4DV1E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv1E02
2EZ6A 1I94I 1Z59A 4JI6E 5LMUI 1YYWA 1XNRE 1N32E 1QU6A 4DV2I 1YYOA 5LMNE 1IBLI 1HNXE 1MG7A 2Q2EB 4JI1I 2IHR1 3WU3A 1VISA 1UILA 4DR1I 4LF9E 2LBSB 1Z0BA 4GKKE 4JI7I 4X65I 1NHJA 5LL6R 1K47A 4JI4E 3LLHA 4JI5I 1WHQA 1S16A 1STUA 1WUUA 1FJGE 1WHNA 4JI2I 4DR3E 4UTGA 4LF8E 4LF6I 1H74A 3OTOE 4LFAE 5A2QC 4DV0E 1ZM3A 2X7IA 3H4LA 4B3RI 3J7Yp 4FN5A 3J80Q 2YT4A 4DV7I 4FWGA 4PU9A 4LF5E 2R42A 3J81C 1KTVA 2JVAA 1MX0A 1HR0E 3T1YE 4EMDA 4DR2I 1XHKA 4X66E 3D4JA 3HULA 2AJ4A 1S4EA 3ADIA 2VQEI 4X64I 1PIEA 2B7VA 4LFBE 1J26A 4DR6I 2XEXA 2V34A 1A6FA 5BR8E 2HK2A 2DIXA 1RREA 4USKA 5GMDA 1NHIA 2VQFI 4DPTA 4R1FA 4NXNE 1HNZE 4M30A 5L3JA 3ZKDA 1KIJA 4LFCI 5LMNI 4HXZA 4JI6I 2HFUA 4DV4E 2L3JA 1XMQI 1XNRI 1N32I 1XNQE 2ZITA 2HHHE 1HNXI 2NA2A 4DV3E 4HACA 2UXCI 4DKKA 5IT9Q 2RSMA 4JV5E 1Z0GA 2CZ9A 4NXME 4LF9I 4FW9A 4DPYA 4DUYE 2NUEA 4GKKI 1Z0EA 4DV6E 1ELOA 2VF3A 2KHXA 1ZM9A 2DEJA 3HTXA 4DXLA 4JI4I 4DUZE 1XMOE 1HNWE 2UXBE 3B8HA 4K0KI 3VYYA 2HKEA 4DR4I 3GONA 1FJGI 4DR3I 4LF8I 2LTRA 4LFAI 4RPFA 4WUBA 4HYMA 2UUAE 1X48A 1RQ0A 1FWKA 1U2RA 2E5LI 3C4TA 4LF7I 3VYXA 3B82A 1ZM4A 1UHZA 4JG4A 2L33A 1HR0I 3T1YI 4B3ME 1RR9A 4OOGC 1IBKE 3JAMQ 4JI3E 4ED4A 1DI2A 4I3HA 2A2CA 1QZRA 1ZXMA 1GQEA 4OX9E 4LFBI 1N33E 4DR5E 3T1HE 1ZBTA 2UUCE 2B3TB 1IBME 3LPSA 4AQYE 4B3TE 5FLXC 3PYDA 5BR8I 4DU8A 2L2KB 2LJHA 3J80C 4KHPE 4JYAE 4B3SI 4DV5E 4DR7E 1RC7A 2LJPA 2F4VE 1EI1A 2NPFA 2EFGA 4NXNI 3F0NA 4Z7CA 1HNZI 1FWLA 3M6AA 3J7AG 3Q1QA 5A2QQ 3ADLA 4P52A 4X62I 3ADGA 4HACB 1UEKA 5IWAE 2LUQA 1XNQI 2V8PA 1PVGA 2L3CA 3J81Q 2HHHI 2NUFA 1N34E 4YY3I 2UXDI 1N0UA 4DV3I 4LF4E 2HFSA 4JI0E 4NXMI 2RS7A 1J5EE 1NHHA 3K17A 4DUYI 4P7AA 4DV6I 3V5RA 4FWDA 3CWVA 3B78A 4PRXA 2L2NA 1Z5BA 4DV1E 1Z5CA 5IWAI 4DUZI 1MU5A 1H7SA 4B3RE 4WYQB 1Z5AA 2E1RA 2WW4A 1N36E 2RTXA 2OI2A 2UUAI 1NZ0A 2MDRA 4FWHA 1KKHA 4JI8E 2UU9E 4PRVA 3ZZ0A 2LRSA 2VQEE 4B3MI 1IBKI 4DR6E 2JY9A 4Z7YA 2UUBE 3LNUA 4USMA 3P1XA 1N33I 4DR5I 3T1HI 1Z0TA 2UUCI 3LTOA 1O0WA 2DB2A 1H72C 3OTOI 1IBMI 4DV0I 4AQYI 4GKJE 4B3TI 2DEIA 4DPUA 3QT7A 2ZM6E 4MYTA 2GS8A 4LF5I 4ZVIA 2J7KA 4JYAI 4DV5I 1Z0CA 4URLA 4DR7I 4M2ZA 2DMYA 3PYGA 1XMQE 1T4OA 1ZXNA 4M1KA 5CFFE 4X66I 1EKZA 4WUCA 3JAMC 1D6TA 1T4LB 4DU7A 1EA6A 2UXCE 1H73A 4UT4A 4DPXA 3QT8A 4YHHE 1N34I 2V2VA 4LF4I 4X8WA 1X47A 3QT5A 3V2UC 3PYFA 3QT6A 1FI4A 3ZM7A 4JI0I 1YYKA 4KQVA 2A2DA 1J5EI 2HK3A 1I94E 1OJ4A 2X36A 4K0KE 4DR4E 5LMUE 4DV2E 5FLXQ 4DV1I 3ZZUA 1IBLE 4DV4I 1Z0WA 2LUPB 4MYUA 2ZBKB 1N36I 2E5LE 4LF7E 4JI1E 4WFTA 4DR1E 3WU4A 4XTJA 4JI7E 3ADJA 4X65E 4JV5I 3J7AM 4JI8I 1ZM2A 2UU9I 2V2ZA 4JI5E 1H7UA 2B7TA 3K1JA 4WUDA 3PYEA 3ZKBA 3ZZTA 4JI2E 4LF6E 4HY1A 1XMOI 2UUBI 1HNWI 2UXBI 1Z0VA 1YZ9A 1PKPA 2R3VA 2BV3A 4DV7E 2RS6A 4GKJI 4B3SE 2ZM6I 3WU6A 2CPNA 4DR2E 2NUGA 2V2QA 5IT9C 4X62E 5GMEA 3WU5A 1DARA 2BM1A 2L2MA 1FNMA 4X64E 1X49A 4JI3I 1N0VC 4YY3E 3C4BA 1FKAE 2UXDE 4OX9I 1T4NA 2LTSA 4DPWA 2N3HA 1KVKA 4YHHI 2VQFE 2HKJA 1B62A 1BKNA 2BM0A 4KHPI 4LFCE 1B63A 2N3GA 2F4VI
chains in the Genus database with same CATH superfamily
2EMWA 2EZ6A 1I94I 2V83A 4MDTA 1Z59A 4JI6E 2EQ3A 1YYWA 1XNRE 5LMUI 1N32E 1JK1A 1QU6A 3OMLA 4DV2I 4FW3A 3ECRA 1YYOA 5LMNE 3PS3A 5C0XE 1ZR9A 1IBLI 4R2CA 1HNXE 2BA0D 2NN6C 1KJKA 1MG7A 2Q2EB 5DNYA 1LLMC 2EN1A 4BA2B 4HEIA 4JI1I 2IHR1 2DLQA 1DQ3A 3WU3A 1VISA 1WJPA 1UILA 3BGHA 2YTPA 4DR1I 2C37A 4LF9E 2LBSB 2C39A 1Z0BA 4LTYA 3VHTB 4GKKE 4JI7I 2K4VA 2EWLA 1IQOA 4X65I 1NHJA 5DRPA 5LL6R 2ENCA 4U3DA 3M99B 4JI4E 1K47A 3LLHA 2DRPA 3HJCA 4JI5I 2EM7A 4U3BA 1WHQA 1S16A 3Q6MA 1STUA 4WX9A 2WNRA 2MC6A 1YH8A 2Z5EA 5C0XB 4R8OA 1FJGE 1WUUA 2BR2B 2V88A 1WHNA 4JI2I 1X6FA 4DR3E 1RMDA 2GQ0A 4LF8E 4UTGA 2G7HA 4LF6I 1H74A 2O1UA 3OTOE 4LFAE 5A2QC 4DV0E 5K36B 2DLKA 2JOBA 1ZM3A 2X7IA 3H4LA 4B3RI 3CDJA 3J7Yp 4WXCA 2EQ0A 2N8XA 3EPHA 2GO3A 4FN5A 1BBOA 4MU4A 3L00A 3J80Q 2YT4A 2GLIA 2EL4A 3GCMA 4DV7I 4FWGA 2JEBB 1G2DC 4PU9A 4LF5E 2R42A 2BB8A 1L4SA 3HKMA 2EORA 5KL5A 3J81C 2BA1G 2IOQA 2YZTA 2PRTA 1NEIA 2ADRA 2HC5A 2JXPA 2K7IA 2JVAA 4LU9A 1KTVA 2CG9A 1MX0A 1HR0E 3T1YE 2J7JA 4EMDA 4DR2I 2WP8B 1PDAA 2R76A 3HPSA 1XHKA 3U1KA 4X66E 3BF2A 3D4JA 3HULA 4BA2A 2AJ4A 1ZU1A 3CDIA 1F2IG 1S4EA 3ADIA 2VQEI 2EOXA 2EOIA 4X64I 1PIEA 3M7ND 2B7VA 4LFBE 1EH6A 5DNLA 1J26A 2EOEA 2EM6A 1HK7A 4DR6I 2O3ZA 4IFDD 2JPAA 2XEXA 2V34A 4TUGA 2Z5CB 4N4RB 1A6FA 1OYSA 5BR8E 4R2QA 2EPAA 1USVA 2PNLA 3NZKA 2HK2A 2M4IA 5JEAF 2DIXA 1RREA 1Y5YA 1OYRA 1YPNA 2BR2A 1MEYC 2NN6A 2PNZB 4USKA 3JTZA 2BBGA 5GMDA 2YRMA 1NHIA 2BA0G 2VQFI 4DPTA 4R1FA 5K36A 4R2DA 4FK5C 4NXNE 2EN4A 2ELZA 5KL3A 1HNZE 4M30A 5L3JA 2Q8UA 4ZYHA 5KL7A 4X9JA 3ZKDA 2EPZA 3DF6A 2JEBA 1KIJA 4LFCI 4I8OA 5LMNI 4HXZA 3M85D 2YRKA 4F6MA 2EMAA 2HFUA 2PO2B 4JI6I 4DV4E 2L3JA 2EMYA 1A1FA 4FW5A 1XMQI 1XNRI 1N32I 4WSPA 4R03A 1XNQE 2JWOA 2EMCA 2WP8A 2EMZA 2C37B 2ZITA 2C38B 5DRRA 2HHHE 1HNXI 2GO4A 4OZEA 2NA2A 4DV3E 4F6NA 4HACA 2UXCI 4DKKA 5IT9Q 1R6MA 2RSMA 3K6QA 3MSWA 4JV5E 1Z0GA 2CZ9A 4NXME 2PO1A 4LF9I 4FW9A 4DPYA 4DUYE 2NUEA 2YRHA 4FW7A 4GKKI 1Z0EA 4DV6E 3PS1A 1ELOA 2VF3A 2KHXA 3IWDA 2I9IA 1ZM9A 2EP3A 2GPIA 3HTXA 2DEJA 1A1GA 4DXLA 4JI4I 3PRYA 2EOZA 5A6BA 2PNZA 2EOFA 4RHBB 5AE3A 2WZOA 2JP9A 2NN6F 4DUZE 1XMOE 1HNWE 2EPRA 3DJWA 1A1LA 2UXBE 1XXEA 2B9DA 3B8HA 4LCHA 4K0KI 3VYYA 2HKEA 2RPCA 4DR4I 3GONA 4OO1C 4AIMA 4OO1D 2ELYA 3HPZA 4DR3I 1FJGI 5K36F 4FW6A 4LF8I 2EOYA 2LTRA 2EOHA 1AAYA 4LFAI 4RPFA 4MU3A 2F1DA 2NN6E 4WUBA 3GLLA 2WBSA 4HYMA 2R1FA 2UUAE 4IZJD 4MU0A 2M1SA 1X48A 2PO2A 1RQ0A 2CSHA 1FWKA 2YU8A 1U2RA 2E5LI 3C4TA 4LF7I 5K36E 4NHRA 4BCAA 3VYXA 3B82A 1ZM4A 1GTKA 1YHCA 2C38A 3H1CA 1EH8A 1UHZA 4JG4A 4IZKB 4KWYA 2L33A 3KWRA 1HR0I 2ENAA 5DROA 3T1YI 4O4KA 4B3ME 2ODRC 4J8ZA 1RR9A 2ODRD 2YSOA 3BBGA 4OOGC 4BMJA 1IBKE 3P3GA 3JAMQ 4JI3E 4ED4A 3U1YA 1DI2A 4ISAA 2O1WA 2CT1A 4N3OA 4I3HA 5ELWA 2A2CA 5C0XD 1QZRA 1ZXMA 2IERA 1GQEA 4OX9E 1IQSA 2E72A 3MHHC 1N33E 2NN6B 2YU5A 4LFBI 4DR5E 3T1HE 1ZBTA 2UUCE 2VESA 2B3TB 2YTEA 1BBGA 1IBME 2RQLA 3LPSA 4AQYE 1A1JA 2J65A 2JE6B 4B3TE 2V87A 5FLXC 3PYDA 5BR8I 4DU8A 1Y60A 2IESA 4BHBA 2F8BA 2L2KB 2LJHA 3J80C 3RMPA 3P3CA 4MLVA 4L8NA 5EL9A 3KZYA 4KHPE 4JYAE 1X3CA 2EPNA 4O5GA 4DV5E 4B3SI 4DR7E 1RC7A 4LFCE 2F4VE 1EI1A 2LJPA 2EFGA 4O43A 2NPFA 2EM8A 4NXNI 3THNA 2WCC3 3F0NA 4Z7CA 1HNZI 1FWLA 1WXRA 2EN8A 3M6AA 3J7AG 3Q1QA 1TN9A 5A2QQ 2EMIA 5KL4A 3ADLA 4P52A 4X62I 3ADGA 3GMEA 1EH7A 2EN6A 2PO0B 2EPOA 4HACB 1UEKA 2CGEA 4LCFA 4WPYA 5TSEA 2LT7A 4IZKA 2LUQA 1XNQI 2V8PA 1PVGA 3M85G 4IS9A 1AH5A 1UDSA 4OO1A 2PO1B 4IFDC 2L3CA 3J81Q 5LLQA 2HHHI 2NUFA 1N34E 3AV0A 4YY3I 2UXDI 1N0UA 2MKNA 4DV3I 4LF4E 1X6HA 3C6MA 2HFSA 1RHYA 2FTXB 4R2SA 1YFHA 2DGCA 4JI0E 2YTFA 2Z5CA 4NXMI 5EKWA 3HXLA 1P42A 2RS7A 2LO3A 2YTNA 1J5EE 1NHHA 4F9CB 3K17A 2JE6A 4P7AA 2EMBA 4DUYI 4DMIA 3B4TA 2CVEA 2JT2A 4DV6I 4BC7A 1ZBQA 2YTGA 2V89A 2O1VA 3V5RA 4FWDA 2L8TA 3B78A 3CWVA 4PRXA 2L2NA 2PNMA 2EOQA 4R2PA 1Z5BA 1G2FC 3Q6NA 4DV1E 1Z5CA 5IWAI 2JYAA 1DGCA 1ZAAC 1MU5A 1UDOA 4DUZI 2CTDA 4IFDB 1H7SA 4B3RE 2A25A 4GQUA 2D9HA 2H36X 4WYQB 1TF6A 1Z5AA 2EPMX 2V85A 2EJ4A 1UBDC 2E1RA 1N36E 2WW4A 4BA1A 2RTXA 2OI2A 4NBQA 2UUAI 2NABA 1NZ0A 2PO0A 4AM3A 2V86A 2MDRA 2HGHA 4FWHA 4QNJA 2EPUA 5JEAC 1KKHA 2LE2A 5JEAD 5KL6A 4JI8E 2UU9E 4PRVA 3PS2A 3ZZ0A 2EN7A 3IWCA 2LRSA 2VQEE 4BBYA 1X5WA 4LOMA 2EPKX 4B3MI 5DNXA 1IBKI 5T6JA 2VE7C 3UHMA 4Q35B 4DR6E 2JY9A 4Z7YA 2UUBE 3P3EA 3LNUA 1UN6B 4USMA 2EOSA 4ZYDA 3P1XA 1N33I 3ZOQB 4DR5I 3T1HI 1Z0TA 2UUCI 3LTOA 1O0WA 2DB2A 1H72C 3OTOI 1IBMI 2EM4A 2EOMA 5A6KA 4MU1A 4GKJE 4DV0I 4AQYI 4B3TI 2DEIA 2MC5A 3M7NG 1MGTA 1T38A 4IFDA 4DPUA 3QT7A 2ZM6E 3P76A 2RSIA 5AE1A 4MYTA 2EM5A 2EM2A 2DMIA 3IWBA 2ENHA 4BHCA 4ZYEA 2GS8A 4O24A 1PJSA 1KYQA 2J7KA 4ZVIA 4DV5I 4LF5I 4JYAI 2EOOA 1Z0CA 4URLA 4DR7I 2EE8A 4M2ZA 2DMYA 3PYGA 4M9VC 2EMFA 2L6MA 2YTJA 4WXDA 2EN3A 1XMQE 5AC4A 1BB8A 4OO1B 1T4OA 1A1KA 1ZXNA 4M1KA 5CFFE 4X66I 1EKZA 1JK2A 2V8QB 1USUA 3C6KA 2LJUA 4WUCA 3JAMC 1D6TA 2KOUA 2VF1A 1T4LB 5C0XC 4DU7A 1EA6A 1PJTA 3BIDA 1QNTA 2UXCE 1H73A 2NN6D 4UT4A 4P7DA 5IV8B 2IOPA 4IZJB 1NCSA 2EOJA 1SR9A 2EM0A 2FV4B 2YTOA 1PJQA 3EQ1A 2KONA 3LMLA 4WSGA 3EPJA 3QT8A 2HJJA 2M9AA 4YHHE 1N34I 5K36C 4QNKA 5K36D 2V2VA 2EL6A 2EMGA 4LF4I 4MLQA 2EMKA 1X47A 4X8WA 4BS9A 3QT5A 5KL2A 4F54A 4GZNC 4R2RA 4NZVA 3V2UC 1FI4A 3PYFA 3QT6A 3ZM7A 2E1MA 4JI0I 3DD6A 1YYKA 4KQVA 1Y4SA 2A2DA 1J5EI 2HK3A 4M0VA 2EQ1A 2WBTA 5JEAA 4R2AA 1I94E 1OJ4A 2X36A 2YWQA 1E3PA 4K0KE 2EMXA 2YTQA 2FGGA 5AC5A 5LMUE 4DR4E 4BA1B 4IFDF 2LV2A 1SFEA 2YTIA 4TUIA 4DV2E 5FLXQ 4DV1I 2EMLA 1B69A 1YUJA 3ZZUA 1IBLE 5A69A 2EPPA 4DV4I 4IJDA 3L7ZB 1Z0WA 5DRQA 3THOB 2LUPB 2VRDA 4MYUA 2EM9A 2LVHA 2WBUA 2E5LE 4LF7E 2ZBKB 1N36I 4IFDE 3F6HA 4JI1E 5A6AA 1IMUA 4L5NC 4RH8A 1YUIA 3P06A 4WFTA 4DR1E 1A1HA 3WU4A 4XTJA 1T39A 4MQYA 2EPCA 4IS1C 4JI7E 3ADJA 2LCEA 4F2JC 2EMHA 5F3WA 1Y4UA 2EN2A 5A6BD 4X65E 5FWKA 4GEQB 4JV5I 3J7AM 4IZJA 3EPLA 4JI8I 4OKGA 1ZM2A 3JU0A 2UU9I 1Z1BA 3HQ1A 2V2ZA 4JI5E 2JR1A 3UK3C 2B7TA 5AASA 1H7UA 3K1JA 4LPFA 1YSAC 4F9AB 3PYEA 4WUDA 3ZKBA 3ZZTA 3VK6A 4JI2E 3KRNA 4LF6E 2JEAB 3H09A 1WRJA 4HTGA 4HY1A 1E3HA 2L92A 1XMOI 3QG5C 1VI7A 2O1TA 3AUZA 5ADZA 2UUBI 1Z0VA 1HNWI 2UXBI 3EPKA 2GHFA 1YZ9A 1PKPA 2R3VA 4FW4A 2BV3A 2Z5BB 5C0XA 1UDNA 4DV7E 1N3GA 2RS6A 4GKJI 4B3SE 5A6JA 4R2EA 2ZM6I 1X6EA 1Y6ZA 3WU6A 2CPNA 2YSPA 5JEAE 3L7ZA 4DR2E 2NUGA 2V2QA 5IT9C 4X62E 1UDQA 1GZ6A 5GMEA 4F9BB 3WU5A 1DARA 4BC9A 2BM1A 1R6LA 1P47A 1A1IA 3K85A 4OO1F 2JOXA 2L2MA 4J3DA 1FNMA 3FIGA 4X64E 1OYPA 4AIDA 2YPNA 1X49A 4JI3I 2C39B 1N0VC 2EL5A 4YY3E 4OO1E 3C4BA 1FKAE 4KZSA 2UXDE 4OX9I 1T4NA 2LTSA 3KZZA 2BA1D 2YTDA 4DPXA 2AE8A 2I13A 2LMZA 2N3HA 4DPWA 4ZYGA 1KVKA 4YHHI 2JEAA 2VQFE 5JEAB 3TQMA 2MDGA 2HKJA 2DSYA 1B62A 1BKNA 2WNRB 5AE2A 2BM0A 3F6GA 4Q28A 2Z5BA 2EPLX 3MHSC 2EM3A 4LCGA 2EPXA 1TF3A 2MKDA 5C0XF 2M7QA 4KHPI 5IWAE 1B63A 2N3GA 5IXMB 2F4VI 4P78A
chains in the Genus database with same CATH topology
2EZ6A 1I94I 2V83A 1Z59A 4JI6E 5LMUI 1YYWA 1XNRE 1N32E 1QU6A 3OMLA 4DV2I 1YYOA 1IBLI 1HNXE 1MG7A 2Q2EB 5DNYA 4JI1I 2IHR1 1DQ3A 3WU3A 1VISA 1UILA 4DR1I 4LF9E 2LBSB 1Z0BA 4LTYA 4GKKE 4JI7I 2K4VA 2EWLA 4X65I 1NHJA 5LL6R 1K47A 4JI4E 3LLHA 3HJCA 4JI5I 1WHQA 1S16A 3Q6MA 1STUA 2Z5EA 2MC6A 4R8OA 1FJGE 1WUUA 2V88A 1WHNA 4JI2I 4DR3E 2GQ0A 4UTGA 4LF8E 4LF6I 2G7HA 1H74A 2O1UA 3OTOE 4LFAE 5A2QC 4DV0E 2JOBA 1ZM3A 2X7IA 3H4LA 4B3RI 3J7Yp 4FN5A 3J80Q 2YT4A 4DV7I 4FWGA 4PU9A 4LF5E 2R42A 2IOQA 3J81C 2YZTA 1KTVA 4LU9A 2CG9A 2JVAA 1MX0A 1HR0E 3T1YE 4EMDA 4DR2I 3HPSA 1XHKA 4X66E 3D4JA 3HULA 2AJ4A 1S4EA 3ADIA 2VQEI 4X64I 1PIEA 2B7VA 4LFBE 1J26A 4DR6I 1HK7A 2XEXA 2V34A 4TUGA 1A6FA 5BR8E 1USVA 2PNLA 2HK2A 2M4IA 2DIXA 1RREA 4USKA 3JTZA 5GMDA 1NHIA 2VQFI 4DPTA 4R1FA 4NXNE 1HNZE 4M30A 5L3JA 3ZKDA 3DF6A 1KIJA 4LFCI 4I8OA 5LMNI 4HXZA 4JI6I 2HFUA 4DV4E 2L3JA 1XMQI 1XNRI 1N32I 4WSPA 4R03A 1XNQE 2JWOA 2ZITA 2HHHE 1HNXI 2NA2A 4DV3E 4HACA 2UXCI 4DKKA 5IT9Q 2RSMA 3K6QA 3MSWA 4JV5E 1Z0GA 2CZ9A 4NXME 4LF9I 4FW9A 4DPYA 4DUYE 2NUEA 4GKKI 1Z0EA 4DV6E 1ELOA 2VF3A 2KHXA 3IWDA 1ZM9A 2DEJA 3HTXA 4DXLA 4JI4I 3PRYA 5AE3A 2WZOA 4DUZE 1XMOE 1HNWE 3DJWA 2UXBE 2B9DA 3B8HA 4K0KI 3VYYA 2HKEA 4DR4I 3GONA 1FJGI 3HPZA 4DR3I 4LF8I 2LTRA 4LFAI 4RPFA 4WUBA 4HYMA 2UUAE 4IZJD 2M1SA 1X48A 1RQ0A 1FWKA 1U2RA 2E5LI 3C4TA 4LF7I 4BCAA 3VYXA 3B82A 1ZM4A 1UHZA 4JG4A 4IZKB 2L33A 3KWRA 1HR0I 3T1YI 4B3ME 2ODRC 4J8ZA 1RR9A 2ODRD 4OOGC 1IBKE 4BMJA 3JAMQ 4JI3E 4ED4A 1DI2A 2O1WA 4N3OA 4I3HA 2A2CA 1QZRA 1ZXMA 1GQEA 4OX9E 4LFBI 1N33E 4DR5E 3T1HE 1ZBTA 2UUCE 2B3TB 1IBME 3LPSA 4AQYE 4B3TE 2V87A 5FLXC 3PYDA 5BR8I 4DU8A 2F8BA 2L2KB 2LJHA 3J80C 3RMPA 4L8NA 4KHPE 4JYAE 4B3SI 4DV5E 4DR7E 1RC7A 2F4VE 2LJPA 1EI1A 2NPFA 2EFGA 4NXNI 3F0NA 4Z7CA 1HNZI 1FWLA 1WXRA 2N3GA 3M6AA 3J7AG 3Q1QA 5A2QQ 3ADLA 4P52A 4X62I 3ADGA 4HACB 1UEKA 2CGEA 4WPYA 5IWAE 4IZKA 2LUQA 1XNQI 2V8PA 1PVGA 2L3CA 3J81Q 2HHHI 2NUFA 1N34E 3AV0A 4YY3I 2UXDI 1N0UA 4DV3I 4LF4E 2HFSA 2FTXB 4JI0E 2Z5CA 4NXMI 3HXLA 2RS7A 1J5EE 1NHHA 3K17A 4F9CB 4DUYI 4P7AA 4DMIA 4DV6I 4BC7A 1ZBQA 2V89A 2O1VA 3V5RA 4FWDA 2L8TA 3B78A 3CWVA 4PRXA 2L2NA 2PNMA 1Z5BA 3Q6NA 4DV1E 1Z5CA 5IWAI 4DUZI 1MU5A 1H7SA 4B3RE 2H36X 4WYQB 1Z5AA 2V85A 2E1RA 2WW4A 1N36E 2RTXA 2OI2A 2UUAI 1NZ0A 2V86A 2MDRA 4FWHA 1KKHA 2LE2A 4JI8E 2UU9E 4PRVA 3ZZ0A 3IWCA 2LRSA 2VQEE 4BBYA 4B3MI 1IBKI 5T6JA 2VE7C 4DR6E 2JY9A 4Z7YA 2UUBE 3LNUA 4USMA 3P1XA 1N33I 3ZOQB 4DR5I 3T1HI 1Z0TA 2UUCI 3LTOA 1O0WA 2DB2A 1H72C 3OTOI 1IBMI 4DV0I 4AQYI 4GKJE 4B3TI 2DEIA 2MC5A 4DPUA 3QT7A 2ZM6E 5AE1A 4MYTA 3IWBA 2GS8A 4LF5I 4ZVIA 2J7KA 4JYAI 4DV5I 1Z0CA 4URLA 4DR7I 4M2ZA 2DMYA 3PYGA 2L6MA 1XMQE 1T4OA 1ZXNA 4M1KA 5CFFE 4X66I 1EKZA 2V8QB 1USUA 4WUCA 3JAMC 1D6TA 2KOUA 2VF1A 1T4LB 4DU7A 1EA6A 2UXCE 1H73A 4UT4A 4P7DA 2IOPA 4IZJB 2FV4B 4DPXA 1SR9A 3LMLA 2Z5CB 2KONA 3QT8A 4YHHE 1N34I 2V2VA 4LF4I 4X8WA 1X47A 4BS9A 3QT5A 3V2UC 4F54A 1FI4A 3PYFA 3QT6A 3ZM7A 2E1MA 4JI0I 1YYKA 4KQVA 1Y4SA 2A2DA 1J5EI 2HK3A 4M0VA 1I94E 1OJ4A 2X36A 4K0KE 4DR4E 2FGGA 5LMUE 4TUIA 4DV2E 5FLXQ 4DV1I 3ZZUA 1IBLE 4DV4I 1Z0WA 2LUPB 4MYUA 2ZBKB 1N36I 2E5LE 4LF7E 3F6HA 4JI1E 3P06A 4L5NC 4WFTA 4DR1E 3WU4A 4XTJA 4JI7E 3ADJA 5FWKA 5F3WA 1Y4UA 4X65E 4GEQB 4JV5I 3J7AM 4IZJA 4JI8I 1ZM2A 3JU0A 2UU9I 3HQ1A 2V2ZA 4JI5E 2JR1A 1H7UA 2B7TA 5AASA 3K1JA 4F9AB 3PYEA 4WUDA 3ZKBA 3ZZTA 3VK6A 4JI2E 4LF6E 3H09A 4HY1A 2L92A 1XMOI 2O1TA 2UUBI 3AUZA 5ADZA 1HNWI 1Z0VA 2UXBI 1YZ9A 1PKPA 2R3VA 2BV3A 2Z5BB 4DV7E 2RS6A 4GKJI 4B3SE 2ZM6I 1Y6ZA 3WU6A 2CPNA 4DR2E 2NUGA 2V2QA 5IT9C 4X62E 1GZ6A 5GMEA 4F9BB 3WU5A 1DARA 4BC9A 2BM1A 3K85A 2JOXA 2L2MA 1FNMA 3FIGA 4X64E 1X49A 4JI3I 1N0VC 4YY3E 3C4BA 1FKAE 4KZSA 2UXDE 4OX9I 1T4NA 2LTSA 2LMZA 2N3HA 4DPWA 1KVKA 4YHHI 2VQFE 2HKJA 2DSYA 1B62A 1BKNA 5AE2A 2BM0A 3F6GA 4Q28A 2Z5BA 4KHPI 2M7QA 4LFCE 1B63A 5LMNE 2F4VI 4P78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZ6 A;  1I94 I;  1Z59 A;  4JI6 E;  5LMU I;  1YYW A;  1XNR E;  1N32 E;  1QU6 A;  4DV2 I;  1YYO A;  5LMN E;  1IBL I;  1HNX E;  1MG7 A;  2Q2E B;  4JI1 I;  2IHR 1;  3WU3 A;  1VIS A;  1UIL A;  4DR1 I;  4LF9 E;  2LBS B;  1Z0B A;  4GKK E;  4JI7 I;  4X65 I;  1NHJ A;  5LL6 R;  1K47 A;  4JI4 E;  3LLH A;  4JI5 I;  1WHQ A;  1S16 A;  1STU A;  1WUU A;  1FJG E;  1WHN A;  4JI2 I;  4DR3 E;  4UTG A;  4LF8 E;  4LF6 I;  1H74 A;  3OTO E;  4LFA E;  5A2Q C;  4DV0 E;  1ZM3 A;  2X7I A;  3H4L A;  4B3R I;  3J7Y p;  4FN5 A;  3J80 Q;  2YT4 A;  4DV7 I;  4FWG A;  4PU9 A;  4LF5 E;  2R42 A;  3J81 C;  1KTV A;  2JVA A;  1MX0 A;  1HR0 E;  3T1Y E;  4EMD A;  4DR2 I;  1XHK A;  4X66 E;  3D4J A;  3HUL A;  2AJ4 A;  1S4E A;  3ADI A;  2VQE I;  4X64 I;  1PIE A;  2B7V A;  4LFB E;  1J26 A;  4DR6 I;  2XEX A;  2V34 A;  1A6F A;  5BR8 E;  2HK2 A;  2DIX A;  1RRE A;  4USK A;  5GMD A;  1NHI A;  2VQF I;  4DPT A;  4R1F A;  4NXN E;  1HNZ E;  4M30 A;  5L3J A;  3ZKD A;  1KIJ A;  4LFC I;  5LMN I;  4HXZ A;  4JI6 I;  2HFU A;  4DV4 E;  2L3J A;  1XMQ I;  1XNR I;  1N32 I;  1XNQ E;  2ZIT A;  2HHH E;  1HNX I;  2NA2 A;  4DV3 E;  4HAC A;  2UXC I;  4DKK A;  5IT9 Q;  2RSM A;  4JV5 E;  1Z0G A;  2CZ9 A;  4NXM E;  4LF9 I;  4FW9 A;  4DPY A;  4DUY E;  2NUE A;  4GKK I;  1Z0E A;  4DV6 E;  1ELO A;  2VF3 A;  2KHX A;  1ZM9 A;  2DEJ A;  3HTX A;  4DXL A;  4JI4 I;  4DUZ E;  1XMO E;  1HNW E;  2UXB E;  3B8H A;  4K0K I;  3VYY A;  2HKE A;  4DR4 I;  3GON A;  1FJG I;  4DR3 I;  4LF8 I;  2LTR A;  4LFA I;  4RPF A;  4WUB A;  4HYM A;  2UUA E;  1X48 A;  1RQ0 A;  1FWK A;  1U2R A;  2E5L I;  3C4T A;  4LF7 I;  3VYX A;  3B82 A;  1ZM4 A;  1UHZ A;  4JG4 A;  2L33 A;  1HR0 I;  3T1Y I;  4B3M E;  1RR9 A;  4OOG C;  1IBK E;  3JAM Q;  4JI3 E;  4ED4 A;  1DI2 A;  4I3H A;  2A2C A;  1QZR A;  1ZXM A;  1GQE A;  4OX9 E;  4LFB I;  1N33 E;  4DR5 E;  3T1H E;  1ZBT A;  2UUC E;  2B3T B;  1IBM E;  3LPS A;  4AQY E;  4B3T E;  5FLX C;  3PYD A;  5BR8 I;  4DU8 A;  2L2K B;  2LJH A;  3J80 C;  4KHP E;  4JYA E;  4B3S I;  4DV5 E;  4DR7 E;  1RC7 A;  2LJP A;  2F4V E;  1EI1 A;  2NPF A;  2EFG A;  4NXN I;  3F0N A;  4Z7C A;  1HNZ I;  1FWL A;  3M6A A;  3J7A G;  3Q1Q A;  5A2Q Q;  3ADL A;  4P52 A;  4X62 I;  3ADG A;  4HAC B;  1UEK A;  5IWA E;  2LUQ A;  1XNQ I;  2V8P A;  1PVG A;  2L3C A;  3J81 Q;  2HHH I;  2NUF A;  1N34 E;  4YY3 I;  2UXD I;  1N0U A;  4DV3 I;  4LF4 E;  2HFS A;  4JI0 E;  4NXM I;  2RS7 A;  1J5E E;  1NHH A;  3K17 A;  4DUY I;  4P7A A;  4DV6 I;  3V5R A;  4FWD A;  3CWV A;  3B78 A;  4PRX A;  2L2N A;  1Z5B A;  4DV1 E;  1Z5C A;  5IWA I;  4DUZ I;  1MU5 A;  1H7S A;  4B3R E;  4WYQ B;  1Z5A A;  2E1R A;  2WW4 A;  1N36 E;  2RTX A;  2OI2 A;  2UUA I;  1NZ0 A;  2MDR A;  4FWH A;  1KKH A;  4JI8 E;  2UU9 E;  4PRV A;  3ZZ0 A;  2LRS A;  2VQE E;  4B3M I;  1IBK I;  4DR6 E;  2JY9 A;  4Z7Y A;  2UUB E;  3LNU A;  4USM A;  3P1X A;  1N33 I;  4DR5 I;  3T1H I;  1Z0T A;  2UUC I;  3LTO A;  1O0W A;  2DB2 A;  1H72 C;  3OTO I;  1IBM I;  4DV0 I;  4AQY I;  4GKJ E;  4B3T I;  2DEI A;  4DPU A;  3QT7 A;  2ZM6 E;  4MYT A;  2GS8 A;  4LF5 I;  4ZVI A;  2J7K A;  4JYA I;  4DV5 I;  1Z0C A;  4URL A;  4DR7 I;  4M2Z A;  2DMY A;  3PYG A;  1XMQ E;  1T4O A;  1ZXN A;  4M1K A;  5CFF E;  4X66 I;  1EKZ A;  4WUC A;  3JAM C;  1D6T A;  1T4L B;  4DU7 A;  1EA6 A;  2UXC E;  1H73 A;  4UT4 A;  4DPX A;  3QT8 A;  4YHH E;  1N34 I;  2V2V A;  4LF4 I;  4X8W A;  1X47 A;  3QT5 A;  3V2U C;  3PYF A;  3QT6 A;  1FI4 A;  3ZM7 A;  4JI0 I;  1YYK A;  4KQV A;  2A2D A;  1J5E I;  2HK3 A;  1I94 E;  1OJ4 A;  2X36 A;  4K0K E;  4DR4 E;  5LMU E;  4DV2 E;  5FLX Q;  4DV1 I;  3ZZU A;  1IBL E;  4DV4 I;  1Z0W A;  2LUP B;  4MYU A;  2ZBK B;  1N36 I;  2E5L E;  4LF7 E;  4JI1 E;  4WFT A;  4DR1 E;  3WU4 A;  4XTJ A;  4JI7 E;  3ADJ A;  4X65 E;  4JV5 I;  3J7A M;  4JI8 I;  1ZM2 A;  2UU9 I;  2V2Z A;  4JI5 E;  1H7U A;  2B7T A;  3K1J A;  4WUD A;  3PYE A;  3ZKB A;  3ZZT A;  4JI2 E;  4LF6 E;  4HY1 A;  1XMO I;  2UUB I;  1HNW I;  2UXB I;  1Z0V A;  1YZ9 A;  1PKP A;  2R3V A;  2BV3 A;  4DV7 E;  2RS6 A;  4GKJ I;  4B3S E;  2ZM6 I;  3WU6 A;  2CPN A;  4DR2 E;  2NUG A;  2V2Q A;  5IT9 C;  4X62 E;  5GME A;  3WU5 A;  1DAR A;  2BM1 A;  2L2M A;  1FNM A;  4X64 E;  1X49 A;  4JI3 I;  1N0V C;  4YY3 E;  3C4B A;  1FKA E;  2UXD E;  4OX9 I;  1T4N A;  2LTS A;  4DPW A;  2N3H A;  1KVK A;  4YHH I;  2VQF E;  2HKJ A;  1B62 A;  1BKN A;  2BM0 A;  4KHP I;  4LFC E;  1B63 A;  2N3G A;  2F4V I; 
#chains in the Genus database with same CATH topology
 2EMW A;  2EZ6 A;  1I94 I;  2V83 A;  4MDT A;  1Z59 A;  4JI6 E;  2EQ3 A;  1YYW A;  1XNR E;  5LMU I;  1N32 E;  1JK1 A;  1QU6 A;  3OML A;  4DV2 I;  4FW3 A;  3ECR A;  1YYO A;  5LMN E;  3PS3 A;  5C0X E;  1ZR9 A;  1IBL I;  4R2C A;  1HNX E;  2BA0 D;  2NN6 C;  1KJK A;  1MG7 A;  2Q2E B;  5DNY A;  1LLM C;  2EN1 A;  4BA2 B;  4HEI A;  4JI1 I;  2IHR 1;  2DLQ A;  1DQ3 A;  3WU3 A;  1VIS A;  1WJP A;  1UIL A;  3BGH A;  2YTP A;  4DR1 I;  2C37 A;  4LF9 E;  2LBS B;  2C39 A;  1Z0B A;  4LTY A;  3VHT B;  4GKK E;  4JI7 I;  2K4V A;  2EWL A;  1IQO A;  4X65 I;  1NHJ A;  5DRP A;  5LL6 R;  2ENC A;  4U3D A;  3M99 B;  4JI4 E;  1K47 A;  3LLH A;  2DRP A;  3HJC A;  4JI5 I;  2EM7 A;  4U3B A;  1WHQ A;  1S16 A;  3Q6M A;  1STU A;  4WX9 A;  2WNR A;  2MC6 A;  1YH8 A;  2Z5E A;  5C0X B;  4R8O A;  1FJG E;  1WUU A;  2BR2 B;  2V88 A;  1WHN A;  4JI2 I;  1X6F A;  4DR3 E;  1RMD A;  2GQ0 A;  4LF8 E;  4UTG A;  2G7H A;  4LF6 I;  1H74 A;  2O1U A;  3OTO E;  4LFA E;  5A2Q C;  4DV0 E;  5K36 B;  2DLK A;  2JOB A;  1ZM3 A;  2X7I A;  3H4L A;  4B3R I;  3CDJ A;  3J7Y p;  4WXC A;  2EQ0 A;  2N8X A;  3EPH A;  2GO3 A;  4FN5 A;  1BBO A;  4MU4 A;  3L00 A;  3J80 Q;  2YT4 A;  2GLI A;  2EL4 A;  3GCM A;  4DV7 I;  4FWG A;  2JEB B;  1G2D C;  4PU9 A;  4LF5 E;  2R42 A;  2BB8 A;  1L4S A;  3HKM A;  2EOR A;  5KL5 A;  3J81 C;  2BA1 G;  2IOQ A;  2YZT A;  2PRT A;  1NEI A;  2ADR A;  2HC5 A;  2JXP A;  2K7I A;  2JVA A;  4LU9 A;  1KTV A;  2CG9 A;  1MX0 A;  1HR0 E;  3T1Y E;  2J7J A;  4EMD A;  4DR2 I;  2WP8 B;  1PDA A;  2R76 A;  3HPS A;  1XHK A;  3U1K A;  4X66 E;  3BF2 A;  3D4J A;  3HUL A;  4BA2 A;  2AJ4 A;  1ZU1 A;  3CDI A;  1F2I G;  1S4E A;  3ADI A;  2VQE I;  2EOX A;  2EOI A;  4X64 I;  1PIE A;  3M7N D;  2B7V A;  4LFB E;  1EH6 A;  5DNL A;  1J26 A;  2EOE A;  2EM6 A;  1HK7 A;  4DR6 I;  2O3Z A;  4IFD D;  2JPA A;  2XEX A;  2V34 A;  4TUG A;  2Z5C B;  4N4R B;  1A6F A;  1OYS A;  5BR8 E;  4R2Q A;  2EPA A;  1USV A;  2PNL A;  3NZK A;  2HK2 A;  2M4I A;  5JEA F;  2DIX A;  1RRE A;  1Y5Y A;  1OYR A;  1YPN A;  2BR2 A;  1MEY C;  2NN6 A;  2PNZ B;  4USK A;  3JTZ A;  2BBG A;  5GMD A;  2YRM A;  1NHI A;  2BA0 G;  2VQF I;  4DPT A;  4R1F A;  5K36 A;  4R2D A;  4FK5 C;  4NXN E;  2EN4 A;  2ELZ A;  5KL3 A;  1HNZ E;  4M30 A;  5L3J A;  2Q8U A;  4ZYH A;  5KL7 A;  4X9J A;  3ZKD A;  2EPZ A;  3DF6 A;  2JEB A;  1KIJ A;  4LFC I;  4I8O A;  5LMN I;  4HXZ A;  3M85 D;  2YRK A;  4F6M A;  2EMA A;  2HFU A;  2PO2 B;  4JI6 I;  4DV4 E;  2L3J A;  2EMY A;  1A1F A;  4FW5 A;  1XMQ I;  1XNR I;  1N32 I;  4WSP A;  4R03 A;  1XNQ E;  2JWO A;  2EMC A;  2WP8 A;  2EMZ A;  2C37 B;  2ZIT A;  2C38 B;  5DRR A;  2HHH E;  1HNX I;  2GO4 A;  4OZE A;  2NA2 A;  4DV3 E;  4F6N A;  4HAC A;  2UXC I;  4DKK A;  5IT9 Q;  1R6M A;  2RSM A;  3K6Q A;  3MSW A;  4JV5 E;  1Z0G A;  2CZ9 A;  4NXM E;  2PO1 A;  4LF9 I;  4FW9 A;  4DPY A;  4DUY E;  2NUE A;  2YRH A;  4FW7 A;  4GKK I;  1Z0E A;  4DV6 E;  3PS1 A;  1ELO A;  2VF3 A;  2KHX A;  3IWD A;  2I9I A;  1ZM9 A;  2EP3 A;  2GPI A;  3HTX A;  2DEJ A;  1A1G A;  4DXL A;  4JI4 I;  3PRY A;  2EOZ A;  5A6B A;  2PNZ A;  2EOF A;  4RHB B;  5AE3 A;  2WZO A;  2JP9 A;  2NN6 F;  4DUZ E;  1XMO E;  1HNW E;  2EPR A;  3DJW A;  1A1L A;  2UXB E;  1XXE A;  2B9D A;  3B8H A;  4LCH A;  4K0K I;  3VYY A;  2HKE A;  2RPC A;  4DR4 I;  3GON A;  4OO1 C;  4AIM A;  4OO1 D;  2ELY A;  3HPZ A;  4DR3 I;  1FJG I;  5K36 F;  4FW6 A;  4LF8 I;  2EOY A;  2LTR A;  2EOH A;  1AAY A;  4LFA I;  4RPF A;  4MU3 A;  2F1D A;  2NN6 E;  4WUB A;  3GLL A;  2WBS A;  4HYM A;  2R1F A;  2UUA E;  4IZJ D;  4MU0 A;  2M1S A;  1X48 A;  2PO2 A;  1RQ0 A;  2CSH A;  1FWK A;  2YU8 A;  1U2R A;  2E5L I;  3C4T A;  4LF7 I;  5K36 E;  4NHR A;  4BCA A;  3VYX A;  3B82 A;  1ZM4 A;  1GTK A;  1YHC A;  2C38 A;  3H1C A;  1EH8 A;  1UHZ A;  4JG4 A;  4IZK B;  4KWY A;  2L33 A;  3KWR A;  1HR0 I;  2ENA A;  5DRO A;  3T1Y I;  4O4K A;  4B3M E;  2ODR C;  4J8Z A;  1RR9 A;  2ODR D;  2YSO A;  3BBG A;  4OOG C;  4BMJ A;  1IBK E;  3P3G A;  3JAM Q;  4JI3 E;  4ED4 A;  3U1Y A;  1DI2 A;  4ISA A;  2O1W A;  2CT1 A;  4N3O A;  4I3H A;  5ELW A;  2A2C A;  5C0X D;  1QZR A;  1ZXM A;  2IER A;  1GQE A;  4OX9 E;  1IQS A;  2E72 A;  3MHH C;  1N33 E;  2NN6 B;  2YU5 A;  4LFB I;  4DR5 E;  3T1H E;  1ZBT A;  2UUC E;  2VES A;  2B3T B;  2YTE A;  1BBG A;  1IBM E;  2RQL A;  3LPS A;  4AQY E;  1A1J A;  2J65 A;  2JE6 B;  4B3T E;  2V87 A;  5FLX C;  3PYD A;  5BR8 I;  4DU8 A;  1Y60 A;  2IES A;  4BHB A;  2F8B A;  2L2K B;  2LJH A;  3J80 C;  3RMP A;  3P3C A;  4MLV A;  4L8N A;  5EL9 A;  3KZY A;  4KHP E;  4JYA E;  1X3C A;  2EPN A;  4O5G A;  4DV5 E;  4B3S I;  4DR7 E;  1RC7 A;  4LFC E;  2F4V E;  1EI1 A;  2LJP A;  2EFG A;  4O43 A;  2NPF A;  2EM8 A;  4NXN I;  3THN A;  2WCC 3;  3F0N A;  4Z7C A;  1HNZ I;  1FWL A;  1WXR A;  2EN8 A;  3M6A A;  3J7A G;  3Q1Q A;  1TN9 A;  5A2Q Q;  2EMI A;  5KL4 A;  3ADL A;  4P52 A;  4X62 I;  3ADG A;  3GME A;  1EH7 A;  2EN6 A;  2PO0 B;  2EPO A;  4HAC B;  1UEK A;  2CGE A;  4LCF A;  4WPY A;  5TSE A;  2LT7 A;  4IZK A;  2LUQ A;  1XNQ I;  2V8P A;  1PVG A;  3M85 G;  4IS9 A;  1AH5 A;  1UDS A;  4OO1 A;  2PO1 B;  4IFD C;  2L3C A;  3J81 Q;  5LLQ A;  2HHH I;  2NUF A;  1N34 E;  3AV0 A;  4YY3 I;  2UXD I;  1N0U A;  2MKN A;  4DV3 I;  4LF4 E;  1X6H A;  3C6M A;  2HFS A;  1RHY A;  2FTX B;  4R2S A;  1YFH A;  2DGC A;  4JI0 E;  2YTF A;  2Z5C A;  4NXM I;  5EKW A;  3HXL A;  1P42 A;  2RS7 A;  2LO3 A;  2YTN A;  1J5E E;  1NHH A;  4F9C B;  3K17 A;  2JE6 A;  4P7A A;  2EMB A;  4DUY I;  4DMI A;  3B4T A;  2CVE A;  2JT2 A;  4DV6 I;  4BC7 A;  1ZBQ A;  2YTG A;  2V89 A;  2O1V A;  3V5R A;  4FWD A;  2L8T A;  3B78 A;  3CWV A;  4PRX A;  2L2N A;  2PNM A;  2EOQ A;  4R2P A;  1Z5B A;  1G2F C;  3Q6N A;  4DV1 E;  1Z5C A;  5IWA I;  2JYA A;  1DGC A;  1ZAA C;  1MU5 A;  1UDO A;  4DUZ I;  2CTD A;  4IFD B;  1H7S A;  4B3R E;  2A25 A;  4GQU A;  2D9H A;  2H36 X;  4WYQ B;  1TF6 A;  1Z5A A;  2EPM X;  2V85 A;  2EJ4 A;  1UBD C;  2E1R A;  1N36 E;  2WW4 A;  4BA1 A;  2RTX A;  2OI2 A;  4NBQ A;  2UUA I;  2NAB A;  1NZ0 A;  2PO0 A;  4AM3 A;  2V86 A;  2MDR A;  2HGH A;  4FWH A;  4QNJ A;  2EPU A;  5JEA C;  1KKH A;  2LE2 A;  5JEA D;  5KL6 A;  4JI8 E;  2UU9 E;  4PRV A;  3PS2 A;  3ZZ0 A;  2EN7 A;  3IWC A;  2LRS A;  2VQE E;  4BBY A;  1X5W A;  4LOM A;  2EPK X;  4B3M I;  5DNX A;  1IBK I;  5T6J A;  2VE7 C;  3UHM A;  4Q35 B;  4DR6 E;  2JY9 A;  4Z7Y A;  2UUB E;  3P3E A;  3LNU A;  1UN6 B;  4USM A;  2EOS A;  4ZYD A;  3P1X A;  1N33 I;  3ZOQ B;  4DR5 I;  3T1H I;  1Z0T A;  2UUC I;  3LTO A;  1O0W A;  2DB2 A;  1H72 C;  3OTO I;  1IBM I;  2EM4 A;  2EOM A;  5A6K A;  4MU1 A;  4GKJ E;  4DV0 I;  4AQY I;  4B3T I;  2DEI A;  2MC5 A;  3M7N G;  1MGT A;  1T38 A;  4IFD A;  4DPU A;  3QT7 A;  2ZM6 E;  3P76 A;  2RSI A;  5AE1 A;  4MYT A;  2EM5 A;  2EM2 A;  2DMI A;  3IWB A;  2ENH A;  4BHC A;  4ZYE A;  2GS8 A;  4O24 A;  1PJS A;  1KYQ A;  2J7K A;  4ZVI A;  4DV5 I;  4LF5 I;  4JYA I;  2EOO A;  1Z0C A;  4URL A;  4DR7 I;  2EE8 A;  4M2Z A;  2DMY A;  3PYG A;  4M9V C;  2EMF A;  2L6M A;  2YTJ A;  4WXD A;  2EN3 A;  1XMQ E;  5AC4 A;  1BB8 A;  4OO1 B;  1T4O A;  1A1K A;  1ZXN A;  4M1K A;  5CFF E;  4X66 I;  1EKZ A;  1JK2 A;  2V8Q B;  1USU A;  3C6K A;  2LJU A;  4WUC A;  3JAM C;  1D6T A;  2KOU A;  2VF1 A;  1T4L B;  5C0X C;  4DU7 A;  1EA6 A;  1PJT A;  3BID A;  1QNT A;  2UXC E;  1H73 A;  2NN6 D;  4UT4 A;  4P7D A;  5IV8 B;  2IOP A;  4IZJ B;  1NCS A;  2EOJ A;  1SR9 A;  2EM0 A;  2FV4 B;  2YTO A;  1PJQ A;  3EQ1 A;  2KON A;  3LML A;  4WSG A;  3EPJ A;  3QT8 A;  2HJJ A;  2M9A A;  4YHH E;  1N34 I;  5K36 C;  4QNK A;  5K36 D;  2V2V A;  2EL6 A;  2EMG A;  4LF4 I;  4MLQ A;  2EMK A;  1X47 A;  4X8W A;  4BS9 A;  3QT5 A;  5KL2 A;  4F54 A;  4GZN C;  4R2R A;  4NZV A;  3V2U C;  1FI4 A;  3PYF A;  3QT6 A;  3ZM7 A;  2E1M A;  4JI0 I;  3DD6 A;  1YYK A;  4KQV A;  1Y4S A;  2A2D A;  1J5E I;  2HK3 A;  4M0V A;  2EQ1 A;  2WBT A;  5JEA A;  4R2A A;  1I94 E;  1OJ4 A;  2X36 A;  2YWQ A;  1E3P A;  4K0K E;  2EMX A;  2YTQ A;  2FGG A;  5AC5 A;  5LMU E;  4DR4 E;  4BA1 B;  4IFD F;  2LV2 A;  1SFE A;  2YTI A;  4TUI A;  4DV2 E;  5FLX Q;  4DV1 I;  2EML A;  1B69 A;  1YUJ A;  3ZZU A;  1IBL E;  5A69 A;  2EPP A;  4DV4 I;  4IJD A;  3L7Z B;  1Z0W A;  5DRQ A;  3THO B;  2LUP B;  2VRD A;  4MYU A;  2EM9 A;  2LVH A;  2WBU A;  2E5L E;  4LF7 E;  2ZBK B;  1N36 I;  4IFD E;  3F6H A;  4JI1 E;  5A6A A;  1IMU A;  4L5N C;  4RH8 A;  1YUI A;  3P06 A;  4WFT A;  4DR1 E;  1A1H A;  3WU4 A;  4XTJ A;  1T39 A;  4MQY A;  2EPC A;  4IS1 C;  4JI7 E;  3ADJ A;  2LCE A;  4F2J C;  2EMH A;  5F3W A;  1Y4U A;  2EN2 A;  5A6B D;  4X65 E;  5FWK A;  4GEQ B;  4JV5 I;  3J7A M;  4IZJ A;  3EPL A;  4JI8 I;  4OKG A;  1ZM2 A;  3JU0 A;  2UU9 I;  1Z1B A;  3HQ1 A;  2V2Z A;  4JI5 E;  2JR1 A;  3UK3 C;  2B7T A;  5AAS A;  1H7U A;  3K1J A;  4LPF A;  1YSA C;  4F9A B;  3PYE A;  4WUD A;  3ZKB A;  3ZZT A;  3VK6 A;  4JI2 E;  3KRN A;  4LF6 E;  2JEA B;  3H09 A;  1WRJ A;  4HTG A;  4HY1 A;  1E3H A;  2L92 A;  1XMO I;  3QG5 C;  1VI7 A;  2O1T A;  3AUZ A;  5ADZ A;  2UUB I;  1Z0V A;  1HNW I;  2UXB I;  3EPK A;  2GHF A;  1YZ9 A;  1PKP A;  2R3V A;  4FW4 A;  2BV3 A;  2Z5B B;  5C0X A;  1UDN A;  4DV7 E;  1N3G A;  2RS6 A;  4GKJ I;  4B3S E;  5A6J A;  4R2E A;  2ZM6 I;  1X6E A;  1Y6Z A;  3WU6 A;  2CPN A;  2YSP A;  5JEA E;  3L7Z A;  4DR2 E;  2NUG A;  2V2Q A;  5IT9 C;  4X62 E;  1UDQ A;  1GZ6 A;  5GME A;  4F9B B;  3WU5 A;  1DAR A;  4BC9 A;  2BM1 A;  1R6L A;  1P47 A;  1A1I A;  3K85 A;  4OO1 F;  2JOX A;  2L2M A;  4J3D A;  1FNM A;  3FIG A;  4X64 E;  1OYP A;  4AID A;  2YPN A;  1X49 A;  4JI3 I;  2C39 B;  1N0V C;  2EL5 A;  4YY3 E;  4OO1 E;  3C4B A;  1FKA E;  4KZS A;  2UXD E;  4OX9 I;  1T4N A;  2LTS A;  3KZZ A;  2BA1 D;  2YTD A;  4DPX A;  2AE8 A;  2I13 A;  2LMZ A;  2N3H A;  4DPW A;  4ZYG A;  1KVK A;  4YHH I;  2JEA A;  2VQF E;  5JEA B;  3TQM A;  2MDG A;  2HKJ A;  2DSY A;  1B62 A;  1BKN A;  2WNR B;  5AE2 A;  2BM0 A;  3F6G A;  4Q28 A;  2Z5B A;  2EPL X;  3MHS C;  2EM3 A;  4LCG A;  2EPX A;  1TF3 A;  2MKD A;  5C0X F;  2M7Q A;  4KHP I;  5IWA E;  1B63 A;  2N3G A;  5IXM B;  2F4V I;  4P78 A; 
#chains in the Genus database with same CATH homology
 2EZ6 A;  1I94 I;  2V83 A;  1Z59 A;  4JI6 E;  5LMU I;  1YYW A;  1XNR E;  1N32 E;  1QU6 A;  3OML A;  4DV2 I;  1YYO A;  1IBL I;  1HNX E;  1MG7 A;  2Q2E B;  5DNY A;  4JI1 I;  2IHR 1;  1DQ3 A;  3WU3 A;  1VIS A;  1UIL A;  4DR1 I;  4LF9 E;  2LBS B;  1Z0B A;  4LTY A;  4GKK E;  4JI7 I;  2K4V A;  2EWL A;  4X65 I;  1NHJ A;  5LL6 R;  1K47 A;  4JI4 E;  3LLH A;  3HJC A;  4JI5 I;  1WHQ A;  1S16 A;  3Q6M A;  1STU A;  2Z5E A;  2MC6 A;  4R8O A;  1FJG E;  1WUU A;  2V88 A;  1WHN A;  4JI2 I;  4DR3 E;  2GQ0 A;  4UTG A;  4LF8 E;  4LF6 I;  2G7H A;  1H74 A;  2O1U A;  3OTO E;  4LFA E;  5A2Q C;  4DV0 E;  2JOB A;  1ZM3 A;  2X7I A;  3H4L A;  4B3R I;  3J7Y p;  4FN5 A;  3J80 Q;  2YT4 A;  4DV7 I;  4FWG A;  4PU9 A;  4LF5 E;  2R42 A;  2IOQ A;  3J81 C;  2YZT A;  1KTV A;  4LU9 A;  2CG9 A;  2JVA A;  1MX0 A;  1HR0 E;  3T1Y E;  4EMD A;  4DR2 I;  3HPS A;  1XHK A;  4X66 E;  3D4J A;  3HUL A;  2AJ4 A;  1S4E A;  3ADI A;  2VQE I;  4X64 I;  1PIE A;  2B7V A;  4LFB E;  1J26 A;  4DR6 I;  1HK7 A;  2XEX A;  2V34 A;  4TUG A;  1A6F A;  5BR8 E;  1USV A;  2PNL A;  2HK2 A;  2M4I A;  2DIX A;  1RRE A;  4USK A;  3JTZ A;  5GMD A;  1NHI A;  2VQF I;  4DPT A;  4R1F A;  4NXN E;  1HNZ E;  4M30 A;  5L3J A;  3ZKD A;  3DF6 A;  1KIJ A;  4LFC I;  4I8O A;  5LMN I;  4HXZ A;  4JI6 I;  2HFU A;  4DV4 E;  2L3J A;  1XMQ I;  1XNR I;  1N32 I;  4WSP A;  4R03 A;  1XNQ E;  2JWO A;  2ZIT A;  2HHH E;  1HNX I;  2NA2 A;  4DV3 E;  4HAC A;  2UXC I;  4DKK A;  5IT9 Q;  2RSM A;  3K6Q A;  3MSW A;  4JV5 E;  1Z0G A;  2CZ9 A;  4NXM E;  4LF9 I;  4FW9 A;  4DPY A;  4DUY E;  2NUE A;  4GKK I;  1Z0E A;  4DV6 E;  1ELO A;  2VF3 A;  2KHX A;  3IWD A;  1ZM9 A;  2DEJ A;  3HTX A;  4DXL A;  4JI4 I;  3PRY A;  5AE3 A;  2WZO A;  4DUZ E;  1XMO E;  1HNW E;  3DJW A;  2UXB E;  2B9D A;  3B8H A;  4K0K I;  3VYY A;  2HKE A;  4DR4 I;  3GON A;  1FJG I;  3HPZ A;  4DR3 I;  4LF8 I;  2LTR A;  4LFA I;  4RPF A;  4WUB A;  4HYM A;  2UUA E;  4IZJ D;  2M1S A;  1X48 A;  1RQ0 A;  1FWK A;  1U2R A;  2E5L I;  3C4T A;  4LF7 I;  4BCA A;  3VYX A;  3B82 A;  1ZM4 A;  1UHZ A;  4JG4 A;  4IZK B;  2L33 A;  3KWR A;  1HR0 I;  3T1Y I;  4B3M E;  2ODR C;  4J8Z A;  1RR9 A;  2ODR D;  4OOG C;  1IBK E;  4BMJ A;  3JAM Q;  4JI3 E;  4ED4 A;  1DI2 A;  2O1W A;  4N3O A;  4I3H A;  2A2C A;  1QZR A;  1ZXM A;  1GQE A;  4OX9 E;  4LFB I;  1N33 E;  4DR5 E;  3T1H E;  1ZBT A;  2UUC E;  2B3T B;  1IBM E;  3LPS A;  4AQY E;  4B3T E;  2V87 A;  5FLX C;  3PYD A;  5BR8 I;  4DU8 A;  2F8B A;  2L2K B;  2LJH A;  3J80 C;  3RMP A;  4L8N A;  4KHP E;  4JYA E;  4B3S I;  4DV5 E;  4DR7 E;  1RC7 A;  2F4V E;  2LJP A;  1EI1 A;  2NPF A;  2EFG A;  4NXN I;  3F0N A;  4Z7C A;  1HNZ I;  1FWL A;  1WXR A;  2N3G A;  3M6A A;  3J7A G;  3Q1Q A;  5A2Q Q;  3ADL A;  4P52 A;  4X62 I;  3ADG A;  4HAC B;  1UEK A;  2CGE A;  4WPY A;  5IWA E;  4IZK A;  2LUQ A;  1XNQ I;  2V8P A;  1PVG A;  2L3C A;  3J81 Q;  2HHH I;  2NUF A;  1N34 E;  3AV0 A;  4YY3 I;  2UXD I;  1N0U A;  4DV3 I;  4LF4 E;  2HFS A;  2FTX B;  4JI0 E;  2Z5C A;  4NXM I;  3HXL A;  2RS7 A;  1J5E E;  1NHH A;  3K17 A;  4F9C B;  4DUY I;  4P7A A;  4DMI A;  4DV6 I;  4BC7 A;  1ZBQ A;  2V89 A;  2O1V A;  3V5R A;  4FWD A;  2L8T A;  3B78 A;  3CWV A;  4PRX A;  2L2N A;  2PNM A;  1Z5B A;  3Q6N A;  4DV1 E;  1Z5C A;  5IWA I;  4DUZ I;  1MU5 A;  1H7S A;  4B3R E;  2H36 X;  4WYQ B;  1Z5A A;  2V85 A;  2E1R A;  2WW4 A;  1N36 E;  2RTX A;  2OI2 A;  2UUA I;  1NZ0 A;  2V86 A;  2MDR A;  4FWH A;  1KKH A;  2LE2 A;  4JI8 E;  2UU9 E;  4PRV A;  3ZZ0 A;  3IWC A;  2LRS A;  2VQE E;  4BBY A;  4B3M I;  1IBK I;  5T6J A;  2VE7 C;  4DR6 E;  2JY9 A;  4Z7Y A;  2UUB E;  3LNU A;  4USM A;  3P1X A;  1N33 I;  3ZOQ B;  4DR5 I;  3T1H I;  1Z0T A;  2UUC I;  3LTO A;  1O0W A;  2DB2 A;  1H72 C;  3OTO I;  1IBM I;  4DV0 I;  4AQY I;  4GKJ E;  4B3T I;  2DEI A;  2MC5 A;  4DPU A;  3QT7 A;  2ZM6 E;  5AE1 A;  4MYT A;  3IWB A;  2GS8 A;  4LF5 I;  4ZVI A;  2J7K A;  4JYA I;  4DV5 I;  1Z0C A;  4URL A;  4DR7 I;  4M2Z A;  2DMY A;  3PYG A;  2L6M A;  1XMQ E;  1T4O A;  1ZXN A;  4M1K A;  5CFF E;  4X66 I;  1EKZ A;  2V8Q B;  1USU A;  4WUC A;  3JAM C;  1D6T A;  2KOU A;  2VF1 A;  1T4L B;  4DU7 A;  1EA6 A;  2UXC E;  1H73 A;  4UT4 A;  4P7D A;  2IOP A;  4IZJ B;  2FV4 B;  4DPX A;  1SR9 A;  3LML A;  2Z5C B;  2KON A;  3QT8 A;  4YHH E;  1N34 I;  2V2V A;  4LF4 I;  4X8W A;  1X47 A;  4BS9 A;  3QT5 A;  3V2U C;  4F54 A;  1FI4 A;  3PYF A;  3QT6 A;  3ZM7 A;  2E1M A;  4JI0 I;  1YYK A;  4KQV A;  1Y4S A;  2A2D A;  1J5E I;  2HK3 A;  4M0V A;  1I94 E;  1OJ4 A;  2X36 A;  4K0K E;  4DR4 E;  2FGG A;  5LMU E;  4TUI A;  4DV2 E;  5FLX Q;  4DV1 I;  3ZZU A;  1IBL E;  4DV4 I;  1Z0W A;  2LUP B;  4MYU A;  2ZBK B;  1N36 I;  2E5L E;  4LF7 E;  3F6H A;  4JI1 E;  3P06 A;  4L5N C;  4WFT A;  4DR1 E;  3WU4 A;  4XTJ A;  4JI7 E;  3ADJ A;  5FWK A;  5F3W A;  1Y4U A;  4X65 E;  4GEQ B;  4JV5 I;  3J7A M;  4IZJ A;  4JI8 I;  1ZM2 A;  3JU0 A;  2UU9 I;  3HQ1 A;  2V2Z A;  4JI5 E;  2JR1 A;  1H7U A;  2B7T A;  5AAS A;  3K1J A;  4F9A B;  3PYE A;  4WUD A;  3ZKB A;  3ZZT A;  3VK6 A;  4JI2 E;  4LF6 E;  3H09 A;  4HY1 A;  2L92 A;  1XMO I;  2O1T A;  2UUB I;  3AUZ A;  5ADZ A;  1HNW I;  1Z0V A;  2UXB I;  1YZ9 A;  1PKP A;  2R3V A;  2BV3 A;  2Z5B B;  4DV7 E;  2RS6 A;  4GKJ I;  4B3S E;  2ZM6 I;  1Y6Z A;  3WU6 A;  2CPN A;  4DR2 E;  2NUG A;  2V2Q A;  5IT9 C;  4X62 E;  1GZ6 A;  5GME A;  4F9B B;  3WU5 A;  1DAR A;  4BC9 A;  2BM1 A;  3K85 A;  2JOX A;  2L2M A;  1FNM A;  3FIG A;  4X64 E;  1X49 A;  4JI3 I;  1N0V C;  4YY3 E;  3C4B A;  1FKA E;  4KZS A;  2UXD E;  4OX9 I;  1T4N A;  2LTS A;  2LMZ A;  2N3H A;  4DPW A;  1KVK A;  4YHH I;  2VQF E;  2HKJ A;  2DSY A;  1B62 A;  1BKN A;  5AE2 A;  2BM0 A;  3F6G A;  4Q28 A;  2Z5B A;  4KHP I;  2M7Q A;  4LFC E;  1B63 A;  5LMN E;  2F4V I;  4P78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...