L5NC 1IBME 3TQMA 2L33A 3EPKA 4JI2E 1YZ9A 2VQEI 5DROA 4X65I 2H36X 4DV2E 4LF9E 1Z0VA 4R2EA 3CDIA 5JEAB 1FJGE 4IS9A 4PRVA 2MKDA 3KRNA 3BIDA 2EM7A 1UBDC 1YSAC 4DR3E 1JK2A 3P3CA 1U2RA 4DR1I 4HEIA 2WBUA 4FW7A 2AE8A 1XXEA 4HTGA 2HFSA 1MU5A 5DNLA 3NZKA 2YTJA 1Z0BA 4I8OA 2Z5BA 2C39A 2CGEA 2EL4A 4JI4I 2JE6B 2LTSA 1QNTA 4DXLA 1A1FA 4JI5E 3F0NA 4BA2A 1AH5A 2HGHA 3THOB 1UDQA 1ZBTA 2JE6A 2V34A 3UHMA 4X64E 2YSOA 4WYQB 4BCAA 1XNRI 2EMCA 5LMNE 4LF9I 2WNRB 1RR9A 1N32I 2LTRA 1HNZE 3ZOQB 2EN3A 4JYAI 2EMLA 4IJDA 1ZM9A 2NPFA 2NN6D 2D9HA 3WU4A 3GONA 2VESA 3VK6A 4QNKA 3PS1A 4DPXA 4LF7E 2ADRA 1IBLE 3H4LA 4FW9A 4JI5I 2HKEA 2ZM6E 3P3GA 5KL7A 4AIDA 4X64I 5AE2A 1ZM2A 1Y6ZA 4X66I 3MSWA 2Q8UA 2YRKA 1RC7A 3BGHA 3HTXA 2YU8A 2YRMA 1IBMI 4IZJA 4ZYHA 4MU3A 4JYAE 3PYDA 1N33E 3M85G 1OYRA 2LBSB 4O4KA 2EPLX 2EPOA 1IMUA 1N0UA 3PYFA 1USVA 2LMZA 4LF7I
chains in the Genus database with same CATH topology
3KWRA 3OMLA 3LTOA 4K0KI 4GKJI 2V2VA 3HQ1A 3J80Q 3HPZA 2UU9I 2RTXA 2UXDI 2RS7A 4JI4E 2E1RA 1DQ3A 2V83A 4JI2I 4X66E 4BC7A 4DV2I 2L3JA 2R42A 3PRYA 3ZZTA 2L3CA 1XNQI 2MC5A 1ZM3A 2LUPB 4DV3I 2EZ6A 2HKJA 4KHPE 4LFCE 4B3TE 2UXDE 1PIEA 4DV7I 4Z7YA 2LE2A 4B3SE 2B7VA 4R1FA 2ZM6I 1N32E 3H09A 2MC6A 4DV4E 3J81Q 3T1YI 2UXBI 1XNQE 4DV5E 1X49A 3RMPA 2HK3A 1N33I 1ZM4A 4KHPI 4DV6I 4F9AB 4DV7E 2DMYA 2V8QB 1IBKE 2JY9A 4GKJE 2ZBKB 2NUEA 3K85A 1EI1A 4B3RI 2UU9E 3T1YE 4WUDA 4IZJB 2KONA 1I94I 2NUFA 1UEKA 1NHJA 3JU0A 1EKZA 2Q2EB 1USUA 2UUAI 2A2CA 4K0KE 2V86A 1HNWI 2FGGA 4LF8E 2BV3A 4BMJA 4R03A 5T6JA 4DR5E 4P52A 1X48A 3HPSA 4B3TI 2NUGA 4I3HA 2A2DA 2OI2A 1YYKA 1WXRA 4USKA 3JTZA 2NA2A 4FWHA 4WUCA 3QT8A 1Z5BA 4DV0I 2MDRA 2WZOA 4DR7I 1OJ4A 3B82A 4B3MI 4LFCI 4DMIA 4DR5I 1S16A 2EFGA 2UXCE 4FN5A 2VQFI 2BM1A 4AQYE 3C4BA 3Q1QA 2UXBE 3JAMQ 4DU7A 5LMNI 4YHHI 3P06A 3P1XA 3DF6A 4UT4A 2BM0A 4DR7E 4Z7CA 2ODRC 2FTXB 3K1JA 2V88A 1ZBQA 3J7AG 4YY3I 3WU3A 5IWAE 4WUBA 4ED4A 2VQFE 3Q6NA 4TUIA 2VE7C 1O0WA 2Z5CA 4JI1E 3PYEA 4B3RE 1HNWE 4XTJA 1UHZA 4IZJD 1STUA 1BKNA 4DPUA 1WHNA 4JI0I 1I94E 5A2QC 2DEJA 3J7AM 4GKKE 2PNLA 4DPWA 1KIJA 2RSMA 2JVAA 4IZKA 1XMOE 2F4VI 2WW4A 2X36A 3WU6A 4HXZA 4LFBI 4JI7E 2V8PA 5GMDA 1Z0GA 4HY1A 4F9BB 2Z5EA 1DARA 3OTOI 3V5RA 1YYOA 4MYUA 1UILA 4YHHE 4LF4E 4L8NA 1T4OA 4DV3E 2UXCI 2YT4A 4OX9E 2F4VE 1XMOI 4AQYI 2KOUA 4YY3E 2JOXA 5ADZA 3LPSA 3B78A 2DEIA 4B3SI 4LU9A 1PVGA 1FWLA 1D6TA 5AASA 3J81C 2YZTA 4J8ZA 2O1WA 4DU8A 1A6FA 3ZZUA 1WHQA 4JI0E 4GEQB 4DV5I 2CPNA 2CZ9A 4GKKI 1FI4A 4M1KA 2V2QA 4DV6E 2K4VA 1NHIA 2V87A 2DSYA 2Z5CB 2EWLA 1T4LB 2E5LI 4PU9A 4JI3I 3F6HA 1PKPA 3ADJA 1K47A 1VISA 1RQ0A 4JV5E 4JI7I 5GMEA 1Z0WA 2L2KB 4BS9A 3PYGA 4DKKA 4X62I 2L6MA 4WSPA 1WUUA 3OTOE 1GZ6A 3ZKDA 3HULA 4JI6I 4DV1I 1H74A 4LF8I 5DNYA 4JI3E 3Q6MA 2ODRD 4M2ZA 2E1MA 4FWDA 1X47A 3QT7A 2LRSA 4DR6I 4LF4I 1DI2A 2O1TA 4DV0E 1Z59A 4KQVA 1Y4SA 2AJ4A 1H7UA 4NXNI 4NXMI 4B3ME 3J7Yp 1EA6A 2B7TA 4TUGA 1B63A 1YYWA 4DR2E 1MX0A 4DUYI 5BR8E 4DUZI 4OOGC 2GQ0A 4HACA 2B9DA 4WPYA 5CFFE 2F8BA 1B62A 5FLXC 3ZZ0A 4LFAE 1RREA 2N3HA 3JAMC 2IHR1 3AUZA 2J7KA 4X8WA 1QZRA 2L8TA 2M1SA 1SR9A 2RS6A 3HXLA 1FWKA 1Z0EA 5IWAI 2JR1A 1XMQI 3LLHA 2LUQA 2V85A 3D4JA 1ZXMA 1J5EE 4DUZE 5BR8I 1GQEA 4JI1I 3M6AA 4JI6E 4JV5I 1J26A 3AV0A 3T1HE 5F3WA 4FWGA 5IT9C 4URLA 3VYYA 4P78A 2L2MA 3WU5A 4LF5I 4WFTA 1T4NA 3QT6A 2UUCI 4DV1E 1HK7A 1NZ0A 1ZXNA 2N3GA 4USMA 3ADGA 2FV4B 4LFBE 2IOPA 2L92A 2GS8A 2HK2A 4HYMA 4DUYE 4DR6E 2LJPA 4M0VA 2KHXA 1N36I 2VF3A 3F6GA 1H7SA 2JOBA 4BC9A 3ZKBA 4NXNE 4NXME 5IT9Q 1HNZI 4DR2I 2X7IA 2V89A 4OX9I 3HJCA 2G7HA 4R8OA 1XMQE 4F9CB 2CG9A 1FKAE 4HACB 4N3OA 4UTGA 3ADLA 2IOQA 1N36E 4RPFA 4LFAI 2Z5BB 1KVKA 5FWKA 3VYXA 5A2QQ 1S4EA 1Z5CA 1KKHA 5FLXQ 1QU6A 2HHHE 3J80C 4IZKB 4M30A 1KTVA 3C4TA 2E5LE 3T1HI 4ZVIA 2L2NA 2V2ZA 1Y4UA 3LNUA 5AE1A 4LF6I 5LMUI 3DJWA 4LF5E 4P7AA 4X62E 2UUCE 2HFUA 1H72C 4MYTA 3V2UC 3LMLA 4KZSA 4X65E 2M7QA 4Q28A 2O1VA 2DIXA 2R3VA 4DPTA 5L3JA 1HR0I 4BBYA 1Z0CA 3B8HA 1HNXE 1N34I 3ADIA 2VQEE 1MG7A 2XEXA 2PNMA 4JI8I 1FJGI 1Z5AA 1XHKA 4DV4I 5AE3A 3K17A 1Z0TA 4LTYA 2UUBI 4P7DA 4DR1E 5LL6R 4EMDA 3FIGA 1N0VC 2HHHI 1ELOA 3IWDA 1NHHA 2B3TB 1IBKI 3IWCA 1XNRE 4DR4E 4JI8E 5LMUE 2JWOA 2M4IA 2UUBE 4JG4A 2DB2A 2ZITA 3ZM7A 1J5EI 4DPYA 2UUAE 2VF1A 4DR3I 3IWBA 1IBLI 2O1UA 3K6QA 4LF6E 1FNMA 4F54A 1HR0E 4DR4I 2LJHA 3QT5A 1N34E 1HNXI 4PRXA 1H73A 2VQEI 4L5NC 1IBME 4JI2E 2L33A 1YZ9A 4X65I 2H36X 4DV2E 4LF9E 1Z0VA 1FJGE 4PRVA 4DR3E 1U2RA 4DR1I 2HFSA 1MU5A 1Z0BA 4I8OA 2Z5BA 2CGEA 4JI4I 2LTSA 4DXLA 3F0NA 4JI5E 1ZBTA 2V34A 4X64E 4WYQB 4BCAA 1XNRI 5LMNE 4LF9I 1RR9A 1N32I 2LTRA 1HNZE 3ZOQB 4JYAI 1ZM9A 2NPFA 3WU4A 3GONA 4DPXA 3VK6A 4LF7E 1IBLE 3H4LA 4FW9A 4JI5I 2HKEA 2ZM6E 4X64I 5AE2A 1ZM2A 1Y6ZA 4X66I 3MSWA 1RC7A 3HTXA 1IBMI 4IZJA 4JYAE 3PYDA 1N33E 2LBSB 3PYFA 1N0UA 3CWVA 1USVA 2LMZA 4LF7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTO A;  4K0K I;  4GKJ I;  2V2V A;  3J80 Q;  2UU9 I;  2RTX A;  2UXD I;  2RS7 A;  4JI4 E;  2E1R A;  4JI2 I;  4X66 E;  4DV2 I;  2L3J A;  2R42 A;  3ZZT A;  2L3C A;  1XNQ I;  1ZM3 A;  2LUP B;  4DV3 I;  2EZ6 A;  2HKJ A;  4KHP E;  4LFC E;  4B3T E;  2UXD E;  1PIE A;  4DV7 I;  4Z7Y A;  4B3S E;  2B7V A;  4R1F A;  2ZM6 I;  1N32 E;  4DV4 E;  3T1Y I;  3J81 Q;  2UXB I;  1XNQ E;  4DV5 E;  1X49 A;  2HK3 A;  1N33 I;  1ZM4 A;  4KHP I;  4DV6 I;  4DV7 E;  2DMY A;  1IBK E;  2JY9 A;  2ZBK B;  4GKJ E;  2NUE A;  1EI1 A;  4B3R I;  2UU9 E;  3T1Y E;  4WUD A;  1I94 I;  2NUF A;  1UEK A;  1NHJ A;  2Q2E B;  1EKZ A;  2UUA I;  2A2C A;  4K0K E;  1HNW I;  4LF8 E;  2BV3 A;  4P52 A;  4DR5 E;  1X48 A;  4B3T I;  2NUG A;  4I3H A;  2A2D A;  2OI2 A;  1YYK A;  4USK A;  2NA2 A;  4FWH A;  4WUC A;  3QT8 A;  1Z5B A;  4DV0 I;  2MDR A;  4DR7 I;  1OJ4 A;  3B82 A;  4B3M I;  4LFC I;  4DR5 I;  1S16 A;  2EFG A;  2UXC E;  4FN5 A;  2VQF I;  2BM1 A;  4AQY E;  3C4B A;  3Q1Q A;  2UXB E;  3JAM Q;  4DU7 A;  5LMN I;  4YHH I;  3P1X A;  4UT4 A;  2BM0 A;  4DR7 E;  4Z7C A;  3K1J A;  3J7A G;  4YY3 I;  3WU3 A;  5IWA E;  4WUB A;  4ED4 A;  2VQF E;  1O0W A;  4JI1 E;  3PYE A;  4B3R E;  1HNW E;  4XTJ A;  1UHZ A;  1STU A;  1BKN A;  4DPU A;  1WHN A;  4JI0 I;  1I94 E;  5A2Q C;  2DEJ A;  3J7A M;  4GKK E;  4DPW A;  1KIJ A;  2RSM A;  2JVA A;  1XMO E;  2F4V I;  2WW4 A;  2X36 A;  3WU6 A;  4HXZ A;  4LFB I;  4JI7 E;  2V8P A;  5GMD A;  1Z0G A;  4HY1 A;  1DAR A;  3OTO I;  3V5R A;  1YYO A;  4MYU A;  1UIL A;  4YHH E;  4LF4 E;  1T4O A;  4DV3 E;  2UXC I;  2YT4 A;  4OX9 E;  2F4V E;  1XMO I;  4AQY I;  4YY3 E;  3LPS A;  3B78 A;  2DEI A;  4B3S I;  1PVG A;  1FWL A;  1D6T A;  3J81 C;  4DU8 A;  1A6F A;  3ZZU A;  1WHQ A;  4JI0 E;  4DV5 I;  2CPN A;  2CZ9 A;  4GKK I;  1FI4 A;  4M1K A;  2V2Q A;  4DV6 E;  1NHI A;  1T4L B;  2E5L I;  4PU9 A;  4JI3 I;  1PKP A;  3ADJ A;  1K47 A;  1VIS A;  1RQ0 A;  4JV5 E;  4JI7 I;  5GME A;  1Z0W A;  2L2K B;  3PYG A;  4DKK A;  4X62 I;  1WUU A;  3OTO E;  3ZKD A;  3HUL A;  4JI6 I;  4DV1 I;  1H74 A;  4LF8 I;  4JI3 E;  4M2Z A;  4FWD A;  1X47 A;  3QT7 A;  2LRS A;  4DR6 I;  4LF4 I;  1DI2 A;  4DV0 E;  1Z59 A;  4KQV A;  2AJ4 A;  1H7U A;  4NXN I;  4NXM I;  4B3M E;  3J7Y p;  1EA6 A;  2B7T A;  1B63 A;  1YYW A;  4DR2 E;  1MX0 A;  4DUY I;  5BR8 E;  4DUZ I;  4OOG C;  4HAC A;  5CFF E;  3ZZ0 A;  1B62 A;  5FLX C;  4LFA E;  1RRE A;  2N3H A;  3JAM C;  2IHR 1;  2J7K A;  4X8W A;  1QZR A;  2RS6 A;  1FWK A;  1Z0E A;  5IWA I;  1XMQ I;  3LLH A;  2LUQ A;  3D4J A;  1ZXM A;  1J5E E;  4DUZ E;  5BR8 I;  1GQE A;  4JI1 I;  3M6A A;  4JI6 E;  4JV5 I;  1J26 A;  3T1H E;  4FWG A;  5IT9 C;  4URL A;  3VYY A;  2L2M A;  3WU5 A;  4LF5 I;  4WFT A;  1T4N A;  3QT6 A;  2UUC I;  4DV1 E;  1NZ0 A;  1ZXN A;  2N3G A;  4USM A;  3ADG A;  4LFB E;  2GS8 A;  2HK2 A;  4HYM A;  4DUY E;  4DR6 E;  2LJP A;  2KHX A;  1N36 I;  2VF3 A;  1H7S A;  3ZKB A;  4NXN E;  4NXM E;  5IT9 Q;  1HNZ I;  4DR2 I;  2X7I A;  4OX9 I;  1XMQ E;  1FKA E;  4HAC B;  4UTG A;  3ADL A;  1N36 E;  4RPF A;  4LFA I;  1KVK A;  3VYX A;  5A2Q Q;  1S4E A;  1Z5C A;  1KKH A;  5FLX Q;  1QU6 A;  2HHH E;  3J80 C;  4M30 A;  1KTV A;  3C4T A;  2E5L E;  3T1H I;  4ZVI A;  2L2N A;  2V2Z A;  3LNU A;  4LF6 I;  5LMU I;  4LF5 E;  4P7A A;  4X62 E;  2UUC E;  2HFU A;  1H72 C;  4MYT A;  3V2U C;  4X65 E;  2DIX A;  2R3V A;  4DPT A;  5L3J A;  1HR0 I;  1Z0C A;  3B8H A;  1HNX E;  1N34 I;  3ADI A;  2VQE E;  1MG7 A;  2XEX A;  4JI8 I;  1FJG I;  1Z5A A;  1XHK A;  4DV4 I;  3K17 A;  1Z0T A;  2UUB I;  4DR1 E;  5LL6 R;  4EMD A;  2HHH I;  1N0V C;  1ELO A;  1NHH A;  2B3T B;  1IBK I;  1XNR E;  4DR4 E;  4JI8 E;  5LMU E;  2UUB E;  4JG4 A;  2DB2 A;  2ZIT A;  3ZM7 A;  1J5E I;  4DPY A;  2UUA E;  4DR3 I;  1IBL I;  4LF6 E;  1FNM A;  1HR0 E;  4DR4 I;  2LJH A;  3QT5 A;  1N34 E;  1HNX I;  4PRX A;  1H73 A;  2VQE I;  4JI2 E;  1IBM E;  1YZ9 A;  2L33 A;  4X65 I;  4DV2 E;  4LF9 E;  1Z0V A;  1FJG E;  4PRV A;  4DR3 E;  1U2R A;  4DR1 I;  2HFS A;  1MU5 A;  1Z0B A;  4JI4 I;  2LTS A;  4DXL A;  3F0N A;  4JI5 E;  1ZBT A;  2V34 A;  4X64 E;  4WYQ B;  1XNR I;  5LMN E;  4LF9 I;  1RR9 A;  1N32 I;  2LTR A;  1HNZ E;  4JYA I;  1ZM9 A;  2NPF A;  3WU4 A;  3GON A;  4DPX A;  4LF7 E;  1IBL E;  3H4L A;  4FW9 A;  4JI5 I;  2HKE A;  2ZM6 E;  4X64 I;  1ZM2 A;  4X66 I;  1RC7 A;  3HTX A;  1IBM I;  4JYA E;  3PYD A;  1N33 E;  2LBS B;  3PYF A;  1N0U A;  3CWV A;  4LF7 I; 
#chains in the Genus database with same CATH topology
 3KWR A;  3OML A;  4ZYG A;  3LTO A;  4GKJ I;  4K0K I;  2V2V A;  3HQ1 A;  2J65 A;  3J80 Q;  3HPZ A;  2EPU A;  2RTX A;  2DLQ A;  2UU9 I;  2UXD I;  2PO2 B;  2EOE A;  2RS7 A;  4JI4 E;  1DQ3 A;  2V83 A;  2E1R A;  3BBG A;  4X66 E;  2JT2 A;  4JI2 I;  2YSP A;  4BC7 A;  4DV2 I;  2L3J A;  5K36 E;  2R42 A;  5KL5 A;  3PRY A;  2EOZ A;  2R1F A;  4WXD A;  5LLQ A;  3ZZT A;  3EPH A;  3KZZ A;  5KL2 A;  2JPA A;  2L3C A;  1XNQ I;  2MC5 A;  1ZM3 A;  2LUP B;  4DV3 I;  2EZ6 A;  1PDA A;  2HKJ A;  4KHP E;  2RSI A;  4LFC E;  4B3T E;  2EOF A;  2UXD E;  1PIE A;  4DV7 I;  4Z7Y A;  2LE2 A;  4B3S E;  3B4T A;  5DRQ A;  4WSG A;  2B7V A;  4AIM A;  2YTO A;  4R1F A;  2ZM6 I;  1N32 E;  3H09 A;  2MC6 A;  4DV4 E;  3J81 Q;  3T1Y I;  2UXB I;  2CSH A;  2EM2 A;  5KL3 A;  1XNQ E;  4DV5 E;  1X49 A;  2EMY A;  3RMP A;  1X3C A;  2HK3 A;  1N33 I;  1ZM4 A;  1YH8 A;  4KHP I;  4R2A A;  4DV6 I;  2MKN A;  4F9A B;  2EOJ A;  5KL6 A;  4DV7 E;  4J3D A;  2DMY A;  2V8Q B;  2F1D A;  2N8X A;  1IBK E;  2JY9 A;  4NHR A;  4GKJ E;  2ZBK B;  2NUE A;  2EN4 A;  1EI1 A;  3K85 A;  4MU4 A;  4GQU A;  2JEA A;  2UU9 E;  4B3R I;  5A6B A;  4X9J A;  3T1Y E;  4WUD A;  3BF2 A;  3ECR A;  3GLL A;  2KON A;  4IZJ B;  4OKG A;  2WCC 3;  1I94 I;  2NUF A;  1UEK A;  4FW6 A;  1NHJ A;  3JU0 A;  1EKZ A;  2Q2E B;  4BHB A;  1USU A;  2YTE A;  2UUA I;  2EM3 A;  5A6J A;  2A2C A;  4K0K E;  2V86 A;  2C39 B;  5DNX A;  1HNW I;  2FGG A;  1TF3 A;  2PNZ B;  4LF8 E;  2BV3 A;  4BMJ A;  4R03 A;  5T6J A;  4DR5 E;  3EPL A;  2C38 A;  4P52 A;  1X48 A;  3HPS A;  3M99 B;  4B3T I;  2DRP A;  2NUG A;  2LV2 A;  5DRR A;  2A2D A;  4I3H A;  4LPF A;  2OI2 A;  1YYK A;  1WXR A;  1DGC A;  3JTZ A;  4USK A;  2NA2 A;  4FWH A;  4MDT A;  1AAY A;  3QT8 A;  1GTK A;  1A1I A;  4MU1 A;  4WUC A;  1Z5B A;  3THN A;  1MGT A;  2EPP A;  2MDR A;  4DV0 I;  2WZO A;  2EM6 A;  2JYA A;  2PRT A;  5JEA F;  4DR7 I;  1OJ4 A;  4O24 A;  3B82 A;  4B3M I;  2EPX A;  4LFC I;  4DMI A;  4IFD D;  5K36 D;  2EM0 A;  4BA1 B;  4DR5 I;  1S16 A;  2EFG A;  2UXC E;  4FN5 A;  5C0X C;  2BM1 A;  2VQF I;  4AQY E;  2EOI A;  4IFD B;  3C4B A;  2EM4 A;  3Q1Q A;  2EPC A;  1NCS A;  2UXB E;  3JAM Q;  4DU7 A;  5LMN I;  1YFH A;  4YHH I;  2EJ4 A;  3P06 A;  3P1X A;  3DF6 A;  4LOM A;  2EE8 A;  2EN6 A;  4UT4 A;  2BM0 A;  4F6M A;  4DR7 E;  2PO0 B;  4Z7C A;  2ODR C;  2DGC A;  4NBQ A;  2FTX B;  2BA1 D;  3U1K A;  3K1J A;  2GPI A;  2V88 A;  1ZBQ A;  2EMW A;  3J7A G;  4YY3 I;  1EH7 A;  1B69 A;  5IWA E;  4WUB A;  5JEA C;  3WU3 A;  4ED4 A;  5A6K A;  2VQF E;  4M9V C;  4TUI A;  2VE7 C;  3Q6N A;  1O0W A;  4OO1 E;  2ENH A;  2Z5C A;  2LT7 A;  4JI1 E;  4B3R E;  1HNW E;  1MEY C;  3PYE A;  4XTJ A;  1UHZ A;  4IZJ D;  1STU A;  1ZU1 A;  1BKN A;  4DPU A;  1WHN A;  4JI0 I;  1I94 E;  5A2Q C;  2DEJ A;  3J7A M;  5A69 A;  5EL9 A;  2LJU A;  4GKK E;  5JEA A;  2PNL A;  4DPW A;  1F2I G;  2EPM X;  1KIJ A;  4WX9 A;  2RSM A;  5C0X A;  2JVA A;  4IZK A;  2NN6 A;  2J7J A;  5TSE A;  1JK1 A;  1XMO E;  4MU0 A;  5C0X B;  2F4V I;  1G2D C;  2EOQ A;  1OYS A;  2NN6 B;  5IV8 B;  2EM9 A;  2WW4 A;  2X36 A;  4HXZ A;  3WU6 A;  4LFB I;  2EL5 A;  2I9I A;  4JI7 E;  2EMA A;  1NEI A;  2V8P A;  5GMD A;  1Z0G A;  1G2F C;  4HY1 A;  4F9B B;  2PO1 A;  2Z5E A;  2EP3 A;  1DAR A;  1BBO A;  3OTO I;  3PS3 A;  2YTN A;  3V5R A;  1YYO A;  4MYU A;  1UIL A;  2PO1 B;  4YHH E;  4LF4 E;  3M7N D;  4L8N A;  1T4O A;  2EOH A;  4DV3 E;  2UXC I;  2YT4 A;  3MHH C;  2DMI A;  4OX9 E;  2F4V E;  1XMO I;  4AQY I;  2KOU A;  4YY3 E;  2JOX A;  5ADZ A;  3LPS A;  3L00 A;  5C0X D;  5C0X F;  3B78 A;  1UDN A;  2DEI A;  4B3S I;  4LU9 A;  1PVG A;  2YRH A;  1X6H A;  1L4S A;  1FWL A;  4O5G A;  1D6T A;  5AAS A;  4MLV A;  4Q35 B;  3J81 C;  2YZT A;  4J8Z A;  2O1W A;  2DLK A;  4DU8 A;  1A6F A;  2EOX A;  1WHQ A;  4JI0 E;  3ZZU A;  2RPC A;  4GEQ B;  4DV5 I;  2CPN A;  1XMQ I;  2CZ9 A;  4GKK I;  2R76 A;  1E3H A;  1FI4 A;  3PS2 A;  2V2Q A;  3VHT B;  4DV6 E;  2K4V A;  4M1K A;  1NHI A;  2V87 A;  2NN6 C;  2ENC A;  2DSY A;  2Z5C B;  4LCH A;  2EWL A;  4BHC A;  2EMH A;  1T4L B;  2E5L I;  2E72 A;  4PU9 A;  4JI3 I;  3F6H A;  1PKP A;  2ENA A;  3ADJ A;  1K47 A;  1RQ0 A;  1VIS A;  4JV5 E;  5JEA E;  2YPN A;  3CWV A;  4JI7 I;  5GME A;  1Z0W A;  4ISA A;  2L2K B;  4IFD C;  4BS9 A;  3PYG A;  4DKK A;  4RHB B;  3L7Z B;  4X62 I;  2EMF A;  2L6M A;  4WSP A;  4IS1 C;  1WUU A;  3OTO E;  1UDO A;  3L7Z A;  1Y5Y A;  1GZ6 A;  4FW5 A;  4BA1 A;  4O43 A;  3ZKD A;  3HUL A;  4R2R A;  4JI6 I;  4DV1 I;  2LVH A;  1H74 A;  3HKM A;  5DNY A;  4LF8 I;  2GLI A;  4IFD A;  4JI3 E;  2NN6 F;  3P76 A;  3Q6M A;  2HC5 A;  2ODR D;  4WXC A;  4M2Z A;  1KYQ A;  2E1M A;  4N4R B;  4FWD A;  1X47 A;  3QT7 A;  2LRS A;  4DR6 I;  4U3D A;  4LF4 I;  3QG5 C;  1DI2 A;  2JEB B;  2O1T A;  2PO0 A;  4DV0 E;  1Z59 A;  4KQV A;  4OO1 F;  2WBS A;  3GCM A;  1Y4S A;  2IES A;  4R2Q A;  2AJ4 A;  2JEB A;  1H7U A;  4NXN I;  4NXM I;  2WBT A;  1A1G A;  4B3M E;  3J7Y p;  1EA6 A;  2B7T A;  4TUG A;  1B63 A;  1YYW A;  4DR2 E;  1RMD A;  4NZV A;  1MX0 A;  4DUY I;  5BR8 E;  4DUZ I;  4OOG C;  2EPA A;  2GQ0 A;  4HAC A;  2B9D A;  2EMI A;  4WPY A;  4IFD F;  5CFF E;  2F8B A;  1B62 A;  5FLX C;  3ZZ0 A;  2EOY A;  4LFA E;  1RRE A;  4BA2 B;  2N3H A;  3JAM C;  2EN8 A;  2IHR 1;  3AUZ A;  4F6N A;  4MLQ A;  5A6B D;  4X8W A;  1P42 A;  1QZR A;  2J7K A;  4R2C A;  2L8T A;  2M1S A;  1YUJ A;  2WNR A;  1SR9 A;  1TN9 A;  2RS6 A;  3HXL A;  1FWK A;  1Z0E A;  5IWA I;  2JR1 A;  1A1J A;  3LLH A;  2LUQ A;  2V85 A;  2GHF A;  1ZXM A;  3D4J A;  1J5E E;  1UN6 B;  4OO1 A;  2C38 B;  5K36 A;  4DUZ E;  5BR8 I;  1GQE A;  4JI1 I;  3M6A A;  4JI6 E;  4JV5 I;  5K36 B;  2EMB A;  3AV0 A;  2EPR A;  2EN7 A;  1J26 A;  3T1H E;  5F3W A;  2CVE A;  4FWG A;  2MDG A;  5IT9 C;  1Z1B A;  2ELY A;  4URL A;  2EPK X;  2BA0 G;  1A1L A;  2EQ1 A;  3VYY A;  4P78 A;  2EOS A;  1R6M A;  1SFE A;  2L2M A;  1YPN A;  4ZYD A;  2ELZ A;  3WU5 A;  1IQO A;  4LF5 I;  2A25 A;  4OO1 C;  4WFT A;  1T4N A;  3UK3 C;  3QT6 A;  5C0X E;  3M85 D;  2UUC I;  1A1H A;  4DV1 E;  2LCE A;  1HK7 A;  1NZ0 A;  1TF6 A;  1ZXN A;  2EMK A;  4R2S A;  2N3G A;  5IXM B;  4USM A;  1VI7 A;  3ADG A;  2JXP A;  3U1Y A;  2FV4 B;  4LFB E;  2IOP A;  2JP9 A;  2L92 A;  1ZR9 A;  2GS8 A;  2HK2 A;  4HYM A;  2IER A;  4DUY E;  4DR6 E;  2LJP A;  4M0V A;  4R2P A;  2KHX A;  4GZN C;  1N36 I;  2VF3 A;  1KJK A;  3F6G A;  1H7S A;  2CTD A;  2EM8 A;  2JOB A;  4BC9 A;  2EOM A;  3H1C A;  4LCG A;  3ZKB A;  4NXN E;  4NXM E;  1PJT A;  1T38 A;  4OZE A;  5IT9 Q;  1UDS A;  2YWQ A;  1X6E A;  1HNZ I;  5EKW A;  4DR2 I;  2X7I A;  2V89 A;  1RHY A;  2NAB A;  2BA1 G;  4KWY A;  2GO4 A;  3HJC A;  4QNJ A;  4OX9 I;  5K36 C;  5DRP A;  2G7H A;  4R8O A;  1T39 A;  1XMQ E;  4OO1 D;  4F9C B;  2CG9 A;  1FKA E;  1R6L A;  4HAC B;  4N3O A;  4UTG A;  2RQL A;  3ADL A;  2IOQ A;  1N36 E;  2YTI A;  1P47 A;  4RPF A;  3KZY A;  4LFA I;  2Z5B B;  1KVK A;  5FWK A;  3VYX A;  5A2Q Q;  1S4E A;  1Z5C A;  1KKH A;  5FLX Q;  1QU6 A;  2HHH E;  3J80 C;  1EH6 A;  4IZK B;  1IQS A;  4M30 A;  1WJP A;  1KTV A;  3C4T A;  2YU5 A;  1A1K A;  2E5L E;  2EPZ A;  3T1H I;  5K36 F;  4ZVI A;  2L2N A;  2BR2 B;  2V2Z A;  2EMZ A;  3CDJ A;  1Y4U A;  3LNU A;  5AE1 A;  4LF6 I;  5LMU I;  1PJS A;  3DJW A;  1N3G A;  2CT1 A;  2EQ0 A;  4LF5 E;  5AC4 A;  4P7A A;  2JEA B;  4X62 E;  3DD6 A;  2UUC E;  2I13 A;  2HFU A;  2YTG A;  1H72 C;  4FW3 A;  4MYT A;  3V2U C;  3LML A;  4KZS A;  4X65 E;  2LO3 A;  1E3P A;  2EMG A;  2M7Q A;  2VRD A;  4Q28 A;  4R2D A;  2DIX A;  2O1V A;  3M7N G;  2R3V A;  4IFD E;  4DPT A;  5L3J A;  1BBG A;  5ELW A;  2YTF A;  4MQY A;  1HR0 I;  4BBY A;  2PNZ A;  1Z0C A;  3B8H A;  2EN2 A;  1HNX E;  3ADI A;  1N34 I;  1Y60 A;  2VQE E;  1MG7 A;  2XEX A;  2PNM A;  4F2J C;  1OYP A;  2EPN A;  2GO3 A;  2BBG A;  2NN6 E;  4JI8 I;  3C6K A;  2EN1 A;  3EQ1 A;  1Z5A A;  1FJG I;  1XHK A;  4DV4 I;  5AE3 A;  2EM5 A;  1ZAA C;  3K17 A;  1Z0T A;  4FW4 A;  4LTY A;  2HJJ A;  1X5W A;  4P7D A;  2UUB I;  4DR1 E;  4OO1 B;  1BB8 A;  2YTQ A;  5LL6 R;  4EMD A;  2YTP A;  3FIG A;  1N0V C;  3MHS C;  4FK5 C;  2HHH I;  1WRJ A;  1EH8 A;  4LCF A;  3P3E A;  5A6A A;  3IWD A;  1ELO A;  1NHH A;  4U3B A;  2B3T B;  4AM3 A;  2O3Z A;  1X6F A;  2EMX A;  2YTD A;  1IBK I;  3IWC A;  2EL6 A;  1XNR E;  4DR4 E;  2BA0 D;  3GME A;  4JI8 E;  2WP8 A;  2M9A A;  5LMU E;  5AC5 A;  2JWO A;  3C6M A;  2WP8 B;  2M4I A;  2UUB E;  4JG4 A;  2DB2 A;  2ZIT A;  1YHC A;  1PJQ A;  5KL4 A;  3ZM7 A;  1J5E I;  2K7I A;  4DPY A;  2UUA E;  2C37 B;  2VF1 A;  4DR3 I;  3IWB A;  1IBL I;  2O1U A;  2EQ3 A;  2BR2 A;  1LLM C;  2EOO A;  3K6Q A;  4LF6 E;  1FNM A;  2C37 A;  4F54 A;  1HR0 E;  4ZYE A;  4DR4 I;  2LJH A;  3EPJ A;  2BB8 A;  3QT5 A;  1N34 E;  2EOR A;  2PO2 A;  4PRX A;  5JEA D;  1H73 A;  1HNX I;  1YUI A;  4RH8 A;  4L5N C;  1IBM E;  3TQM A;  2L33 A;  3EPK A;  4JI2 E;  1YZ9 A;  2VQE I;  5DRO A;  4X65 I;  2H36 X;  4DV2 E;  4LF9 E;  1Z0V A;  4R2E A;  3CDI A;  5JEA B;  1FJG E;  4IS9 A;  4PRV A;  2MKD A;  3KRN A;  3BID A;  2EM7 A;  1UBD C;  1YSA C;  4DR3 E;  1JK2 A;  3P3C A;  1U2R A;  4DR1 I;  4HEI A;  2WBU A;  4FW7 A;  2AE8 A;  1XXE A;  4HTG A;  2HFS A;  1MU5 A;  5DNL A;  3NZK A;  2YTJ A;  1Z0B A;  4I8O A;  2Z5B A;  2C39 A;  2CGE A;  2EL4 A;  4JI4 I;  2JE6 B;  2LTS A;  1QNT A;  4DXL A;  1A1F A;  4JI5 E;  3F0N A;  4BA2 A;  1AH5 A;  2HGH A;  3THO B;  1UDQ A;  1ZBT A;  2JE6 A;  2V34 A;  3UHM A;  4X64 E;  2YSO A;  4WYQ B;  4BCA A;  1XNR I;  2EMC A;  5LMN E;  4LF9 I;  2WNR B;  1RR9 A;  1N32 I;  2LTR A;  1HNZ E;  3ZOQ B;  2EN3 A;  4JYA I;  2EML A;  4IJD A;  1ZM9 A;  2NPF A;  2NN6 D;  2D9H A;  3WU4 A;  3GON A;  2VES A;  3VK6 A;  4QNK A;  3PS1 A;  4DPX A;  4LF7 E;  2ADR A;  1IBL E;  3H4L A;  4FW9 A;  4JI5 I;  2HKE A;  2ZM6 E;  3P3G A;  5KL7 A;  4AID A;  4X64 I;  5AE2 A;  1ZM2 A;  1Y6Z A;  4X66 I;  3MSW A;  2Q8U A;  2YRK A;  1RC7 A;  3BGH A;  3HTX A;  2YU8 A;  2YRM A;  1IBM I;  4IZJ A;  4ZYH A;  4MU3 A;  4JYA E;  3PYD A;  1N33 E;  3M85 G;  1OYR A;  2LBS B;  4O4K A;  2EPL X;  2EPO A;  1IMU A;  1N0U A;  3PYF A;  1USV A;  2LMZ A;  4LF7 I; 
#chains in the Genus database with same CATH homology
 3KWR A;  3OML A;  3LTO A;  4K0K I;  4GKJ I;  2V2V A;  3HQ1 A;  3J80 Q;  3HPZ A;  2UU9 I;  2RTX A;  2UXD I;  2RS7 A;  4JI4 E;  2E1R A;  1DQ3 A;  2V83 A;  4JI2 I;  4X66 E;  4BC7 A;  4DV2 I;  2L3J A;  2R42 A;  3PRY A;  3ZZT A;  2L3C A;  1XNQ I;  2MC5 A;  1ZM3 A;  2LUP B;  4DV3 I;  2EZ6 A;  2HKJ A;  4KHP E;  4LFC E;  4B3T E;  2UXD E;  1PIE A;  4DV7 I;  4Z7Y A;  2LE2 A;  4B3S E;  2B7V A;  4R1F A;  2ZM6 I;  1N32 E;  3H09 A;  2MC6 A;  4DV4 E;  3J81 Q;  3T1Y I;  2UXB I;  1XNQ E;  4DV5 E;  1X49 A;  3RMP A;  2HK3 A;  1N33 I;  1ZM4 A;  4KHP I;  4DV6 I;  4F9A B;  4DV7 E;  2DMY A;  2V8Q B;  1IBK E;  2JY9 A;  4GKJ E;  2ZBK B;  2NUE A;  3K85 A;  1EI1 A;  4B3R I;  2UU9 E;  3T1Y E;  4WUD A;  4IZJ B;  2KON A;  1I94 I;  2NUF A;  1UEK A;  1NHJ A;  3JU0 A;  1EKZ A;  2Q2E B;  1USU A;  2UUA I;  2A2C A;  4K0K E;  2V86 A;  1HNW I;  2FGG A;  4LF8 E;  2BV3 A;  4BMJ A;  4R03 A;  5T6J A;  4DR5 E;  4P52 A;  1X48 A;  3HPS A;  4B3T I;  2NUG A;  4I3H A;  2A2D A;  2OI2 A;  1YYK A;  1WXR A;  4USK A;  3JTZ A;  2NA2 A;  4FWH A;  4WUC A;  3QT8 A;  1Z5B A;  4DV0 I;  2MDR A;  2WZO A;  4DR7 I;  1OJ4 A;  3B82 A;  4B3M I;  4LFC I;  4DMI A;  4DR5 I;  1S16 A;  2EFG A;  2UXC E;  4FN5 A;  2VQF I;  2BM1 A;  4AQY E;  3C4B A;  3Q1Q A;  2UXB E;  3JAM Q;  4DU7 A;  5LMN I;  4YHH I;  3P06 A;  3P1X A;  3DF6 A;  4UT4 A;  2BM0 A;  4DR7 E;  4Z7C A;  2ODR C;  2FTX B;  3K1J A;  2V88 A;  1ZBQ A;  3J7A G;  4YY3 I;  3WU3 A;  5IWA E;  4WUB A;  4ED4 A;  2VQF E;  3Q6N A;  4TUI A;  2VE7 C;  1O0W A;  2Z5C A;  4JI1 E;  3PYE A;  4B3R E;  1HNW E;  4XTJ A;  1UHZ A;  4IZJ D;  1STU A;  1BKN A;  4DPU A;  1WHN A;  4JI0 I;  1I94 E;  5A2Q C;  2DEJ A;  3J7A M;  4GKK E;  2PNL A;  4DPW A;  1KIJ A;  2RSM A;  2JVA A;  4IZK A;  1XMO E;  2F4V I;  2WW4 A;  2X36 A;  3WU6 A;  4HXZ A;  4LFB I;  4JI7 E;  2V8P A;  5GMD A;  1Z0G A;  4HY1 A;  4F9B B;  2Z5E A;  1DAR A;  3OTO I;  3V5R A;  1YYO A;  4MYU A;  1UIL A;  4YHH E;  4LF4 E;  4L8N A;  1T4O A;  4DV3 E;  2UXC I;  2YT4 A;  4OX9 E;  2F4V E;  1XMO I;  4AQY I;  2KOU A;  4YY3 E;  2JOX A;  5ADZ A;  3LPS A;  3B78 A;  2DEI A;  4B3S I;  4LU9 A;  1PVG A;  1FWL A;  1D6T A;  5AAS A;  3J81 C;  2YZT A;  4J8Z A;  2O1W A;  4DU8 A;  1A6F A;  3ZZU A;  1WHQ A;  4JI0 E;  4GEQ B;  4DV5 I;  2CPN A;  2CZ9 A;  4GKK I;  1FI4 A;  4M1K A;  2V2Q A;  4DV6 E;  2K4V A;  1NHI A;  2V87 A;  2DSY A;  2Z5C B;  2EWL A;  1T4L B;  2E5L I;  4PU9 A;  4JI3 I;  3F6H A;  1PKP A;  3ADJ A;  1K47 A;  1VIS A;  1RQ0 A;  4JV5 E;  4JI7 I;  5GME A;  1Z0W A;  2L2K B;  4BS9 A;  3PYG A;  4DKK A;  4X62 I;  2L6M A;  4WSP A;  1WUU A;  3OTO E;  1GZ6 A;  3ZKD A;  3HUL A;  4JI6 I;  4DV1 I;  1H74 A;  4LF8 I;  5DNY A;  4JI3 E;  3Q6M A;  2ODR D;  4M2Z A;  2E1M A;  4FWD A;  1X47 A;  3QT7 A;  2LRS A;  4DR6 I;  4LF4 I;  1DI2 A;  2O1T A;  4DV0 E;  1Z59 A;  4KQV A;  1Y4S A;  2AJ4 A;  1H7U A;  4NXN I;  4NXM I;  4B3M E;  3J7Y p;  1EA6 A;  2B7T A;  4TUG A;  1B63 A;  1YYW A;  4DR2 E;  1MX0 A;  4DUY I;  5BR8 E;  4DUZ I;  4OOG C;  2GQ0 A;  4HAC A;  2B9D A;  4WPY A;  5CFF E;  2F8B A;  1B62 A;  5FLX C;  3ZZ0 A;  4LFA E;  1RRE A;  2N3H A;  3JAM C;  2IHR 1;  3AUZ A;  2J7K A;  4X8W A;  1QZR A;  2L8T A;  2M1S A;  1SR9 A;  2RS6 A;  3HXL A;  1FWK A;  1Z0E A;  5IWA I;  2JR1 A;  1XMQ I;  3LLH A;  2LUQ A;  2V85 A;  3D4J A;  1ZXM A;  1J5E E;  4DUZ E;  5BR8 I;  1GQE A;  4JI1 I;  3M6A A;  4JI6 E;  4JV5 I;  1J26 A;  3AV0 A;  3T1H E;  5F3W A;  4FWG A;  5IT9 C;  4URL A;  3VYY A;  4P78 A;  2L2M A;  3WU5 A;  4LF5 I;  4WFT A;  1T4N A;  3QT6 A;  2UUC I;  4DV1 E;  1HK7 A;  1NZ0 A;  1ZXN A;  2N3G A;  4USM A;  3ADG A;  2FV4 B;  4LFB E;  2IOP A;  2L92 A;  2GS8 A;  2HK2 A;  4HYM A;  4DUY E;  4DR6 E;  2LJP A;  4M0V A;  2KHX A;  1N36 I;  2VF3 A;  3F6G A;  1H7S A;  2JOB A;  4BC9 A;  3ZKB A;  4NXN E;  4NXM E;  5IT9 Q;  1HNZ I;  4DR2 I;  2X7I A;  2V89 A;  4OX9 I;  3HJC A;  2G7H A;  4R8O A;  1XMQ E;  4F9C B;  2CG9 A;  1FKA E;  4HAC B;  4N3O A;  4UTG A;  3ADL A;  2IOQ A;  1N36 E;  4RPF A;  4LFA I;  2Z5B B;  1KVK A;  5FWK A;  3VYX A;  5A2Q Q;  1S4E A;  1Z5C A;  1KKH A;  5FLX Q;  1QU6 A;  2HHH E;  3J80 C;  4IZK B;  4M30 A;  1KTV A;  3C4T A;  2E5L E;  3T1H I;  4ZVI A;  2L2N A;  2V2Z A;  1Y4U A;  3LNU A;  5AE1 A;  4LF6 I;  5LMU I;  3DJW A;  4LF5 E;  4P7A A;  4X62 E;  2UUC E;  2HFU A;  1H72 C;  4MYT A;  3V2U C;  3LML A;  4KZS A;  4X65 E;  2M7Q A;  4Q28 A;  2O1V A;  2DIX A;  2R3V A;  4DPT A;  5L3J A;  1HR0 I;  4BBY A;  1Z0C A;  3B8H A;  1HNX E;  1N34 I;  3ADI A;  2VQE E;  1MG7 A;  2XEX A;  2PNM A;  4JI8 I;  1FJG I;  1Z5A A;  1XHK A;  4DV4 I;  5AE3 A;  3K17 A;  1Z0T A;  4LTY A;  2UUB I;  4P7D A;  4DR1 E;  5LL6 R;  4EMD A;  3FIG A;  1N0V C;  2HHH I;  1ELO A;  3IWD A;  1NHH A;  2B3T B;  1IBK I;  3IWC A;  1XNR E;  4DR4 E;  4JI8 E;  5LMU E;  2JWO A;  2M4I A;  2UUB E;  4JG4 A;  2DB2 A;  2ZIT A;  3ZM7 A;  1J5E I;  4DPY A;  2UUA E;  2VF1 A;  4DR3 I;  3IWB A;  1IBL I;  2O1U A;  3K6Q A;  4LF6 E;  1FNM A;  4F54 A;  1HR0 E;  4DR4 I;  2LJH A;  3QT5 A;  1N34 E;  1HNX I;  4PRX A;  1H73 A;  2VQE I;  4L5N C;  1IBM E;  4JI2 E;  2L33 A;  1YZ9 A;  4X65 I;  2H36 X;  4DV2 E;  4LF9 E;  1Z0V A;  1FJG E;  4PRV A;  4DR3 E;  1U2R A;  4DR1 I;  2HFS A;  1MU5 A;  1Z0B A;  4I8O A;  2Z5B A;  2CGE A;  4JI4 I;  2LTS A;  4DXL A;  3F0N A;  4JI5 E;  1ZBT A;  2V34 A;  4X64 E;  4WYQ B;  4BCA A;  1XNR I;  5LMN E;  4LF9 I;  1RR9 A;  1N32 I;  2LTR A;  1HNZ E;  3ZOQ B;  4JYA I;  1ZM9 A;  2NPF A;  3WU4 A;  3GON A;  4DPX A;  3VK6 A;  4LF7 E;  1IBL E;  3H4L A;  4FW9 A;  4JI5 I;  2HKE A;  2ZM6 E;  4X64 I;  5AE2 A;  1ZM2 A;  1Y6Z A;  4X66 I;  3MSW A;  1RC7 A;  3HTX A;  1IBM I;  4IZJ A;  4JYA E;  3PYD A;  1N33 E;  2LBS B;  3PYF A;  1N0U A;  3CWV A;  1USV A;  2LMZ A;  4LF7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...