1KKHA

Crystal structure of the methanococcus jannaschii mevalonate kinase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
317
structure length
317
Chain Sequence
PRGSHMIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate Kinase
publication title Structure of the Methanococcus jannaschii mevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 104
structure length 317
sequence length 317
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2001-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1kkhA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1kkhA01
2HK3A 4DR5I 2BM0A 2WW4A 1XMQI 4DUYE 4USKA 3J7AG 1ELOA 1U2RA 1NZ0A 1MX0A 3HULA 3LNUA 1K47A 4DUYI 1KKHA 1PVGA 4JG4A 2HFSA 2HKEA 3PYDA 4WUCA 4FN5A 5GMEA 4USMA 1I94E 4DV7E 4JV5I 1PKPA 1ZM9A 5IT9Q 2DEJA 1DARA 1RREA 1I94I 1FWKA 3T1HE 4B3TE 1Z0TA 3LPSA 2R3VA 4DV7I 1XNRE 1WUUA 3WU6A 4HXZA 1B62A 2V2VA 4DR2E 2Q2EB 1Z0EA 4B3TI 4AQYE 4X64E 2UXBE 1XNRI 4Z7YA 4DPXA 5L3JA 2X7IA 4JI8E 2VF3A 4DR2I 1J5EE 4UTGA 1HNWI 4JI4E 3F0NA 4AQYI 4X64I 2UXBI 4B3SE 4DPUA 1B63A 3ZKDA 1MG7A 5A2QQ 2UXDE 4JI8I 4LF4E 4B3RE 4JI4I 4B3SI 4DR1E 3H4LA 4K0KE 4DV3E 1Z0VA 4M1KA 3JAMC 4DV2E 1PIEA 3ZKBA 1S4EA 3V2UC 3QT6A 4K0KI 4JI6E 4KHPI 4DV3I 1XMQE 3V5RA 1RR9A 1Z5BA 4MYUA 1N36I 4HYMA 4JI1I 4JI6I 4JI0I 1D6TA 4RPFA 4GKKI 1FKAE 1NHJA 4UT4A 1UEKA 1KIJA 2VQEI 4LFAE 4LF5I 4XTJA 3PYFA 4DV4I 4DR3E 2GS8A 2UUBE 4LFAI 5IWAE 1FJGE 4DR4E 3GONA 4JI2I 3J81C 4DR3I 4JYAE 2F4VE 4JV5E 1N32E 5GMDA 2UUBI 1IBME 4PRVA 4DV5E 5IWAI 1N0VC 1FJGI 2HHHI 4DR4I 3CWVA 3QT7A 4JYAI 1NHIA 2F4VI 1N32I 4ZVIA 4NXNE 1Z0CA 1IBMI 3B78A 1N34E 4LF7E 4HACB 5LMUE 4DV5I 1XHKA 4LF6E 4FWDA 4FWHA 1Z5AA 3M6AA 4P52A 1H74A 4NXNI 5FLXC 1N34I 4LF7I 4FWGA 3OTOE 4P7AA 5LMUI 4LF6I 1HNWE 1EA6A 1H7UA 4JI7I 3OTOI 3JAMQ 3PYEA 2VQFI 3PYGA 1H72C 2UUAE 4DR6I 4X66I 1MU5A 4I3HA 1HR0E 4YY3E 2J7KA 4LFBE 4PU9A 2UUAI 3J80C 1Z0GA 4HY1A 1HR0I 4DV1E 4KHPE 4YY3I 4LFBI 4DU7A 1NHHA 3B8HA 1N36E 1IBKE 5LL6R 4JI1E 4JI0E 4DV1I 4GKKE 2HKJA 1KTVA 1N33E 1BKNA 3ZZTA 3Q1QA 3QT8A 4X62E 4Z7CA 4R1FA 1IBKI 2AJ4A 1QZRA 2VQEE 2NPFA 4LF5E 1H73A 3QT5A 3J81Q 1HNZI 4JI5E 4ED4A 4DPWA 2CZ9A 4DV4E 1N33I 4DPYA 4X62I 4LF8E 1FNMA 4OX9E 5BR8E 4LF9E 4JI5I 4FW9A 3J7AM 2ZBKB 2UXCE 1FI4A 4JI2E 2A2CA 1Z0WA 4LF8I 2HK2A 3K1JA 1VISA 4OX9I 4DV6E 1H7SA 5BR8I 4LF9I 2HHHE 2XEXA 2LJPA 2UXCI 2V34A 5LMNE 4URLA 4X65E 5FLXQ 1XMOE 4GKJE 4DV0E 4YHHE 2R42A 4DR7E 2HFUA 4DV6I 2V8PA 1ZXNA 4PRXA 1Z0BA 5LMNI 4X65I 4GKJI 1XMOI 4DV0I 4YHHI 2UUCE 1FWLA 4DR7I 3B82A 2BM1A 1Z59A 1ZM4A 4JI7E 2OI2A 2UUCI 1KVKA 2VQFE 2E1RA 4NXME 4EMDA 3J80Q 1EI1A 4DR6E 4X66E 4DXLA 1OJ4A 1XNQE 4NXMI 1A6FA 3WU5A 4WUBA 3WU3A 2BV3A 2ZITA 2X36A 3T1HI 1XNQI 1N0UA 2UU9E 3ZZUA 4DUZE 2A2DA 5IT9C 1ZM3A 1HNXE 2E5LE 2UU9I 4HACA 4KQVA 4DU8A 4JI3E 4DUZI 1Z5CA 3T1YE 2V2ZA 1J5EI 1HNXI 1HNZE 2E5LI 3LTOA 3D4JA 3K17A 3ZM7A 1ZXMA 1ZM2A 2EFGA 4JI3I 4B3ME 1IBLE 2ZM6E 2UXDI 4LF4I 3T1YI 3WU4A 4B3RI 4LFCE 1S16A 4DR1I 4MYTA 4DR5E 4B3MI 1IBLI 2ZM6I 5A2QC 4DV2I 4LFCI 4DPTA 3ZZ0A 2DEIA 2V2QA 4WUDA
chains in the Genus database with same CATH superfamily
3K89A 5GAHI 2XGQA 2VICA 2BQ3A 2GGPB 4DQSA 5DLFA 2NZ4A 1BQMB 1KTQA 5HJYA 3M1VB 3J7AG 3QFWA 1NZ0A 3UNGC 1EETA 4G6VB 1K47A 1DLOA 1RADB 1RLCL 2O67A 2AD9A 1EP4B 1UZDA 3T5JA 1N33F 1S0NA 3TP2A 2VG5B 3QIDA 4OHVA 3EX7B 2IM1A 2YNHB 4C8ZA 4QYZK 3OPKA 4WBFA 3OUYA 4DL4A 3VTIA 2F8EX 2N4CA 3L09A 3NG8A 4LF9F 1KQGB 3QJPA 1NMEB 4ZP6A 1JLCA 2QC3A 3T1HE 1CULA 3JYTA 3TAPA 1KOHA 2PNMA 2ASDA 3FRYA 4PWWA 4ZPDA 1U8WA 4GKJF 2M4MA 4KT0C 5U47A 2F9DA 3Q2SC 6FDRA 4Q0BB 3P8BB 4I69A 4FF3A 2LYVA 5DRRA 2KYZA 1UWBA 4U96A 3DMJA 4WP8A 3G82A 2AF6A 4C3LA 1YJNS 2QL9B 1DJ0A 1Z2LA 1ZH5A 1LWEA 2NUHA 4DL5A 2XZTB 3LH2S 3RAMA 4C3MA 4M95A 3K8WA 1QE1A 1Y4ZB 1APSA 2FLPA 4NLOA 1FXLA 5HMZA 4JV1A 1UP1A 2FVRA 2G2OA 4HYMA 4L76A 5E5NA 2R7WA 4RWWA 4ISAA 2HWIA 1Z2ZA 1IM4A 2XSJA 1NLKL 3OSNA 2HHXA 4DL0C 5B08A 3N6LA 2DISA 3VHQA 1IUJA 2ROPA 1CPZA 2ADCA 3EWGA 1TMMA 2QG9B 2DB1A 2QA2A 4IG3B 3M9NB 2JC1A 2ZM6F 1FRLA 5AXLA 2VL1A 2PFFB 5F3TA 1NPRA 3GIRA 2CQ0A 1N34E 2EFQA 4HACB 4OI4A 1AA1B 1N5QA 3MPWA 2HQ3A 4NOHA 3PFOA 3DRSB 4NLXA 2DY1A 2WVFA 3DDNA 1XR5A 3TJAA 1SUQB 4Y00A 3A3PB 1H0HB 2FZCB 1HWKA 2GMHA 3AJ2A 3OXFA 1Q81T 2QFIA 1NK5A 1HLWA 1B0VA 5ETMA 3PYEA 3R6LB 4I2PB 3PYGA 5HANA 2VH7A 5L9XA 4QWAA 2UUAE 4GC6A 3Q6NA 4DL6A 4X66I 1UCNA 1UDNA 1VRUB 2RKIB 1LNQA 2JZ5A 2IBKA 2DKOB 2H4WB 3G2XA 3I5BA 3DI6B 4AE5A 4HY1A 5A8RA 2D9OA 3HHLC 3K2YA 2HGMA 4DU7A 5L1JA 4LFAJ 3BGFA 1NK6A 4DEZA 2L48A 1O6XA 2DNZA 4DV1I 2YWKA 5GMKa 2HS3A 3BBCA 3QT8A 1SL1A 2A18A 1GX6A 5K8OA 4JYAJ 4DX7A 2WP8A 1TV6B 4RW4A 4X62I 4FKYA 1I6JA 4F0MA 2QA4S 2IAJA 4YN3B 4DSKA 3HMJG 4NXNJ 2K06A 5HMXA 2YNIB 4Y65A 2FLOA 3F56A 3PXGa 4CM0A 4DN0A 4JI7J 5H9EK 4ZLJA 4ZP7A 1A0OB 1RHYA 3MD1A 3DOMA 4PCQA 4Y34A 4X65I 3IA0A 2W4PA 2PO0B 4P2XA 4TQRA 2ABYA 4NLTA 2KXNB 3OFEA 1N48A 1Z59A 4FF4A 4FF1A 2DRBA 4MKBA 1RT6B 2MHEA 1ZOTA 2ZBRA 4FW4A 1UWAA 1SH0A 1FDDA 3KFWX 3IG1A 3BJYA 4X66E 4DXLA 1RWWB 4ECUA 2BJ9A 2XYHB 2AEMA 5GVQA 3DRPB 2GMLA 3H8YA 1XNQI 4IFDC 4LRAA 2A1BA 5IT9C 1V5IB 2AKWB 3HI9A 3M8WA 5DROA 4IZJB 5DLGA 4GC7A 4Y2IA 5AE2A 2CKWA 5ETRA 1J5EI 4X4UA 4ZN3A 3W7BA 3M6WA 3CCLS 3HP6A 1R0AB 2VQFF 4QWEA 1IBLE 2UXDI 3ISNC 3L7PA 4LF4I 3V6KA 4WKYA 1RCOB 1B0TA 3ETOA 2VFUA 4AUKA 3BGOP 3GG1A 2VHGA 5DRQA 5DDOC 3UVJA 2OPPB 4BS2A 4G1QA 3M30B 1F60B 2XHWA 1GH8A 1S0VA 1WDDA 3I0RB 4DUTA 2HHWA 1VRTB 5F0UA 2I0XA 4GO5X 4RBUA 1C0TB 1Q7LB 1F5CA 3MMBB 1Y5LB 1HNZF 3QO9B 4WXOA 1WD6A 1Z4UA 2Y8WA 2VFTA 2FJVA 5HQMA 3SDEB 3MM7A 3Q23A 4USMA 4U67Q 2QA1A 5DRKA 1CJUA 1N4LA 4IRKA 4P9SA 4WFZA 4IUFA 5KT5A 3EUNA 1REVA 1ZM9A 2HYIB 1WHWA 2LKZA 4NA3A 2NPIA 3PDNA 4F2SA 5D15A 5J2MA 5D4OA 3QPIA 3R1HA 2HAIA 2ZHBA 4F4AA 3M2UB 2FVSA 5BJRA 4AM3A 3OR1B 2PI4A 3MFIA 1AROP 4ED0A 5J2NA 4QJVA 3RRKA 2G0JA 2IJNA 3VALA 4Y6IA 1J5EE 2U1AA 3DC2A 1JJ4A 2UUCF 3EXYA 3PJ9A 1QAYA 4Q8EA 4LIRA 2UXDE 2ZD1B 3IR7B 4LF4E 5KFEA 1Y00A 1HBOB 3H4LA 1RGVA 4O4RA 3IRXA 1M5VC 5E3CA 2FZGB 2PSZA 1U0SA 2M5YA 2L3MA 4I2QB 4RW7B 1CJVB 2QEXS 1X5SA 1W26A 5KFMA 4JI6I 4RPFA 1QSLA 3BKTA 4PYAA 5ETOA 1F2HA 3RBZA 3HJFA 1I1GA 1M90T 1FKPA 3FEXB 3DDIA 3I96A 1X9SA 2DXFA 4ID8A 1WF1A 4RJVA 1XERA 3OHAA 5D8HB 1WG4A 4K2XA 1RHMB 1TL1B 1YI2S 1WG5A 4JOUA 1NSQA 4EBCA 5AXMA 3CULA 4DR2J 3HVTB 2GO4A 2D3ZA 1UVMA 4DR5F 4O3RA 1ZAWA 3ONQA 3D3BJ 3K7RA 2RILA 5KFWA 1AZSA 2DHSA 4JI4J 3ZO7A 1ZTTA 2EFVA 2HHVA 1K1SA 2CQIA 3CDUA 3W2VA 4Y2MA 2KVQE 3O3LA 4KKOB 1RBOB 3LALA 5A2QU 4DV3J 3GJSB 1KQKA 4F3OA 1FJCA 2PFDA 2LP4A 2XMUA 4JI1J 2VPZB 2IBOA 3QATA 3VAMA 4OZ5A 2BJ7A 4O23A 4CM2A 3FCWA 2J7KA 3E01A 4MKVA 1VQMS 4M5DA 4FF2A 3TRGA 2IRUA 4BWMA 1RSCA 3AD7C 4FP9A 4J9RA 4YY3I 3KNGA 4HYKA 1W25A 1JKHB 5KFNA 3ZZPA 1GMUA 2EEYA 4B3TF 3TQEA 4OO1D 5M2UA 4DR3J 2UVUA 4OZ1A 3GILA 1N33E 1QAIA 1BKNA 1RT5A 1N5SA 3PKYA 3C8YA 4AQYF 2E7XA 3L7ZB 2L08A 3VV2B 3GV8B 2E9RX 2DPJA 2VBXA 1FE0A 3MMAB 2YNGA 4LF9E 4YR0A 4EGLA 2ZBKB 3SEOA 2Y0BB 1OPIA 2C3YA 3H5YA 3AH6A 3LWMA 1Q86T 4KJIA 4DJBA 4NZ6A 3G9CA 2FYXA 2UXCI 4KHPF 4GKJE 2KG0A 1JJCB 2PN6A 3T5LA 3DLKB 2RRNA 2KRBA 1YX2A 4J37A 2R7RA 3UWTA 2AE8A 4RKUC 1FNOA 3KJQB 5L9NA 1U4BA 4OO1A 4YFUA 5HBMA 1HD0A 4DV4F 3B54A 2OI2A 3WX8A 4ECVA 3TVYA 4PR6A 1IKWA 2OO4A 4RZRA 1RWVB 2O5DA 3CIZA 1HBUB 2R7TA 5EWFA 4WE1A 4NXMI 4ETZA 3AXKA 2CQBA 3I5AA 4ED3A 3LPEA 5ETKA 2F4VF 1MU2A 3TEGA 3CW2C 3D66A 5D0GA 4N3OA 2CPHA 3QRPA 2YQ3A 1ICEB 5B0GA 2UU9I 4LF7F 1MSWD 3PO4A 3TJ9A 2WK4A 4IR1A 5G0RA 3AA9A 5H9EJ 2DD8S 4DV6J 1ZXMA 2GHVC 2EFGA 4B3OB 4LCFA 4JI3I 2ZM6E 2AJ1A 3T1YI 1WOOA 2LXIA 3D0IE 2A10A 4NMXA 3VWSA 2OAUA 1DZ5A 4YQWA 1RLDA 5A2QC 3DU6A 2RQ4A 4YP3A 1HI1A 3IWXA 3MM5A 3P06A 5KG0A 2FJDB 4KFBA 3OTEA 1FWPA 2WW4A 2PA3A 3C14B 3FDSA 4N47A 5HROA 3M8SA 5DZ6A 1T94A 1U1PA 1KLMA 1IBKF 2A6MA 3FZ2A 2VG7A 4WUCA 2BW2A 1O8BA 1GNKA 4WXWA 2XTJP 3BF4A 4E8UA 3BO4A 1T9YA 4PQUA 4QPTA 3D54A 1B0PA 3D6HB 3TZXA 4PEOA 3P49B 2KDOA 3UDEA 2Z8QA 4UW2A 2FJWA 3LGMA 2W2MP 3PEJA 2OSRA 3G86A 1IKXA 1RT1B 4NLYA 3KK1A 5LMNF 1UVLA 4TYBA 3MD3A 4QU7A 1Q8BA 2PNLA 3NNCA 3MF5A 4KGMA 1B99A 2H54B 2FIUA 2LXUA 2HZCA 1RUSA 3AJDA 2UVVA 4X64I 3M7NG 1QLNA 3ZKDA 3MOZA 1NBEB 4J5OA 4O3SA 1DQAA 4JI8I 3U1YA 2CJAA 1KRPA 1MLAA 4ZVTB 2W9BB 4WFYA 4PPZA 4B3SI 5JMNA 2K8GA 1Z0VA 1GK8A 3M6UA 5T7LA 1PJ5A 4I1TA 2M52A 5K8MA 3M8ZA 5ETQA 3V5RA 5KFHA 2I2YA 2ZHOA 4LR8A 1RT4B 1NK0A 3AB2B 2VBYA 4DMZA 4ECZA 5G4DA 2G1HA 4ED5A 5F8IA 2Z5CA 2FTRA 3KG4A 1FXDA 2BA0D 2DYAA 3L7UA 1TFYA 2PEBA 3OLAA 2NQPA 3T9NA 3J7YU 1ZS6A 1CJKA 1JLQA 2FJXA 3J81C 2EVZA 3EGZA 2HNYA 2FJAB 2ZHAA 4W98A 2B43A 4DR4I 5K14A 2GAGC 5CCLA 2FD2A 3K5OA 4Y2CA 3RB4A 3WBZA 1DFDA 1Y9OA 4O3PA 3VZIA 2IPOB 1FF2A 4N5SA 5HVHA 3CCMS 1KD1T 1TL7B 4KHMA 1UTAA 4NCAA 4LSZB 1T95A 1DURA 5A8KB 3NGKA 4JV5F 5AJ3J 5K36D 1X4AA 2MLZA 1HI0P 2MDAA 1C0UA 1Q95G 4HH0A 2VOPA 3BDPA 3KK2B 1U6FA 2B4VA 3MR6A 5GAEU 1U24A 3H90A 4J9VA 2H4YB 4Z7CA 1EQ0A 2E7WA 2SXLA 2NPFA 4X4OA 1UFKA 1H73A 3QT5A 4FW5A 2V4JA 1VQ9S 2C2KB 2AZ1A 3ZTRA 3NY0A 3FBBA 1TKZB 2ZH8A 3KYLA 2VESA 3EZ5A 5HQLA 4LF6J 2OP5A 5HP1B 1VISA 1GAOA 2HMIB 1WORA 1ZPWX 1TL3A 5KFAA 4CLKA 2WSFC 4A8FA 5K36A 2XYPB 3EGVA 4U3DA 4ZCIA 5F9NA 4LR7A 4ZP9A 2JEAB 2OLWA 3K0JA 1RU2A 2RH3A 2ZZTA 1XMOI 4I67A 2UUCE 3BQ0A 1YQHA 2VQEF 1R8CA 4LF5F 1G7CB 4OYXA 2F8MA 4U7UD 3JAMU 4LFBJ 1HKAA 3HCXA 1K0TA 1PJ6A 5IV3A 3IAS9 4EMDA 5A76A 4DLEA 1OJ4A 4XK8C 2Y0SD 4TU7A 1NDKA 1T0TV 1X4GA 2MZRA 2RQCA 2YWGA 2ZDPA 3RR8A 3W3SA 4K59A 2E7VA 2VPYB 4LRDA 3BQ2A 1VFJA 4DV5F 4JI5J 2WB4A 3K57A 5KG6A 1S4FA 4NLRA 3SV4A 2DRAA 1C2PA 1DLOB 3HHKA 5CABA 3ZM7A 3KDNA 5M2PA 5C42A 6FD1A 1NDCA 2YKNB 2BJ8A 4C3KA 2IVYA 1S1TA 1RT3A 5J2PA 4KTQA 4ED7A 4DR5E 2BBEA 3MPDA 3UFCX 1WOSA 2Z0GA 4JBCA 2IC3A 1HR0F 3ENQA 2HK3A 1AXQA 2HNZB 1VGYA 2H5IB 3U27A 1M5KC 2JEBB 3KLVA 2FLNA 3HULA 2HNDA 5J1EB 2HLTA 4FYXB 4F8RA 1E6VB 4B9TA 2AYBA 3NMRA 4JG4A 2ACYA 1LW2A 2HKEA 3CCES 2GO8A 3PYDA 1LFWA 2JL9A 5GMEA 4O44B 3QSYB 1Q8KA 2VODA 4PXEA 4KV8A 2GVZA 1HNXJ 3CC4S 4H4KA 4B3TE 2MSSA 1RTIB 5ETTA 1QE1B 4HR2A 2RD5C 6AT1B 3NWGA 3GV5B 1FX2A 1T3OA 4KH1B 1WC1A 5KFPA 2I38A 4AQYE 4TNOA 3Q8YA 3EGWB 1XNRI 1XWLA 3VAGA 5DQGA 5LT5A 1X60A 1XMQJ 2UXBI 4LSLA 4PG6A 2GW8A 4HHJA 4M63A 3BO3A 1QSYA 2JVOA 4KPCA 2KZMA 2HHTA 4A46A 4OJ1A 2B8QA 2U2FA 2MLYA 3QNWB 3L9ZA 3RRHA 3CJKA 3JAMC 3N6NA 1S9EB 2W2QP 3U7JA 1FRJA 5I3UB 2YPZA 2J0XA 3VAIA 3W60A 2OD6A 2B5JA 5DGAA 1T9UA 3LP2A 2NXJA 4ZPVR 1JLGA 4LBPA 3OXLA 1SJ1A 2BOPA 1H2UX 5ETLA 3MM6A 4ZPBA 1MMDA 4A8XA 3KLEA 2C2NA 3EVMA 1S6QB 2F4VE 2JEFA 4OX8A 8RUCA 1N0VC 1FJGI 3DYAA 4WJBA 2O3DA 5A6WA 2IY5B 3HVAA 1IBMI 4LF7E 1NDLA 1NXIA 3U02A 1J2VA 2ZVSA 4DSLA 5LMUI 4J9MA 4IDKA 3BPSP 1U2CA 2MZ1A 3GZ7A 3RUBL 4RW4B 3P3EA 2AWZA 1QTMA 3KTQA 4PG8A 2IAJB 3GE9A 4M5NA 4I3HA 2EWHA 2HS0A 3J80C 2G9OA 1HQ2A 3UI3A 4K4VA 1JLFB 2QTWA 1G3OA 2VDHA 3PW4A 1IBKE 4DS5A 2VG6A 3N5FA 1AB8A 1VBYA 5IC6B 4IRDA 1XK8A 3JSBA 4DPOA 1RJJA 4BA2A 1DY3A 2RDDA 3EDQB 2CZ9A 1FNMA 1QAJA 3IAM9 4CQ1A 3KDOA 1Y60A 1KVIA 5BYSA 3VAFA 1N34J 3TVZA 4H4MA 1PILA 2F9JA 1QUPA 2RMLA 2RF2A 5LMNE 3BV8A 5FLXQ 2O1WA 2P9CA 1HHSA 1S1WB 1S6PA 2Y3YA 2HFUA 2V8GA 5AE1A 1RYRA 4IFYA 3K59A 2AYEA 4O3QA 3JS9A 2UUAJ 4DR7I 2K7KA 1VI7A 4PAAA 3SCKE 3WZ0A 4ID5B 2B7CB 1KN6A 3TW0A 2PI5A 1H2TZ 2HFOA 4B17A 1TELA 3RJMB 1HIYA 3BB5A 3B6BA 1EI1A 4J9QA 2DGSA 3MWBA 2VC0A 5HLFA 1N56A 4DL3A 4WK3A 1UFWA 3HVWA 3R9LA 4C6AA 3WU5A 2CJYB 1ZTWA 2BV3A 2F1FA 2M7SA 3C19A 3TVKA 2MJUA 4ETXA 2BE7D 1PYSB 2UZAA 4LMZA 2LCWA 2DNLA 1T9TA 2FJBB 4KQVA 4ES1A 1AUDA 4HDGA 4NLPA 1S7HA 2C38B 4CNYA 2ZJPQ 1JLBB 1VLYA 4CH0S 5IT0A 4HLBA 5K5MA 1I3OB 1VQLS 4ILRA 4B3RI 1OS5A 1R6VA 4ZITA 2FQQB 1CJUB 1L3KA 1RK8A 1U0HA 5CYMA 1N5VA 2OMLA 4WUDA 2GMJA 3AODA 3M2VA 4A8QA 3OV7A 2DTJA 1C1CB 1ELOA 4PABA 1TP7A 4MQYA 4P74A 3KJFB 2HW3A 3LANA 3DLBA 4DUYI 1KKHA 2DT9A 3GIIA 1HNIB 2DHHA 1FDBA 5J2NB 1PVGA 1HQUA 5K8PA 1LW0B 4FVCA 2HFSA 3DD6A 3PJWA 3I9V9 1NK4A 2BVZA 2NZCA 3TARA 1KFSA 1S5ZA 1WSVA 5JEAA 1LXJA 3LP1A 2XM3A 1ZYQA 3AAWB 3GPAA 1I94I 4A47A 4IZKB 1WUUA 2JVRA 4HI2A 3QLHB 1Q16B 2V67A 1F5BA 5KFCA 4YHHF 1IBLJ 2OEMA 3M32B 2F7VA 3T9ZA 2I5JA 1T9VA 1E6YA 3FNNA 2EBGA 2NXCA 4HT5A 4DPUA 1IR0A 5F8JA 2HS4A 4B3RE 2ZWPA 4DCPB 3H42A 4PWDA 3V4IB 2PNZA 2QN6B 4M1KA 3H59A 3CUNA 2FY1A 2R7SA 2AEJA 3V2UC 3QT6A 2AV5A 1SJFA 2R7QA 3TOQA 1NUEA 2H5JB 1FRKA 3FEYB 4M5IA 4R0JA 1VDHA 4OHZA 5HMYA 2HVIA 3THPA 3WIUA 1IWAA 4LRFA 2HBQB 4TVAB 3EICA 2MQPA 4H4OA 4DS4A 3M2RB 2E5LF 2GVDA 4R8UB 4QIWD 4N56A 4XTJA 3NOGA 4QIGA 5MAOA 2N4DA 4F3MA 3RRGA 4QYRA 3TEHB 4IFDF 3M7VA 1K0VA 4LVNP 5KFVA 2D3O1 3GONA 2ZNZA 2MGZB 1GQEA 2UUBI 3ZTOA 3NGDA 4DV5E 1IKVB 1QUVA 2JX2A 2C39A 5JUMA 1FERA 2HQIA 3AA8A 1OY9A 4AIDA 4UOHA 2NXNA 2FC9A 3HHLB 2G2ZA 2J9DE 1T8EA 1PYTA 3HSDA 4FWDA 3G6VA 4P6QA 3QIPA 4P52A 2UXDJ 1U1MA 2IOQA 1DTQA 3W62A 2QMXA 3CO9A 2W2PP 1EA6A 2HVEA 3MCMA 4UQTA 3OTOI 4FKXA 3BGUA 4U6PA 4DR6I 1A9NB 4J9OA 1MU5A 4OZNA 4I56A 1HR0E 3M4XA 3F73A 1RT2A 2G4BA 2L9DA 1KHVA 5D4NA 4IH5A 2CNLB 4ZIWA 4B9MA 1X9MA 4DV7F 2XS7A 4ELUA 1UEVA 3AD8C 4UZCA 3I56S 3PW0A 1U7LA 1TZ0A 2YKMA 4PYDA 2B9WA 1R6YA 2EG2A 2NCKL 4RW8A 5D6GA 2NN6F 2GZOA 3QWUA 2XULA 1OYRA 2HHUA 4L75A 2HHHJ 1N5TA 2QYCA 2VFSA 1QZRA 1RYSA 3SBMA 3NNAA 2M3DA 2XY7A 3IR5B 3NS5A 3GR1A 1U25A 1H7XA 1XN9A 1CS4B 1GMWD 4BCAA 3BSNA 2DR7A 1AW0A 3LP0A 2FHJD 4NL5A 4IQXA 1CJTB 1NCLA 3H20A 3SMZA 4IFDB 2MY7A 1N36F 4P72A 1JLAA 3GYNA 1VK8A 1LWCA 1X0FA 3RAQA 2V94A 4FXDA 2W25A 3HD1A 4RNMA 2ZZMA 2M8HA 3DN9A 5H9FK 1LWFB 2WAQD 1S48A 2OFHX 1LQ9A 1M5PC 4DR6E 1FKOA 2YKQA 1KHWA 2ASYA 4F7VA 3M7ND 5IWAF 3DGPA 2E29A 3T5HA 2ZNYA 2G13A 5I42B 1SH2A 1N33J 2BX6A 2ZITA 1N32F 1GMWA 3HXMA 1MWQA 3BBFA 4RW9A 2FHJA 1MROA 1UVNA 5DQIA 2RU9A 1RTHA 3C16A 4LF9J 2IJRA 4DF4A 4KGKA 1KLMB 4EBDA 4MT1A 4MU0A 3D4JA 2VG7B 4MIWA 3DRRA 3Q0AA 3CJQA 1NH8A 4GKJJ 3POTA 2ZJQQ 2NN6B 2BQUA 5L38A 3UPFA 4ZVEA 1Z1ZA 4FNHA 2P6SA 2P9EA 4PWUA 2YX7A 3MCSA 4EUVA 4LFCI 2YWHA 7FDRA 4AL7A 1NKBA 3BBBA 1TQLA 5DQHA 3RU0A 3MUMP 1GEHA 2KU7A 2DGTA 2DR6A 3BR9A 2XLKA 2NYIA 4OZ3A 3I55S 1FFSB 3KK3A 1PC4A 3V6DA 1W2BR 2Q79A 3AT1B 4R0EA 3C46A 2JC0A 3NL0A 4RUBA 2V63A 4FN5A 2HG4A 1RKIA 2OEJA 3TO8A 3U1LA 1TKTA 3CDWA 3A3NB 4LF8F 3IFEA 2ZH7A 1FVSA 3N0VA 4OX9F 1XXEA 5BR8F 5IT9Q 1EHWA 2KJVA 1N5YB 2K3IA 3MMJA 1RABB 2D9PA 3JTPA 5C25A 4C8OA 2C3MA 1B64A 3GP9A 4PZVA 3UCGA 3H25A 4ZVUB 3DXBA 1SV5A 2P8IA 2MKKA 4CTAB 2XZWA 4DV0F 2ZM6J 4AXJA 1R8HA 2LQ5A 2MKJA 3GJQB 1H38A 2A0FB 1FXRA 3I31A 4B9SA 4IS9A 4PUOA 3HDSA 3A8IA 1SKRA 3NZKA 4ECRA 3OL6A 3GYGA 2GX8A 2AU0A 3IS9A 3BEGB 3BH7B 5DO2A 1FTCA 1PIEA 2CNKB 5D77A 3T1HF 3BYPA 4USVA 1K44A 4K0KI 4J7CA 3CT9A 4XDCA 3G6YA 5C0XD 3MZIA 4ANEA 4YUDA 2VV5A 1T11A 2O1TA 3G71S 1KP6A 5L46A 2IMOA 3W8GA 2IM3A 2DCLA 1OYPA 1YVFA 4ZVQB 4DUZF 4RUAA 4AD6A 3SQGA 3NNHA 1KBRA 3HJCA 5M2RA 1Q4RA 2ACMA 3Q8PB 2CPEA 2UV8G 4B3MF 5EX0A 3M8YA 4JI2I 3CO0P 5DRPA 4PRVA 5KT3A 3FKBA 1H2VZ 4R5PB 2CQ3A 3CCJS 2WNRA 1S9GA 3PR4A 4UOCA 4URQU 2C2MB 4W92B 2ILYA 4I6WA 4ZA1A 3VF0B 5C0XA 1I5OB 2LDYA 3N79A 1VQ4S 3MDFA 4J3DA 4LF2A 2MZJA 2VC1A 3U1NA 5DDRC 2AQ4A 2V4JB 1VC5A 2IIHA 4IOCQ 2HFVA 2FDNA 3MMCB 5THWA 1XMBA 2AYGA 2UUWA 5F8LA 3VCDA 4M5HA 1XTZA 5LSRA 4ZVOB 3MM8B 3UD4P 1T9WA 3KG1A 3MI7X 1QD1A 3KJVB 2XO6A 2PO2B 3MEEB 1MMNA 2J6UA 4ES2A 1FHTA 1FT8A 3CEDA 4RL1A 2ROGA 4WZMA 2PO1A 1EKSA 5FLXU 2DO0A 4JI2E 5GAGU 2QO3A 1GXTA 2MEWA 2R7XA 4DR1F 2QL5B 2W7AA 2CQGA 2VQFJ 3KG0A 3J7ZT 4YHHE 3DM2B 4QWCA 1PGZA 4IH7A 2LXFA 1Z0BA 2GJ2A 3OVSA 1VHIA 3SCIE 2IM0A 2D41A 5IM0A 3LAKA 1TVRA 2XMKA 4O4GA 4FYVB 1A6LA 2DNPA 5A6PA 3UN2A 1UVIA 1HBNA 2Y1RI 4B9NA 3RR7A 2B6AB 5JXSA 1JB0C 1RT3B 4WYLA 1U1LA 1X4EA 2J5AA 1P9QC 1T9XA 1HNZJ 3WU3A 4YS2A 1R7IA 3QZ8A 4RBTA 3KLFB 2X36A 1NB7A 2Y1JA 1VIOA 1RCXB 2FC8A 4NLUA 4X4RA 4WWSA 1VCTA 1OYSA 4LR9A 1FVQA 2E5LE 3MEGA 1WKKA 3VGSA 1N6QB 5CHCB 3OBIA 4DU8A 3ZC4A 5HK4A 1Y10A 4AXIA 2M88A 2EBEA 2W7OA 4P2SA 1MWZA 1ZPVA 4X66F 3A8KA 1ZBTA 4N77A 3CNQP 2C3OA 2RS2A 1OQ6A 3N9UC 2Z5BB 2AEFA 4OFZA 4KV8B 2BANA 5B0FA 4TU8A 2UUCJ 3U1MA 2ALYB 4UF4A 3SZ2A 1VIXA 2DY9A 5H9FJ 3JSRA 4M5MA 3BGRB 4DV1F 3CVKA 4RNHA 2ZH1A 1SCJB 4Y28C 4C4WA 3CCZA 4C98A 4DQPA 1WJ9A 4X62F 1V3RA 2XMVA 1GFWB 1U1QA 4ZJQA 4C97A 3TAMB 2ZUAA 3ET6B 3PV8A 1RP5A 4QOTA 4DV7E 1PKPA 3EXCX 5IT9Y 3C15A 2JEGA 4X2BA 1IQTA 1UDQA 2R3VA 1NHVA 2NN6E 2JWNA 1RWPB 3CDAA 4X65F 1B62A 4F4KA 2Q2EB 3PG9A 1AFJA 2OPSA 3PIOQ 1Q79A 3PEHA 3QZ7A 2QZ8A 3PTWA 4DR5J 2EFNA 4DL7A 2JH3A 4TY8B 1NHKL 2HIYA 5A2QQ 3GYXB 3KLIB 3W5YA 1SI9A 2VU5A 3CE8A 2BOAA 2RUGA 5KG1A 3B4TA 4CT8A 4LIWA 3LGHA 5DG9A 1UVJA 3H0PA 2DNNA 3SFGA 3ZKBA 5IZHA 1XNQF 3V81A 3DYAB 3RBXA 4N76A 2BE2A 2COLA 1WC5A 4MU3A 1X7VA 4IYQA 3J7A1 1J5OA 4OYBA 1U1RA 3CMQA 5LXYA 2OTJS 4K4WA 1F5AA 2FHKA 1D9AA 1J5EF 1RT7B 4IDKB 1RTZA 2J0WA 4P75A 1U02A 3GFZA 2UXDF 3I6PA 4LF4F 4IQMA 2E1AA 4B3TJ 4Q43A 5HI7A 4LFAI 5IWAE 2RT3A 3D0HE 4E98A 2JSXA 2DXDA 1N32E 3FFIB 3GMEA 2K1RA 4AQYJ 1VC0A 2KM8B 1S59A 4YB7A 3T3FA 3KNAA 4FBUA 4JYAI 4P10A 3G8QA 1F0XA 3MPYA 1NSKL 1RISA 2MB0B 4ILMA 2GGPA 3JSMB 1BQMA 1H74A 4NXNI 2WOMB 3M1VA 1URRA 4QW8A 4K4ZA 4NI2B 4F4ZA 4KHPJ 2GIQA 5I3QA 4RUCA 3D6FB 3IR6B 4JI7I 5AXNA 2VPXB 3GCXP 2E5HA 1EP4A 4F4XA 3W9IA 3OL7A 2VG5A 1SQFA 3IM8A 1UPMB 3D5MA 4FYDA 2YNHA 1HD1A 2OEKA 4CLYA 1RAFB 4QCLA 1CQMA 2WHOA 4DV4J 3TUPA 1SL2A 1BD6A 5HVGA 4FW6A 1UVKA 3QYYA 4PG4A 1SJ4P 4OYPA 4YR2A 5I3PA 1C4CA 4R1FA 5JEAF 3CSKA 4IRCA 5SZTA 3BGLA 2K2PA 5B0CA 2F4VJ 3NMAA 2IYIA 3J81Q 1VOMA 3LGNA 3Q8RB 2XCAA 1FRMA 4LF8E 2ZJRQ 1BY9A 4OX9E 5BR8E 4Z2XA 7FD1A 2CJKA 4LF7J 3K1JA 3CDJA 2OUGA 4LOMA 5LJ5Y 2CPIA 1FD8A 4DV0E 4DV2F 2CPDA 2CQHA 4KGZB 1X5PA 2W9CB 5CCMA 1IR1A 1YRXA 1S1VB 3LPYA 2DHAA 4JI6F 2C2RA 3CGIA 2BKOA 1RAHB 3BDEA 2XY5A 1UL3A 5B7WA 4DFKA 2QMUB 5F9LA 5J2QB 1YG0A 4X4VA 5KFXA 3NBPB 4JI7E 3OSPA 3K58A 2QGFB 2ROEA 1IBKJ 2QLJB 3KXDA 2CPJA 1YZ7A 4A8MP 4IG3A 4ED2A 3WIVA 4Z37A 3CD5A 4OYMA 2DNYA 5KG5A 2C2EA 4DUZE 1JXEA 3MCOA 3ILIA 5EKWA 1RU1A 1IJFB 2XMJA 4HACA 2FUG9 3I9ZA 3DRSA 1Z5CA 1USVA 1MWYA 2MKCA 4CO1A 4A8YA 3LTOA 3K17A 3SSQA 2E44A 1YDLA 2LMIA 4B3ME 2R7UA 3BH6B 2ZE2B 5LMNJ 2E1PA 3H4DA 5KFUA 4DR1I 4MYTA 3M8PB 4I2PA 5KFSA 2CPYA 1IJEB 3MAHA 5KFZA 5FDLB 4RWXA 5JEAB 1WEXA 2HBZB 2X3DA 2BJ3A 1HWUA 1UJ6A 1T05B 2HVDA 3H2VE 4MK9A 4YY3F 3FK4A 3D7SB 2XMTA 5MLCV 5GADU 2RKIA 1YJTA 5F3ZA 4ZPWR 3WQPA 3DI6A 3MEDB 1U2RA 3LNUA 1HBMB 1UMJA 3GWCA 1HYSB 3QRQA 3GFXA 4JI0F 2RUSA 3F44A 3HT3A 2ALZA 1NO8A 4YB1P 2AX0A 5IT9U 5EWEA 1TV6A 3H4BA 4EBEA 3E51A 2AGOA 2UXCF 2P6TA 2IRYA 1RREA 1P42A 1Z0TA 3LPSA 1P6TA 2QLWA 2CJBA 2O1VA 2PMWA 4I4BA 4X4SA 4QR2A 2Q43A 4IZJD 4ECWA 4EO6A 3HHDA 3NXZA 1RTDB 2X7IA 3DLLQ 4DR2I 2CIMA 2Z30B 4UTGA 3I0SA 2PO0A 4WFAQ 5AXKA 1Q0NA 1EARA 5A2QY 2MQNA 1AT1B 4JI4I 1RT6A 4DR1E 2RSQA 1HFEL 4IG0B 2ATCB 4NXMF 2E66A 4PQAA 1YJ9S 1GMVA 4NCGA 1NNDA 4C2MA 3NGRA 4UQGA 3DOKA 3UR0A 5KT4A 1TFWA 3O1LA 3I82A 2E9ZA 4DV3I 3DRPA 2RQKA 1RR9A 3HO1A 1R8AA 2UU9F 4JI1I 4JV5J 3OW2R 2B7BB 3DXSX 1NHJA 5A8WB 1DTQB 1SQEA 4BWJA 1YH8A 4P71A 4IZJA 1X5OA 4BDPA 2R2TA 4MMOA 4IFVA 3E2EA 4JI3F 1X4CA 5L1IA 5LXRA 4DHVA 3T1YF 1T3NA 5E3AA 2CNOB 3BSCA 1F9HA 3O8WA 4ECTA 4K4UA 4DR3I 3ICLA 3M9OB 2XWXA 2DVIA 2BDPA 2MQMA 3ENWA 1RT2B 3HFVA 4Y0FA 1T02A 4OZEA 3PO5A 3IC1A 2OPPA 3M30A 1SIWB 3M85G 4AIMA 4OO1C 2R8HA 1ITPA 4HL9A 3MPUB 1VRTA 3D0GE 3THTA 4FWHA 1EIYB 2YPYA 4CT9A 4ZKAA 2X3GA 4BHQA 1C0TA 1Y5NB 3H5UA 1MN9A 2LFVA 4HHUA 4NYOA 4N7TA 3KHHA 2ZBCA 1HARA 1NSPA 1JJHA 4NRUA 3JAMQ 4WIQA 1NH7A 1Y3JA 5HQ8A 4B9UA 1C4AA 3R5JB 1TUVA 1WKJA 5DNLA 3THVA 2CPZA 3SDEA 2HZVA 4ZCLA 1TK5A 4PPDA 1XQIA 2VQEJ 3J7AN 4LF5J 4Q2LA 4L6V3 2NUUG 4MU1A 4DV1E 1EAYC 3B8HA 2V50A 4ZCMA 1NEEA 4JI1E 4KO0A 4CIOA 1JLAB 4ZHRA 5JVHQ 3UD5A 5EWGA 3M2UA 2UVRA 4K2JA 4X62E 1LWCB 4KYZA 2DIVA 3PW5A 1DHMA 3OR1A 4X64F 3NCPA 4OJ3A 4NLVA 4JI8F 4DV5J 4USTA 3M6VA 5HO4A 2MZSA 4GVBB 1KFDA 4B3SF 2K3KA 3KHGA 2ZD1A 3EDRB 2XGPA 4AT1B 2GHPA 2XC9A 2W8KA 4WU3A 1HBOA 3A8EA 3OJSA 4X65E 1SC4B 3CCUS 1WI8A 4I2QA 4DV6I 4RW7A 1CJVA 1MROB 2J7UA 2V8VA 4BA1B 3OL8A 2Z58B 4NLQA 2BM1A 3OFHA 2NN6C 1HR0J 3PRVA 3FCHA 3HD2A 2BR2B 1XC9A 2C37A 2EW9A 3J80Q 1WWHA 1XNQE 2JE6B 1SC3B 1TL1A 3T41A 3AY0A 1S76D 4DR4F 3R5CA 4NEYA 3PHEA 2W9AA 1N0UA 1W2IA 2C2ZB 2DNOA 3HVTA 2RRBA 5IS2A 3O5TB 2EI5A 1X9WA 1ZM3A 1Q78A 2G2YA 3MUTP 3GJTB 4F3QA 4CLSA 4O0NA 4RLEA 3ENAA 4OI1A 3TQ1A 1TU0B 4CYUB 3V6DB 2HZAA 2PDAA 2WBRA 2YTCA 4MFBB 4CZCA 3JXOA 2HRUA 3TJ8A 4KKOA 2IVFB 4ZVFA 4ICLB 1VQNS 3PS2A 2VA2A 4KR0B 1S16A 1S1XA 1UW4A 1VJWA 1NJYA 4LCHA 4DV2I 3CCWA 2QT7A 5C25B 1SL0A 4QNKA 3G4SS 1K9MT 4QYZJ 4FZVA 3R7BB 2KJWA 2DH8A 4OX7A 4L3KA 1U09A 3G6XA 1JLEB 3FCVA 4K4TA 1G1XA 1JKHA 2YNFB 4F4WA 1DAXA 2HHSA 4HKQA 1KR4A 5DS7A 1IKYB 2HIQA 5L8RC 3OR2B 5E33A 1ZA2B 2H65B 2BKPA 3P3DA 1U47A 3L7ZA 2CDQA 1C1BB 3SSSA 5GAHU 3MMAA 3W65A 4DCOB 2Q66A 1FWKA 3TUJC 3P4UB 4ECXA 3M8QA 1ACMB 3DLHA 3CC7S 1XMOF 5JEAE 3DLKA 2UV8A 4UY8T 1WI6A 4A4JA 2GQCA 1OO0B 2LU2A 1RHKB 3E3XA 2BKNA 3SQGB 4O0IA 3DLGB 2R2SA 2CUYA 3MAQA 3GFHA 2D1CA 1JXVA 3TX0A 1NJZA 2R8JA 4OJGA 3KLGB 1EX8A 2Y9HA 3JTNA 3Q24A 2DGWA 4DV2E 3IWLA 1MN7A 2VZ9A 1HBUA 1TKXB 3ITHB 4JI6E 1RZMA 2EKYA 5CYQB 1PBUA 4PXBA 3W64A 3SV3A 3LAMA 4GVLA 2P5VA 1UA0A 5ETNA 4NX9A 4JI0I 4DSIA 2LQJA 2XS2A 2OHDA 3D9BA 3CCQS 3QGHA 5D78A 2DHXA 1WF0A 3AD9C 4LCGA 1QY7A 5B0AA 3R3TA 1Y7PA 5LOQA 2MKIA 4LRBA 4K4SA 4B3OA 2VFVA 1ZZNA 4LSNB 2JLGA 2WW8A 2CNNB 5GMDA 3FQLA 1HNVB 3CD0A 1X4DA 2NS1B 4WP3A 3IP0A 4DFJA 2KFNA 3CWVA 2V5HG 1R31A 1NK7A 4WFNQ 1K73T 3M6AA 1F3FA 5DGBA 2MPUA 1IXKA 2C2DA 1RQ0A 4LF6I 2RAQA 2Z2YB 3CCSS 5DDQC 3UN5A 4ZMMA 3JAMY 5CYJA 4NBQA 3MM9B 1SC6A 1R89A 2R7VA 2GO3A 4YY3E 1S1UB 2XNRA 4PU9A 3DU5A 3PM9A 4KBIA 3CMES 2C1EB 4I68A 2Z2ZA 3ZFVA 2GIFA 5ETVA 4LFBI 5CXTA 3J81U 3C6UB 1JXLA 4JI0E 1XNRF 3G8TA 1RT1A 3WC0A 2ZUGA 2W2OP 4ECSA 4EK2A 2UXBF 1RHUB 1VBZA 1NHUA 3FSIA 5B0BA 1REGX 2ZOGA 2HWHA 2AYMA 4JI5I 1X4BA 3J7AM 2UXCE 1ZZFA 3IM9A 1TL4A 1U8SA 3O6QA 2J65A 2W9BA 3BO2A 1NZ8A 1Q8IA 2CZ4A 3R27A 1OY8A 3G87A 3Q2TC 2CQCA 1VQOS 4GRSA 1M5OC 1TL5A 1RAAB 3VZHA 2D3UA 1MMLA 3QGPA 2FGOA 2KB2A 1FK9B 4F25A 1QM9A 5C24B 3R2DJ 1RT4A 3NCQA 1BQNB 5CD4A 3A8JA 4DG1B 4FNIA 2WONB 1ZM4A 2N7YA 2YWFA 1FTRA 1SKSA 2E5GA 4NXME 1NKEA 3PX0A 4KRWA 5IV4A 5DM6Q 4CLPA 3GTYX 1YRUA 2DNRA 3RB0A 4F36A 1FJGF 1L5UA 4CLFA 2VA3A 4RW6B 2QJ3A 1IBMF 2UU9E 4OYZA 1G4CA 3AOBA 1WTBA 4Q45A 3KWMA 4NRTA 2ATLA 5LMUF 5DETA 4J90A 4JI3E 1SXLA 2CJ9A 3GJRB 4QIEA 3T1YE 2XG8A 4I64A 1HNXI 4OX6A 4URSA 4Q5VA 4ZVRB 1BLUA 2O1PA 2OMOA 3GCWP 1TL7A 3LO3A 1B7FA 3A3OB 3NGSA 5CH7B 4YHHJ 4RX6A 1FFWB 4GO7X 2CQDA 3K85A 5A8KA 3IMQJ 3DCAA 3JSYA 3RB6A 1X8DA 3BPDA 2B4UA 3L95X 1D9DA 1JIHA 1XMQI 3DLEB 3UDVA 5T14A 1Y4SA 1T03B 3IGNA 5KT6A 1YIJS 2MLXA 2I6WA 3EGNA 4KY3A 3KK2A 3HSJA 1RAIB 1D09B 5KOWA 2HRTA 1TUWA 2YVSA 2YX4A 3NCRA 4CO5A 2W2NP 1RA7A 3WX4A 3LUYA 1CLFA 1TKZA 1SBRA 1YJVA 2E5LJ 2J8SA 2DNGA 4QQBA 4MK8A 3D28A 1S12A 3CB4A 5HP1A 1X5TA 5D3GB 1UEUA 2HMIA 1USUA 4AL5A 3WU6A 2J76E 3ZNUA 1O5JA 4X64E 3T1AA 4DR7F 3Q8QB 2JEAA 4OYOA 1P1LA 4EI2A 2YX1A 4JI8E 1Y11A 1B63A 4B3SE 3DOLB 1U1OA 4KE5A 2KM8C 3BS9A 1S97A 5EL9A 4ZDNA 3AQOA 2QSWA 5E3PA 2CG4A 4BC9A 2ZH9A 1D0EA 1LK5A 3H1CA 4CLZA 3ENVA 4DOZA 4AFFA 3MXHP 5T41A 1XMQE 2B3TB 3MCNA 5E0OA 2HFNA 3AJ1A 5KFIA 3JQMA 3T6JA 1R3NA 3UDLA 2WB1D 1RTJB 4DV7J 3UHMA 4WPAA 2WSCC 3ILJA 3UR3C 3PYFA 1JK9B 4B3RF 4DR4E 5JJBA 1HL6A 5KG3A 2YKNA 5J1NA 1HPZB 5DJBA 1Q5VA 2DH7A 4ZOSA 3TUZC 3ZZYA 1M1HA 3GU0A 3CF5Q 2CADA 3CC2S 2D69A 4W90B 1T7PA 2HNZA 4DUYF 3S6EA 1U6BA 1N34I 2JEBA 3VAKA 2MTLA 5J1EA 1E6VA 2XNQA 4CRJA 1N36J 5C0XE 2QA4G 4ZK7M 1VQ5S 1HW8A 2BUNA 4O44A 4EZ9A 3OJUA 4DI6A 3MTJA 1R8PA 2UUAI 1I94F 1UKUA 4KGXB 2H9ZA 1GXLA 3E8OA 1EETB 1D8ZA 1QJHA 4ZLLA 1Y0HA 1U6ZA 1KOOA 1RTIA 3M05A 5KTQA 3LW5C 3ZZTA 2PGCA 5IWAJ 2D7SA 1ULRA 5HAOA 1N32J 4ZLPA 4LBIA 4OI2A 4O3OA 4A48A 3OUYB 1FEHA 4URGA 2WBMA 1TMJA 1UJ5A 5E7OB 1JLCB 2NSCA 2A3JA 3NRBA 1CULB 3JYTB 1LV5A 1E3PA 2J9DA 2DJWA 3R5AA 1XMOE 2DO4A 3UO0A 1S9EA 3Q8UA 4USJC 5I3UA 3PACA 3ZZZA 1UWBB 3J80U 3DMJB 3G82B 4DSEA 1FD2A 2F65A 1WHYA 1LWEB 5ELWA 1WHXA 3ZTQA 5JEAC 2F3JA 2BE9B 4X4TA 1HQEA 1N52B 1YGYA 2JHEA 3CCTA 1FEEA 4CDIA 3PCOB 2UUBF 1YITS 1KSPA 3Q89A 1A6FA 2BJ1A 4DQIA 1S6QA 1WSRA 2DR5A 4WKRA 2CDRB 1N54B 4UUXA 2XSJB 2N7CA 4EZ6A 4LF8J 2RJZA 5CAAA 4OX9J 5BR8J 2VKRA 1BMQB 1GT8A 4IO1A 5LSOA 2HVZA 3IRWP 1H3DA 3D6TB 4ZVSB 3OTOF 2UP1A 4NPOA 5D0EA 4ANCA 4LUBA 3R2CJ 4DR6F 2BACA 4QZVB 4DV0J 4OQJA 3OTBA 3C66A 3WC2A 1IBLI 4ENOA 1ZA1B 4DPTA 2BJEA 3RBEA 2KVIA 4J9UE 2YH0A 4QBUA 1U26A 3GSIA 4HVZA 4B02A 2C28A 1JLFA 2Z5EA 2XCPA 4FS1A 4WYWA 2KT3A 1R27B 3KOAA 2AGPA 2B9XA 3T1HJ 2XMAA 3M85D 2VKZG 3TI0A 2W1BA 3I0SB 1Y5IB 1U45A 3PW7A 5I4MA 1XBWA 4OYAA 1UW9A 1FE4A 4EYIB 1KQFB 2DGQA 4DUZJ 2QE5A 5F8GA 5A8RB 4MK7A 2CQ2A 4NCGB 3DOKB 1LFPA 1XNRE 2VB6A 1LWXA 4PG7A 2VONA 3EMTA 4OHWA 3RTVA 4B3MJ 1S1WA 3CD7A 2UXBE 2RDIA 4LBHA 2WP8B 3UD3P 4DBQA 3CIMA 1YJRA 3UW1A 4ELVA 4J9LA 1HW9A 2VF3A 1RWUA 2GQ0A 3BN7A 1HNWI 1YWXA 4IFVB 1NDPA 4ID5A 2A6OA 2C42A 3W9JA 3C3LA 2V0NA 3NKYA 3BSOA 2LU1A 3NAIA 1D3WA 2C3PA 1S99A 1PCAA 1Q53A 3CDIA 4W4MA 2ZH4A 3KRNA 2XLIA 3NGUA 2VD3A 3DOMB 3J7YI 1E3HA 5D0HA 3JTOA 3PS1A 2OJ3A 3UCZP 1VQ7S 3RZAA 4OHYA 4MYUA 4CP5A 4IKAA 5K20B 3HSGA 4EWTA 4C8YA 2JEIA 1NB2A 5CZVA 5KT2A 3KUGA 3W8PA 5ADZA 1CSJA 3IG1B 4OLPA 2CG8A 2GS8A 2C38A 5K9FA 4UOGA 1U49A 1JLBA 3DHXA 1FJGE 2IM2A 2MMYA 2LEPA 2XYGB 3Q8VA 1Q8LA 2GJFA 4OZ2A 1ROFA 1IBME 4LFCF 2VUGA 4C0HA 3KHRA 2BRKA 2HHHI 2GAHC 3R5DA 3FMWA 2EKNA 2FVQA 2EC2A 1EJ7L 2CQ4A 5E3RA 1HHQA 1Z0CA 3T19A 2G1DA 3HF5A 1SIZA 5LMUE 4NWBA 2ZKTA 2K7JA 1XHKA 2AIRB 4XO0A 4ZJLA 2GHWA 4KO0B 4PKDB 1C1CA 3EZOA 4ZHRB 1AYEA 2XB2D 4DR1J 4J9NA 1HNWE 3QQCD 5LJ3Y 1HNIA 4KH0B 2DNHA 1HHTP 5GAEI 1YSJA 1LW0A 4NASA 1FA0A 3MFHA 5DM7Q 1OSCA 3UVJB 5B0EA 4G1QB 4N8NA 2DNQA 7AT1B 2KKHA 2W01A 1TUGB 4NZ0A 1Z0GA 4KSEB 2R7OA 5K8NA 2MQ8A 3KUEA 3RBDA 4KQZA 4IZKA 1SC1B 2J0SD 2DBBA 3Q86A 1IBCB 3P6YC 3QLHA 2CG9A 3MPVA 1S6OA 1DTTA 5HATA 3M32A 1F3VA 3MM7B 2X1GA 4ED4A 2Q3PA 3TZYA 1VQ6S 2OGUA 1N33I 4EO8A 4ZVGA 4P7VA 1YK9A 3DLJA 1REVB 2YXLA 2C37B 1OQ3A 2A2CA 3GFYA 2HK2A 5J2MB 2WVCA 1M1KT 3TR5A 4LF9I 2HHHE 1U1KA 4K0KF 3V4IA 4CNZA 3LWLA 2XS5A 5EX3A 3ZXWA 2VDIA 4K8RA 4DR7E 3HHLD 4X66J 5KFTA 3S01A 1YHCA 3WHIA 4GKJI 2HWTA 5E41A 1FWLA 3OT9A 4CWBA 2NSBA 4CLWA 3TNVA 3NOCA 2AJQA 2KN4A 3M2RA 4QW9A 2E1RA 3ETMA 4R8UA 3BKFA 2MZTA 2KT2A 3IRXB 4DV1J 2QX0A 4B08A 4FXWA 4JI2F 5ITHA 1S1XB 4MJKA 1VQPS 4F0HA 2OPRA 1NK8A 2EFOA 3SQOP 2ZBQA 2MGZA 4X62J 4F50A 3N4WA 4V1Ak 4MH8A 1YRTA 1IKVA 3M8RA 2NXEA 4DX6A 5L1KA 4Q44A 2PO4A 3HHLA 1FKPB 2XI2A 4MAKA 1X4HA 1FX4A 3SCLE 3BYRA 1W7WA 2V2ZA 4M94A 4P2MA 3EZUA 3J7Z5 4OIXA 3CJRA 4X65J 1JMTA 3WU4A 4PXCA 3FZBA 2CWXA 4OO1F 4CO2A 8ATCB 3NP5A 1FESA 2ZM6I 1EB0A 1BWEA 1PKUA 4LVOP 3HT0A 5KAKA 4QR1A 2MQLA 1AZSB 2QMWA 3AHPA 1IVZA 3GIMA 4NYZA 3MR3A 3DHWC 9RUBA 2F40A 3KHLA 4DUYE 4IFDD 4ZN1A 3M8QB 3W2VB 3W61A 4ECQA 4JUZA 2QLBB 1NSAA 4J91A 2CWKA 2NYHA 4P73A 3FC9A 1XNQJ 4GKKF 1L3VA 5DDPC 2I8EA 2MQQA 4U8YA 4GMKA 2JFDA 3E01B 3ISND 2IJFA 4M5DB 1I94E 3FEZA 4EEYA 2RS8A 5CZXA 1G6BA 2DHGA 2KG1A 2V4QA 1J5EJ 5EDWA 2LQ8A 1TKDA 5F8MA 1UAWA 4L3NA 5C0XC 1CS4A 3EJMA 5KFGA 5B0DA 4LF4J 3IBCB 4LQ3A 2MKSA 2E9TA 4LPFA 1CJTA 2V2VA 1RT5B 4IFDA 2BR0A 3PZPA 3TYTA 2C22A 4Z7YA 2W4CA 4HT7A 1V5VA 1Y4UA 1GX5A 3QJLA 2YNGB 3V4MA 2HQCA 4ZPAA 2BABA 2NN6D 2AW0A 2DITA 1UDOA 1HMVA 1LWFA 1U1NA 4O3NA 3RW6A 3FBCA 3D1QA 3N28A 2VFRA 1S4EA 1QVGR 9ATCB 1X0PA 1KEKA 2B8PA 3AFGA 5CD4H 5I42A 1Z5BA 2H48B 3MEKA 2R2RA 2ASLA 1JNRB 1HWIA 3BREA 2LEBA 4OO1B 5HBMB 3MURP 2JT2A 2HAFA 3VAHA 4LJMA 1FCAA 3LOUA 2DGOA 4WK1A 2V4RA 1IKWB 3VVTA 3CJTA 1Q5YA 2UUBE 4YDXA 3CDBA 2ZBIA 4LRCA 1RHJB 4WE1B 5KFOA 1SKWA 5IXUA 2AP6A 4CLUA 1H7WA 5FLXY 3PNIA 4CLLA 2VJVA 1RWXB 2YY3A 2NN6A 1S72S 3EPGA 3QSIA 1MU2B 3CJ8A 1NHIA 4ZVIA 2LA4A 3KLHA 2HGLA 5KG7A 1NZAA 4WIIA 1OIAA 5G0RB 3CWJA 3MAAA 3OTOE 1XJWB 4ES3A 2QLFB 2X1BA 4OLOA 4ED1A 1S9FA 4F2RA 2KZZA 4DV2J 2BQRA 2VQFI 2CPFA 3VQTA 1H72C 4JI6J 1S0MA 3PS3A 3OFFA 3A4TA 2NXUA 3MM5B 1FNXH 4KFBB 2GJIA 2IDEA 1S6UA 3TUIC 1V9OA 2M8DB 4YR3A 1QTNB 5HROB 3OQ2A 1N5YA 3PX4A 2Z2LA 5F41A 4ED8A 4NLSA 2KO1A 1YJUA 2EG1A 2CGEA 1RBLA 4C11A 4CTAA 2V69A 1V6HA 4NMLA 1RAGB 5DG7A 3US5A 2BA9A 1HNZI 4DPWA 4TLQA 5KFDA 2VJUA 2JRSA 4OZJA 4PQUB 3HX9A 2RIJA 3P5TL 1BWVA 1FI4A 2XZDB 4L73A 1Z0WA 4FDFA 2ZH2A 2RU3A 1TAQA 2WVBA 3BKUA 3OL9A 3ZTPA 1PG5B 3CJ4A 4E0DA 1I51B 1IKXB 3KK1B 1K8AT 4M8LA 3K5PA 1S7IA 4U8VA 2MQOA 2V8PA 2N3OA 1ZXNA 3PY8A 4C8KA 4D3HA 3X3UA 1RA6A 4USHA 2VBWA 2ADBA 3GSDA 4UZBA 4YY3J 1FKAF 4WFBQ 2V68A 2UUCI 4IH6A 3BSAA 2VQFE 2OPQA 2IERA 4LFAF 3H7HB 3BQ1A 2GIRA 5T7LB 4K7QA 2B4PA 2HLUA 3IXQA 4WZQA 4JI0J 3BR8A 4UUWA 2BW7A 4JYAF 2HFZA 1RWKB 2AJ0A 2IFXA 5HSPA 4HEA9 2F5GA 1TTHB 4R5PA 2H5EA 2N82B 2A2DA 4DDFA 3HFKA 2V6AA 4NXNF 2XWYA 1EZZB 2YQ0A 3GCMA 1JJ2R 3Q6MA 2Z5CB 1Y3KA 5K36F 2KTQA 2UXCJ 2Z57B 2BXJA 4JI7F 1HNZE 1VK3A 2IA6A 1CJKB 2RB7A 2CVIA 1ZM2A 1JLQB 3OVAA 4ER8A 3L7OA 2R8GA 2HNYB 2DPIA 4LFCE 2XBPA 2RVJA 1R8BA 4JV2A 1M5HA 3SSRA 5K14B 3MMCA 2HBYB 3P3GA 3D6MB 5HJXA 5L1LA 4X4QA 1UFLA 1R6LA 2E1CA 2RDJA 4DR5I 3PRDA 2AJFE 2BM0A 3S7RA 2E1MC 1WC4A 3MM8A 5E3QA 3CJ0A 4C9DA 4NXMJ 4K5SA 3ZZOA 3R5GA 2Q6BA 3KJVA 2PO2A 4XAKA 4X4NA 3MEEA 1YLXA 2DGUA 3CJ2A 4J9KA 3C6TA 4PXDA 1IR2A 2DGXA 2UU9J 2H3EB 4IR9A 4ALZA 3TAQA 1RACB 2P2CB 4U3BA 2AX1A 1RAJA 2GCFA 4M5JA 1L3UA 1C0UB 2YWWA 3MECA 4XPCA 2DEJA 4QWBA 3FSYA 2W7PA 4JI3J 4ZPCA 5EHHA 2OSQA 3T1YJ 3W2WA 1WACA 4QNJA 4ZPTR 3HPOA 1RDRA 2ZVIA 3DDKA 4B3TI 4HTJA 3BZQA 3W9HA 3DM2A 4DPXA 5L3JA 4OKGA 3QFHA 5IQQA 1V3SA 2M0GB 1NJIT 4F67A 4AQYI 1WC0A 2AHOB 4K4YA 3HZGA 1RB0A 3F41A 2YQ1A 2PMHA 1WF2A 2JNJA 1NU4A 1R0BG 2W24A 1TL3B 4K0KE 5L39A 5K36B 3H98A 2B6AA 4ATNA 3D68A 1TAUA 4KIAA 4TN2A 2R2UA 1JQGA 4JV0A 2Q6CA 4KHPI 1H98A 4RBVA 4DQQA 1SJ3P 3HLUA 3KLFA 5FWKA 1D6TA 3M6XA 4GKKI 4UT4A 1QVFR 1RXOB 1N6QA 2FHMA 2H1YA 4DV4I 2L9WA 1WG1A 2ZH5A 2VASA 2KFZA 4EYHB 4DF8A 3FJ2A 1U2FA 4LT6A 3I4PA 4X64J 1DQ9A 2R9LA 1XR6A 2Z5BA 4KC5A 4JI8J 2F4VI 3HKZD 1LEOA 3L3CA 1H6KX 2LQ9A 2QYGA 4B3SJ 1SJRA 5C7PA 1UJ4A 2HHPA 3N5BA 3V6JA 4LF7I 5BYQA 3BGRA 4P7AA 1S57A 1CQNA 5KFQA 1VQ8S 3PIPQ 2QV6A 4I7FA 2FJEB 4YDDB 5C42B 3VGUA 2V9KA 3KUHA 2HQFA 3HVRA 4OO1E 1S1TB 1ZAVA 2RE1A 2E5IA 4NE9C 1QSSA 5J2PB 4RUHA 2B56A 2ZZNA 4X84A 1RHQB 3GV7B 2IC3B 2QLXA 3AB4B 1RKJA 4OZ0A 3TAMA 1VLOA 1SPBP 3ET6A 4USUA 2KXHA 4ZP8A 2IYGA 1R0CB 2FVCA 3OFGA 1EQMA 3SI8A 2PT0A 4KHPE 2IHR1 4PRFA 4D3GA 2HNDB 3PFEA 4IOAQ 2XY6A 3H5XA 3GLLA 5LL6R 1LW2B 4GKKE 2HKJA 1SB6A 2JFKA 4DR2F 3TZWA 4DFPA 4DR4J 1IBKI 5DG8A 4RNNA 2EXUA 2X1FA 1VMBA 1YKWA 4DV4E 2B0GA 4JI4F 2AGQA 1HQEB 4TY8A 2GVZB 3KLIA 1KWMA 5EN1A 3GMGA 1NPKA 1VQYA 4V19J 2CJQA 2XEXA 4LREA 2HVHA 5RUBA 2V34A 4DV3F 4M5KA 2F63A 1OWXA 3MTKA 3D3CJ 1KQSR 5FD1A 3RAXA 2ZWOA 4WP9A 4JI1F 1HA1A 5LMNI 2PMZD 2GFFA 4LSLB 2DGVA 2W4DA 2Y1LB 4F4YA 5BYRA 4ERDA 5KG2A 2YKAA 1TR0A 2C2OB 3H2LA 3DNCA 4TU9A 4RO0A 1GTEA 1RT7A 5A0YA 2KFYA 3CJKB 1NJWA 4HH1A 4DR3F 2L9NA 4QR0A 3HKMA 1BC6A 4AYBD 1OYEA 3FFIA 3ISZA 1KLNA 3ZZUA 2B5JB 3LP2B 4KPYA 4CI0B 3FQKA 5AE3A 1JLGB 3EYZA 2ILZA 2YH1A 1HI8A 3DRYA 1L3TA 3H2UB 3JSMA 1FJEB 4RNFA 3MM6B 3CD6S 2R4FA 2WOMA 3HHEA 3ILOA 3KLEB 2ZH6A 4NI2A 2R8IA 3MR5A 1XMOJ 3CTRA 4ILLA 2MYFA 4WF9Q 4ZJOA 2J9EA 4UOFA 2B4OA 5EUHA 1PO6A 1WEZA 2ZC3A 5JVGQ 4JP8A 4WFXA 4N41A 2M2BA 3PRBA 2LA6A 4MIAA 4WTOB 1IM6A 2BJDA 4G3IA 4TLRA 1B7YB 4OI0A 3I87A 2OELA 4FW3A 1P27B 2IOPA 2GC8A 3QBCA 8AT1B 3HSZA 3JQKA 2EFPA 4FYYB 1L3SA 4I6AA 3FUYA 4JV5I 1NM2A 2HPUA 2XMMA 2LVWA 3KMSA 3B4DA 2VG6B 4DV6F 3NLCA 3G96A 1NKCA 4FW7A 4NA1A 5KFJA 2RRAA 2G0IA 2W9CA 4BA2B 1FFGB 1S1VA 2Z4PA 2ZBPA 4DCJB 4USIA 2HRYA 2NREA 5J2QA 2OKQA 2IDLA 5KFLA 3MR2A 3KJNB 3NBPA 4H4MB 4MU4A 3P96A 1U48A 5BXIA 2RF2B 2IESA 3H5SA 5JEAD 2D74B 1D1UA 4S0MA 4GQUA 3X1LB 1S6PB 2DIUA 1R6MA 4WCEQ 3CMAS 1KDNA 4IFYB 1O51A 3DGVA 3R1LA 3VR1A 2DR8A 2DCUB 2VBZA 1RBAA 1SQGA 4YB6A 3PW2A 4Q8FA 3P45B 4EU0A 1FKAE 1YBAA 4Q0BA 1UEKA 3ULHA 2WTFA 2DH9A 4QPXA 4Y3CA 1VS3A 2VQEI 4LFAE 2XSFA 4LF5I 2BA1G 3A13A 1WEYA 1SVDA 4N8OA 5HLFB 4RU2A 3GR0A 4HTIA 4K5RA 1WTFA 1XNRJ 3AQPA 3KMQA 4JYAE 2ZE2A 4UY85 4JV5E 2MKYA 3AXMA 5B09A 1S0OA 5J1PA 2UXBJ 3M8PA 2J6TA 3QMQA 3QT7A 3RYLA 5FDLA 2CAJA 1R43A 1M0SA 2B9YA 4HI1A 4NXNE 4TQSA 3B78A 1T05A 4DV5I 1RI7A 5HVFA 4FPRA 5K36E 3LF0A 1AUSL 3EE3A 3MEDA 2CZVC 2V9WA 5HL7Q 1LKZA 4YB5A 1HBMA 4OL8A 1DTTB 2VOOA 3A1YG 3IBFB 3UE2A 1HYSA 2F8HA 3T5KA 5C2GA 4RNOA 1P8GA 3D67A 2QL7B 4QU6A 2J0QD 2RHQB 1U0HB 3N6MA 5CYMB 4NLGA 4C8NA 1WOPA 1PYOB 4TYAA 1G2EA 2AMCB 2CJXB 2PEHA 2XLJA 3M2VB 2KI2A 4CO4A 1HR0I 1LOUA 5GAGI 3IN5A 1SUQA 2JLFA 3TA2A 1WDTA 1HQUB 3PVXA 4B9VA 3I4HX 4MTPA 2X51A 1VBXA 1KTVA 4BBYA 4Y2KA 2BMBA 1FJGJ 2XI3A 2VQEE 3M9MB 1NRKA 4LF5E 1P1TA 1IBMJ 2FHOB 1RTDA 2PE8A 5KFBA 3GIJA 3NGTA 3DFEA 2RNEA 3L4BC 1QAXA 3LP1B 2V8HA 4C0BA 5LMUJ 2HQDA 2PIIA 2Z56B 1VRUA 4OV1A 4CH7A 4WU2A 2EPIA 3I32A 2OPRB 1UA1A 2DXEA 4IG0A 2LJPA 1VR6A 3VGTA 3AOAA 1HNWJ 1FDAA 2ZKUA 3O2IA 1TK8A 1Q82T 2I5JB 5CA5A 1E6YB 3W1YC 1FO1A 1XR7A 1WC3A 5AJ3F 2HEKA 4OYWA 3B82A 4ED6A 3AOCA 3OTCA 1VQSA 3PJXA 4OYIA 5A8WA 4M5GA 2EK6A 3S1TA 4FVMA 1DBDA 4Q2MA 4E2FB 4PWDB 2PNZB 2KH9A 2YNIA 4QWDA 3R7NB 2O3ZA 1RWNB 3PKMA 4U9RA 4WUBA 5D4LA 5LL6d 4C7QA 4ZCKA 2F4FA 2ASJA 4WTYA 2CFXA 4H4OB 3PR5B 5LM7E 2GVDB 3LQVA 2O1UA 2LECA 4LF6F 5KT7A 2V2KA 2V8DA 4ANDA 2MSTA 2MHNA 2GV1A 2P9GA 5LSLA 1DQ8A 4TY9A 4FPIA 1TK0A 3JQJA 4CCHA 3S8SA 3OXGA 4DR7J 2C39B 2MJNA 1UPPA 3TA1A 2WRMA 1KVJA 1F1BB 3DRXA 4NLWA 5ETPA 2CQ1A 3ZZ0A 4G1PA 2YKPA 4LFBF 4QIVA 3QIPB 1RAOA 2DK2A 4KHRA 2AJ2A 2O01C 4FS2A 1MX0A 4USWA 3G8SA 2EK1A 4H54A 2UVWA 1LXNA 2M70A 2J6SA 1R0AA 1HK7A 2J9CA 4MDTA 4CO0A 5SUHA 2FVPA 4JI5F 2KT5A 4HDHA 4MKAA 2IVMA 2IA0A 3ADAC 2LLZA 4GVBA 4L72B 1HMVB 3Q22A 1DARA 3MUVP 3I0RA 1PC5A 1SJQA 3CJSA 3R8YA 2YKMB 2AZ3A 3CJ3A 4LQ9A 4RW8B 3P76A 4B3RJ 3IBWA 4NCBA 4DR2E 4IO9Q 1Z0EA 3MMBA 2KHDA 1JWWA 3OD2A 1V3ZA 1BXNA 3W63A 3QO9A 3HK2A 4B9LA 1Y5YA 2CQPA 4JI4E 1SH3A 1WC6A 3CCVS 4BA1A 4YMEA 1MG7A 4OV6A 2YKOA 4DFMA 2BR2A 3LP0B 2CRLA 4DUYJ 2XMWA 4DV3E 3P3CA 3QAUA 4NEZA 4DSFA 2JE6A 4A8KA 1URNA 4KGVB 4DX8H 2WSEC 1F2GA 1VJQA 3KLHB 2G0CA 1LK7A 1YBTA 1RE1B 2XQCA 3J81Y 1BE4A 3MAAB 1VQKS 1I94J 1HNXF 2AT1B 4TXSA 1F9EB 1HWJA 4CYUA 2ZOMA 1FKOB 3QGIA 4DR3E 4MFBA 2CA9A 3QGGA 1OYDA 3DGPB 4DWIA 3N01A 4ICLA 2BRLA 2BEFA 2N3LA 4DLGA 4RW9B 2DR9A 3D1HA 1WNEA 1YZ6A 2MY8A 5IOLA 3FGVA 1XMQF 4DSJA 4LF1A 1RTHB 3RG6A 3C16B 1X31C 4F26A 4U95A 3FBEA 3D2WA 3Q83A 4X4PA 3LA0A 4MKYA 1A7GE 4FWGA 1JLEA 1FJ7A 4C11B 3DRRB 3CPWR 1QDUB 4ZVPB 3K8VA 1H7UA 2YNFA 2HHQA 3POTB 4L74A 3CXCR 1HWLA 2HURA 1VRQC 4FBTA 1IKYA 2HBRB 3OR2A 2B9EA 1K1QA 3GIKA 2HQGA 3O44A 5C5JA 4OJHA 1YJWS 1C1BA 1B70B 2I1RA 3Q8SB 1XEZA 1WKLA 5D0RA 5FIIA 3H40A 1PBAA 3NS7B 4RR5A 3OTDA 1RWMB 1B4SA 2B51A 3KK3B 2VPWB 3PRYA 3JB9k 3QAEA 4DZ6A 1FRIA 2UUBJ 5KFRA 2KXFA 3BM7A 3Q1QA 2MZQA 2QIFA 4ZS6A 4J9PA 2PC6A 1JX4A 2KHCA 2CVEA 1KONA 3MR7A 4G65A 4DPYA 4BLGA 1NPPA 1TKTB 5C0XF 2OPQB 5FJ4A 4FW9A 3DLGA 3UDCA 5F0WA 1KC8T 1WELA 3TX8A 4F02A 3QRRA 3CJ5A 4DV6E 3MGJA 1H7SA 1EKRA 2FGCA 4Q7AA 3KLGA 1SV5B 3OTOJ 4URLA 2NR0A 2Q1LA 4M5LA 4DR6J 1JNZB 1TKXA 2ZDOA 3ITHA 4PRXA 5CYQA 3OVBA 3SXLA 3NWRA 4YHHI 2R8KA 1MW7A 3R5BA 3K5MA 4PUOB 1N88A 3WDOA 3W5XA 3UN3A 3C2PA 1KVKA 4PG5A 4JB8B 1BQXA 2J7WA 2M9KA 3IS9B 3RB3A 2FPHX 4EFAC 1GTHA 5D4PA 4OZLA 4DN9A 3HFZB 3DKDA 2EC0A 4LSNA 2XHCA 3IGVA 1HNVA 1KS2A 4NZ7A 5AT1B 4FYWB 4CH1A 5IT4A 3MOJB 3HJVA 4OI3A 1N34F 5GADI 2KL8A 4A8SA 3RW7A 1M1GA 2E5LI 3EVWA 4YOEA 4U7CA 3QJJA 3ZNJ1 2VIHA 4OMFG 2FY8A 4ITSA 3C6TB 2POKA 1PJ7A 2IMWP 1PAUB 2UUAF 2WNRB 3MM9A 3U1KA 1S9GB 3MECB 4CLTA 1S49A 5ETSA 2DNMA 2V2QA 1S1UA 3HM9A 5C0XB 2OH2A 4USKA 3W2WB 1UETA 5KFFA 1ZAXA 1OSDA 4KB7A 3C6UA 4V19X 2BZ2A 4AL6A 4Y2AA 1RAEB 4IOBA 1D8YA 5K36C 1B3TA 4DX5A 4P7TA 4DZDA 5F8HA 1N8RT 4XTTA 2W8LA 2HSEB 1AFIA 3P5BP 4ECYA 3HKWA 1M5SA 2GQ2A 3B4MA 4DV7I 2DRDA 2KYXA 2BYCA 2FZKB 2GQQA 3C14A 4K4XA 4HXZA 3GQCA 1VHFA 1VC6A 3A12A 4LFCJ 3VQSA 5IQ6A 3W66A 1OY6A 2WVEA 1FK9A 5F8NA 3FVYA 5HN0A 5C24A 2MXYA 3F0NA 2WVDA 2PO1B 1IN0A 1BQNA 3OLBA 4DG1A 3FRZA 2WONA 3MHYA 2X1AA 1S79A 4IFDE 4C48A 4QIFA 4HHHA 2OTLS 1CC8A 2ZEJA 3FMBA 5KOXA 4DQRA 3IWNC 3GB0A 3HZEA 4KAIA 2GNKA 4RW6A 5IM0B 1N36I 2PA8D 1TVRB 5KFKA 1CEZA 4O4GB 3SCJE 1O0PA 3T6BA 3SIPB 3GG0A 1KIJA 1HBNB 1FRXA 4ZIVA 4OHXA 1DRZA 4MIBA 4ELTA 4I7FB 3PHTA 3ELHA 5KG4A 3R97A 1NAQA 4RU9A 3UCUP 2WCXA 2ZOFA 3G6ES 4YEAA 1OMSA 2YWEA 1IBLF 2CXEA 4ZLNA 2LDIA 3CCRS 4FXVA 1BGXT 5IWAI 4DL2A 2HGNA 2LEAA 2L41A 2YBVA 4XIUA 3PX6A 1N32I 4A8WA 3MEGB 1BHNA 1VYAA 4LF6E 2ERRA 3GLJA 3BN4A 1Z5AA 3DLEA 1CC7A 2JLEA 5FLXC 2KRRA 1GXUA 1T03A 3TWZA 3R7SB 1WHVA 2RQMA 1UDSA 4K0KJ 3J80Y 3VVUA 4H4KC 2GA7A 1F6TA 2JEJA 2CYYA 2UUTA 4NLDA 2PD1A 2BANB 5H1SV 3TA0A 3NAHA 4LFBE 4I0WA 2Z2MA 2JDJA 5C2CA 3ZTSA 1PAEX 1XIQA 3ILLA 2J8AA 1D9FA 1RHRB 4NYPA 1Q7YT 1NHHA 1N36E 2GO9A 4C0OC 1BUXA 5D3GA 4F04B 4JI2J 3QWPA 1J27A 1IWGA 1FRHA 2CPXA 1VBKA 4CO3A 2JJ4D 2QRRA 2ZFHA 1NJXA 1HNWF 2AJ4A 3OHBA 3FBFA 4JI5E 4OI6A 1IQZA 1CVJA 1S77D 3R6GB 2E5JA 4C8MA 2FLLA 5A0YB 3C15B 3D1OA 2O66A 3DOLA 5E2QA 1F9FA 3EM1A 1Q1KA 2IRXA 4LF8I 2Y8YA 3FSXA 2WZ1A 2DNKA 4C8LA 3SFUA 4NA2A 4OX9I 5BR8I 5CQGA 4U7UK 2OIHA 2NLWA 1P9YA 1Y6ZA 3TZZA 1X4FA 2R42A 2OPSB 3VAJA 4A8OA 1YBUA 3VGVA 2QFJA 2RHSB 3KKFA 5KFYA 3HHNB 1MNEA 2D3OR 2BA0G 3K5LA 2FB0A 1YTYA 4DV0I 2JOQA 2OD4A 1KNZA 4I6YA 4XDDA 3UQSA 4J9SA 3RGIA 3IO1A 5DNXA 3NS6A 2I9SA 4BC7A 1RTJA 2XO7A 2QSFA 3CDEA 1SKUB 3K5NA 3V81B 5HMWA 2BE2B 2HHHF 2APOA 4GKKJ 4K50A 1CG2A 3EPIA 3T1HI 2F1DA 4ZVHA 3J81j 1J5OB 1HPZA 3SYZA 5DZ7A 4G1IA 5IC4B 1PSDA 1HNXE 3I5CA 3UNYA 5EGYA 3EVOA 3W5ZA 4F0KA 2ZC4A 1S10A 4DUZI 3ZZRA 4R25A 2OFGX 1YJ7A 1FDNA 2H51B 3NEKA 1OPZA 1YHQS 3TANA 1UZHA 2ZH3A 4TKTA 1RWOB 1NK9A 1CBKA 2K1RB 4B3MI 2Y1IA 2C3UA 5IFMA 2BA1D 2LQBA 3V6HA 2DEIA 2MKHA 1ZETA 4XPEA 4P2FA
chains in the Genus database with same CATH topology
2HK3A 4DR5I 2BM0A 2WW4A 1XMQI 4DUYE 4USKA 1Y4SA 1ELOA 1U2RA 3J7AG 1NZ0A 1MX0A 2Z5EA 3HULA 3LNUA 1K47A 4DUYI 1KKHA 1PVGA 4JG4A 2HFSA 2HKEA 3PYDA 1HK7A 4WUCA 4FN5A 2IOPA 5GMEA 4USMA 1I94E 4DV7E 4JV5I 1PKPA 1ZM9A 5IT9Q 2DEJA 1DARA 1RREA 1I94I 1FWKA 3T1HE 4B3TE 1Z0TA 3LPSA 2R3VA 4DV7I 1USUA 4IZKB 1WUUA 2O1VA 2PNMA 1XNRE 3WU6A 4HXZA 1B62A 2V2VA 4DR2E 2Q2EB 1Z0EA 4B3TI 4IZJD 4AQYE 2PNLA 4X64E 2UXBE 1XNRI 4Z7YA 4DPXA 5L3JA 2X7IA 4JI8E 2VF3A 4DR2I 1J5EE 2GQ0A 1Y4UA 4UTGA 1HNWI 4JI4E 3F0NA 4AQYI 4X64I 2UXBI 4DPUA 1B63A 4B3SE 3ZKDA 1MG7A 5A2QQ 2UXDE 4JI8I 4LF4E 4B3RE 4JI4I 4B3SI 4DR1E 3H4LA 4K0KE 4DV3E 1Z0VA 4M1KA 3JAMC 4DV2E 1PIEA 3ZKBA 1S4EA 3V2UC 3QT6A 4K0KI 4JI6E 4KHPI 4DV3I 1XMQE 3V5RA 1RR9A 1Z5BA 2O1TA 4MYUA 5FWKA 1N36I 4HYMA 4JI1I 4JI6I 4JI0I 1D6TA 4RPFA 4GKKI 1FKAE 1NHJA 4UT4A 1UEKA 1KIJA 4IZJA 2VQEI 4LFAE 4LF5I 2Z5CA 4XTJA 3PYFA 4DV4I 4DR3E 2GS8A 3HJCA 2UUBE 4LFAI 5IWAE 1FJGE 4DR4E 3GONA 4JI2I 3J81C 4DR3I 4JYAE 2F4VE 4JV5E 1N32E 5GMDA 2UUBI 1IBME 4PRVA 4DV5E 5IWAI 1N0VC 1FJGI 2HHHI 4DR4I 3CWVA 3QT7A 2Z5BA 4JYAI 1NHIA 2F4VI 1N32I 4ZVIA 4NXNE 1Z0CA 1IBMI 3B78A 1N34E 4LF7E 4HACB 5LMUE 4DV5I 1XHKA 4LF6E 4FWDA 4FWHA 1Z5AA 3M6AA 2IOQA 4P52A 1H74A 4NXNI 5FLXC 1N34I 4LF7I 4FWGA 3OTOE 4P7AA 5LMUI 4LF6I 1HNWE 1EA6A 1H7UA 4JI7I 3OTOI 3JAMQ 3PYEA 2VQFI 3PYGA 1H72C 2UUAE 3Q6NA 4DR6I 4X66I 1MU5A 4I3HA 1HR0E 4YY3E 2J7KA 4LFBE 4PU9A 2UUAI 3J80C 1Z0GA 4HY1A 1HR0I 4DV1E 4KHPE 4YY3I 4LFBI 4DU7A 1NHHA 3B8HA 1N36E 1IBKE 5LL6R 3PRYA 4JI1E 4IZKA 4JI0E 4DV1I 4GKKE 2HKJA 2CGEA 1KTVA 1N33E 1BKNA 3ZZTA 3Q1QA 2CG9A 3QT8A 4X62E 4Z7CA 4R1FA 1IBKI 2AJ4A 1QZRA 2VQEE 2NPFA 4LF5E 1H73A 3QT5A 3J81Q 1HNZI 4JI5E 4ED4A 4DPWA 2CZ9A 4DV4E 1N33I 4DPYA 4X62I 4LF8E 1FNMA 4OX9E 5BR8E 4LF9E 4JI5I 4FW9A 3J7AM 2ZBKB 2UXCE 1FI4A 4JI2E 2A2CA 1Z0WA 4LF8I 2HK2A 3K1JA 1VISA 4OX9I 4DV6E 1H7SA 5BR8I 4LF9I 2HHHE 2XEXA 2LJPA 2UXCI 2V34A 5LMNE 1Y6ZA 4URLA 4X65E 5FLXQ 1XMOE 4GKJE 2O1WA 4DV0E 4YHHE 2R42A 4DR7E 2HFUA 4DV6I 2V8PA 1ZXNA 4PRXA 1Z0BA 5LMNI 4X65I 4GKJI 1XMOI 4DV0I 4YHHI 2UUCE 1FWLA 4DR7I 3B82A 2BM1A 1Z59A 1ZM4A 4JI7E 2OI2A 2UUCI 1KVKA 2VQFE 2E1RA 4NXME 4EMDA 3J80Q 1EI1A 4DR6E 4X66E 4DXLA 1OJ4A 1XNQE 4NXMI 1A6FA 3WU5A 4WUBA 3WU3A 2BV3A 2ZITA 2X36A 3T1HI 1XNQI 1N0UA 2UU9E 3ZZUA 4N3OA 4DUZE 2A2DA 5IT9C 1ZM3A 1HNXE 4IZJB 2E5LE 2UU9I 4HACA 4KQVA 3Q6MA 2O1UA 2Z5CB 4DU8A 4JI3E 4DUZI 1Z5CA 1USVA 3T1YE 2V2ZA 1J5EI 1HNXI 1HNZE 2E5LI 3LTOA 3D4JA 3K17A 3ZM7A 1ZXMA 1ZM2A 2EFGA 4JI3I 4B3ME 1IBLE 2ZM6E 2UXDI 4LF4I 3T1YI 3WU4A 4B3RI 4LFCE 1S16A 4DR1I 4MYTA 4DR5E 2Z5BB 4B3MI 1IBLI 2ZM6I 5A2QC 3K85A 4DV2I 4LFCI 4DPTA 3ZZ0A 2DEIA 2V2QA 3P06A 4WUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  4DR5 I;  2BM0 A;  2WW4 A;  1XMQ I;  4DUY E;  4USK A;  3J7A G;  1ELO A;  1U2R A;  1NZ0 A;  1MX0 A;  3HUL A;  3LNU A;  1K47 A;  4DUY I;  1KKH A;  1PVG A;  4JG4 A;  2HFS A;  2HKE A;  3PYD A;  4WUC A;  4FN5 A;  5GME A;  4USM A;  1I94 E;  4DV7 E;  4JV5 I;  1PKP A;  1ZM9 A;  5IT9 Q;  2DEJ A;  1DAR A;  1RRE A;  1I94 I;  1FWK A;  3T1H E;  4B3T E;  1Z0T A;  3LPS A;  2R3V A;  4DV7 I;  1XNR E;  1WUU A;  3WU6 A;  4HXZ A;  1B62 A;  2V2V A;  4DR2 E;  2Q2E B;  1Z0E A;  4B3T I;  4AQY E;  4X64 E;  2UXB E;  1XNR I;  4Z7Y A;  4DPX A;  5L3J A;  2X7I A;  4JI8 E;  2VF3 A;  4DR2 I;  1J5E E;  4UTG A;  1HNW I;  4JI4 E;  3F0N A;  4AQY I;  4X64 I;  2UXB I;  4B3S E;  4DPU A;  1B63 A;  3ZKD A;  1MG7 A;  5A2Q Q;  2UXD E;  4JI8 I;  4LF4 E;  4B3R E;  4JI4 I;  4B3S I;  4DR1 E;  3H4L A;  4K0K E;  4DV3 E;  1Z0V A;  4M1K A;  3JAM C;  4DV2 E;  1PIE A;  3ZKB A;  1S4E A;  3V2U C;  3QT6 A;  4K0K I;  4JI6 E;  4KHP I;  4DV3 I;  1XMQ E;  3V5R A;  1RR9 A;  1Z5B A;  4MYU A;  1N36 I;  4HYM A;  4JI1 I;  4JI6 I;  4JI0 I;  1D6T A;  4RPF A;  4GKK I;  1FKA E;  1NHJ A;  4UT4 A;  1UEK A;  1KIJ A;  2VQE I;  4LFA E;  4LF5 I;  4XTJ A;  3PYF A;  4DV4 I;  4DR3 E;  2GS8 A;  2UUB E;  4LFA I;  5IWA E;  1FJG E;  4DR4 E;  3GON A;  4JI2 I;  3J81 C;  4DR3 I;  4JYA E;  2F4V E;  4JV5 E;  1N32 E;  5GMD A;  2UUB I;  1IBM E;  4PRV A;  4DV5 E;  5IWA I;  1N0V C;  1FJG I;  2HHH I;  4DR4 I;  3CWV A;  3QT7 A;  4JYA I;  1NHI A;  2F4V I;  1N32 I;  4ZVI A;  4NXN E;  1Z0C A;  1IBM I;  3B78 A;  1N34 E;  4LF7 E;  4HAC B;  5LMU E;  4DV5 I;  1XHK A;  4LF6 E;  4FWD A;  4FWH A;  1Z5A A;  3M6A A;  4P52 A;  1H74 A;  4NXN I;  5FLX C;  1N34 I;  4LF7 I;  4FWG A;  3OTO E;  4P7A A;  5LMU I;  4LF6 I;  1HNW E;  1EA6 A;  1H7U A;  4JI7 I;  3OTO I;  3JAM Q;  3PYE A;  2VQF I;  3PYG A;  1H72 C;  2UUA E;  4DR6 I;  4X66 I;  1MU5 A;  4I3H A;  1HR0 E;  4YY3 E;  2J7K A;  4LFB E;  4PU9 A;  2UUA I;  3J80 C;  1Z0G A;  4HY1 A;  1HR0 I;  4DV1 E;  4KHP E;  4YY3 I;  4LFB I;  4DU7 A;  1NHH A;  3B8H A;  1N36 E;  1IBK E;  5LL6 R;  4JI1 E;  4JI0 E;  4DV1 I;  4GKK E;  2HKJ A;  1KTV A;  1N33 E;  1BKN A;  3ZZT A;  3Q1Q A;  3QT8 A;  4X62 E;  4Z7C A;  4R1F A;  1IBK I;  2AJ4 A;  1QZR A;  2VQE E;  2NPF A;  4LF5 E;  1H73 A;  3QT5 A;  3J81 Q;  1HNZ I;  4JI5 E;  4ED4 A;  4DPW A;  2CZ9 A;  4DV4 E;  1N33 I;  4DPY A;  4X62 I;  4LF8 E;  1FNM A;  4OX9 E;  5BR8 E;  4LF9 E;  4JI5 I;  4FW9 A;  3J7A M;  2ZBK B;  2UXC E;  1FI4 A;  4JI2 E;  2A2C A;  1Z0W A;  4LF8 I;  2HK2 A;  3K1J A;  1VIS A;  4OX9 I;  4DV6 E;  1H7S A;  5BR8 I;  4LF9 I;  2HHH E;  2XEX A;  2LJP A;  2UXC I;  2V34 A;  5LMN E;  4URL A;  4X65 E;  5FLX Q;  1XMO E;  4GKJ E;  4DV0 E;  4YHH E;  2R42 A;  4DR7 E;  2HFU A;  4DV6 I;  2V8P A;  1ZXN A;  4PRX A;  1Z0B A;  5LMN I;  4X65 I;  4GKJ I;  1XMO I;  4DV0 I;  4YHH I;  2UUC E;  1FWL A;  4DR7 I;  3B82 A;  2BM1 A;  1Z59 A;  1ZM4 A;  4JI7 E;  2OI2 A;  2UUC I;  1KVK A;  2VQF E;  2E1R A;  4NXM E;  4EMD A;  3J80 Q;  1EI1 A;  4DR6 E;  4X66 E;  4DXL A;  1OJ4 A;  1XNQ E;  4NXM I;  1A6F A;  3WU5 A;  4WUB A;  3WU3 A;  2BV3 A;  2ZIT A;  2X36 A;  3T1H I;  1XNQ I;  1N0U A;  2UU9 E;  3ZZU A;  4DUZ E;  2A2D A;  5IT9 C;  1ZM3 A;  1HNX E;  2E5L E;  2UU9 I;  4HAC A;  4KQV A;  4DU8 A;  4JI3 E;  4DUZ I;  1Z5C A;  3T1Y E;  2V2Z A;  1J5E I;  1HNX I;  1HNZ E;  2E5L I;  3LTO A;  3D4J A;  3K17 A;  3ZM7 A;  1ZXM A;  1ZM2 A;  2EFG A;  4JI3 I;  4B3M E;  1IBL E;  2ZM6 E;  2UXD I;  4LF4 I;  3T1Y I;  3WU4 A;  4B3R I;  4LFC E;  1S16 A;  4DR1 I;  4MYT A;  4DR5 E;  4B3M I;  1IBL I;  2ZM6 I;  5A2Q C;  4DV2 I;  4LFC I;  4DPT A;  3ZZ0 A;  2DEI A;  2V2Q A;  4WUD A; 
#chains in the Genus database with same CATH topology
 3K89 A;  5GAH I;  2XGQ A;  2VIC A;  2BQ3 A;  2GGP B;  4DQS A;  5DLF A;  2NZ4 A;  1BQM B;  1KTQ A;  5HJY A;  3M1V B;  3J7A G;  3QFW A;  1NZ0 A;  3UNG C;  1EET A;  4G6V B;  1K47 A;  1DLO A;  1RAD B;  1RLC L;  2O67 A;  2AD9 A;  1EP4 B;  1UZD A;  3T5J A;  1N33 F;  1S0N A;  3TP2 A;  2VG5 B;  3QID A;  4OHV A;  3EX7 B;  2IM1 A;  2YNH B;  4C8Z A;  4QYZ K;  3OPK A;  4WBF A;  3OUY A;  4DL4 A;  3VTI A;  2F8E X;  2N4C A;  3L09 A;  3NG8 A;  4LF9 F;  1KQG B;  3QJP A;  1NME B;  4ZP6 A;  1JLC A;  2QC3 A;  3T1H E;  1CUL A;  3JYT A;  3TAP A;  1KOH A;  2PNM A;  2ASD A;  3FRY A;  4PWW A;  4ZPD A;  1U8W A;  4GKJ F;  2M4M A;  4KT0 C;  5U47 A;  2F9D A;  3Q2S C;  6FDR A;  4Q0B B;  3P8B B;  4I69 A;  4FF3 A;  2LYV A;  5DRR A;  2KYZ A;  1UWB A;  4U96 A;  3DMJ A;  4WP8 A;  3G82 A;  2AF6 A;  4C3L A;  1YJN S;  2QL9 B;  1DJ0 A;  1Z2L A;  1ZH5 A;  1LWE A;  2NUH A;  4DL5 A;  2XZT B;  3LH2 S;  3RAM A;  4C3M A;  4M95 A;  3K8W A;  1QE1 A;  1Y4Z B;  1APS A;  2FLP A;  4NLO A;  1FXL A;  5HMZ A;  4JV1 A;  1UP1 A;  2FVR A;  2G2O A;  4HYM A;  4L76 A;  5E5N A;  2R7W A;  4RWW A;  4ISA A;  2HWI A;  1Z2Z A;  1IM4 A;  2XSJ A;  1NLK L;  3OSN A;  2HHX A;  4DL0 C;  5B08 A;  3N6L A;  2DIS A;  3VHQ A;  1IUJ A;  2ROP A;  1CPZ A;  2ADC A;  3EWG A;  1TMM A;  2QG9 B;  2DB1 A;  2QA2 A;  4IG3 B;  3M9N B;  2JC1 A;  2ZM6 F;  1FRL A;  5AXL A;  2VL1 A;  2PFF B;  5F3T A;  1NPR A;  3GIR A;  2CQ0 A;  1N34 E;  2EFQ A;  4HAC B;  4OI4 A;  1AA1 B;  1N5Q A;  3MPW A;  2HQ3 A;  4NOH A;  3PFO A;  3DRS B;  4NLX A;  2DY1 A;  2WVF A;  3DDN A;  1XR5 A;  3TJA A;  1SUQ B;  4Y00 A;  3A3P B;  1H0H B;  2FZC B;  1HWK A;  2GMH A;  3AJ2 A;  3OXF A;  1Q81 T;  2QFI A;  1NK5 A;  1HLW A;  1B0V A;  5ETM A;  3PYE A;  3R6L B;  4I2P B;  3PYG A;  5HAN A;  2VH7 A;  5L9X A;  4QWA A;  2UUA E;  4GC6 A;  3Q6N A;  4DL6 A;  4X66 I;  1UCN A;  1UDN A;  1VRU B;  2RKI B;  1LNQ A;  2JZ5 A;  2IBK A;  2DKO B;  2H4W B;  3G2X A;  3I5B A;  3DI6 B;  4AE5 A;  4HY1 A;  5A8R A;  2D9O A;  3HHL C;  3K2Y A;  2HGM A;  4DU7 A;  5L1J A;  4LFA J;  3BGF A;  1NK6 A;  4DEZ A;  2L48 A;  1O6X A;  2DNZ A;  4DV1 I;  2YWK A;  5GMK a;  2HS3 A;  3BBC A;  3QT8 A;  1SL1 A;  2A18 A;  1GX6 A;  5K8O A;  4JYA J;  4DX7 A;  2WP8 A;  1TV6 B;  4RW4 A;  4X62 I;  4FKY A;  1I6J A;  4F0M A;  2QA4 S;  2IAJ A;  4YN3 B;  4DSK A;  3HMJ G;  4NXN J;  2K06 A;  5HMX A;  2YNI B;  4Y65 A;  2FLO A;  3F56 A;  3PXG a;  4CM0 A;  4DN0 A;  4JI7 J;  5H9E K;  4ZLJ A;  4ZP7 A;  1A0O B;  1RHY A;  3MD1 A;  3DOM A;  4PCQ A;  4Y34 A;  4X65 I;  3IA0 A;  2W4P A;  2PO0 B;  4P2X A;  4TQR A;  2ABY A;  4NLT A;  2KXN B;  3OFE A;  1N48 A;  1Z59 A;  4FF4 A;  4FF1 A;  2DRB A;  4MKB A;  1RT6 B;  2MHE A;  1ZOT A;  2ZBR A;  4FW4 A;  1UWA A;  1SH0 A;  1FDD A;  3KFW X;  3IG1 A;  3BJY A;  4X66 E;  4DXL A;  1RWW B;  4ECU A;  2BJ9 A;  2XYH B;  2AEM A;  5GVQ A;  3DRP B;  2GML A;  3H8Y A;  1XNQ I;  4IFD C;  4LRA A;  2A1B A;  5IT9 C;  1V5I B;  2AKW B;  3HI9 A;  3M8W A;  5DRO A;  4IZJ B;  5DLG A;  4GC7 A;  4Y2I A;  5AE2 A;  2CKW A;  5ETR A;  1J5E I;  4X4U A;  4ZN3 A;  3W7B A;  3M6W A;  3CCL S;  3HP6 A;  1R0A B;  2VQF F;  4QWE A;  1IBL E;  2UXD I;  3ISN C;  3L7P A;  4LF4 I;  3V6K A;  4WKY A;  1RCO B;  1B0T A;  3ETO A;  2VFU A;  4AUK A;  3BGO P;  3GG1 A;  2VHG A;  5DRQ A;  5DDO C;  3UVJ A;  2OPP B;  4BS2 A;  4G1Q A;  3M30 B;  1F60 B;  2XHW A;  1GH8 A;  1S0V A;  1WDD A;  3I0R B;  4DUT A;  2HHW A;  1VRT B;  5F0U A;  2I0X A;  4GO5 X;  4RBU A;  1C0T B;  1Q7L B;  1F5C A;  3MMB B;  1Y5L B;  1HNZ F;  3QO9 B;  4WXO A;  1WD6 A;  1Z4U A;  2Y8W A;  2VFT A;  2FJV A;  5HQM A;  3SDE B;  3MM7 A;  3Q23 A;  4USM A;  4U67 Q;  2QA1 A;  5DRK A;  1CJU A;  1N4L A;  4IRK A;  4P9S A;  4WFZ A;  4IUF A;  5KT5 A;  3EUN A;  1REV A;  1ZM9 A;  2HYI B;  1WHW A;  2LKZ A;  4NA3 A;  2NPI A;  3PDN A;  4F2S A;  5D15 A;  5J2M A;  5D4O A;  3QPI A;  3R1H A;  2HAI A;  2ZHB A;  4F4A A;  3M2U B;  2FVS A;  5BJR A;  4AM3 A;  3OR1 B;  2PI4 A;  3MFI A;  1ARO P;  4ED0 A;  5J2N A;  4QJV A;  3RRK A;  2G0J A;  2IJN A;  3VAL A;  4Y6I A;  1J5E E;  2U1A A;  3DC2 A;  1JJ4 A;  2UUC F;  3EXY A;  3PJ9 A;  1QAY A;  4Q8E A;  4LIR A;  2UXD E;  2ZD1 B;  3IR7 B;  4LF4 E;  5KFE A;  1Y00 A;  1HBO B;  3H4L A;  1RGV A;  4O4R A;  3IRX A;  1M5V C;  5E3C A;  2FZG B;  2PSZ A;  1U0S A;  2M5Y A;  2L3M A;  4I2Q B;  4RW7 B;  1CJV B;  2QEX S;  1X5S A;  1W26 A;  5KFM A;  4JI6 I;  4RPF A;  1QSL A;  3BKT A;  4PYA A;  5ETO A;  1F2H A;  3RBZ A;  3HJF A;  1I1G A;  1M90 T;  1FKP A;  3FEX B;  3DDI A;  3I96 A;  1X9S A;  2DXF A;  4ID8 A;  1WF1 A;  4RJV A;  1XER A;  3OHA A;  5D8H B;  1WG4 A;  4K2X A;  1RHM B;  1TL1 B;  1YI2 S;  1WG5 A;  4JOU A;  1NSQ A;  4EBC A;  5AXM A;  3CUL A;  4DR2 J;  3HVT B;  2GO4 A;  2D3Z A;  1UVM A;  4DR5 F;  4O3R A;  1ZAW A;  3ONQ A;  3D3B J;  3K7R A;  2RIL A;  5KFW A;  1AZS A;  2DHS A;  4JI4 J;  3ZO7 A;  1ZTT A;  2EFV A;  2HHV A;  1K1S A;  2CQI A;  3CDU A;  3W2V A;  4Y2M A;  2KVQ E;  3O3L A;  4KKO B;  1RBO B;  3LAL A;  5A2Q U;  4DV3 J;  3GJS B;  1KQK A;  4F3O A;  1FJC A;  2PFD A;  2LP4 A;  2XMU A;  4JI1 J;  2VPZ B;  2IBO A;  3QAT A;  3VAM A;  4OZ5 A;  2BJ7 A;  4O23 A;  4CM2 A;  3FCW A;  2J7K A;  3E01 A;  4MKV A;  1VQM S;  4M5D A;  4FF2 A;  3TRG A;  2IRU A;  4BWM A;  1RSC A;  3AD7 C;  4FP9 A;  4J9R A;  4YY3 I;  3KNG A;  4HYK A;  1W25 A;  1JKH B;  5KFN A;  3ZZP A;  1GMU A;  2EEY A;  4B3T F;  3TQE A;  4OO1 D;  5M2U A;  4DR3 J;  2UVU A;  4OZ1 A;  3GIL A;  1N33 E;  1QAI A;  1BKN A;  1RT5 A;  1N5S A;  3PKY A;  3C8Y A;  4AQY F;  2E7X A;  3L7Z B;  2L08 A;  3VV2 B;  3GV8 B;  2E9R X;  2DPJ A;  2VBX A;  1FE0 A;  3MMA B;  2YNG A;  4LF9 E;  4YR0 A;  4EGL A;  2ZBK B;  3SEO A;  2Y0B B;  1OPI A;  2C3Y A;  3H5Y A;  3AH6 A;  3LWM A;  1Q86 T;  4KJI A;  4DJB A;  4NZ6 A;  3G9C A;  2FYX A;  2UXC I;  4KHP F;  4GKJ E;  2KG0 A;  1JJC B;  2PN6 A;  3T5L A;  3DLK B;  2RRN A;  2KRB A;  1YX2 A;  4J37 A;  2R7R A;  3UWT A;  2AE8 A;  4RKU C;  1FNO A;  3KJQ B;  5L9N A;  1U4B A;  4OO1 A;  4YFU A;  5HBM A;  1HD0 A;  4DV4 F;  3B54 A;  2OI2 A;  3WX8 A;  4ECV A;  3TVY A;  4PR6 A;  1IKW A;  2OO4 A;  4RZR A;  1RWV B;  2O5D A;  3CIZ A;  1HBU B;  2R7T A;  5EWF A;  4WE1 A;  4NXM I;  4ETZ A;  3AXK A;  2CQB A;  3I5A A;  4ED3 A;  3LPE A;  5ETK A;  2F4V F;  1MU2 A;  3TEG A;  3CW2 C;  3D66 A;  5D0G A;  4N3O A;  2CPH A;  3QRP A;  2YQ3 A;  1ICE B;  5B0G A;  2UU9 I;  4LF7 F;  1MSW D;  3PO4 A;  3TJ9 A;  2WK4 A;  4IR1 A;  5G0R A;  3AA9 A;  5H9E J;  2DD8 S;  4DV6 J;  1ZXM A;  2GHV C;  2EFG A;  4B3O B;  4LCF A;  4JI3 I;  2ZM6 E;  2AJ1 A;  3T1Y I;  1WOO A;  2LXI A;  3D0I E;  2A10 A;  4NMX A;  3VWS A;  2OAU A;  1DZ5 A;  4YQW A;  1RLD A;  5A2Q C;  3DU6 A;  2RQ4 A;  4YP3 A;  1HI1 A;  3IWX A;  3MM5 A;  3P06 A;  5KG0 A;  2FJD B;  4KFB A;  3OTE A;  1FWP A;  2WW4 A;  2PA3 A;  3C14 B;  3FDS A;  4N47 A;  5HRO A;  3M8S A;  5DZ6 A;  1T94 A;  1U1P A;  1KLM A;  1IBK F;  2A6M A;  3FZ2 A;  2VG7 A;  4WUC A;  2BW2 A;  1O8B A;  1GNK A;  4WXW A;  2XTJ P;  3BF4 A;  4E8U A;  3BO4 A;  1T9Y A;  4PQU A;  4QPT A;  3D54 A;  1B0P A;  3D6H B;  3TZX A;  4PEO A;  3P49 B;  2KDO A;  3UDE A;  2Z8Q A;  4UW2 A;  2FJW A;  3LGM A;  2W2M P;  3PEJ A;  2OSR A;  3G86 A;  1IKX A;  1RT1 B;  4NLY A;  3KK1 A;  5LMN F;  1UVL A;  4TYB A;  3MD3 A;  4QU7 A;  1Q8B A;  2PNL A;  3NNC A;  3MF5 A;  4KGM A;  1B99 A;  2H54 B;  2FIU A;  2LXU A;  2HZC A;  1RUS A;  3AJD A;  2UVV A;  4X64 I;  3M7N G;  1QLN A;  3ZKD A;  3MOZ A;  1NBE B;  4J5O A;  4O3S A;  1DQA A;  4JI8 I;  3U1Y A;  2CJA A;  1KRP A;  1MLA A;  4ZVT B;  2W9B B;  4WFY A;  4PPZ A;  4B3S I;  5JMN A;  2K8G A;  1Z0V A;  1GK8 A;  3M6U A;  5T7L A;  1PJ5 A;  4I1T A;  2M52 A;  5K8M A;  3M8Z A;  5ETQ A;  3V5R A;  5KFH A;  2I2Y A;  2ZHO A;  4LR8 A;  1RT4 B;  1NK0 A;  3AB2 B;  2VBY A;  4DMZ A;  4ECZ A;  5G4D A;  2G1H A;  4ED5 A;  5F8I A;  2Z5C A;  2FTR A;  3KG4 A;  1FXD A;  2BA0 D;  2DYA A;  3L7U A;  1TFY A;  2PEB A;  3OLA A;  2NQP A;  3T9N A;  3J7Y U;  1ZS6 A;  1CJK A;  1JLQ A;  2FJX A;  3J81 C;  2EVZ A;  3EGZ A;  2HNY A;  2FJA B;  2ZHA A;  4W98 A;  2B43 A;  4DR4 I;  5K14 A;  2GAG C;  5CCL A;  2FD2 A;  3K5O A;  4Y2C A;  3RB4 A;  3WBZ A;  1DFD A;  1Y9O A;  4O3P A;  3VZI A;  2IPO B;  1FF2 A;  4N5S A;  5HVH A;  3CCM S;  1KD1 T;  1TL7 B;  4KHM A;  1UTA A;  4NCA A;  4LSZ B;  1T95 A;  1DUR A;  5A8K B;  3NGK A;  4JV5 F;  5AJ3 J;  5K36 D;  1X4A A;  2MLZ A;  1HI0 P;  2MDA A;  1C0U A;  1Q95 G;  4HH0 A;  2VOP A;  3BDP A;  3KK2 B;  1U6F A;  2B4V A;  3MR6 A;  5GAE U;  1U24 A;  3H90 A;  4J9V A;  2H4Y B;  4Z7C A;  1EQ0 A;  2E7W A;  2SXL A;  2NPF A;  4X4O A;  1UFK A;  1H73 A;  3QT5 A;  4FW5 A;  2V4J A;  1VQ9 S;  2C2K B;  2AZ1 A;  3ZTR A;  3NY0 A;  3FBB A;  1TKZ B;  2ZH8 A;  3KYL A;  2VES A;  3EZ5 A;  5HQL A;  4LF6 J;  2OP5 A;  5HP1 B;  1VIS A;  1GAO A;  2HMI B;  1WOR A;  1ZPW X;  1TL3 A;  5KFA A;  4CLK A;  2WSF C;  4A8F A;  5K36 A;  2XYP B;  3EGV A;  4U3D A;  4ZCI A;  5F9N A;  4LR7 A;  4ZP9 A;  2JEA B;  2OLW A;  3K0J A;  1RU2 A;  2RH3 A;  2ZZT A;  1XMO I;  4I67 A;  2UUC E;  3BQ0 A;  1YQH A;  2VQE F;  1R8C A;  4LF5 F;  1G7C B;  4OYX A;  2F8M A;  4U7U D;  3JAM U;  4LFB J;  1HKA A;  3HCX A;  1K0T A;  1PJ6 A;  5IV3 A;  3IAS 9;  4EMD A;  5A76 A;  4DLE A;  1OJ4 A;  4XK8 C;  2Y0S D;  4TU7 A;  1NDK A;  1T0T V;  1X4G A;  2MZR A;  2RQC A;  2YWG A;  2ZDP A;  3RR8 A;  3W3S A;  4K59 A;  2E7V A;  2VPY B;  4LRD A;  3BQ2 A;  1VFJ A;  4DV5 F;  4JI5 J;  2WB4 A;  3K57 A;  5KG6 A;  1S4F A;  4NLR A;  3SV4 A;  2DRA A;  1C2P A;  1DLO B;  3HHK A;  5CAB A;  3ZM7 A;  3KDN A;  5M2P A;  5C42 A;  6FD1 A;  1NDC A;  2YKN B;  2BJ8 A;  4C3K A;  2IVY A;  1S1T A;  1RT3 A;  5J2P A;  4KTQ A;  4ED7 A;  4DR5 E;  2BBE A;  3MPD A;  3UFC X;  1WOS A;  2Z0G A;  4JBC A;  2IC3 A;  1HR0 F;  3ENQ A;  2H