4DV1E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 32
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv1E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv1E02
4FWDA 2ZM6I 4ED4A 4Z7YA 3Q1QA 4FWGA 2L2MA 1XMQE 1PVGA 2X7IA 1ZM2A 2NUGA 2UXDE 3J7AG 2UUAI 3ZM7A 1IBLE 4JI3I 4LF5I 4WYQB 2A2CA 2DEIA 3PYGA 1Z0GA 4DUYE 1ZXNA 2V2QA 4UT4A 3QT5A 3P1XA 2UU9E 2ZBKB 3LNUA 3GONA 4YHHE 2BV3A 4DPWA 2E5LE 4LFCE 1Z59A 2UUBI 4YY3I 2B3TB 4ZVIA 2UXBE 1I94E 4JI2I 2EZ6A 2L33A 1XMOE 4DV7I 3WU3A 4USKA 1ZM3A 4B3SI 4LF8E 4DR5E 3V2UC 4GKJI 1Z0TA 1B62A 1N36E 1FNMA 2LJPA 1YYKA 4PRVA 4DV2E 5LMUI 4NXNI 4R1FA 4JI0I 4JI4I 2AJ4A 4X65E 3LLHA 4DR3E 3T1YE 2L2NA 1MX0A 1Z0BA 4LFBE 2HK3A 2ZITA 4LF5E 5LMNE 2X36A 1OJ4A 1J26A 1HR0E 2Q2EB 4LFAE 1FJGI 4PU9A 3HTXA 1Z5BA 1DARA 4DPXA 5CFFE 3WU6A 1UEKA 2LTSA 2J7KA 4JYAE 4DR2I 1J5EI 2RSMA 1H7SA 4GKKI 2V8PA 3B82A 4KQVA 1GQEA 1FWLA 1IBKI 1HNZE 4DV3E 4B3RI 2L3JA 1KIJA 4DPTA 1N0VC 1B63A 5BR8E 4DV5I 1NHIA 3ZKDA 1MG7A 2HK2A 1QZRA 4JI5E 4JI8I 4I3HA 3ADJA 5LMUE 4MYTA 3ADIA 4Z7CA 4X64E 2LJHA 3LTOA 3ADLA 4DR6I 4AQYI 2JVAA 1ZM4A 5IWAE 1N33E 5GMDA 2RTXA 4B3TE 4DR4I 1N32E 2L3CA 1RREA 4DXLA 3VYYA 3J7AM 5FLXC 1O0WA 4DR1E 2OI2A 4LF9E 4OX9E 1FJGE 4USMA 4JG4A 1UHZA 1XNRI 2JY9A 2UXCI 2DMYA 2HHHI 1T4OA 4KHPE 2UUCE 3ZKBA 1IBMI 4LF6I 3T1HE 4K0KI 4DV0I 3J81Q 4JI1E 2L2KB 4FWHA 4B3RE 1RC7A 1Z0WA 2R3VA 4DV1I 1T4LB 5LL6R 4DPUA 4X8WA 2BM0A 1HNWE 3K17A 4X62I 2N3GA 1D6TA 3M6AA 3ADGA 4DUZI 2LBSB 2LUPB 4DV6E 5GMEA 4RPFA 4JI7E 1Z0VA 2HKEA 4HACB 1XNQI 1H72C 3OTOE 4X66I 1N34I 4JI6I 4DKKA 2KHXA 1HNXE 4HACA 3F0NA 3J80Q 2ZM6E 3QT8A 3J81C 4DV4I 4M30A 4DR7I 4WFTA 1XNRE 4MYUA 3D4JA 2UXCE 1X49A 4WUDA 1X48A 2UUAE 4JI3E 2YT4A 4B3MI 1NHJA 4LF7I 2XEXA 1KVKA 3ZZTA 1XHKA 4DPYA 3WU5A 2DB2A 1H73A 2VQFI 4JV5I 2B7TA 4EMDA 1HNXI 2LRSA 2UUBE 2RS7A 4YY3E 3CWVA 4FW9A 3C4BA 4LF4I 4JI2E 4DV7E 5L3JA 4B3SE 1T4NA 4GKJE 2HKJA 4HY1A 1XMQI 3QT7A 1X47A 1EKZA 3HULA 3JAMQ 2UXDI 2EFGA 2VF3A 1IBLI 4NXNE 2IHR1 4JI0E 4JI4E 3ZZUA 2F4VI 2RS6A 2LTRA 4DUYI 2UU9I 1ELOA 3C4TA 1U2RA 4YHHI 1NZ0A 3ZZ0A 2E5LI 4LFCI 1KKHA 3B78A 2UXBI 1Z5CA 2V34A 1I94I 3H4LA 2A2DA 1XMOI 3PYDA 5IT9Q 4DU7A 4LF8I 4DR5I 4DR2E 1J5EE 4GKKE 3PYFA 1KTVA 4NXMI 1N36I 1IBKE 4DV2I 1YYOA 3LPSA 1RR9A 2GS8A 4X65I 4DR3I 4DV5E 3T1YI 4WUBA 1NHHA 4JI8E 4LFBI 2N3HA 1DI2A 2HFSA 4XTJA 2WW4A 5LMNI 1VISA 2F4VE 4DR6E 4AQYE 1HR0I 4LFAI 4HXZA 1ZXMA 4DR4E 5IT9C 2BM1A 3PYEA 1WHNA 1QU6A 4JYAI 1N0UA 1PIEA 2NPFA 3WU4A 4HYMA 1S4EA 1HNZI 2HHHE 4UTGA 4DV3I 2CPNA 2NUEA 1IBME 4LF6E 4M1KA 1H74A 5BR8I 1YYWA 4K0KE 4DV0E 4NXME 4JI5I 5A2QQ 2VQEI 4X64I 1YZ9A 3QT6A 4DV1E 2CZ9A 3J7Yp 5IWAI 1N33I 1EA6A 1A6FA 4X62E 4B3TI 1N32I 4DUZE 3K1JA 3J80C 4P7AA 4DR1I 4LF9I 4P52A 1XNQE 3V5RA 4WUCA 4OX9I 4X66E 1S16A 1N34E 4JI6E 2NUFA 4OOGC 2E1RA 4FN5A 4KHPI 1ZM9A 2UUCI 5FLXQ 1ZBTA 4DV4E 1Z0EA 2MDRA 4DR7E 3T1HI 4M2ZA 5A2QC 4URLA 3B8HA 4JI1I 1FI4A 1BKNA 1H7UA 4B3ME 2R42A 2DEJA 4LF7E 1K47A 3VYXA 2V2ZA 1MU5A 1HNWI 4DU8A 2B7VA 2VQEE 2LUQA 1FWKA 2VQFE 1RQ0A 4JV5E 2NA2A 1FKAE 4DV6I 4JI7I 2V2VA 2DIXA 1WHQA 4LF4E 3OTOI 1EI1A 1UILA 3JAMC 1Z0CA 1STUA 2HFUA 1Z5AA 1PKPA 1WUUA 4PRXA
chains in the Genus database with same CATH superfamily
2BA1G 4FWDA 2ZM6I 2EOEA 4ED4A 2HGHA 1PJTA 4Z7YA 3JTZA 3Q1QA 4FWGA 1AH5A 5AE2A 2L2MA 2YTPA 1XMQE 1PVGA 3QG5C 2O1WA 3U1KA 1G2FC 2X7IA 1ZM2A 2NUGA 2UXDE 1EH7A 3J7AG 2UUAI 2PO0A 1T39A 5JEAC 3ZM7A 1IBLE 4FW4A 2EN2A 4JI3I 2YTGA 4MU0A 4HEIA 3NZKA 4MU1A 4LF5I 2EL4A 4WYQB 1AAYA 4F54A 2A2CA 2EPOA 2DEIA 2EMCA 2PO2B 3PYGA 1Z0GA 5IXMB 4DUYE 2JE6B 1ZXNA 4IFDB 2V2QA 4UT4A 3P1XA 2UU9E 3QT5A 2ZBKB 2M7QA 4F6NA 3LNUA 3GONA 4YHHE 2BV3A 4DPWA 2V86A 2E5LE 4LFCE 2PO2A 2YTOA 3HPZA 1Z59A 2UUBI 3HXLA 4LCHA 5K36C 3KZZA 1Y4SA 4YY3I 2B3TB 4BHBA 2JE6A 4ZVIA 2UXBE 4IFDA 2EM3A 2A25A 1E3HA 5C0XB 4R2CA 1I94E 2EM2A 1Y5YA 1Y60A 4QNJA 2JR1A 1IMUA 4JI2I 2EZ6A 2L33A 1UN6B 1XMOE 4WSGA 4DV7I 3C6KA 4O4KA 3WU3A 3DJWA 2JYAA 4USKA 1RMDA 2ENHA 2EPCA 3EPHA 1ZM3A 4B3SI 2EOOA 4LF8E 2CSHA 4DR5E 4FW7A 4N3OA 5FWKA 3V2UC 5C0XA 1Z0TA 4GKJI 1DGCA 4MU3A 2DSYA 2LMZA 1B62A 3IWBA 4BA1B 4R2RA 1N36E 1FNMA 3MHSC 1YYKA 4FK5C 2LJPA 4IZKB 1R6MA 4PRVA 4DV2E 5LMUI 2EQ3A 2EN7A 4O24A 4NXNI 4R1FA 4JI0I 4JI4I 3THNA 2Q8UA 4X65E 4WXCA 2AJ4A 1TN9A 3LLHA 4DR3E 4BS9A 3PS1A 4RH8A 2EPLX 3L00A 2L2NA 3T1YE 4L5NC 1MX0A 2Z5EA 1ZU1A 2EMFA 4O5GA 1X3CA 1Z0BA 2PNMA 1ZBQA 2YTJA 3UHMA 4LFBE 4GEQB 2HK3A 4ZYDA 2ZITA 2K7IA 4HTGA 4LF5E 5LMNE 5DNLA 5KL6A 2EORA 1OJ4A 2YTQA 1J26A 2X36A 3K6QA 3HJCA 2EOIA 1HR0E 1QNTA 2Q2EB 2MC5A 4LFAE 4R8OA 4AIMA 2NN6B 1FJGI 4OO1C 2GO3A 2WNRB 4PU9A 3HTXA 1Z5BA 4J3DA 2WZOA 1XXEA 2WCC3 1DARA 4DPXA 5CFFE 2EOSA 2DLQA 1UBDC 3WU6A 1P47A 1UEKA 1WRJA 4AIDA 2LTSA 2EM0A 2J7KA 4FW6A 1A1LA 4JYAE 2NN6A 2KONA 2EMYA 2M4IA 2WNRA 4DR2I 1J5EI 4WX9A 4IZJB 2RSMA 1H7SA 2KOUA 2V8PA 4GKKI 5DRQA 2DGCA 3B82A 4IFDC 4KQVA 1GQEA 1FWLA 2YSOA 2F8BA 2LT7A 1IBKI 1HNZE 1YUIA 2YU5A 4MLVA 4R2SA 4DV3E 5DRRA 5A69A 2LE2A 5DROA 4B3RI 2L3JA 2RQLA 1KIJA 1N0VC 4DPTA 4RHBB 5BR8E 1B63A 4IZJA 2DLKA 2R1FA 1YSAC 4DV5I 3BF2A 1NHIA 3ZKDA 3VHTB 3AUZA 2V87A 1MG7A 1QZRA 2HK2A 4JI5E 2EOMA 5C0XC 4JI8I 3LMLA 3AV0A 4I3HA 3ADJA 5LMUE 4MYTA 3BBGA 4MLQA 1NCSA 3EPKA 3ADIA 4X64E 2LJHA 4U3BA 4Z7CA 2WBTA 2BR2A 3LTOA 4I8OA 2CG9A 3ADLA 2HC5A 1A1JA 4DR6I 4AQYI 3P76A 2JVAA 3M7ND 1ZM4A 5IWAE 1N33E 1A1FA 1TF6A 5GMDA 5F3WA 2RTXA 2VRDA 4B3TE 2EOZA 3DD6A 3PS2A 1N32E 2EOXA 4IS9A 2FGGA 2V89A 2L3CA 5EL9A 4DR4I 2I13A 1RREA 1YFHA 4DXLA 2EOFA 3VYYA 3J7AM 2EPUA 2EM9A 5FLXC 1A1IA 1O0WA 4DR1E 4P7DA 1KJKA 2OI2A 4LF9E 4ISAA 4BC7A 1VI7A 2ENCA 5A6BA 1IQSA 4OX9E 1FJGE 2Z5CB 1ZR9A 4USMA 2EWLA 4JG4A 1UHZA 2YTIA 1XNRI 2JEBB 2EP3A 4L8NA 4OO1B 1P42A 2JY9A 2UXCI 2EN3A 2DMYA 3EQ1A 1ZAAC 3U1YA 1SR9A 1BBOA 1T4OA 5JEAD 2HHHI 4KHPE 2UUCE 3ZKBA 2Z5CA 1IBMI 4LF6I 4R2DA 3T1HE 2VESA 4K0KI 4DV0I 3M7NG 1PDAA 2JEBA 2NN6C 4OO1A 3J81Q 3M99B 4WXDA 4JI1E 2L2KB 4FWHA 4B3RE 4BBYA 1JK2A 2ENAA 2K4VA 1RC7A 1Z0WA 2R3VA 4DV1I 1T4LB 5LL6R 5K36D 4DPUA 4X8WA 2BM0A 1HNWE 5A6KA 1GTKA 2EMHA 1L4SA 2MC6A 3K17A 3HQ1A 5DRPA 4X62I 2N3GA 1D6TA 3THOB 3M6AA 3PS3A 3ADGA 4DUZI 2RSIA 2LBSB 2LUPB 2E1MA 4WPYA 4DV6E 1UDOA 4RPFA 5GMEA 4JI7E 1EH6A 5KL5A 4N4RB 1Z0VA 4IS1C 2HKEA 4HACB 4TUIA 1XNQI 2EPPA 2EPNA 2GO4A 1LLMC 1H72C 3OTOE 2C37B 2JWOA 4Q28A 4X66I 1N34I 2YTNA 4J8ZA 4JI6I 3IWCA 4DKKA 2KHXA 1HNXE 4HACA 3F0NA 2JOXA 2NABA 3J80Q 2ZM6E 4F9AB 3QT8A 3J81C 4FW3A 5DNYA 4DV4I 4M30A 4DR7I 2EMLA 2EM4A 4WFTA 2C37A 3BIDA 1XNRE 2O3ZA 4MYUA 5KL3A 5JEAE 3D4JA 2UXCE 2EE8A 1X49A 4MDTA 4WUDA 3P06A 1X48A 2UUAE 2O1VA 4LPFA 4JI3E 2YT4A 4B3MI 1NHJA 4KZSA 3L7ZA 2AE8A 2XEXA 3JU0A 4LF7I 1KVKA 3ZZTA 2EMXA 1Y6ZA 2EJ4A 2L8TA 1XHKA 2CVEA 2JEAA 4GZNC 4DPYA 3WU5A 4F6MA 5AC4A 3DF6A 4R03A 1T38A 1OYPA 5JEAF 2DB2A 1DQ3A 2V83A 1H73A 1Z1BA 2GPIA 2VQFI 2B7TA 4DMIA 4JV5I 4EMDA 1HNXI 2LRSA 2V88A 2UUBE 3P3GA 2RS7A 2EMKA 1SFEA 4YY3E 1JK1A 3CWVA 5ELWA 3GLLA 4FW9A 2EM7A 3EPJA 3C4BA 4LF4I 2JXPA 4OKGA 4IFDD 2EMBA 4JI2E 3UK3C 4OZEA 3IWDA 4DV7E 2B9DA 4M0VA 5L3JA 2F1DA 2C39B 3VK6A 3HKMA 5K36F 4B3SE 3Q6NA 1T4NA 2LCEA 4GKJE 2HKJA 4HY1A 2BR2B 4R2EA 1XMQI 3QT7A 1X47A 1EKZA 5C0XD 3HULA 3JAMQ 2ODRD 2JPAA 2C38B 2EFGA 2VF3A 2UXDI 2C39A 2EN8A 1YHCA 1IBLI 4NXNE 2IHR1 4JI0E 4JI4E 1X6FA 2EMWA 2EM8A 3ZZUA 3M85D 2EL6A 1PJSA 2F4VI 4ZYGA 2RS6A 2PRTA 2EN4A 2LTRA 2C38A 4DUYI 2EPXA 2PNZB 1ELOA 2JP9A 2J65A 2UU9I 3C4TA 1U2RA 1USUA 2YRMA 3H09A 2BBGA 4YHHI 1NZ0A 3ZZ0A 4LCGA 2E5LI 4BMJA 1KKHA 4LFCI 2EMZA 2MDGA 3B78A 2WBSA 1X6HA 1A1KA 2UXBI 2O1TA 5T6JA 2L6MA 5AASA 1Z5CA 2V34A 2PNZA 1I94I 2E72A 2JOBA 3H4LA 2A2DA 2EM6A 2EN1A 1XMOI 3PYDA 5IT9Q 4DU7A 2YTDA 4LF8I 3M85G 3CDIA 1MGTA 3EPLA 4DR2E 1B69A 1J5EE 4MU4A 3ZOQB 4DR5I 4GKKE 1N3GA 3PYFA 2NN6D 1KTVA 3F6HA 4NXMI 2EOQA 4M9VC 2Z5BB 3GMEA 1N36I 1IBKE 3MHHC 2YTEA 4DV2I 1YYOA 2GLIA 4NHRA 4U3DA 3FIGA 3LPSA 2LJUA 4Q35B 1RR9A 2GS8A 5C0XE 4X65I 4DR3I 4DV5E 4IJDA 2YU8A 4R2PA 3P3EA 2VF1A 2HJJA 4WUBA 3T1YI 2FTXB 2GHFA 1NHHA 4IFDF 4IZJD 2Z5BA 2DMIA 1KYQA 2YPNA 2CGEA 3H1CA 4KWYA 2EMIA 3MSWA 4P78A 4JI8E 4R2QA 2N3HA 4QNKA 4LFBI 1YUJA 1A1GA 1DI2A 5AE3A 1Y4UA 2H36X 2ELZA 2HFSA 3ECRA 2IOPA 2MKDA 2WW4A 4XTJA 3HPSA 3Q6MA 5LMNI 4X9JA 1VISA 2F4VE 4DR6E 3GCMA 2YRHA 4AQYE 4FW5A 1HR0I 4NZVA 4LFAI 5C0XF 2PNLA 4HXZA 2LV2A 1ZXMA 2BB8A 4LU9A 4DR4E 5IT9C 2BM1A 1WHNA 3PYEA 4BCAA 2J7JA 3OMLA 1QU6A 1UDNA 5AE1A 2EPZA 2MKNA 2JT2A 4JYAI 2EMAA 2I9IA 1N0UA 1PIEA 4AM3A 2L92A 2LVHA 2NPFA 3WU4A 3L7ZB 5A6BD 4F2JC 5DNXA 2EL5A 1G2DC 4HYMA 4WSPA 2EOYA 1S4EA 2LO3A 1HNZI 2HHHE 2GQ0A 4UTGA 3CDJA 4DV3I 5TSEA 2JEAB 2CPNA 2NUEA 4GQUA 2M1SA 1IBME 2NN6E 2BA0D 4LF6E 1X6EA 2V8QB 1H74A 4LCFA 4M1KA 5BR8I 1YYWA 1WXRA 4K0KE 4DV0E 1WJPA 3TQMA 3PRYA 4BHCA 4NXME 2YWQA 3KRNA 1EH8A 1F2IG 1IQOA 4JI5I 4NBQA 2ADRA 5A2QQ 5AC5A 4OO1D 3C6MA 4ZYEA 2VQEI 4X64I 1HK7A 2CTDA 3KZYA 5K36E 1YZ9A 3QT6A 1NEIA 2EOHA 4DV1E 4BA1A 1YH8A 1GZ6A 2EM5A 2CZ9A 2NN6F 3J7Yp 5IWAI 4IZKA 1EA6A 1N33I 2YZTA 1A6FA 4X62E 4B3TI 1N32I 1UDQA 2EMGA 4DUZE 3K1JA 4BC9A 5JEAB 3J80C 2WP8B 4MQYA 2G7HA 1R6LA 4P7AA 4DR1I 2BA0G 4LF9I 4P52A 4TUGA 1XNQE 3V5RA 4WUCA 1BBGA 4OX9I 2ELYA 2PO1B 4F9BB 2EPRA 4LOMA 4X66E 1E3PA 1S16A 1N34E 3B4TA 5IV8B 3RMPA 5JEAA 4JI6E 2NUFA 2WP8A 2N8XA 4OOGC 2EN6A 4LTYA 2M9AA 2R76A 2E1RA 4FN5A 1PJQA 1USVA 1ZM9A 2UUCI 5FLXQ 2WBUA 4KHPI 1ZBTA 2CT1A 2YSPA 2IOQA 5KL4A 2PO1A 5K36B 4DV4E 1Z0EA 2MDRA 4DR7E 3T1HI 1MEYC 4M2ZA 2EQ0A 2EPKX 2V85A 5A2QC 4BA2B 2EPMX 1TF3A 4URLA 3B8HA 4JI1I 1X5WA 1FI4A 2EOJA 5KL7A 2D9HA 1BKNA 2IESA 1H7UA 5LLQA 2RPCA 4B3ME 2EQ1A 2YTFA 2R42A 2DEJA 5K36A 2BA1D 2VE7C 1UDSA 4ZYHA 4LF7E 1K47A 1OYSA 4OO1E 4R2AA 4BA2A 1A1HA 3VYXA 2V2ZA 1MU5A 1HNWI 2ODRC 3KWRA 5ADZA 4DU8A 2B7VA 3F6GA 2VQEE 2IERA 2LUQA 2EPAA 1RQ0A 2VQFE 4JV5E 1FWKA 2NA2A 1FKAE 2O1UA 4DV6I 1BB8A 4JI7I 2V2VA 5EKWA 2DIXA 4F9CB 1YPNA 4IFDE 1RHYA 3BGHA 1WHQA 2FV4B 4LF4E 4O43A 3OTOI 4OO1F 1EI1A 2DRPA 1UILA 3JAMC 1Z0CA 1STUA 3K85A 5A6JA 1Z5AA 2HFUA 3P3CA 1PKPA 5KL2A 1WUUA 4PRXA 2YRKA 2PO0B 1OYRA 5A6AA
chains in the Genus database with same CATH topology
4FWDA 2ZM6I 4ED4A 4Z7YA 3JTZA 3Q1QA 4FWGA 5AE2A 2L2MA 1XMQE 2O1WA 1PVGA 2X7IA 1ZM2A 2NUGA 2UXDE 3J7AG 2UUAI 3ZM7A 1IBLE 4JI3I 4LF5I 4WYQB 2A2CA 4F54A 2DEIA 3PYGA 1Z0GA 4DUYE 1ZXNA 2V2QA 4UT4A 3P1XA 2UU9E 3QT5A 2ZBKB 2M7QA 3LNUA 3GONA 4YHHE 2BV3A 4DPWA 2V86A 2E5LE 4LFCE 3HPZA 1Z59A 2UUBI 3HXLA 4YY3I 1Y4SA 2B3TB 4ZVIA 2UXBE 1I94E 2JR1A 4JI2I 2EZ6A 2L33A 1XMOE 4DV7I 3WU3A 3DJWA 4USKA 1ZM3A 4B3SI 4LF8E 4DR5E 5FWKA 4N3OA 3V2UC 4GKJI 1Z0TA 2DSYA 2LMZA 1B62A 3IWBA 1N36E 1FNMA 2LJPA 1YYKA 4IZKB 4PRVA 4DV2E 5LMUI 4NXNI 4R1FA 4JI0I 4JI4I 2AJ4A 4X65E 3LLHA 4DR3E 4BS9A 3T1YE 2L2NA 4L5NC 1MX0A 2Z5EA 1Z0BA 2PNMA 1ZBQA 4LFBE 4GEQB 2HK3A 2ZITA 4LF5E 5LMNE 2X36A 1OJ4A 1J26A 3K6QA 3HJCA 1HR0E 2Q2EB 2MC5A 4LFAE 4R8OA 1FJGI 4PU9A 3HTXA 1Z5BA 2WZOA 1DARA 4DPXA 5CFFE 3WU6A 1UEKA 2LTSA 2J7KA 4JYAE 2KONA 2M4IA 4DR2I 1J5EI 4IZJB 2RSMA 1H7SA 2KOUA 2V8PA 4GKKI 3B82A 4KQVA 1GQEA 1FWLA 2F8BA 1IBKI 1HNZE 4DV3E 2LE2A 4B3RI 2L3JA 1KIJA 4DPTA 1N0VC 5BR8E 1B63A 4IZJA 4DV5I 1NHIA 3ZKDA 1MG7A 3AUZA 2V87A 2HK2A 1QZRA 4JI5E 4JI8I 3LMLA 3AV0A 4I3HA 3ADJA 5LMUE 4MYTA 3ADIA 4Z7CA 4X64E 2LJHA 3LTOA 4I8OA 2CG9A 3ADLA 4DR6I 4AQYI 2JVAA 1ZM4A 5IWAE 1N33E 5GMDA 5F3WA 2RTXA 4B3TE 4DR4I 1N32E 2FGGA 2V89A 2L3CA 1RREA 4DXLA 3VYYA 3J7AM 5FLXC 1O0WA 4DR1E 4P7DA 2OI2A 4LF9E 4BC7A 2Z5CB 4OX9E 1FJGE 4USMA 2EWLA 4JG4A 1UHZA 1XNRI 4L8NA 2JY9A 2UXCI 2DMYA 2HHHI 1SR9A 1T4OA 4KHPE 2UUCE 3ZKBA 2Z5CA 1IBMI 4LF6I 3T1HE 4K0KI 4DV0I 3J81Q 4JI1E 2L2KB 4FWHA 4B3RE 4BBYA 2K4VA 1RC7A 1Z0WA 2R3VA 4DV1I 1T4LB 5LL6R 4DPUA 4X8WA 2BM0A 1HNWE 3K17A 2MC6A 3HQ1A 4X62I 2N3GA 1D6TA 3M6AA 3ADGA 4DUZI 2LBSB 2LUPB 2E1MA 4WPYA 4DV6E 5GMEA 4RPFA 4JI7E 1Z0VA 2HKEA 4HACB 4TUIA 1XNQI 1H72C 3OTOE 2JWOA 4Q28A 4X66I 1N34I 4J8ZA 4JI6I 3IWCA 4DKKA 2KHXA 1HNXE 4HACA 3F0NA 2JOXA 3J80Q 2ZM6E 4F9AB 3QT8A 3J81C 5DNYA 4DV4I 4M30A 4DR7I 4WFTA 1XNRE 4MYUA 3D4JA 2UXCE 1X49A 4WUDA 3P06A 1X48A 2UUAE 2O1VA 4JI3E 2YT4A 4B3MI 1NHJA 4KZSA 4LF7I 2XEXA 3JU0A 1KVKA 3ZZTA 1Y6ZA 2L8TA 1XHKA 4DPYA 3WU5A 3DF6A 4R03A 2DB2A 1DQ3A 2V83A 1H73A 2VQFI 4JV5I 2B7TA 4DMIA 4EMDA 1HNXI 2LRSA 2V88A 2UUBE 2RS7A 4YY3E 3CWVA 4FW9A 3C4BA 4LF4I 4JI2E 3IWDA 4DV7E 2B9DA 4M0VA 5L3JA 3VK6A 4B3SE 3Q6NA 1T4NA 4GKJE 2HKJA 4HY1A 1XMQI 3QT7A 1X47A 1EKZA 3HULA 3JAMQ 2ODRD 2UXDI 2EFGA 2VF3A 1IBLI 4NXNE 2IHR1 4JI0E 4JI4E 3ZZUA 2F4VI 2RS6A 2LTRA 4DUYI 2UU9I 1ELOA 3C4TA 1U2RA 1USUA 3H09A 4YHHI 1NZ0A 3ZZ0A 2E5LI 4BMJA 1KKHA 4LFCI 3B78A 2UXBI 2O1TA 5T6JA 2L6MA 5AASA 1Z5CA 2V34A 1I94I 2JOBA 3H4LA 2A2DA 1XMOI 3PYDA 5IT9Q 4DU7A 4LF8I 4DR5I 4DR2E 1J5EE 3ZOQB 4GKKE 3PYFA 1KTVA 3F6HA 4NXMI 2Z5BB 1N36I 1IBKE 4DV2I 1YYOA 3FIGA 3LPSA 1RR9A 2GS8A 4X65I 4DR3I 4DV5E 3T1YI 2VF1A 4WUBA 2FTXB 1NHHA 4IZJD 2Z5BA 2CGEA 4P78A 3MSWA 4JI8E 4LFBI 2N3HA 1DI2A 5AE3A 1Y4UA 2H36X 2HFSA 2IOPA 2WW4A 4XTJA 5LMNI 3HPSA 3Q6MA 1VISA 2F4VE 4DR6E 4AQYE 1HR0I 4LFAI 2PNLA 4HXZA 1ZXMA 4LU9A 4DR4E 5IT9C 2BM1A 1WHNA 3PYEA 4BCAA 3OMLA 1QU6A 5AE1A 4JYAI 1N0UA 1PIEA 2L92A 2NPFA 3WU4A 4HYMA 4WSPA 1S4EA 1HNZI 2HHHE 2GQ0A 4UTGA 4DV3I 2CPNA 2NUEA 2M1SA 1IBME 4LF6E 2V8QB 1H74A 4M1KA 5BR8I 1YYWA 1WXRA 4K0KE 4DV0E 3PRYA 4NXME 4JI5I 5A2QQ 2VQEI 4X64I 1HK7A 1YZ9A 3QT6A 4DV1E 1GZ6A 2CZ9A 3J7Yp 5IWAI 4IZKA 1EA6A 1N33I 2YZTA 1A6FA 4X62E 4B3TI 1N32I 4DUZE 3K1JA 4BC9A 3J80C 2G7HA 4P7AA 4DR1I 4LF9I 4P52A 4TUGA 1XNQE 3V5RA 4WUCA 4OX9I 4F9BB 4X66E 1S16A 1N34E 3RMPA 4JI6E 2NUFA 4OOGC 4LTYA 2E1RA 4FN5A 4KHPI 1USVA 1ZM9A 2UUCI 5FLXQ 1ZBTA 2IOQA 4DV4E 1Z0EA 2MDRA 4DR7E 3T1HI 4M2ZA 2V85A 5A2QC 4URLA 3B8HA 4JI1I 1FI4A 1BKNA 1H7UA 4B3ME 2R42A 2DEJA 2VE7C 4LF7E 1K47A 3VYXA 2V2ZA 1MU5A 1HNWI 2ODRC 3KWRA 5ADZA 4DU8A 2B7VA 3F6GA 2VQEE 2LUQA 1FWKA 4JV5E 1RQ0A 2VQFE 2O1UA 2NA2A 1FKAE 4DV6I 4JI7I 2V2VA 2DIXA 4F9CB 1WHQA 2FV4B 4LF4E 3OTOI 1EI1A 1UILA 3JAMC 1Z0CA 1STUA 3K85A 2HFUA 1Z5AA 1PKPA 1WUUA 4PRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWD A;  2ZM6 I;  4ED4 A;  4Z7Y A;  3Q1Q A;  4FWG A;  2L2M A;  1XMQ E;  1PVG A;  2X7I A;  1ZM2 A;  2NUG A;  2UXD E;  3J7A G;  2UUA I;  3ZM7 A;  1IBL E;  4JI3 I;  4LF5 I;  4WYQ B;  2A2C A;  2DEI A;  3PYG A;  1Z0G A;  4DUY E;  1ZXN A;  2V2Q A;  4UT4 A;  3QT5 A;  3P1X A;  2UU9 E;  2ZBK B;  3LNU A;  3GON A;  4YHH E;  2BV3 A;  4DPW A;  2E5L E;  4LFC E;  1Z59 A;  2UUB I;  4YY3 I;  2B3T B;  4ZVI A;  2UXB E;  1I94 E;  4JI2 I;  2EZ6 A;  2L33 A;  1XMO E;  4DV7 I;  3WU3 A;  4USK A;  1ZM3 A;  4B3S I;  4LF8 E;  4DR5 E;  3V2U C;  4GKJ I;  1Z0T A;  1B62 A;  1N36 E;  1FNM A;  2LJP A;  1YYK A;  4PRV A;  4DV2 E;  5LMU I;  4NXN I;  4R1F A;  4JI0 I;  4JI4 I;  2AJ4 A;  4X65 E;  3LLH A;  4DR3 E;  3T1Y E;  2L2N A;  1MX0 A;  1Z0B A;  4LFB E;  2HK3 A;  2ZIT A;  4LF5 E;  5LMN E;  2X36 A;  1OJ4 A;  1J26 A;  1HR0 E;  2Q2E B;  4LFA E;  1FJG I;  4PU9 A;  3HTX A;  1Z5B A;  1DAR A;  4DPX A;  5CFF E;  3WU6 A;  1UEK A;  2LTS A;  2J7K A;  4JYA E;  4DR2 I;  1J5E I;  2RSM A;  1H7S A;  4GKK I;  2V8P A;  3B82 A;  4KQV A;  1GQE A;  1FWL A;  1IBK I;  1HNZ E;  4DV3 E;  4B3R I;  2L3J A;  1KIJ A;  4DPT A;  1N0V C;  1B63 A;  5BR8 E;  4DV5 I;  1NHI A;  3ZKD A;  1MG7 A;  2HK2 A;  1QZR A;  4JI5 E;  4JI8 I;  4I3H A;  3ADJ A;  5LMU E;  4MYT A;  3ADI A;  4Z7C A;  4X64 E;  2LJH A;  3LTO A;  3ADL A;  4DR6 I;  4AQY I;  2JVA A;  1ZM4 A;  5IWA E;  1N33 E;  5GMD A;  2RTX A;  4B3T E;  4DR4 I;  1N32 E;  2L3C A;  1RRE A;  4DXL A;  3VYY A;  3J7A M;  5FLX C;  1O0W A;  4DR1 E;  2OI2 A;  4LF9 E;  4OX9 E;  1FJG E;  4USM A;  4JG4 A;  1UHZ A;  1XNR I;  2JY9 A;  2UXC I;  2DMY A;  2HHH I;  1T4O A;  4KHP E;  2UUC E;  3ZKB A;  1IBM I;  4LF6 I;  3T1H E;  4K0K I;  4DV0 I;  3J81 Q;  4JI1 E;  2L2K B;  4FWH A;  4B3R E;  1RC7 A;  1Z0W A;  2R3V A;  4DV1 I;  1T4L B;  5LL6 R;  4DPU A;  4X8W A;  2BM0 A;  1HNW E;  3K17 A;  4X62 I;  2N3G A;  1D6T A;  3M6A A;  3ADG A;  4DUZ I;  2LBS B;  2LUP B;  4DV6 E;  5GME A;  4RPF A;  4JI7 E;  1Z0V A;  2HKE A;  4HAC B;  1XNQ I;  1H72 C;  3OTO E;  4X66 I;  1N34 I;  4JI6 I;  4DKK A;  2KHX A;  1HNX E;  4HAC A;  3F0N A;  3J80 Q;  2ZM6 E;  3QT8 A;  3J81 C;  4DV4 I;  4M30 A;  4DR7 I;  4WFT A;  1XNR E;  4MYU A;  3D4J A;  2UXC E;  1X49 A;  4WUD A;  1X48 A;  2UUA E;  4JI3 E;  2YT4 A;  4B3M I;  1NHJ A;  4LF7 I;  2XEX A;  1KVK A;  3ZZT A;  1XHK A;  4DPY A;  3WU5 A;  2DB2 A;  1H73 A;  2VQF I;  4JV5 I;  2B7T A;  4EMD A;  1HNX I;  2LRS A;  2UUB E;  2RS7 A;  4YY3 E;  3CWV A;  4FW9 A;  3C4B A;  4LF4 I;  4JI2 E;  4DV7 E;  5L3J A;  4B3S E;  1T4N A;  4GKJ E;  2HKJ A;  4HY1 A;  1XMQ I;  3QT7 A;  1X47 A;  1EKZ A;  3HUL A;  3JAM Q;  2UXD I;  2EFG A;  2VF3 A;  1IBL I;  4NXN E;  2IHR 1;  4JI0 E;  4JI4 E;  3ZZU A;  2F4V I;  2RS6 A;  2LTR A;  4DUY I;  2UU9 I;  1ELO A;  3C4T A;  1U2R A;  4YHH I;  1NZ0 A;  3ZZ0 A;  2E5L I;  4LFC I;  1KKH A;  3B78 A;  2UXB I;  1Z5C A;  2V34 A;  1I94 I;  3H4L A;  2A2D A;  1XMO I;  3PYD A;  5IT9 Q;  4DU7 A;  4LF8 I;  4DR5 I;  4DR2 E;  1J5E E;  4GKK E;  3PYF A;  1KTV A;  4NXM I;  1N36 I;  1IBK E;  4DV2 I;  1YYO A;  3LPS A;  1RR9 A;  2GS8 A;  4X65 I;  4DR3 I;  4DV5 E;  3T1Y I;  4WUB A;  1NHH A;  4JI8 E;  4LFB I;  2N3H A;  1DI2 A;  2HFS A;  4XTJ A;  2WW4 A;  5LMN I;  1VIS A;  2F4V E;  4DR6 E;  4AQY E;  1HR0 I;  4LFA I;  4HXZ A;  1ZXM A;  4DR4 E;  5IT9 C;  2BM1 A;  3PYE A;  1WHN A;  1QU6 A;  4JYA I;  1N0U A;  1PIE A;  2NPF A;  3WU4 A;  4HYM A;  1S4E A;  1HNZ I;  2HHH E;  4UTG A;  4DV3 I;  2CPN A;  2NUE A;  1IBM E;  4LF6 E;  4M1K A;  1H74 A;  5BR8 I;  1YYW A;  4K0K E;  4DV0 E;  4NXM E;  4JI5 I;  5A2Q Q;  2VQE I;  4X64 I;  1YZ9 A;  3QT6 A;  4DV1 E;  2CZ9 A;  3J7Y p;  5IWA I;  1N33 I;  1EA6 A;  1A6F A;  4X62 E;  4B3T I;  1N32 I;  4DUZ E;  3K1J A;  3J80 C;  4P7A A;  4DR1 I;  4LF9 I;  4P52 A;  1XNQ E;  3V5R A;  4WUC A;  4OX9 I;  4X66 E;  1S16 A;  1N34 E;  4JI6 E;  2NUF A;  4OOG C;  2E1R A;  4FN5 A;  4KHP I;  1ZM9 A;  2UUC I;  5FLX Q;  1ZBT A;  4DV4 E;  1Z0E A;  2MDR A;  4DR7 E;  3T1H I;  4M2Z A;  5A2Q C;  4URL A;  3B8H A;  4JI1 I;  1FI4 A;  1BKN A;  1H7U A;  4B3M E;  2R42 A;  2DEJ A;  4LF7 E;  1K47 A;  3VYX A;  2V2Z A;  1MU5 A;  1HNW I;  4DU8 A;  2B7V A;  2VQE E;  2LUQ A;  1FWK A;  2VQF E;  1RQ0 A;  4JV5 E;  2NA2 A;  1FKA E;  4DV6 I;  4JI7 I;  2V2V A;  2DIX A;  1WHQ A;  4LF4 E;  3OTO I;  1EI1 A;  1UIL A;  3JAM C;  1Z0C A;  1STU A;  2HFU A;  1Z5A A;  1PKP A;  1WUU A;  4PRX A; 
#chains in the Genus database with same CATH topology
 2BA1 G;  4FWD A;  2ZM6 I;  2EOE A;  4ED4 A;  2HGH A;  1PJT A;  4Z7Y A;  3JTZ A;  3Q1Q A;  4FWG A;  1AH5 A;  5AE2 A;  2L2M A;  2YTP A;  1XMQ E;  1PVG A;  3QG5 C;  2O1W A;  3U1K A;  1G2F C;  2X7I A;  1ZM2 A;  2NUG A;  2UXD E;  1EH7 A;  3J7A G;  2UUA I;  2PO0 A;  1T39 A;  5JEA C;  3ZM7 A;  1IBL E;  4FW4 A;  2EN2 A;  4JI3 I;  2YTG A;  4MU0 A;  4HEI A;  3NZK A;  4MU1 A;  4LF5 I;  2EL4 A;  4WYQ B;  1AAY A;  4F54 A;  2A2C A;  2EPO A;  2DEI A;  2EMC A;  2PO2 B;  3PYG A;  1Z0G A;  5IXM B;  4DUY E;  2JE6 B;  1ZXN A;  4IFD B;  2V2Q A;  4UT4 A;  3P1X A;  2UU9 E;  3QT5 A;  2ZBK B;  2M7Q A;  4F6N A;  3LNU A;  3GON A;  4YHH E;  2BV3 A;  4DPW A;  2V86 A;  2E5L E;  4LFC E;  2PO2 A;  2YTO A;  3HPZ A;  1Z59 A;  2UUB I;  3HXL A;  4LCH A;  5K36 C;  3KZZ A;  1Y4S A;  4YY3 I;  2B3T B;  4BHB A;  2JE6 A;  4ZVI A;  2UXB E;  4IFD A;  2EM3 A;  2A25 A;  1E3H A;  5C0X B;  4R2C A;  1I94 E;  2EM2 A;  1Y5Y A;  1Y60 A;  4QNJ A;  2JR1 A;  1IMU A;  4JI2 I;  2EZ6 A;  2L33 A;  1UN6 B;  1XMO E;  4WSG A;  4DV7 I;  3C6K A;  4O4K A;  3WU3 A;  3DJW A;  2JYA A;  4USK A;  1RMD A;  2ENH A;  2EPC A;  3EPH A;  1ZM3 A;  4B3S I;  2EOO A;  4LF8 E;  2CSH A;  4DR5 E;  4FW7 A;  4N3O A;  5FWK A;  3V2U C;  5C0X A;  1Z0T A;  4GKJ I;  1DGC A;  4MU3 A;  2DSY A;  2LMZ A;  1B62 A;  3IWB A;  4BA1 B;  4R2R A;  1N36 E;  1FNM A;  3MHS C;  1YYK A;  4FK5 C;  2LJP A;  4IZK B;  1R6M A;  4PRV A;  4DV2 E;  5LMU I;  2EQ3 A;  2EN7 A;  4O24 A;  4NXN I;  4R1F A;  4JI0 I;  4JI4 I;  3THN A;  2Q8U A;  4X65 E;  4WXC A;  2AJ4 A;  1TN9 A;  3LLH A;  4DR3 E;  4BS9 A;  3PS1 A;  4RH8 A;  2EPL X;  3L00 A;  2L2N A;  3T1Y E;  4L5N C;  1MX0 A;  2Z5E A;  1ZU1 A;  2EMF A;  4O5G A;  1X3C A;  1Z0B A;  2PNM A;  1ZBQ A;  2YTJ A;  3UHM A;  4LFB E;  4GEQ B;  2HK3 A;  4ZYD A;  2ZIT A;  2K7I A;  4HTG A;  4LF5 E;  5LMN E;  5DNL A;  5KL6 A;  2EOR A;  1OJ4 A;  2YTQ A;  1J26 A;  2X36 A;  3K6Q A;  3HJC A;  2EOI A;  1HR0 E;  1QNT A;  2Q2E B;  2MC5 A;  4LFA E;  4R8O A;  4AIM A;  2NN6 B;  1FJG I;  4OO1 C;  2GO3 A;  2WNR B;  4PU9 A;  3HTX A;  1Z5B A;  4J3D A;  2WZO A;  1XXE A;  2WCC 3;  1DAR A;  4DPX A;  5CFF E;  2EOS A;  2DLQ A;  1UBD C;  3WU6 A;  1P47 A;  1UEK A;  1WRJ A;  4AID A;  2LTS A;  2EM0 A;  2J7K A;  4FW6 A;  1A1L A;  4JYA E;  2NN6 A;  2KON A;  2EMY A;  2M4I A;  2WNR A;  4DR2 I;  1J5E I;  4WX9 A;  4IZJ B;  2RSM A;  1H7S A;  2KOU A;  2V8P A;  4GKK I;  5DRQ A;  2DGC A;  3B82 A;  4IFD C;  4KQV A;  1GQE A;  1FWL A;  2YSO A;  2F8B A;  2LT7 A;  1IBK I;  1HNZ E;  1YUI A;  2YU5 A;  4MLV A;  4R2S A;  4DV3 E;  5DRR A;  5A69 A;  2LE2 A;  5DRO A;  4B3R I;  2L3J A;  2RQL A;  1KIJ A;  1N0V C;  4DPT A;  4RHB B;  5BR8 E;  1B63 A;  4IZJ A;  2DLK A;  2R1F A;  1YSA C;  4DV5 I;  3BF2 A;  1NHI A;  3ZKD A;  3VHT B;  3AUZ A;  2V87 A;  1MG7 A;  1QZR A;  2HK2 A;  4JI5 E;  2EOM A;  5C0X C;  4JI8 I;  3LML A;  3AV0 A;  4I3H A;  3ADJ A;  5LMU E;  4MYT A;  3BBG A;  4MLQ A;  1NCS A;  3EPK A;  3ADI A;  4X64 E;  2LJH A;  4U3B A;  4Z7C A;  2WBT A;  2BR2 A;  3LTO A;  4I8O A;  2CG9 A;  3ADL A;  2HC5 A;  1A1J A;  4DR6 I;  4AQY I;  3P76 A;  2JVA A;  3M7N D;  1ZM4 A;  5IWA E;  1N33 E;  1A1F A;  1TF6 A;  5GMD A;  5F3W A;  2RTX A;  2VRD A;  4B3T E;  2EOZ A;  3DD6 A;  3PS2 A;  1N32 E;  2EOX A;  4IS9 A;  2FGG A;  2V89 A;  2L3C A;  5EL9 A;  4DR4 I;  2I13 A;  1RRE A;  1YFH A;  4DXL A;  2EOF A;  3VYY A;  3J7A M;  2EPU A;  2EM9 A;  5FLX C;  1A1I A;  1O0W A;  4DR1 E;  4P7D A;  1KJK A;  2OI2 A;  4LF9 E;  4ISA A;  4BC7 A;  1VI7 A;  2ENC A;  5A6B A;  1IQS A;  4OX9 E;  1FJG E;  2Z5C B;  1ZR9 A;  4USM A;  2EWL A;  4JG4 A;  1UHZ A;  2YTI A;  1XNR I;  2JEB B;  2EP3 A;  4L8N A;  4OO1 B;  1P42 A;  2JY9 A;  2UXC I;  2EN3 A;  2DMY A;  3EQ1 A;  1ZAA C;  3U1Y A;  1SR9 A;  1BBO A;  1T4O A;  5JEA D;  2HHH I;  4KHP E;  2UUC E;  3ZKB A;  2Z5C A;  1IBM I;  4LF6 I;  4R2D A;  3T1H E;  2VES A;  4K0K I;  4DV0 I;  3M7N G;  1PDA A;  2JEB A;  2NN6 C;  4OO1 A;  3J81 Q;  3M99 B;  4WXD A;  4JI1 E;  2L2K B;  4FWH A;  4B3R E;  4BBY A;  1JK2 A;  2ENA A;  2K4V A;  1RC7 A;  1Z0W A;  2R3V A;  4DV1 I;  1T4L B;  5LL6 R;  5K36 D;  4DPU A;  4X8W A;  2BM0 A;  1HNW E;  5A6K A;  1GTK A;  2EMH A;  1L4S A;  2MC6 A;  3K17 A;  3HQ1 A;  5DRP A;  4X62 I;  2N3G A;  1D6T A;  3THO B;  3M6A A;  3PS3 A;  3ADG A;  4DUZ I;  2RSI A;  2LBS B;  2LUP B;  2E1M A;  4WPY A;  4DV6 E;  1UDO A;  4RPF A;  5GME A;  4JI7 E;  1EH6 A;  5KL5 A;  4N4R B;  1Z0V A;  4IS1 C;  2HKE A;  4HAC B;  4TUI A;  1XNQ I;  2EPP A;  2EPN A;  2GO4 A;  1LLM C;  1H72 C;  3OTO E;  2C37 B;  2JWO A;  4Q28 A;  4X66 I;  1N34 I;  2YTN A;  4J8Z A;  4JI6 I;  3IWC A;  4DKK A;  2KHX A;  1HNX E;  4HAC A;  3F0N A;  2JOX A;  2NAB A;  3J80 Q;  2ZM6 E;  4F9A B;  3QT8 A;  3J81 C;  4FW3 A;  5DNY A;  4DV4 I;  4M30 A;  4DR7 I;  2EML A;  2EM4 A;  4WFT A;  2C37 A;  3BID A;  1XNR E;  2O3Z A;  4MYU A;  5KL3 A;  5JEA E;  3D4J A;  2UXC E;  2EE8 A;  1X49 A;  4MDT A;  4WUD A;  3P06 A;  1X48 A;  2UUA E;  2O1V A;  4LPF A;  4JI3 E;  2YT4 A;  4B3M I;  1NHJ A;  4KZS A;  3L7Z A;  2AE8 A;  2XEX A;  3JU0 A;  4LF7 I;  1KVK A;  3ZZT A;  2EMX A;  1Y6Z A;  2EJ4 A;  2L8T A;  1XHK A;  2CVE A;  2JEA A;  4GZN C;  4DPY A;  3WU5 A;  4F6M A;  5AC4 A;  3DF6 A;  4R03 A;  1T38 A;  1OYP A;  5JEA F;  2DB2 A;  1DQ3 A;  2V83 A;  1H73 A;  1Z1B A;  2GPI A;  2VQF I;  2B7T A;  4DMI A;  4JV5 I;  4EMD A;  1HNX I;  2LRS A;  2V88 A;  2UUB E;  3P3G A;  2RS7 A;  2EMK A;  1SFE A;  4YY3 E;  1JK1 A;  3CWV A;  5ELW A;  3GLL A;  4FW9 A;  2EM7 A;  3EPJ A;  3C4B A;  4LF4 I;  2JXP A;  4OKG A;  4IFD D;  2EMB A;  4JI2 E;  3UK3 C;  4OZE A;  3IWD A;  4DV7 E;  2B9D A;  4M0V A;  5L3J A;  2F1D A;  2C39 B;  3VK6 A;  3HKM A;  5K36 F;  4B3S E;  3Q6N A;  1T4N A;  2LCE A;  4GKJ E;  2HKJ A;  4HY1 A;  2BR2 B;  4R2E A;  1XMQ I;  3QT7 A;  1X47 A;  1EKZ A;  5C0X D;  3HUL A;  3JAM Q;  2ODR D;  2JPA A;  2C38 B;  2EFG A;  2VF3 A;  2UXD I;  2C39 A;  2EN8 A;  1YHC A;  1IBL I;  4NXN E;  2IHR 1;  4JI0 E;  4JI4 E;  1X6F A;  2EMW A;  2EM8 A;  3ZZU A;  3M85 D;  2EL6 A;  1PJS A;  2F4V I;  4ZYG A;  2RS6 A;  2PRT A;  2EN4 A;  2LTR A;  2C38 A;  4DUY I;  2EPX A;  2PNZ B;  1ELO A;  2JP9 A;  2J65 A;  2UU9 I;  3C4T A;  1U2R A;  1USU A;  2YRM A;  3H09 A;  2BBG A;  4YHH I;  1NZ0 A;  3ZZ0 A;  4LCG A;  2E5L I;  4BMJ A;  1KKH A;  4LFC I;  2EMZ A;  2MDG A;  3B78 A;  2WBS A;  1X6H A;  1A1K A;  2UXB I;  2O1T A;  5T6J A;  2L6M A;  5AAS A;  1Z5C A;  2V34 A;  2PNZ A;  1I94 I;  2E72 A;  2JOB A;  3H4L A;  2A2D A;  2EM6 A;  2EN1 A;  1XMO I;  3PYD A;  5IT9 Q;  4DU7 A;  2YTD A;  4LF8 I;  3M85 G;  3CDI A;  1MGT A;  3EPL A;  4DR2 E;  1B69 A;  1J5E E;  4MU4 A;  3ZOQ B;  4DR5 I;  4GKK E;  1N3G A;  3PYF A;  2NN6 D;  1KTV A;  3F6H A;  4NXM I;  2EOQ A;  4M9V C;  2Z5B B;  3GME A;  1N36 I;  1IBK E;  3MHH C;  2YTE A;  4DV2 I;  1YYO A;  2GLI A;  4NHR A;  4U3D A;  3FIG A;  3LPS A;  2LJU A;  4Q35 B;  1RR9 A;  2GS8 A;  5C0X E;  4X65 I;  4DR3 I;  4DV5 E;  4IJD A;  2YU8 A;  4R2P A;  3P3E A;  2VF1 A;  2HJJ A;  4WUB A;  3T1Y I;  2FTX B;  2GHF A;  1NHH A;  4IFD F;  4IZJ D;  2Z5B A;  2DMI A;  1KYQ A;  2YPN A;  2CGE A;  3H1C A;  4KWY A;  2EMI A;  3MSW A;  4P78 A;  4JI8 E;  4R2Q A;  2N3H A;  4QNK A;  4LFB I;  1YUJ A;  1A1G A;  1DI2 A;  5AE3 A;  1Y4U A;  2H36 X;  2ELZ A;  2HFS A;  3ECR A;  2IOP A;  2MKD A;  2WW4 A;  4XTJ A;  3HPS A;  3Q6M A;  5LMN I;  4X9J A;  1VIS A;  2F4V E;  4DR6 E;  3GCM A;  2YRH A;  4AQY E;  4FW5 A;  1HR0 I;  4NZV A;  4LFA I;  5C0X F;  2PNL A;  4HXZ A;  2LV2 A;  1ZXM A;  2BB8 A;  4LU9 A;  4DR4 E;  5IT9 C;  2BM1 A;  1WHN A;  3PYE A;  4BCA A;  2J7J A;  3OML A;  1QU6 A;  1UDN A;  5AE1 A;  2EPZ A;  2MKN A;  2JT2 A;  4JYA I;  2EMA A;  2I9I A;  1N0U A;  1PIE A;  4AM3 A;  2L92 A;  2LVH A;  2NPF A;  3WU4 A;  3L7Z B;  5A6B D;  4F2J C;  5DNX A;  2EL5 A;  1G2D C;  4HYM A;  4WSP A;  2EOY A;  1S4E A;  2LO3 A;  1HNZ I;  2HHH E;  2GQ0 A;  4UTG A;  3CDJ A;  4DV3 I;  5TSE A;  2JEA B;  2CPN A;  2NUE A;  4GQU A;  2M1S A;  1IBM E;  2NN6 E;  2BA0 D;  4LF6 E;  1X6E A;  2V8Q B;  1H74 A;  4LCF A;  4M1K A;  5BR8 I;  1YYW A;  1WXR A;  4K0K E;  4DV0 E;  1WJP A;  3TQM A;  3PRY A;  4BHC A;  4NXM E;  2YWQ A;  3KRN A;  1EH8 A;  1F2I G;  1IQO A;  4JI5 I;  4NBQ A;  2ADR A;  5A2Q Q;  5AC5 A;  4OO1 D;  3C6M A;  4ZYE A;  2VQE I;  4X64 I;  1HK7 A;  2CTD A;  3KZY A;  5K36 E;  1YZ9 A;  3QT6 A;  1NEI A;  2EOH A;  4DV1 E;  4BA1 A;  1YH8 A;  1GZ6 A;  2EM5 A;  2CZ9 A;  2NN6 F;  3J7Y p;  5IWA I;  4IZK A;  1EA6 A;  1N33 I;  2YZT A;  1A6F A;  4X62 E;  4B3T I;  1N32 I;  1UDQ A;  2EMG A;  4DUZ E;  3K1J A;  4BC9 A;  5JEA B;  3J80 C;  2WP8 B;  4MQY A;  2G7H A;  1R6L A;  4P7A A;  4DR1 I;  2BA0 G;  4LF9 I;  4P52 A;  4TUG A;  1XNQ E;  3V5R A;  4WUC A;  1BBG A;  4OX9 I;  2ELY A;  2PO1 B;  4F9B B;  2EPR A;  4LOM A;  4X66 E;  1E3P A;  1S16 A;  1N34 E;  3B4T A;  5IV8 B;  3RMP A;  5JEA A;  4JI6 E;  2NUF A;  2WP8 A;  2N8X A;  4OOG C;  2EN6 A;  4LTY A;  2M9A A;  2R76 A;  2E1R A;  4FN5 A;  1PJQ A;  1USV A;  1ZM9 A;  2UUC I;  5FLX Q;  2WBU A;  4KHP I;  1ZBT A;  2CT1 A;  2YSP A;  2IOQ A;  5KL4 A;  2PO1 A;  5K36 B;  4DV4 E;  1Z0E A;  2MDR A;  4DR7 E;  3T1H I;  1MEY C;  4M2Z A;  2EQ0 A;  2EPK X;  2V85 A;  5A2Q C;  4BA2 B;  2EPM X;  1TF3 A;  4URL A;  3B8H A;  4JI1 I;  1X5W A;  1FI4 A;  2EOJ A;  5KL7 A;  2D9H A;  1BKN A;  2IES A;  1H7U A;  5LLQ A;  2RPC A;  4B3M E;  2EQ1 A;  2YTF A;  2R42 A;  2DEJ A;  5K36 A;  2BA1 D;  2VE7 C;  1UDS A;  4ZYH A;  4LF7 E;  1K47 A;  1OYS A;  4OO1 E;  4R2A A;  4BA2 A;  1A1H A;  3VYX A;  2V2Z A;  1MU5 A;  1HNW I;  2ODR C;  3KWR A;  5ADZ A;  4DU8 A;  2B7V A;  3F6G A;  2VQE E;  2IER A;  2LUQ A;  2EPA A;  1RQ0 A;  2VQF E;  4JV5 E;  1FWK A;  2NA2 A;  1FKA E;  2O1U A;  4DV6 I;  1BB8 A;  4JI7 I;  2V2V A;  5EKW A;  2DIX A;  4F9C B;  1YPN A;  4IFD E;  1RHY A;  3BGH A;  1WHQ A;  2FV4 B;  4LF4 E;  4O43 A;  3OTO I;  4OO1 F;  1EI1 A;  2DRP A;  1UIL A;  3JAM C;  1Z0C A;  1STU A;  3K85 A;  5A6J A;  1Z5A A;  2HFU A;  3P3C A;  1PKP A;  5KL2 A;  1WUU A;  4PRX A;  2YRK A;  2PO0 B;  1OYR A;  5A6A A; 
#chains in the Genus database with same CATH homology
 4FWD A;  2ZM6 I;  4ED4 A;  4Z7Y A;  3JTZ A;  3Q1Q A;  4FWG A;  5AE2 A;  2L2M A;  1XMQ E;  2O1W A;  1PVG A;  2X7I A;  1ZM2 A;  2NUG A;  2UXD E;  3J7A G;  2UUA I;  3ZM7 A;  1IBL E;  4JI3 I;  4LF5 I;  4WYQ B;  2A2C A;  4F54 A;  2DEI A;  3PYG A;  1Z0G A;  4DUY E;  1ZXN A;  2V2Q A;  4UT4 A;  3P1X A;  2UU9 E;  3QT5 A;  2ZBK B;  2M7Q A;  3LNU A;  3GON A;  4YHH E;  2BV3 A;  4DPW A;  2V86 A;  2E5L E;  4LFC E;  3HPZ A;  1Z59 A;  2UUB I;  3HXL A;  4YY3 I;  1Y4S A;  2B3T B;  4ZVI A;  2UXB E;  1I94 E;  2JR1 A;  4JI2 I;  2EZ6 A;  2L33 A;  1XMO E;  4DV7 I;  3WU3 A;  3DJW A;  4USK A;  1ZM3 A;  4B3S I;  4LF8 E;  4DR5 E;  5FWK A;  4N3O A;  3V2U C;  4GKJ I;  1Z0T A;  2DSY A;  2LMZ A;  1B62 A;  3IWB A;  1N36 E;  1FNM A;  2LJP A;  1YYK A;  4IZK B;  4PRV A;  4DV2 E;  5LMU I;  4NXN I;  4R1F A;  4JI0 I;  4JI4 I;  2AJ4 A;  4X65 E;  3LLH A;  4DR3 E;  4BS9 A;  3T1Y E;  2L2N A;  4L5N C;  1MX0 A;  2Z5E A;  1Z0B A;  2PNM A;  1ZBQ A;  4LFB E;  4GEQ B;  2HK3 A;  2ZIT A;  4LF5 E;  5LMN E;  2X36 A;  1OJ4 A;  1J26 A;  3K6Q A;  3HJC A;  1HR0 E;  2Q2E B;  2MC5 A;  4LFA E;  4R8O A;  1FJG I;  4PU9 A;  3HTX A;  1Z5B A;  2WZO A;  1DAR A;  4DPX A;  5CFF E;  3WU6 A;  1UEK A;  2LTS A;  2J7K A;  4JYA E;  2KON A;  2M4I A;  4DR2 I;  1J5E I;  4IZJ B;  2RSM A;  1H7S A;  2KOU A;  2V8P A;  4GKK I;  3B82 A;  4KQV A;  1GQE A;  1FWL A;  2F8B A;  1IBK I;  1HNZ E;  4DV3 E;  2LE2 A;  4B3R I;  2L3J A;  1KIJ A;  4DPT A;  1N0V C;  5BR8 E;  1B63 A;  4IZJ A;  4DV5 I;  1NHI A;  3ZKD A;  1MG7 A;  3AUZ A;  2V87 A;  2HK2 A;  1QZR A;  4JI5 E;  4JI8 I;  3LML A;  3AV0 A;  4I3H A;  3ADJ A;  5LMU E;  4MYT A;  3ADI A;  4Z7C A;  4X64 E;  2LJH A;  3LTO A;  4I8O A;  2CG9 A;  3ADL A;  4DR6 I;  4AQY I;  2JVA A;  1ZM4 A;  5IWA E;  1N33 E;  5GMD A;  5F3W A;  2RTX A;  4B3T E;  4DR4 I;  1N32 E;  2FGG A;  2V89 A;  2L3C A;  1RRE A;  4DXL A;  3VYY A;  3J7A M;  5FLX C;  1O0W A;  4DR1 E;  4P7D A;  2OI2 A;  4LF9 E;  4BC7 A;  2Z5C B;  4OX9 E;  1FJG E;  4USM A;  2EWL A;  4JG4 A;  1UHZ A;  1XNR I;  4L8N A;  2JY9 A;  2UXC I;  2DMY A;  2HHH I;  1SR9 A;  1T4O A;  4KHP E;  2UUC E;  3ZKB A;  2Z5C A;  1IBM I;  4LF6 I;  3T1H E;  4K0K I;  4DV0 I;  3J81 Q;  4JI1 E;  2L2K B;  4FWH A;  4B3R E;  4BBY A;  2K4V A;  1RC7 A;  1Z0W A;  2R3V A;  4DV1 I;  1T4L B;  5LL6 R;  4DPU A;  4X8W A;  2BM0 A;  1HNW E;  3K17 A;  2MC6 A;  3HQ1 A;  4X62 I;  2N3G A;  1D6T A;  3M6A A;  3ADG A;  4DUZ I;  2LBS B;  2LUP B;  2E1M A;  4WPY A;  4DV6 E;  5GME A;  4RPF A;  4JI7 E;  1Z0V A;  2HKE A;  4HAC B;  4TUI A;  1XNQ I;  1H72 C;  3OTO E;  2JWO A;  4Q28 A;  4X66 I;  1N34 I;  4J8Z A;  4JI6 I;  3IWC A;  4DKK A;  2KHX A;  1HNX E;  4HAC A;  3F0N A;  2JOX A;  3J80 Q;  2ZM6 E;  4F9A B;  3QT8 A;  3J81 C;  5DNY A;  4DV4 I;  4M30 A;  4DR7 I;  4WFT A;  1XNR E;  4MYU A;  3D4J A;  2UXC E;  1X49 A;  4WUD A;  3P06 A;  1X48 A;  2UUA E;  2O1V A;  4JI3 E;  2YT4 A;  4B3M I;  1NHJ A;  4KZS A;  4LF7 I;  2XEX A;  3JU0 A;  1KVK A;  3ZZT A;  1Y6Z A;  2L8T A;  1XHK A;  4DPY A;  3WU5 A;  3DF6 A;  4R03 A;  2DB2 A;  1DQ3 A;  2V83 A;  1H73 A;  2VQF I;  4JV5 I;  2B7T A;  4DMI A;  4EMD A;  1HNX I;  2LRS A;  2V88 A;  2UUB E;  2RS7 A;  4YY3 E;  3CWV A;  4FW9 A;  3C4B A;  4LF4 I;  4JI2 E;  3IWD A;  4DV7 E;  2B9D A;  4M0V A;  5L3J A;  3VK6 A;  4B3S E;  3Q6N A;  1T4N A;  4GKJ E;  2HKJ A;  4HY1 A;  1XMQ I;  3QT7 A;  1X47 A;  1EKZ A;  3HUL A;  3JAM Q;  2ODR D;  2UXD I;  2EFG A;  2VF3 A;  1IBL I;  4NXN E;  2IHR 1;  4JI0 E;  4JI4 E;  3ZZU A;  2F4V I;  2RS6 A;  2LTR A;  4DUY I;  2UU9 I;  1ELO A;  3C4T A;  1U2R A;  1USU A;  3H09 A;  4YHH I;  1NZ0 A;  3ZZ0 A;  2E5L I;  4BMJ A;  1KKH A;  4LFC I;  3B78 A;  2UXB I;  2O1T A;  5T6J A;  2L6M A;  5AAS A;  1Z5C A;  2V34 A;  1I94 I;  2JOB A;  3H4L A;  2A2D A;  1XMO I;  3PYD A;  5IT9 Q;  4DU7 A;  4LF8 I;  4DR5 I;  4DR2 E;  1J5E E;  3ZOQ B;  4GKK E;  3PYF A;  1KTV A;  3F6H A;  4NXM I;  2Z5B B;  1N36 I;  1IBK E;  4DV2 I;  1YYO A;  3FIG A;  3LPS A;  1RR9 A;  2GS8 A;  4X65 I;  4DR3 I;  4DV5 E;  3T1Y I;  2VF1 A;  4WUB A;  2FTX B;  1NHH A;  4IZJ D;  2Z5B A;  2CGE A;  4P78 A;  3MSW A;  4JI8 E;  4LFB I;  2N3H A;  1DI2 A;  5AE3 A;  1Y4U A;  2H36 X;  2HFS A;  2IOP A;  2WW4 A;  4XTJ A;  5LMN I;  3HPS A;  3Q6M A;  1VIS A;  2F4V E;  4DR6 E;  4AQY E;  1HR0 I;  4LFA I;  2PNL A;  4HXZ A;  1ZXM A;  4LU9 A;  4DR4 E;  5IT9 C;  2BM1 A;  1WHN A;  3PYE A;  4BCA A;  3OML A;  1QU6 A;  5AE1 A;  4JYA I;  1N0U A;  1PIE A;  2L92 A;  2NPF A;  3WU4 A;  4HYM A;  4WSP A;  1S4E A;  1HNZ I;  2HHH E;  2GQ0 A;  4UTG A;  4DV3 I;  2CPN A;  2NUE A;  2M1S A;  1IBM E;  4LF6 E;  2V8Q B;  1H74 A;  4M1K A;  5BR8 I;  1YYW A;  1WXR A;  4K0K E;  4DV0 E;  3PRY A;  4NXM E;  4JI5 I;  5A2Q Q;  2VQE I;  4X64 I;  1HK7 A;  1YZ9 A;  3QT6 A;  4DV1 E;  1GZ6 A;  2CZ9 A;  3J7Y p;  5IWA I;  4IZK A;  1EA6 A;  1N33 I;  2YZT A;  1A6F A;  4X62 E;  4B3T I;  1N32 I;  4DUZ E;  3K1J A;  4BC9 A;  3J80 C;  2G7H A;  4P7A A;  4DR1 I;  4LF9 I;  4P52 A;  4TUG A;  1XNQ E;  3V5R A;  4WUC A;  4OX9 I;  4F9B B;  4X66 E;  1S16 A;  1N34 E;  3RMP A;  4JI6 E;  2NUF A;  4OOG C;  4LTY A;  2E1R A;  4FN5 A;  4KHP I;  1USV A;  1ZM9 A;  2UUC I;  5FLX Q;  1ZBT A;  2IOQ A;  4DV4 E;  1Z0E A;  2MDR A;  4DR7 E;  3T1H I;  4M2Z A;  2V85 A;  5A2Q C;  4URL A;  3B8H A;  4JI1 I;  1FI4 A;  1BKN A;  1H7U A;  4B3M E;  2R42 A;  2DEJ A;  2VE7 C;  4LF7 E;  1K47 A;  3VYX A;  2V2Z A;  1MU5 A;  1HNW I;  2ODR C;  3KWR A;  5ADZ A;  4DU8 A;  2B7V A;  3F6G A;  2VQE E;  2LUQ A;  1FWK A;  4JV5 E;  1RQ0 A;  2VQF E;  2O1U A;  2NA2 A;  1FKA E;  4DV6 I;  4JI7 I;  2V2V A;  2DIX A;  4F9C B;  1WHQ A;  2FV4 B;  4LF4 E;  3OTO I;  1EI1 A;  1UIL A;  3JAM C;  1Z0C A;  1STU A;  3K85 A;  2HFU A;  1Z5A A;  1PKP A;  1WUU A;  4PRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...