4DV1E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 32
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv1E02
2F4VE 2L2NA 2V2VA 4JI8I 5A2QQ 1RC7A 2GS8A 2VQEI 4DV1E 1Z59A 3ZZ0A 3M6AA 5LMNI 4B3SI 4JI2E 2LRSA 1FJGI 2L3JA 4HACA 4NXNI 2XEXA 1FI4A 5IWAI 4LF7E 4LF6E 1N33E 1DARA 1Z0WA 4DV4E 2L3CA 1B63A 2F4VI 4JG4A 4DXLA 2AJ4A 2LJHA 3VYYA 1STUA 4LFCI 4DR7I 2UU9I 1NHHA 4DPYA 3C4TA 3OTOE 1Z5CA 1IBLE 1QU6A 4ZVIA 1ZM9A 1Z0BA 4M30A 1XNRE 4URLA 3ADIA 3J7AM 3K1JA 4LF6I 2NA2A 4X65I 4DPWA 4EMDA 1ZXNA 5IT9C 1ZBTA 3B78A 4B3ME 4JI7I 2L2MA 4DR6I 1H72C 4JI3E 1Z0GA 4WYQB 1HNWE 4LFCE 4DR7E 4RPFA 1Z0VA 3ZZUA 3HTXA 5IT9Q 2VF3A 4JI1I 5GMEA 1HNZE 2EZ6A 2NUGA 3LNUA 1BKNA 4B3TI 4LF7I 4LF9I 4DR6E 2RTXA 2E1RA 1N0VC 3LPSA 4X66E 4JI0I 4DV0E 1IBME 1ZM4A 4X62I 4JI6E 4DUZI 2HFUA 1A6FA 4DV5E 2NPFA 4DR1I 5CFFE 1IBKE 1OJ4A 4DV1I 4JI8E 2JVAA 1VISA 3J80C 2LUQA 4DV7I 4Z7YA 2ZITA 1YYWA 2LJPA 4X8WA 4WFTA 1J5EE 3J80Q 3QT7A 1O0WA 1Z5AA 2R3VA 1N36I 1N32I 3V5RA 4HYMA 4K0KE 4B3RI 3J7Yp 1N32E 4UTGA 1XMQI 4DV2I 1MG7A 4P52A 4DV3E 1H7UA 4PRXA 3B8HA 3F0NA 3PYDA 1B62A 5A2QC 1YZ9A 1PKPA 4ED4A 4X66I 4DU7A 2X36A 1Z0EA 1HR0E 4JI7E 4DV5I 1KTVA 2ZM6I 4R1FA 4FN5A 1N0UA 4WUCA 4DU8A 3OTOI 5BR8I 2HHHE 4USKA 1UHZA 4DR1E 3PYFA 3ADGA 2RS7A 4YHHI 3PYGA 2V8PA 4DV7E 2EFGA 2LTSA 4YY3E 4JV5I 2HK2A 3V2UC 4LF8I 2B7VA 2B7TA 3WU3A 4B3MI 4JI4I 1FKAE 4X65E 4DV3I 2NUEA 4DR2E 4JI4E 1GQEA 2DEIA 2L33A 4LFAI 1ELOA 1I94I 1X48A 2J7KA 4B3RE 4K0KI 2BM1A 1MX0A 1HNXE 4JI6I 1J26A 1ZXMA 4DR2I 4DV2E 2LUPB 4JV5E 4YY3I 3LLHA 2A2DA 4DR4E 4LF4I 4FWHA 4DUYI 1EA6A 1MU5A 1XNQE 2LTRA 4B3SE 1H73A 2X7IA 3JAMQ 4X62E 4NXNE 5LL6R 1ZM3A 3K17A 4LFAE 2A2CA 4FWGA 2UXBE 5LMNE 5BR8E 4DUYE 3LTOA 5LMUI 2B3TB 4AQYE 1QZRA 2JY9A 4DPUA 4NXME 4KQVA 1X47A 3ZKBA 4HY1A 2L2KB 4LF8E 1XMQE 4B3TE 2UU9E 2V34A 4JI1E 3Q1QA 2ZM6E 2HKEA 3ZM7A 1ZM2A 5GMDA 2YT4A 2UUCE 1EKZA 4NXMI 2UXCE 1XMOI 1N34I 4XTJA 1RR9A 1UILA 3C4BA 2V2QA 1D6TA 3QT5A 3J7AG 2OI2A 1KIJA 4LF9E 5FLXC 1NZ0A 1XNRI 1FWKA 2UXBI 4LF5E 4KHPI 4DUZE 3H4LA 4OOGC 5LMUE 3QT6A 4DV6E 4DR5I 3T1HI 2N3GA 4JI2I 1EI1A 1HNXI 4X64E 3T1HE 4GKKI 2VQEE 2VQFE 4JI0E 4DV0I 2DEJA 1IBMI 2DMYA 1NHIA 1FWLA 4JI3I 1DI2A 2V2ZA 4HACB 1KKHA 2NUFA 3D4JA 4M2ZA 4LFBI 1WHQA 1WHNA 1X49A 1UEKA 3CWVA 3J81Q 4AQYI 2RSMA 4GKKE 3ADJA 3JAMC 4I3HA 4GKJI 2UXCI 2WW4A 1FJGE 3B82A 1Z0TA 1RREA 5FLXQ 1U2RA 2HHHI 3QT8A 2N3HA 2ZBKB 5L3JA 3VYXA 2E5LE 2HK3A 1H74A 4X64I 1Z5BA 3ADLA 2IHR1 4FWDA 1S4EA 4DR5E 4DV6I 3PYEA 1IBLI 2UUAE 1PIEA 1Z0CA 4WUDA 4DV4I 2RS6A 4DPTA 2DIXA 2UUBI 3ZKDA 2MDRA 4DR3I 4MYUA 3WU4A 4DPXA 4Z7CA 1HNZI 1I94E 1H7SA 4JYAI 2Q2EB 2UXDI 5IWAE 1YYOA 1PVGA 2UXDE 3P1XA 4DKKA 1XMOE 1N34E 1HR0I 2BV3A 2R42A 2CZ9A 4JI5E 4PU9A 4OX9I 1S16A 4YHHE 4MYTA 1RQ0A 2UUBE 1NHJA 1IBKI 4P7AA 2UUCI 3T1YI 4JYAE 1FNMA 4PRVA 2BM0A 2E5LI 1XHKA 1YYKA 1KVKA 1T4NA 4LFBE 3J81C 1HNWI 3WU6A 4GKJE 1J5EI 2CPNA 4WUBA 2HFSA 4FW9A 4KHPE 4LF5I 4UT4A 4DR3E 2UUAI 2VQFI 3HULA 4JI5I 4USMA 1N36E 4HXZA 2LBSB 3GONA 1XNQI 3WU5A 1T4LB 4LF4E 4DR4I 4M1KA 2KHXA 3T1YE 4OX9E 1WUUA 3ZZTA 2DB2A 1K47A 1T4OA 1N33I 2HKJA
chains in the Genus database with same CATH superfamily
4MU1A 2F4VE 2JYAA 2C38B 5C0XB 2L2NA 2V2VA 4JI8I 2EN1A 2IOQA 1GTKA 2JR1A 5A2QQ 1RC7A 2EOEA 1PDAA 2JWOA 3MHHC 2GS8A 4ZYEA 2EPMX 2VQEI 2JOBA 4LCFA 3QG5C 2EOJA 4DV1E 1Z59A 3ZZ0A 2CSHA 3L7ZB 2CG9A 2K4VA 3M6AA 5LMNI 4B3SI 4F9CB 2ODRC 4JI2E 2YPNA 2BA0G 2LRSA 4LCGA 1FJGI 2L3JA 3ZOQB 4FW4A 1TF3A 4HACA 2G7HA 5C0XF 3P06A 4NXNI 2O1TA 1EH7A 2XEXA 2EN8A 2YTPA 3EPLA 1FI4A 4O24A 3PS3A 5IWAI 5K36B 2WBTA 4LF7E 2IERA 4LF6E 3F6HA 4WXCA 1N33E 2EPAA 1DARA 2EPPA 1Z0WA 4BA2A 4NBQA 3OMLA 4DV4E 2L3CA 3GLLA 2EM9A 1B63A 4WPYA 2M9AA 1UDQA 2F4VI 2EOXA 4JG4A 2PNLA 4DXLA 2EM6A 2AJ4A 2LJHA 3VYYA 1SFEA 1STUA 4BC7A 2EORA 4LFCI 4DR7I 4IZJA 2BBGA 4M9VC 2YRMA 1E3HA 2C37B 4BA1A 3PS1A 4IZKA 2UU9I 2LO3A 1NHHA 1KYQA 4KWYA 3C4TA 2LT7A 2GQ0A 4FW3A 4DPYA 1NCSA 2YRKA 4ZYGA 3OTOE 1Z5CA 1IBLE 3HJCA 1QU6A 2DMIA 2M4IA 4NZVA 4BHBA 2EMBA 1MGTA 4ZVIA 4WX9A 1ZM9A 1ZR9A 1Z1BA 1Z0BA 2O1WA 5ELWA 1YUJA 4M30A 1XNRE 4URLA 3ADIA 3J7AM 2EP3A 1OYSA 5C0XD 1XXEA 5A6BD 4BS9A 3K1JA 4LF6I 2NA2A 4X65I 2MKDA 4DPWA 4EMDA 4OO1C 1L4SA 1ZXNA 5IT9C 1ZBTA 3B78A 2MC6A 4B3ME 2WP8A 4JI7I 2L2MA 4DR6I 1EH6A 2V88A 1H72C 4GZNC 4JI3E 1Z0GA 4WYQB 1A1JA 1HNWE 4LFCE 4DR7E 4RPFA 1Z0VA 4O5GA 3ZZUA 5JEAF 2R1FA 3HTXA 5IT9Q 2VF3A 3JU0A 4FW6A 5GMEA 4JI1I 1HNZE 2NN6F 3CDIA 2EM3A 2H36X 2EZ6A 2NUGA 3RMPA 5C0XE 1R6LA 3LNUA 1BKNA 1X6FA 4B3TI 4LF7I 4LF9I 5TSEA 4DR6E 2RTXA 2DRPA 1X6HA 1N0VC 2E1RA 4X66E 4DV0E 1IBME 3LPSA 1ZM4A 2HGHA 4JI0I 2ENAA 4JI6E 5JEAC 4X62I 5K36A 4DUZI 2HFUA 2JEBA 2JEAA 1A6FA 2PO0A 4DV5E 2NPFA 1YUIA 4GQUA 1A1FA 1AAYA 4IFDD 2YTNA 4DR1I 5CFFE 1IBKE 1OJ4A 4DV1I 4JI8E 2JVAA 3J80C 1VISA 2LUQA 4DV7I 1X6EA 2EJ4A 4Z7YA 2ZITA 2HJJA 1YYWA 2LJPA 2O3ZA 4X8WA 4LCHA 4WFTA 3GMEA 1J5EE 3KZZA 3J80Q 3QT7A 1O0WA 1DGCA 2WBSA 4R2EA 5JEAA 4FK5C 4IS9A 2YTFA 3VHTB 2E72A 1Z5AA 2J65A 2EMGA 2R3VA 1WRJA 2PNZA 1UDNA 1N36I 1N32I 3V5RA 4HYMA 4R8OA 4K0KE 4B3RI 4OO1F 2NN6D 2EMYA 4F6MA 4NHRA 1G2DC 3J7Yp 1R6MA 1N32E 5JEAB 2EPNA 5DNLA 4UTGA 1XMQI 3IWDA 5KL4A 4DV2I 2DGCA 2YRHA 1MG7A 2ELYA 2WZOA 4P52A 4DV3E 1USUA 1H7UA 4PRXA 2V85A 3B8HA 3F0NA 4IS1C 3PYDA 2RPCA 1B62A 2EOYA 1PJSA 5A2QC 1YZ9A 1OYRA 2EQ0A 2EMKA 1PKPA 2CTDA 4ED4A 2JPAA 4DU7A 1ZBQA 3IWBA 1MEYC 2X36A 4X66I 3UHMA 1Z0EA 4N3OA 1HR0E 4WXDA 4JI7E 4ZYHA 1JK2A 5JEAD 3M7NG 4ISAA 4DV5I 2JXPA 2GHFA 1KTVA 2E1MA 2ZM6I 4R1FA 4FN5A 2EN6A 1N0UA 1Y5YA 1Y4SA 2JE6B 4WUCA 4R2RA 4DU8A 2BA1G 3OTOI 2EOMA 2EL6A 4AIMA 3H1CA 2EM0A 4RHBB 4DMIA 5BR8I 2C38A 2HHHE 4USKA 2JEBB 2NN6E 1UHZA 4R03A 4DR1E 3PYFA 2LJUA 4MU4A 3ADGA 2ENCA 3M99B 2LCEA 2RS7A 5DNYA 4YHHI 2MDGA 2V86A 3MSWA 3PYGA 2V8PA 4DV7E 2V89A 2EFGA 2BA0D 4MU0A 2LTSA 4YY3E 5KL5A 4JV5I 4L8NA 2M7QA 2HK2A 3V2UC 4LF8I 2B7VA 2B7TA 3EPHA 3WU3A 1JK1A 5T6JA 4Q28A 4B3MI 3THOB 5A6AA 2YTDA 2YTGA 3THNA 3M85D 4JI4I 2ELZA 4IFDE 2KOUA 5A6JA 5A6KA 1FKAE 1BBGA 4X65E 4IFDB 4OO1B 4DV3I 2NUEA 1X3CA 2LMZA 3DD6A 4DR2E 2EN3A 4GEQB 4JI4E 1GQEA 2DEIA 5K36D 5KL7A 2L33A 4LFAI 1F2IG 4IFDC 2NABA 3AUZA 1E3PA 1ELOA 4R2PA 2Q8UA 2I9IA 1I94I 1X48A 2J7KA 4R2CA 1YFHA 4B3RE 2BM1A 3K6QA 1MX0A 4K0KI 2EQ1A 2YSPA 1BBOA 4TUIA 1HNXE 4JI6I 5KL6A 1DQ3A 2F1DA 1J26A 1ZXMA 2EPCA 4DR2I 4DV2E 2WNRB 1NEIA 2LUPB 3B4TA 2CT1A 4JV5E 4YY3I 3LLHA 3K85A 5LLQA 2A2DA 4RH8A 4DR4E 4LF4I 4F54A 2IESA 2Z5EA 5DROA 4FWHA 2PO2A 4DUYI 1EA6A 1MU5A 2EQ3A 1XNQE 2CVEA 2LTRA 3LMLA 2PRTA 4B3SE 2R76A 4IZJD 4O43A 1UDSA 2PNZB 1A1IA 1H73A 2EE8A 2X7IA 2GO3A 3JAMQ 4X62E 2LVHA 4NXNE 3CDJA 5LL6R 3Q6NA 1ZM3A 3K17A 5DRQA 4LFAE 2A2CA 3L7ZA 4FWGA 4LPFA 2UXBE 4LF5I 5LMNE 5BR8E 4DUYE 5JEAE 3LTOA 5LMUI 1KJKA 2EMIA 2B3TB 4X9JA 5K36C 1X5WA 4AQYE 4J8ZA 2V8QB 1QZRA 2YTQA 2YZTA 2JY9A 5ADZA 2DSYA 2EPOA 4U3DA 4OO1A 4NXME 4DPUA 1HK7A 4KQVA 1X47A 3ZKBA 4HY1A 2L2KB 2EL4A 2V87A 4WSGA 4LF8E 1XMQE 4B3TE 3C6KA 2UU9E 2Z5CA 2MC5A 3UK3C 3BBGA 5C0XC 1T39A 2V34A 3KRNA 1IMUA 4JI1E 3Q1QA 4AM3A 2L92A 1A1LA 2ZM6E 2HKEA 3HQ1A 3ZM7A 3FIGA 4F9AB 5K36F 1RMDA 1ZM2A 3PS2A 5GMDA 2YT4A 1WJPA 2UUCE 5AE2A 3L00A 2EM7A 1EKZA 4TUGA 1P47A 4R2SA 4NXMI 2PO1B 2UXCE 3P3GA 3BIDA 1XMOI 1N34I 4XTJA 5A6BA 2EN7A 1RR9A 1PJQA 1UILA 4L5NC 2IOPA 3C4BA 2JOXA 1TF6A 2V2QA 1D6TA 3QT5A 3J7AG 4R2AA 2OI2A 2ODRD 2EMAA 3IWCA 2EOOA 1KIJA 3MHSC 2WNRA 2YTJA 5FLXC 4LF9E 1NZ0A 1XNRI 2VE7C 2BB8A 2I13A 1FWKA 1A1KA 2PNMA 2UXBI 1OYPA 4LF5E 4P7DA 4BA1B 4DUZE 4KHPI 3C6MA 3H4LA 4OOGC 2EMZA 2WCC3 2EPXA 5LMUE 4IZJB 3QT6A 4HTGA 4DV6E 4DR5I 3T1HI 1TN9A 2N3GA 5KL3A 2Z5BA 4JI2I 1EI1A 4J3DA 4AIDA 1HNXI 4X64E 4F6NA 3T1HE 4GKKI 2EL5A 2VQEE 2VQFE 5F3WA 4JI0E 2EPRA 2DEJA 4DV0I 1IBMI 4I8OA 2DMYA 3BGHA 3KZYA 4ZYDA 1P42A 1NHIA 2YWQA 1FWLA 4JI3I 3EPKA 4IFDF 4FW5A 1DI2A 2V2ZA 2ADRA 1A1GA 4HACB 4P78A 4QNJA 1KKHA 2NUFA 2WP8B 3D4JA 2CGEA 4M2ZA 4LU9A 2YTOA 3DF6A 4LFBI 1WHQA 2O1VA 1WHNA 2BA1D 1WXRA 1X49A 2EMFA 1UEKA 2EOQA 1Y4UA 2JE6A 3CWVA 4OZEA 3J81Q 2RSMA 4AQYI 4GKKE 3ADJA 3JAMC 4F9BB 1AH5A 4R2QA 3PRYA 4I3HA 4GKJI 2WW4A 2UXCI 2EWLA 1FJGE 3HXLA 3B82A 1Z0TA 2VESA 1RREA 5FLXQ 1U2RA 2HHHI 3QT8A 2YSOA 3DJWA 1UN6B 2N3HA 2ZBKB 2VRDA 1IQSA 4IJDA 5L3JA 1ZU1A 4F2JC 2E5LE 3VYXA 2JT2A 2EMLA 2EMXA 2EOIA 3HKMA 2GLIA 2HK3A 1USVA 1H74A 1YH8A 4X64I 2JEAB 4OKGA 1Z5BA 5EKWA 1UDOA 4O4KA 3ADLA 2IHR1 5AC5A 4FWDA 2EOHA 2EN4A 4MDTA 3EQ1A 1S4EA 2EM8A 4DR5E 4DV6I 3PYEA 5K36E 1IBLI 2NN6B 2UUAE 1PIEA 2L6MA 2EOSA 2EMWA 3F6GA 1Z0CA 4WUDA 5C0XA 3JTZA 1N3GA 2EPKX 3P76A 4DV4I 3KWRA 2RS6A 4OO1E 2DLKA 4DPTA 2DIXA 2FV4B 2UUBI 4BBYA 5IV8B 3ZKDA 4WSPA 2MDRA 4DR3I 2EOZA 4MYUA 4M0VA 3WU4A 2WBUA 1Y60A 2Z5CB 2YU8A 4DPXA 1A1HA 5DRPA 4Z7CA 1HNZI 1I94E 1H7SA 3M85G 2N8XA 2FGGA 2MKNA 1SR9A 2D9HA 2VF1A 4JYAI 2Q2EB 2J7JA 1T38A 1LLMC 2YTIA 5AE1A 2BR2A 4U3BA 2GO4A 2UXDI 2PO0B 2NN6A 4OO1D 5IWAE 1YYOA 2DLQA 1PVGA 1GZ6A 2V83A 2M1SA 5AC4A 2B9DA 2UXDE 3BF2A 3P1XA 4DKKA 2GPIA 4LOMA 1XMOE 1N34E 4QNKA 3GCMA 4R2DA 1HR0I 2HC5A 2BV3A 2R42A 2LV2A 2CZ9A 2KONA 5AASA 1ZAAC 4JI5E 4PU9A 2EM2A 2LE2A 1YPNA 4MLVA 4OX9I 4MQYA 1S16A 2RQLA 4YHHE 4KZSA 4MYTA 2EPUA 4IFDA 1RQ0A 2UUBE 1BB8A 3U1KA 1NHJA 2PO2B 1IBKI 2EM4A 4BMJA 4P7AA 1YSAC 2UUCI 2RSIA 2EPZA 2EM5A 3T1YI 2JP9A 2EMHA 2K7IA 4JYAE 4BCAA 1FNMA 5FWKA 5EL9A 5DNXA 4PRVA 2BM0A 2E5LI 1XHKA 1G2FC 1YYKA 1KVKA 2Z5BB 1T4NA 1PJTA 2EN2A 3J81C 2F8BA 3H09A 4LFBE 5KL2A 3M7ND 1HNWI 3WU6A 2AE8A 2FTXB 3NZKA 4GKJE 2YTEA 3P3CA 1J5EI 2CPNA 2HFSA 4WUBA 3EPJA 4BHCA 1B69A 4KHPE 1RHYA 4FW9A 2C39A 2C39B 2NN6C 2EMCA 3ECRA 4DR3E 3U1YA 2EOFA 4LTYA 2A25A 4UT4A 2VQFI 3HULA 2UUAI 1QNTA 4USMA 4JI5I 1N36E 1VI7A 4HXZA 3HPZA 1Y6ZA 2C37A 4N4RB 5A69A 2LBSB 2O1UA 3GONA 3AV0A 1XNQI 2EPLX 4MU3A 2BR2B 5DRRA 3WU5A 2PO1A 2L8TA 1T4LB 4FW7A 4Q35B 1IQOA 4LF4E 3P3EA 4M1KA 4DR4I 2KHXA 1UBDC 3T1YE 4OX9E 1EH8A 3HPSA 5AE3A 5IXMB 1WUUA 3ZZTA 2DB2A 3VK6A 4BA2B 1YHCA 4IZKB 1K47A 1T4OA 3Q6MA 4HEIA 1N33I 2HKJA 2ENHA 4MLQA 4BC9A 3TQMA 2YU5A
chains in the Genus database with same CATH topology
2F4VE 2L2NA 2V2VA 4JI8I 2IOQA 2JR1A 5A2QQ 1RC7A 2JWOA 2GS8A 2VQEI 2JOBA 4DV1E 1Z59A 3ZZ0A 2CG9A 2K4VA 3M6AA 5LMNI 4B3SI 4F9CB 2ODRC 4JI2E 2LRSA 1FJGI 2L3JA 3ZOQB 4HACA 2G7HA 3P06A 4NXNI 2O1TA 2XEXA 1FI4A 5IWAI 4LF7E 4LF6E 3F6HA 1N33E 1DARA 1Z0WA 3OMLA 4DV4E 2L3CA 1B63A 4WPYA 2F4VI 4JG4A 2PNLA 4DXLA 2AJ4A 2LJHA 3VYYA 1STUA 4BC7A 4LFCI 4DR7I 4IZJA 4IZKA 2UU9I 1NHHA 2GQ0A 3C4TA 4DPYA 3OTOE 1Z5CA 1IBLE 3HJCA 1QU6A 2M4IA 4ZVIA 1ZM9A 1Z0BA 2O1WA 4M30A 1XNRE 4URLA 3ADIA 3J7AM 4BS9A 3K1JA 4LF6I 2NA2A 4X65I 4DPWA 4EMDA 1ZXNA 5IT9C 1ZBTA 3B78A 2MC6A 4B3ME 4JI7I 2L2MA 4DR6I 2V88A 1H72C 4JI3E 1Z0GA 4WYQB 1HNWE 4LFCE 4DR7E 4RPFA 1Z0VA 3ZZUA 3HTXA 5IT9Q 2VF3A 3JU0A 4JI1I 5GMEA 1HNZE 2H36X 2EZ6A 2NUGA 3RMPA 3LNUA 1BKNA 4B3TI 4LF7I 4LF9I 4DR6E 2RTXA 2E1RA 1N0VC 3LPSA 4X66E 4DV0E 1IBME 4JI0I 1ZM4A 4X62I 4JI6E 4DUZI 2HFUA 1A6FA 4DV5E 2NPFA 4DR1I 5CFFE 1IBKE 1OJ4A 4DV1I 4JI8E 2JVAA 3J80C 1VISA 2LUQA 4DV7I 4Z7YA 2ZITA 1YYWA 2LJPA 4X8WA 4WFTA 1J5EE 3J80Q 3QT7A 1O0WA 1Z5AA 2R3VA 1N36I 1N32I 3V5RA 4HYMA 4R8OA 4K0KE 4B3RI 3J7Yp 1N32E 4UTGA 1XMQI 3IWDA 4DV2I 1MG7A 2WZOA 4P52A 4DV3E 1USUA 1H7UA 4PRXA 2V85A 3B8HA 3F0NA 3PYDA 1B62A 5A2QC 1YZ9A 1PKPA 4ED4A 4X66I 4DU7A 1ZBQA 3IWBA 2X36A 1Z0EA 4N3OA 1HR0E 4JI7E 4DV5I 1KTVA 2E1MA 2ZM6I 4R1FA 4FN5A 1Y4SA 1N0UA 4WUCA 4DU8A 3OTOI 4DMIA 5BR8I 2HHHE 4USKA 1UHZA 4R03A 4DR1E 3PYFA 3ADGA 5DNYA 2RS7A 4YHHI 2V86A 3MSWA 3PYGA 2V8PA 4DV7E 2V89A 2EFGA 2LTSA 4YY3E 4JV5I 4L8NA 2M7QA 2HK2A 3V2UC 4LF8I 2B7VA 2B7TA 3WU3A 5T6JA 4Q28A 4B3MI 4JI4I 2KOUA 1FKAE 4X65E 4DV3I 2NUEA 2LMZA 4DR2E 4GEQB 4JI4E 1GQEA 2DEIA 2L33A 4LFAI 3AUZA 1ELOA 1I94I 1X48A 2J7KA 4B3RE 4K0KI 2BM1A 3K6QA 1MX0A 4TUIA 1HNXE 4JI6I 1DQ3A 1J26A 1ZXMA 4DR2I 4DV2E 2LUPB 4JV5E 4YY3I 3LLHA 3K85A 2A2DA 4DR4E 4LF4I 4F54A 2Z5EA 4FWHA 4DUYI 1EA6A 1MU5A 1XNQE 2LTRA 3LMLA 4B3SE 4IZJD 1H73A 2X7IA 3JAMQ 4X62E 4NXNE 5LL6R 3Q6NA 1ZM3A 3K17A 4LFAE 2A2CA 4FWGA 2UXBE 5LMNE 5BR8E 4DUYE 3LTOA 5LMUI 2B3TB 4AQYE 4J8ZA 2V8QB 1QZRA 2YZTA 2JY9A 5ADZA 2DSYA 4DPUA 4NXME 1HK7A 4KQVA 1X47A 3ZKBA 4HY1A 2L2KB 2V87A 4LF8E 1XMQE 4B3TE 2Z5CA 2UU9E 2MC5A 2V34A 4JI1E 3Q1QA 2L92A 2ZM6E 2HKEA 3HQ1A 3ZM7A 3FIGA 4F9AB 1ZM2A 5GMDA 2YT4A 2UUCE 5AE2A 1EKZA 4TUGA 4NXMI 2UXCE 1XMOI 1N34I 4XTJA 1RR9A 1UILA 4L5NC 2IOPA 3C4BA 2JOXA 2V2QA 1D6TA 3QT5A 3J7AG 2OI2A 2ODRD 3IWCA 1KIJA 4LF9E 5FLXC 1NZ0A 1XNRI 2VE7C 1FWKA 2UXBI 2PNMA 4LF5E 4P7DA 4KHPI 4DUZE 3H4LA 4OOGC 5LMUE 4IZJB 3QT6A 4DV6E 4DR5I 3T1HI 2N3GA 2Z5BA 4JI2I 1EI1A 1HNXI 4X64E 3T1HE 4GKKI 2VQEE 2VQFE 5F3WA 4JI0E 4DV0I 2DEJA 1IBMI 4I8OA 2DMYA 1NHIA 1FWLA 4JI3I 1DI2A 2V2ZA 4HACB 4P78A 1KKHA 2NUFA 3D4JA 2CGEA 4M2ZA 4LU9A 4LFBI 3DF6A 1WHQA 2O1VA 1WHNA 1WXRA 1X49A 1UEKA 3CWVA 1Y4UA 3J81Q 4AQYI 2RSMA 4GKKE 3ADJA 3JAMC 4F9BB 3PRYA 4I3HA 4GKJI 2UXCI 2WW4A 2EWLA 1FJGE 3HXLA 3B82A 1Z0TA 1RREA 5FLXQ 1U2RA 2HHHI 3QT8A 3DJWA 2N3HA 2ZBKB 5L3JA 3VYXA 2E5LE 2HK3A 1USVA 1H74A 4X64I 1Z5BA 3ADLA 2IHR1 4FWDA 1S4EA 4DR5E 4DV6I 3PYEA 1IBLI 2UUAE 1PIEA 2L6MA 3F6GA 1Z0CA 4WUDA 3JTZA 4DV4I 3KWRA 2RS6A 4DPTA 2DIXA 2FV4B 2UUBI 4BBYA 3ZKDA 4WSPA 2MDRA 4DR3I 4MYUA 4M0VA 3WU4A 4DPXA 2Z5CB 4Z7CA 1HNZI 1I94E 1H7SA 2FGGA 1SR9A 2VF1A 4JYAI 2Q2EB 5AE1A 2UXDI 5IWAE 1YYOA 1PVGA 1GZ6A 2V83A 2M1SA 2B9DA 2UXDE 3P1XA 4DKKA 1XMOE 1N34E 1HR0I 2BV3A 2R42A 2CZ9A 2KONA 5AASA 4JI5E 4PU9A 2LE2A 4OX9I 1S16A 4YHHE 4KZSA 4MYTA 1RQ0A 2UUBE 1NHJA 1IBKI 4BMJA 4P7AA 2UUCI 3T1YI 4JYAE 4BCAA 1FNMA 5FWKA 4PRVA 2BM0A 2E5LI 1XHKA 1YYKA 2Z5BB 1KVKA 1T4NA 4LFBE 3J81C 2F8BA 3H09A 1HNWI 3WU6A 2FTXB 4GKJE 1J5EI 2CPNA 2HFSA 4WUBA 4FW9A 4KHPE 4LF5I 4UT4A 4DR3E 2UUAI 4LTYA 2VQFI 3HULA 4JI5I 4USMA 1N36E 4HXZA 1Y6ZA 3HPZA 2LBSB 3GONA 2O1UA 3AV0A 1XNQI 3WU5A 2L8TA 1T4LB 4LF4E 4DR4I 4M1KA 2KHXA 3T1YE 4OX9E 3HPSA 5AE3A 1WUUA 3ZZTA 2DB2A 3VK6A 4IZKB 1K47A 1T4OA 3Q6MA 1N33I 2HKJA 4BC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V E;  2L2N A;  2V2V A;  4JI8 I;  5A2Q Q;  1RC7 A;  2GS8 A;  2VQE I;  4DV1 E;  1Z59 A;  3ZZ0 A;  3M6A A;  5LMN I;  4B3S I;  4JI2 E;  2LRS A;  1FJG I;  2L3J A;  4HAC A;  4NXN I;  2XEX A;  1FI4 A;  5IWA I;  4LF7 E;  4LF6 E;  1N33 E;  1DAR A;  1Z0W A;  4DV4 E;  2L3C A;  1B63 A;  2F4V I;  4JG4 A;  4DXL A;  2AJ4 A;  2LJH A;  3VYY A;  1STU A;  4LFC I;  4DR7 I;  2UU9 I;  1NHH A;  4DPY A;  3C4T A;  3OTO E;  1Z5C A;  1IBL E;  1QU6 A;  4ZVI A;  1ZM9 A;  1Z0B A;  4M30 A;  1XNR E;  4URL A;  3ADI A;  3J7A M;  3K1J A;  4LF6 I;  2NA2 A;  4X65 I;  4DPW A;  4EMD A;  1ZXN A;  5IT9 C;  1ZBT A;  3B78 A;  4B3M E;  4JI7 I;  2L2M A;  4DR6 I;  1H72 C;  4JI3 E;  1Z0G A;  4WYQ B;  1HNW E;  4LFC E;  4DR7 E;  4RPF A;  1Z0V A;  3ZZU A;  3HTX A;  5IT9 Q;  2VF3 A;  4JI1 I;  5GME A;  1HNZ E;  2EZ6 A;  2NUG A;  3LNU A;  1BKN A;  4B3T I;  4LF7 I;  4LF9 I;  4DR6 E;  2RTX A;  2E1R A;  1N0V C;  3LPS A;  4X66 E;  4JI0 I;  4DV0 E;  1IBM E;  1ZM4 A;  4X62 I;  4JI6 E;  4DUZ I;  2HFU A;  1A6F A;  4DV5 E;  2NPF A;  4DR1 I;  5CFF E;  1IBK E;  1OJ4 A;  4DV1 I;  4JI8 E;  2JVA A;  1VIS A;  3J80 C;  2LUQ A;  4DV7 I;  4Z7Y A;  2ZIT A;  1YYW A;  2LJP A;  4X8W A;  4WFT A;  1J5E E;  3J80 Q;  3QT7 A;  1O0W A;  1Z5A A;  2R3V A;  1N36 I;  1N32 I;  3V5R A;  4HYM A;  4K0K E;  4B3R I;  3J7Y p;  1N32 E;  4UTG A;  1XMQ I;  4DV2 I;  1MG7 A;  4P52 A;  4DV3 E;  1H7U A;  4PRX A;  3B8H A;  3F0N A;  3PYD A;  1B62 A;  5A2Q C;  1YZ9 A;  1PKP A;  4ED4 A;  4X66 I;  4DU7 A;  2X36 A;  1Z0E A;  1HR0 E;  4JI7 E;  4DV5 I;  1KTV A;  2ZM6 I;  4R1F A;  4FN5 A;  1N0U A;  4WUC A;  4DU8 A;  3OTO I;  5BR8 I;  2HHH E;  4USK A;  1UHZ A;  4DR1 E;  3PYF A;  3ADG A;  2RS7 A;  4YHH I;  3PYG A;  2V8P A;  4DV7 E;  2EFG A;  2LTS A;  4YY3 E;  4JV5 I;  2HK2 A;  3V2U C;  4LF8 I;  2B7V A;  2B7T A;  3WU3 A;  4B3M I;  4JI4 I;  1FKA E;  4X65 E;  4DV3 I;  2NUE A;  4DR2 E;  4JI4 E;  1GQE A;  2DEI A;  2L33 A;  4LFA I;  1ELO A;  1I94 I;  1X48 A;  2J7K A;  4B3R E;  4K0K I;  2BM1 A;  1MX0 A;  1HNX E;  4JI6 I;  1J26 A;  1ZXM A;  4DR2 I;  4DV2 E;  2LUP B;  4JV5 E;  4YY3 I;  3LLH A;  2A2D A;  4DR4 E;  4LF4 I;  4FWH A;  4DUY I;  1EA6 A;  1MU5 A;  1XNQ E;  2LTR A;  4B3S E;  1H73 A;  2X7I A;  3JAM Q;  4X62 E;  4NXN E;  5LL6 R;  1ZM3 A;  3K17 A;  4LFA E;  2A2C A;  4FWG A;  2UXB E;  5LMN E;  5BR8 E;  4DUY E;  3LTO A;  5LMU I;  2B3T B;  4AQY E;  1QZR A;  2JY9 A;  4DPU A;  4NXM E;  4KQV A;  1X47 A;  3ZKB A;  4HY1 A;  2L2K B;  4LF8 E;  1XMQ E;  4B3T E;  2UU9 E;  2V34 A;  4JI1 E;  3Q1Q A;  2ZM6 E;  2HKE A;  3ZM7 A;  1ZM2 A;  5GMD A;  2YT4 A;  2UUC E;  1EKZ A;  4NXM I;  2UXC E;  1XMO I;  1N34 I;  4XTJ A;  1RR9 A;  1UIL A;  3C4B A;  2V2Q A;  1D6T A;  3QT5 A;  3J7A G;  2OI2 A;  1KIJ A;  4LF9 E;  5FLX C;  1NZ0 A;  1XNR I;  1FWK A;  2UXB I;  4LF5 E;  4KHP I;  4DUZ E;  3H4L A;  4OOG C;  5LMU E;  3QT6 A;  4DV6 E;  4DR5 I;  3T1H I;  2N3G A;  4JI2 I;  1EI1 A;  1HNX I;  4X64 E;  3T1H E;  4GKK I;  2VQE E;  2VQF E;  4JI0 E;  4DV0 I;  2DEJ A;  1IBM I;  2DMY A;  1NHI A;  1FWL A;  4JI3 I;  1DI2 A;  2V2Z A;  4HAC B;  1KKH A;  2NUF A;  3D4J A;  4M2Z A;  4LFB I;  1WHQ A;  1WHN A;  1X49 A;  1UEK A;  3CWV A;  3J81 Q;  4AQY I;  2RSM A;  4GKK E;  3ADJ A;  3JAM C;  4I3H A;  4GKJ I;  2UXC I;  2WW4 A;  1FJG E;  3B82 A;  1Z0T A;  1RRE A;  5FLX Q;  1U2R A;  2HHH I;  3QT8 A;  2N3H A;  2ZBK B;  5L3J A;  3VYX A;  2E5L E;  2HK3 A;  1H74 A;  4X64 I;  1Z5B A;  3ADL A;  2IHR 1;  4FWD A;  1S4E A;  4DR5 E;  4DV6 I;  3PYE A;  1IBL I;  2UUA E;  1PIE A;  1Z0C A;  4WUD A;  4DV4 I;  2RS6 A;  4DPT A;  2DIX A;  2UUB I;  3ZKD A;  2MDR A;  4DR3 I;  4MYU A;  3WU4 A;  4DPX A;  4Z7C A;  1HNZ I;  1I94 E;  1H7S A;  4JYA I;  2Q2E B;  2UXD I;  5IWA E;  1YYO A;  1PVG A;  2UXD E;  3P1X A;  4DKK A;  1XMO E;  1N34 E;  1HR0 I;  2BV3 A;  2R42 A;  2CZ9 A;  4JI5 E;  4PU9 A;  4OX9 I;  1S16 A;  4YHH E;  4MYT A;  1RQ0 A;  2UUB E;  1NHJ A;  1IBK I;  4P7A A;  2UUC I;  3T1Y I;  4JYA E;  1FNM A;  4PRV A;  2BM0 A;  2E5L I;  1XHK A;  1YYK A;  1KVK A;  1T4N A;  4LFB E;  3J81 C;  1HNW I;  3WU6 A;  4GKJ E;  1J5E I;  2CPN A;  4WUB A;  2HFS A;  4FW9 A;  4KHP E;  4LF5 I;  4UT4 A;  4DR3 E;  2UUA I;  2VQF I;  3HUL A;  4JI5 I;  4USM A;  1N36 E;  4HXZ A;  2LBS B;  3GON A;  1XNQ I;  3WU5 A;  1T4L B;  4LF4 E;  4DR4 I;  4M1K A;  2KHX A;  3T1Y E;  4OX9 E;  1WUU A;  3ZZT A;  2DB2 A;  1K47 A;  1T4O A;  1N33 I;  2HKJ A; 
#chains in the Genus database with same CATH topology
 4MU1 A;  2F4V E;  2JYA A;  2C38 B;  5C0X B;  2L2N A;  2V2V A;  4JI8 I;  2EN1 A;  2IOQ A;  1GTK A;  2JR1 A;  5A2Q Q;  1RC7 A;  2EOE A;  1PDA A;  2JWO A;  3MHH C;  2GS8 A;  4ZYE A;  2EPM X;  2VQE I;  2JOB A;  4LCF A;  3QG5 C;  2EOJ A;  4DV1 E;  1Z59 A;  3ZZ0 A;  2CSH A;  3L7Z B;  2CG9 A;  2K4V A;  3M6A A;  5LMN I;  4B3S I;  4F9C B;  2ODR C;  4JI2 E;  2YPN A;  2BA0 G;  2LRS A;  4LCG A;  1FJG I;  2L3J A;  3ZOQ B;  4FW4 A;  1TF3 A;  4HAC A;  2G7H A;  5C0X F;  3P06 A;  4NXN I;  2O1T A;  1EH7 A;  2XEX A;  2EN8 A;  2YTP A;  3EPL A;  1FI4 A;  4O24 A;  3PS3 A;  5IWA I;  5K36 B;  2WBT A;  4LF7 E;  2IER A;  4LF6 E;  3F6H A;  4WXC A;  1N33 E;  2EPA A;  1DAR A;  2EPP A;  1Z0W A;  4BA2 A;  4NBQ A;  3OML A;  4DV4 E;  2L3C A;  3GLL A;  2EM9 A;  1B63 A;  4WPY A;  2M9A A;  1UDQ A;  2F4V I;  2EOX A;  4JG4 A;  2PNL A;  4DXL A;  2EM6 A;  2AJ4 A;  2LJH A;  3VYY A;  1SFE A;  1STU A;  4BC7 A;  2EOR A;  4LFC I;  4DR7 I;  4IZJ A;  2BBG A;  4M9V C;  2YRM A;  1E3H A;  2C37 B;  4BA1 A;  3PS1 A;  4IZK A;  2UU9 I;  2LO3 A;  1NHH A;  1KYQ A;  4KWY A;  3C4T A;  2LT7 A;  2GQ0 A;  4FW3 A;  4DPY A;  1NCS A;  2YRK A;  4ZYG A;  3OTO E;  1Z5C A;  1IBL E;  3HJC A;  1QU6 A;  2DMI A;  2M4I A;  4NZV A;  4BHB A;  2EMB A;  1MGT A;  4ZVI A;  4WX9 A;  1ZM9 A;  1ZR9 A;  1Z1B A;  1Z0B A;  2O1W A;  5ELW A;  1YUJ A;  4M30 A;  1XNR E;  4URL A;  3ADI A;  3J7A M;  2EP3 A;  1OYS A;  5C0X D;  1XXE A;  5A6B D;  4BS9 A;  3K1J A;  4LF6 I;  2NA2 A;  4X65 I;  2MKD A;  4DPW A;  4EMD A;  4OO1 C;  1L4S A;  1ZXN A;  5IT9 C;  1ZBT A;  3B78 A;  2MC6 A;  4B3M E;  2WP8 A;  4JI7 I;  2L2M A;  4DR6 I;  1EH6 A;  2V88 A;  1H72 C;  4GZN C;  4JI3 E;  1Z0G A;  4WYQ B;  1A1J A;  1HNW E;  4LFC E;  4DR7 E;  4RPF A;  1Z0V A;  4O5G A;  3ZZU A;  5JEA F;  2R1F A;  3HTX A;  5IT9 Q;  2VF3 A;  3JU0 A;  4FW6 A;  5GME A;  4JI1 I;  1HNZ E;  2NN6 F;  3CDI A;  2EM3 A;  2H36 X;  2EZ6 A;  2NUG A;  3RMP A;  5C0X E;  1R6L A;  3LNU A;  1BKN A;  1X6F A;  4B3T I;  4LF7 I;  4LF9 I;  5TSE A;  4DR6 E;  2RTX A;  2DRP A;  1X6H A;  1N0V C;  2E1R A;  4X66 E;  4DV0 E;  1IBM E;  3LPS A;  1ZM4 A;  2HGH A;  4JI0 I;  2ENA A;  4JI6 E;  5JEA C;  4X62 I;  5K36 A;  4DUZ I;  2HFU A;  2JEB A;  2JEA A;  1A6F A;  2PO0 A;  4DV5 E;  2NPF A;  1YUI A;  4GQU A;  1A1F A;  1AAY A;  4IFD D;  2YTN A;  4DR1 I;  5CFF E;  1IBK E;  1OJ4 A;  4DV1 I;  4JI8 E;  2JVA A;  3J80 C;  1VIS A;  2LUQ A;  4DV7 I;  1X6E A;  2EJ4 A;  4Z7Y A;  2ZIT A;  2HJJ A;  1YYW A;  2LJP A;  2O3Z A;  4X8W A;  4LCH A;  4WFT A;  3GME A;  1J5E E;  3KZZ A;  3J80 Q;  3QT7 A;  1O0W A;  1DGC A;  2WBS A;  4R2E A;  5JEA A;  4FK5 C;  4IS9 A;  2YTF A;  3VHT B;  2E72 A;  1Z5A A;  2J65 A;  2EMG A;  2R3V A;  1WRJ A;  2PNZ A;  1UDN A;  1N36 I;  1N32 I;  3V5R A;  4HYM A;  4R8O A;  4K0K E;  4B3R I;  4OO1 F;  2NN6 D;  2EMY A;  4F6M A;  4NHR A;  1G2D C;  3J7Y p;  1R6M A;  1N32 E;  5JEA B;  2EPN A;  5DNL A;  4UTG A;  1XMQ I;  3IWD A;  5KL4 A;  4DV2 I;  2DGC A;  2YRH A;  1MG7 A;  2ELY A;  2WZO A;  4P52 A;  4DV3 E;  1USU A;  1H7U A;  4PRX A;  2V85 A;  3B8H A;  3F0N A;  4IS1 C;  3PYD A;  2RPC A;  1B62 A;  2EOY A;  1PJS A;  5A2Q C;  1YZ9 A;  1OYR A;  2EQ0 A;  2EMK A;  1PKP A;  2CTD A;  4ED4 A;  2JPA A;  4DU7 A;  1ZBQ A;  3IWB A;  1MEY C;  2X36 A;  4X66 I;  3UHM A;  1Z0E A;  4N3O A;  1HR0 E;  4WXD A;  4JI7 E;  4ZYH A;  1JK2 A;  5JEA D;  3M7N G;  4ISA A;  4DV5 I;  2JXP A;  2GHF A;  1KTV A;  2E1M A;  2ZM6 I;  4R1F A;  4FN5 A;  2EN6 A;  1N0U A;  1Y5Y A;  1Y4S A;  2JE6 B;  4WUC A;  4R2R A;  4DU8 A;  2BA1 G;  3OTO I;  2EOM A;  2EL6 A;  4AIM A;  3H1C A;  2EM0 A;  4RHB B;  4DMI A;  5BR8 I;  2C38 A;  2HHH E;  4USK A;  2JEB B;  2NN6 E;  1UHZ A;  4R03 A;  4DR1 E;  3PYF A;  2LJU A;  4MU4 A;  3ADG A;  2ENC A;  3M99 B;  2LCE A;  2RS7 A;  5DNY A;  4YHH I;  2MDG A;  2V86 A;  3MSW A;  3PYG A;  2V8P A;  4DV7 E;  2V89 A;  2EFG A;  2BA0 D;  4MU0 A;  2LTS A;  4YY3 E;  5KL5 A;  4JV5 I;  4L8N A;  2M7Q A;  2HK2 A;  3V2U C;  4LF8 I;  2B7V A;  2B7T A;  3EPH A;  3WU3 A;  1JK1 A;  5T6J A;  4Q28 A;  4B3M I;  3THO B;  5A6A A;  2YTD A;  2YTG A;  3THN A;  3M85 D;  4JI4 I;  2ELZ A;  4IFD E;  2KOU A;  5A6J A;  5A6K A;  1FKA E;  1BBG A;  4X65 E;  4IFD B;  4OO1 B;  4DV3 I;  2NUE A;  1X3C A;  2LMZ A;  3DD6 A;  4DR2 E;  2EN3 A;  4GEQ B;  4JI4 E;  1GQE A;  2DEI A;  5K36 D;  5KL7 A;  2L33 A;  4LFA I;  1F2I G;  4IFD C;  2NAB A;  3AUZ A;  1E3P A;  1ELO A;  4R2P A;  2Q8U A;  2I9I A;  1I94 I;  1X48 A;  2J7K A;  4R2C A;  1YFH A;  4B3R E;  2BM1 A;  3K6Q A;  1MX0 A;  4K0K I;  2EQ1 A;  2YSP A;  1BBO A;  4TUI A;  1HNX E;  4JI6 I;  5KL6 A;  1DQ3 A;  2F1D A;  1J26 A;  1ZXM A;  2EPC A;  4DR2 I;  4DV2 E;  2WNR B;  1NEI A;  2LUP B;  3B4T A;  2CT1 A;  4JV5 E;  4YY3 I;  3LLH A;  3K85 A;  5LLQ A;  2A2D A;  4RH8 A;  4DR4 E;  4LF4 I;  4F54 A;  2IES A;  2Z5E A;  5DRO A;  4FWH A;  2PO2 A;  4DUY I;  1EA6 A;  1MU5 A;  2EQ3 A;  1XNQ E;  2CVE A;  2LTR A;  3LML A;  2PRT A;  4B3S E;  2R76 A;  4IZJ D;  4O43 A;  1UDS A;  2PNZ B;  1A1I A;  1H73 A;  2EE8 A;  2X7I A;  2GO3 A;  3JAM Q;  4X62 E;  2LVH A;  4NXN E;  3CDJ A;  5LL6 R;  3Q6N A;  1ZM3 A;  3K17 A;  5DRQ A;  4LFA E;  2A2C A;  3L7Z A;  4FWG A;  4LPF A;  2UXB E;  4LF5 I;  5LMN E;  5BR8 E;  4DUY E;  5JEA E;  3LTO A;  5LMU I;  1KJK A;  2EMI A;  2B3T B;  4X9J A;  5K36 C;  1X5W A;  4AQY E;  4J8Z A;  2V8Q B;  1QZR A;  2YTQ A;  2YZT A;  2JY9 A;  5ADZ A;  2DSY A;  2EPO A;  4U3D A;  4OO1 A;  4NXM E;  4DPU A;  1HK7 A;  4KQV A;  1X47 A;  3ZKB A;  4HY1 A;  2L2K B;  2EL4 A;  2V87 A;  4WSG A;  4LF8 E;  1XMQ E;  4B3T E;  3C6K A;  2UU9 E;  2Z5C A;  2MC5 A;  3UK3 C;  3BBG A;  5C0X C;  1T39 A;  2V34 A;  3KRN A;  1IMU A;  4JI1 E;  3Q1Q A;  4AM3 A;  2L92 A;  1A1L A;  2ZM6 E;  2HKE A;  3HQ1 A;  3ZM7 A;  3FIG A;  4F9A B;  5K36 F;  1RMD A;  1ZM2 A;  3PS2 A;  5GMD A;  2YT4 A;  1WJP A;  2UUC E;  5AE2 A;  3L00 A;  2EM7 A;  1EKZ A;  4TUG A;  1P47 A;  4R2S A;  4NXM I;  2PO1 B;  2UXC E;  3P3G A;  3BID A;  1XMO I;  1N34 I;  4XTJ A;  5A6B A;  2EN7 A;  1RR9 A;  1PJQ A;  1UIL A;  4L5N C;  2IOP A;  3C4B A;  2JOX A;  1TF6 A;  2V2Q A;  1D6T A;  3QT5 A;  3J7A G;  4R2A A;  2OI2 A;  2ODR D;  2EMA A;  3IWC A;  2EOO A;  1KIJ A;  3MHS C;  2WNR A;  2YTJ A;  5FLX C;  4LF9 E;  1NZ0 A;  1XNR I;  2VE7 C;  2BB8 A;  2I13 A;  1FWK A;  1A1K A;  2PNM A;  2UXB I;  1OYP A;  4LF5 E;  4P7D A;  4BA1 B;  4DUZ E;  4KHP I;  3C6M A;  3H4L A;  4OOG C;  2EMZ A;  2WCC 3;  2EPX A;  5LMU E;  4IZJ B;  3QT6 A;  4HTG A;  4DV6 E;  4DR5 I;  3T1H I;  1TN9 A;  2N3G A;  5KL3 A;  2Z5B A;  4JI2 I;  1EI1 A;  4J3D A;  4AID A;  1HNX I;  4X64 E;  4F6N A;  3T1H E;  4GKK I;  2EL5 A;  2VQE E;  2VQF E;  5F3W A;  4JI0 E;  2EPR A;  2DEJ A;  4DV0 I;  1IBM I;  4I8O A;  2DMY A;  3BGH A;  3KZY A;  4ZYD A;  1P42 A;  1NHI A;  2YWQ A;  1FWL A;  4JI3 I;  3EPK A;  4IFD F;  4FW5 A;  1DI2 A;  2V2Z A;  2ADR A;  1A1G A;  4HAC B;  4P78 A;  4QNJ A;  1KKH A;  2NUF A;  2WP8 B;  3D4J A;  2CGE A;  4M2Z A;  4LU9 A;  2YTO A;  3DF6 A;  4LFB I;  1WHQ A;  2O1V A;  1WHN A;  2BA1 D;  1WXR A;  1X49 A;  2EMF A;  1UEK A;  2EOQ A;  1Y4U A;  2JE6 A;  3CWV A;  4OZE A;  3J81 Q;  2RSM A;  4AQY I;  4GKK E;  3ADJ A;  3JAM C;  4F9B B;  1AH5 A;  4R2Q A;  3PRY A;  4I3H A;  4GKJ I;  2WW4 A;  2UXC I;  2EWL A;  1FJG E;  3HXL A;  3B82 A;  1Z0T A;  2VES A;  1RRE A;  5FLX Q;  1U2R A;  2HHH I;  3QT8 A;  2YSO A;  3DJW A;  1UN6 B;  2N3H A;  2ZBK B;  2VRD A;  1IQS A;  4IJD A;  5L3J A;  1ZU1 A;  4F2J C;  2E5L E;  3VYX A;  2JT2 A;  2EML A;  2EMX A;  2EOI A;  3HKM A;  2GLI A;  2HK3 A;  1USV A;  1H74 A;  1YH8 A;  4X64 I;  2JEA B;  4OKG A;  1Z5B A;  5EKW A;  1UDO A;  4O4K A;  3ADL A;  2IHR 1;  5AC5 A;  4FWD A;  2EOH A;  2EN4 A;  4MDT A;  3EQ1 A;  1S4E A;  2EM8 A;  4DR5 E;  4DV6 I;  3PYE A;  5K36 E;  1IBL I;  2NN6 B;  2UUA E;  1PIE A;  2L6M A;  2EOS A;  2EMW A;  3F6G A;  1Z0C A;  4WUD A;  5C0X A;  3JTZ A;  1N3G A;  2EPK X;  3P76 A;  4DV4 I;  3KWR A;  2RS6 A;  4OO1 E;  2DLK A;  4DPT A;  2DIX A;  2FV4 B;  2UUB I;  4BBY A;  5IV8 B;  3ZKD A;  4WSP A;  2MDR A;  4DR3 I;  2EOZ A;  4MYU A;  4M0V A;  3WU4 A;  2WBU A;  1Y60 A;  2Z5C B;  2YU8 A;  4DPX A;  1A1H A;  5DRP A;  4Z7C A;  1HNZ I;  1I94 E;  1H7S A;  3M85 G;  2N8X A;  2FGG A;  2MKN A;  1SR9 A;  2D9H A;  2VF1 A;  4JYA I;  2Q2E B;  2J7J A;  1T38 A;  1LLM C;  2YTI A;  5AE1 A;  2BR2 A;  4U3B A;  2GO4 A;  2UXD I;  2PO0 B;  2NN6 A;  4OO1 D;  5IWA E;  1YYO A;  2DLQ A;  1PVG A;  1GZ6 A;  2V83 A;  2M1S A;  5AC4 A;  2B9D A;  2UXD E;  3BF2 A;  3P1X A;  4DKK A;  2GPI A;  4LOM A;  1XMO E;  1N34 E;  4QNK A;  3GCM A;  4R2D A;  1HR0 I;  2HC5 A;  2BV3 A;  2R42 A;  2LV2 A;  2CZ9 A;  2KON A;  5AAS A;  1ZAA C;  4JI5 E;  4PU9 A;  2EM2 A;  2LE2 A;  1YPN A;  4MLV A;  4OX9 I;  4MQY A;  1S16 A;  2RQL A;  4YHH E;  4KZS A;  4MYT A;  2EPU A;  4IFD A;  1RQ0 A;  2UUB E;  1BB8 A;  3U1K A;  1NHJ A;  2PO2 B;  1IBK I;  2EM4 A;  4BMJ A;  4P7A A;  1YSA C;  2UUC I;  2RSI A;  2EPZ A;  2EM5 A;  3T1Y I;  2JP9 A;  2EMH A;  2K7I A;  4JYA E;  4BCA A;  1FNM A;  5FWK A;  5EL9 A;  5DNX A;  4PRV A;  2BM0 A;  2E5L I;  1XHK A;  1G2F C;  1YYK A;  1KVK A;  2Z5B B;  1T4N A;  1PJT A;  2EN2 A;  3J81 C;  2F8B A;  3H09 A;  4LFB E;  5KL2 A;  3M7N D;  1HNW I;  3WU6 A;  2AE8 A;  2FTX B;  3NZK A;  4GKJ E;  2YTE A;  3P3C A;  1J5E I;  2CPN A;  2HFS A;  4WUB A;  3EPJ A;  4BHC A;  1B69 A;  4KHP E;  1RHY A;  4FW9 A;  2C39 A;  2C39 B;  2NN6 C;  2EMC A;  3ECR A;  4DR3 E;  3U1Y A;  2EOF A;  4LTY A;  2A25 A;  4UT4 A;  2VQF I;  3HUL A;  2UUA I;  1QNT A;  4USM A;  4JI5 I;  1N36 E;  1VI7 A;  4HXZ A;  3HPZ A;  1Y6Z A;  2C37 A;  4N4R B;  5A69 A;  2LBS B;  2O1U A;  3GON A;  3AV0 A;  1XNQ I;  2EPL X;  4MU3 A;  2BR2 B;  5DRR A;  3WU5 A;  2PO1 A;  2L8T A;  1T4L B;  4FW7 A;  4Q35 B;  1IQO A;  4LF4 E;  3P3E A;  4M1K A;  4DR4 I;  2KHX A;  1UBD C;  3T1Y E;  4OX9 E;  1EH8 A;  3HPS A;  5AE3 A;  5IXM B;  1WUU A;  3ZZT A;  2DB2 A;  3VK6 A;  4BA2 B;  1YHC A;  4IZK B;  1K47 A;  1T4O A;  3Q6M A;  4HEI A;  1N33 I;  2HKJ A;  2ENH A;  4MLQ A;  4BC9 A;  3TQM A;  2YU5 A; 
#chains in the Genus database with same CATH homology
 2F4V E;  2L2N A;  2V2V A;  4JI8 I;  2IOQ A;  2JR1 A;  5A2Q Q;  1RC7 A;  2JWO A;  2GS8 A;  2VQE I;  2JOB A;  4DV1 E;  1Z59 A;  3ZZ0 A;  2CG9 A;  2K4V A;  3M6A A;  5LMN I;  4B3S I;  4F9C B;  2ODR C;  4JI2 E;  2LRS A;  1FJG I;  2L3J A;  3ZOQ B;  4HAC A;  2G7H A;  3P06 A;  4NXN I;  2O1T A;  2XEX A;  1FI4 A;  5IWA I;  4LF7 E;  4LF6 E;  3F6H A;  1N33 E;  1DAR A;  1Z0W A;  3OML A;  4DV4 E;  2L3C A;  1B63 A;  4WPY A;  2F4V I;  4JG4 A;  2PNL A;  4DXL A;  2AJ4 A;  2LJH A;  3VYY A;  1STU A;  4BC7 A;  4LFC I;  4DR7 I;  4IZJ A;  4IZK A;  2UU9 I;  1NHH A;  2GQ0 A;  3C4T A;  4DPY A;  3OTO E;  1Z5C A;  1IBL E;  3HJC A;  1QU6 A;  2M4I A;  4ZVI A;  1ZM9 A;  1Z0B A;  2O1W A;  4M30 A;  1XNR E;  4URL A;  3ADI A;  3J7A M;  4BS9 A;  3K1J A;  4LF6 I;  2NA2 A;  4X65 I;  4DPW A;  4EMD A;  1ZXN A;  5IT9 C;  1ZBT A;  3B78 A;  2MC6 A;  4B3M E;  4JI7 I;  2L2M A;  4DR6 I;  2V88 A;  1H72 C;  4JI3 E;  1Z0G A;  4WYQ B;  1HNW E;  4LFC E;  4DR7 E;  4RPF A;  1Z0V A;  3ZZU A;  3HTX A;  5IT9 Q;  2VF3 A;  3JU0 A;  4JI1 I;  5GME A;  1HNZ E;  2H36 X;  2EZ6 A;  2NUG A;  3RMP A;  3LNU A;  1BKN A;  4B3T I;  4LF7 I;  4LF9 I;  4DR6 E;  2RTX A;  2E1R A;  1N0V C;  3LPS A;  4X66 E;  4DV0 E;  1IBM E;  4JI0 I;  1ZM4 A;  4X62 I;  4JI6 E;  4DUZ I;  2HFU A;  1A6F A;  4DV5 E;  2NPF A;  4DR1 I;  5CFF E;  1IBK E;  1OJ4 A;  4DV1 I;  4JI8 E;  2JVA A;  3J80 C;  1VIS A;  2LUQ A;  4DV7 I;  4Z7Y A;  2ZIT A;  1YYW A;  2LJP A;  4X8W A;  4WFT A;  1J5E E;  3J80 Q;  3QT7 A;  1O0W A;  1Z5A A;  2R3V A;  1N36 I;  1N32 I;  3V5R A;  4HYM A;  4R8O A;  4K0K E;  4B3R I;  3J7Y p;  1N32 E;  4UTG A;  1XMQ I;  3IWD A;  4DV2 I;  1MG7 A;  2WZO A;  4P52 A;  4DV3 E;  1USU A;  1H7U A;  4PRX A;  2V85 A;  3B8H A;  3F0N A;  3PYD A;  1B62 A;  5A2Q C;  1YZ9 A;  1PKP A;  4ED4 A;  4X66 I;  4DU7 A;  1ZBQ A;  3IWB A;  2X36 A;  1Z0E A;  4N3O A;  1HR0 E;  4JI7 E;  4DV5 I;  1KTV A;  2E1M A;  2ZM6 I;  4R1F A;  4FN5 A;  1Y4S A;  1N0U A;  4WUC A;  4DU8 A;  3OTO I;  4DMI A;  5BR8 I;  2HHH E;  4USK A;  1UHZ A;  4R03 A;  4DR1 E;  3PYF A;  3ADG A;  5DNY A;  2RS7 A;  4YHH I;  2V86 A;  3MSW A;  3PYG A;  2V8P A;  4DV7 E;  2V89 A;  2EFG A;  2LTS A;  4YY3 E;  4JV5 I;  4L8N A;  2M7Q A;  2HK2 A;  3V2U C;  4LF8 I;  2B7V A;  2B7T A;  3WU3 A;  5T6J A;  4Q28 A;  4B3M I;  4JI4 I;  2KOU A;  1FKA E;  4X65 E;  4DV3 I;  2NUE A;  2LMZ A;  4DR2 E;  4GEQ B;  4JI4 E;  1GQE A;  2DEI A;  2L33 A;  4LFA I;  3AUZ A;  1ELO A;  1I94 I;  1X48 A;  2J7K A;  4B3R E;  4K0K I;  2BM1 A;  3K6Q A;  1MX0 A;  4TUI A;  1HNX E;  4JI6 I;  1DQ3 A;  1J26 A;  1ZXM A;  4DR2 I;  4DV2 E;  2LUP B;  4JV5 E;  4YY3 I;  3LLH A;  3K85 A;  2A2D A;  4DR4 E;  4LF4 I;  4F54 A;  2Z5E A;  4FWH A;  4DUY I;  1EA6 A;  1MU5 A;  1XNQ E;  2LTR A;  3LML A;  4B3S E;  4IZJ D;  1H73 A;  2X7I A;  3JAM Q;  4X62 E;  4NXN E;  5LL6 R;  3Q6N A;  1ZM3 A;  3K17 A;  4LFA E;  2A2C A;  4FWG A;  2UXB E;  5LMN E;  5BR8 E;  4DUY E;  3LTO A;  5LMU I;  2B3T B;  4AQY E;  4J8Z A;  2V8Q B;  1QZR A;  2YZT A;  2JY9 A;  5ADZ A;  2DSY A;  4DPU A;  4NXM E;  1HK7 A;  4KQV A;  1X47 A;  3ZKB A;  4HY1 A;  2L2K B;  2V87 A;  4LF8 E;  1XMQ E;  4B3T E;  2Z5C A;  2UU9 E;  2MC5 A;  2V34 A;  4JI1 E;  3Q1Q A;  2L92 A;  2ZM6 E;  2HKE A;  3HQ1 A;  3ZM7 A;  3FIG A;  4F9A B;  1ZM2 A;  5GMD A;  2YT4 A;  2UUC E;  5AE2 A;  1EKZ A;  4TUG A;  4NXM I;  2UXC E;  1XMO I;  1N34 I;  4XTJ A;  1RR9 A;  1UIL A;  4L5N C;  2IOP A;  3C4B A;  2JOX A;  2V2Q A;  1D6T A;  3QT5 A;  3J7A G;  2OI2 A;  2ODR D;  3IWC A;  1KIJ A;  4LF9 E;  5FLX C;  1NZ0 A;  1XNR I;  2VE7 C;  1FWK A;  2UXB I;  2PNM A;  4LF5 E;  4P7D A;  4KHP I;  4DUZ E;  3H4L A;  4OOG C;  5LMU E;  4IZJ B;  3QT6 A;  4DV6 E;  4DR5 I;  3T1H I;  2N3G A;  2Z5B A;  4JI2 I;  1EI1 A;  1HNX I;  4X64 E;  3T1H E;  4GKK I;  2VQE E;  2VQF E;  5F3W A;  4JI0 E;  4DV0 I;  2DEJ A;  1IBM I;  4I8O A;  2DMY A;  1NHI A;  1FWL A;  4JI3 I;  1DI2 A;  2V2Z A;  4HAC B;  4P78 A;  1KKH A;  2NUF A;  3D4J A;  2CGE A;  4M2Z A;  4LU9 A;  4LFB I;  3DF6 A;  1WHQ A;  2O1V A;  1WHN A;  1WXR A;  1X49 A;  1UEK A;  3CWV A;  1Y4U A;  3J81 Q;  4AQY I;  2RSM A;  4GKK E;  3ADJ A;  3JAM C;  4F9B B;  3PRY A;  4I3H A;  4GKJ I;  2UXC I;  2WW4 A;  2EWL A;  1FJG E;  3HXL A;  3B82 A;  1Z0T A;  1RRE A;  5FLX Q;  1U2R A;  2HHH I;  3QT8 A;  3DJW A;  2N3H A;  2ZBK B;  5L3J A;  3VYX A;  2E5L E;  2HK3 A;  1USV A;  1H74 A;  4X64 I;  1Z5B A;  3ADL A;  2IHR 1;  4FWD A;  1S4E A;  4DR5 E;  4DV6 I;  3PYE A;  1IBL I;  2UUA E;  1PIE A;  2L6M A;  3F6G A;  1Z0C A;  4WUD A;  3JTZ A;  4DV4 I;  3KWR A;  2RS6 A;  4DPT A;  2DIX A;  2FV4 B;  2UUB I;  4BBY A;  3ZKD A;  4WSP A;  2MDR A;  4DR3 I;  4MYU A;  4M0V A;  3WU4 A;  4DPX A;  2Z5C B;  4Z7C A;  1HNZ I;  1I94 E;  1H7S A;  2FGG A;  1SR9 A;  2VF1 A;  4JYA I;  2Q2E B;  5AE1 A;  2UXD I;  5IWA E;  1YYO A;  1PVG A;  1GZ6 A;  2V83 A;  2M1S A;  2B9D A;  2UXD E;  3P1X A;  4DKK A;  1XMO E;  1N34 E;  1HR0 I;  2BV3 A;  2R42 A;  2CZ9 A;  2KON A;  5AAS A;  4JI5 E;  4PU9 A;  2LE2 A;  4OX9 I;  1S16 A;  4YHH E;  4KZS A;  4MYT A;  1RQ0 A;  2UUB E;  1NHJ A;  1IBK I;  4BMJ A;  4P7A A;  2UUC I;  3T1Y I;  4JYA E;  4BCA A;  1FNM A;  5FWK A;  4PRV A;  2BM0 A;  2E5L I;  1XHK A;  1YYK A;  2Z5B B;  1KVK A;  1T4N A;  4LFB E;  3J81 C;  2F8B A;  3H09 A;  1HNW I;  3WU6 A;  2FTX B;  4GKJ E;  1J5E I;  2CPN A;  2HFS A;  4WUB A;  4FW9 A;  4KHP E;  4LF5 I;  4UT4 A;  4DR3 E;  2UUA I;  4LTY A;  2VQF I;  3HUL A;  4JI5 I;  4USM A;  1N36 E;  4HXZ A;  1Y6Z A;  3HPZ A;  2LBS B;  3GON A;  2O1U A;  3AV0 A;  1XNQ I;  3WU5 A;  2L8T A;  1T4L B;  4LF4 E;  4DR4 I;  4M1K A;  2KHX A;  3T1Y E;  4OX9 E;  3HPS A;  5AE3 A;  1WUU A;  3ZZT A;  2DB2 A;  3VK6 A;  4IZK B;  1K47 A;  1T4O A;  3Q6M A;  1N33 I;  2HKJ A;  4BC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...