1KKHA

Crystal structure of the methanococcus jannaschii mevalonate kinase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
317
structure length
317
Chain Sequence
PRGSHMIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Methanococcus jannaschii mevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Mevalonate Kinase
total genus 104
structure length 317
sequence length 317
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2001-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1kkhA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1kkhA01
1HNXI 4X62E 4JI4E 4FW9A 1ZXNA 4LF9I 4GKJI 4AQYI 1Z0WA 1ZM3A 3WU6A 1H73A 4M1KA 4JI5I 4B3MI 1N32I 1MU5A 2WW4A 4OX9E 5L3JA 2F4VI 4DV1I 4GKKI 2UUBI 4PRXA 4DV7I 1Z0EA 4LF6I 2UUAI 4FWGA 1FNMA 3F0NA 4LF4I 4FWDA 4YY3I 3LTOA 4GKJE 4X65E 4LF6E 1ELOA 4USMA 4P7AA 1EA6A 3QT7A 4JYAE 4JYAI 1N32E 3J80Q 4JI6E 2Q2EB 4HACA 2V2ZA 1H7UA 3M6AA 2EFGA 2HKEA 4WUCA 3J81Q 2OI2A 4X64E 2E5LI 2VQFI 1N0UA 2CZ9A 4LFAI 2UUAE 4K0KE 1IBME 1Z5CA 4YHHE 2X7IA 4B3RE 3T1HE 4JI1I 1KTVA 4YHHI 4DUZE 4GKKE 5IWAI 1QZRA 2HFSA 1PKPA 4DV7E 3Q1QA 1I94I 4X66E 5GMEA 4X64I 3PYEA 4DU8A 2HHHE 2BM1A 1XMQE 4DR2I 5FLXQ 3T1YE 3T1YI 4X62I 4LF9E 4LFCE 1XMQI 4JI5E 4DXLA 1NHIA 4DV6E 4X66I 2LJPA 1J5EI 4OX9I 1IBLI 1Z5AA 2UU9E 4WUBA 4WUDA 4DV2E 4MYTA 4DV5E 2V2QA 4DR3I 4FWHA 4JI7I 3PYFA 2VF3A 4JI2I 4JI8I 3CWVA 1HNWE 2HK3A 1Z0TA 4R1FA 3ZM7A 2DEJA 4DPTA 1ZM2A 1IBKE 2V2VA 4JI6I 4DPYA 4URLA 4DR7I 1XMOI 1N0VC 3B82A 1HR0I 1VISA 2UUBE 4B3TE 4LFBE 4NXMI 3B78A 3J80C 2UXCI 4Z7YA 1Z5BA 1N36I 4B3ME 1S4EA 1Z59A 1S16A 5LMNI 4JV5I 4Z7CA 2ZBKB 1Z0BA 1KIJA 4UT4A 1B63A 3OTOE 2VQEI 2AJ4A 1UEKA 4LF7I 2UXDI 3V2UC 1PIEA 3QT6A 4HYMA 1KVKA 2BM0A 1XNQI 5A2QC 3V5RA 5LMUE 3ZZTA 4DV1E 1U2RA 3K1JA 2F4VE 3WU3A 5IT9Q 1XMOE 4DR7E 4LF8I 4AQYE 4JI0E 4JI0I 2UUCI 1HNXE 4JI3E 1RR9A 1NHHA 1ZXMA 1FKAE 3B8HA 4DR4I 1MG7A 4P52A 2X36A 2XEXA 2UXBI 2ZM6E 5BR8I 4B3SI 2R42A 1ZM4A 4DR1E 3WU5A 5BR8E 3D4JA 5LL6R 4DV3E 4LF5E 4PU9A 1NZ0A 1B62A 1N34I 1N34E 3K17A 5FLXC 2UUCE 1FJGI 4EMDA 1HNZE 1XNRE 4RPFA 1N33I 2DEIA 4JV5E 2J7KA 5A2QQ 5GMDA 4DV0E 4DV0I 1A6FA 1ZM9A 4DUYE 3ZZ0A 4HY1A 4KHPI 4LF5I 4DV4I 4DV4E 1NHJA 2A2CA 2HFUA 4JI3I 4JI2E 4USKA 3GONA 4LFBI 4LF8E 4DV3I 4DUZI 4B3RI 2UXBE 4NXNE 1XNRI 4MYUA 1DARA 4HXZA 4DPWA 1XNQE 4KQVA 1KKHA 4DR6E 4KHPE 1WUUA 1IBKI 1MX0A 3LPSA 2UXCE 1BKNA 4DR3E 2GS8A 3LNUA 2ZM6I 3JAMC 4NXME 4JI8E 4DR5E 4DUYI 1FWLA 4B3SE 2ZITA 4DR6I 4ED4A 4XTJA 1FJGE 3OTOI 1Z0GA 4DU7A 2VQFE 1FWKA 4FN5A 4DPUA 4NXNI 3ZZUA 1N33E 3PYDA 5LMNE 4JG4A 1RREA 5IWAE 4DR5I 4JI1E 3HULA 5LMUI 1Z0VA 3QT5A 1H7SA 5IT9C 2R3VA 1FI4A 4LF7E 2UXDE 4JI7E 2V34A 4YY3E 1OJ4A 2V8PA 1HNZI 1D6TA 2E1RA 4UTGA 4B3TI 2NPFA 4DV2I 3H4LA 2HKJA 4HACB 1Z0CA 1N36E 1IBMI 3J7AM 2VQEE 4DV6I 4DPXA 1XHKA 1I94E 4DR4E 3J81C 1J5EE 1EI1A 1PVGA 2HK2A 4LF4E 3J7AG 2BV3A 1K47A 3WU4A 3ZKBA 2UU9I 3ZKDA 4LFCI 1IBLE 2A2DA 4K0KI 4DR2E 2E5LE 4X65I 1HNWI 3T1HI 4PRVA 4ZVIA 3JAMQ 4DR1I 4DV5I 3QT8A 4I3HA 3PYGA 1H74A 2HHHI 1HR0E 1H72C 4JI4I 4LFAE
chains in the Genus database with same CATH superfamily
4CYUA 3G8TA 2L48A 4LF5J 4M8LA 5JJBA 2LU1A 4M1KA 3P3DA 3CW2C 3R7BB 4RLEA 1PG5B 2WRMA 3C6TA 5ETMA 5J1EA 1N32I 1H7WA 2CZVC 2WCXA 3UI3A 1BQNA 3W65A 1U4BA 4WTYA 5M2UA 2C2EA 2RS2A 3NLCA 2MZSA 4DQPA 4G1QB 5E0OA 5J2NB 1XWLA 3W2VA 2KRBA 2MQ8A 3ET6B 4C48A 4RL1A 2F7VA 4RO0A 2DHXA 3V6KA 4DV1I 1F3VA 4FW6A 2ADBA 1H2VZ 2I5JB 2HNYB 4PG4A 5HLFA 2IESA 3T6JA 2XB2D 1Z2LA 1U7LA 4ANCA 2FC9A 1SIZA 2RD5C 3QWUA 1QSLA 2PFFB 4PRXA 3MTJA 4JI3J 2MQNA 2VPZB 4HTIA 4NCGB 4O4RA 4WKRA 4MIBA 5DO2A 4LSNB 3TO8A 5E3RA 5KT7A 5JVHQ 1HQEB 1CBKA 1W7WA 3MM5A 4HDHA 5A8WB 4JB8B 3VAIA 2DPIA 3FBFA 4N41A 4NMXA 1TAUA 3Q8QB 3RAMA 4KO0B 3KG0A 4X4RA 1AFIA 2LKZA 3CJKB 4A8QA 1U1NA 1HHTP 2ZZNA 1S1WA 2XYGB 3FVYA 2EK6A 2DGVA 3EPGA 2GMJA 5D6GA 2Z5BA 5E3AA 4ZVEA 3SSRA 5C0XF 3HKMA 3DI6B 1EETA 3Q8YA 4B3TE 2GJ2A 3A1YG 4LF4I 4QR1A 1RHMB 3KUEA 1C0TB 1OPZA 2E5HA 2YNFA 3LANA 2JWNA 1BXNA 1GX6A 1MU2B 2FJBB 5HP1A 1T05A 1KQFB 5L46A 1NB2A 2AYEA 2NYHA 2AF6A 2MZ1A 3MPYA 3NGUA 3B4DA 1R43A 1JIHA 4ELUA 1V5VA 5ETKA 5G0RB 4ED1A 3CD6S 4Y0FA 4GKJE 1XC9A 3UCUP 5D3GB 2POKA 1ELOA 3W9IA 2KTQA 5I42A 4P7AA 5EX0A 1Q53A 3G6XA 3P06A 2ZVSA 3MGJA 2HHTA 1Q0NA 3O1LA 5I42B 4KGMA 1RTIA 2COLA 3GMGA 4JYAI 1FD2A 2JFDA 1D9AA 4Y6IA 3VF0B 3FEYB 1F0XA 3TX8A 2CJKA 4PUOB 5KAKA 2YY3A 3I0RA 3PFOA 3J80Q 3BS9A 4FPRA 3UN3A 4ZCMA 2WZ1A 3CUNA 2F4FA 1YJVA 2O66A 1JLCB 2V2ZA 3R8YA 2X36A 1LKZA 1Y10A 3G8QA 4LVNP 4X65F 3OUYA 3EMTA 4KYZA 2ZFHA 1Q16B 2XCPA 1AB8A 1I94F 1H7UA 3EJMA 3I5AA 4BBYA 1DQ8A 3KHGA 2GHPA 5LMUJ 1GK8A 3UD5A 3SCLE 1ZS6A 1S1XA 3U02A 2QSFA 1S4FA 1FXLA 2C39A 5DGAA 5MLCV 3NY0A 2PGCA 4FYXB 3R3TA 3R7SB 2VJUA 3PZPA 1RCXB 2YNGA 1E6VB 1OMSA 5I3PA 3M9MB 1N0UA 4KFBA 2F3JA 5JEAC 1E6YB 5KG0A 2E9ZA 4GQUA 5EWGA 2M9KA 4OYAA 1IBME 2YKNA 1Y60A 2X7IA 2QX0A 2AZ3A 1AZSA 3FBCA 3SCKE 4OO1C 1VGYA 3ZZRA 2QL7B 3T1HE 3DOLB 4ETZA 2W2MP 1RT1B 3PEJA 1Q1KA 2XMJA 2FZCB 2KI2A 2VG6A 2E9RX 1FKOB 3AB4B 4M5KA 3PKYA 2QJ3A 1X8DA 3OW2R 2HFSA 3CSKA 4ID5A 2PN6A 2W01A 4OYOA 3QATA 2P2CB 3KYLA 4LRBA 4LSLB 4LFCF 4NYPA 4C3LA 5DLGA 2HBZB 3CCQS 2QE5A 1HW8A 1TKZB 5HANA 4LF6F 1YRTA 3H2VE 4G1QA 1LEOA 1LW0B 1S6PA 2MZQA 5GMEA 1U1QA 2GHVC 4PWWA 2WBRA 1FEHA 5LSLA 3DLKA 4NX9A 2UXBF 2BM1A 2RQ4A 3KDOA 5L1LA 3FQKA 4NOHA 3UDLA 3SV4A 1KC8T 3T1YI 4ETXA 4UZBA 4E0DA 1UWBA 4LF9E 1IKWB 3HHLB 3CO9A 1XMQI 1FX4A 1C2PA 3R5DA 1Y3JA 3BB5A 3PJ9A 2B43A 2NXUA 2H48B 2YWEA 4ZLLA 2MKHA 3WX8A 3OV7A 3UCZP 2J65A 3ITHA 1HNZJ 2FY8A 1NHUA 4EWTA 5LT5A 2GMLA 3C16B 3ISZA 1SKRA 1RBOB 2WSEC 3C14B 3C6UB 2EWHA 2BZ2A 2DYAA 2PMHA 2RKIB 3FKBA 1XMOF 4TU7A 1T9WA 2CIMA 2LFVA 4G1IA 4NLUA 2OTJS 1U24A 1BQNB 2FGCA 3FEZA 1Z5AA 3H1CA 4H4KA 4RUAA 1NKEA 2O1UA 2W24A 3OXGA 4MYTA 4WUDA 4DV5E 1YI2S 1HR0J 4KAIA 4JI7I 1LWCA 2VF3A 4UUWA 4J9LA 1UVMA 4HYKA 2CKWA 3CULA 3OSNA 2AT1B 2KXFA 5L1KA 2FHJA 1FRLA 2O1TA 1B70B 2ATCB 4JI8I 1YH8A 4QZVB 2XULA 5T41A 3R5JB 2ROEA 4F3QA 3ELHA 4PG7A 1FO1A 1U6ZA 1U1MA 4OZ2A 4FXDA 4NCBA 3BSAA 2HBYB 2PO2B 5JEAF 2V4QA 2LECA 2DRBA 2I0XA 1BC6A 4DPTA 3UD4P 2VPXB 2G1HA 4JI6I 3EE3A 4TQSA 1LWXA 4KY3A 3RZAA 3OL9A 1RTJB 2JT2A 3UDVA 1VBKA 2XMUA 1VISA 4YY3J 1ZOTA 3SCJE 4DS5A 3P6YC 3LP1B 1RLCL 5DS7A 3J7YU 2GQ0A 3P3EA 4RW6A 3MM8B 4F26A 4J9MA 3SDEB 5AT1B 2UUWA 4TU9A 2DGSA 2DGOA 2XZTB 3DRPB 4F0HA 2C39B 2UXCI 3AQOA 4O44B 1Z5BA 5CYJA 5A6WA 3OTBA 2W9BB 4EBCA 2HG4A 5HAOA 1GX5A 4B3ME 1RWNB 1X5TA 3K57A 1S4EA 2CADA 2RDJA 1UVIA 2DNQA 1BE4A 2XY6A 1Z59A 1FCAA 4F02A 2CPDA 2LXFA 5ETRA 4ELVA 2XS5A 5BXIA 4ED0A 2HFZA 4EEYA 2NUUG 2KHDA 5LMNI 3GFXA 2XWYA 4DI6A 1N6QB 4PUOA 1XMBA 4ES3A 2ZBKB 1KIJA 4UT4A 2CPZA 1IKYA 1B63A 3I56S 2X1GA 1WHXA 1S1UB 2V0NA 3MMAB 4OYWA 4LSLA 5B7WA 5RUBA 1CQMA 3DOMA 1NH8A 5FLXU 2YNHB 2BA1G 1RWUA 2VQEI 1UDQA 3ZTPA 3CMQA 4X84A 4OIXA 3JYTB 4LF7I 3M7VA 5JXSA 4DL7A 1VQ4S 2VQEE 3CPWR 4X4VA 4U7UD 2R7OA 1KVKA 4DZDA 3D6FB 1TL1A 1B64A 2UUTA 2XMTA 3J80Y 2XY5A 4NXMF 4YDDB 4X62J 1PBUA 2UUCF 3NBPA 1XNQI 5CYMB 5DETA 3J7Z5 1DTTB 5A2QC 3W5XA 3V5RA 2VG7A 2B7CB 3HKZD 3BZQA 4LT6A 3H7HB 4RBTA 4MMOA 5CZVA 1OS5A 1EKSA 1S1TA 2K3IA 2WHOA 5CYMA 3OL7A 2W9AA 2HFOA 4U96A 4IZKA 3DLEA 3WU3A 5KFTA 4HLBA 1N33J 5IT9Q 4RNOA 1U48A 4IYQA 9RUBA 2WAQD 4AD6A 2VG6B 4K0KJ 2QMXA 2HYIB 2B8QA 1SI9A 2ZH2A 2J9DA 1WSRA 2GZOA 2HMIA 1JJCB 2LLZA 2R2UA 4IOBA 1VS3A 2XHWA 5LMUF 3RRHA 1GH8A 3M8SA 2BANA 1DZ5A 2LYVA 1RT6B 2WSFC 4ZKAA 2R8IA 4DL5A 1U49A 1RWKB 1NHHA 4KFBB 3I9V9 1LWFA 1PC4A 1FKAE 4DR4I 5FDLB 1MG7A 1X5PA 4QNJA 4P52A 1R89A 2I5JA 2DNMA 1NJYA 2FJXA 1NDCA 3ETOA 4WP3A 2MKKA 1SBRA 2DH9A 3D0GE 4UUXA 5HVFA 4CM0A 4OHVA 2ZH8A 2O3ZA 4J5OA 2UXBI 4M5DA 1QAJA 4UY8T 3F56A 1JKHA 4PWDB 2R42A 1ZM4A 4WE1B 1CLFA 4IDKB 2LEPA 3MCOA 4KIAA 5BR8E 2CPJA 4DCPB 3JQMA 3I9ZA 3ZNJ1 2K06A 4IDKA 3AXKA 3EXCX 1RXOB 4LFCJ 4Y2MA 1V5IB 1WEYA 4LF5E 3HFVA 1NZ0A 1U1KA 4P2MA 3UO0A 4OYZA 3DLKB 1EETB 2V8HA 1HNVA 2YBVA 3KUGA 4NZ7A 4K7QA 1HWJA 5LJ3Y 2R7XA 3M6UA 1H3DA 2EFOA 2JVOA 1TL3B 4I7FA 5DDRC 5CD4A 2W1BA 1T94A 4EMDA 1FJGI 2BEFA 2ALYB 2IM3A 4O4GB 3SMZA 2E1CA 3OQ2A 2MDAA 1N33I 2IY5B 1J5EJ 2CQHA 4R5PB 8RUCA 2C3MA 3V6HA 4Q8FA 3QRQA 4HI1A 2ZUGA 4PXEA 3G71S 4I2PA 2FQQB 4HH1A 4YR0A 1ZYQA 1M5OC 3HSJA 5G0RA 3HM9A 1D0EA 2CRLA 1SV5A 1FD8A 2B5JB 2D3UA 2PEHA 4TVAB 4BWJA 1A6FA 3VQTA 1L3SA 5KG4A 4LR9A 2ZH4A 2DGUA 4HY1A 3ZTQA 4KHPI 1X0PA 5KFGA 5KFJA 1IKVB 2OPPA 3NOGA 2V63A 3BN7A 2YTCA 1NHJA 1OYRA 4R0JA 2A2CA 3UFCX 3W63A 5HMYA 1UL3A 5KFSA 4L6V3 4GC7A 2HHWA 2VG7B 1KDNA 3C3LA 3PNIA 2VQEF 3PCOB 3VALA 2BOAA 2VPYB 3BGRA 4FVMA 4BC7A 4JI7F 1FJGF 2FPHX 3IR7B 4AL7A 4X64J 4DUZI 3R5AA 4CO2A 1PYSB 2LEAA 1RACB 1NK8A 1VIOA 3WHIA 4KPYA 5HJYA 1XNRI 1TK8A 3C2PA 2GAGC 4EU0A 5ETQA 2JLEA 3CDBA 2FVPA 1DARA 3NWGA 1ZPVA 1KONA 2V94A 5K20B 4AIDA 1Q5YA 2NN6E 4KQVA 4BA1B 1XNQE 1R6VA 2QL5B 1KKHA 2NR0A 4DR6E 1RWOB 2UVVA 1N6QA 1BD6A 4NZ0A 1VI7A 3Q8PB 3OJSA 5K14A 4ZIVA 3RR7A 4N8NA 3GSDA 4RNMA 3T1YF 1V9OA 2XG8A 1UEVA 3ENWA 4FYVB 2GVDB 3TEGA 1R6MA 3IM8A 4DS4A 1G6BA 4K5SA 1KN6A 3GIIA 2UXCE 3NS6A 4L72B 4DR3E 2JHEA 1SJQA 2GS8A 4CI0B 4CWBA 4JV5F 4U7UK 1VK3A 4LUBA 2QA4G 4K5RA 3ZTRA 6FD1A 2ROPA 3ONQA 4TKTA 4D3GA 2BKNA 5EUHA 4DFJA 1DLOB 2YKPA 2FHMA 3CJRA 1F1BB 3CVKA 3WX4A 1SIWB 3BQ0A 1DAXA 1FWLA 2HQ3A 2FGOA 2W7OA 1S0OA 4OO1E 4NLQA 3OFGA 1NAQA 4K59A 5IFMA 1UEUA 3TZWA 4PXBA 5HN0A 2DNKA 3GWCA 3NCQA 4MFBA 1MWQA 2E5IA 3PRVA 5G4DA 4PYAA 2RDIA 3I5CA 1T8EA 4ED4A 2FTRA 3JSBA 4J90A 2DHHA 1YJ9S 1EIYB 3HJFA 3UWTA 5AJ3J 1RHYA 1S1UA 2MLYA 3MR5A 1K44A 1RK8A 3KLGB 2HHVA 2HHHE 3CD0A 3AXMA 2MHEA 3BF4A 2VQFE 2BJ3A 2P5VA 2YVSA 3QIPA 1RAJA 3CE8A 3HVWA 3ILOA 3LP2A 3W61A 2UXCJ 2W2NP 2N7CA 4U8YA 1VC6A 2KYXA 5HL7Q 3M30A 4DPUA 4IZJD 4USIA 2HQIA 4NXNI 1R0CB 2HMIB 2WW8A 1CULA 1N5YA 3MTKA 1P1LA 3LO3A 4H4KC 3IC1A 2QSWA 4PWUA 2FUG9 3UVJA 2KN4A 4L74A 4F0KA 3GV8B 2RRAA 5IWAE 3HCXA 4LFBF 4DV1J 4HHHA 4OHZA 1YJTA 3US5A 4F67A 1HWUA 3T1HF 5DM7Q 1HBMB 3POTB 4M5DB 2F9JA 3BKFA 3G82A 2H5IB 3QT5A 4J91A 4Q45A 4ED2A 4JYAF 2PO4A 2NN6D 4GKJJ 5IT9C 3M8PA 3T5KA 4TLRA 1WWHA 1M90T 4KGZB 3FMBA 4LF6I 2O67A 2FVRA 4DN9A 2Z2ZA 1EX8A 3AODA 3THPA 4NLGA 2MSTA 2D7SA 2IYGA 2RE1A 3OTDA 1TL5A 4QWDA 3G87A 2AWZA 1UDNA 2RF2B 1G1XA 3K2YA 1VIXA 1UW9A 1NH7A 3GV5B 2V8PA 2BBEA 2W9CA 2PO1B 1S9FA 1N4LA 1SXLA 2VICA 3K5MA 3DLGB 4LF4J 5B08A 1HBOA 2CGEA 1QD1A 2Q6BA 2DJWA 4KGXB 3OFEA 4OO1F 4IH6A 2KXNB 3SXLA 2JSXA 1C1BB 4RBVA 1RP5A 4I6WA 4URGA 3C19A 4WJBA 2DK2A 3BSCA 3P96A 5KFNA 1U47A 3D6HB 2K7KA 3FGVA 3KLIA 4HACB 1LFWA 1IN0A 1P27B 1L3TA 2DISA 1IBMI 5IT9Y 1KOOA 1N5SA 2W2PP 5J2MA 5HSPA 3QZ8A 1Y0HA 2X3GA 3QBCA 4K4UA 5GAHU 4JV5J 2RKIA 1CJTB 1P6TA 2O3DA 3A8KA 3A8IA 3R5GA 4WIIA 4YB7A 4Y00A 5AE1A 3LA0A 2YNIB 2NZ4A 5KTQA 2JOQA 3C8YA 3DOMB 4WFBQ 3A13A 3SIPB 1J2VA 2FLPA 2DNZA 4NE9C 3KLGA 1TUGB 5BYQA 4Q7AA 1JJHA 1QAYA 4B9TA 3E2EA 5H9FK 4LF4E 2IYIA 2BV3A 4HH0A 4RNNA 2ZH6A 2NXNA 1VFJA 5L9XA 3WU4A 3LP0A 3MZIA 4P9SA 2C3UA 3WIVA 2OD6A 4GKKJ 3G2XA 3UDEA 2BA0D 4LF8J 2ZBCA 2HFNA 1N5YB 1RWMB 4EO8A 2JH3A 2ZUAA 4QPXA 8ATCB 1FX2A 5B0DA 1F6TA 4KBIA 2PEBA 4G3IA 4X4SA 1RAHB 1B4SA 2YWGA 3KJNB 4PYDA 3ZTSA 1BWEA 2E5LE 3PJXA 3BSOA 3LUYA 3PTWA 3AJ1A 4C8ZA 4D3HA 1YRUA 4ZJQA 3MHYA 2VQEJ 2HVHA 2W7PA 1FRJA 1QVGR 1BQXA 4NCAA 4ZVIA 4FYYB 2HQFA 4FNIA 1NEEA 1HI1A 4OV1A 2X1AA 2KVIA 3MM9B 1T95A 4A8XA 3PG9A 4MK7A 1RT1A 4X66F 2XQCA 1PGZA 3KUHA 4H4MB 1LW2A 2MB0B 3JAMQ 1CG2A 3OFHA 4TY8B 3SCIE 3PO5A 4ED7A 3QLHA 1UDOA 3TX0A 5ITHA 3R1LA 3TUPA 4I3HA 4AFFA 3Q6NA 2N3LA 2YKNB 1WELA 3PYGA 4AL5A 1H74A 2DD8S 4UTGA 4NWBA 2XNQA 1H6KX 4OHXA 4FZVA 4O3PA 4A48A 4AXJA 2PO0A 2IVMA 1HR0E 3R27A 3IAS9 2RHSB 5J2NA 3J7A1 1TFWA 3G82B 2B4OA 3MD3A 3QGPA 2F65A 1R3NA 4X62E 4FW9A 1ZXNA 4IRDA 4FS2A 1FWPA 1V3ZA 4DFPA 4C7QA 1NJZA 1ZM3A 4DWIA 1OSDA 3T9NA 2CDQA 5J2QA 1TL4A 2DH7A 3UNGC 5IV3A 2RRBA 4B08A 1NK7A 1HQEA 1Q4RA 2V69A 2UUCJ 1RTHB 1HYSA 4DSEA 3RGIA 3M30B 4OX9E 1WF0A 5L3JA 1DTQA 2Q1LA 1GAOA 1MN7A 2DGXA 5BYSA 4DQQA 1BQMB 1KWMA 2CNLB 2HQCA 3DN9A 3NGRA 1OQ3A 4HR2A 4DR5J 4E2FB 2QIFA 4ZLJA 3UQSA 4DR2F 4ZCLA 1I3OB 2PC6A 5HROB 5EN1A 5JEAD 3CB4A 4DV7I 3S8SA 2HGMA 5D77A 1YLXA 5DZ7A 2P6TA 2PSZA 3JQKA 3GTYX 4WBFA 5K5MA 3N6MA 4I69A 1HNIA 4HI2A 3DLEB 1D8YA 2RSQA 2RHQB 2JEFA 4K4ZA 4NXNF 1FFWB 4OYXA 2R8HA 4P71A 4DL2A 5DNXA 2XMWA 3MEKA 3TZYA 4TU8A 2P9CA 2CQ0A 5GAGI 2BOPA 3V4IA 3TQ1A 1DURA 5IC6B 1IBMF 3F0NA 1N88A 1RJJA 2IRYA 4DFKA 3PHEA 4WFYA 1NPPA 1F9EB 4DDFA 2UXBJ 4OLOA 1RT4A 1S59A 4FP9A 4NXNJ 2X51A 3M6WA 4CCHA 2VODA 1KVJA 2IHR1 2UUBF 1S1WB 2JEAB 1XN9A 4K8RA 4RW8B 1GMUA 2RMLA 3KLHA 3PX4A 4LFAF 4NA2A 1WTBA 2VV5A 2RT3A 4JV1A 4LMZA 3IS9B 4A4JA 4IRKA 4YY3I 1KHWA 1O5JA 3H5UA 4X65E 4LF6E 3FSXA 4UY85 3OTOJ 5BR8F 2CPIA 1AT1B 3VAFA 3MMBB 3GJSB 4OI1A 5DZ6A 2F1FA 3SFUA 2NN6C 4FKXA 4BA1A 2Y9HA 4C8LA 1G2EA 5J2MB 4N3OA 3QYYA 3K8VA 2CPYA 4ZLNA 3KHRA 4OYMA 2NREA 2V5HG 2DH8A 3IGVA 4OYIA 4WXOA 4DV7J 4WZQA 2HWHA 4C11B 2UXDF 4R8UB 4YB6A 4YR2A 1AROP 2OAUA 5K9FA 3R2CJ 2NQPA 3J81Q 4U6PA 3UD3P 2N4CA 3RB6A 4ILMA 5FIIA 3RW6A 3M7ND 5DG7A 4X64E 2VONA 1UWAA 4DX5A 1X5OA 1UJ5A 5A8RA 1FJCA 1RHKB 4DLGA 1HI0P 4Q0BA 2RQMA 2LEBA 3BH7B 4GRSA 2WVCA 4I6AA 6AT1B 4ZIWA 3MUMP 2LQJA 2Q79A 1Y5IB 3D2WA 3J81j 4EZ6A 2UUAE 1TL1B 1UJ4A 1FK9A 2H4YB 2WOMA 3LWMA 3JYTA 1NPRA 2ZHOA 4KH0B 4MFBB 2ERRA 2LQ8A 3MCMA 4X4NA 2WSCC 4B3RE 3BN4A 2B4PA 4M5NA 4C3MA 3R1HA 1HNXJ 4L3NA 3TZZA 1PJ7A 1XNQJ 2F4VF 1EJ7L 4YHHI 4ZVHA 4DUZE 3OJUA 3R2DJ 2GV1A 3G96A 1N36F 1ZA1B 4DR4J 4OX9F 4DR2I 3ZFVA 1PKPA 1MSWD 2BJEA 2FZKB 5KFIA 1NK5A 4UOFA 1J5OA 3NGDA 4DV7E 1SC3B 3MM6B 3Q1QA 1S1TB 4DR2J 4X66E 1NZAA 3H5XA 4X64I 2IAJA 3MR6A 4DR3J 2HBRB 4DU8A 3UDCA 1HHSA 3CCMS 4OJGA 4ANEA 3P3GA 2OFHX 3C6TB 3I32A 1NSPA 4IFYB 1MWYA 5DQGA 2IA6A 1N54B 2XGQA 2WNRB 1MMDA 3D67A 4GKKF 2JEJA 2MHNA 3T1AA 4FF3A 2AD9A 4U3BA 3IBFB 1RBLA 1HKAA 1I6JA 2DY9A 3E01B 1TKDA 5A0YA 2AP6A 3PRBA 4JI5E 1CJKA 5GAEU 4C8NA 4OI0A 4DV5F 3GG0A 3FCWA 2CQPA 3P45B 2B8PA 1W2BR 2KG0A 2KU7A 3W8GA 1X4CA 1PJ6A 4KGVB 5F9NA 1J5EI 2OTLS 4QWEA 2XWXA 4MIAA 1C0UB 3TWZA 1N56A 3T5LA 2WVFA 2ZWOA 3AT1B 3T3FA 2VG5A 3WZ0A 4X66J 3ZZZA 2JL9A 2HZCA 3H40A 4WUBA 2RDDA 3UN2A 4LREA 1QTMA 3TVKA 2HRTA 4FWHA 1EHWA 2DKOB 1EP4B 3W2WA 1NNDA 4ZJLA 2ROGA 4NRUA 1J5EF 4JI3F 4ED5A 4JI2I 3V4MA 4B3OA 4WFXA 3CJTA 3CWVA 5KT2A 2BRKA 4HT5A 1OQ6A 1VHFA 4CIOA 4DUZF 3T5HA 2RILA 1N36J 3LP1A 4DR4F 2HK3A 4QYZJ 3M2UA 3MCNA 1T0TV 3BYRA 3CIMA 1SV5B 5KG3A 2XGPA 1VC5A 4R1FA 5KT6A 1S9EA 3K5OA 2DEJA 1F3FA 1FDAA 3BGOP 3HJVA 4M5GA 5D0RA 3KK3A 4DR3F 2D69A 2YQ0A 1YK9A 1FERA 1ZA2B 2V2VA 2VHGA 1S57A 1FRIA 2B4VA 3TAMA 3VV2B 2MQMA 3PX0A 1TL3A 4I7FB 4DX7A 1IBLF 1N0VC 4F0MA 2K1RA 3FFIB 1VQ8S 4QIFA 3NNAA 1SVDA 1EQMA 1O0PA 1JLGA 1WHWA 3CJQA 3W8PA 5AE3A 3PRYA 4NXMI 3GV7B 1MNEA 2RVJA 7AT1B 3IFEA 1KR4A 4JOUA 4NLRA 1DQAA 2KM8C 5C0XA 2FHOB 1N36I 1WHYA 2VFTA 2LXUA 2M2BA 4UOGA 2ZZMA 1JLCA 1RHRB 4YHHF 1KD1T 2I2YA 4NI2B 4P74A 2KFYA 3D7SB 3CCLS 5ETOA 3RU0A 3BO2A 5B0EA 1JK9B 3H4DA 1VQ9S 2EFQA 2C42A 4OQJA 2LU2A 5AXNA 2Z8QA 1T3NA 3LF0A 2UP1A 3EWGA 4JV5I 2PNZA 1ULRA 2EFVA 3T6BA 4WF9Q 2DNGA 1HK7A 3KK1A 2RQCA 3U1LA 4DSJA 2RH3A 2DNLA 3BJYA 1MROB 3PX6A 5FDLA 1RTIB 3CIZA 4JP8A 3ZNUA 3CJ3A 3UNYA 4OO1B 1OY6A 1S77D 3LGNA 4DF4A 2W9CB 4A8KA 3BH6B 1ROFA 3QGIA 2AHOB 2NXEA 1XERA 2NXJA 2VQFJ 2HNZA 2PA8D 3E51A 5HBMA 5LMNF 1XMQF 1C1CA 2XLIA 4ECXA 5BJRA 2UXDI 1J27A 4TY8A 2FVQA 1Y4SA 3R6GB 2IOPA 3EDQB 1ACMB 3FUYA 4H4MA 3TEHB 5SZTA 3UHMA 1VR6A 2E5GA 2KT2A 4MJKA 4W90B 2KB2A 2B9EA 3TA1A 3V81A 4GC6A 2Z5EA 4YN3B 4RWXA 1Y6ZA 3KOAA 1XNRF 1N32J 5IWAJ 2LP4A 4F3OA 4ECWA 2V67A 3D3BJ 5LMUE 4YDXA 3MR3A 4DV1E 2D74B 3BEGB 1GMVA 3CO0P 4OZ3A 2W25A 1KQKA 1RBAA 2KZZA 3K8WA 3K1JA 4IFDB 1JLEB 3QFWA 2FJDB 2A3JA 4H54A 4C11A 4YS2A 1LNQA 5A2QU 5CH7B 1RKIA 4K4YA 4IFVA 4DR7E 4YP3A 4FW5A 2JLGA 3NNHA 3CC2S 4WE1A 1RDRA 3JQJA 3IN5A 2XNRA 2JEBB 5FLXY 1VQYA 3FCVA 4J3DA 1NBEB 3I0SB 4I2PB 4LF8I 1FKOA 2CQ2A 4YUDA 5HO4A 4JI0I 3I4HX 2XSJA 2UUCI 4DMZA 3VCDA 5KFEA 3C16A 7FD1A 1OWXA 2VC1A 3N5BA 3BQ1A 1TKTA 1BQMA 2MKIA 2A0FB 2DXDA 2Z2YB 3C14A 3D9BA 4OZLA 1TKTB 5L38A 4EYIB 2GQ2A 4JI8F 2J6UA 2WONB 5EHHA 4KH1B 4B9VA 2DRAA 2X3DA 4DV0J 2E5JA 5KG6A 3W2VB 5D4NA 4PAAA 2OPSB 1DJ0A 2OPRA 3H0PA 1SH2A 4B3SI 2IM1A 3LPEA 2BE9B 3GFZA 3CD7A 1R8HA 1NHVA 4DL0C 5A2QY 1CJKB 2D1CA 1X4BA 4CYUB 3EZUA 3OBIA 4WWSA 4C0HA 5A8KA 2QA4S 3JTNA 3KLVA 3QAUA 5K36B 2JC1A 1PYOB 5F0UA 4CTAA 4OZNA 2HHHJ 2A10A 1FJ7A 2BE2B 3NXZA 1LOUA 2WK4A 1B62A 3UW1A 3GCMA 2G9OA 3U1KA 2R7RA 1N34E 1NPKA 1TV6B 3CJKA 3K17A 5FLXC 4N7TA 3I6PA 2UUCE 2C2KB 3MFHA 4ZVUB 5MAOA 3R6LB 1HNZE 2VBYA 3HMJG 3N5FA 3OPKA 1BWVA 4GVBA 1NO8A 5BYRA 1D1UA 1Q78A 3C46A 3VZIA 2HVZA 3VAGA 4JUZA 1MWZA 3TW0A 2D3O1 4USWA 2J0QD 4RUBA 5GMDA 2DHAA 4USUA 4M63A 4CO3A 4ZLPA 1CQNA 1S6QB 3OLBA 4DV6J 5J2PA 3V6DB 3CJ0A 4DV5J 2L3MA 3DGPA 3GSIA 3PW2A 2DR7A 5F8NA 4DR5F 3I4PA 5JEAB 1BGXT 3DNCA 1KFDA 1Q5VA 2M52A 3HFKA 1FE4A 3IG1A 4LF5I 1HWIA 4EZ9A 1UCNA 3KK1B 4Y28C 1IBKF 2DHGA 2HFUA 3MWBA 1UVLA 1U8SA 2AKWB 2D9OA 2EBEA 4PZVA 3KMQA 3PS1A 4RW4B 4JI2E 4LRDA 2B9WA 1D8ZA 1WJ9A 3CJ5A 2H5JB 4KGKA 4WYWA 1USUA 1R0BG 2XI3A 1RISA 3JTPA 3PRDA 5ETLA 3PW5A 4A46A 1WF1A 3CT9A 2H1YA 2UVWA 3P76A 2UXBE 1IM6A 2V8VA 2ZNZA 3HI9A 2OIHA 2WNRA 2HHQA 1MMLA 4NXNE 4RKUC 1USVA 3ICLA 2MSSA 4DX6A 2FD2A 2NUHA 3QGGA 4QQBA 5IQQA 4C97A 4RUCA 3MM8A 3G6YA 3CDWA 1IJFB 1QTNB 2YNHA 3HX9A 4YB1P 4A8SA 1RWXB 1U1PA 3D6TB 4C0BA 3MMAA 4DPWA 4ZITA 4JI4F 2NZCA 4DV3F 3TUIC 1UVNA 1X4HA 4DL6A 2DPJA 4LF6J 4U7CA 2B5JA 3HP6A 1CS4B 3EUNA 4U95A 1T9UA 2HIQA 4KHPE 4KC5A 4X4UA 1M0SA 2VFVA 2FVCA 2K3KA 2M88A 4CNZA 2VU5A 4IFDC 1GQEA 5KG1A 1JLAA 2V4RA 4F3MA 4C9DA 2Z30B 4GVLA 3L7PA 4FVCA 3EGVA 3BBFA 2DNNA 1FEEA 3N6LA 1X9MA 2GO4A 5C0XB 5E41A 1V3SA 2KJVA 5B0AA 5KT5A 3I31A 1WDDA 3DRRB 3M05A 2K7JA 2XS2A 2ZDPA 3L7ZA 4ID5B 4EUVA 4JI8E 1L3KA 1WOPA 2ZBPA 3D5MA 5E3CA 3S1TA 4CQ1A 1L3UA 2UUAJ 2IJFA 3FCHA 4DR5E 4B9MA 2AYMA 3NMRA 2YWWA 4O3RA 4ZOSA 2VZ9A 2UXCF 1B0PA 2EFPA 2E7WA 4J7CA 1AA1B 2RF2A 4HL9A 4JV0A 1HQUB 2OJ3A 2L9DA 2VFRA 2J8AA 2ZITA 3M4XA 1TVRA 3MMCB 1H2UX 3QFHA 3G6ES 3CF5Q 4C6AA 4DF8A 4DR6I 1X4EA 5D4OA 1JWWA 3ETMA 1B0TA 3N0VA 3W7BA 2QA1A 2H4WB 3KTQA 1HNWF 1FTRA 4NLWA 3OTOI 2VFUA 3FBEA 1Z0GA 1Q81T 2CVIA 2UU9J 3M8PB 4BDPA 3LH2S 4I68A 4DUZJ 4C8OA 3OVBA 3U1MA 2F8HA 2FLNA 2DIUA 1H38A 1YJUA 4LOMA 4AT1B 3ZZUA 3MEGA 1YQHA 2DR5A 2GO9A 2KFZA 1DTQB 1WC0A 1F5CA 3R5BA 1N33E 1EP4A 5B0FA 2EFNA 5KT4A 4JG4A 3H90A 1P9QC 4ZHRA 2AV5A 4DR5I 1CEZA 3HULA 2QLJB 2ZC4A 4AE5A 1IWGA 4F4KA 2E9TA 2IBOA 3MR2A 2OPSA 3ENQA 1HMVB 1PAEX 1I51B 2CDRB 3D28A 3DMJA 5KFUA 4B3TF 2MTLA 4DL4A 2R7UA 3ILIA 4QR0A 1XJWB 1JJ4A 4DV4F 2QLXA 1NK4A 2NLWA 3C66A 3KFWX 1VK8A 2R3VA 4USTA 4BCAA 3SZ2A 1NK9A 5HATA 1L3VA 2F8EX 1XK8A 2JC0A 3QNWB 4O0NA 4OJ1A 4P2XA 1JXVA 1S1VB 3PIPQ 3MECB 4J9RA 4DPOA 1KQSR 2Z5CB 1TFYA 2HVEA 4CP5A 1W2IA 1MLAA 3JSRA 5L1IA 4DSIA 3MECA 3GG1A 4TY9A 1CJVA 1VBYA 2NS1B 1KRPA 5IV4A 1ZZNA 2M8DB 2JFKA 2BVZA 3IR5B 2GJFA 2B9YA 2EC0A 1IKXB 4O0IA 2XO6A 1NKBA 1U09A 3LWLA 4PG8A 4NLOA 1ZBTA 3S7RA 4DZ6A 3O3LA 1HD1A 3CDIA 3L09A 1D6TA 4RJVA 3DC2A 5LSOA 2YX7A 2ZKUA 1PC5A 1WC5A 2QG9B 3DXSX 1WORA 3UR3C 4DN0A 2BQUA 4WK3A 5H9FJ 1QSYA 2M7SA 2R9LA 3K85A 4B3TI 2L08A 4X2BA 1FJGE 2HWTA 2JZ5A 4CLLA 3VR1A 2C22A 3AJDA 4IUFA 3CDAA 3H4LA 1MW7A 1OY9A 2B6AA 2EG1A 4Y3CA 3X3UA 1U0SA 3OUYB 1QLNA 5HQ8A 3NZKA 4LF4F 2ZEJA 3I87A 1N36E 2LQ5A 4EO6A 1YBUA 2P9EA 4X4PA 3I55S 4LIRA 3KLFA 4B3RJ 3MDFA 2HW3A 2OSQA 5DDOC 3LGHA 3MM7A 1E6YA 2E7XA 1VQLS 1UPMB 3EZOA 2FJVA 2XO7A 4DR4E 3NCRA 2OSRA 4IG0A 1S6OA 3RRGA 3M6VA 5KFKA 3IWXA 1RTJA 1WC3A 1UKUA 1IKYB 2HK2A 3HHKA 4Q43A 2XMAA 5FJ4A 1PVGA 1FXRA 2A1BA 1FRHA 2IM0A 1FXDA 2OEKA 1ZETA 2CAJA 3PKMA 1NXIA 3PS3A 4JI5F 4R8UA 1H98A 5GAGU 3CCUS 1CVJA 3ZKBA 5E5NA 2EW9A 1DRZA 1KNZA 3QO9A 3ZKDA 1DLOA 2CJ9A 1S48A 4B02A 3JAMU 3FC9A 1UFLA 4Q2MA 3TR5A 1HNXF 1UPPA 2R2SA 1M5VC 4BS2A 1UDSA 1LW0A 1Z0EA 4IZJB 2KT5A 3NNCA 4DX8H 1NJIT 1Y11A 1RKJA 3QRPA 3ENAA 3M9OB 1AUSL 4JI5J 2Y3YA 4CRJA 2CJAA 1R0AB 2GIRA 4MU0A 4CLKA 4X65I 1SCJB 1TKXA 2BKPA 2IPOB 1DTTA 3CEDA 1K1SA 4AXIA 5CAAA 4RX6A 3T1YJ 3T1HI 3HKWA 3T9ZA 3G9CA 5LXYA 5K14B 1BLUA 2CNOB 3QJPA 1JLAB 4M5IA 1OYSA 1IUJA 4RWWA 1M1GA 4ZVGA 3PW0A 1N5VA 2HGNA 3ADAC 2BXJA 2I8EA 1Y5NB 3BR8A 4UOCA 4Y65A 5F0WA 2M3DA 3W60A 4DSKA 4DV5I 3NGKA 2EC2A 1F9FA 3CCZA 2GC8A 2Y1IA 4H4OB 2LVWA 2O1WA 2HHHI 4GO5X 4MU3A 4Z37A 5DRRA 1YHQS 2DNHA 1H72C 1N8RT 2GVZB 4B9SA 1VLOA 3BM7A 3KNAA 4FW7A 4JI4I 4LFAE 1HMVA 2Y1LB 2FLOA 4C8KA 1F60B 4ZPTR 3SYZA 2IMWP 4P6QA 3I96A 3HF5A 1SJ3P 2JEIA 1XR6A 3HVAA 3Q23A 4AQYI 1Z0WA 2RU9A 1HBMA 5A8KB 3WU6A 3HFZB 3P3CA 3DDIA 5KFVA 5K8NA 4XDCA 4NLTA 1X4AA 2QTWA 3M1VB 5AJ3F 3M8RA 2NPIA 2W4CA 3TARA 4B3MI 1LWEB 1S9GB 4UOHA 4UZCA 2HEKA 3D66A 3SQOP 1FESA 3NMAA 2W4DA 3GU0A 2WP8B 4DR7J 2EBGA 2PMZD 1JLFA 3W1YC 2F4VI 1LK5A 2H5EA 4CO5A 5KT3A 3TYTA 5M2RA 1AYEA 5KFCA 1SC6A 4J9KA 2R8KA 1JNRB 3FK4A 3GILA 3AY0A 5T7LA 2YWHA 1SL1A 3FRZA 4R25A 4NBQA 2BANB 1OSCA 2BJ9A 4TNOA 4DR7F 5D8HB 2MQQA 2DXEA 4GVBB 2CQ1A 2IOQA 4RW7B 2QT7A 1M5KC 4RW8A 1X7VA 3HSGA 4CLTA 5CA5A 2FHKA 3QAEA 1JLEA 2UUBJ 1YBAA 1HBUA 4JYAJ 2XBPA 4AIMA 3NOCA 1Q86T 1C1BA 4CLFA 4ZVQB 2ZVIA 5C25A 1NKCA 3W9HA 4DEZA 2M5YA 1SQEA 2ATLA 2DNPA 1T05B 2V9WA 1X31C 2WTFA 3QGHA 2LA6A 3O8WA 4WIQA 4ZJOA 3W62A 1SC1B 3R9LA 3Q6MA 1SKUB 1HIYA 4G6VB 4ISAA 4WYLA 3K5NA 2ZE2A 3D68A 2Z5BB 3M32B 4WU3A 4NASA 2BJ1A 4F7VA 3DLHA 3GYNA 4FWDA 9ATCB 1T9XA 4DUTA 1G3OA 7FDRA 2LA4A 1JLQB 1IXKA 2BE7D 3DOKB 3T19A 2DTJA 3LTOA 3VZHA 2C3YA 4C98A 3MUTP 1W25A 3JXOA 4ID8A 4N76A 3FSYA 4USMA 4HHUA 3KG1A 1Y00A 4OV6A 1N34F 2F5GA 1EA6A 3L3CA 1CC8A 3D1OA 3EVMA 3O6QA 3POTA 3QT7A 3W66A 4CO0A 4CO4A 4JYAE 1OPIA 1S7IA 1N32E 4S0MA 2WB1D 2J7WA 5EWEA 2PNZB 5M2PA 5HK4A 1NSAA 4MKBA 2CNKB 3Q2SC 4HACA 2BW7A 4JI0F 4C3KA 4LCGA 1QE1B 2YKQA 1RTDB 5IC4B 4LQ3A 4LF7F 2WBMA 4DCOB 4MH8A 1KLNA 2EFGA 4WKYA 2CPHA 4P7VA 2HKEA 4PPZA 2H9ZA 1RT4B 4ZPCA 5CCLA 3KK2B 4O3NA 2Y0BB 4F50A 2AU0A 1RB0A 2QLBB 1JB0C 4IZKB 3IRXB 2QN6B 1NU4A 2LDYA 4NYOA 2E5LI 4L73A 4OYPA 5KOWA 1Y5YA 1YG0A 1TP7A 2QL9B 5T14A 1OYDA 2VQFI 3MM6A 1X9SA 4QIGA 2HLUA 3K89A 3PV8A 1AW0A 4TXSA 4DV2F 4AYBD 3OR2A 4G65A 2CZ4A 3Q83A 3V81B 1CPZA 5JEAA 2C2OB 5I3QA 3RB3A 4J9OA 2APOA 1EQ0A 1XR7A 4B17A 4ZN3A 3NWRA 2C2RA 2FYXA 2HURA 1VYAA 3P5TL 1LW2B 3BREA 3OVAA 4JI1I 1KTVA 1QM9A 1FT8A 3N6NA 4BC9A 1VBZA 4PQUA 1ITPA 2YQ1A 5IWAI 1U2FA 4GKKE 2N4DA 1TKXB 1QZRA 1YJWS 1RWVB 2PA3A 2KM8B 4LBIA 3FSIA 2QFJA 4FNHA 3D0IE 4ECUA 2QZ8A 3IMQJ 2DNRA 2C38A 3GB0A 5IQ6A 5KFOA 2BMBA 2VKZG 3DLLQ 2J0SD 1FDBA 3RB0A 2CQ4A 3PYEA 2OPQB 2Q3PA 2XYHB 1VQPS 2E5LJ 2J6TA 1NDLA 4F04B 4EGLA 2O1PA 4FF1A 3BKUA 2U2FA 1NB7A 2EEYA 4DV0F 4LBHA 3FZBA 1IJEB 2EXUA 4JI8J 4F2SA 3MEGB 3NKYA 4CNYA 4X62I 3BKTA 1TZ0A 3OXLA 4LR7A 3CMAS 1S0MA 3S01A 1CS4A 2CXEA 2IA0A 4HKQA 5JUMA 5C42A 1Y4ZB 2KG1A 3PW4A 3Q8VA 1ZAWA 3CDEA 4E98A 1KFSA 4I64A 2VBWA 2AEJA 1JXLA 4DV6E 4X66I 5HQLA 3TANA 2OGUA 1VC0A 3VVUA 5CXTA 3B6BA 2CG8A 3RG6A 2GIQA 3E01A 4XDDA 5HVHA 1QY7A 1IKWA 1R8AA 3D1QA 4OX9I 4M95A 3FDSA 2J0XA 5CZXA 4NL5A 3KLEB 4BHQA 1IBLI 4PG5A 1S9EB 2E1MC 1RLDA 3L4BC 1VRTB 4P75A 3HJCA 2WP8A 2BUNA 3KLIB 3K58A 3RBDA 1APSA 2OEJA 2UU9E 5F8IA 1I1GA 2O1VA 1U45A 2LCWA 2V2QA 1S97A 2LXIA 3PIOQ 3HVRA 3U1NA 3FRYA 3FZ2A 3PYFA 1YBTA 4O3OA 1P8GA 4QIWD 2C1EB 3A12A 3SSQA 2ZOFA 2IIHA 3MPUB 4UQTA 3AH6A 3KKFA 2ZJQQ 4MKYA 1REVB 5KFBA 2FC8A 2L9WA 3CJ2A 2MXYA 1HNWE 2GGPA 2IVYA 1JLGB 3DLGA 3MPWA 3KRNA 1HR0F 2DBBA 2J9EA 3AD7C 4DV7F 4QYRA 1R7IA 1F2GA 4K0KI 1HPZB 2QYGA 4RW6B 4Y2KA 1AFJA 5C25B 1N52B 2YPZA 3ZM7A 1HBUB 1SL0A 4ZVSB 2BACA 2BX6A 2IRUA 1ZM2A 3JSMA 1DQ9A 3KJVA 2HVIA 4OO1D 4KHPJ 4P2SA 4DPYA 5CCMA 4X4QA 3Q8SB 1BY9A 4DR7I 3OHBA 2AW0A 3ENVA 3LQVA 3RUBL 3GE9A 1REGX 3ZXWA 2GW8A 2DT9A 3M6XA 3F73A 5T7LB 2Y1JA 2K2PA 5GADI 4RU9A 2PO2A 3J7ZT 4OO1A 3OT9A 1TQLA 5KFFA 3N28A 2M4MA 1RCOB 2F8MA 3TJ9A 1JXEA 5DDQC 3VAMA 2V2KA 3BO4A 1TK0A 2FJAB 4B9LA 2G0JA 4OL8A 4DQRA 1S10A 1RHUB 1VJWA 1ZAVA 2DGWA 2KDOA 3GJTB 3I5BA 5DM6Q 2GNKA 3OLAA 1RU1A 3HD2A 2VIHA 2VESA 1RAGB 1S72S 3QJJA 4F4YA 1LFPA 1S16A 1SH3A 3DLBA 3CDJA 2CQGA 1U1RA 3LAMA 5H9EK 2DCLA 1H0HB 1T11A 3RTVA 1Z0BA 5F8MA 1S5ZA 2DIVA 1XMOJ 1Y3KA 3OTOE 2RIJA 2MZTA 1C4CA 2DRDA 3HVTB 5L8RC 4CH1A 5D3GA 2HHUA 1YWXA 3SBMA 2HHHF 2M0GB 1IKXA 4B3SJ 1GXLA 2YNIA 4P2FA 1FVQA 2AJ4A 2R4FA 4OLPA 4CLZA 4CZCA 4XPEA 2C2NA 2OP5A 3HZEA 3DRSB 1VCTA 4K4TA 3AOAA 1KLMB 2JEAA 3QT6A 4IFVB 1SUQB 2AEMA 3CJ4A 4USHA 3DGVA 2QV6A 2BM0A 2Y1RI 3M8QA 3Q86A 2H54B 1XQIA 3VTIA 4QCLA 1PAUB 2Q43A 3SFGA 2XMMA 4IR9A 4UW2A 4IFYA 3VAHA 5LM7E 2KO1A 1KBRA 3DRYA 3OL8A 3EX7B 2MQOA 3L7ZB 4OX7A 4K4VA 3VVTA 3DU5A 2NSCA 2CQDA 3IR6B 3NS7B 2MQPA 3EYZA 2MJUA 1F5BA 1REVA 5KFPA 4ZPBA 2RB7A 3NEKA 2PT0A 2YKMB 2Y8WA 2IERA 3BGLA 3D54A 3AJ2A 5ETSA 3UVJB 2G4BA 3AD8C 4HHJA 1WG4A 1UJ6A 1BMQB 5I4MA 4B9NA 3W9JA 2G0CA 3OR1A 1HNXE 1U25A 3A8JA 2R8GA 4KJIA 1HQ2A 1FRKA 1S0NA 1QAXA 2JX2A 3H20A 3CCJS 1YJRA 5HI7A 3GFHA 4DCJB 3HLUA 3M2VA 1C0UA 3OD2A 3OR2B 5F41A 5IXUA 3SV3A 2XEXA 1Q8KA 4DFMA 3B4MA 1LXNA 2HBQB 2MJNA 3HSDA 4EYHB 4LF1A 2RUGA 3W3SA 4CLSA 4Q0BB 2GO8A 2VUGA 5BR8I 3BQ2A 5JEAE 2IC3A 3BGFA 1NK0A 1VBXA 5GADU 3TA0A 2ZH5A 1RR9A 2A18A 1NSKL 2JRSA 2K8GA 2XC9A 3WU5A 3ILJA 3NCPA 2UVUA 4CO1A 2JLFA 3DKDA 1VQKS 1S0VA 2PMWA 4YOEA 3UE2A 1MMNA 2KL8A 4PWDA 1NDKA 4E8UA 5HP1B 5LL6R 4DV3E 4OZ1A 4JV2A 2OPRB 5CD4H 4RU2A 1C0TA 2YNFB 3MFIA 4LR8A 1KSPA 4DR6F 2ILYA 1UP1A 1BUXA 3DRXA 4ECYA 3RAXA 2CPXA 3JSYA 1YZ7A 3TAMB 4NMLA 2ZOGA 1EKRA 4OX6A 5L39A 4FXVA 4RPFA 5A76A 4AM3A 2YWFA 1JLQA 3EGWB 1WNEA 5L1JA 1VLYA 1Z1ZA 2CQIA 5C5JA 2J76E 2J7KA 4A8WA 2HLTA 5A2QQ 4FKYA 3KLHB 1CJUA 1ZM9A 2PD1A 4BLGA 1R31A 4R5PA 5HROA 4I2QA 5SUHA 1Q7YT 4LJMA 2FY1A 1XBWA 5EL9A 2PDAA 1N5QA 4ENOA 3HHDA 4IQMA 4OI2A 1TK5A 4JI6J 2YX1A 4IH7A 4W98A 3ULHA 1RU2A 4UQGA 3ISNC 2MEWA 4OYBA 3QJLA 4DV4I 4ECQA 4B3SF 2QGFB 4L75A 2HZVA 1B99A 2G0IA 3IWNC 4MQYA 1K0VA 1RAEB 3HXMA 1M1HA 4CTAB 2FLLA 2UVRA 3GR1A 3OSPA 1S1XB 1WI8A 4ZP6A 5EWFA 3V4IB 2ADCA 3OXFA 4F4XA 1U2CA 3QWPA 2ZWPA 2QMUB 1U6FA 5KG2A 4DV3I 1Q79A 4KHPF 3N9UC 2BR2B 4B3RI 4LSZB 2VB6A 3P49B 3NRBA 3MAQA 4XPCA 2JJ4D 2QRRA 3OTEA 1QUPA 4MYUA 5ETNA 3TJ8A 1GXTA 1PBAA 4DOZA 4YHHJ 3I0RB 4NLVA 2AYGA 3TOQA 2XCAA 3NGSA 3GCXP 3EGZA 2AJFE 1N33F 3RRKA 1FNXH 3BYPA 2AJQA 1WKKA 2LQBA 4OKGA 2BJDA 3MMBA 1KVIA 2J0WA 3JSMB 5F3ZA 3CCTA 1KEKA 4OZ0A 1RT5B 2H3EB 3EXYA 3CCRS 1RYRA 1IBKI 3RJMB 5D4LA 2MLZA 2V50A 1HQUA 4NPOA 3MXHP 2YKMA 4ZVRB 4LVOP 1RAFB 4GKJF 4CT8A 4NEZA 3SI8A 2IFXA 3A3OB 2ZH9A 1HI8A 4IG3A 4C2MA 2ZM6I 4URLA 2HHPA 1TELA 3GLJA 3GYGA 3K5PA 1XMQJ 2Q6CA 2C38B 2PNMA 1U0HB 3PEHA 3PJWA 5DGBA 3HO1A 4IFDA 1R8BA 2RNEA 1TL7B 3M2RB 4L76A 3G4SS 3GMEA 2CFXA 1UAWA 4FXWA 1KP6A 3RW7A 5U47A 1KQGB 2YPYA 3HDSA 4Y2IA 1Q8IA 1SUQA 3H5YA 3M8QB 4ECVA 1C4AA 1OIAA 1NCLA 1CJVB 3GR0A 2ALZA 1FE0A 2VDIA 1VQ5S 2DO4A 4F8RA 1FK9B 2WOMB 4XAKA 1XMOE 4WP8A 5KFQA 1UZHA 3GZ7A 1WG1A 4FDFA 5B0GA 3VAKA 4XTJA 3R5CA 2W4PA 3PM9A 2R7TA 1VQ6S 2J7UA 2KH9A 1NJWA 5DNLA 3QIDA 4DU7A 4CH7A 5KFXA 2E5LF 5D0HA 1FWKA 3TAQA 1EARA 2PIIA 2FB0A 3M85G 4DV2J 4YEAA 2NCKL 1RT7B 5IM0A 1MROA 1FFGB 1WOSA 3PACA 2DR9A 1GTEA 2C37A 4FPIA 3CTRA 1R6YA 4J9PA 3QSYB 1JLFB 2V8GA 3PYDA 5A6PA 2AX0A 2JEBA 2D41A 1XEZA 2N3OA 4MT1A 3Q8UA 2KJWA 1WG5A 1Z4UA 3THVA 1XNQF 2NN6F 5K8PA 4LCFA 5LMNE 4LRCA 1R8CA 2IDEA 2PFDA 2MZRA 4Q2LA 1FA0A 2CUYA 2VG5B 4ZVOB 4DBQA 2HHSA 4JI1E 3PW7A 4HEA9 3GIKA 3T5JA 4FBTA 3H42A 5E2QA 3HT3A 4YB5A 4IRCA 4XK8C 2AJ0A 3KJQB 4ZCKA 4Q44A 1H7SA 3T41A 3GLLA 1DY3A 3LGMA 3MMCA 1WTFA 4HDGA 3SQGB 3UCGA 2XMVA 5KFMA 2W8LA 4A47A 2PO0B 3DYAA 3M8ZA 2CWKA 3DGPB 4JI7E 2OEMA 4ZMMA 4LF7E 2V34A 4OZJA 1OJ4A 1S6QA 3OR1B 3TRGA 5J2PB 3J81Y 3HHLA 5KFYA 3WC0A 4QNKA 4WZMA 1VOMA 1NZ8A 3EVOA 2Z5CA 3THTA 3M9NB 1HNZI 1E6VA 1Q82T 3N79A 5KFWA 3DLJA 5K8MA 1NM2A 4WFAQ 3MMJA 3CCES 4ILRA 4LF9I 2E1RA 3H25A 2NN6B 4OI3A 1HNVB 2KYZA 1HBOB 2Z2LA 5DJBA 2NPFA 3SEOA 4DV6F 1VQMS 1N34J 1FKPA 2G2OA 3PO4A 4B3OB 2HQDA 2ASDA 4DV2I 5H1SV 2FHJD 2YH1A 2PE8A 4F4ZA 1K9MT 4MU4A 3LOUA 2W8KA 5IT0A 2VQFF 2HS3A 1Z0CA 2DNYA 3MUVP 1ZTTA 2YKAA 5ETTA 1B3TA 3Q0AA 1YX2A 3GPAA 3J81U 2OKQA 1S1VA 4N56A 4DL3A 4LF7J 2ZHBA 3BO3A 1UVJA 1FDDA 4DPXA 3RAQA 1QVFR 2Z0GA 1XNRJ 1G7CB 1GMWA 2XHCA 1IBMJ 2VA3A 3QRRA 2K1RB 3FFIA 3MF5A 4HTJA 2U1AA 1EI1A 4QWBA 4DLEA 2J9DE 4ZP7A 4PPDA 3PR5B 2FJEB 3MPDA 4QWAA 1X4GA 3J7AG 1URNA 4X64F 1NLKL 3QQCD 4JI2J 2IJRA 4DSLA 2ZZTA 5E33A 2GX8A 2ZH1A 3I0SA 4I6YA 2OO4A 2MGZA 2VOOA 5J1PA 3B54A 3RBEA 1T9YA 3HT0A 2F4VJ 2DXFA 1PJ5A 2BYCA 4NI2A 3WIUA 2R2RA 4PR6A 4DSFA 1M1KT 2CYYA 5IS2A 2Y8YA 2B6AB 4RR5A 1TUVA 1XIQA 2L41A 2OH2A 3MOZA 1YJNS 2F63A 4H4OA 5IT4A 1TKZA 3EM1A 1UFKA 4X4OA 2FVSA 4AQYJ 2DR6A 2NSBA 5DRKA 5DDPC 3PFEA 2D3ZA 2OLWA 2YWKA 1Z2ZA 1NK6A 1TVRB 4MKAA 3R97A 4QR2A 3UPFA 5F8HA 3RR8A 2HZAA 1AZSB 1X5SA 4IQXA 4WK1A 2VOPA 4WPAA 5F3TA 5GVQA 3MPVA 1AUDA 1U8WA 2MYFA 3QT8A 3CXCR 2MY8A 2RJZA 4PKDB 1K0TA 4NA3A 1S79A 2HNZB 2E29A 2B3TB 1W26A 2HSEB 2UV8G 2W2OP 4XIUA 1TL7A 2BE2A 2QC3A 3M2RA 4IO9Q 5F8LA 2YX4A 3DRRA 2J5AA 2L9NA 3PDNA 4DR1J 4USVA 2HGLA 2JDJA 2V4JB 1VQ7S 2XLKA 2BA0G 4QIEA 3BR9A 1TU0B 1NMEB 3CDUA 4KB7A 4QW8A 4K0KF 1HNXI 1Q7LB 2Z2MA 3VHQA 4QYZK 3C15A 4JI4E 4GKJI 2NXCA 4EI2A 3WC2A 2MKJA 2BW2A 1H73A 4JI5I 1UVKA 4C8MA 2J6SA 3GQCA 1MU5A 4ZVPB 1H7XA 4RW7A 1NJXA 3ISND 1URRA 1H2TZ 2OPQA 2WW4A 2C37B 4N5SA 3W64A 3D6MB 1JLBB 1S76D 4JI6F 1Q8LA 3CGIA 2DHSA 4F2RA 1XXEA 3IG1B 2DVIA 1R6LA 4ZS6A 3EPIA 4J9NA 5D15A 1BHNA 2FZGB 4GKKI 4PABA 2N7YA 3BSNA 2UUBI 3CD5A 2RU3A 2QEXS 3E3XA 4WTOB 4JV5E 1SJ1A 2GAHC 5ETVA 5F8JA 4RBUA 4KT0C 2CNNB 2XS7A 2CG9A 1RTHA 1HYSB 4NYZA 3MAHA 2DGQA 3TVYA 4KRWA 3NAIA 5E7OB 5J1EB 4FWGA 2YQ3A 2HIYA 2JNJA 1HHQA 2QA2A 2XI2A 2XYPB 2XZWA 3A3NB 3KG4A 4M94A 4OZ5A 3NG8A 5AXLA 1JX4A 2XY7A 1HPZA 1FNMA 4ZCIA 4I67A 5C0XC 2BA9A 4YR3A 3MEEB 4OMFG 5IZHA 5I3UB 2GGPB 4KHRA 5KFDA 4ELTA 2JE6B 4J9QA 1RAIB 2EKYA 3FMWA 2IBKA 4FW4A 2ACMA 4K2XA 1SQFA 3MAAA 3AA9A 4AL6A 3OHAA 1JKHB 2O01C 4HT7A 5HJXA 2E66A 4CH0S 3L7OA 5DQIA 3EDRB 1YTYA 4OHYA 3H8YA 4ED6A 4U3DA 5EKWA 2VBZA 3IAM9 4ZPVR 3SSSA 4R0EA 1RT3A 3M7NG 4IG0B 2YXLA 4UF4A 5CHCB 1QDUB 5THWA 4FF2A 4PRFA 5IOLA 1JNZB 2CPEA 3FBBA 3JTOA 4G1PA 1SB6A 2IRXA 4WU2A 2YKOA 3HPOA 5HLFB 1U1OA 1UA0A 2Q66A 6FDRA 3MEDA 4QIVA 3IS9A 4JI6E 1D3WA 4IZJA 3S6EA 1A9NB 2BA1D 2Q2EB 1A6LA 5LXRA 4OI6A 1KS2A 5KFAA 4CLUA 1RT2B 1SQGA 3C15B 3EGNA 3ILLA 2GFFA 4WUCA 2W9BA 4RW4A 2EG2A 3AB2B 4LRFA 5B0BA 5LJ5Y 1X0FA 4ZK7M 2OI2A 2ZKTA 2ZJPQ 1IVZA 1KOHA 2W7AA 1UW4A 1IKVA 1HFEL 2OPPB 4U8VA 5D4PA 1SKSA 5KFLA 1TR0A 2CZ9A 1K1QA 4LFAI 1J5OB 4K0KE 1WC4A 4KKOB 1YITS 1Z5CA 1ZH5A 1U1LA 2C28A 3FEXB 5HVGA 4YHHE 4C8YA 5LSRA 3VGVA 2QLFB 2ZJRQ 2MPUA 1NUEA 4K2JA 1Q8BA 4DJBA 4A8YA 1SC4B 2P8IA 1A0OB 1ICEB 2HPUA 4ZP8A 2HHXA 3DXBA 2Y0SD 4QJVA 1RADB 4I4BA 4KR0B 3BDPA 1T7PA 4LQ9A 3T1YE 2AJ1A 3L7UA 3UR0A 1FDNA 3Q89A 4KV8B 4YMEA 3TVZA 3B4TA 1P1TA 1KTQA 2ZD1B 2MMYA 2YNGB 5CYQA 4DV3J 1Q95G 1PSDA 4USJC 5K36C 1SH0A 2XMKA 3H2LA 3JS9A 4ECTA 1LWEA 1S9GA 1IQZA 3UN5A 3AHPA 2D3OR 3M1VA 1N5TA 2MGZB 3K7RA 3J7YI 4EBDA 1XMQE 2PNLA 4K4WA 1M5HA 1PKUA 2ZBIA 4V1Ak 2GIFA 2ZHAA 5FLXQ 2QLWA 3KLEA 4ECRA 4DQSA 4ZPDA 3AA8A 2EI5A 5FWKA 4LFCE 2R7SA 3RYLA 1VRTA 1C1CB 3BGUA 4ED3A 1QAIA 2UUAI 2C2ZB 2ZM6F 3VGSA 5KFRA 3C6UA 2KZMA 4DXLA 2V4JA 3JB9k 1RYSA 3HD1A 5B09A 4DR1F 1UA1A 4OZEA 2AYBA 1VJQA 3NP5A 1NHIA 3KNGA 3SQGA 5J1NA 4BWMA 3ZZPA 2HNYA 1IBKJ 3K5LA 3ZZYA 2B56A 1GMWD 2LJPA 2Z56B 1IQTA 1FFSB 3DMJB 3NS5A 2KHCA 1O51A 4CLWA 2ACYA 4LFAJ 1LWFB 1UETA 2VD3A 5A0YB 2E1PA 2BR0A 3M6AA 4K4SA 2I9SA 3FJ2A 3NL0A 4LFBJ 4I56A 4LRAA 4MKVA 4DV2E 2RRNA 3AOBA 1LXJA 4P72A 4IR1A 1UZDA 2WVEA 2ABYA 3IXQA 5L9NA 3MOJB 4PCQA 3MURP 2MLXA 3H59A 4ES1A 2R7VA 3CJSA 3M2UB 3M32A 2H51B 1DFDA 2LMIA 2ZE2B 4B3RF 5DG9A 4FS1A 4Q8EA 2CA9A 2NN6A 1TMMA 3LP2B 1ZAXA 2XZDB 2B7BB 4ZVTB 5HMWA 3HZGA 2EPIA 3IRWP 4JI1J 1Z0TA 1EB0A 1CJUB 1WC1A 3TUJC 2GVDA 2F4VE 2J8SA 3W2WB 1HW9A 5AXKA 2HQGA 5K8OA 2PO1A 1RWWB 3KWMA 4BA2A 2HNDB 4NLDA 3VWSA 1KLMA 3P5BP 2BRLA 4I1TA 4KKOA 4DV1F 1RHQB 1IBKE 4LF2A 4BA2B 1OYEA 3LAKA 1QSSA 2C3OA 4RNHA 2G13A 4ITSA 3EZ5A 1XMOI 2R7QA 3B82A 3KK3B 4JI7J 1HR0I 2UUBE 2HRYA 3GIRA 3MD1A 1VQSA 4LFBE 4EFAC 4NLXA 2CQCA 3B78A 5D78A 3TA2A 3OL6A 5DRQA 4J9SA 2VPWB 3A8EA 3O44A 4OJHA 2ZOMA 4P73A 3KLFB 1R0AA 2PI4A 1WI6A 3LW5C 3J80C 1DBDA 4P7TA 3HVTA 4IKAA 1F2HA 4Z7YA 5B0CA 3GIJA 4F4WA 1RABB 1WF2A 1FHTA 4FBUA 1Y4UA 3F41A 3KK2A 1D9DA 2O5DA 3HHLD 1HARA 2RUSA 4NLPA 3KHHA 1RQ0A 3BGRB 2A6MA 1X4FA 2JVRA 1FKAF 2XTJP 4IOCQ 2CJQA 2GCFA 4CLYA 3CCSS 3MEDB 4Z7CA 2XSFA 1TTHB 1WD6A 4PXCA 3V6JA 3KXDA 4PG6A 3RBZA 5DLFA 3PVXA 5DRPA 2UZAA 1IBCB 4MIWA 4OFZA 2BQ3A 1HBNB 3KDNA 3DRPA 4QU6A 4DHVA 3W5ZA 1XTZA 4PQUB 5KFZA 4JI0J 3MM7B 4MAKA 4TYBA 1X4DA 1SJFA 5DG8A 4ERDA 3QLHB 2E44A 1UEKA 4LF8F 3V2UC 1PIEA 3GJRB 3H98A 3MI7X 4B9UA 4LF5F 2EVZA 2FDNA 3DCAA 1X9WA 1P9YA 4NLSA 2OUGA 2QYCA 2RS8A 2QO3A 1FJGJ 4HYMA 4RW9A 3O2IA 5LOQA 2CQBA 3OTOF 1GT8A 1U6BA 1GEHA 1B7YB 1VRQC 2CJYB 2I38A 5LMNJ 2NYIA 1VDHA 2M70A 1V3RA 1U0HA 3ZZTA 3R7NB 2G2YA 3F44A 3BV8A 1U2RA 2DCUB 3BDEA 3P4UB 1RUSA 4MK9A 3VAJA 2RQKA 4KO0A 1S6PB 1YGYA 1RSCA 4KQZA 5AE2A 5KFHA 1E3HA 3PXGa 1YIJS 1XR5A 4U67Q 2ZNYA 3KHLA 1SL2A 4WXWA 1HLWA 1HWKA 2SXLA 3P8BB 4F4AA 2GQQA 2MKSA 1N32F 3WBZA 3G8SA 3TAPA 2IC3B 1WOOA 4M5MA 2BJ7A 5C0XD 2MZJA 4DV0E 4AQYE 4JI0E 2CJXB 1ZTWA 4GO7X 5IM0B 1LQ9A 1Y7PA 2WONA 4JI3E 4Y34A 5ADZA 1ZXMA 2ZH7A 3Q24A 1EAYC 4ALZA 4WFZA 2N82B 3B8HA 2LQ9A 3FNNA 3ZZOA 1VQNS 4FW3A 4PEOA 1P42A 1RAAB 2B51A 4KSEB 3VGTA 5C0XE 1NSQA 4AUKA 2CG4A 3IRXA 1OO0B 4JBCA 4NEYA 1WSVA 5F9LA 1JJ2R 1V6HA 5J2QB 2ZM6E 4MTPA 3KJFB 1Y5LB 3DM2B 1T03A 3GYXB 1YSJA 2R8JA 4KPCA 2ZH3A 2GQCA 2HS0A 2ILZA 5K36A 1FRXA 4DR1E 2DB1A 2MKYA 2DO0A 2IMOA 4WP9A 2XLJA 5EX3A 1WKLA 2E7VA 4IO1A 3D4JA 3N4WA 4ED8A 4JI4J 5F8GA 3M85D 4FF4A 1JQGA 3MEEA 2VBXA 2AE8A 4PU9A 3NGTA 1GNKA 3BBCA 3G86A 1D9FA 3A4TA 1GFWB 2QFIA 5I3UA 1N34I 4ZA1A 3M8WA 5CQGA 3DDNA 2IVFB 2AX1A 2D9PA 2KVQE 3QPIA 4LIWA 2A6OA 4LF9J 3WQPA 1VHIA 4CLPA 2V8DA 3HK2A 2WVBA 3MM5B 1XNRE 3KJVB 3CC7S 2AEFA 4V19J 3V6DA 3WDOA 5JVGQ 4X62F 2DEIA 1RT3B 4OJ3A 1FJEB 4DR3I 1OY8A 3CWJA 4LSNA 4IFDE 4DV0I 3PS2A 3H5SA 2XM3A 2ZM6J 1TMJA 2B4UA 3TUZC 3VGUA 4DUYE 4TN2A 4LF9F 4I0WA 3KMSA 1Y9OA 2VASA 3ZZ0A 2AIRB 5AXMA 1PO6A 4V19X 1T3OA 4ANDA 3DI6A 4ZDNA 1MU2A 4GMKA 4QWCA 4DV4E 4ES2A 4ZPWR 1RGVA 3O5TB 4CDIA 1F9HA 4JI3I 1WHVA 3IP0A 1UTAA 1SPBP 2HS4A 4USKA 3GONA 3GCWP 1HNWJ 3VQSA 4LFBI 3QO9B 1RT2A 3LPYA 3U7JA 4EK2A 4LF8E 4ECSA 2F1DA 1HWLA 3LP0B 1O8BA 3U1YA 2CVEA 2Z4PA 1VRUA 4K4XA 4O44A 3EICA 1OYPA 2V6AA 4ICLB 1U02A 5IT9U 1QE1A 3BPSP 1RTDA 3AD9C 1IR0A 5K36D 5H9EJ 1M5PC 1YVFA 2MQLA 1SJ4P 3Q8RB 4MU1A 4NZ6A 3T1HJ 4TYAA 1RA6A 4DUYJ 2Z57B 2ZDOA 3TNVA 1CJTA 1YKWA 1VMBA 3H4BA 3AFGA 2X1FA 2VH7A 5K36E 1JMTA 1WUUA 2BKOA 2WB4A 2AGPA 4M5LA 2Z58B 1RWPB 2XSJB 2HAIA 5JMNA 4Q5VA 4DV4J 1T02A 4IH5A 3CC4S 1MX0A 1DHMA 3MM9A 3MR7A 4WFNQ 2ASLA 4B3TJ 3HHNB 4AQYF 4Z2XA 5C7PA 3IO1A 3LPSA 4Y2AA 2VC0A 2W2QP 3PHTA 1BKNA 1HA1A 3MAAB 2GMHA 4YFUA 3RBXA 2FJWA 2IAJB 3LNUA 3JAMC 1ZZFA 2ZD1A 5CYQB 4RNFA 2AJ2A 4NXME 1CC7A 4KV8A 4LBPA 2GVZA 3CJ8A 5LL6d 2CWXA 3AQPA 2BQRA 2VL1A 3K0JA 4IOAQ 3DD6A 2G1DA 2DR8A 1WEZA 5C24B 3DU6A 1LWCB 2F9DA 2C2DA 2DY1A 3GFYA 1ZPWX 3NBPB 4DG1A 2KXHA 4IG3B 4XO0A 4DUYI 1PILA 2FIUA 1HNIB 3DOLA 5GAHI 1YHCA 1I94E 4B3SE 4RW9B 4IFDD 4J9VA 2WVDA 2UU9F 1G4CA 2AQ4A 1IWAA 2HRUA 3QMQA 2EKNA 2KKHA 4J9UE 5E3PA 5E3QA 5HBMB 4NCGA 2MY7A 2PI5A 1RZMA 4OX9J 1WEXA 1UMJA 1WDTA 2VFSA 5A8WA 3Q2TC 1RA7A 1FVSA 2OELA 2LDIA 4W4MA 5CABA 1HBNA 1S49A 3L95X 5IWAF 4QU7A 4FYDA 2VKRA 3M2VB 3HHEA 4QPTA 4PQAA 5A8RB 4JI1F 4URSA 4XTTA 1RHJB 3CNQP 3OVSA 3AOCA 1S6UA 3BPDA 4FN5A 4CT9A 5C42B 4NRTA 2C2MB 2IM2A 2EK1A 1YZ6A 4F25A 1HNZF 4LPFA 5GMKa 4NXMJ 3ET6A 1UWBB 3IBWA 2J9CA 4ZHRB 1U26A 2BJ8A 2B0GA 2MKCA 3W5YA 3JAMY 4RZRA 2UUAF 2M8HA 1S12A 1YDLA 2VJVA 4M5HA 4QW9A 4K50A 1RREA 3TQEA 1RT7A 4DUYF 5HMXA 3AAWB 4KTQA 3G6VA 3DFEA 3EVWA 5LMUI 3DM2A 1T03B 2GA7A 4O3QA 4CM2A 1Z0VA 3ZC4A 3D1HA 3QIPB 3ITHB 2R7WA 3U27A 1FI4A 4TLQA 4M5JA 2VA2A 2AMCB 4IS9A 2BABA 4URQU 1GXUA 2CPFA 2OD4A 3MCSA 2I6WA 1E3PA 3DOKA 4I2QB 5KG5A 4J37A 2UXDE 2GO3A 2JEGA 4YY3E 2H65B 1FNOA 1SJRA 4B3MF 5HMZA 3LALA 1CSJA 1KHVA 4X65J 1I94J 4OHWA 2R2TA 2HNDA 4HXZA 4DQIA 1AXQA 3DHXA 1B7FA 2B9XA 4EBEA 4ECZA 2KRRA 2F40A 3HSZA 1EZZB 3QSIA 5C2GA 3TZXA 3GIMA 1FRMA 4B3MJ 1QUVA 3GJQB 2CQ3A 1PCAA 1TV6A 2HWIA 2DGTA 3H2UB 1QJHA 3IGNA 4OI4A 4IFDF 4N77A 1UFWA 1RI7A 5BR8J 2AGQA 2AZ1A 2HAFA 3E8OA 5D0GA 4ILLA 4MK8A 2HKJA 1VQOS 1CULB 1A7GE 2GHWA 2ZBRA 2CJBA 1I5OB 2IJNA 4ZVFA 1MN9A 5C2CA 3QZ7A 3N01A 5FD1A 1T9TA 2X1BA 3IM9A 3TJAA 3J7AM 3NAHA 2HVDA 3DYAB 1K73T 1M5SA 1WACA 3D0HE 4U9RA 4JI2F 2UXDJ 4O23A 3SDEA 1YJ7A 3PY8A 1RTZA 4ZPAA 4ER8A 3DDKA 2GJIA 4W92B 4DV6I 2YH0A 1XHKA 3K59A 3OTCA 4ATNA 4L3KA 8AT1B 4TQRA 3IWLA 3RB4A 2KT3A 2AGOA 3J81C 1J5EE 1R27B 5D0EA 3PR4A 4KHMA 3CCVS 1FF2A 3D3CJ 3CCWA 3ZTOA 2E1AA 3J7AN 3TI0A 2VDHA 4ICLA 2DITA 1RT6A 2RAQA 1WC6A 1K47A 3FQLA 4N47A 2ASJA 1NDPA 1HL6A 1VRUB 1N48A 4NLYA 3GP9A 2BR2A 4C0OC 1FTCA 4DG1B 4PXDA 4N8OA 5DQHA 1NRKA 3CMES 5DROA 2UU9I 4LFCI 1NHKL 3OFFA 5GAEI 2KFNA 1IBLE 1FKPB 2A2DA 2G2ZA 4NA1A 4A8MP 4DR2E 5K36F 1B0VA 3A3PB 4YY3F 1HD0A 2ZBQA 2V9KA 2BDPA 1IR1A 3HHLC 4O3SA 3IBCB 1SKWA 1IR2A 1D09B 1GTHA 1YRXA 2OHDA 1S99A 2P6SA 2C3PA 2OMLA 4HVZA 4QOTA 1HNWI 1IM4A 2ASYA 3IA0A 4FYWB 4ZN1A 2IDLA 4YQWA 1L5UA 5ETPA 1K8AT 1O6XA 4MDTA 1RT5A 4PRVA 5EDWA 4QBUA 2OMOA 2V68A 5EGYA 2ZC3A 1TUWA 5KOXA 5KG7A 1X60A 2OFGX 4OX8A 4DR1I 1F5AA 3TP2A 4F36A 4LCHA 1I94I 3J80U 1RAOA 4C4WA 1RE1B 1PYTA 1TAQA 1T9VA 1WKJA 3DHWC 3DRSA 4O4GA 1LV5A 1S7HA 4KE5A 4P10A 3ZO7A 2QMWA 3M8YA 1LK7A 5C24A 1R8PA 3Q22A 4WCEQ 2UV8A 3L9ZA 4DR6J 2DNOA 4ZP9A 4A8OA 1JLBA 2I1RA 3X1LB 2JE6A 4Y2CA 4X4TA 4A8FA 1IBLJ 5ELWA 4RUHA 3I82A 2P9GA 5HQMA 2HFVA 3BBBA
chains in the Genus database with same CATH topology
1HNXI 4X62E 4JI4E 4FW9A 1ZXNA 4LF9I 4GKJI 4AQYI 1Z0WA 1ZM3A 3WU6A 1H73A 4M1KA 4JI5I 4B3MI 1N32I 1MU5A 2WW4A 4OX9E 5L3JA 2F4VI 4DV1I 4GKKI 2UUBI 4PRXA 4DV7I 2CG9A 2IOQA 1Z0EA 4LF6I 2UUAI 4FWGA 1FNMA 2Z5BA 3F0NA 3Q6MA 4LF4I 2Z5BB 4FWDA 4YY3I 3LTOA 4GKJE 4X65E 4LF6E 1ELOA 4USMA 4P7AA 3P06A 1EA6A 3QT7A 4JYAE 4JYAI 1N32E 4N3OA 3J80Q 4JI6E 4IZJA 2Q2EB 4HACA 2V2ZA 1HK7A 1H7UA 3M6AA 2EFGA 2HKEA 4WUCA 3J81Q 4IZKB 2OI2A 4X64E 2E5LI 2VQFI 1N0UA 2CZ9A 4LFAI 2UUAE 4K0KE 1IBME 1Z5CA 4YHHE 2X7IA 4B3RE 3T1HE 4JI1I 1KTVA 4YHHI 4DUZE 4GKKE 5IWAI 1QZRA 2HFSA 1PKPA 4DV7E 3Q1QA 1I94I 4X66E 5GMEA 4X64I 3PYEA 4DU8A 2HHHE 2BM1A 1XMQE 2PNLA 4DR2I 5FLXQ 3T1YE 5FWKA 3T1YI 4X62I 4LF9E 4LFCE 1XMQI 4JI5E 4DXLA 1NHIA 4DV6E 4X66I 2LJPA 1J5EI 4OX9I 1IBLI 1Z5AA 3HJCA 2UU9E 4WUBA 2O1UA 4WUDA 4DV2E 4DV5E 2O1VA 4MYTA 2V2QA 4DR3I 4FWHA 4JI7I 3PYFA 2VF3A 2O1TA 4JI2I 4JI8I 3CWVA 1HNWE 2HK3A 1Z0TA 4R1FA 3ZM7A 2DEJA 4DPTA 1ZM2A 1IBKE 2V2VA 4JI6I 4DPYA 4URLA 4DR7I 1XMOI 1N0VC 3B82A 1HR0I 1VISA 2UUBE 4B3TE 2GQ0A 3PRYA 4LFBE 4NXMI 3B78A 3J80C 2UXCI 4Z7YA 1Z5BA 1N36I 1Y4UA 4B3ME 1S4EA 1Z59A 1S16A 5LMNI 4JV5I 4Z7CA 2ZBKB 1Z0BA 1KIJA 4UT4A 1B63A 3OTOE 2VQEI 2IOPA 2AJ4A 1UEKA 4LF7I 2UXDI 3V2UC 1PIEA 1Y4SA 3QT6A 4HYMA 1KVKA 2BM0A 2Z5EA 1Y6ZA 1XNQI 5A2QC 3V5RA 5LMUE 3ZZTA 4DV1E 1U2RA 3K1JA 2F4VE 4IZKA 3WU3A 5IT9Q 1XMOE 4DR7E 4LF8I 4AQYE 4JI0E 4JI0I 2UUCI 1HNXE 4JI3E 1RR9A 1NHHA 1ZXMA 1FKAE 3B8HA 4DR4I 1MG7A 4P52A 2X36A 2XEXA 2UXBI 2ZM6E 5BR8I 4B3SI 2R42A 1ZM4A 4DR1E 3WU5A 5BR8E 3D4JA 5LL6R 4DV3E 4LF5E 4PU9A 1NZ0A 1B62A 1N34I 1N34E 3K17A 5FLXC 2UUCE 1FJGI 4EMDA 1HNZE 1XNRE 4RPFA 1N33I 2DEIA 4JV5E 2J7KA 5A2QQ 5GMDA 4DV0E 4DV0I 1A6FA 1ZM9A 4DUYE 3ZZ0A 4HY1A 4KHPI 4LF5I 4DV4I 4DV4E 1NHJA 2A2CA 2HFUA 4JI3I 4JI2E 4USKA 3GONA 1USUA 4LFBI 4LF8E 4DV3I 4DUZI 4B3RI 2UXBE 4NXNE 1XNRI 1USVA 4MYUA 1DARA 4HXZA 4DPWA 1XNQE 4KQVA 1KKHA 4DR6E 4KHPE 1WUUA 1IBKI 1MX0A 3LPSA 2UXCE 1BKNA 4DR3E 2GS8A 3LNUA 2ZM6I 3JAMC 4NXME 2PNMA 4JI8E 4DR5E 4DUYI 1FWLA 4B3SE 2ZITA 4DR6I 4ED4A 4XTJA 1FJGE 3OTOI 1Z0GA 4DU7A 2VQFE 1FWKA 4FN5A 4DPUA 4IZJD 4NXNI 3ZZUA 1N33E 3PYDA 5LMNE 4JG4A 1RREA 5IWAE 4DR5I 4JI1E 3HULA 5LMUI 1Z0VA 3QT5A 1H7SA 5IT9C 2R3VA 1FI4A 2Z5CB 4LF7E 2UXDE 4JI7E 2V34A 4YY3E 1OJ4A 2V8PA 1HNZI 2Z5CA 2CGEA 1D6TA 2E1RA 4UTGA 4B3TI 3K85A 2NPFA 4DV2I 3H4LA 2HKJA 4HACB 1Z0CA 1N36E 1IBMI 3J7AM 2VQEE 4DV6I 4DPXA 1XHKA 1I94E 4DR4E 3J81C 1J5EE 1EI1A 1PVGA 2HK2A 4LF4E 3J7AG 2BV3A 1K47A 3WU4A 3ZKBA 2UU9I 3ZKDA 4LFCI 1IBLE 2A2DA 4K0KI 4IZJB 4DR2E 2E5LE 4X65I 1HNWI 3T1HI 4PRVA 4ZVIA 3JAMQ 4DR1I 4DV5I 3QT8A 4I3HA 3Q6NA 3PYGA 1H74A 2O1WA 2HHHI 1HR0E 1H72C 4JI4I 4LFAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX I;  4X62 E;  4JI4 E;  4FW9 A;  1ZXN A;  4LF9 I;  4GKJ I;  4AQY I;  1Z0W A;  1ZM3 A;  3WU6 A;  1H73 A;  4M1K A;  4JI5 I;  4B3M I;  1N32 I;  1MU5 A;  2WW4 A;  4OX9 E;  5L3J A;  2F4V I;  4DV1 I;  4GKK I;  2UUB I;  4PRX A;  4DV7 I;  1Z0E A;  4LF6 I;  2UUA I;  4FWG A;  1FNM A;  3F0N A;  4LF4 I;  4FWD A;  4YY3 I;  3LTO A;  4GKJ E;  4X65 E;  4LF6 E;  1ELO A;  4USM A;  4P7A A;  1EA6 A;  3QT7 A;  4JYA E;  4JYA I;  1N32 E;  3J80 Q;  4JI6 E;  2Q2E B;  4HAC A;  2V2Z A;  1H7U A;  3M6A A;  2EFG A;  2HKE A;  4WUC A;  3J81 Q;  2OI2 A;  4X64 E;  2E5L I;  2VQF I;  1N0U A;  2CZ9 A;  4LFA I;  2UUA E;  4K0K E;  1IBM E;  1Z5C A;  4YHH E;  2X7I A;  4B3R E;  3T1H E;  4JI1 I;  1KTV A;  4YHH I;  4DUZ E;  4GKK E;  5IWA I;  1QZR A;  2HFS A;  1PKP A;  4DV7 E;  3Q1Q A;  1I94 I;  4X66 E;  5GME A;  4X64 I;  3PYE A;  4DU8 A;  2HHH E;  2BM1 A;  1XMQ E;  4DR2 I;  5FLX Q;  3T1Y E;  3T1Y I;  4X62 I;  4LF9 E;  4LFC E;  1XMQ I;  4JI5 E;  4DXL A;  1NHI A;  4DV6 E;  4X66 I;  2LJP A;  1J5E I;  4OX9 I;  1IBL I;  1Z5A A;  2UU9 E;  4WUB A;  4WUD A;  4DV2 E;  4MYT A;  4DV5 E;  2V2Q A;  4DR3 I;  4FWH A;  4JI7 I;  3PYF A;  2VF3 A;  4JI2 I;  4JI8 I;  3CWV A;  1HNW E;  2HK3 A;  1Z0T A;  4R1F A;  3ZM7 A;  2DEJ A;  4DPT A;  1ZM2 A;  1IBK E;  2V2V A;  4JI6 I;  4DPY A;  4URL A;  4DR7 I;  1XMO I;  1N0V C;  3B82 A;  1HR0 I;  1VIS A;  2UUB E;  4B3T E;  4LFB E;  4NXM I;  3B78 A;  3J80 C;  2UXC I;  4Z7Y A;  1Z5B A;  1N36 I;  4B3M E;  1S4E A;  1Z59 A;  1S16 A;  5LMN I;  4JV5 I;  4Z7C A;  2ZBK B;  1Z0B A;  1KIJ A;  4UT4 A;  1B63 A;  3OTO E;  2VQE I;  2AJ4 A;  1UEK A;  4LF7 I;  2UXD I;  3V2U C;  1PIE A;  3QT6 A;  4HYM A;  1KVK A;  2BM0 A;  1XNQ I;  5A2Q C;  3V5R A;  5LMU E;  3ZZT A;  4DV1 E;  1U2R A;  3K1J A;  2F4V E;  3WU3 A;  5IT9 Q;  1XMO E;  4DR7 E;  4LF8 I;  4AQY E;  4JI0 E;  4JI0 I;  2UUC I;  1HNX E;  4JI3 E;  1RR9 A;  1NHH A;  1ZXM A;  1FKA E;  3B8H A;  4DR4 I;  1MG7 A;  4P52 A;  2X36 A;  2XEX A;  2UXB I;  2ZM6 E;  5BR8 I;  4B3S I;  2R42 A;  1ZM4 A;  4DR1 E;  3WU5 A;  5BR8 E;  3D4J A;  5LL6 R;  4DV3 E;  4LF5 E;  4PU9 A;  1NZ0 A;  1B62 A;  1N34 I;  1N34 E;  3K17 A;  5FLX C;  2UUC E;  1FJG I;  4EMD A;  1HNZ E;  1XNR E;  4RPF A;  1N33 I;  2DEI A;  4JV5 E;  2J7K A;  5A2Q Q;  5GMD A;  4DV0 E;  4DV0 I;  1A6F A;  1ZM9 A;  4DUY E;  3ZZ0 A;  4HY1 A;  4KHP I;  4LF5 I;  4DV4 I;  4DV4 E;  1NHJ A;  2A2C A;  2HFU A;  4JI3 I;  4JI2 E;  4USK A;  3GON A;  4LFB I;  4LF8 E;  4DV3 I;  4DUZ I;  4B3R I;  2UXB E;  4NXN E;  1XNR I;  4MYU A;  1DAR A;  4HXZ A;  4DPW A;  1XNQ E;  4KQV A;  1KKH A;  4DR6 E;  4KHP E;  1WUU A;  1IBK I;  1MX0 A;  3LPS A;  2UXC E;  1BKN A;  4DR3 E;  2GS8 A;  3LNU A;  2ZM6 I;  3JAM C;  4NXM E;  4JI8 E;  4DR5 E;  4DUY I;  1FWL A;  4B3S E;  2ZIT A;  4DR6 I;  4ED4 A;  4XTJ A;  1FJG E;  3OTO I;  1Z0G A;  4DU7 A;  2VQF E;  1FWK A;  4FN5 A;  4DPU A;  4NXN I;  3ZZU A;  1N33 E;  3PYD A;  5LMN E;  4JG4 A;  1RRE A;  5IWA E;  4DR5 I;  4JI1 E;  3HUL A;  5LMU I;  1Z0V A;  3QT5 A;  1H7S A;  5IT9 C;  2R3V A;  1FI4 A;  4LF7 E;  2UXD E;  4JI7 E;  2V34 A;  4YY3 E;  1OJ4 A;  2V8P A;  1HNZ I;  1D6T A;  2E1R A;  4UTG A;  4B3T I;  2NPF A;  4DV2 I;  3H4L A;  2HKJ A;  4HAC B;  1Z0C A;  1N36 E;  1IBM I;  3J7A M;  2VQE E;  4DV6 I;  4DPX A;  1XHK A;  1I94 E;  4DR4 E;  3J81 C;  1J5E E;  1EI1 A;  1PVG A;  2HK2 A;  4LF4 E;  3J7A G;  2BV3 A;  1K47 A;  3WU4 A;  3ZKB A;  2UU9 I;  3ZKD A;  4LFC I;  1IBL E;  2A2D A;  4K0K I;  4DR2 E;  2E5L E;  4X65 I;  1HNW I;  3T1H I;  4PRV A;  4ZVI A;  3JAM Q;  4DR1 I;  4DV5 I;  3QT8 A;  4I3H A;  3PYG A;  1H74 A;  2HHH I;  1HR0 E;  1H72 C;  4JI4 I;  4LFA E; 
#chains in the Genus database with same CATH topology
 4CYU A;  3G8T A;  2L48 A;  4LF5 J;  4M8L A;  5JJB A;  2LU1 A;  4M1K A;  3P3D A;  3CW2 C;  3R7B B;  4RLE A;  1PG5 B;  2WRM A;  3C6T A;  5ETM A;  5J1E A;  1N32 I;  1H7W A;  2CZV C;  2WCX A;  3UI3 A;  1BQN A;  3W65 A;  1U4B A;  4WTY A;  5M2U A;  2C2E A;  2RS2 A;  3NLC A;  2MZS A;  4DQP A;  4G1Q B;  5E0O A;  5J2N B;  1XWL A;  3W2V A;  2KRB A;  2MQ8 A;  3ET6 B;  4C48 A;  4RL1 A;  2F7V A;  4RO0 A;  2DHX A;  3V6K A;  4DV1 I;  1F3V A;  4FW6 A;  2ADB A;  1H2V Z;  2I5J B;  2HNY B;  4PG4 A;  5HLF A;  2IES A;  3T6J A;  2XB2 D;  1Z2L A;  1U7L A;  4ANC A;  2FC9 A;  1SIZ A;  2RD5 C;  3QWU A;  1QSL A;  2PFF B;  4PRX A;  3MTJ A;  4JI3 J;  2MQN A;  2VPZ B;  4HTI A;  4NCG B;  4O4R A;  4WKR A;  4MIB A;  5DO2 A;  4LSN B;  3TO8 A;  5E3R A;  5KT7 A;  5JVH Q;  1HQE B;  1CBK A;  1W7W A;  3MM5 A;  4HDH A;  5A8W B;  4JB8 B;  3VAI A;  2DPI A;  3FBF A;  4N41 A;  4NMX A;  1TAU A;  3Q8Q B;  3RAM A;  4KO0 B;  3KG0 A;  4X4R A;  1AFI A;  2LKZ A;  3CJK B;  4A8Q A;  1U1N A;  1HHT P;  2ZZN A;  1S1W A;  2XYG B;  3FVY A;  2EK6 A;  2DGV A;  3EPG A;  2GMJ A;  5D6G A;  2Z5B A;  5E3A A;  4ZVE A;  3SSR A;  5C0X F;  3HKM A;  3DI6 B;  1EET A;  3Q8Y A;  4B3T E;  2GJ2 A;  3A1Y G;  4LF4 I;  4QR1 A;  1RHM B;  3KUE A;  1C0T B;  1OPZ A;  2E5H A;  2YNF A;  3LAN A;  2JWN A;  1BXN A;  1GX6 A;  1MU2 B;  2FJB B;  5HP1 A;  1T05 A;  1KQF B;  5L46 A;  1NB2 A;  2AYE A;  2NYH A;  2AF6 A;  2MZ1 A;  3MPY A;  3NGU A;  3B4D A;  1R43 A;  1JIH A;  4ELU A;  1V5V A;  5ETK A;  5G0R B;  4ED1 A;  3CD6 S;  4Y0F A;  4GKJ E;  1XC9 A;  3UCU P;  5D3G B;  2POK A;  1ELO A;  3W9I A;  2KTQ A;  5I42 A;  4P7A A;  5EX0 A;  1Q53 A;  3G6X A;  3P06 A;  2ZVS A;  3MGJ A;  2HHT A;  1Q0N A;  3O1L A;  5I42 B;  4KGM A;  1RTI A;  2COL A;  3GMG A;  4JYA I;  1FD2 A;  2JFD A;  1D9A A;  4Y6I A;  3VF0 B;  3FEY B;  1F0X A;  3TX8 A;  2CJK A;  4PUO B;  5KAK A;  2YY3 A;  3I0R A;  3PFO A;  3J80 Q;  3BS9 A;  4FPR A;  3UN3 A;  4ZCM A;  2WZ1 A;  3CUN A;  2F4F A;  1YJV A;  2O66 A;  1JLC B;  2V2Z A;  3R8Y A;  2X36 A;  1LKZ A;  1Y10 A;  3G8Q A;  4LVN P;  4X65 F;  3OUY A;  3EMT A;  4KYZ A;  2ZFH A;  1Q16 B;  2XCP A;  1AB8 A;  1I94 F;  1H7U A;  3EJM A;  3I5A A;  4BBY A;  1DQ8 A;  3KHG A;  2GHP A;  5LMU J;  1GK8 A;  3UD5 A;  3SCL E;  1ZS6 A;  1S1X A;  3U02 A;  2QSF A;  1S4F A;  1FXL A;  2C39 A;  5DGA A;  5MLC V;  3NY0 A;  2PGC A;  4FYX B;  3R3T A;  3R7S B;  2VJU A;  3PZP A;  1RCX B;  2YNG A;  1E6V B;  1OMS A;  5I3P A;  3M9M B;  1N0U A;  4KFB A;  2F3J A;  5JEA C;  1E6Y B;  5KG0 A;  2E9Z A;  4GQU A;  5EWG A;  2M9K A;  4OYA A;  1IBM E;  2YKN A;  1Y60 A;  2X7I A;  2QX0 A;  2AZ3 A;  1AZS A;  3FBC A;  3SCK E;  4OO1 C;  1VGY A;  3ZZR A;  2QL7 B;  3T1H E;  3DOL B;  4ETZ A;  2W2M P;  1RT1 B;  3PEJ A;  1Q1K A;  2XMJ A;  2FZC B;  2KI2 A;  2VG6 A;  2E9R X;  1FKO B;  3AB4 B;  4M5K A;  3PKY A;  2QJ3 A;  1X8D A;  3OW2 R;  2HFS A;  3CSK A;  4ID5 A;  2PN6 A;  2W01 A;  4OYO A;  3QAT A;  2P2C B;  3KYL A;  4LRB A;  4LSL B;  4LFC F;  4NYP A;  4C3L A;  5DLG A;  2HBZ B;  3CCQ S;  2QE5 A;  1HW8 A;  1TKZ B;  5HAN A;  4LF6 F;  1YRT A;  3H2V E;  4G1Q A;  1LEO A;  1LW0 B;  1S6P A;  2MZQ A;  5GME A;  1U1Q A;  2GHV C;  4PWW A;  2WBR A;  1FEH A;  5LSL A;  3DLK A;  4NX9 A;  2UXB F;  2BM1 A;  2RQ4 A;  3KDO A;  5L1L A;  3FQK A;  4NOH A;  3UDL A;  3SV4 A;  1KC8 T;  3T1Y I;  4ETX A;  4UZB A;  4E0D A;  1UWB A;  4LF9 E;  1IKW B;  3HHL B;  3CO9 A;  1XMQ I;  1FX4 A;  1C2P A;  3R5D A;  1Y3J A;  3BB5 A;  3PJ9 A;  2B43 A;  2NXU A;  2H48 B;  2YWE A;  4ZLL A;  2MKH A;  3WX8 A;  3OV7 A;  3UCZ P;  2J65 A;  3ITH A;  1HNZ J;  2FY8 A;  1NHU A;  4EWT A;  5LT5 A;  2GML A;  3C16 B;  3ISZ A;  1SKR A;  1RBO B;  2WSE C;  3C14 B;  3C6U B;  2EWH A;  2BZ2 A;  2DYA A;  2PMH A;  2RKI B;  3FKB A;  1XMO F;  4TU7 A;  1T9W A;  2CIM A;  2LFV A;  4G1I A;  4NLU A;  2OTJ S;  1U24 A;  1BQN B;  2FGC A;  3FEZ A;  1Z5A A;  3H1C A;  4H4K A;  4RUA A;  1NKE A;  2O1U A;  2W24 A;  3OXG A;  4MYT A;  4WUD A;  4DV5 E;  1YI2 S;  1HR0 J;  4KAI A;  4JI7 I;  1LWC A;  2VF3 A;  4UUW A;  4J9L A;  1UVM A;  4HYK A;  2CKW A;  3CUL A;  3OSN A;  2AT1 B;  2KXF A;  5L1K A;  2FHJ A;  1FRL A;  2O1T A;  1B70 B;  2ATC B;  4JI8 I;  1YH8 A;  4QZV B;  2XUL A;  5T41 A;  3R5J B;  2ROE A;  4F3Q A;  3ELH A;  4PG7 A;  1FO1 A;  1U6Z A;  1U1M A;  4OZ2 A;  4FXD A;  4NCB A;  3BSA A;  2HBY B;  2PO2 B;  5JEA F;  2V4Q A;  2LEC A;  2DRB A;  2I0X A;  1BC6 A;  4DPT A;  3UD4 P;  2VPX B;  2G1H A;  4JI6 I;  3EE3 A;  4TQS A;  1LWX A;  4KY3 A;  3RZA A;  3OL9 A;  1RTJ B;  2JT2 A;  3UDV A;  1VBK A;  2XMU A;  1VIS A;  4YY3 J;  1ZOT A;  3SCJ E;  4DS5 A;  3P6Y C;  3LP1 B;  1RLC L;  5DS7 A;  3J7Y U;  2GQ0 A;  3P3E A;  4RW6 A;  3MM8 B;  4F26 A;  4J9M A;  3SDE B;  5AT1 B;  2UUW A;  4TU9 A;  2DGS A;  2DGO A;  2XZT B;  3DRP B;  4F0H A;  2C39 B;  2UXC I;  3AQO A;  4O44 B;  1Z5B A;  5CYJ A;  5A6W A;  3OTB A;  2W9B B;  4EBC A;  2HG4 A;  5HAO A;  1GX5 A;  4B3M E;  1RWN B;  1X5T A;  3K57 A;  1S4E A;  2CAD A;  2RDJ A;  1UVI A;  2DNQ A;  1BE4 A;  2XY6 A;  1Z59 A;  1FCA A;  4F02 A;  2CPD A;  2LXF A;  5ETR A;  4ELV A;  2XS5 A;  5BXI A;  4ED0 A;  2HFZ A;  4EEY A;  2NUU G;  2KHD A;  5LMN I;  3GFX A;  2XWY A;  4DI6 A;  1N6Q B;  4PUO A;  1XMB A;  4ES3 A;  2ZBK B;  1KIJ A;  4UT4 A;  2CPZ A;  1IKY A;  1B63 A;  3I56 S;  2X1G A;  1WHX A;  1S1U B;  2V0N A;  3MMA B;  4OYW A;  4LSL A;  5B7W A;  5RUB A;  1CQM A;  3DOM A;  1NH8 A;  5FLX U;  2YNH B;  2BA1 G;  1RWU A;  2VQE I;  1UDQ A;  3ZTP A;  3CMQ A;  4X84 A;  4OIX A;  3JYT B;  4LF7 I;  3M7V A;  5JXS A;  4DL7 A;  1VQ4 S;  2VQE E;  3CPW R;  4X4V A;  4U7U D;  2R7O A;  1KVK A;  4DZD A;  3D6F B;  1TL1 A;  1B64 A;  2UUT A;  2XMT A;  3J80 Y;  2XY5 A;  4NXM F;  4YDD B;  4X62 J;  1PBU A;  2UUC F;  3NBP A;  1XNQ I;  5CYM B;  5DET A;  3J7Z 5;  1DTT B;  5A2Q C;  3W5X A;  3V5R A;  2VG7 A;  2B7C B;  3HKZ D;  3BZQ A;  4LT6 A;  3H7H B;  4RBT A;  4MMO A;  5CZV A;  1OS5 A;  1EKS A;  1S1T A;  2K3I A;  2WHO A;  5CYM A;  3OL7 A;  2W9A A;  2HFO A;  4U96 A;  4IZK A;  3DLE A;  3WU3 A;  5KFT A;  4HLB A;  1N33 J;  5IT9 Q;  4RNO A;  1U48 A;  4IYQ A;  9RUB A;  2WAQ D;  4AD6 A;  2VG6 B;  4K0K J;  2QMX A;  2HYI B;  2B8Q A;  1SI9 A;  2ZH2 A;  2J9D A;  1WSR A;  2GZO A;  2HMI A;  1JJC B;  2LLZ A;  2R2U A;  4IOB A;  1VS3 A;  2XHW A;  5LMU F;  3RRH A;  1GH8 A;  3M8S A;  2BAN A;  1DZ5 A;  2LYV A;  1RT6 B;  2WSF C;  4ZKA A;  2R8I A;  4DL5 A;  1U49 A;  1RWK B;  1NHH A;  4KFB B;  3I9V 9;  1LWF A;  1PC4 A;  1FKA E;  4DR4 I;  5FDL B;  1MG7 A;  1X5P A;  4QNJ A;  4P52 A;  1R89 A;  2I5J A;  2DNM A;  1NJY A;  2FJX A;  1NDC A;  3ETO A;  4WP3 A;  2MKK A;  1SBR A;  2DH9 A;  3D0G E;  4UUX A;  5HVF A;  4CM0 A;  4OHV A;  2ZH8 A;  2O3Z A;  4J5O A;  2UXB I;  4M5D A;  1QAJ A;  4UY8 T;  3F56 A;  1JKH A;  4PWD B;  2R42 A;  1ZM4 A;  4WE1 B;  1CLF A;  4IDK B;  2LEP A;  3MCO A;  4KIA A;  5BR8 E;  2CPJ A;  4DCP B;  3JQM A;  3I9Z A;  3ZNJ 1;  2K06 A;  4IDK A;  3AXK A;  3EXC X;  1RXO B;  4LFC J;  4Y2M A;  1V5I B;  1WEY A;  4LF5 E;  3HFV A;  1NZ0 A;  1U1K A;  4P2M A;  3UO0 A;  4OYZ A;  3DLK B;  1EET B;  2V8H A;  1HNV A;  2YBV A;  3KUG A;  4NZ7 A;  4K7Q A;  1HWJ A;  5LJ3 Y;  2R7X A;  3M6U A;  1H3D A;  2EFO A;  2JVO A;  1TL3 B;  4I7F A;  5DDR C;  5CD4 A;  2W1B A;  1T94 A;  4EMD A;  1FJG I;  2BEF A;  2ALY B;  2IM3 A;  4O4G B;  3SMZ A;  2E1C A;  3OQ2 A;  2MDA A;  1N33 I;  2IY5 B;  1J5E J;  2CQH A;  4R5P B;  8RUC A;  2C3M A;  3V6H A;  4Q8F A;  3QRQ A;  4HI1 A;  2ZUG A;  4PXE A;  3G71 S;  4I2P A;  2FQQ B;  4HH1 A;  4YR0 A;  1ZYQ A;  1M5O C;  3HSJ A;  5G0R A;  3HM9 A;  1D0E A;  2CRL A;  1SV5 A;  1FD8 A;  2B5J B;  2D3U A;  2PEH A;  4TVA B;  4BWJ A;  1A6F A;  3VQT A;  1L3S A;  5KG4 A;  4LR9 A;  2ZH4 A;  2DGU A;  4HY1 A;  3ZTQ A;  4KHP I;  1X0P A;  5KFG A;  5KFJ A;  1IKV B;  2OPP A;  3NOG A;  2V63 A;  3BN7 A;  2YTC A;  1NHJ A;  1OYR A;  4R0J A;  2A2C A;  3UFC X;  3W63 A;  5HMY A;  1UL3 A;  5KFS A;  4L6V 3;  4GC7 A;  2HHW A;  2VG7 B;  1KDN A;  3C3L A;  3PNI A;  2VQE F;  3PCO B;  3VAL A;  2BOA A;  2VPY B;  3BGR A;  4FVM A;  4BC7 A;  4JI7 F;  1FJG F;  2FPH X;  3IR7 B;  4AL7 A;  4X64 J;  4DUZ I;  3R5A A;  4CO2 A;  1PYS B;  2LEA A;  1RAC B;  1NK8 A;  1VIO A;  3WHI A;  4KPY A;  5HJY A;  1XNR I;  1TK8 A;  3C2P A;  2GAG C;  4EU0 A;  5ETQ A;  2JLE A;  3CDB A;  2FVP A;  1DAR A;  3NWG A;  1ZPV A;  1KON A;  2V94 A;  5K20 B;  4AID A;  1Q5Y A;  2NN6 E;  4KQV A;  4BA1 B;  1XNQ E;  1R6V A;  2QL5 B;  1KKH A;  2NR0 A;  4DR6 E;  1RWO B;  2UVV A;  1N6Q A;  1BD6 A;  4NZ0 A;  1VI7 A;  3Q8P B;  3OJS A;  5K14 A;  4ZIV A;  3RR7 A;  4N8N A;  3GSD A;  4RNM A;  3T1Y F;  1V9O A;  2XG8 A;  1UEV A;  3ENW A;  4FYV B;  2GVD B;  3TEG A;  1R6M A;  3IM8 A;  4DS4 A;  1G6B A;  4K5S A;  1KN6 A;  3GII A;  2UXC E;  3NS6 A;  4L72 B;  4DR3 E;  2JHE A;  1SJQ A;  2GS8 A;  4CI0 B;  4CWB A;  4JV5 F;  4U7U K;  1VK3 A;  4LUB A;  2QA4 G;  4K5R A;  3ZTR A;  6FD1 A;  2ROP A;  3ONQ A;  4TKT A;  4D3G A;  2BKN A;  5EUH A;  4DFJ A;  1DLO B;  2YKP A;  2FHM A;  3CJR A;  1F1B B;  3CVK A;  3WX4 A;  1SIW B;  3BQ0 A;  1DAX A;  1FWL A;  2HQ3 A;  2FGO A;  2W7O A;  1S0O A;  4OO1 E;  4NLQ A;  3OFG A;  1NAQ A;  4K59 A;  5IFM A;  1UEU A;  3TZW A;  4PXB A;  5HN0 A;  2DNK A;  3GWC A;  3NCQ A;  4MFB A;  1MWQ A;  2E5I A;  3PRV A;  5G4D A;  4PYA A;  2RDI A;  3I5C A;  1T8E A;  4ED4 A;  2FTR A;  3JSB A;  4J90 A;  2DHH A;  1YJ9 S;  1EIY B;  3HJF A;  3UWT A;  5AJ3 J;  1RHY A;  1S1U A;  2MLY A;  3MR5 A;  1K44 A;  1RK8 A;  3KLG B;  2HHV A;  2HHH E;  3CD0 A;  3AXM A;  2MHE A;  3BF4 A;  2VQF E;  2BJ3 A;  2P5V A;  2YVS A;  3QIP A;  1RAJ A;  3CE8 A;  3HVW A;  3ILO A;  3LP2 A;  3W61 A;  2UXC J;  2W2N P;  2N7C A;  4U8Y A;  1VC6 A;  2KYX A;  5HL7 Q;  3M30 A;  4DPU A;  4IZJ D;  4USI A;  2HQI A;  4NXN I;  1R0C B;  2HMI B;  2WW8