1KKHA

Crystal structure of the methanococcus jannaschii mevalonate kinase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
317
structure length
317
Chain Sequence
PRGSHMIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Methanococcus jannaschii mevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Mevalonate Kinase
total genus 104
structure length 317
sequence length 317
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2001-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1kkhA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1kkhA01
2HK2A 5GMDA 1Z0VA 4MYUA 1QZRA 3LNUA 2UXDI 5BR8I 1HR0I 4B3SI 4HY1A 4LF6I 3K17A 1Z5CA 1N36E 1S4EA 5LMUE 4DPYA 1Z59A 3Q1QA 4NXNI 3ZZ0A 4X65I 2HHHE 5BR8E 1Z0TA 4OX9E 1KVKA 1HNZI 1IBMI 4GKKI 2WW4A 4JI5I 1XMOE 4NXMI 4JI8E 5LMNI 1FNMA 4R1FA 4JI3E 1Z0BA 4DR5E 1FKAE 1KKHA 4X62E 1FI4A 3JAMC 2HK3A 2J7KA 3PYFA 1XNRI 3ZZUA 3B78A 2HKEA 2DEJA 3WU3A 4P52A 1DARA 5LMNE 3ZKDA 4LF4I 1H7SA 4I3HA 4DPWA 4DR7E 4ED4A 1ZM3A 1ELOA 4DR2E 2E1RA 2UXBI 2UXCE 4KHPI 4LF9E 3HULA 4DV4I 3OTOE 1PKPA 2UUCE 1I94E 4JI0I 3B8HA 4DR7I 4DUYI 2VQFE 4GKJI 1UEKA 1HR0E 5LMUI 4DV6I 2UXBE 4JI1E 2UUBE 4X66I 4DV4E 3J7AG 3J81C 2UUAE 2ZM6E 4DUYE 3LTOA 1MG7A 4JYAI 4XTJA 1WUUA 2OI2A 3ZKBA 2VQEI 3PYEA 1MX0A 2E5LE 3ZZTA 4P7AA 2F4VI 1XNRE 2GS8A 4HACB 2V2ZA 2CZ9A 4B3TI 4LFAI 1A6FA 1N0UA 1Z0CA 4YHHI 3V5RA 4UT4A 3PYDA 2DEIA 2HHHI 4UTGA 1D6TA 2AJ4A 3F0NA 4LF5I 4K0KE 4NXME 1OJ4A 1KIJA 4JV5I 4KHPE 3QT6A 3H4LA 4RPFA 3M6AA 4AQYI 4X66E 4USKA 4KQVA 5A2QC 4MYTA 4DPTA 4LFCI 4DXLA 1Z0GA 2HFSA 4HACA 4DV2E 3WU5A 1HNWI 4B3RI 4FN5A 3T1HE 4WUBA 1Z5AA 4LFCE 3D4JA 4PRXA 2UUAI 4DV0E 4DV2I 1FJGE 1IBKE 4WUDA 2ZITA 1XMQE 3JAMQ 1HNWE 1PVGA 2UXDE 4K0KI 4DR6E 4JI4I 2NPFA 5IWAI 1FWKA 4DR5I 1KTVA 1Z0WA 4JI7I 2BV3A 4JI5E 4LF7E 1H7UA 4LF5E 4X64I 1EA6A 3J7AM 1XHKA 4X65E 4DV1E 5IWAE 1N32E 4YY3I 5FLXC 4JI1I 4Z7CA 3J80C 4JI3I 4DR3E 4JI6E 4X64E 4JI2E 4AQYE 2UUBI 4DR1I 1HNXI 2E5LI 2UU9I 4URLA 3J81Q 5A2QQ 4DV5E 5IT9Q 4FWHA 2VF3A 5LL6R 4JYAE 1MU5A 4JI4E 4DV3I 1HNZE 2ZM6I 1IBKI 4LF8I 2LJPA 4GKKE 3QT7A 2VQFI 4GKJE 1NHHA 1B62A 3LPSA 3T1YI 1K47A 4PU9A 2HKJA 4DV7E 1IBLE 2UU9E 4FW9A 1H72C 4JI2I 4B3SE 1ZXNA 4HXZA 1H74A 4LF6E 4DUZE 4HYMA 1XNQE 4JG4A 4ZVIA 5L3JA 1VISA 2BM1A 2R42A 4JV5E 1J5EE 2X36A 4YY3E 4FWDA 5GMEA 2VQEE 2V8PA 1N33E 4OX9I 4YHHE 1Z0EA 4LFBE 1XMOI 3ZM7A 2V2QA 1NZ0A 4WUCA 3QT8A 1HNXE 4USMA 1BKNA 2F4VE 5FLXQ 1Z5BA 3K1JA 4DV0I 1FJGI 3WU4A 1H73A 1EI1A 4DR6I 2X7IA 1N33I 1IBME 4B3TE 4LFAE 4B3RE 4DU8A 4DV7I 1XMQI 4DR2I 2HFUA 1XNQI 1N34E 3QT5A 3GONA 4LF4E 5IT9C 1ZM4A 4FWGA 1U2RA 4DV3E 1N36I 1ZM9A 4DV6E 4B3ME 2UUCI 4M1KA 4JI0E 3OTOI 1NHJA 1ZM2A 2ZBKB 4DR4I 1N0VC 1ZXMA 2EFGA 4DPXA 4Z7YA 1N32I 1NHIA 3B82A 4LF9I 1S16A 1IBLI 3PYGA 1I94I 4LFBI 4EMDA 2A2CA 2XEXA 2V34A 3T1HI 2A2DA 1FWLA 4DV1I 2UXCI 1J5EI 4DR1E 2V2VA 3J80Q 4LF7I 4DR3I 4DV5I 1RREA 4PRVA 4NXNE 1RR9A 1N34I 4X62I 4JI7E 4JI6I 3WU6A 3CWVA 3V2UC 3T1YE 2Q2EB 4B3MI 4JI8I 2R3VA 4LF8E 1B63A 2BM0A 4DUZI 4DR4E 1PIEA 4DU7A 4DPUA
chains in the Genus database with same CATH superfamily
2MPUA 3M2RB 4DF4A 3M2UB 2HK2A 3ADAC 4NX9A 4KKOB 1XIQA 2ADBA 3M8ZA 1FO1A 3ZTQA 3JQKA 3BSCA 2A18A 4W4MA 3S01A 4MTPA 5IV3A 4PABA 4NXMJ 3B4TA 2QSWA 1U1OA 2EC0A 1U1QA 2CPZA 2DH8A 1LWCA 2HNZA 2IVYA 3G82A 3GIRA 3JTOA 3PACA 4P73A 1E6VA 4WJBA 5E3PA 1I94F 3G71S 2EW9A 2GQ0A 4B3SI 2UVWA 5HATA 4F0KA 2PO0A 4OZEA 3HJCA 2C2ZB 3TA2A 3FBEA 4OZ1A 3R1HA 1HR0F 1Z5CA 1RP5A 4WE1B 3TQEA 2UVRA 3EZUA 2VKZG 5HROA 1N36E 2PO1A 4K4SA 2I1RA 1HHQA 4B3SF 1P8GA 4FYXB 2ADCA 2Z5BB 2KHDA 5GVQA 2O66A 4Y34A 3KLHB 3CCTA 4DPYA 4WK1A 3JYTA 2KM8B 3HP6A 2BJ3A 2YH1A 1N5SA 1RYRA 2VL1A 3QRQA 4CO5A 4NXNI 1YHQS 2V68A 3ZC4A 3Q24A 4FKXA 3TX0A 4LRFA 3NCPA 5DJBA 4NYZA 5DLFA 2E1PA 2M52A 1EJ7L 1TMMA 3VWSA 2VBWA 3ZZ0A 3CGIA 5CCMA 5JEAA 4X65I 1EKRA 2RILA 2XWYA 2ZBIA 4MKBA 4ZVRB 4PWUA 4BWJA 3CF5Q 3V4IB 2DHXA 3AD9C 2EFVA 1Z0TA 3JXOA 4OX9E 2OIHA 2W2QP 3HHEA 2VQEJ 1CJVB 4ZVUB 1HNZI 2KJWA 5K36A 2Y1LB 5DRKA 1R0CB 3SSRA 4YDDB 5F8JA 4OX9F 3WIUA 1X5SA 4OYOA 3EGWB 1G4CA 3VAGA 2C28A 1SL1A 1VBKA 3D1OA 4OYIA 4QIVA 3BBCA 5C25B 1KTQA 4DQSA 1T8EA 4JYAE 4FXWA 1HNIB 4E2FB 1AT1B 2CNLB 2HNDA 1U45A 1Z0BA 3QFHA 4Y28C 4DR5E 2H4WB 1NK9A 4I6YA 1KKHA 1R0AB 3HJFA 1TU0B 1HIYA 2G2ZA 5HMYA 1YK9A 2J9DA 2DVIA 3E01A 1QY7A 2YKMA 5DDRC 3VAHA 1KRPA 4FPRA 4LF2A 4PR6A 2LEBA 2FLNA 2DYAA 2F4VF 3ENVA 1FXRA 1XNRI 3EXYA 1J5OA 3NNCA 1LQ9A 1C0TA 3W65A 2MHEA 2VQFI 2YBVA 3B78A 2HKEA 4NEZA 1IKWA 5CQGA 3K59A 2BOAA 5KFQA 3SCIE 1HARA 1Y4UA 3GTYX 2E1CA 3WU3A 3QWUA 2RQCA 1XNRF 2MZRA 5IS2A 2HVIA 2FY8A 1XWLA 2ZHAA 5LMNE 3OUYB 1Q5YA 2VESA 2QGFB 3VQSA 1FHTA 2JL9A 3CJ4A 4WZMA 3D1HA 1SUQB 1WJ9A 3GZ7A 4TVAB 5DO2A 2OD6A 5IWAJ 3EPGA 2G2OA 3ZKDA 1LKZA 1U7LA 3BPSP 1TKTA 2CRLA 2WHOA 4WBFA 3P3EA 1OY6A 1XNQF 4DR7E 1SH3A 3T1HF 1W25A 3DLHA 1TZ0A 2OPSA 1N5TA 4QWDA 4QYZK 2MKIA 1VC0A 4HI2A 2DNRA 3MEEB 4F3MA 2E1RA 5CCLA 3L7ZA 3MAAB 4I2PB 5DG9A 2D9OA 2V8HA 2Y8YA 4OI1A 1ULRA 2UXCE 4WXWA 4LF9E 3HULA 3UNYA 2Q6CA 1PKPA 2XNQA 2F9DA 4FYVB 1XR5A 4NLDA 3MCMA 3OHAA 5DG8A 3UE2A 2C3OA 3NBPB 1UJ5A 4DR7I 3TANA 5KG3A 1Y4SA 3PW4A 1N34F 3CD6S 5L1JA 1E3HA 2VQFE 1AZSA 1K73T 4GVBB 3R6GB 2XHWA 1OYDA 3W7BA 5IWAF 3CJQA 3KNAA 4JI1E 2CPDA 3V6JA 4RX6A 2P6TA 5KFCA 4R5PA 3OR1B 1YWXA 1SL0A 3DRYA 4JYAF 1EZZB 3J81C 4OZ0A 4KSEB 4KHRA 1Z2LA 4JI1F 2BR0A 4JV2A 4NLWA 2XYHB 3D6FB 3NG8A 4LRBA 3ELHA 3GPAA 4IFDA 1M5PC 4JOUA 3QJLA 4DR2F 3M32B 2AWZA 1I6JA 3PW7A 4L3KA 1F9FA 1JLCA 1WUUA 2Z2ZA 1T9XA 3DDKA 4YUDA 3MR2A 4C11A 1J5EF 2NUUG 3ZKBA 2BKOA 2D41A 5ETLA 2C42A 1B7FA 3DRXA 4PAAA 2F4VI 4X4RA 3MPYA 1YBTA 2BANB 2RHSB 2XTJP 5J1EA 4Y2MA 5C0XE 2P5VA 4DDFA 3JSBA 4LSNB 1Y6ZA 1XNRE 2JDJA 2Q3PA 5JUMA 5BJRA 2HBRB 2QMUB 3O44A 1TK5A 4KFBB 2B4OA 3UVJB 4WFYA 3LWLA 2CNKB 2PD1A 2WB4A 4GMKA 4RW6A 4HACB 3MFHA 4JI7J 3P06A 2V2ZA 3ENWA 1HQUA 4OFZA 1HBOB 4RWWA 1JXEA 2LA6A 3MEDA 2JFKA 2OEJA 1M5OC 2YKPA 1YI2S 2GNKA 4QYRA 1VQOS 1RBOB 3UHMA 2E44A 2F8EX 2H4YB 3AODA 4KB7A 2HQ3A 4OLPA 2YWHA 4BHQA 1V3RA 1NK8A 4IS9A 2HRYA 3BR8A 3DRPA 4YHHI 2LMIA 4ZKAA 4B3TJ 2W2OP 1QE1A 4LF9J 2VOPA 4C9DA 2IYIA 5E3QA 4IR1A 3PYDA 1UWBB 1N33J 3M9NB 3O5TB 2RIJA 3K5LA 3H1CA 1YSJA 1FA0A 2DEIA 4DN0A 1M5HA 4DZDA 3VGUA 1F2GA 1BQMB 3AJDA 4DSKA 1FEEA 2HQGA 3OD2A 5T14A 1BE4A 2CG9A 1NJXA 1KONA 3N9UC 2J9CA 3PG9A 4KO0A 5F41A 2HYIB 2IIHA 5FWKA 1FVSA 4ZCIA 3M1VA 2SXLA 5A0YA 5T7LA 2MKKA 5LT5A 1NO8A 2QL5B 2MZSA 3KMQA 4JUZA 2JLFA 5HANA 5KFNA 1XR6A 4KQZA 1D9AA 4NCGB 4Q7AA 5HVHA 3HPOA 2FZGB 2FD2A 1VBYA 1CVJA 4YQWA 3Q6NA 2XNRA 3X1LB 2B7CB 3BS9A 1VQ7S 1HMVB 3DLJA 1RT7B 2I5JB 4PEOA 3M6AA 4K2XA 2WNRB 1WOOA 2F8MA 3JYTB 2H5JB 3KLEB 3H20A 5LMNJ 4KQVA 5A2QC 3RU0A 3D0GE 5L9NA 1LFPA 3RZAA 3M85D 5F8LA 3ILJA 4CM0A 3TZZA 5HP1A 2F1FA 2LQJA 1F9HA 1IXKA 3IRXA 4B3RF 3CD5A 2PI5A 4G1QA 1B70B 1RT6A 4FF2A 2HFSA 2IJFA 4ZP7A 4LF6F 3KDNA 4BC9A 1UP1A 5C7PA 3A4TA 4ILLA 1HPZA 1M1GA 2BRKA 1OO0B 3CD0A 2KZMA 4F3QA 2AD9A 4NXNF 4P2MA 4CI0B 4IFYB 3WQPA 4X64F 4Q0BB 5IV4A 2E5IA 1Q8LA 4BCAA 1WWHA 2XSJA 4FN5A 4K5SA 4FS2A 5C25A 4DMZA 5KT6A 2DR8A 3WIVA 2RQKA 2XMVA 1B0VA 2I6WA 3MOJB 5GAGU 1SCJB 4U8VA 2JNJA 1BGXT 1YDLA 3C16B 1U1PA 3I4HX 4R8UB 4K4UA 4OHXA 2UUAI 1FJGE 3AXKA 4U7UD 3E8OA 2ACYA 2ZITA 4ZLJA 2UXDE 4ED7A 3HMJG 4LFBJ 3MZIA 4X4UA 1EKSA 5A8RB 2YKAA 3NBPA 4IFYA 5DRPA 2LA4A 4P7VA 1DTQA 2JE6A 3M1VB 2OPRA 3S1TA 5JVHQ 1VJWA 3EGVA 3J7AN 1PYSB 3I0SB 2YNIA 3ETMA 3ULHA 1QSLA 4K0KF 2BV3A 4LT6A 1QDUB 2KKHA 3UQSA 4D3GA 1T05B 4JI5E 2PT0A 3MMAB 4URQU 4GC6A 1B64A 3CJ0A 1LWEA 2MXYA 1RT2B 3QAUA 4BA1A 2DNOA 3PFOA 1YVFA 4LVNP 4ZVTB 4CLZA 4X64I 8ATCB 2Q79A 4LF5E 1C2PA 5LL6d 3WHIA 4M95A 1EETA 1EA6A 1E6VB 3GU0A 3PNIA 3O8WA 1Y00A 4ZCLA 4BWMA 5DRQA 1RT1B 2QL9B 1OYPA 2XY5A 4A8QA 2MY8A 3TVYA 1ICEB 1U25A 2AJ0A 2L41A 5FLXU 1XHKA 2MZJA 1AROP 1OPIA 4DV5F 2AX1A 4MFBA 3T1AA 2B4UA 4JI8J 3C2PA 4RO0A 5D4LA 3UD5A 4DV1E 5L1KA 4JI3J 2PFFB 1JB0C 4DR4F 3HD2A 4N8NA 1BHNA 4BA2B 1U4BA 2MKSA 4N8OA 3MECB 1SH2A 4PPDA 2NN6A 3N01A 2FHJD 4ZA1A 1AFJA 1M5SA 4C8MA 1J5OB 2ZBRA 3SQGB 5L38A 3HT3A 1S49A 1VFJA 4LSNA 5LSLA 2RAQA 2L9WA 4ZPBA 5KFDA 1LV5A 5HLFA 3M2VB 4AE5A 5EGYA 2BA0D 1RE1B 5M2UA 2QO3A 3LP2B 5LSRA 2P2CB 3NNAA 4FNIA 4DBQA 4YHHF 4JI2E 1QAIA 2EFPA 3MAHA 1XJWB 4DV3J 4ZVPB 3T6BA 1RT7A 4JI0J 2DRAA 3OR2B 3W8GA 4I67A 2UUBI 1JLFA 1C4AA 2E5LI 4OJ1A 1FWPA 4URLA 3J7YI 5I3UB 1IJFB 2MQLA 3RRGA 1FJGJ 1RLCL 2C2OB 2KJVA 3QIPA 3R8YA 4UOHA 3ZZPA 1FJGF 1L3TA 4DV5E 5IT9Q 1JK9B 2ZH5A 4TU8A 2D74B 2CQIA 3LUYA 3MM7A 1VYAA 2VG5B 4RW4B 2BA1G 4JI4E 2F5GA 3GLJA 2EBGA 4LJMA 3QFWA 4CH7A 1U1LA 3D1QA 5D4PA 3DM2A 1FK9A 1EIYB 1LEOA 3O3LA 2JEBB 4FBTA 1S77D 4BA1B 3NWGA 2ZZMA 4NLOA 1ZYQA 1CS4B 1M0SA 2GJFA 2MKHA 2RVJA 4FKYA 1LOUA 5B0DA 1RXOB 8RUCA 3FCVA 1TQLA 3OTCA 3PJ9A 5C24A 4UZBA 1V6HA 1GAOA 2RKIA 4CH1A 1SPBP 3ZNUA 4PU9A 4CLSA 3T1YI 4QPTA 2GGPB 5KG1A 2JSXA 3TW0A 5C42A 4ECSA 3PO5A 5DNLA 4OO1F 2B5JA 5A8KB 1IBLE 2UU9E 3MEGB 3NZKA 2AYGA 2EG1A 5AJ3J 1NCLA 4J91A 1S6OA 1S1TB 4IOBA 3S7RA 3UW1A 2RRNA 3K5MA 3K5PA 4RW9B 1N6QA 4O3RA 5LOQA 2X51A 1UVLA 2LQBA 5HK4A 1MMNA 2FQQB 3IC1A 4CNYA 1RABB 3DLGA 2YPYA 1HYSA 5B0CA 1H74A 3KHLA 1UVJA 2N4CA 4O3NA 2C2KB 2KFZA 2YKOA 1NJYA 1TKDA 4HYMA 5GAHI 3G96A 3EPIA 4RWXA 2BQ3A 1R8AA 4PCQA 1WNEA 2DBBA 2WVEA 3GV7B 1HK7A 4ZVIA 3C6UB 2DY9A 4N56A 1R31A 2HQCA 3BZQA 1HPZB 2J9EA 5GMEA 4DUTA 4E98A 2AJ2A 4J90A 1KEKA 1FRXA 5CXTA 5AE3A 4PWDB 3C8YA 2LKZA 5CYMB 2QLBB 2CPXA 3OVBA 1PKUA 2M0GB 3W2VA 4F4WA 1IBMJ 1K0TA 4LFBE 2CVIA 3WX8A 3P45B 5L39A 2PI4A 2R7VA 1LK5A 3FFIA 5F8MA 1N34J 4LF8J 3DU5A 3HHLB 3BKUA 3D6TB 2V94A 3BBBA 3MM8A 4PPZA 4A8KA 3ZM7A 1GMVA 3N4WA 4OO1B 5AT1B 4DV5J 3DM2B 3DXBA 5DQGA 4F50A 1NZ0A 2IPOB 2ASDA 1UW9A 3HVTA 4MJKA 5HQLA 4BA2A 1HQEB 2RE1A 3FZ2A 3GQCA 2ALZA 5ETQA 1H2VZ 3FCHA 4ZVSB 1JJ4A 1SJRA 4DUYF 4J9VA 1C0UB 2HMIB 1GTEA 1Z5BA 2YKNA 4I2QB 4CYUB 2C1EB 4A47A 2LYVA 2WVCA 4MK8A 4NLXA 1RWUA 1H73A 4F0HA 2CNNB 3CIMA 3TZYA 2KO1A 1IWGA 3P5TL 4RR5A 4DCJB 1KFDA 2D3UA 3BBFA 3I96A 4CP5A 5HL7Q 4CM2A 1N33I 5K36D 3DHWC 3DN9A 4I0WA 1NH8A 4RUCA 4X84A 4Q8EA 1VHFA 2O67A 3ILIA 4H4OB 2BUNA 2I2YA 3BO3A 2B7BB 1T95A 1UW4A 3NAIA 2OP5A 4DJBA 2GMHA 2UV8A 3G4SS 3MD3A 1HR0J 1DAXA 2U2FA 4M63A 3W9IA 3J7YU 3M6WA 4Q0BA 4USUA 2M8HA 1UJ4A 4QBUA 3KJNB 2MLZA 3QT5A 1WC6A 3GONA 2NN6D 3SEOA 2PNZA 1GTHA 4KAIA 3H5YA 2R8IA 2V4JB 3CDUA 1H3DA 1R27B 2Y0BB 1RTIB 3ITHA 2J0QD 1ZM4A 4XDDA 1FERA 4RUHA 1S1VA 2XWXA 5L46A 4ED5A 3U1LA 1U48A 1DQ9A 3I5CA 1Q81T 4FWGA 3W5YA 3PS1A 2CQ1A 3FJ2A 3R9LA 4U6PA 1O5JA 2K8GA 2XI2A 4H4OA 2VG6B 2OMLA 3IWLA 2KFYA 3BSNA 4A4JA 1FFSB 1IKXA 5FIIA 1U1KA 4ZN1A 3HO1A 4OO1D 1VGYA 1Q7LB 1Q82T 4X66E 2DRBA 1CJKA 3CC2S 3SFGA 1RTDB 2PFDA 1TL7A 3DRSA 2F1DA 2OELA 1P6TA 1RWXB 2HS4A 3MTKA 4RBUA 4N7TA 4IZKA 4DPXA 2W4DA 4WFNQ 3MI7X 1ZAXA 4NLTA 1PBUA 2KRBA 4RUBA 4LRAA 4OZLA 4TU9A 1IBLI 1HQ2A 4GKKJ 1Y7PA 4HDHA 4O44B 2C37B 1S1XA 2DHSA 1HNZJ 2V8DA 4LR9A 1RB0A 1RAIB 2W2PP 5ETNA 4X62J 3KK2A 1UCNA 3H8YA 2VPXB 3CJ8A 4QWEA 3KJVB 3L09A 4RW8A 2FVPA 2FHOB 2A2DA 2MTLA 1FWLA 2NS1B 3MEKA 3NCRA 4H54A 4DUYJ 1KN6A 1NPKA 3L4BC 3QZ7A 2XLIA 3U1YA 4OV6A 2HBQB 2ZJQQ 2X1FA 2WNRA 3G82B 2NREA 3NMAA 1QUVA 3CSKA 5KT4A 2XLJA 3ET6A 3OW2R 1H98A 3GIIA 2K1RB 3VZIA 4Q8FA 2G1DA 4DV1F 1RTJB 3A12A 1TVRA 5KFTA 4DV5I 2W4CA 3H25A 3KNGA 4USIA 2UUBJ 1QD1A 3OBIA 2IOQA 3BB5A 1A9NB 2H5EA 3W9HA 1N34I 1NPRA 1SB6A 2GMLA 3D0HE 5G0RA 3FSYA 4F4YA 3M7VA 2HFZA 2MZQA 1N6QB 1IKVA 1RA7A 4JI7E 1FT8A 2YWWA 3DOKB 2CZVC 3GFHA 1RZMA 2RT3A 1HNZE 2DITA 3D66A 4EYHB 4ILMA 1UMJA 1B4SA 3KKFA 4J37A 2Z56B 3THPA 4PRFA 4F02A 2Q43A 2VFRA 1ROFA 3T1YE 4L75A 1F9EB 3UCUP 1T02A 1IQZA 2KH9A 1Z1ZA 3GFYA 3HVRA 5K36F 1KS2A 2MKYA 4LF8E 4ED3A 3TARA 5GMKa 1R8HA 2C3PA 3US5A 4FWHA 2O3ZA 1UA0A 5KFHA 1USVA 2IRYA 5THWA 4KH0B 4HI1A 5EL9A 1GX5A 4DUZI 4DR4E 2V6AA 4KGKA 4C3LA 3KYLA 2W9AA 1NK7A 4HHHA 4UUWA 4K4YA 2QEXS 2ZNYA 3B54A 5B08A 2FVQA 1BWVA 4C8LA 1LW2A 3IXQA 3UN3A 2QN6B 3MDFA 1EQ0A 2FC9A 1RKJA 4TKTA 3HT0A 2I0XA 2OPQB 5J2QB 1X9SA 5D4OA 1WTBA 3LP1B 3AHPA 1N56A 1RT2A 3AQPA 1RJJA 1MW7A 5ETKA 4ERDA 3Q2SC 3LNUA 4EK2A 2EI5A 2VHGA 4YB5A 4GRSA 4ZP6A 3MR7A 2HHWA 4PUOB 3PS3A 5BR8I 3CCES 4X4OA 4ICLB 2HWHA 4ETXA 1RWOB 1TR0A 1FX4A 1U2CA 3CE8A 3BQ2A 2VA2A 2HVZA 2BE7D 2JX2A 2RRBA 3HVAA 4GVLA 5HVFA 5DETA 3V81A 4K0KJ 1S9GA 2OPPB 3BF4A 5E3RA 3Q22A 5D8HB 3K2YA 1CLFA 4F25A 3DI6A 3H5UA 5IZHA 1LWFA 2BACA 2C3MA 2OPQA 3MEDB 5E0OA 5J2QA 2R7TA 4DSEA 4RZRA 3M8SA 1JXVA 4B02A 3OR1A 3KLFB 3KK1A 5F8NA 2HVDA 4QQBA 1Z59A 2M70A 3Q1QA 4LRCA 3THVA 2UUBF 2EKYA 4IRDA 4JV1A 4IZKB 4YB1P 4B9MA 4EBCA 1RHRB 2AGQA 3KLIA 2F4VJ 2UXCJ 1X9WA 5DZ6A 3QAEA 3DOMB 3CCVS 1FKPB 4CCHA 2XMAA 3CMAS 2UUCF 4FW5A 1KVKA 1G1XA 4LCGA 4X4NA 4DFJA 4CRJA 1HI1A 2MYFA 4KHPE 2DNYA 1EETB 2DHHA 2EXUA 4LSLA 2DXFA 4CH0S 3O6QA 4G65A 1FRLA 4JI3F 3MAQA 4NXMI 4C3KA 2HHVA 1UEVA 2H9ZA 2ZBPA 3MM9A 2ZH4A 1FNMA 1RI7A 4R1FA 4F4AA 1KDNA 1WD6A 2MQNA 3DC2A 3R27A 4ZVEA 3P6YC 2HG4A 5KFMA 1U26A 1B99A 3DKDA 5KFRA 7FD1A 4OL8A 1SXLA 2AQ4A 1NK6A 2C2NA 4X62E 1REVA 1YZ6A 1PAEX 1WACA 2HSEB 2HLTA 4WFBQ 3D2WA 4J9PA 2RRAA 2OTLS 2FJEB 2ILZA 4YR2A 2GVZA 3PCOB 4JI5F 3FBCA 4NLUA 4RU9A 3CUNA 4OQJA 2AMCB 1FKOA 1T0TV 2J0XA 4RW7A 1IBCB 2E5JA 2HQDA 2DH7A 2NXEA 3DMJB 3MPVA 3PYFA 2C39A 3ZZUA 3LP0B 3J7ZT 2KZZA 2WRMA 3DRRB 2PGCA 4DLEA 2CG8A 4M5DB 2O1TA 3TZWA 4P9SA 2KXNB 2RH3A 2E7VA 3K5OA 3FQLA 2JZ5A 1LWFB 4B9TA 1UVIA 4RW8B 4WCEQ 3RB4A 1IR2A 2HHSA 3D9BA 4ISAA 3NRBA 1GEHA 1CQNA 1MN9A 3PEJA 4ZIWA 2JWNA 1DHMA 1MU2A 2B6AB 2VQFJ 4ECRA 2Y9HA 4X62F 2QFJA 4M5LA 2KVQE 3T19A 5IM0A 2DGXA 3M8QA 4LF4I 1RT4A 4NE9C 3I9V9 3T5LA 4C48A 3PHEA 1ZH5A 2DGWA 2ILYA 1NB2A 2M7SA 4A48A 5GADU 4DR3I 3CCLS 5A6PA 4UQTA 3FNNA 2MSSA 2ZC4A 2R9LA 4DR3J 1N5YA 1U0SA 2U1AA 1Q86T 2NR0A 3DOKA 2E29A 4KHPI 2YNHB 2KN4A 3L7OA 3SZ2A 3TAQA 1GK8A 3HZGA 2PSZA 3GE9A 1H7XA 1CEZA 1H0HB 2UUCE 2FB0A 1SIZA 1X5PA 3HHDA 1U8WA 1WF2A 2EBEA 3RGIA 1X4AA 4P72A 4W92B 4DUYI 1T3NA 2DPJA 4C8YA 3KG1A 1WC4A 2HRTA 2MMYA 4UOCA 5IC4B 4ECUA 5I42A 2CDRB 4B3ME 2B5JB 2JJ4D 2VH7A 3A8KA 3QGPA 2RUGA 1Q8IA 3EX7B 1YJTA 1QSSA 1W26A 3C15A 4GKJF 2QSFA 1NLKL 1PBAA 1GFWB 3PIPQ 1Y4ZB 1X0FA 1V5IB 2VB6A 3NY0A 1VRUB 3W5ZA 2QJ3A 3OFFA 2KHCA 2LDIA 3AJ2A 1SJFA 3OXFA 4UOFA 5C2GA 4DUYE 1WG5A 3SV4A 5E7OB 1FCAA 5BYSA 3LTOA 1MG7A 2VC0A 3TUJC 1CJKB 2RU3A 2J6UA 1VQ6S 2CGEA 4S0MA 1IM4A 2OI2A 3BGRA 2N82B 1N54B 2GQ2A 4DSLA 2I5JA 3FEYB 1BMQB 5E3AA 2APOA 2E5LE 3ZZRA 1TK8A 2Y0SD 2ZWOA 1Q1KA 2HPUA 3NP5A 1ZZNA 3N5BA 3UN2A 4BBYA 5C2CA 4NXNJ 2LXFA 4RL1A 2GW8A 4ALZA 4J9MA 4DV4J 4KJIA 3NEKA 1R89A 4PXDA 3T9NA 5D77A 2VBXA 3ZO7A 1OSCA 1UWAA 4LIRA 5F3ZA 1S0NA 3VAKA 4G1QB 3DLBA 1A0OB 2VFUA 3MM8B 2QE5A 4DX8H 4JV5F 2HRUA 3LOUA 1RAAB 3PW2A 1TL1B 1RAEB 2Z2MA 3AJ1A 3BH7B 3HVWA 3R7BB 5J1EB 1BUXA 2BKPA 1XEZA 2IJRA 3N6MA 3VQTA 2G1HA 4MK7A 4KY3A 3LH2S 1UFWA 4TYAA 4C0BA 4ED0A 3T3FA 1IBMF 2FJDB 2XHCA 3J81U 3NS7B 4LFAJ 4WFXA 4IO9Q 5ETVA 4DV7I 4HR2A 2Z2LA 3V5RA 4UT4A 3RBXA 5A2QY 1WEXA 3R5JB 2Q6BA 4Y3CA 2CIMA 3UDLA 1U02A 5IT0A 3CJRA 4WYWA 3L95X 4IQXA 2UXBF 1HHTP 3TQ1A 3WZ0A 3LP1A 2C2RA 2XY6A 4NA1A 2X3GA 5H9EK 1IKVB 4G6VB 2HHHI 1K8AT 3TVZA 3T1HE 1WORA 5FDLB 1P1TA 1VQ5S 1RTHA 1P9YA 4P74A 3MMBB 1Q7YT 5BYQA 5KT7A 5F0UA 1WELA 6AT1B 3DLEB 3F0NA 4IZJA 4LF5I 2J0WA 5IXUA 2UXCI 4FYWB 4U7UK 2BE2B 4O3OA 1OJ4A 4IFVB 3VGVA 4DL0C 2EFNA 1T05A 4JV5I 1IBLF 1RTIA 1JLFB 2DO4A 1N33F 2FJBB 2BW7A 2OFGX 2VBYA 4PXCA 5K8MA 1URRA 3HVTB 4AQYI 2XYGB 5MAOA 4KO0B 5KFWA 3T1YF 4LUBA 4ZN3A 4ZP9A 2G2YA 2FZKB 1EX8A 2GHWA 1U6ZA 3OSNA 2H5IB 4MYTA 2NXCA 1T7PA 2C38A 3PJXA 1Q0NA 2YWGA 4AYBD 2HZVA 3DLLQ 3CDJA 3DRSB 3PDNA 2QA4S 3GIKA 1RWVB 2NSCA 1NK5A 1HQUB 1NB7A 1Z0GA 3H2LA 1N52B 1FK9B 4L72B 4NCAA 3CDIA 2ZVSA 2QC3A 2R8HA 4DSFA 5C0XC 5SUHA 4C2MA 3D6HB 3HD1A 1U6FA 3IR5B 4RNMA 2OH2A 3LO3A 4B3RI 4LF7J 3IR6B 1PJ5A 2YNFA 3ENQA 4NYOA 1RGVA 1S7HA 1BQNB 1PJ6A 2FC8A 4RNHA 1LXJA 4QNJA 2ZBQA 4OO1C 2HBYB 3BM7A 1DLOA 3OVAA 1RWNB 3M8QB 3QLHA 1K1QA 1RISA 3K8WA 3SCKE 3BGUA 1D0EA 3KG4A 3C14A 4RNFA 4UW2A 1IBKE 5K14B 4WPAA 1XMQE 3JAMQ 2UUTA 1D8ZA 4K0KI 3VALA 1MROA 3KLGA 1UFKA 1S79A 1DURA 2V50A 4JI4J 1XMQF 1VJQA 1CJUB 2NPFA 3NL0A 4DV2F 2DY1A 3KJQB 2O5DA 5RUBA 4OI0A 5DRRA 3K8VA 4NA2A 1YH8A 2ZD1B 4DR5I 5SZTA 1KTVA 2QV6A 3KLVA 2UUAJ 4DR2E 5A76A 2CZ4A 2NN6E 1DQAA 4C0OC 5KFJA 4NPOA 2JVOA 5ETPA 2BOPA 2G4BA 1UDNA 3OUYA 4IKAA 3D6MB 5C0XD 2VD3A 1R7IA 2FGCA 3H7HB 4OLOA 2QG9B 2BJ7A 2W2NP 1RAHB 2YX4A 3M05A 1HWUA 2IAJB 1CBKA 5G4DA 4JI0F 5HQMA 3Q8SB 2C2EA 2UU9J 5D4NA 2JEJA 4WZQA 1HNWJ 2EFQA 3LPYA 2HWIA 3W60A 1R8BA 3HCXA 2O01C 2JEAA 2DGTA 1PO6A 1FNXH 4HKQA 5KT5A 4OO1A 4E8UA 1S4FA 2LEPA 4O4GB 1U1MA 3EDQB 2MEWA 1UWBA 2DCLA 1ZPWX 1KLNA 1LK7A 3GJQB 4NLGA 1RBAA 2D3OR 3ZTPA 1JNRB 5EWEA 3RBEA 3OR2A 1VLOA 2HEKA 2JT2A 3HLUA 1NNDA 2BZ2A 5B0GA 4WIIA 3KK3A 1QM9A 4ANCA 1KNZA 1RHYA 2HHPA 3JSMA 1YX2A 4JI6F 1WI6A 2F4FA 4JI3I 3EE3A 3DOMA 3IWXA 4JV5J 5KFPA 1FE4A 4NLVA 2MKCA 4YP3A 2KRRA 4DR3E 5IT9Y 5F0WA 4YN3B 1TL7B 4LF5J 2VODA 3C14B 4R8UA 2BVZA 5G0RB 4PWDA 1B0PA 1HNXI 3EZOA 3HHKA 2FDNA 2IM0A 1SUQA 4KR0B 3K58A 4M5HA 3C6UA 3W66A 4AFFA 3FDSA 4F4ZA 2NYIA 2ASJA 1DTTA 1E6YB 2P9CA 3TJAA 3BDPA 5A2QQ 3BKFA 4F36A 1R8PA 1TV6A 2HFOA 3SFUA 2IM1A 5EWGA 2EPIA 1YRTA 1HW9A 2MQMA 2XO6A 1SKRA 2K7JA 3R5CA 2VONA 3DOLA 5IFMA 2BR2B 1RAJA 1DFDA 5KAKA 1V9OA 1HLWA 2ABYA 2B43A 1A7GE 2BJ9A 2NXUA 4DV3I 4R0EA 4I6WA 4XPEA 3BGRB 4DX7A 2GAGC 3H98A 3H40A 3IGNA 1T9TA 2HNYB 3MCSA 4NZ7A 4NXMF 3MPDA 4QW8A 3BYPA 4B17A 4LF5F 1IBKI 2MY7A 3OLBA 3DLKA 3KOAA 1LWEB 1JJHA 2ZOGA 4HHUA 4GKJE 4Y0FA 2IDLA 1HBNB 2WONB 4CDIA 2YWFA 4OX9J 4ED2A 4PG4A 4HEA9 4C6AA 1EI1A 2NZ4A 4L76A 2VPWB 5KFIA 5D6GA 2UVVA 1LW2B 3QLHB 4PWWA 4LSZB 1S76D 4DV7E 3G86A 1NXIA 3GILA 2I8EA 4Y2IA 2HWTA 2HQFA 4P7TA 4XDCA 2ROPA 1JQGA 4DI6A 2W9CB 3GIJA 1HA1A 2WVBA 2YQ3A 1H2TZ 1FKAF 4I68A 1FFGB 2GHPA 1F3FA 2ATCB 5ETRA 2CQ0A 4J9UE 4Q2MA 4B3OB 4B3SE 1ZXNA 4CLFA 2DT9A 4LF6E 2MLYA 4MU1A 5CAAA 2JRSA 1UPPA 3P3DA 4DUZE 3HHLA 4ES1A 1N5YB 2PO1B 2PC6A 4RJVA 4AXJA 2ZKTA 1GXUA 1TKXB 1MWZA 1Y0HA 3AY0A 5I3QA 5B7WA 5L3JA 3TUIC 4C8ZA 4JV5E 1RT3A 1S7IA 3G87A 4DQPA 4FW4A 1NAQA 3DD6A 3R3TA 2FZCB 4Y65A 2UXDJ 2DNZA 2IMWP 2XMUA 5J2MB 4QW9A 2GO8A 4FF4A 2XBPA 3C6TA 4CZCA 3ENAA 2BKNA 4NCGA 4JI4F 4O4GA 2FY1A 2IA6A 4IZJB 1X7VA 2X3DA 4P2XA 4F26A 1RTDA 1P42A 4DFKA 2KYXA 2WSFC 3M4XA 2IYGA 1VMBA 3R5BA 4I4BA 5KG6A 1OIAA 5HSPA 3EXCX 1HNXE 4JI7F 1LWCB 4ZJQA 2GO9A 4HTIA 6FDRA 3K1JA 4KPCA 2Q66A 2YQ1A 1UA1A 3T6JA 4ER8A 2JH3A 4DV0I 4A8FA 3POTA 4OJ3A 4QR0A 3RB0A 1M5VC 5ELWA 3WU4A 2HS0A 1F5CA 1SBRA 2PIIA 5J2NA 2QMXA 2N4DA 1X0PA 3EM1A 4IO1A 3MEGA 4D3HA 1TAUA 1USUA 5AJ3F 1QE1B 4KIAA 5E2QA 5KTQA 2ERRA 5KFFA 2GGPA 4KHMA 1TFYA 5A2QU 3WC2A 4U8YA 2V9WA 4B3TE 5KFUA 2D3O1 1I94J 4ATNA 1I51B 5F8IA 5C0XF 2HHTA 2JFDA 4OX8A 1FRMA 2IBOA 1UETA 1O0PA 2D69A 2VQFF 1S0VA 2XMKA 3A13A 4CO3A 4CTAB 2CJQA 4DR2I 2HFUA 1YHCA 1XNQI 3U7JA 7AT1B 4F3OA 4IFDD 1Y5LB 4LCHA 1N34E 4DX6A 3MWBA 4PG8A 2FVCA 4FVCA 1D8YA 4OZ5A 4DX5A 4JI1J 2CPYA 5FD1A 4A8MP 2KU7A 1RAFB 3UVJA 2BDPA 1DLOB 1BLUA 3VV2B 4PKDB 2NLWA 2AEMA 1YBAA 3AA9A 2X1BA 4IFVA 5AXLA 1SKSA 1KHVA 2IBKA 1NMEB 1U0HA 3KUHA 2JLEA 2UXCF 3D68A 3UWTA 1S9EB 1GXLA 1UAWA 2CPFA 2AEJA 3BN4A 4DUZJ 4DV3E 4N47A 3W2WB 1YJNS 3DNCA 1ZM9A 3LANA 2GQCA 5M2RA 3IBFB 3PKYA 2GIFA 1JJ2R 1SIWB 2J6SA 2AF6A 4MU4A 1HWKA 2R2UA 2CPIA 2B51A 4LF9F 3H5SA 2DPIA 2J6TA 5B09A 8AT1B 4EO8A 1ZM2A 4PXBA 2RS8A 2ZBKB 4DR4I 3D0IE 4OI6A 2KL8A 1NHKL 1ZXMA 2PA8D 2JEGA 4Z7YA 5D3GB 2PNLA 1U8SA 1N32I 2XZWA 1I5OB 4AT1B 2HGMA 3PYGA 4B3OA 3UDCA 1L3SA 3DOLB 2BR2A 3E3XA 1I94I 4WKRA 4LFBI 2A2CA 2IMOA 2XEXA 3CO9A 3FRZA 1OQ6A 5J2NB 1TV6B 2B56A 3ZTRA 2FJXA 3MTJA 4MIBA 1MNEA 4QWAA 4GKJJ 2RS2A 4DR1F 4KPYA 3T41A 4DFPA 1VIOA 1HBOA 1MLAA 3CJ5A 4DV1I 4LF7F 2BQUA 4LVOP 4WWSA 4R5PB 1T9YA 4DR1E 5L8RC 2V2VA 5LXRA 1Z2ZA 1SKUB 4L73A 1M1HA 1NRKA 4F2RA 4WTOB 3EDRB 1R43A 4ZDNA 2NSBA 3ILOA 1KC8T 1KVJA 1BY9A 2F7VA 4LF7I 2XULA 1C1BA 3DXSX 3IAM9 1WC1A 2R7WA 3RAXA 4IR9A 5AE1A 4X65F 3V4MA 4AXIA 4YFUA 3Q0AA 3AT1B 2YWKA 1N5QA 3BR9A 3MM5B 5A8KA 2V69A 4DL3A 4NXNE 2OSQA 3H2VE 2V4JA 4LF6J 3IM9A 3PVXA 4JYAJ 3KLHA 4B3SJ 5D0RA 1MWQA 2NCKL 2OLWA 4K4XA 3EWGA 3VZHA 2CJKA 3MMJA 1S48A 4LFCF 4NZ6A 2MKJA 1DTTB 3DLEA 4CLKA 3RBZA 2CNOB 4X2BA 3CWVA 2V67A 4RNNA 3G8SA 3RG6A 3TA1A 3A8EA 1X4DA 1RWMB 3GFZA 1OPZA 5B0BA 1QVGR 1IKWB 3GG0A 2G9OA 1WG1A 5DQIA 4R25A 2AZ1A 4ZLNA 3RBDA 2IESA 2Q2EB 5IT4A 3OXLA 4X4PA 3BQ1A 4KV8B 2VQEF 1ZTWA 2DNNA 1M1KT 1PYTA 1URNA 4KGVB 2N7CA 1N36J 2XCPA 2CDQA 1K44A 3X3UA 3MFIA 2PO2A 5JEAD 4BC7A 4OHWA 1RHMB 1HBMB 3V6HA 1RLDA 2CKWA 5GADI 2W9BA 4DPUA 1JX4A 3P8BB 3PRYA 3DFEA 3ZXWA 4Q43A 4ED8A 3MCOA 2BJ8A 3VAFA 2RQMA 4I1TA 3DI6B 1SV5A 4CLUA 3KJVA 1S1TA 4FYYB 2C2MB 3MHYA 2UXDI 2YKMB 1XC9A 2RB7A 3QJPA 4RBVA 4JI6J 2PMZD 5HBMA 1OS5A 1TL3A 2RD5C 4NRUA 4YY3F 2ZZNA 4DV7J 4O3SA 3PV8A 2CQCA 2DNQA 1HBMA 4HY1A 3GMEA 4I3HA 5I42B 3QYYA 2XMTA 4L74A 4DR6J 2WBRA 3CPWR 3TP2A 3IO1A 4W98A 4MDTA 5LMUE 1NU4A 2LECA 4DL7A 1AFIA 4ECZA 4OHYA 1S6QA 2AJQA 3L3CA 3AOBA 5JMNA 5HBMB 4OV1A 1UJ6A 3R5AA 4CQ1A 1TL4A 3VHQA 4YOEA 3FFIB 2C38B 2F63A 1S9GB 1WTFA 2OPPA 3FMBA 1SI9A 4DPOA 1NPPA 4OYPA 2GJIA 1FDBA 3KK2B 2DIUA 2R7QA 5E41A 4DL4A 3ITHB 5BR8E 4DF8A 3KDOA 1Q5VA 1QAXA 1REVB 1L5UA 3G9CA 1XXEA 1OYEA 1PJ7A 2HMIA 3I0RA 2VG7B 3HZEA 3UDVA 4FW7A 1PYOB 1VBZA 1F60B 3C19A 2FTRA 5DQHA 1ACMB 4JI5I 3NLCA 4TYBA 3OT9A 1XMOE 2QA1A 2YX7A 5LMNI 2FLOA 3KLIB 1RCXB 2BMBA 5CABA 1XMOF 1UVMA 1RHQB 2B4VA 4IRKA 4LFAI 1MWYA 1FKAE 3AA8A 1HMVA 1VLYA 1FI4A 3CC7S 3K85A 1S6PA 3D3BJ 2V5HG 4LF1A 3H5XA 3OTEA 4EI2A 4J9SA 1F3VA 1TP7A 1Y5NB 2CQHA 2PMHA 4DR7J 2K3IA 3PS2A 2M9KA 3ILLA 3ISNC 1RWWB 5CYQB 5U47A 2JLGA 5DS7A 1REGX 1OMSA 3PX0A 2FVSA 2R7OA 2HAIA 1PCAA 2RJZA 3QATA 4IH5A 1YLXA 4Y2CA 3KK3B 3FSIA 4JI2F 3PR5B 4P2SA 1WI8A 4LQ9A 2ZJRQ 4KHPJ 2Z30B 3GP9A 2DEJA 2J5AA 4CWBA 4HHJA 1LW0A 1RU2A 2Y3YA 4P52A 3ZZZA 2HHXA 3W61A 5JVGQ 2ZWPA 1ITPA 4KBIA 4DG1B 3HHLD 4FPIA 4U95A 1HHSA 2DXDA 2P6SA 3LGHA 3E51A 4FW6A 1VCTA 2LVWA 4ED6A 3GCWP 3MMBA 2AYEA 1GX6A 2ZDOA 3QO9A 1H7SA 1CG2A 1YKWA 4ED4A 3MM7B 4RW4A 4DV2J 1ZM3A 4FXVA 3I9ZA 5F3TA 1ELOA 2BE2A 2EFOA 2VKRA 2XG8A 3Q8YA 4TN2A 3FMWA 4WP8A 4Q44A 1YJ7A 2DO0A 5LSOA 1FJ7A 2UXBI 5CZVA 9RUBA 2DKOB 1EAYC 1RWKB 4ZPVR 4N5SA 4EUVA 4U3DA 1FXDA 3QBCA 1PC4A 2AIRB 3Q8PB 2HBZB 5KG2A 2V4RA 1IKYB 3QWPA 3F44A 3VGSA 4ZOSA 4DV6F 1X4BA 4ZVOB 2JEIA 2C3UA 2WONA 3WDOA 4JI0I 3BREA 3M2VA 4DV1J 1YJ9S 2KM8C 1I3OB 3B4DA 1GMWA 4LF8F 1NSQA 2A6OA 1KQGB 2Y8WA 1UDOA 1JLEA 2UXBE 2H3EB 4ID5B 1F0XA 1VBXA 4ZVHA 2UUBE 4X66I 1NZAA 5DDOC 2DGUA 3DHXA 4DR5F 5EKWA 3CDAA 3MUMP 3OJUA 2IOPA 3VTIA 4M5GA 2PO2B 1MMLA 1TVRB 4M5KA 3G6VA 2NQPA 1JKHB 3TUPA 4JYAI 3SCLE 3S8SA 3FEZA 3GG1A 3SDEA 2BA1D 4HT7A 2GO3A 5K36B 1YG0A 4WU2A 3PYEA 3CNQP 1NKCA 3M8PA 1MSWD 2YY3A 4F0MA 3GIMA 3KFWX 5L1LA 3OSPA 2WOMA 3UNGC 3ZZTA 1MX0A 2ZH6A 1KLMB 1VQNS 2ZE2B 1NJIT 2W8LA 4XTTA 3K5NA 3RTVA 2J7WA 2KXHA 3JQJA 2GS8A 4LQ3A 3FSXA 3PRVA 2UUAE 2C37A 1SKWA 3FC9A 4DS4A 3CDEA 2OFHX 4H4KA 4K7QA 1UDQA 2XM3A 2QTWA 4DR3F 2Z5BA 2CZ9A 2DNHA 1BQMA 2IVMA 2DTJA 4HLBA 5D0GA 3PR4A 4EZ6A 5IOLA 1A6FA 3RW6A 2RF2B 3BDEA 2E5LJ 1XBWA 1VRTA 2IC3A 5A8WB 4M94A 2GMJA 3R7NB 1X4HA 5E3CA 4DFMA 1D09B 1UKUA 2IVFB 3M6VA 2HFNA 3R5GA 1BD6A 1UTAA 2B9WA 3G6XA 4LFAF 1IKXB 3ZFVA 4BLGA 4USVA 3D54A 3P4UB 4B3MF 1FXLA 1XR7A 1FKPA 4TY9A 4UY8T 2DNMA 2L48A 4OMFG 2CJYB 5KFLA 3GLLA 4ETZA 4OYBA 4Q45A 2MLXA 4HL9A 3ZZOA 2CQBA 2C22A 3Q2TC 4UTGA 3Q23A 1HNXJ 5KT3A 1OWXA 1RU1A 2FGOA 1D6TA 2KDOA 1VR6A 1S10A 3H4DA 2AJ4A 1ZOTA 2HHHF 1HL6A 1SC1B 3VF0B 3MEEA 3FZBA 5ITHA 3MURP 1VQ9S 1WHXA 3MMAA 3Q8VA 1PG5B 4XAKA 3E01B 1S1VB 1U09A 5E5NA 4FDFA 2VJUA 2VOOA 1RAOA 4JB8B 1HBUA 2M3DA 4RPFA 3H2UB 2OHDA 3MR6A 1U1RA 5L1IA 1NKBA 3GJTB 1RCOB 3TNVA 4C0HA 3V6KA 1KOHA 5J1NA 3Q6MA 3LQVA 2HGLA 4USKA 2UXDF 4K2JA 1OYRA 5CH7B 2DNLA 2BA0G 4TLQA 1C1BB 1HD0A 2AT1B 2ALYB 3QQCD 4PYAA 4URSA 5DGBA 1X9MA 5B0EA 4CO4A 1S99A 3HI9A 2RDDA 1XMBA 4J9NA 4HACA 5KFYA 4NBQA 3WU5A 3DYAA 2DRDA 2DJWA 5AXMA 4CNZA 3I56S 3RAQA 1UDSA 4OJGA 2Z0GA 3OFGA 3QPIA 4J9OA 2AP6A 3UN5A 4ZS6A 1VRTB 2DGQA 2IC3B 3TAMA 3BJYA 4X64J 3M6XA 2RSQA 2HHHJ 1U49A 3H59A 1VQ8S 2J0SD 1QTNB 1ZPVA 1VRUA 3SQGA 3CCMS 3PX4A 5CYMA 5I4MA 4ECVA 2O1WA 2B3TB 4N41A 2JEFA 2DIVA 4TXSA 4LFCE 5C42B 2GIRA 4C11B 2GVDA 3HDSA 1OY8A 3JS9A 3QIDA 4DV0E 1RWPB 4DV2I 2IM2A 4ECXA 2DGVA 1XMOJ 2OO4A 2M5YA 1KD1T 3GCMA 4I2PA 2XY7A 5I3PA 5DGAA 2ZH9A 1GT8A 2CYYA 1RDRA 4QIWD 4ES3A 4LFBF 4JI4I 1X4GA 1ZA1B 3ONQA 5F8HA 5IWAI 3KWMA 4OIXA 3S6EA 2PDAA 1FWKA 3DRRA 1B3TA 2XS7A 3CJTA 3NOGA 2POKA 4OX7A 2IRXA 4PZVA 4FVMA 3VCDA 2XS2A 2ZOMA 1NSAA 2IA0A 3I32A 5HMXA 4DWIA 2O1PA 3W64A 1AZSB 2BEFA 1N48A 2E7WA 1DQ8A 1H7UA 4EBDA 1HNVA 1NH7A 1CULB 2ZUAA 3M8YA 3RW7A 1YRXA 4M5NA 2UU9F 2LFVA 1H2UX 3IM8A 5J2MA 2FHKA 4CT9A 2K2PA 3CCRS 1HI0P 4EU0A 2NYHA 4DR1J 2PNZB 1R6VA 1TTHB 3CEDA 3IAS9 1QJHA 4PYDA 3M85G 2VZ9A 2VA3A 3LP2A 5KG4A 1MN7A 2A3JA 3IRXB 2DGSA 3BPDA 1DBDA 2G0CA 3VVTA 4KC5A 1JLQA 3IP0A 3Q8UA 5H9FJ 1NJZA 1S72S 3CJKA 2QFIA 1FNOA 2B8QA 1B0TA 1VQ4S 5AXNA 1N32E 3NGSA 2K06A 1FD8A 2OEKA 4ZPAA 3AB4B 3OL8A 1S6QB 1JLBB 2LDYA 4HT5A 1WDDA 2EKNA 4ZVGA 3A1YG 3RB3A 1KQSR 1N32F 4LF4F 3OVSA 1HWLA 3J80C 2JHEA 4EFAC 4U96A 2CA9A 4WP3A 4JI5J 4UF4A 4O4RA 1H38A 4NI2A 4C98A 4PQUA 3TOQA 1U1NA 2LU2A 1S9FA 3QSIA 3CWJA 4X64E 1NKEA 3IG1B 2DNGA 1VK8A 3ICLA 5K5MA 3GYGA 4ZK7M 2QLJB 4AQYE 4F04B 4MMOA 4DR1I 2IHR1 4ID5A 1Z4UA 2WBMA 1FX2A 4QR2A 3P49B 3HKMA 2Z4PA 2LEAA 2C3YA 3EUNA 3L7PA 3P5BP 5MLCV 4BS2A 2VQEE 4OO1E 1K1SA 4DV0J 3J81Q 4DV0F 3MR3A 5HP1B 2B9XA 2OTJS 1ZA2B 4DSIA 3CDWA 2VF3A 1MU5A 3I0SA 1RT4B 4DQIA 1FDNA 2W24A 2QYCA 4JI6I 4NRTA 4OZNA 4DL6A 2BJDA 3UO0A 4ANDA 1TKZB 1WOSA 3D5MA 5L9XA 1YJVA 2R8JA 5E33A 3I55S 2LJPA 2YNGB 3O2IA 1CULA 1WF1A 4YR3A 1GMWD 2GHVC 3QT7A 4AIDA 1HW8A 1S1WA 1UL3A 1X4CA 3HX9A 3FCWA 3FVYA 1E6YA 2ZE2A 3POTB 2HAFA 4HH1A 4KGMA 1FRHA 4USTA 3KHGA 2FLLA 2M8DB 1B62A 4QNKA 3CB4A 4V19J 4ZVFA 1D3WA 3C16A 2HHQA 2HKJA 2L08A 4KFBA 4QWBA 2B9YA 4FW9A 4MU3A 1H72C 2KTQA 4X4TA 3G8TA 4DR4J 3N28A 3FGVA 3HF5A 1H6KX 2VV5A 1WF0A 2Z57B 4OZ2A 2MHNA 4I7FA 3CJ2A 2A1BA 1NDKA 4JI2I 4I56A 3C15B 1TMJA 4YR0A 5IQ6A 4BDPA 2LXUA 5B0FA 4J3DA 2IRUA 3DRPB 3KUEA 2DHGA 2M88A 4TNOA 3MCNA 1RT6B 2CQPA 2FIUA 3TZXA 2R7XA 1T3OA 2AX0A 1S5ZA 1APSA 1UFLA 3JTNA 3MAAA 2NPIA 7FDRA 4EBEA 1ZAWA 1KBRA 4DR7F 3U02A 4JG4A 5DROA 1XNQE 1VISA 2BM1A 2R42A 3HHLC 2X36A 1J5EE 2CJ9A 2FHJA 1X8DA 1KHWA 1S6PB 2CADA 3NCQA 1X60A 3Q89A 1KQFB 5CD4H 1D9FA 1JJCB 2V8PA 2XMJA 2FVRA 2EEYA 2RDIA 3PRDA 4YHHE 4X66F 1TFWA 1Z0EA 1CSJA 1YRUA 5K8NA 5CYQA 5ETMA 4XO0A 4PG6A 4MFBB 4ZLPA 1XMOI 3D28A 2J76E 5F9NA 2UV8G 2J7UA 2CQ4A 3J81j 1TKZA 3A8IA 2DISA 3UCGA 3Q8RB 2GQQA 3QT8A 5KFXA 3MMCB 1QSYA 3IMQJ 1JLBA 1HBUB 1U6BA 4USMA 2MDAA 3LALA 2AU0A 3KTQA 1BKNA 3IBCB 2GX8A 2N3OA 1DRZA 2QL7B 2ROGA 3PHTA 4ECYA 3EGZA 2KVIA 2ZDPA 2IJNA 2WCXA 4KH1B 1RACB 2QA4G 1V3SA 2HGNA 3HKWA 4H4MB 5HMZA 3OTOF 1WC5A 2C2DA 5KG7A 4DR6I 3NOCA 2Z5CA 1NDCA 3JSYA 1Y3KA 4QIFA 1IBKF 4LFAE 4RBTA 3QSYB 1P1LA 2HURA 1VHIA 3W62A 4B3RE 4M5IA 1NJWA 3OJSA 2E5GA 3UDEA 3NGRA 4DR6F 4DLGA 2BYCA 3K7RA 4DQQA 3QGIA 3TAMB 2D7SA 3AB2B 4NWBA 1C0UA 2CPEA 4WIQA 3TAPA 2GJ2A 2VUGA 5T7LB 3GJSB 4C7QA 4CLYA 3M2RA 3SIPB 1GH8A 4M5DA 2AGOA 2BQRA 4RW6B 4LF4E 1EHWA 3M30A 1G3OA 2MJUA 4WYLA 1X4EA 1RUSA 3MM6A 4USWA 4NASA 2GZOA 2UUWA 2BE9B 2W7AA 2ZFHA 4IDKA 4J9KA 4GVBA 1FESA 2W25A 4IOAQ 2NZCA 2RF2A 1AXQA 2OGUA 1Q79A 2VDHA 2ZUGA 3UI3A 3PZPA 4FF3A 4QU6A 1FTRA 5A6WA 4WKYA 1SJQA 2CPHA 2Y1RI 1CC7A 4B9UA 2AV5A 1N88A 1S1XB 1P9QC 5LJ5Y 2MQQA 5GAGI 3U1KA 1RA6A 2CUYA 3IFEA 1NHJA 2ROEA 3CCWA 4NMLA 2VPYB 1KFSA 3P76A 1NK4A 1D1UA 3R2CJ 4ZHRB 4U9RA 5HLFB 9ATCB 3M9OB 2O3DA 3TJ9A 1RHJB 4IOCQ 2MJNA 2ZNZA 5LMNF 4WP9A 4KV8A 3NGDA 1NHIA 4LF9I 3DU6A 4L3NA 3VVUA 3TX8A 1LNQA 4ECQA 1S16A 1WKKA 4OYMA 1NSPA 4DR2J 2LCWA 1C0TB 1FE0A 5DLGA 4WFAQ 3GCXP 1S0OA 3CULA 4B9SA 4B9VA 1X4FA 2LQ9A 4HVZA 3DGVA 4XPCA 2V34A 4TU7A 3OQ2A 3RR7A 1VQSA 4ELTA 1J2VA 1W7WA 3LPEA 1S12A 2WTFA 2XLKA 4HTJA 1IM6A 2E66A 1NK0A 3LWMA 4B9LA 3JTPA 2KG0A 4IH6A 1EQMA 1FDDA 2QLWA 4NMXA 3RJMB 4ZIVA 3FEXB 1JXLA 3QRPA 2H48B 2UVUA 2PA3A 3PY8A 4ELUA 1NZ8A 1R6MA 2OUGA 3H42A 4Q5VA 5A8WA 4MH8A 2K7KA 3KXDA 3J80Q 3MM9B 2ZHOA 3GB0A 4WE1A 5K20B 4TQRA 3U1MA 1TK0A 4B3RJ 1TUGB 2DH9A 3DDIA 4DCOB 4NZ0A 3V81B 3KUGA 3CIZA 4B08A 4FBUA 4K4VA 2KB2A 3OFEA 1T11A 1RR9A 4ZPDA 2XGQA 3H0PA 1LXNA 1Y11A 4K5RA 5T41A 4QWCA 2E9RX 2EWHA 4A8SA 2LXIA 3AAWB 1FDAA 3BGLA 5LXYA 3W2WA 3J81Y 3ZZYA 4RNOA 4U67Q 2AZ3A 3AH6A 3NGTA 1S9EA 4GO5X 1YZ7A 4OI2A 4RW7B 4USHA 4ZPCA 5BR8J 5DM6Q 4A46A 1B7YB 3LA0A 4IFDF 1G7CB 1EARA 2ZJPQ 3RAMA 5GAEI 1R0BG 5EHHA 4AQYJ 5IC6B 3HFZB 2VFSA 1RAGB 2BA9A 3NKYA 1XTZA 4G1IA 2K3KA 4EO6A 2ASLA 1HNWF 4QYZJ 2ZEJA 1RT5B 5JEAC 3OTOJ 1YIJS 1VC5A 1B63A 2KI2A 1XNRJ 3OL6A 2W01A 4O0IA 4U3BA 3E2EA 2UP1A 3OL7A 2BM0A 1PIEA 2EVZA 3W2VB 5J1PA 1VDHA 3AOAA 4DU7A 2CQGA 4O44A 4ZCKA 5H9EJ 5FLXC 1RK8A 2YX1A 5IM0B 2UUAF 1R0AA 2ZD1A 2ZH2A 3TEHB 3EZ5A 5B0AA 2QRRA 5HMWA 3BO4A 1SJ4P 1T03A 1UVNA 2QT7A 2OJ3A 4MKYA 4DS5A 1NHUA 3JAMY 3CCSS 2PMWA 4Y2AA 2H51B 1SQEA 4MYUA 5GMDA 1Q95G 5AXKA 5KFSA 5HROB 1QLNA 1Z0VA 1TAQA 1QZRA 4J5OA 3T1YJ 3BN7A 3NS6A 4JBCA 1QAJA 4M5JA 5KFOA 2FJWA 1HR0I 2AJ1A 1OYSA 1RTHB 3PO4A 5D0HA 1PC5A 2CWKA 1PILA 3AXMA 4MKAA 4J9LA 3L9ZA 1IBKJ 1SC4B 4LF6I 3K17A 1IWAA 4AM3A 4O0NA 1IR0A 1SC6A 3PRBA 3ZTSA 4OYXA 4K50A 2CWXA 4JI8F 1S4EA 1PSDA 3IBWA 2E5HA 2RNEA 2XI3A 4OYWA 3A8JA 3GR0A 1WC0A 1YBUA 1YJUA 3QO9B 2OPRB 2BJEA 3QZ8A 4ITSA 4PUOA 1DY3A 3VAJA 3NMRA 1FJEB 1RTZA 1HNIA 4MQYA 1C1CB 5GAEU 4KGZB 4HDGA 2HHHE 3T1HJ 1CPZA 4W90B 3A3NB 4PG5A 1OQ3A 4DCPB 3RRHA 3M8PB 5HN0A 3M8WA 4LBPA 4TY8A 1H7WA 2I9SA 3MUTP 3GV5B 1UVKA 3WBZA 1SVDA 3EYZA 4DV3F 1IBMI 4GKKI 2HQIA 2WW4A 2G13A 1WHWA 2P9EA 4MIAA 4AQYF 1IBLJ 4NL5A 4V19X 2XB2D 1DZ5A 1HWJA 1NM2A 1RHKB 2V8GA 4LBHA 4CLTA 4JI8E 1O6XA 2AHOB 3N5FA 4CYUA 3PEHA 4JI3E 2QLXA 4GO7X 2B9EA 4IG0A 3KHHA 4CT8A 3SI8A 1S59A 2WSEC 1NDLA 3FKBA 2D9PA 3QNWB 3NNHA 3NGUA 3MXHP 1XMQI 3PIOQ 4HYKA 1CJVA 2Z5CB 4OKGA 3JAMC 3W9JA 5KFGA 1W2BR 2HK3A 3FUYA 1RADB 5IQQA 5JEAE 1ZZFA 2J7KA 2YPZA 3PW0A 2BX6A 4LPFA 3HSJA 4R0JA 1L3UA 5ETSA 3C6TB 5JEAF 2E9TA 2PO0B 2IY5B 1GNKA 4IG3A 1IVZA 4ZITA 4ANEA 1R6YA 1U24A 3CD7A 3FRYA 3Q86A 4NA3A 1JLAA 4IFDC 4OI4A 3QGHA 1R3NA 3U1NA 1XK8A 4X4SA 3VGTA 1DARA 3PJWA 3N6LA 5LMUF 3G2XA 1S97A 2YH0A 5ETOA 3M7ND 2LU1A 1TUVA 3CW2C 4IZJD 1VQLS 4WK3A 4ES2A 3RB6A 2QA2A 3P96A 4LF4J 2X1AA 4AL5A 2ZZTA 3C66A 4MAKA 1K9MT 4L6V3 2MB0B 2QYGA 4DHVA 1C4CA 2XO7A 2KG1A 3EGNA 3UFCX 4DPWA 2DD8S 2MQOA 3HM9A 3BQ0A 4A8XA 4Z37A 3R1LA 1FJCA 4DV4F 1HI8A 5ADZA 1CJTA 3J80Y 4N76A 2DB1A 2KYZA 1WEYA 3AFGA 2JC0A 1WG4A 3KMSA 5FJ4A 1NBEB 4A8OA 4CO1A 4F8RA 4ZHRA 5FLXY 1S1UB 3UCZP 1HFEL 4QJVA 1Q16B 2YTCA 3G8QA 1G2EA 2KXFA 2V2KA 4DV4I 3OTOE 3WX4A 2YKQA 2XMWA 4ZPTR 2DK2A 3CCJS 4NLRA 4F7VA 2E5LF 2YXLA 1GMUA 4KGXB 3AD8C 4YB7A 2B6AA 3RYLA 2R2RA 5F8GA 3JB9k 1I94E 1CJUA 4FNHA 3B8HA 2QLFB 3BSAA 4ZP8A 2VASA 3CVKA 4NLSA 4ZVQB 1N36F 4ZJLA 3KHRA 3VAMA 4AL6A 1UEKA 2YQ0A 1HR0E 4GKJI 2FJVA 1CJTB 5H9FK 1SJ1A 1N4LA 1VQKS 3IRWP 5LMUI 4DV6I 1HNZF 1J27A 3TUZC 3UD3P 4P10A 1RBLA 3U27A 3QGGA 1AUDA 1WC3A 3M8RA 1TL5A 4DV4E 2FUG9 3J7AG 2YNHA 1F1BB 2FPHX 2VG6A 3GJRB 2R2TA 2COLA 2Y1IA 3FBFA 2ZM6E 3D7SB 1BQNA 1MMDA 4X4VA 1SH0A 1RTJA 4MT1A 2GCFA 3QJJA 4X66J 1FFWB 1WEZA 4QOTA 4CO2A 3M2UA 2DNKA 2LP4A 2VJVA 4XTJA 1XQIA 4OYZA 2VQEI 1YTYA 4RKUC 3R6LB 1RKIA 2GC8A 3BGOP 3TJ8A 2PN6A 2CVEA 2OD4A 2F40A 4P6QA 5DDQC 1G6BA 4A8YA 1RT3B 4X65J 2AYBA 1OSDA 2UUCJ 2HIYA 4I64A 3THTA 3O1LA 4P7AA 1AUSL 4I69A 5AE2A 1CS4A 1L3KA 4UQGA 2VICA 3SV3A 1F2HA 1V3ZA 1N36I 4OHZA 2LLZA 1FD2A 3MD1A 5DDPC 1JNZB 1IQTA 1UEUA 2YNIB 4UZCA 3HFVA 1U47A 4IQMA 3IS9B 2MGZB 5EWFA 3T9ZA 1PGZA 3IG1A 3N0VA 1SQGA 4IFDE 3MUVP 1FF2A 1S1UA 2AYMA 2W9CA 2Y1JA 4LR8A 4B3TI 2OAUA 5K36C 1XNQJ 2X1GA 2YKNB 4I2QA 1N0UA 4YB6A 5M2PA 5I3UA 1Z0CA 5DZ7A 4Y2KA 2BRLA 2JVRA 2D1CA 5K36E 1LFWA 4B3TF 2F65A 4NLQA 2A10A 4ECWA 3J7Z5 1WDTA 3T5KA 4I6AA 1L3VA 2VG5A 2FJAB 2H54B 1S6UA 2VBZA 2WVFA 4C97A 5K8OA 3H4BA 1NHVA 1YGYA 1I1GA 3EVMA 3N6NA 4FP9A 4EGLA 5HVGA 3UR0A 2ATLA 5C0XA 3DLKB 3TRGA 1BQXA 2R4FA 2WW8A 2YNGA 1M5KC 2CJAA 4FXDA 2HNYA 3OXGA 2NN6B 2XZDB 1XN9A 3VR1A 2J9DE 5HAOA 1KVIA 1JLGA 3N79A 1K0VA 1QTMA 1SQFA 4DUZF 4DL5A 1WSVA 2DCUB 2HNDB 3Q83A 1FVQA 4HH0A 4WF9Q 2J8AA 4OYAA 4IUFA 2DR7A 4K0KE 2B4PA 1Q4RA 1WKJA 2XCAA 2VIHA 2OPSB 3BGFA 5GAHU 3T5HA 3SSQA 3C46A 4B3MJ 1F5BA 3OHBA 1KIJA 4LCFA 4N3OA 3MM6B 3QT6A 2RUSA 3HHNB 4E0DA 2VFTA 1SL2A 3H4LA 3MMCA 3G6ES 2NXJA 4ILRA 1VOMA 2IAJA 3SMZA 2W9BB 5HQ8A 1IR1A 1RSCA 2FYXA 2KT3A 1S0MA 4LMZA 4H4KC 1JWWA 4F2SA 3R7SB 2H65B 1FTCA 4NCBA 2L9DA 4DPTA 4LFCI 1XMQJ 5DNXA 2RHQB 2I38A 3B4MA 4KKOA 4LIWA 4JV0A 3KJFB 5KFZA 4DXLA 5HI7A 4WXOA 2R7UA 3DGPB 4QZVB 4DN9A 4DV2E 1F6TA 2G0IA 3NWRA 3TEGA 4TY8B 1ZAVA 4MKVA 1HNWI 1TL3B 1MU2B 3I31A 3BEGB 4CLPA 2OMOA 1KWMA 3HSZA 3I6PA 1KP6A 2CQ3A 1X31C 2ZVIA 1VQYA 2LQ5A 4QU7A 1Y5YA 2Z5EA 2VU5A 1AYEA 1Z5AA 2WP8B 2CQDA 4WUBA 3L7ZB 3V6DB 1D9DA 1SC3B 3DDNA 3L7UA 3D4JA 4J9QA 4F4KA 1BC6A 4P71A 3J7A1 4PRXA 3ISND 3HSGA 3M30B 4P2FA 3BH6B 3WC0A 3SDEB 4NLPA 4F4XA 2BABA 2E1AA 2IM3A 4I7FB 4WUDA 1HNWE 1PVGA 1HNVB 2HW3A 2G0JA 2NN6C 3ETOA 4DR6E 4K8RA 1KLMA 2O1VA 2KFNA 2IFXA 1WSRA 1UPMB 2Z58B 3ET6B 4FZVA 1HYSB 4CLWA 1AB8A 3EJMA 4WFZA 4CO0A 4EZ9A 4YMEA 3Q8QB 1N32J 4C3MA 4G1PA 2W7PA 3ZTOA 3RUBL 3V6DA 2CAJA 4NOHA 3PW5A 4RU2A 1Z0WA 2R8KA 4JI7I 3MPUB 4RLEA 3V4IA 4QIGA 5HO4A 2RDJA 2PE8A 3HJVA 4LF7E 1S1WB 4LBIA 3R97A 4ED1A 5D15A 3PM9A 4CIOA 3GSDA 5K14A 2HIQA 3MPWA 4MK9A 4KT0C 1P27B 5KOWA 2VG7A 5LJ3Y 3MECA 3J7AM 4TLRA 5LM7E 4ENOA 3CJ3A 2HNZB 3BSOA 3SXLA 1T9VA 3K89A 2MQPA 4GC7A 1ZS6A 4O3PA 1YJWS 1BWEA 3MR5A 5C24B 1GQEA 4IG0B 3BV8A 4JP8A 2XQCA 4C4WA 1VK3A 5D78A 4X65E 3ISZA 1WKLA 2Z2YB 4NYPA 1U0HB 1VI7A 1E3PA 4J9RA 4KYZA 3CXCR 2ZH8A 5IWAE 2OSRA 4YY3I 1Y60A 2YWEA 4ZCMA 4JI1I 2V63A 1T9UA 1IKYA 3DYAB 3I5BA 5FDLA 4Z7CA 3TI0A 2YVSA 3TWZA 1Y9OA 4J7CA 2HHUA 3HK2A 1W2IA 2NN6F 1NSKL 2PEHA 2XSJB 4QCLA 1Y3JA 1CQMA 2W2MP 1R8CA 3UD4P 1KOOA 2HZCA 3H90A 2FLPA 2XGPA 4YEAA 4JI6E 3EMTA 3IN5A 4DSJA 2MQ8A 3CT9A 1RQ0A 1RHUB 1U2FA 3SSSA 2AE8A 4XK8C 2WAQD 4QIEA 2VFVA 3I5AA 4IRCA 2L9NA 3LGNA 4RUAA 2AW0A 2UZAA 2UU9I 5D3GA 3PTWA 4LOMA 2DXEA 4OZ3A 5KFBA 1HWIA 4F67A 3OLAA 4MU0A 3W63A 3OTDA 2IERA 2H1YA 2ZH7A 5J2PA 1F5AA 4ECTA 5H1SV 5HJYA 5LL6R 3G6YA 2ZH3A 3P3GA 1A6LA 4OX6A 2ZH1A 2N3LA 2P8IA 4OI3A 2ZHBA 1TUWA 3LAMA 3M9MB 2AEFA 1Y5IB 3HSDA 4URGA 2NXNA 3J80U 2V4QA 1RYSA 4GKKF 4UOGA 3M6UA 2ZM6I 3UR3C 4LF8I 3TO8A 3CO0P 4K4TA 5DM7Q 3LW5C 4GKKE 1YITS 1VC6A 1FKOB 5F9LA 1QVFR 2MSTA 2J8SA 2KT5A 2YNFB 4UY85 2HFVA 3CCZA 4X4QA 3SQOP 2W7OA 5EDWA 2BW2A 2R8GA 1IN0A 2L3MA 4ZMMA 4FW3A 2F9JA 3LPSA 1BXNA 3R5DA 4UUXA 5A0YB 3BO2A 4FS1A 3DLGB 1JLGB 1JLAB 1WHVA 1K47A 2CG4A 3TR5A 2R7SA 5ETTA 2J65A 3MF5A 1FRKA 1JLEB 2E9ZA 5JXSA 3C3LA 4H4MA 2CFXA 1ZBTA 2NUHA 2LQ8A 3CCQS 3NGKA 1ZTTA 3A3OB 2O1UA 3CJSA 3GYXB 1LWXA 5KFVA 1Q8KA 2B8PA 3SBMA 4IYQA 3RRKA 4DEZA 2Q1LA 4NEYA 4LSLB 5D0EA 2FHMA 2CQ2A 4NLYA 3QMQA 5EUHA 3TA0A 2CJXB 5KT2A 3GFXA 3PXGa 2DR6A 1JLCB 2W8KA 4HXZA 2B0GA 3D67A 2DR9A 1WOPA 3SCJE 2BXJA 4CLLA 3GV8B 2R2SA 4C8OA 1N5VA 2KT2A 1EP4A 1FRJA 4NI2B 1SJ3P 4LFCJ 4PQUB 2VDIA 2QX0A 2ZM6F 5C0XB 4TQSA 1KQKA 4PXEA 4O3QA 4IDKB 4YY3E 3GMGA 2GAHC 4AIMA 4FWDA 4K59A 1HQEA 2GV1A 2ZC3A 4DV7F 4DL2A 3AD7C 3CMES 1N33E 1OY9A 4OX9I 3K57A 4N77A 2HS3A 3LP0A 3TVKA 2GO4A 4IH7A 2E7XA 2ACMA 4MIWA 1VIXA 5BXIA 1AA1B 1JIHA 3DMJA 4OJHA 5J2PB 5KG5A 4AL7A 3PFEA 2PO4A 2Z8QA 5LMUJ 2XS5A 3F41A 5KG0A 1TELA 1SV5B 1S57A 3I4PA 4ID8A 2QMWA 4FF1A 3OTBA 1LW0B 2ZOFA 2V2QA 3W3SA 2GA7A 2EK6A 2GFFA 3F56A 1X5OA 5KFEA 3I0RB 2AJFE 5JJBA 1O51A 4WUCA 2HLUA 4QPXA 1Q8BA 2W1BA 3IA0A 2F4VE 2N7YA 5FLXQ 3M7NG 3HFKA 4AUKA 2JEBA 5A8RA 1HBNA 2ASYA 3W5XA 4YS2A 3KLGB 1GXTA 2DNPA 3T5JA 1FJGI 1VQMS 2F8HA 3CTRA 1M90T 2C39B 5EN1A 2M2BA 4EYIB 2XMMA 2X7IA 1RT5A 1ZETA 1J5EJ 4Y00A 3RR8A 2XSFA 3MOZA 4K4ZA 1IBME 3EVWA 3BKTA 3DGPA 1UZHA 3KLFA 2JC1A 4YHHJ 3KK1B 4B9NA 4Z2XA 4DU8A 4USJC 4DOZA 2HVEA 1IUJA 2PNMA 1XERA 1VQPS 1R6LA 2CJBA 3CMQA 4M5MA 2BANA 2DHAA 5JEAB 3ZNJ1 4KTQA 2OKQA 1Q53A 2K1RA 3NS5A 4AD6A 2WP8A 3QRRA 1V5VA 1T03B 5IT9C 5KOXA 2XZTB 4P75A 3IS9A 2MGZA 4A8WA 2WVDA 2DR5A 1EB0A 3FQKA 3OL9A 1VRQC 4OZJA 3B6BA 1UZDA 3BYRA 4PG7A 1AW0A 4NXME 3HKZD 3F73A 1NHHA 3KG0A 2IDEA 1FEHA 1Q78A 2ZKUA 3I82A 2A6MA 4G3IA 4EWTA 5KFAA 1U2RA 3EVOA 1VS3A 2VPZB 2P9GA 3JSMB 3GR1A 4KRWA 5CZXA 4DV6E 2V8VA 3NAHA 3KLEA 3CCUS 4JI2J 4C8NA 2PEBA 3OPKA 2UUCI 4M8LA 2OEMA 4M1KA 5K9FA 4JI0E 3OTOI 5EX3A 2RKIB 3NXZA 1JKHA 2GIQA 3LGMA 2HZAA 4YDXA 1QAYA 3IR7B 1N0VC 2JEAB 1FRIA 2EFGA 2QIFA 2GVZB 2RU9A 3JSRA 1JMTA 2BBEA 2WOMB 3B82A 3OFHA 4V1Ak 4ZJOA 4DR5J 3IWNC 2V0NA 4FYDA 4ZPWR 4U7CA 5CD4A 4O23A 1PAUB 4Y6IA 3CC4S 2MZ1A 4IG3B 3A3PB 3TYTA 4Q2LA 3UPFA 2EC2A 4EMDA 2R7RA 2RQ4A 3D3CJ 3VAIA 3WU6A 2WZ1A 1JLQB 2QZ8A 5EX0A 1EP4B 2ZM6J 2MZTA 4ELVA 5BYRA 3K0JA 1HD1A 3T1HI 4WU3A 4QR1A 1CC8A 1J5EI 1NEEA 1YJRA 2GVDB 2W4PA 3W8PA 3KRNA 4LREA 4ICLA 5CA5A 1NUEA 4KHPF 4GQUA 1DTQB 2JE6B 3FK4A 2VC1A 3CDBA 3MGJA 4LR7A 3M32A 1X5TA 3DCAA 4XIUA 2UXBJ 1RREA 3PKMA 5K8PA 3P3CA 4PRVA 1NDPA 2D3ZA 2E1MC 1O8BA 2V9KA 3LF0A 5IT9U 3AOCA 1HKAA 4LRDA 6FD1A 4X62I 2A0FB 2M4MA 5DG7A 1QUPA 1KR4A 3LAKA 2WSCC 4RW9A 2DGOA 4ZLLA 5BR8F 3GSIA 4PQAA 5C5JA 1Y10A 2XC9A 2AKWB 2EK1A 3QIPB 1C1CA 5CHCB 2CPJA 2JOQA 2WB1D 3OV7A 2EG2A 2F3JA 3IGVA 1KSPA 3JQMA 2WK4A 3GWCA 3FBBA 2CXEA 1IJEB 3V2UC 3HXMA 4K4WA 1RT1A 1T94A 4OHVA 4YY3J 5KFKA 3W1YC 4DQRA 4DZ6A 3PX6A 1YQHA 2AGPA 4B3MI 3JAMU 3EICA 4DV6J 3I87A 1WHYA 3MM5A 4JI8I 2XYPB 2R3VA 3AQOA 4C8KA 1N8RT 3R2DJ 3CJKB 4EEYA 2HVHA 1TKXA 1MROB 4DG1A 1TL1A 1T9WA 4CTAA 4IFDB 3SYZA 2RMLA 4WTYA 5HJXA 5CYJA 1HNXF 2BJ1A 4KE5A 3GYNA 2ZBCA 1TKTB 1DJ0A
chains in the Genus database with same CATH topology
2HK2A 5GMDA 1Z0VA 4MYUA 1QZRA 3LNUA 2UXDI 5BR8I 1HR0I 4B3SI 2GQ0A 4HY1A 4LF6I 3HJCA 3K17A 1Z5CA 1N36E 1S4EA 5LMUE 2Z5BB 4DPYA 1Z59A 3Q1QA 4NXNI 4IZKB 3ZZ0A 4X65I 2HHHE 5BR8E 1Z0TA 4OX9E 1KVKA 1HNZI 1IBMI 4GKKI 2WW4A 4JI5I 1XMOE 4NXMI 4JI8E 5LMNI 1FNMA 4R1FA 4JI3E 1Z0BA 4DR5E 1FKAE 1KKHA 4X62E 3K85A 1FI4A 2Z5CB 3JAMC 2HK3A 2J7KA 3PYFA 1XNRI 3ZZUA 3B78A 2HKEA 2DEJA 3WU3A 4P52A 1DARA 5LMNE 4IZJD 3ZKDA 4LF4I 1H7SA 4I3HA 4DPWA 4DR7E 4ED4A 1ZM3A 1ELOA 4DR2E 2E1RA 2UXBI 2UXCE 4KHPI 4LF9E 3HULA 4DV4I 3OTOE 1PKPA 2UUCE 1I94E 4JI0I 3B8HA 4DR7I 4DUYI 1Y4SA 2VQFE 4GKJI 1UEKA 1HR0E 5LMUI 4DV6I 2UXBE 4JI1E 2UUBE 4X66I 4DV4E 3J7AG 2IOPA 3J81C 2UUAE 2ZM6E 4DUYE 3LTOA 1MG7A 2CGEA 4JYAI 4XTJA 1WUUA 2OI2A 3ZKBA 2VQEI 3PYEA 1MX0A 2E5LE 3ZZTA 4P7AA 2F4VI 1Y6ZA 1XNRE 2GS8A 4HACB 3P06A 2V2ZA 2Z5BA 2CZ9A 4B3TI 4LFAI 1A6FA 1N0UA 1Z0CA 4YHHI 3V5RA 4UT4A 3PYDA 2DEIA 2HHHI 2CG9A 4UTGA 5FWKA 1D6TA 2AJ4A 3F0NA 4IZJA 4LF5I 4K0KE 4NXME 1OJ4A 1KIJA 4N3OA 4JV5I 4KHPE 3Q6NA 3QT6A 3H4LA 4RPFA 3M6AA 4AQYI 4X66E 3Q6MA 4USKA 4KQVA 5A2QC 4MYTA 4DPTA 4LFCI 4DXLA 1Z0GA 2HFSA 4HACA 4DV2E 3WU5A 1HNWI 4B3RI 4FN5A 2Z5EA 3T1HE 4WUBA 1Z5AA 4LFCE 3D4JA 2O1WA 4PRXA 2UUAI 4DV0E 4DV2I 1FJGE 1IBKE 4WUDA 2ZITA 1XMQE 3JAMQ 1HNWE 1PVGA 2UXDE 4K0KI 4DR6E 4JI4I 2O1VA 2NPFA 5IWAI 1FWKA 4DR5I 1KTVA 1Z0WA 4JI7I 2BV3A 4JI5E 4LF7E 1H7UA 4LF5E 4X64I 1EA6A 3J7AM 1Y4UA 1XHKA 4X65E 4DV1E 5IWAE 1N32E 4YY3I 5FLXC 4JI1I 4Z7CA 3J80C 4JI3I 4DR3E 4JI6E 4X64E 4JI2E 4AQYE 2UUBI 4DR1I 1HNXI 2E5LI 2UU9I 4URLA 3J81Q 5A2QQ 4DV5E 5IT9Q 4FWHA 2VF3A 5LL6R 4JYAE 1MU5A 4JI4E 4DV3I 1HNZE 2ZM6I 1IBKI 4LF8I 2LJPA 4GKKE 3QT7A 2VQFI 4GKJE 2O1TA 1NHHA 1B62A 3LPSA 4IZKA 3T1YI 1K47A 4PU9A 2HKJA 4DV7E 1IBLE 2UU9E 4FW9A 1H72C 2O1UA 4JI2I 4B3SE 1ZXNA 4HXZA 1H74A 4LF6E 4DUZE 4HYMA 1XNQE 4JG4A 4ZVIA 5L3JA 1VISA 2BM1A 2R42A 1HK7A 1J5EE 2X36A 4JV5E 4YY3E 4FWDA 5GMEA 2VQEE 2V8PA 1N33E 4OX9I 4YHHE 1Z0EA 4LFBE 4IZJB 1XMOI 3ZM7A 2V2QA 1NZ0A 4WUCA 3QT8A 1HNXE 4USMA 1BKNA 2F4VE 5FLXQ 1Z5BA 3K1JA 4DV0I 1FJGI 3WU4A 1H73A 1EI1A 1USUA 4DR6I 2X7IA 2Z5CA 1N33I 1IBME 4B3TE 4LFAE 4B3RE 4DU8A 4DV7I 1XMQI 2PNMA 4DR2I 2HFUA 1XNQI 1N34E 3QT5A 3GONA 4LF4E 5IT9C 1ZM4A 4FWGA 1U2RA 4DV3E 1N36I 1ZM9A 4DV6E 4B3ME 2UUCI 4M1KA 4JI0E 3OTOI 1NHJA 1ZM2A 2ZBKB 4DR4I 1N0VC 1ZXMA 2EFGA 4DPXA 4Z7YA 2PNLA 1N32I 1NHIA 3B82A 4LF9I 1S16A 1IBLI 3PYGA 1I94I 4LFBI 4EMDA 2A2CA 2XEXA 2V34A 3T1HI 2A2DA 4DV1I 1FWLA 2UXCI 1J5EI 4DR1E 2V2VA 3J80Q 4LF7I 4DR3I 4DV5I 1RREA 4PRVA 2IOQA 4NXNE 1RR9A 1N34I 4X62I 4JI7E 4JI6I 3WU6A 3CWVA 3V2UC 3T1YE 2Q2EB 4B3MI 4JI8I 2R3VA 1B63A 4LF8E 1USVA 2BM0A 4DUZI 4DR4E 1PIEA 4DU7A 4DPUA 3PRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK2 A;  5GMD A;  1Z0V A;  4MYU A;  1QZR A;  3LNU A;  2UXD I;  5BR8 I;  1HR0 I;  4B3S I;  4HY1 A;  4LF6 I;  3K17 A;  1Z5C A;  1N36 E;  1S4E A;  5LMU E;  4DPY A;  1Z59 A;  3Q1Q A;  4NXN I;  3ZZ0 A;  4X65 I;  2HHH E;  5BR8 E;  1Z0T A;  4OX9 E;  1KVK A;  1HNZ I;  1IBM I;  4GKK I;  2WW4 A;  4JI5 I;  1XMO E;  4NXM I;  4JI8 E;  5LMN I;  1FNM A;  4R1F A;  4JI3 E;  1Z0B A;  4DR5 E;  1FKA E;  1KKH A;  4X62 E;  1FI4 A;  3JAM C;  2HK3 A;  2J7K A;  3PYF A;  1XNR I;  3ZZU A;  3B78 A;  2HKE A;  2DEJ A;  3WU3 A;  4P52 A;  1DAR A;  5LMN E;  3ZKD A;  4LF4 I;  1H7S A;  4I3H A;  4DPW A;  4DR7 E;  4ED4 A;  1ZM3 A;  1ELO A;  4DR2 E;  2E1R A;  2UXB I;  2UXC E;  4KHP I;  4LF9 E;  3HUL A;  4DV4 I;  3OTO E;  1PKP A;  2UUC E;  1I94 E;  4JI0 I;  3B8H A;  4DR7 I;  4DUY I;  2VQF E;  4GKJ I;  1UEK A;  1HR0 E;  5LMU I;  4DV6 I;  2UXB E;  4JI1 E;  2UUB E;  4X66 I;  4DV4 E;  3J7A G;  3J81 C;  2UUA E;  2ZM6 E;  4DUY E;  3LTO A;  1MG7 A;  4JYA I;  4XTJ A;  1WUU A;  2OI2 A;  3ZKB A;  2VQE I;  3PYE A;  1MX0 A;  2E5L E;  3ZZT A;  4P7A A;  2F4V I;  1XNR E;  2GS8 A;  4HAC B;  2V2Z A;  2CZ9 A;  4B3T I;  4LFA I;  1A6F A;  1N0U A;  1Z0C A;  4YHH I;  3V5R A;  4UT4 A;  3PYD A;  2DEI A;  2HHH I;  4UTG A;  1D6T A;  2AJ4 A;  3F0N A;  4LF5 I;  4K0K E;  4NXM E;  1OJ4 A;  1KIJ A;  4JV5 I;  4KHP E;  3QT6 A;  3H4L A;  4RPF A;  3M6A A;  4AQY I;  4X66 E;  4USK A;  4KQV A;  5A2Q C;  4MYT A;  4DPT A;  4LFC I;  4DXL A;  1Z0G A;  2HFS A;  4HAC A;  4DV2 E;  3WU5 A;  1HNW I;  4B3R I;  4FN5 A;  3T1H E;  4WUB A;  1Z5A A;  4LFC E;  3D4J A;  4PRX A;  2UUA I;  4DV0 E;  4DV2 I;  1FJG E;  1IBK E;  4WUD A;  2ZIT A;  1XMQ E;  3JAM Q;  1HNW E;  1PVG A;  2UXD E;  4K0K I;  4DR6 E;  4JI4 I;  2NPF A;  5IWA I;  1FWK A;  4DR5 I;  1KTV A;  1Z0W A;  4JI7 I;  2BV3 A;  4JI5 E;  4LF7 E;  1H7U A;  4LF5 E;  4X64 I;  1EA6 A;  3J7A M;  1XHK A;  4X65 E;  4DV1 E;  5IWA E;  1N32 E;  4YY3 I;  5FLX C;  4JI1 I;  4Z7C A;  3J80 C;  4JI3 I;  4DR3 E;  4JI6 E;  4X64 E;  4JI2 E;  4AQY E;  2UUB I;  4DR1 I;  1HNX I;  2E5L I;  2UU9 I;  4URL A;  3J81 Q;  5A2Q Q;  4DV5 E;  5IT9 Q;  4FWH A;  2VF3 A;  5LL6 R;  4JYA E;  1MU5 A;  4JI4 E;  4DV3 I;  1HNZ E;  2ZM6 I;  1IBK I;  4LF8 I;  2LJP A;  4GKK E;  3QT7 A;  2VQF I;  4GKJ E;  1NHH A;  1B62 A;  3LPS A;  3T1Y I;  1K47 A;  4PU9 A;  2HKJ A;  4DV7 E;  1IBL E;  2UU9 E;  4FW9 A;  1H72 C;  4JI2 I;  4B3S E;  1ZXN A;  4HXZ A;  1H74 A;  4LF6 E;  4DUZ E;  4HYM A;  1XNQ E;  4JG4 A;  4ZVI A;  5L3J A;  1VIS A;  2BM1 A;  2R42 A;  4JV5 E;  1J5E E;  2X36 A;  4YY3 E;  4FWD A;  5GME A;  2VQE E;  2V8P A;  1N33 E;  4OX9 I;  4YHH E;  1Z0E A;  4LFB E;  1XMO I;  3ZM7 A;  2V2Q A;  1NZ0 A;  4WUC A;  3QT8 A;  1HNX E;  4USM A;  1BKN A;  2F4V E;  5FLX Q;  1Z5B A;  3K1J A;  4DV0 I;  1FJG I;  3WU4 A;  1H73 A;  1EI1 A;  4DR6 I;  2X7I A;  1N33 I;  1IBM E;  4B3T E;  4LFA E;  4B3R E;  4DU8 A;  4DV7 I;  1XMQ I;  4DR2 I;  2HFU A;  1XNQ I;  1N34 E;  3QT5 A;  3GON A;  4LF4 E;  5IT9 C;  1ZM4 A;  4FWG A;  1U2R A;  4DV3 E;  1N36 I;  1ZM9 A;  4DV6 E;  4B3M E;  2UUC I;  4M1K A;  4JI0 E;  3OTO I;  1NHJ A;  1ZM2 A;  2ZBK B;  4DR4 I;  1N0V C;  1ZXM A;  2EFG A;  4DPX A;  4Z7Y A;  1N32 I;  1NHI A;  3B82 A;  4LF9 I;  1S16 A;  1IBL I;  3PYG A;  1I94 I;  4LFB I;  4EMD A;  2A2C A;  2XEX A;  2V34 A;  3T1H I;  2A2D A;  1FWL A;  4DV1 I;  2UXC I;  1J5E I;  4DR1 E;  2V2V A;  3J80 Q;  4LF7 I;  4DR3 I;  4DV5 I;  1RRE A;  4PRV A;  4NXN E;  1RR9 A;  1N34 I;  4X62 I;  4JI7 E;  4JI6 I;  3WU6 A;  3CWV A;  3V2U C;  3T1Y E;  2Q2E B;  4B3M I;  4JI8 I;  2R3V A;  4LF8 E;  1B63 A;  2BM0 A;  4DUZ I;  4DR4 E;  1PIE A;  4DU7 A;  4DPU A; 
#chains in the Genus database with same CATH topology
 2MPU A;  3M2R B;  4DF4 A;  3M2U B;  2HK2 A;  3ADA C;  4NX9 A;  4KKO B;  1XIQ A;  2ADB A;  3M8Z A;  1FO1 A;  3ZTQ A;  3JQK A;  3BSC A;  2A18 A;  4W4M A;  3S01 A;  4MTP A;  5IV3 A;  4PAB A;  4NXM J;  3B4T A;  2QSW A;  1U1O A;  2EC0 A;  1U1Q A;  2CPZ A;  2DH8 A;  1LWC A;  2HNZ A;  2IVY A;  3G82 A;  3GIR A;  3JTO A;  3PAC A;  4P73 A;  1E6V A;  4WJB A;  5E3P A;  1I94 F;  3G71 S;  2EW9 A;  2GQ0 A;  4B3S I;  2UVW A;  5HAT A;  4F0K A;  2PO0 A;  4OZE A;  3HJC A;  2C2Z B;  3TA2 A;  3FBE A;  4OZ1 A;  3R1H A;  1HR0 F;  1Z5C A;  1RP5 A;  4WE1 B;  3TQE A;  2UVR A;  3EZU A;  2VKZ G;  5HRO A;  1N36 E;  2PO1 A;  4K4S A;  2I1R A;  1HHQ A;  4B3S F;  1P8G A;  4FYX B;  2ADC A;  2Z5B B;  2KHD A;  5GVQ A;  2O66 A;  4Y34 A;  3KLH B;  3CCT A;  4DPY A;  4WK1 A;  3JYT A;  2KM8 B;  3HP6 A;  2BJ3 A;  2YH1 A;  1N5S A;  1RYR A;  2VL1 A;  3QRQ A;  4CO5 A;  4NXN I;  1YHQ S;  2V68 A;  3ZC4 A;  3Q24 A;  4FKX A;  3TX0 A;  4LRF A;  3NCP A;  5DJB A;  4NYZ A;  5DLF A;  2E1P A;  2M52 A;  1EJ7 L;  1TMM A;  3VWS A;  2VBW A;  3ZZ0 A;  3CGI A;  5CCM A;  5JEA A;  4X65 I;  1EKR A;  2RIL A;  2XWY A;  2ZBI A;  4MKB A;  4ZVR B;  4PWU A;  4BWJ A;  3CF5 Q;  3V4I B;  2DHX A;  3AD9 C;  2EFV A;  1Z0T A;  3JXO A;  4OX9 E;  2OIH A;  2W2Q P;  3HHE A;  2VQE J;  1CJV B;  4ZVU B;  1HNZ I;  2KJW A;  5K36 A;  2Y1L B;  5DRK A;  1R0C B;  3SSR A;  4YDD B;  5F8J A;  4OX9 F;  3WIU A;  1X5S A;  4OYO A;  3EGW B;  1G4C A;  3VAG A;  2C28 A;  1SL1 A;  1VBK A;  3D1O A;  4OYI A;  4QIV A;  3BBC A;  5C25 B;  1KTQ A;  4DQS A;  1T8E A;  4JYA E;  4FXW A;  1HNI B;  4E2F B;  1AT1 B;  2CNL B;  2HND A;  1U45 A;  1Z0B A;  3QFH A;  4Y28 C;  4DR5 E;  2H4W B;  1NK9 A;  4I6Y A;  1KKH A;  1R0A B;  3HJF A;  1TU0 B;  1HIY A;  2G2Z A;  5HMY A;  1YK9 A;  2J9D A;  2DVI A;  3E01 A;  1QY7 A;  2YKM A;  5DDR C;  3VAH A;  1KRP A;  4FPR A;  4LF2 A;  4PR6 A;  2LEB A;  2FLN A;  2DYA A;  2F4V F;  3ENV A;  1FXR A;  1XNR I;  3EXY A;  1J5O A;  3NNC A;  1LQ9 A;  1C0T A;  3W65 A;  2MHE A;  2VQF I;  2YBV A;  3B78 A;  2HKE A;  4NEZ A;  1IKW A;  5CQG A;  3K59 A;  2BOA A;  5KFQ A;  3SCI E;  1HAR A;  1Y4U A;  3GTY X;  2E1C A;  3WU3 A;  3QWU A;  2RQC A;  1XNR F;  2MZR A;  5IS2 A;  2HVI A;  2FY8 A;  1XWL A;  2ZHA A;  5LMN E;  3OUY B;  1Q5Y A;  2VES A;  2QGF B;  3VQS A;  1FHT A;  2JL9 A;  3CJ4 A;  4WZM A;  3D1H A;  1SUQ B;  1WJ9 A;  3GZ7 A;  4TVA B;  5DO2 A;  2OD6 A;  5IWA J;  3EPG A;  2G2O A;  3ZKD A;  1LKZ A;  1U7L A;  3BPS P;  1TKT A;  2CRL A;  2WHO A;  4WBF A;  3P3E A;  1OY6 A;  1XNQ F;  4DR7 E;  1SH3 A;  3T1H F;  1W25 A;  3DLH A;  1TZ0 A;  2OPS A;  1N5T A;  4QWD A;  4QYZ K;  2MKI A;  1VC0 A;  4HI2 A;  2DNR A;  3MEE B;  4F3M A;  2E1R A;  5CCL A;  3L7Z A;  3MAA B;  4I2P B;  5DG9 A;  2D9O A;  2V8H A;  2Y8Y A;  4OI1 A;  1ULR A;  2UXC E;  4WXW A;  4LF9 E;  3HUL A;  3UNY A;  2Q6C A;  1PKP A;  2XNQ A;  2F9D A;  4FYV B;  1XR5 A;  4NLD A;  3MCM A;  3OHA A;  5DG8 A;  3UE2 A;  2C3O A;  3NBP B;  1UJ5 A;  4DR7 I;  3TAN A;  5KG3 A;  1Y4S A;  3PW4 A;  1N34 F;  3CD6 S;  5L1J A;  1E3H A;  2VQF E;  1AZS A;  1K73 T;  4GVB B;  3R6G B;  2XHW A;  1OYD A;  3W7B A;  5IWA F;  3CJQ A;  3KNA A;  4JI1 E;  2CPD A;  3V6J A;  4RX6 A;  2P6T A;  5KFC A;  4R5P A;  3OR1 B;  1YWX A;  1SL0 A;  3DRY A;  4JYA F;  1EZZ B;  3J81 C;  4OZ0 A;  4KSE B;  4KHR A;  1Z2L A;  4JI1 F;  2BR0 A;  4JV2 A;  4NLW A;  2XYH B;  3D6F B;  3NG8 A;  4LRB A;  3ELH A;  3GPA A;  4IFD A;  1M5P C;  4JOU A;  3QJL A;  4DR2 F;  3M32 B;  2AWZ A;  1I6J A;  3PW7 A;  4L3K A;  1F9F A;  1JLC A;  1WUU A;  2Z2Z A;  1T9X A;  3DDK A;  4YUD A;  3MR2 A;  4C11 A;  1J5E F;  2NUU G;  3ZKB A;  2BKO A;  2D41 A;  5ETL A;  2C42 A;  1B7F A;  3DRX A;  4PAA A;  2F4V I;  4X4R A;  3MPY A;  1YBT A;  2BAN B;  2RHS B;  2XTJ P;  5J1E A;  4Y2M A;  5C0X E;  2P5V A;  4DDF A;  3JSB A;  4LSN B;  1Y6Z A;  1XNR E;  2JDJ A;  2Q3P A;  5JUM A;  5BJR A;  2HBR B;  2QMU B;  3O44 A;  1TK5 A;  4KFB B;  2B4O A;  3UVJ B;  4WFY A;  3LWL A;  2CNK B;  2PD1 A;  2WB4 A;  4GMK A;  4RW6 A;  4HAC B;  3MFH A;  4JI7 J;  3P06 A;  2V2Z A;  3ENW A;  1HQU A;  4OFZ A;  1HBO B;  4RWW A;  1JXE A;  2LA6 A;  3MED A;  2JFK A;  2OEJ A;  1M5O C;  2YKP A;  1YI2 S;  2GNK A;  4QYR A;  1VQO S;  1RBO B;  3UHM A;  2E44 A;  2F8E X;  2H4Y B;  3AOD A;  4KB7 A;  2HQ3 A;  4OLP A;  2YWH A;  4BHQ A;  1V3R A;  1NK8 A;  4IS9 A;  2HRY A;  3BR8 A;  3DRP A;  4YHH I;  2LMI A;  4ZKA A;  4B3T J;  2W2O P;  1QE1 A;  4LF9 J;  2VOP A;  4C9D A;  2IYI A;  5E3Q A;  4IR1 A;  3PYD A;  1UWB B;  1N33 J;  3M9N B;  3O5T B;  2RIJ A;  3K5L A;  3H1C A;  1YSJ A;  1FA0 A;  2DEI A;  4DN0 A;  1M5H A;  4DZD A;  3VGU A;  1F2G A;  1BQM B;  3AJD A;  4DSK A;  1FEE A;  2HQG A;  3OD2 A;  5T14 A;  1BE4 A;  2CG9 A;  1NJX A;  1KON A;  3N9U C;  2J9C A;  3PG9 A;  4KO0 A;  5F41 A;  2HYI B;  2IIH A;  5FWK A;  1FVS A;  4ZCI A;  3M1V A;  2SXL A;  5A0Y A;  5T7L A;  2MKK A;  5LT5 A;  1NO8 A;  2QL5 B;  2MZS A;  3KMQ A;  4JUZ A;  2JLF A;  5HAN A;  5KFN A;  1XR6 A;  4KQZ A;  1D9A A;  4NCG B;  4Q7A A;  5HVH A;  3HPO A;  2FZG B;  2FD2 A;  1VBY A;  1CVJ A;  4YQW A;  3Q6N A;  2XNR A;  3X1L B;  2B7C B;  3BS9 A;  1VQ7 S;  1HMV B;  3DLJ A;  1RT7 B;  2I5J B;  4PEO A;  3M6A A;  4K2X A;  2WNR B;  1WOO A;  2F8M A;  3JYT B;  2H5J B;  3KLE B;  3H20 A;  5LMN J;  4KQV A;  5A2Q C;  3RU0 A;  3D0G E;  5L9N A;  1LFP A;  3RZA A;  3M85 D;  5F8L A;  3ILJ A;  4CM0 A;  3TZZ A;  5HP1 A;  2F1F A;  2LQJ A;  1F9H A;  1IXK A;  3IRX A;  4B3R F;  3CD5 A;  2PI5 A;  4G1Q A;  1B70 B;  1RT6 A;  4FF2 A;  2HFS A;  2IJF A;  4ZP7 A;  4LF6 F;  3KDN A;  4BC9 A;  1UP1 A;  5C7P A;  3A4T A;  4ILL A;  1HPZ A;  1M1G A;  2BRK A;  1OO0 B;  3CD0 A;  2KZM A;  4F3Q A;  2AD9 A;  4NXN F;  4P2M A;  4CI0 B;  4IFY B;  3WQP A;  4X64 F;  4Q0B B;  5IV4 A;  2E5I A;  1Q8L A;  4BCA A;  1WWH A;  2XSJ A;  4FN5 A;  4K5S A;  4FS2 A;  5C25 A;  4DMZ A;  5KT6 A;  2DR8 A;  3WIV A;  2RQK A;  2XMV A;  1B0V A;  2I6W A;  3MOJ B;  5GAG U;  1SCJ B;  4U8V A;  2JNJ A;  1BGX T;  1YDL A;  3C16 B;  1U1P A;  3I4H X;  4R8U B;  4K4U A;  4OHX A;  2UUA I;  1FJG E;  3AXK A;  4U7U D;  3E8O A;  2ACY A;  2ZIT A;  4ZLJ A;  2UXD E;  4ED7 A;  3HMJ G;  4LFB J;  3MZI A;  4X4U A;  1EKS A;  5A8R B;  2YKA A;  3NBP A;  4IFY A;  5DRP A;  2LA4 A;  4P7V A;  1DTQ A;  2JE6 A;  3M1V B;  2OPR A;  3S1T A;  5JVH Q;  1VJW A;  3EGV A;  3J7A N;  1PYS B;  3I0S B;  2YNI A;  3ETM A;  3ULH A;  1QSL A;  4K0K F;  2BV3 A;  4LT6 A;  1QDU B;  2KKH A;  3UQS A;  4D3G A;  1T05 B;  4JI5 E;  2PT0 A;  3MMA B;  4URQ U;  4GC6 A;  1B64 A;  3CJ0 A;  1LWE A;  2MXY A;  1RT2 B;  3QAU A;  4BA1 A;  2DNO A;  3PFO A;  1YVF A;  4LVN P;  4ZVT B;  4CLZ A;  4X64 I;  8ATC B;  2Q79 A;  4LF5 E;  1C2P A;  5LL6 d;  3WHI A;  4M95 A;  1EET A;  1EA6 A;  1E6V B;  3GU0 A;  3PNI A;  3O8W A;  1Y00 A;  4ZCL A;  4BWM A;  5DRQ A;  1RT1 B;  2QL9 B;  1OYP A;  2XY5 A;  4A8Q A;  2MY8 A;  3TVY A;  1ICE B;  1U25 A;  2AJ0 A;  2L41 A;  5FLX U;  1XHK A;  2MZJ A;  1ARO P;  1OPI A;  4DV5 F;  2AX1 A;  4MFB A;  3T1A A;  2B4U A;  4JI8 J;  3C2P A;  4RO0 A;  5D4L A;  3UD5 A;  4DV1 E;  5L1K A;  4JI3 J;  2PFF B;  1JB0 C;  4DR4 F;  3HD2 A;  4N8N A;  1BHN A;  4BA2 B;  1U4B A;  2MKS A;  4N8O A;  3MEC B;  1SH2 A;  4PPD A;  2NN6 A;  3N01 A;  2FHJ D;  4ZA1 A;  1AFJ A;  1M5S A;  4C8M A;  1J5O B;  2ZBR A;  3SQG B;  5L38 A;  3HT3 A;  1S49 A;  1VFJ A;  4LSN A;  5LSL A;  2RAQ A;  2L9W A;  4ZPB A;  5KFD A;  1LV5 A;  5HLF A;  3M2V B;  4AE5 A;  5EGY A;  2BA0 D;  1RE1 B;  5M2U A;  2QO3 A;  3LP2 B;  5LSR A;  2P2C B;  3NNA A;  4FNI A;  4DBQ A;  4YHH F;  4JI2 E;  1QAI A;  2EFP A;  3MAH A;  1XJW B;  4DV3 J;  4ZVP B;  3T6B A;  1RT7 A;  4JI0 J;  2DRA A;  3OR2 B;  3W8G A;  4I67 A;  2UUB I;  1JLF A;  1C4A A;  2E5L I;  4OJ1 A;  1FWP A;  4URL A;  3J7Y I;  5I3U B;  1IJF B;  2MQL A;  3RRG A;  1FJG J;  1RLC L;  2C2O B;  2KJV A;  3QIP A;  3R8Y A;  4UOH A;  3ZZP A;  1FJG F;  1L3T A;  4DV5 E;  5IT9 Q;  1JK9 B;  2ZH5 A;  4TU8 A;  2D74 B;  2CQI A;  3LUY A;  3MM7 A;  1VYA A;  2VG5 B;  4RW4 B;  2BA1 G;  4JI4 E;  2F5G A;  3GLJ A;  2EBG A;  4LJM A;  3QFW A;  4CH7 A;  1U1L A;  3D1Q A;  5D4P A;  3DM2 A;  1FK9 A;  1EIY B;  1LEO A;  3O3L A;  2JEB B;  4FBT A;  1S77 D;  4BA1 B;  3NWG A;  2ZZM A;  4NLO A;  1ZYQ A;  1CS4 B;  1M0S A;  2GJF A;  2MKH A;  2RVJ A;  4FKY A;  1LOU A;  5B0D A;  1RXO B;  8RUC A;  3FCV A;  1TQL A;  3OTC A;  3PJ9 A;  5C24 A;  4UZB A;  1V6H A;  1GAO A;  2RKI A;  4CH1 A;  1SPB P;  3ZNU A;  4PU9 A;  4CLS A;  3T1Y I;  4QPT A;  2GGP B;  5KG1 A;  2JSX A;  3TW0 A;  5C42 A;  4ECS A;  3PO5 A;  5DNL A;  4OO1 F;  2B5J A;  5A8K B;  1IBL E;  2UU9 E;  3MEG B;  3NZK A;  2AYG A;  2EG1 A;  5AJ3 J;  1NCL A;  4J91 A;  1S6O A;  1S1T B;  4IOB A;  3S7R A;  3UW1 A;  2RRN A;  3K5M A;  3K5P A;  4RW9 B;  1N6Q A;  4O3R A;  5LOQ A;  2X51 A;  1UVL A;  2LQB A;  5HK4 A;  1MMN A;  2FQQ B;  3IC1 A;  4CNY A;  1RAB B;  3DLG A;  2YPY A;  1HYS A;  5B0C A;  1H74 A;  3KHL A;  1UVJ A;  2N4C A;  4O3N A;  2C2K B;  2KFZ A;  2YKO A;  1NJY A;  1TKD A;  4HYM A;  5GAH I;  3G96 A;  3EPI A;  4RWX A;  2BQ3 A;  1R8A A;  4PCQ A;  1WNE A;  2DBB A;  2WVE A;  3GV7 B;  1HK7 A;  4ZVI A;  3C6U B;  2DY9 A;  4N56 A;  1R31 A;  2HQC A;  3BZQ A;  1HPZ B;  2J9E A;  5GME A;  4DUT A;  4E98 A;  2AJ2 A;  4J90 A;  1KEK A;  1FRX A;  5CXT A;  5AE3 A;  4PWD B;  3C8Y A;  2LKZ A;  5CYM B;  2QLB B;  2CPX A;  3OVB A;  1PKU A;  2M0G B;  3W2V A;  4F4W A;  1IBM J;  1K0T A;  4LFB E;  2CVI A;  3WX8 A;  3P45 B;  5L39 A;  2PI4 A;  2R7V A;  1LK5 A;  3FFI A;  5F8M A;  1N34 J;  4LF8 J;  3DU5 A;  3HHL B;  3BKU A;  3D6T B;  2V94 A;  3BBB A;  3MM8 A;  4PPZ A;  4A8K A;  3ZM7 A;  1GMV A;  3N4W A;  4OO1 B;  5AT1 B;  4DV5 J;  3DM2 B;  3DXB A;  5DQG A;  4F50 A;  1NZ0 A;  2IPO B;  2ASD A;  1UW9 A;  3HVT A;  4MJK A;  5HQL A;  4BA2 A;  1HQE B;  2RE1