1KKHA

Crystal structure of the methanococcus jannaschii mevalonate kinase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
317
structure length
317
Chain Sequence
b'PRGSHMIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mevalonate Kinase
publication title Structure of the Methanococcus jannaschii mevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 104
structure length 317
sequence length 317
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2001-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1kkhA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1kkhA01
2CZ9A 1H7SA 2HFUA 3B78A 4YHHI 1HNZE 4B3SE 4JI0E 4DPYA 1NHHA 3J7AM 4P52A 1XMQI 1N33I 1VISA 4Z7CA 4JI6I 4USMA 3T1HE 4DV2I 3QT6A 4X65I 4DV0E 4RPFA 4PRVA 4FWGA 3OTOE 3K17A 1DARA 4JV5I 4DR2E 1N0UA 4DUYI 3J80Q 4LF9E 2WW4A 4DR1E 4JI8I 5IWAE 3JAMQ 4JI5E 3ZKBA 4NXNI 4URLA 4JI2I 4LF7I 4GKKI 2UUAE 2A2DA 1IBLI 1Z5BA 4LF4I 1XNQE 1Z0VA 4LFAI 4P7AA 1Z0BA 3GONA 2HK3A 1FJGE 4B3ME 4NXME 4GKJE 2X7IA 4JI4I 4LF6I 4DR4I 1ZM3A 1U2RA 4JYAI 3F0NA 2VQEE 1ELOA 1ZM4A 2GS8A 4DPWA 4FW9A 4KHPI 2XEXA 4DV3I 4I3HA 4X65E 1HNWE 4HACA 2HFSA 4MYTA 1EI1A 3QT7A 4M1KA 2UXDI 3HULA 5FLXQ 1H74A 3CWVA 1RREA 4NXNE 4GKKE 4DR3I 1KVKA 2R3VA 4HY1A 3WU6A 4X66I 4DR6E 3V5RA 4LF5I 4DPUA 1ZXMA 4K0KE 4OX9E 1HNXI 2UUCE 1Z0WA 4JYAE 4YY3I 1IBKE 4DV4E 4DU7A 3D4JA 4X64I 4JG4A 1XMOE 1N34E 2VF3A 4X62I 4USKA 4DR7I 4HXZA 1NHJA 3J81Q 2V8PA 3WU3A 5IT9C 3PYDA 4XTJA 1HR0I 5A2QQ 2BM1A 4DUZE 4JI1I 5LMNE 3T1YI 2VQFI 1IBMI 5BR8I 4LFBE 2DEJA 3LTOA 4DR3E 1B62A 4WUCA 4WUDA 4JI7E 2ZBKB 2HHHI 3LPSA 2HKEA 4DR5E 2UUBE 1XNRI 1NHIA 5LMUE 2F4VE 2ZM6E 3J80C 4LF8E 1FNMA 4JI3I 3JAMC 1I94I 2BM0A 4YHHE 1Z5CA 4DR7E 1XMQE 1N33E 3B82A 2UXCI 1Z0GA 1BKNA 2UU9I 4JI6E 4DV6I 1S16A 5LL6R 4DV2E 2E5LI 1N36I 3B8HA 3ZM7A 1H72C 1NZ0A 4B3TI 4JV5E 1RR9A 4DUYE 1J5EI 2V2VA 4JI8E 4JI2E 4LF7E 2HHHE 3V2UC 4FWHA 4FWDA 2EFGA 1IBLE 3QT8A 2BV3A 3T1HI 4LF4E 4LFAE 1S4EA 1Z0TA 2V2ZA 3LNUA 4JI3E 5FLXC 3OTOI 1XHKA 4DR2I 3J7AG 4LF9I 4JI4E 4LF6E 4DR1I 4DR4E 3WU5A 4R1FA 4AQYI 5L3JA 5IWAI 4JI5I 1FWLA 3ZZ0A 4DV6E 4KHPE 3PYGA 4DV3E 2UUAI 1UEKA 2HKJA 2E5LE 4DV5I 1ZM2A 4Z7YA 1KIJA 4PU9A 2DEIA 2UXDE 4PRXA 1FJGI 4B3MI 4NXMI 1J5EE 1PVGA 4GKJI 1Z59A 3PYEA 4DV7I 3ZZTA 3K1JA 2VQEI 4KQVA 1EA6A 3J81C 4B3RI 3PYFA 2AJ4A 5A2QC 4X66E 1Z0CA 4LF5E 1HNWI 1WUUA 1FI4A 1PKPA 1Z5AA 2UXBI 2HK2A 1HNXE 2Q2EB 2V34A 1A6FA 4ZVIA 4AQYE 1H7UA 1MX0A 4YY3E 2A2CA 4X64E 3QT5A 1MU5A 4FN5A 4X62E 1KKHA 3WU4A 2X36A 2NPFA 3ZKDA 4DV5E 1N32I 3ZZUA 4DR6I 2LJPA 1HR0E 1D6TA 4DU8A 3M6AA 4K0KI 4LFCI 4OX9I 2UUCI 4JI1E 2J7KA 4DV1I 4DV7E 1ZM9A 3Q1QA 2ZITA 4DPTA 3T1YE 2VQFE 2R42A 1IBKI 1IBME 5GMEA 5BR8E 4DPXA 4DV4I 2V2QA 4B3RE 1HNZI 4B3SI 1XMOI 4HYMA 1N34I 4ED4A 5GMDA 4JI0I 1FKAE 1K47A 3H4LA 1N0VC 1XNRE 2UXBE 4DXLA 1ZXNA 4DV0I 4EMDA 4DUZI 1OJ4A 4UT4A 1MG7A 2OI2A 5LMNI 1I94E 1Z0EA 4HACB 4LFBI 4UTGA 4WUBA 4MYUA 2UXCE 4JI7I 2E1RA 1FWKA 1N32E 2UU9E 4DR5I 1PIEA 2UUBI 1QZRA 1N36E 1KTVA 4LFCE 1XNQI 1H73A 5LMUI 2F4VI 2ZM6I 1B63A 4LF8I 4DV1E 5IT9Q 4B3TE
chains in the Genus database with same CATH superfamily
2CQDA 5EKWA 4ILLA 1QY7A 2WAQD 3BJYA 1HK7A 1RE1B 4DV0F 1XMQI 2FHJA 3GTYX 1K73T 1AROP 4JI6I 2F65A 3KXDA 1T9WA 1RAHB 5SUHA 3IGNA 4X64J 4NCAA 3CWJA 3ET6B 2HVEA 2XS7A 3EPGA 1FHTA 1S1TA 1Y5LB 1B0PA 2RRNA 1WORA 1C4AA 3UI3A 3KYLA 3D0IE 4PZVA 5KFUA 1CC8A 4QW8A 2PE8A 2VQFJ 2FY8A 3ZTSA 1L3UA 3DCAA 2B9XA 5DZ7A 5HL7Q 5DG7A 4LOMA 1OY6A 2BUNA 4MKAA 3PG9A 5EHHA 1U7LA 4MK8A 2VPYB 5KG5A 1X9WA 1Z1ZA 1NK5A 3K7RA 4ED1A 1WG5A 2C37B 4I3HA 4F26A 3DOLB 5KFHA 5J1EA 3PRDA 3KK1A 4A48A 4DR6F 2BJEA 4X2BA 1DJ0A 2P9EA 5LJ3Y 3Q89A 1NK8A 2VG6B 4Y2MA 2DPIA 2XZTB 4WFXA 3H1CA 3TAMA 1M5SA 4DV4F 4AIDA 3C14B 3TEHB 2WONB 2FZKB 4DSLA 2LXFA 1Y10A 4DV0J 4DUZJ 3VTIA 2BW7A 3HKMA 4DR7I 3GPAA 1HBOA 1LFWA 4P2XA 1UVMA 5FDLB 2FGCA 3PYDA 1QSSA 3HHKA 4ID8A 3SCKE 4WCEQ 1WEYA 1YJUA 2W2QP 2KTQA 2L48A 4DUTA 1JK9B 4ANDA 4OYMA 2F4VF 4ED8A 1UETA 2XMVA 4J9VA 2F8MA 3DOMB 2YKOA 1R27B 5K8OA 1RB0A 1S9FA 5LMUE 4QZVB 3GJQB 3IR5B 4FXWA 5KT2A 2UVRA 3ONQA 5D0RA 3VHQA 5I3UB 2FJAB 1JJ4A 2MSTA 3L9ZA 2YKQA 2XGPA 4JBCA 3MEDB 2UXCI 3G4SS 2GIQA 2CNLB 1V5IB 1RYSA 3M9OB 3W5ZA 3B8HA 2CJQA 3LWLA 2DRBA 5J2NA 2NXEA 1U49A 4DR6J 4TVAB 1HI1A 1PAEX 2B4VA 2DPJA 4IFDB 2HHSA 3NG8A 3DU5A 2B0GA 3I82A 4C8KA 3A13A 1QUPA 3GIRA 1WSRA 3FNNA 3PKYA 4ZPDA 2CXEA 4DV4J 2O1UA 1UW4A 4BA1B 3JSRA 4DSJA 4HTJA 1TKZB 5ELWA 4OZEA 2XY5A 5J2QA 1UFWA 4NLRA 4ECUA 3QATA 3DKDA 3NBPA 1YRTA 1JMTA 2JT2A 4FXDA 1ZA1B 3WBZA 1W2IA 2C3OA 2ROEA 4KGKA 4M5DB 4J3DA 2MXYA 1D8YA 1J5OB 3J7ZT 1D9DA 3SFGA 4A8XA 2B9YA 3QWUA 4C3MA 2D1CA 4JV1A 3CCVS 4DL4A 4X66E 4DCOB 3PXGa 1KQSR 5KT3A 4GQUA 3CC4S 1RQ0A 3LP0A 3OT9A 3W8GA 1R31A 1T03A 1AYEA 2MMYA 3M85G 2NPFA 2X36A 4NLYA 5H9EJ 2FZCB 1N32I 2DXEA 3ZZUA 4PG7A 5F41A 4CLUA 3VQTA 1SL2A 4H4MB 2J7UA 4IOCQ 4YR0A 4JI1E 3TZXA 2R4FA 4HYMA 1N34I 3Q8UA 2F5GA 2MLXA 3R27A 1RTHB 2EBGA 1QSLA 3HJCA 4LRFA 4CLTA 4I7FA 2FVSA 3OXGA 3DN9A 2N4DA 5LMNI 3W64A 2MHEA 3S6EA 2C39A 4EGLA 1PYSB 4MYUA 3CDBA 2FLPA 2UU9E 4CNYA 4B3SF 1U45A 3I56S 3OVBA 2VU5A 3M32B 1BGXT 4DV1E 5HI7A 4K4SA 4R8UB 3UVJA 1T9VA 3A8JA 4IOBA 3IWLA 2PNMA 4KGXB 1FRJA 3MPDA 1NH8A 1FJCA 1MWYA 2GGPB 4AQYF 3QT6A 3W2WA 1TK5A 4JUZA 2GQCA 3AAWB 1L3KA 4P7TA 1WOSA 3IC1A 5B0CA 4KFBB 3BN4A 1VQOS 4LF7I 1FJGF 4LCFA 1IVZA 4ZP9A 4LFAI 3IFEA 2CPEA 3FEZA 1RWXB 4A8QA 4NOHA 3DYAB 1C0UB 2WHOA 4LF6I 4MKVA 3EWGA 4O3NA 1CJTA 3MEKA 4KHPI 1VLYA 4OLOA 2CJBA 2HMIB 3GFYA 1RHQB 4JV0A 2CWXA 3Q23A 3HMJG 2UXDI 3AY0A 4A47A 1RWMB 3R5CA 3T41A 4HYKA 1KONA 4PCQA 3TOQA 4Q8FA 2YH0A 4B17A 2ZVSA 4J7CA 4PQUB 2BBEA 5F8JA 2Q6BA 3E8OA 4QYZJ 4B3SJ 2QMWA 4OI2A 1QTNB 4ZP7A 4A8WA 2DHSA 3H40A 1R0BG 2PMHA 1DLOA 1RI7A 3FEYB 3HFZB 1NPKA 4DQQA 2C42A 4K2XA 2BANB 1FKPA 3N9UC 4ZVUB 4LRCA 2KO1A 3P4UB 5AXNA 5F8MA 1KSPA 2XCAA 2EXUA 2V2KA 5K36E 1EZZB 1RT2B 3LTOA 1URNA 2ZKTA 2KB2A 5KFIA 4EI2A 9RUBA 3H42A 3IS9A 3IRWP 1FJGJ 2LQ5A 2E9ZA 3G8QA 2Z5EA 2PC6A 4ZKAA 2ZDPA 4ZVFA 3GE9A 5KG1A 3KUHA 1TFYA 3JQMA 4ZVQB 2IM1A 3PW2A 4J9NA 1SC4B 1NK6A 3M9MB 5L1JA 2L3MA 3PW5A 2HHQA 4OQJA 2C38B 2KYZA 3SSSA 1JJHA 1S16A 4OKGA 3GSIA 4P75A 3HVRA 2IHR1 4JI8F 1TR0A 3QLHA 5DROA 1S1WA 5ETQA 4OI1A 2J9DA 3Q24A 2W2OP 3GJRB 1FTRA 3WIUA 4IS9A 2JJ4D 4C6AA 3H0PA 4FW5A 4FPRA 4JI2E 4L73A 1TL5A 1RT1A 3UQSA 4YUDA 3DLHA 4LF4E 1B0VA 1U1QA 3M8YA 3VCDA 5D0EA 2RE1A 1OIAA 2K3IA 2FUG9 3BGLA 3IAM9 1RHJB 1N5YB 4WFBQ 4V19X 2O66A 1HWLA 1CPZA 1X60A 2MZJA 1JLQB 1KLMB 2BJDA 1KDNA 4IQXA 2XWXA 3UE2A 3F44A 3QJLA 1KIJA 3W2VB 4P2MA 3SQGB 1PC4A 1R8HA 2O67A 4ES3A 4NE9C 1EETB 2JOQA 3FQLA 2VFTA 4IFDE 1S1VB 3CCWA 2J8AA 4YN3B 5DG8A 4I56A 4J5OA 4C3LA 1BE4A 4Y00A 3MURP 1AZSA 1NHVA 2G0CA 1H6KX 1Y4ZB 1SKWA 1TL1B 2AV5A 3MMJA 4NI2B 2XZWA 4I2QB 3ZZYA 1W25A 3GIJA 2ZJRQ 2VJUA 3HVTB 3HDSA 3RR8A 4JI8J 1NPRA 5E3QA 5HMZA 1DHMA 3PW4A 4DV1I 2RUSA 2DNOA 4J91A 1XNRF 2UXBF 2YPYA 1WEXA 5FD1A 4B3RE 2VA3A 2VPXB 5DDQC 3US5A 1RLDA 4MK7A 5A0YB 2VICA 2ZDOA 3R7NB 1LXNA 2CPYA 5MAOA 3DRPA 3DDNA 3TZYA 1WI8A 3N6NA 4KT0C 4UOHA 5DDOC 1APSA 4EBEA 3W3SA 1BLUA 1Z2ZA 3DXSX 2F1DA 3TNVA 2OPPA 4FBUA 1E6YB 1TL7A 4LR9A 2L9WA 1CULB 2DGQA 1V3RA 5DM6Q 1HL6A 4JI0E 1Q5VA 4F0KA 4KQZA 4M5JA 1S57A 4I2PB 2G0IA 4DL6A 3PS3A 4X4OA 1HW8A 4L3KA 4FW7A 4YEAA 2HWTA 1UA0A 2WVFA 5IM0A 3W5YA 3OTOE 4JV5I 2ASLA 2MLYA 2G13A 5K8PA 1UKUA 4WBFA 4O0NA 1R8PA 2P5VA 5LXRA 2ZD1A 1RJJA 3VGVA 1RWVB 2DGOA 2Q6CA 2UUAE 3DMJA 3DC2A 2XY6A 1QSYA 2KXFA 4TY9A 3VAFA 1YWXA 1S1UB 2CQ3A 3NS7B 4AFFA 1UJ6A 2X1BA 1B0TA 2KRBA 2GMJA 1XNRJ 3BH7B 2UXBJ 1HNWF 2PEBA 2H1YA 2CJYB 1CSJA 3EGVA 3P45B 3K0JA 1RAIB 4IFDC 2RT3A 2POKA 4GC7A 5DS7A 2AE8A 3TP2A 3EZ5A 2AEJA 1Q79A 1YKWA 4U95A 5JEAD 2BQ3A 2K1RA 1S9EB 4NYOA 1F2GA 5C0XD 2ZE2B 4ZOSA 1H2VZ 5K14B 4NLUA 3R1HA 4DPUA 1ZXMA 5L38A 5K36D 4OHYA 1FEHA 1HNXI 3MEGA 3TUIC 1IKWA 3PEJA 2WTFA 1N5QA 3J80Y 4ISAA 3UDEA 2IAJA 2CYYA 2R7QA 1HNVB 3AQPA 4N8OA 3M7ND 4KY3A 4HXZA 1SJ3P 3WU3A 1RHRB 3ZZOA 5DRQA 4CP5A 2VBXA 5AXMA 4DR5F 4HT7A 3VAIA 3CJKA 4LF8F 3THTA 1LEOA 3AOAA 5B0FA 1HBNA 3R8YA 2OPSA 3OVAA 1QM9A 2E5HA 3QGPA 1FNMA 4O3RA 3HD1A 1WHYA 1GT8A 1NJIT 1P9QC 2XNQA 1U1PA 2ALZA 4Q0BB 4YHHE 1HNWJ 5IQ6A 3C16A 1JJ2R 3I0RA 1RAAB 3UDLA 3PO4A 3QSYB 2EW9A 2Y1LB 4ZIVA 1RT6A 2XB2D 2JEAB 2CQPA 4NXNF 3H2UB 5LM7E 5HMWA 1R0CB 2O1PA 3GB0A 1KWMA 2Y1RI 5K20B 1OO0B 4UUWA 2GC8A 2QL5B 3V6DB 2H5EA 4IH7A 3SV3A 4YB1P 3QT8A 1RADB 3V81B 3IM9A 4PAAA 4DLEA 4KH0B 1JWWA 1X7VA 2CKWA 3J7AG 2D3OR 1T95A 3I9V9 5KFLA 2BRLA 4LF9I 4Z2XA 2DR5A 1ZAXA 4LR7A 4JI5I 2HFZA 1JLEB 3CCLS 2RHQB 5F0WA 1FRLA 2IFXA 1AT1B 4BS2A 1TK8A 4C48A 4J9QA 3UNGC 1RHYA 2CPFA 2DEIA 2MDAA 3W66A 4DR5J 4ZP6A 4LF5F 1VR6A 4B3RI 3V4IB 4LF8J 3MM9A 3BH6B 1IKXA 4OHVA 1RUSA 1HNIB 4PRFA 2W7OA 3POTA 3BB5A 2R7WA 1BWVA 1AFIA 4XTTA 1R7IA 1MWQA 2LDIA 2YNFA 1SJFA 2QT7A 1MMDA 4RW4A 3SXLA 3PRYA 1JXVA 2CPHA 2VBYA 3CDWA 1YI2S 1MU5A 1FRIA 1JX4A 1RTIA 4Q2LA 3BBBA 4M5MA 3L7ZB 3OHAA 3ZNJ1 1IBMF 5BR8F 2P6SA 3PRBA 1HR0E 1D6TA 2SXLA 5JEAA 1AUDA 4KO0A 4AL6A 3VAHA 2YNHB 5C42B 2ZH7A 2HFNA 4PXCA 3ENWA 5I3QA 4OV6A 3ISND 4JI0I 2OD4A 2FVPA 2JHEA 2MTLA 3BQ1A 3AJ2A 1I94F 2VBWA 2RDJA 2YY3A 3U1YA 3R7BB 3V4MA 3MECB 2DR6A 3S01A 2YH1A 4TY8A 1S5ZA 4ZN1A 2CNOB 1LQ9A 4DFMA 1N36F 3DGPB 4TYAA 1NDLA 4B3TF 1UDNA 4FZVA 2HQDA 3Q2SC 3CT9A 3SZ2A 1B63A 3D6TB 4DL7A 4RNHA 2GO3A 1X4AA 4LF5J 2VESA 3D0GE 3PNIA 2JFKA 5KFEA 4R25A 3EXYA 4URQU 1JLAA 4QU6A 4HR2A 4NPOA 5KFBA 2C3UA 4HT5A 5GMKa 4FWGA 3LO3A 1S4FA 1LWFA 1N0UA 4P73A 2QG9B 4DX8H 2YKNA 2HG4A 3AQOA 4MIWA 3D6FB 1KC8T 1GQEA 3QJJA 2LVWA 2A2DA 3DU6A 3PACA 2KG0A 1H38A 3AJDA 1IBMJ 5BR8J 5U47A 2IESA 3GLJA 2VQEF 3EUNA 4LBPA 1HQUA 4WKYA 1S48A 3J80U 2RIJA 4OO1F 3FCWA 4NLPA 3BKUA 1NAQA 3A3PB 2FC9A 3DOKA 4HKQA 2GQ0A 3MM8B 4DV3I 4X4SA 1I94J 2C2NA 4O3QA 2N7CA 1USUA 3Q6NA 4HACA 5DNXA 2DH8A 4DZDA 1H74A 2IJRA 3M2VA 1N36J 4QR1A 2YQ3A 1BHNA 3KWMA 3IRXA 1AB8A 4OX9F 4B3TJ 3DLBA 1VRTB 4C0HA 1DQ9A 4ECSA 1RBAA 3V5RA 1IBKF 4MFBA 4OZ3A 4UY85 1GK8A 3I55S 1XMOF 4ZVOB 1Q8KA 3LUYA 1Q8LA 2UUCE 4WP8A 4AXIA 1YDLA 5IV4A 4OO1A 4JYAE 1WTBA 3UD4P 5HBMA 1H7XA 4X64I 4HHJA 2J0XA 4UUXA 4ZHRA 1YHQS 1LKZA 3JTNA 1RCOB 2RF2B 1NRKA 3KJFB 2VPWB 4KV8B 4MIBA 1HBMB 2RU3A 2MQQA 5A8WA 3IMQJ 2MQMA 4OZ5A 2VQFI 3NCPA 3N4WA 4RW7A 4ZVRB 1U25A 4JI7E 1Q4RA 2JLEA 1TMMA 3R5BA 1BQXA 2PO2B 1PO6A 1RA7A 4U8YA 2GVDA 2VQEJ 3AT1B 4DR7F 3CULA 4GC6A 1BC6A 7FDRA 2VONA 5FLXY 2P2CB 4CT9A 3DLGA 2R7RA 2Z30B 3UR3C 2V6AA 3MAAB 4NL5A 4DS4A 2FLNA 3DHWC 4TYBA 4C11A 1CJKB 1YJ7A 1JLGB 3ZTOA 3CDAA 2C1EB 3CJ3A 4UOFA 2MGZB 2VASA 1T11A 1N88A 3QNWB 3HVAA 4OZJA 3CF5Q 3IBWA 1NSAA 2QIFA 1GMWA 4OX9J 4BCAA 3ZNUA 3MAQA 3CGIA 3CW2C 4FWDA 2OSRA 2V8GA 4FF4A 4IFYA 4WP3A 1IBKJ 3NGTA 1XMOJ 3TRGA 2GQ2A 4KHRA 3B4DA 4QIVA 3CCUS 3PR4A 2W2PP 3NMAA 2DNRA 3VZIA 3H4BA 4DV6E 2YNIB 1DTQB 5KFKA 1WSVA 2O3DA 2GW8A 4F67A 2V0NA 1BQNA 3AHPA 4RNNA 3MMCA 4HEA9 4I68A 4U6PA 1CEZA 3HHLD 4QBUA 2OKQA 3EVMA 3Q6MA 4OZ2A 4PG5A 2HBRB 3M8WA 3JQKA 5HANA 1FX2A 2LU1A 4LCGA 2C2EA 2PA8D 4F0MA 5F8HA 2HK2A 4DR7J 4X62F 1F60B 3P49B 2NN6D 3CCZA 1DZ5A 3NKYA 3FSIA 4AQYE 4YY3E 4KKOB 4BWJA 4ZPBA 2M4MA 1GXTA 3TVYA 4NCGA 3QWPA 4ECWA 4OYPA 2KN4A 2W01A 4ECYA 2ADCA 4DR6I 1FCAA 3D7SB 1UPMB 1HI8A 2VG7A 1FA0A 2DNZA 1VQKS 4C8LA 4KIAA 1F5AA 3Q1QA 5L1LA 2LFVA 2Z0GA 1NZ8A 3DM2B 3NGSA 5GMEA 3THVA 4DV4I 2RU9A 3T5HA 2OP5A 5M2UA 2NLWA 1LWEB 3Q8VA 2NZ4A 4OHZA 1SV5B 2HNDB 5ETVA 4PUOA 1KTQA 3GZ7A 2UXCJ 2GMHA 3C15A 2DGTA 3E01B 4HI1A 2M5YA 5KFPA 1N32F 2JDJA 2N82B 3KTQA 4CLKA 3KG0A 4WUBA 4M8LA 1K44A 1RTDA 5G0RB 1YK9A 4C98A 2EPIA 2OELA 4PPDA 4MU4A 4XDDA 3EYZA 2FVRA 2HVZA 2KVQE 3KLHA 2F4VI 2KRRA 1TUWA 3P3DA 5CD4H 5DLFA 3C3LA 1SUQA 5FWKA 3MCSA 2CQ0A 4QWBA 3J7AM 2XSFA 1VISA 1JNZB 2BZ2A 3NGKA 3W8PA 4Z7CA 1MROB 3A8KA 5KFJA 2VIHA 2ATCB 2LEAA 6FD1A 2PO1B 1M5HA 4WZMA 3RB3A 4X62J 1QE1A 2LMIA 4ZCKA 1V5VA 4DR2E 1F3VA 5GVQA 2A18A 1C2PA 1ROFA 3M85D 2M2BA 1QDUB 4YFUA 2XSJA 2ASDA 4DQSA 3L4BC 2BA9A 1BD6A 2C3YA 1HD0A 3HD2A 1OPZA 4U96A 3ZTQA 2V5HG 1TV6A 1SCJB 2RKIB 2F9JA 1IKYB 3LP2B 3TWZA 3BQ2A 1UA1A 5E0OA 4JYAI 2C2DA 4IG3B 1ZM4A 4KB7A 2MY7A 5T7LB 4PR6A 1ZH5A 4EBDA 1IKVB 2HBQB 3U1NA 4K2JA 2G0JA 4EZ6A 5B08A 1HQEA 2XS5A 2NREA 4KTQA 3N79A 3ENVA 1N32J 1Z2LA 2K8GA 2RNEA 4C2MA 2BABA 1VCTA 3VAKA 4GKKE 2EKNA 3AFGA 4LRAA 3P96A 5DLGA 4NYPA 3OHBA 3UN3A 4DOZA 3R1LA 4P71A 5FLXU 3TX0A 1BY9A 4KE5A 4DU7A 3P3GA 5KFQA 2KJVA 1I1GA 3QFHA 3O1LA 4HDGA 2DHHA 4F4AA 4NLGA 1PJ6A 4FVCA 1TL4A 5ETOA 2A6OA 9ATCB 3M30A 4DJBA 3VGSA 2LLZA 2P9CA 2DIUA 1I3OB 2XO6A 1U6BA 4PEOA 3PW0A 3CDEA 3NY0A 5LMUF 1BXNA 2HNYA 2FTRA 1B62A 3KJNB 4WUCA 4FYWB 4YP3A 2ZBKB 1K0VA 4F02A 2RQKA 2HNZB 2PIIA 2A3JA 4X4RA 2G2YA 2BVZA 2Z8QA 1O6XA 3QGHA 1R8CA 3J80C 1W2BR 3HVWA 3KJVA 3OLAA 1Z5CA 2XZDB 3N6LA 4DV6I 3HHNB 3GG1A 4DV2E 5D0HA 2XHWA 5HROA 3ZM7A 1S6UA 4K5SA 2C28A 3LGNA 4DUYE 2ZBIA 3ITHA 1T05A 2OSQA 2ZH6A 3MR3A 1XXEA 1S6PA 3LPYA 1RWWB 2WP8B 1FT8A 3UWTA 3W61A 2XMJA 2F4FA 2BV3A 2HHWA 1JLCA 3DOKB 3LNUA 5EGYA 1E6VB 1DQAA 3R5DA 4CO3A 3VWSA 3U1MA 4BA2B 4PQAA 4JI4E 1N5VA 2KT2A 3WU5A 3PJWA 4AQYI 1H98A 1Q7LB 1RP5A 2I2YA 2F7VA 1RHMB 1SH2A 1NUEA 4O0IA 1UVLA 1UFLA 2K3KA 3LP1A 2GO8A 3MR6A 5M2RA 1FJGI 4X66F 4JB8B 2COLA 4QNJA 4KR0B 5GADU 5LMUJ 1EA6A 5DNLA 2OJ3A 3NOGA 2EK1A 3RTVA 1UVJA 4ZVHA 5I4MA 1RTJA 3J7AN 1YX2A 4E0DA 3TUZC 2PGCA 3JSYA 3Q8SB 4PWDA 2NPIA 3L3CA 4LPFA 2J7WA 3CEDA 2NXJA 4L76A 4B3OA 5LOQA 2AX1A 2FJBB 2V94A 2QMUB 2FD2A 4LSLB 1YBTA 4JI1F 3CO0P 1RDRA 4OZNA 3RGIA 4LBIA 2LJPA 3DLKA 4M5GA 3K85A 3ILIA 3N28A 1OYEA 2XMMA 1DTTA 1FNXH 4K4VA 3O5TB 5C24A 1TKTA 4ECZA 1VYAA 3QIPA 4G1QB 2LQJA 3FEXB 4LF1A 1RKIA 4W4MA 4M63A 2UU9F 4IDKB 3I5CA 3U27A 1XN9A 1S6QB 4WE1B 2NXCA 5KG3A 5HLFA 1IM4A 1FXLA 3M8PA 5AXLA 2CRLA 3MD3A 3W65A 1TVRA 4DV1F 4WK3A 3HKWA 5EDWA 4M5LA 2JE6A 2BQRA 2EC0A 3UR0A 2MYFA 4RBUA 4CTAB 5GAEU 5IZHA 5IT9Q 5D4OA 4I69A 4X66J 2Y8WA 4GVBA 1TL3B 2EI5A 5DQHA 4QR0A 2QMXA 2V9KA 4ZLLA 2BE7D 3JSMB 1NPPA 3T1HE 4A8SA 5M2PA 4IKAA 1U0HA 2H9ZA 1ZAVA 1PILA 2PEHA 2FJVA 2VDHA 2DT9A 3K17A 2PO0A 2Z58B 4DR1E 3EMTA 4JI8I 2GJFA 3JAMQ 3U7JA 3AA8A 4JI1J 4GKKI 3KLGB 3GV7B 2JEBA 4KBIA 3ICLA 3KLIA 1C1CA 3UCGA 4I6YA 2ZJQQ 2N3OA 4ELUA 4NX9A 3Q0AA 4NXME 2CNKB 1WC0A 2ZH9A 2VODA 2ZOFA 3GSDA 4DPWA 5JVGQ 4IZJD 3SSRA 1OYDA 2Y1JA 4ICLA 1K1QA 2AJQA 1NZAA 3FFIB 2HZVA 3U02A 4P10A 2IOPA 4ZJLA 3BPSP 5KG0A 4N41A 5DDPC 4E8UA 3VVUA 2EG2A 4NXNE 1ZTWA 2X1GA 1HW9A 1VBYA 5CZXA 2AIRB 5IXUA 4DV1J 2PFFB 2IC3B 5K8MA 1VOMA 4F2RA 4K59A 4YR3A 5KTQA 1NB7A 4N56A 3MCOA 2OUGA 1WACA 1U6FA 3IA0A 4USUA 2ALYB 2B9EA 3NGRA 4DG1B 2R2SA 4B08A 3ET6A 3PTWA 3RAXA 1YBAA 3QGGA 4DCPB 5K36F 1J27A 1FK9B 4UOCA 1NJWA 1SH0A 2QLBB 2IMOA 5D6GA 2UVUA 4DUZE 1CC7A 1Y9OA 4O3PA 3VAGA 1DY3A 3WC2A 4IYQA 2DEJA 5C2GA 4U7CA 4DR3E 5HQ8A 4L6V3 4J9RA 1FWPA 1XNRI 3PX0A 2FDNA 1FJEB 4DFKA 3RW6A 4LF2A 2ZM6E 1UFKA 1RLCL 4RWWA 3MUTP 2C37A 3DOLA 3LAMA 2OEJA 4LQ9A 2CPZA 1N33E 2OFHX 5J1PA 3MEEB 2GVZB 1E3PA 2YWHA 2BYCA 4ZMMA 1GEHA 2BE2B 4CDIA 3VALA 2AP6A 4JI2F 1Y00A 4NA3A 2DRDA 1C4CA 5ETLA 2KI2A 2VG6A 5EWEA 4XIUA 4LF4F 7AT1B 1HYSB 8ATCB 3L7UA 3K58A 4CH1A 1UVNA 2WONA 4O44B 3UDVA 2NSBA 2Y0SD 1A7GE 4TXSA 4Z37A 1PBUA 1IBLE 3CCJS 3EZOA 1D8ZA 1VK3A 2HAFA 5L39A 2P6TA 3AB2B 2V4JB 5A2QY 2CGEA 1TKXB 1Z0TA 1U1RA 5FLXC 5AJ3F 2D74B 3PX4A 4N5SA 3DD6A 2HGNA 1WD6A 3KFWX 3VVTA 1PGZA 1L5UA 2DBBA 5FDLA 7FD1A 3RG6A 4CLZA 4LSNB 3NWGA 2KZZA 3T9ZA 3PYGA 2QJ3A 2MKSA 2ACMA 2O1WA 4IFDF 2Z2MA 2W2MP 2BA1G 5E3CA 2IOQA 4PU9A 3IWNC 3DOMA 1PG5B 3ZZTA 1HBUA 1DAXA 2IY5B 2QV6A 1UEVA 4ZPWR 2OPRB 3TUPA 4RW9B 5I3UA 3CB4A 1HNWI 4UF4A 3ETMA 3IAS9 1NHUA 3MEDA 1JB0C 2B4OA 2YKPA 4M5IA 2VH7A 3PV8A 2AJ0A 2DISA 1YSJA 2XHCA 2AZ3A 4CYUB 1KKHA 3BO3A 3HPOA 2YBVA 4B3RF 2R7OA 4IFDA 4MJKA 4JI2J 1BQMA 2RSQA 2JVOA 1SH3A 6AT1B 4LF4J 4BA1A 3R6LB 4KHMA 1XQIA 1TKZA 4BLGA 4QW9A 4EWTA 5F9NA 1X9MA 3KHRA 1ZXNA 5AJ3J 5SZTA 4ID5B 1G7CB 4EMDA 4J9LA 4BWMA 1KVJA 4M5DA 5LT5A 2IM2A 4UTGA 3B6BA 1X4CA 1J5OA 2E1MC 2QSFA 5LL6d 2YWWA 4DR5I 2DCLA 1S12A 3OR1B 4J9UE 1P27B 3OL7A 4JI0F 1DQ8A 1D9FA 2GJ2A 4LF8I 3I5AA 5CA5A 2BJ1A 3M2UB 1RT7B 4UOGA 1WC4A 3PIPQ 2KYXA 2GHPA 1CBKA 1IBCB 4P52A 1VJWA 2ERRA 1QAYA 1RYRA 3OTOF 3LF0A 3KRNA 4LF9J 2GZOA 4F4XA 4B9NA 1FDBA 5HK4A 2MKHA 2DH7A 3CXCR 3M6UA 4MIAA 1T8EA 2UUAF 3ZC4A 1NDKA 1UTAA 3I32A 5IWAE 2M8HA 4NXNI 4H4MA 2R8KA 2CJKA 4IR9A 4XAKA 2PI4A 2FHJD 1KFSA 3OUYB 4LVNP 4B3RJ 3HFVA 1RACB 4ZDNA 2R7SA 1QLNA 2RB7A 3EJMA 5B0BA 1RTHA 2W24A 1ZZNA 4B02A 1EB0A 1ELOA 3EXCX 3H59A 3TA1A 5D77A 4NWBA 2W9AA 1S99A 3M1VB 2FPHX 4RUBA 4CWBA 2ZC3A 3NAIA 2Z5CB 5GAGI 3W9IA 4W98A 1VGYA 3X3UA 1CQNA 3AXMA 1FX4A 4QWDA 4DX6A 2XCPA 2M7SA 2DGXA 3UN2A 3LH2S 3M32A 1F9HA 3NNCA 2YTCA 4DR3I 3H2LA 4R8UA 5THWA 5KG2A 1EKSA 4LF5I 4JI0J 4OX8A 3PY8A 3VF0B 1RHKB 1XR6A 2GGPA 1UZHA 4OZ1A 3V6HA 3MOJB 3RRHA 3OTOJ 1R6LA 1PJ5A 1Q0NA 4KFBA 2GAGC 2ZJPQ 2IDEA 4DL2A 2FZGB 5GADI 1M5PC 2Y8YA 1R43A 2RS8A 1ZZFA 5A8RB 4JV2A 2UUAJ 3H98A 4X4NA 3KK3B 1IBMI 5BR8I 2JEIA 3RBXA 2RRAA 1G3OA 1U48A 5IT4A 4RW6B 5IOLA 3DYAA 5A2QU 4MH8A 1C0UA 4YHHF 2QL9B 3GFXA 3OD2A 3UW1A 1I94I 1IWGA 5J2MB 1XJWB 4MK9A 2Y9HA 1VDHA 2HMIA 2PNZB 3PW7A 3CMAS 3J7YU 1N36I 2J6SA 4EZ9A 1CS4B 1D0EA 2KZMA 4B3TI 4Y34A 4I6WA 2EK6A 4PQUA 1YRXA 4QPTA 1NK9A 4FKYA 4FYVB 3EM1A 1QD1A 1WHVA 4O4GB 2WB4A 4LRDA 1JLFB 3OL9A 2MZSA 4FP9A 1S4EA 2DNYA 2CVEA 3HSZA 5KFDA 3OFGA 1XERA 1REVB 4FKXA 5B0GA 3V6JA 3M05A 2LECA 5D4PA 3S8SA 2BANA 4R1FA 2ZH5A 1RT4B 2PFDA 2GIFA 1M5OC 2C22A 1HD1A 1LWCB 3G96A 4AD6A 3DRSB 1RT2A 3M7VA 1KNZA 4DSEA 3RZAA 2WVBA 2VV5A 5ADZA 2HVHA 3PO5A 4MU3A 3QGIA 1Z59A 4K5RA 1ZPWX 2CG9A 2VUGA 4LREA 1RT3B 3CSKA 2VQEI 3ZZRA 2F40A 2ZC4A 2XM3A 1HMVB 2E1CA 2CNNB 4L75A 4MU0A 1T9XA 4YHHJ 3FSYA 1U2CA 1LNQA 3FMBA 2C38A 4DL3A 3NWRA 2Z57B 2PMZD 1A6FA 1H7UA 4NA2A 4FNIA 4FF1A 1HR0F 1PYTA 3KLEB 5DETA 4N3OA 1FEEA 2HQIA 3K2YA 4WU2A 2O1TA 2RHSB 2QFIA 4TQRA 1Y7PA 4OX9I 1M5VC 1ZM9A 5J2PB 3T1YE 4C9DA 4KC5A 2R42A 1IBKI 1B99A 4AIMA 1XMOI 2NYIA 1N5YA 1KQFB 3EDRB 5C0XB 2B51A 4KGVB 2O5DA 1VQMS 2DB1A 1NK0A 1JLQA 5K36B 1KLMA 2G2OA 2HEKA 2UP1A 2OHDA 3O44A 2O1VA 2BRKA 3QO9B 2FVCA 1RBOB 3W2VA 1GH8A 2E1RA 3SQGA 4U8VA 3G6XA 2F3JA 1EETA 3E2EA 2WNRB 3FKBA 1VC6A 1D3WA 2I9SA 1S1VA 3K5PA 1TP7A 3BGRB 1OQ6A 3C2PA 2HFUA 1CJVB 3CCSS 5CYMB 3DRYA 2C3PA 4WIIA 3D9BA 2ZZTA 1X4GA 2YKMB 4EFAC 1TL1A 2MY8A 3H5YA 1H7WA 4NI2A 2R8GA 4I2QA 4PRVA 4OIXA 3HVTA 2CAJA 1HR0J 3ZZZA 4URLA 3OTEA 4B9VA 2X3DA 1RAOA 2IIHA 4CRJA 1UP1A 1V6HA 1LW2B 1K1SA 1FJ7A 1HBUB 2XMTA 1FXRA 5DQIA 4UQTA 4QR2A 5A0YA 3UD5A 1IXKA 3OSNA 2R8JA 4GKJE 2XMUA 3SBMA 2XQCA 3TQEA 2YX7A 2AF6A 3NZKA 2QA4S 1VRUB 3Q83A 3R6GB 4ED7A 1RK8A 3MM7B 2ZNZA 4ETXA 5IV3A 2HFSA 2B5JB 4OHXA 1Q53A 3JQJA 3FGVA 3CWVA 3B4MA 2K06A 1RREA 5ETTA 3D6MB 1BQMB 1M90T 1X8DA 3G87A 2UUCF 4JYAF 1E6YA 1CULA 2F8HA 2C2ZB 1H0HB 2HPUA 3NRBA 4K0KE 4B9UA 3PZPA 5ETKA 4FS1A 3A8IA 4K4ZA 3FC9A 4O3OA 4I2PA 2I38A 3CCMS 3UCZP 4ED2A 2HQFA 5KT4A 2VKZG 4X62I 2U2FA 5IT0A 3RAMA 2MZRA 3DFEA 1RBLA 2BJ7A 1U47A 1FF2A 4QCLA 1NJZA 1KLNA 3LALA 4C8NA 1WDTA 4JI7F 5DRKA 2UVVA 2X1AA 3SCLE 2F4VJ 4DF4A 4EUVA 2AYEA 3KOAA 2LCWA 1NKBA 1S1UA 3M8SA 4K4YA 2E1PA 2V8HA 4K8RA 1YITS 4AL5A 4DX5A 3G71S 2QC3A 3HSJA 1LXJA 1VRQC 4W92B 4WTOB 4K4XA 1NSKL 1VHFA 2LP4A 1Z0GA 5A6PA 5JVHQ 3BYPA 1YJTA 4X84A 1N4LA 2EFNA 1H72C 4FXVA 1S9EA 1X4BA 2ZE2A 1FFSB 3AA9A 2E9TA 1NEEA 3BEGB 5K14A 2DH9A 2DO0A 2AZ1A 1JLBB 2EFQA 2MKKA 4KPCA 3EGNA 2UUCJ 1YZ7A 1P9YA 5LSRA 3J81Y 5HP1B 3MM6B 3Q8YA 4H4OB 3D3CJ 4JYAJ 3RB6A 1ACMB 1KP6A 1HNVA 3T6JA 1VMBA 2AJ1A 1QJHA 3MD1A 4DV6F 1H2UX 2NS1B 5HMYA 1F1BB 3M8QB 1GMUA 4DR4E 1USVA 4OX7A 3D66A 1L3TA 1R0AB 2JLGA 2A10A 2HKJA 3RBEA 3NGDA 2E5LE 2B56A 3CJ0A 3K5OA 2V4QA 1JNRB 1K0TA 4JI7J 2Z4PA 3HI9A 2ADBA 2RAQA 5BYQA 4USIA 2EVZA 1K8AT 3FVYA 2A1BA 1U1MA 3QYYA 4ELTA 5A2QC 4Q0BA 4IH6A 4ZCLA 3CDUA 4YY3F 2ATLA 4Q2MA 2B8PA 4RNMA 4B9MA 3BO4A 2Y1IA 1HIYA 1CVJA 1XMBA 2DYAA 2HAIA 2HW3A 2R2UA 1AFJA 2Q2EB 4ZVIA 3FZ2A 1FDDA 4N8NA 1FTCA 4QIFA 2JEAA 1LK5A 3CC7S 2FHOB 3MWBA 5JUMA 3AOBA 3GMGA 1SXLA 1KD1T 1RWUA 3UHMA 4QOTA 5HJYA 2LA6A 2W9BB 4I64A 1TU0B 1Q95G 5CH7B 3M6AA 3TUJC 3V6DA 1NM2A 4B9LA 4DV7E 4FF2A 3EVOA 3S7RA 2IPOB 3V81A 3DLEB 1SC1B 1TELA 5T41A 2VFUA 1R6VA 2XG8A 1SL0A 1F0XA 3R5AA 4ZCMA 2ZEJA 1Q7YT 2I5JB 3RBZA 2MPUA 1N0VC 4DX7A 3IWXA 1KEKA 3DRRB 4NMXA 2GAHC 1SJ1A 1JLEA 3WC0A 5D3GB 1OY9A 4DV6J 4FW3A 5C25B 2YKAA 3CCTA 5CHCB 2AQ4A 1X4DA 3CCES 2B43A 5J1NA 3I0SB 4A8FA 1O51A 4CNZA 1NMEB 3GCXP 2YPZA 2K7KA 1KTVA 1H73A 5LMUI 3CJQA 4QIEA 3V4IA 3NNAA 5CZVA 1HNZE 1HNIA 3K89A 3WX8A 2OO4A 2ABYA 5JEAE 4H54A 4HH1A 4DR2F 2IDLA 4AQYJ 1DFDA 3PJXA 3TJ8A 1MN9A 2J65A 1MN7A 3IGVA 4YY3J 3HHDA 5C0XE 4ZLNA 1R3NA 3HO1A 4OI0A 1WF2A 3J7Z5 4G1PA 3L7ZA 4AT1B 2RDIA 2JSXA 4RU9A 2FQQB 1YJ9S 1KQGB 2JRSA 1FO1A 1SB6A 3TJAA 2YNHA 5C42A 1JIHA 1ZETA 4ZITA 1XNQE 2HZAA 4RNFA 3FRZA 3JYTB 2LXUA 3TVKA 2FC8A 3WDOA 4B3ME 4ED6A 1JXEA 2WBMA 2HSEB 3MECA 3SDEB 1RCXB 2ZUGA 2KXHA 2EFPA 1LWXA 5KFGA 1X4FA 3C66A 2B6AB 3DGPA 4MYTA 4GKKF 2EKYA 2V8DA 4U67Q 1C1BB 2WOMB 3GJTB 1JXLA 1NXIA 3ELHA 4DZ6A 4RR5A 2E7VA 3KMQA 5DM7Q 3CNQP 1KVKA 2HVDA 4X66I 2KFNA 4RW8B 2YQ0A 1M1GA 2AX0A 4KJIA 4E2FB 2AW0A 3R2CJ 4AE5A 4CO4A 1VHIA 3A3NB 1OSDA 3HFKA 4WU3A 2IJNA 4DR2J 1WHWA 1S0VA 1X31C 3M7NG 2F8EX 3GILA 5F8GA 2G9OA 3GU0A 4JI1I 1B7YB 1WOOA 3GIIA 2HRUA 1LK7A 5KFTA 1FVQA 3TAQA 2NN6B 4LFBE 3J81U 3D67A 3IO1A 1RWNB 2HKEA 3MTKA 2UUBE 5B09A 1RWKB 1NHIA 2Z5BB 5K8NA 2KFZA 3MM8A 4ZVSB 3T5KA 4DV2F 1ULRA 2VG5B 3ZO7A 4H4KA 3THPA 2JWNA 3A4TA 1XMQE 4QPXA 4LRBA 2ZBQA 4DUYF 2UU9I 4JI6E 2JVRA 1R89A 2E5LI 5A8KB 2PD1A 2V69A 4GKKJ 5JEAC 4EO6A 5CABA 2VJVA 4NLOA 1VRTA 4WKRA 2LU2A 4L72B 1Y5NB 2V2VA 2UZAA 5C0XC 2PSZA 5EX0A 2FB0A 3SEOA 1EAYC 5K36C 4CO2A 4U7UD 4JI4F 4O3SA 2PMWA 1MU2B 3LANA 2E29A 3D1QA 4PG6A 2DKOB 2OD6A 4DQPA 1GXUA 3KNAA 4CM0A 3GIKA 2RF2A 3G82B 4OFZA 3GR1A 1FWLA 3R9LA 4KV8A 1HBMA 2D3UA 2CVIA 3T9NA 2E5GA 2KG1A 3DXBA 5LJ5Y 3MUVP 2DHAA 2PO2A 1LV5A 3CCRS 2ZH1A 5H1SV 4DV7I 2W9CB 2LYVA 3M2RB 4UQGA 1SJ4P 1S0MA 2JEFA 4KQVA 3PHTA 2BKPA 4A46A 2CPXA 5EX3A 3CPWR 4ECTA 3MPUB 2ILZA 4W90B 4A8YA 3MAAA 3BO2A 3HX9A 1SPBP 1I5OB 2F9DA 3PIOQ 4DV2J 1IN0A 1CJKA 5HVHA 2DRAA 1JLGA 4WTYA 2VB6A 2MGZA 4PYDA 2OLWA 3RU0A 5LSOA 4PG8A 3OLBA 1U8SA 2DNPA 3JB9k 2BXJA 4RL1A 4EBCA 4Y3CA 3BM7A 1HHSA 3GYXB 3D6HB 3BDEA 4WFYA 2G4BA 3FMWA 4DPTA 3CIMA 1U1OA 4WZQA 1M5KC 1HNZI 4ED4A 1Q81T 3OQ2A 3PEHA 3G86A 4BBYA 3H4LA 4JI4J 4C7QA 2HYIB 4Y2AA 5DG9A 4DXLA 1ZTTA 2GHWA 2YNIA 1DTQA 3MM5B 4KYZA 4N47A 2RDDA 4G1IA 3TW0A 3EDQB 2A6MA 2PO4A 2FHKA 3H20A 2UXCE 2LDYA 3QJPA 1FWKA 4OLPA 1OYSA 2HGMA 2YNGB 2VZ9A 4LFCE 1XNQI 1XTZA 1C0TB 3OBIA 1RU2A 3T1HF 3T6BA 4ECVA 3CTRA 2KHDA 4DR1F 2OPQB 4KKOA 2ZH3A 2DXDA 1XC9A 4RPFA 2H4WB 5HVFA 3QFWA 5H9FK 5CCLA 3DHXA 1OPIA 1OSCA 4NMLA 1KOOA 3QAEA 1SKSA 4JI2I 4CH7A 4NXMF 1S59A 2BR2B 3T5JA 3VZHA 3DM2A 4LF4I 1LWEA 3KKFA 3P6YC 1NK7A 2C2KB 4RO0A 1GXLA 1SV5A 2HNDA 4XO0A 3ISNC 3UN5A 2AYMA 1VFJA 4PXBA 3L95X 3E01A 4KH1B 4P74A 3AXKA 5GAHU 2BA0G 4Y2KA 4ILRA 1NCLA 1EI1A 4WJBA 5F3ZA 5G0RA 4PWWA 1TMJA 1VQYA 3AB4B 3LQVA 4DSFA 3BQ0A 2FJWA 4PABA 1HWUA 5ITHA 1S76D 1RSCA 2WVCA 2IA6A 2EFVA 4YS2A 1Q5YA 2CADA 3KLVA 4URGA 1IWAA 3DRXA 3EVWA 1H3DA 3B4TA 1MROA 1UWBB 5FIIA 4KRWA 5G4DA 3T1HJ 2UUWA 3OVSA 1LW0B 2PO1A 2YX1A 3VQSA 3D4JA 2XYHB 1N34E 4C8MA 5D4LA 4DUZF 4LSZB 1FD2A 4F3MA 2GO9A 3GLLA 4IFVB 2B4UA 4Y2CA 1N48A 4DR1J 3A3OB 2GIRA 3OTCA 4DR3F 2ZHOA 1VBXA 1VLOA 5BYRA 4WYWA 3G6YA 2B7CB 3PFOA 5LMNE 1SVDA 4FNHA 4OO1D 1X4EA 4LCHA 2ZM6F 3P8BB 2RKIA 3D54A 1IKYA 2AMCB 3LP2A 4R5PB 4NXMJ 4IO9Q 4IG3A 4X4UA 2R8IA 1HWJA 1N33F 5T7LA 3TA2A 2RJZA 1IKVA 2D41A 4EK2A 3MF5A 4QIWD 1J2VA 5JMNA 1S7HA 1BMQB 2XY7A 2R2RA 3BBCA 1B70B 1BKNA 2CQ2A 4KSEB 5T14A 3KMSA 4NXNJ 2NCKL 2W2NP 1KBRA 1FERA 1IBLF 5AXKA 3AD8C 4IQMA 4C97A 2NN6E 3E51A 4LF7E 3UD3P 4FWHA 3SIPB 3KLFA 3G6ES 4LFAE 5KFSA 4C8OA 4JI3E 2ZNYA 3BR8A 4IH5A 5ETRA 3GCMA 3OTOI 2YVSA 2Y3YA 3H5XA 1JKHB 5F8LA 4LF6E 1VC0A 3DLLQ 5AE1A 2HLUA 2FVQA 1YHCA 1TKDA 5DDRC 3ZZ0A 3A12A 4KHPE 2APOA 1GMWD 2UUAI 3HT0A 2DR8A 2J8SA 3PR5B 2CA9A 4DR3J 5F0UA 3D68A 2YWKA 2UXDE 1NNDA 2HNZA 1J5EE 4DCJB 3PYEA 2CFXA 1F9FA 1YJRA 3FQKA 1LFPA 2ZM6J 1FFWB 3J81C 3IG1B 2JL9A 3PYFA 2AJ4A 1SJRA 1PAUB 1Z0CA 3T19A 2AHOB 3PS1A 1WUUA 1S49A 1HWKA 3H25A 1Z5AA 2MJNA 1N33J 3P3EA 4WP9A 4TKTA 3JXOA 4I67A 2V34A 2IBOA 2CPJA 2BQUA 4EO8A 3GV5B 3C6UB 1TZ0A 5EL9A 2ZBPA 4UZCA 3C6TB 4FN5A 5KFXA 3RBDA 2GA7A 4HLBA 4R0JA 4AUKA 4DEZA 2J6TA 5E33A 4IZJB 2UUTA 1YJVA 4LFCI 2OEMA 1Q82T 4USHA 4F3QA 3P76A 5CXTA 4OJGA 1IBLJ 2WP8A 1IJEB 3KK2A 1MMLA 3MCMA 3W60A 5D15A 1E6VA 5EUHA 1EHWA 2QO3A 3R5GA 4BA2A 3MAHA 2JLFA 4K4UA 4A4JA 2LXIA 1ITPA 4Y0FA 3FCHA 1VQSA 2J9EA 4YB5A 4CO1A 2YWEA 2OI2A 2ZHBA 1G4CA 3GJSB 1RAJA 4AYBD 3W1YC 5HVGA 3L09A 1WNEA 3H7HB 4J90A 3O8WA 4NCBA 2W8LA 1PIEA 1TAQA 2LQBA 4TU8A 3HHLC 1H2TZ 1KHVA 3BN7A 2KT3A 1S9GB 5HO4A 3QMQA 4YHHI 3AJ1A 5DJBA 1NHHA 3E3XA 4NLTA 1WJ9A 1MLAA 2LA4A 2ZKUA 2NN6C 5IWAF 4LSLA 4QWCA 2ROPA 3VGTA 2P9GA 4CH0S 1GTHA 4DDFA 5L1IA 4BC9A 3J80Q 1WKLA 3TR5A 2FJDB 4IOAQ 2AT1B 2QN6B 4NLDA 4I6AA 4IG0B 4NLVA 2QFJA 2QX0A 3GONA 4KAIA 5HN0A 2MJUA 3VAJA 1UL3A 1GX6A 2EEYA 4G1QA 1CJUB 3K57A 2WK4A 3AD7C 1B4SA 3T3FA 3ADAC 1WC5A 2XYGB 5L8RC 4IDKA 2C2MB 3OTDA 1S6QA 4X4QA 4WE1A 3RR7A 2RD5C 1P1LA 2HGLA 2BW2A 1SQEA 2YWGA 1TUGB 3NCQA 3QIDA 3DI6B 4OYBA 3TZZA 1UDQA 1KR4A 5CYQB 4ANEA 4CTAA 4ZP8A 4NYZA 2R3VA 2DXFA 3NOCA 2VFVA 2GO4A 4MDTA 1TL3A 4TLQA 5DZ6A 1VQ4S 3AD9C 3RAQA 2K2PA 4N76A 3O3LA 3JSMA 4J9KA 3TX8A 4EYHB 2XLKA 1KFDA 1T9UA 3H8YA 1VC5A 2LQ8A 1TK0A 3PCOB 1VBZA 1NHJA 3JTPA 2W4DA 5IWAJ 1HR0I 3SYZA 2GMLA 3LW5C 2WBRA 1N6QB 3KLGA 2WSEC 1RT5B 1U1NA 1VQ5S 3G2XA 3TVZA 4WUDA 4M5HA 1XEZA 1FKOB 1EP4B 3FBBA 2X1FA 3CDIA 3GFHA 5HQLA 4NZ6A 4JI3I 2EC2A 4ETZA 2C2RA 3Q2TC 3FFIA 2MSSA 5C5JA 3WX4A 1HPZB 3B82A 1OMSA 1N52B 3PKMA 4ZLJA 5LL6R 3I31A 2V67A 1NU4A 1NZ0A 2IC3A 1Y3KA 4JV5E 1MWZA 1Z4UA 4URSA 3SV4A 1SIZA 3I4HX 3L7PA 1J5EI 1QAIA 1YG0A 3BSNA 3GV8B 4USWA 2MB0B 4OJ3A 4J9OA 5L9NA 2QLXA 3MMAB 4OYWA 1U09A 5KFFA 2LQ9A 4DG1A 1XR5A 1HA1A 3RB0A 3OR2B 4WXOA 3BREA 1S0NA 1LOUA 5L1KA 5I42B 1FK9A 2X51A 1NDPA 3CD5A 4IZKB 1U26A 3AODA 3QRQA 2W4CA 2HHTA 3MMBB 1TAUA 1N8RT 1TFWA 2O3ZA 5JXSA 2N3LA 2KKHA 3CJSA 4C3KA 2QTWA 1VQ6S 5KG4A 1R8AA 1SJQA 2XMWA 5F8NA 1NK4A 4CLLA 4O23A 3NS5A 1CG2A 4DHVA 2HQ3A 1HNXE 3MEEA 2GVZA 2W7PA 1YZ6A 2D7SA 1NB2A 2BE2A 4NZ7A 2FGOA 3PM9A 4WYLA 5KFYA 2RVJA 4DV5E 3IP0A 3T1YF 1HYSA 1S1TB 5HAOA 1F9EB 1S79A 2VBZA 3F56A 4O44A 2UUCI 2J7KA 2Z2YB 4NLXA 2V4JA 5GAHI 2DD8S 1TKXA 3P3CA 2D9OA 1U2FA 4F0HA 3NEKA 1FKAE 1K47A 4XPCA 5F8IA 2V50A 4DF8A 4LSNA 2RS2A 3A1YG 1VK8A 4DQRA 5BXIA 4NZ0A 4IR1A 1U02A 1QTMA 1Z0EA 1UVKA 2EWHA 4WFAQ 2WW8A 1VQPS 5KT7A 4KGMA 4DN9A 5J1EB 3KK1B 4JI7I 2QEXS 3KHGA 2V68A 2A0FB 2CDRB 4OX6A 3BGOP 4CLPA 2ZH2A 4OYIA 1H7SA 1X0PA 3J81j 2OPRA 5KFVA 2BKOA 3KLFB 4RW9A 1P8GA 3TAMB 4EEYA 1UZDA 4V1Ak 4ZVGA 4BDPA 4ZN3A 4C8YA 2IERA 4GVLA 3Q22A 2OFGX 4RX6A 1HHQA 1ICEB 4WK1A 1G1XA 2XI2A 6FDRA 4NRTA 1PKUA 4CYUA 2I1RA 3TZWA 1HBOB 2HBZB 3FBFA 4LF9E 2CQIA 2CPDA 4ZPCA 2IVFB 4JI5E 1ZA2B 1UWAA 4GKJF 2VOOA 2H5IB 3T1YJ 3FK4A 3PX6A 2I8EA 4Y6IA 1Z0BA 4GO5X 1IQZA 2ZBRA 3BSOA 2MLZA 2ZUAA 2QLFB 2O01C 4LBHA 2Q79A 3JTOA 3PDNA 2GS8A 2U1AA 1UJ5A 2KFYA 4I1TA 4ID5A 3SMZA 2BACA 4X65E 1BUXA 1R8BA 2VKRA 4MT1A 2Z56B 1IQTA 2AD9A 3CJ5A 3HULA 1E3HA 4WIQA 5FLXQ 1DBDA 3OR1A 2XS2A 1I6JA 1RZMA 4K0KF 3KHHA 1TUVA 5J2NB 3HZEA 1RWOB 3M2UA 1MSWD 3KK2B 3I5BA 1RT7A 3WU6A 3WIVA 1FRKA 1F5CA 4U9RA 4P9SA 5L9XA 2DY1A 5BJRA 1GX5A 4ENOA 3MGJA 5IQQA 2XWYA 3HHEA 5A6WA 4YY3I 1FNOA 3OJSA 4RUHA 1XWLA 2VF3A 3FRYA 3Q8PB 4Q8EA 1OQ3A 2H3EB 3VGUA 3CE8A 2VDIA 5J2QB 2ZBCA 3NBPB 2HWIA 1NKEA 2MQNA 3SCJE 3QBCA 5KAKA 2MQOA 1P42A 2IVMA 4ATNA 3OUYA 4DMZA 4NLWA 4DI6A 1V9OA 2HIYA 2OGUA 1YQHA 3N01A 2KXNB 4ZPAA 1Y3JA 4GKJJ 2M52A 1GFWB 5HMXA 3MHYA 3Q8QB 2FLOA 2G1HA 2UVWA 4I4BA 3UPFA 2W4PA 5B7WA 1VIXA 1HQ2A 3M1VA 1RHUB 4MQYA 3PVXA 2AGQA 2Z5CA 5DO2A 1UVIA 2HFOA 2DGVA 4ZVEA 2L9DA 3LP0B 2G2ZA 3I87A 2BJ8A 3LAKA 1KQKA 3H2VE 1RWPB 3DLJA 1T03B 2UV8A 3TEGA 2VL1A 4USJC 3HCXA 3EPIA 4C4WA 4DWIA 2R7VA 4IO1A 2BMBA 2M0GB 5JJBA 4F36A 3GMEA 1RABB 4K4TA 2H4YB 2CZVC 3M4XA 3RRKA 4K0KJ 2HHHE 4M95A 1Y5IB 3HK2A 4DR4F 4YDDB 2E1AA 3HP6A 1FRHA 2Q66A 1XHKA 4DR2I 1U1LA 2E5LF 2AWZA 2XMKA 3PRVA 4HL9A 2KHCA 4NEZA 1IR0A 4K50A 4I7FB 5A8RA 4DV3E 1Y4UA 4DV5I 2C39B 3KK3A 1ZM2A 2L9NA 4N77A 4QJVA 4MKYA 4F8RA 4RW6A 4PRXA 2B3TB 4RZRA 2ILYA 1QAJA 3G8SA 1D9AA 4M5KA 3HLUA 5KT6A 3UVJB 5J2MA 3QZ8A 2EBEA 1ZPVA 5H9FJ 2PNZA 3W63A 1WKKA 1RAGB 2AEFA 3D5MA 2H51B 1NJYA 4FYXB 1F2HA 4F4WA 3PJ9A 1YIJS 1MX0A 2ZVIA 3W2WB 4HH0A 3KJQB 4X64E 2J0WA 1CS4A 1UDSA 3V6KA 4DV7F 4F4YA 2ZFHA 1R6YA 1GAOA 3J7A1 4DU8A 3KUGA 3D2WA 4O4GA 4RU2A 3C19A 1JLFA 2XI3A 4OYZA 2YX4A 2VQFE 3VAMA 1P1TA 3MI7X 2F63A 1VBKA 4F4ZA 3K8VA 1MW7A 1REVA 4UY8T 4DR4J 2FLLA 1RT4A 4LR8A 1CJTB 2UU9J 1RTZA 2MHNA 1LWCA 4UT4A 4IFDD 2H65B 5K9FA 4DSKA 2E5LJ 4FW6A 3DRSA 3M8ZA 5ETMA 1U24A 2AYBA 3RB4A 2WB1D 2L41A 1T94A 2IM0A 1D09B 2W8KA 4HVZA 1HNZF 3EGZA 2NQPA 2KM8B 1RT3A 1UEUA 5E7OB 5JEAF 1S97A 2OIHA 1HMVA 1X0FA 1HKAA 3ILOA 2DNNA 3HZGA 4RKUC 2RQCA 5C0XF 5DRPA 2MZQA 3BZQA 1PJ7A 4USMA 2QA4G 3G8TA 2E7WA 3GP9A 4DV2I 2KVIA 3TA0A 4X65I 3KLEA 3N0VA 4LIWA 4DV0E 5E2QA 2AJFE 3PHEA 1V3SA 1OYRA 1DLOB 4F25A 4DUYI 2WW4A 3TARA 1XNQF 1FKPB 4OI4A 2AU0A 3UCUP 2IYGA 3BV8A 3TI0A 1WOPA 4B3MF 4DV7J 1X5TA 5J2PA 2CPIA 1Q86T 1QVFR 4U3BA 4OI6A 3AH6A 3U1KA 2DK2A 1Z0VA 1UMJA 2FJEB 2WVDA 4JOUA 3IS9B 4QWAA 2HK3A 2XTJP 3MPYA 2X7IA 4JI4I 1W7WA 3W7BA 5C0XA 3F0NA 3KHLA 2IRUA 2VA2A 2QE5A 5K36A 2DIVA 1WTFA 2LEBA 4ZJQA 2BDPA 2E66A 3L7OA 4DSIA 4DS5A 3QO9A 4FF3A 2J0QD 2W25A 1X5OA 2XMAA 2WNRA 3H90A 3GCWP 4ZPVR 5E41A 1UDOA 3QLHB 5KT5A 1Y5YA 2RRBA 5HSPA 1S1WB 5CYJA 1OYPA 1X4HA 2XC9A 2DJWA 3BGRA 3LA0A 5KFAA 2HHUA 5IC6B 4DR6E 1HNZJ 1CJVA 3GQCA 5CYMA 1UPPA 4B9TA 2HHXA 5C7PA 1T3NA 1RT1B 3Q8RB 2YKMA 4QWEA 3OXFA 2CQGA 4DV4E 4IRDA 5AE2A 2ASJA 4JG4A 2Z2ZA 1S0OA 2HS3A 4ZVTB 3OJUA 4LFBF 4XTJA 4G3IA 4P72A 2WCXA 2BM1A 2EG1A 3BF4A 1WWHA 1OWXA 1LW2A 2UUBF 2CG8A 2OAUA 1XNQJ 5KFNA 3DGVA 1I51B 3G6VA 2B4PA 1GTEA 2JZ5A 2CZ4A 5ETPA 2ZOMA 2HHHI 2R7XA 2CIMA 3MCNA 4B3MJ 1L3VA 1XIQA 2DNMA 3PS2A 4DN0A 2F4VE 1YBUA 1XMQF 5DQGA 2V8VA 3JS9A 3ZFVA 4JI6F 4OHWA 1VRUA 2BM0A 3MM7A 1CLFA 2OEKA 3CUNA 3DDIA 2BOAA 4OJ1A 1AZSB 4B9SA 2B5JA 1HHTP 3I6PA 2NR0A 2W7AA 2P8IA 1VQNS 2VHGA 2BA0D 1R6MA 1SKUB 3SSQA 1PYOB 3UDCA 1RR9A 3CD6S 5IFMA 1D1UA 1KN6A 5E3RA 4ECQA 1IM6A 3SCIE 1T02A 2EFGA 3T1HI 3MPVA 3I9ZA 4E98A 4CI0B 1UJ4A 5B0AA 2MEWA 3OFHA 3CJTA 3CC2S 4DR1I 1WC6A 2ZHAA 2JEJA 1GNKA 3DRPB 1SKRA 2JX2A 3K5LA 1RU1A 1U8WA 4IUFA 2E44A 2XO7A 4L3NA 4F3OA 4LFBJ 2D3O1 4NRUA 3T1AA 1U4BA 3QRRA 5KFRA 3CJ8A 2V9WA 3CJ2A 4NXMI 1PVGA 3MUMP 2UUBJ 3CJRA 1PBAA 3FJ2A 2R7TA 4RJVA 4G6VB 2OPPB 3D1HA 2IMWP 2J6UA 2MQ8A 5KOXA 1TL7B 4LUBA 3GWCA 1XR7A 3FZBA 1XMQJ 3IBCB 4O4RA 4X4VA 4JI6J 1FVSA 8AT1B 3CVKA 2PN6A 5IM0B 2OMLA 2M9KA 4NLQA 3NXZA 3O2IA 1WHXA 5KG6A 2WSFC 2DY9A 2QLJB 1JJCB 3C46A 1JLBA 1VS3A 4ZCIA 4ILMA 1EKRA 4RBTA 5E5NA 3OW2R 2ZD1B 3DNCA 5HP1A 3MM6A 4H4OA 1VQLS 3DMJB 4A8MP 2V2QA 1NKCA 1NLKL 1SC6A 5GMDA 2JEGA 1WF0A 2QLWA 4ECRA 2VD3A 3BBFA 4QU7A 3GIMA 2XLJA 3M8QA 2GQQA 4P2FA 2OH2A 4RNOA 2UXCF 4DV0I 2QYCA 4F04B 4ZVPB 2HQGA 1UW9A 1R0AA 3OL8A 4DUZI 2ZZMA 3IN5A 1IR1A 3QAUA 4LFCF 4NLSA 3IR6B 2WVEA 1Y6ZA 5ETSA 4HTIA 1HLWA 2PT0A 3EGWB 2RQMA 2K1RB 2DNQA 4LT6A 1FFGB 2IA0A 2QGFB 2ZM6I 1WC3A 3OV7A 2D3ZA 1Q16B 2JC1A 4TN2A 3B78A 1RGVA 4B3SE 4FBTA 3FUYA 3HJVA 3QQCD 1N33I 3VV2B 3LGHA 3MEGB 1IKWB 4V19J 1GMVA 2IAJB 4OYOA 1S6OA 3ISZA 1U6ZA 2OTLS 3R5JB 2MZ1A 4UW2A 1N56A 2W9BA 3NLCA 5EN1A 1EQMA 3KG4A 1T9YA 1KRPA 4M94A 1IBLI 2C3MA 3CO9A 4LMZA 1Z5BA 3DLEA 3CJKB 2XNRA 4CO0A 1FJGE 2I5JA 1HBNB 1XBWA 2OPSB 3DRRA 1EARA 1WI6A 2ZOGA 1U0SA 5D3GA 5C25A 3OXLA 3N5FA 3A8EA 3OFFA 2IM3A 3C16B 3U1LA 3I0RB 4TNOA 5IT9Y 3OFEA 4M1KA 3I0SA 3W62A 2VOPA 3B54A 3MOZA 2DITA 1RT6B 4LFCJ 3MXHP 1W26A 4CCHA 3BS9A 4D3HA 1Q8IA 4TQSA 4HY1A 2FY1A 4QNKA 2RQ4A 4Y65A 1N34F 2FIUA 3N6MA 2M70A 5LXYA 2CQ1A 3BGFA 2CG4A 4MU1A 4M5NA 3F41A 3JAMY 4J9PA 1K9MT 5GAEI 1TQLA 4L74A 4FPIA 4USKA 1VQ9S 5LMNF 1SQGA 2V8PA 2YWFA 4DQIA 3SI8A 1F5BA 5A2QQ 2QA1A 3D1OA 1FDNA 4CLYA 4JP8A 3LWMA 4RUCA 2HWHA 1O0PA 3MFIA 4DLGA 3JYTA 2J9DE 4ES2A 4WPAA 3LPSA 2Z2LA 4A8KA 1O5JA 1HARA 1F6TA 4CT8A 3SDEA 2I0XA 4WFNQ 3MM9B 1ZYQA 1Q8BA 3NAHA 2NXNA 1IKXB 3HSDA 3IM8A 2M88A 2B6AA 3HSGA 3POTB 3GYGA 1SQFA 2H5JB 3HF5A 5K5MA 1C1BA 2WOMA 2JFDA 1PSDA 2YNFB 4HDHA 1RAEB 1T0TV 4ZS6A 4RW4B 2NN6F 3MFHA 3W9HA 4LF7F 1A0OB 1RTIB 1T3OA 1YJWS 1S1XA 1N5TA 4ZLPA 4HHHA 4RW8A 4LFAF 4JI8E 2FYXA 5JEAB 4JI3F 5A76A 3V2UC 3QPIA 4KO0B 2BEFA 2FHMA 2M8DB 4LVOP 5KOWA 4LF6F 2CUYA 1RXOB 1NSQA 2HURA 1N34J 5MLCV 2AJ2A 3HHLA 4KHPF 4CQ1A 5LSLA 2Q3PA 2DR9A 3OTBA 2KM8C 3SFUA 5IWAI 3K8WA 4HI2A 4DFPA 4AM3A 4TY8B 3P06A 2UXDF 2E5JA 2DNKA 1J5EF 5LMNJ 1UEKA 3MPWA 2GHVC 4BC7A 5E3PA 3UO0A 4K4WA 2NN6A 2CWKA 4NBQA 2MKCA 1NSPA 1SI9A 2MKIA 1SL1A 1Y4SA 5EWGA 2DHXA 3F73A 1HWIA 3W9JA 3K1JA 2Z5BA 4XK8C 5I3PA 2Y0BB 5D8HB 5ETNA 4CZCA 2W1BA 2VG5A 2RUGA 3KDNA 4P2SA 2ZZNA 3BKTA 3IXQA 1ZAWA 3D3BJ 1JLAB 1PCAA 5KG7A 5A8KA 1KHWA 3M6VA 2GCFA 3WU4A 3ILLA 3ZKDA 1LWFB 2YKNB 4TU7A 4LF7J 3LOUA 4J9SA 2WSCC 1IUJA 4LFAJ 4B3SI 1HQUB 5GAGU 4JI3J 2B9WA 1MU2A 3BPDA 4Q43A 4LF6J 1XNRE 2UXBE 2HZCA 3W5XA 3G82A 2YQ1A 2DNHA 2IJFA 4X4TA 4KHPJ 3P5BP 4LJMA 3TAPA 2IRYA 1Y0HA 3M8RA 4HACB 5IS2A 1RISA 3K5MA 2UXDJ 2NUHA 1SC3B 1J5EJ 1YVFA 2W9CA 3M2VB 3M2RA 2RMLA 3IRXB 4CM2A 2HBYB 3EX7B 2CZ9A 2N7YA 4MFBB 4LQ3A 1M1HA 2JC0A 1QUVA 3H5SA 4OO1B 2AYGA 4NASA 4WFZA 5IT9U 5HBMB 4X4PA 1FRMA 4K7QA 4ZHRB 3CD7A 1DARA 2DGUA 2H48B 2HIQA 3P5TL 8RUCA 4MKBA 1EQ0A 4Y2IA 1YLXA 5A8WB 2N4CA 1VI7A 1WELA 4OYAA 4FDFA 4DFJA 2CQ4A 1YJNS 4RW7B 5H9EK 3NMRA 4P7AA 4TU9A 2ZWPA 4OI3A 5CD4A 3HT3A 3JAMU 1SIWB 2GVDB 4H4KC 2HLTA 3FBCA 1X9SA 1S10A 4I0WA 3T5LA 1N54B 3MM5A 2WRMA 1T7PA 1EIYB 3DLGB 1HNWE 3NS6A 4FS2A 3UFCX 3QT7A 3LPEA 3NNHA 1S7IA 2YNGA 2I6WA 4C11B 3BYRA 1QAXA 1C0TA 5L46A 3D0HE 2L08A 1OS5A 4GO7X 1B3TA 4ITSA 1L3SA 2CQBA 2IYIA 2NSCA 2KJWA 4ZIWA 5CAAA 4IRCA 1VIOA 4OL8A 1Z0WA 2UV8G 4IFYB 1WG4A 2OPQA 2YXLA 1A6LA 4J37A 4USTA 1SBRA 4U3DA 3KUEA 2AGOA 2D69A 4F7VA 2QYGA 4FYDA 4ER8A 4WF9Q 1YRUA 2ASYA 5EWFA 5KFCA 4UZBA 4YQWA 5HJXA 4C8ZA 2J0SD 1JQGA 5C2CA 2BR2A 1URRA 2G1DA 5BYSA 3T1YI 3ULHA 3M9NB 3CMQA 1BQNB 3OL6A 2GNKA 3MMCB 4DR5E 1B7FA 4ZPTR 4ES1A 2AGPA 2JH3A 4ELVA 2BKNA 4OZLA 3SQOP 3PFEA 4LF8E 4PG4A 1O8BA 4HHUA 4CLFA 3S1TA 2VFRA 4JV5F 1RAFB 2C2OB 4EU0A 2AEMA 1EJ7L 5DRRA 3HKZD 2R8HA 4YOEA 3MR5A 4NCGB 1WF1A 3GYNA 2MKYA 4YR2A 4FW4A 2MZTA 2VG7B 2EFOA 2V63A 3MTJA 3H5UA 3QRPA 2DGSA 1UWBA 1AW0A 1A9NB 4IRKA 3NP5A 1LW0A 2VC1A 2BX6A 4QYZK 4Q7AA 3CDJA 4PPZA 3M6XA 2ACYA 4IFVA 4PUOB 3GR0A 5L3JA 3FDSA 5D4NA 3C15B 3CIZA 1DURA 1X5PA 1MNEA 1WG1A 1M1KT 4YDXA 1VQ7S 4RWXA 4MMOA 1G2EA 5E3AA 4ED0A 5B0EA 1RTDB 2E5IA 4R5PA 4GKJI 2R2TA 3KLHB 1HNXF 1HI0P 1YGYA 3ENAA 1Q78A 3EE3A 4OV1A 4C0BA 3CD0A 1NH7A 4LF5E 1SUQB 2MKJA 2UXBI 2QZ8A 1ZOTA 3KNGA 1OY8A 2Q1LA 3KDOA 4DV5F 2RH3A 4Y28C 1NHKL 2BR0A 3FBEA 4F4KA 1QE1B 4GMKA 2PI5A 4JV5J 2KH9A 1UAWA 2M3DA 2HVIA 3QSIA 4OMFG 4D3GA 1M0SA 4ED5A 5CQGA 4K0KI 1WC1A 2XSJB 3TYTA 1FKAF 1KVIA 3I96A 2ROGA 4BHQA 1IBME 3J7YI 5BR8E 4GRSA 2KU7A 3C14A 1TV6B 2RILA 1WKJA 5HQMA 2GX8A 1EX8A 1JKHA 1V3ZA 4A8OA 3X1LB 1G6BA 4AL7A 1Q1KA 1ZS6A 2DHGA 1T9TA 1FD8A 1OJ4A 1MG7A 2KL8A 1I94E 2CJAA 2HS4A 1HQEB 2VFSA 2Q43A 4CO5A 1FRXA 3HJFA 1S1XB 2QSWA 3DDKA 3AOCA 1QZRA 1X5SA 1N36E 2B8QA 1KOHA 3IG1A 1NBEB 4FVMA 4B3TE 2GV1A 4YB7A 1U1KA 4XDCA 2QRRA 1PC5A 2HQCA 1FE4A 3HHLB 4MTPA 4PXDA 4DPYA 3CMES 1HNXJ 2KDOA 3UNYA 1ZBTA 3NCRA 1VJQA 2CJXB 4LF9F 1S72S 4Q5VA 4RLEA 3C6UA 2PDAA 2K7JA 4JI5F 3IR7B 1WDDA 3C6TA 3TQ1A 3LGMA 2CQHA 4P7VA 4DV5J 4S0MA 4G65A 2XULA 3R97A 2BJ9A 4IZJA 3ZKBA 3M30B 3RYLA 5KFWA 4QYRA 4RBVA 3N5BA 3HXMA 2HNYB 4CIOA 1YH8A 2DNLA 4ZK7M 4PKDB 2R7UA 4PXEA 1UCNA 4X65F 4F50A 3M6WA 4DR4I 1ZM3A 1U2RA 2VQEE 1N5SA 4Q45A 4C0OC 5D0GA 4FW9A 2KT5A 3NL0A 2E7XA 2XEXA 5RUBA 1AXQA 3KJVB 4OO1E 3WHIA 4QQBA 2XGQA 1TTHB 4OJHA 1YTYA 5B0DA 3ZTRA 1NDCA 3BR9A 3ZTPA 5D78A 3FSXA 3I4PA 3GG0A 3NGUA 2DCUB 5HROB 4YB6A 3H4DA 4N7TA 3KG1A 1S9GA 3ITHB 1RKJA 1T05B 3RW7A 4OX9E 5HATA 3ENQA 1S6PB 3WZ0A 4F2SA 2OMOA 4AXJA 1IBKE 2HS0A 2BE9B 1F3FA 1JLCB 3ILJA 5DGBA 1XMOE 1NO8A 1HFEL 2NZCA 5CCMA 3HM9A 2NUUG 5KFZA 2BJ3A 3BKFA 3J81Q 2DO4A 5IT9C 2DGWA 4DL5A 4JI5J 4Q44A 3BGUA 2MQLA 2IVYA 3EZUA 3BDPA 3MDFA 5AT1B 1B64A 4IG0A 1S77D 1AUSL 3LP1B 2HHPA 4QIGA 2QA2A 3MR7A 2HHVA 4MAKA 4WXWA 4ALZA 2QL7B 1CJUA 2AKWB 2DR7A 1FDAA 2F1FA 2E9RX 3WQPA 1RTJB 3JAMC 3RJMB 4X65J 1FE0A 2DVIA 1CQMA 4PWDB 4NA1A 4DR7E 4DUYJ 3TANA 2WZ1A 3IBFB 3DI6A 4B3OB 3ZZPA 5CYQA 2OTJS 2H54B 3GFZA 5KFMA 2HHHF 4USVA 5AE3A 2V4RA 3BSAA 3VR1A 1IR2A 2IRXA 2X3GA 3DLKB 4ED3A 1AA1B 2J76E 3MZIA 4WWSA 2IBKA 2FJXA 5FJ4A 4R0EA 3CJ4A 2B7BB 2XBPA 1DTTB 4PYAA 4NEYA 2V2ZA 5C24B 3K5NA 1TKTB 2NYHA 4YMEA 1XK8A 3K59A 4DV3F 3QIPB 1NJXA 2JNJA 2HFVA 3Q86A 4ERDA 2DTJA 2ZH4A 5IC4B 1REGX 1N6QA 1RT5A 2BA1D 1FESA 2ZWOA 2HRYA 3ZXWA 2R9LA 5HLFB 3RRGA 3M8PB 4XPEA 3C8YA 4Z7YA 1TVRB 2NXUA 1MMNA 3R2DJ 4B3MI 4OO1C 2ZH8A 1FKOA 1EP4A 2JE6B 2HRTA 5F3TA 1P6TA 4RUAA 3O6QA 2J9CA 2PA3A 4GVBB 5F9LA 1FI4A 1PKPA 5KFOA 4X64F 4DL0C 4J9MA 1HPZA 2CJ9A 1VQ8S 1Y11A 2VPZB 4ZJOA 3R3TA 2LEPA 1DRZA 2A2CA 1RA6A 1QVGR 3QT5A 1U0HB 4DPOA 4KGZB 4X62E 1FXDA 2PO0B 2PNLA 4PWUA 2VQFF 2BOPA 4ECXA 3TO8A 2VC0A 4CLWA 2HHHJ 3JSBA 3MR2A 2GJIA 4OZ0A 2MQPA 2ZITA 3CCQS 2JEBB 3QZ7A 4DPXA 5DGAA 3MMAA 3RUBL 3KLIB 3FCVA 1C1CB 1IJFB 2D9PA 3OR2A 2XYPB 4LIRA 2CDQA 5I42A 4P6QA 4ANCA 3G9CA 4IZKA 3D28A 4TLRA 1BWEA 4OYXA 4DV3J 2J5AA 3R7SB 3BSCA 4ZA1A 4KPYA 1WEZA 3MMBA 4ICLB 4LFBI 1Y60A 2DNGA 2LKZA 3EICA 3TJ9A 1N32E 4CLSA 2GFFA 4EYIB 4U7UK 2UUBI 3ETOA 3OPKA 2XLIA 1KS2A 4FYYB 4DBQA 3OSPA 2CQCA
chains in the Genus database with same CATH topology
2CZ9A 1H7SA 2HFUA 3B78A 4YHHI 1HNZE 4B3SE 5FWKA 1HK7A 4JI0E 4DPYA 1NHHA 3J7AM 4P52A 1XMQI 1N33I 1VISA 4Z7CA 2PNMA 4JI6I 4USMA 3T1HE 4DV2I 3QT6A 4X65I 4DV0E 4RPFA 4PRVA 4FWGA 3OTOE 3K17A 1DARA 4JV5I 4DR2E 1N0UA 4DUYI 3J80Q 4LF9E 2WW4A 4DR1E 4IZJA 4JI8I 5IWAE 3JAMQ 4JI5E 3ZKBA 4NXNI 4URLA 4JI2I 4LF7I 4GKKI 2UUAE 2A2DA 1IBLI 1Z5BA 4LF4I 1XNQE 1Z0VA 4LFAI 4P7AA 1Z0BA 3GONA 2HK3A 1FJGE 4B3ME 4NXME 4GKJE 2X7IA 4JI4I 4LF6I 4DR4I 1ZM3A 1U2RA 4JYAI 3F0NA 2VQEE 1ELOA 1ZM4A 2GS8A 4DPWA 4IZJD 4FW9A 4KHPI 2GQ0A 2XEXA 4DV3I 4I3HA 4X65E 1HNWE 1USUA 3Q6NA 4HACA 2Z5CB 2HFSA 4MYTA 1EI1A 3QT7A 2IOPA 4M1KA 2UXDI 3HULA 5FLXQ 1H74A 3CWVA 1RREA 4NXNE 4GKKE 4DR3I 1KVKA 2R3VA 4HY1A 3WU6A 4X66I 4DR6E 3V5RA 4LF5I 4DPUA 1ZXMA 4K0KE 4OX9E 1HNXI 2UUCE 1Z0WA 4JYAE 4YY3I 1IBKE 4DV4E 4DU7A 3D4JA 4X64I 4JG4A 1XMOE 1N34E 2VF3A 4X62I 4USKA 4DR7I 4HXZA 1NHJA 3J81Q 2V8PA 3WU3A 5IT9C 3PYDA 4XTJA 1HR0I 5A2QQ 2BM1A 4DUZE 4JI1I 5LMNE 3T1YI 2VQFI 1IBMI 5BR8I 4LFBE 2DEJA 3LTOA 4DR3E 1B62A 4WUCA 4WUDA 4JI7E 2ZBKB 2HHHI 3LPSA 2HKEA 4DR5E 2UUBE 1XNRI 2Z5EA 1NHIA 2Z5BB 5LMUE 2F4VE 2ZM6E 3J80C 4LF8E 1FNMA 4JI3I 3JAMC 1I94I 2BM0A 4YHHE 2Z5CA 1Z5CA 4DR7E 1XMQE 1N33E 3B82A 2UXCI 1Z0GA 1BKNA 2UU9I 4JI6E 4DV6I 1S16A 5LL6R 4DV2E 2E5LI 1N36I 3B8HA 3ZM7A 1H72C 1NZ0A 4B3TI 4JV5E 1RR9A 4DUYE 1J5EI 2V2VA 4JI8E 4JI2E 4LF7E 2HHHE 3V2UC 4FWHA 4FWDA 2EFGA 1IBLE 3QT8A 2BV3A 3T1HI 4LF4E 2O1UA 2CGEA 4LFAE 1S4EA 1Z0TA 2V2ZA 3LNUA 4JI3E 5FLXC 3OTOI 1XHKA 4DR2I 3J7AG 4LF9I 4JI4E 4LF6E 4DR1I 4DR4E 1USVA 3WU5A 4R1FA 4AQYI 5L3JA 5IWAI 4JI5I 1FWLA 4IZKB 3P06A 3ZZ0A 4DV6E 4KHPE 3PYGA 4DV3E 2UUAI 1UEKA 2HKJA 2E5LE 1Y4UA 4DV5I 1ZM2A 2O1WA 4Z7YA 1KIJA 2IOQA 4PU9A 2DEIA 2UXDE 4PRXA 1FJGI 1Y4SA 4B3MI 4NXMI 1J5EE 1PVGA 4GKJI 1Z59A 3PYEA 4DV7I 3ZZTA 3Q6MA 2CG9A 3K1JA 2Z5BA 2VQEI 4KQVA 1EA6A 3J81C 4B3RI 3PYFA 2AJ4A 5A2QC 4X66E 1Z0CA 4LF5E 1HNWI 1WUUA 1FI4A 1PKPA 1Z5AA 2UXBI 2HK2A 1HNXE 2Q2EB 2V34A 1A6FA 4ZVIA 4AQYE 1H7UA 1MX0A 4YY3E 3PRYA 2A2CA 4X64E 3QT5A 4N3OA 1MU5A 4FN5A 4X62E 1KKHA 3WU4A 2X36A 2NPFA 3ZKDA 2PNLA 4DV5E 1N32I 3ZZUA 2O1TA 4DR6I 2LJPA 4IZJB 1HR0E 1D6TA 4DU8A 3M6AA 4K0KI 3K85A 4LFCI 4OX9I 2UUCI 4JI1E 2J7KA 4DV1I 4DV7E 1ZM9A 3Q1QA 2ZITA 4DPTA 3T1YE 2VQFE 2R42A 1IBKI 1IBME 5GMEA 5BR8E 4DPXA 4DV4I 2V2QA 4B3RE 1HNZI 4B3SI 1XMOI 4HYMA 1N34I 4ED4A 5GMDA 4JI0I 1FKAE 1K47A 3H4LA 1N0VC 1XNRE 2UXBE 3HJCA 4DXLA 1ZXNA 4IZKA 4DV0I 4EMDA 4DUZI 1OJ4A 4UT4A 1MG7A 2OI2A 5LMNI 1I94E 1Z0EA 4HACB 4LFBI 4UTGA 2O1VA 4WUBA 4MYUA 1Y6ZA 2UXCE 4JI7I 2E1RA 1FWKA 1N32E 2UU9E 4DR5I 1PIEA 2UUBI 1QZRA 1N36E 1KTVA 4LFCE 1XNQI 1H73A 5LMUI 2F4VI 2ZM6I 1B63A 4LF8I 4DV1E 5IT9Q 4B3TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ9 A;  1H7S A;  2HFU A;  3B78 A;  4YHH I;  1HNZ E;  4B3S E;  4JI0 E;  4DPY A;  1NHH A;  3J7A M;  4P52 A;  1XMQ I;  1N33 I;  1VIS A;  4Z7C A;  4JI6 I;  4USM A;  3T1H E;  4DV2 I;  3QT6 A;  4X65 I;  4DV0 E;  4RPF A;  4PRV A;  4FWG A;  3OTO E;  3K17 A;  1DAR A;  4JV5 I;  4DR2 E;  1N0U A;  4DUY I;  3J80 Q;  4LF9 E;  2WW4 A;  4DR1 E;  4JI8 I;  5IWA E;  3JAM Q;  4JI5 E;  3ZKB A;  4NXN I;  4URL A;  4JI2 I;  4LF7 I;  4GKK I;  2UUA E;  2A2D A;  1IBL I;  1Z5B A;  4LF4 I;  1XNQ E;  1Z0V A;  4LFA I;  4P7A A;  1Z0B A;  3GON A;  2HK3 A;  1FJG E;  4B3M E;  4NXM E;  4GKJ E;  2X7I A;  4JI4 I;  4LF6 I;  4DR4 I;  1ZM3 A;  1U2R A;  4JYA I;  3F0N A;  2VQE E;  1ELO A;  1ZM4 A;  2GS8 A;  4DPW A;  4FW9 A;  4KHP I;  2XEX A;  4DV3 I;  4I3H A;  4X65 E;  1HNW E;  4HAC A;  2HFS A;  4MYT A;  1EI1 A;  3QT7 A;  4M1K A;  2UXD I;  3HUL A;  5FLX Q;  1H74 A;  3CWV A;  1RRE A;  4NXN E;  4GKK E;  4DR3 I;  1KVK A;  2R3V A;  4HY1 A;  3WU6 A;  4X66 I;  4DR6 E;  3V5R A;  4LF5 I;  4DPU A;  1ZXM A;  4K0K E;  4OX9 E;  1HNX I;  2UUC E;  1Z0W A;  4JYA E;  4YY3 I;  1IBK E;  4DV4 E;  4DU7 A;  3D4J A;  4X64 I;  4JG4 A;  1XMO E;  1N34 E;  2VF3 A;  4X62 I;  4USK A;  4DR7 I;  4HXZ A;  1NHJ A;  3J81 Q;  2V8P A;  3WU3 A;  5IT9 C;  3PYD A;  4XTJ A;  1HR0 I;  5A2Q Q;  2BM1 A;  4DUZ E;  4JI1 I;  5LMN E;  3T1Y I;  2VQF I;  1IBM I;  5BR8 I;  4LFB E;  2DEJ A;  3LTO A;  4DR3 E;  1B62 A;  4WUC A;  4WUD A;  4JI7 E;  2ZBK B;  2HHH I;  3LPS A;  2HKE A;  4DR5 E;  2UUB E;  1XNR I;  1NHI A;  5LMU E;  2F4V E;  2ZM6 E;  3J80 C;  4LF8 E;  1FNM A;  4JI3 I;  3JAM C;  1I94 I;  2BM0 A;  4YHH E;  1Z5C A;  4DR7 E;  1XMQ E;  1N33 E;  3B82 A;  2UXC I;  1Z0G A;  1BKN A;  2UU9 I;  4JI6 E;  4DV6 I;  1S16 A;  5LL6 R;  4DV2 E;  2E5L I;  1N36 I;  3B8H A;  3ZM7 A;  1H72 C;  1NZ0 A;  4B3T I;  4JV5 E;  1RR9 A;  4DUY E;  1J5E I;  2V2V A;  4JI8 E;  4JI2 E;  4LF7 E;  2HHH E;  3V2U C;  4FWH A;  4FWD A;  2EFG A;  1IBL E;  3QT8 A;  2BV3 A;  3T1H I;  4LF4 E;  4LFA E;  1S4E A;  1Z0T A;  2V2Z A;  3LNU A;  4JI3 E;  5FLX C;  3OTO I;  1XHK A;  4DR2 I;  3J7A G;  4LF9 I;  4JI4 E;  4LF6 E;  4DR1 I;  4DR4 E;  3WU5 A;  4R1F A;  4AQY I;  5L3J A;  5IWA I;  4JI5 I;  1FWL A;  3ZZ0 A;  4DV6 E;  4KHP E;  3PYG A;  4DV3 E;  2UUA I;  1UEK A;  2HKJ A;  2E5L E;  4DV5 I;  1ZM2 A;  4Z7Y A;  1KIJ A;  4PU9 A;  2DEI A;  2UXD E;  4PRX A;  1FJG I;  4B3M I;  4NXM I;  1J5E E;  1PVG A;  4GKJ I;  1Z59 A;  3PYE A;  4DV7 I;  3ZZT A;  3K1J A;  2VQE I;  4KQV A;  1EA6 A;  3J81 C;  4B3R I;  3PYF A;  2AJ4 A;  5A2Q C;  4X66 E;  1Z0C A;  4LF5 E;  1HNW I;  1WUU A;  1FI4 A;  1PKP A;  1Z5A A;  2UXB I;  2HK2 A;  1HNX E;  2Q2E B;  2V34 A;  1A6F A;  4ZVI A;  4AQY E;  1H7U A;  1MX0 A;  4YY3 E;  2A2C A;  4X64 E;  3QT5 A;  1MU5 A;  4FN5 A;  4X62 E;  1KKH A;  3WU4 A;  2X36 A;  2NPF A;  3ZKD A;  4DV5 E;  1N32 I;  3ZZU A;  4DR6 I;  2LJP A;  1HR0 E;  1D6T A;  4DU8 A;  3M6A A;  4K0K I;  4LFC I;  4OX9 I;  2UUC I;  4JI1 E;  2J7K A;  4DV1 I;  4DV7 E;  1ZM9 A;  3Q1Q A;  2ZIT A;  4DPT A;  3T1Y E;  2VQF E;  2R42 A;  1IBK I;  1IBM E;  5GME A;  5BR8 E;  4DPX A;  4DV4 I;  2V2Q A;  4B3R E;  1HNZ I;  4B3S I;  1XMO I;  4HYM A;  1N34 I;  4ED4 A;  5GMD A;  4JI0 I;  1FKA E;  1K47 A;  3H4L A;  1N0V C;  1XNR E;  2UXB E;  4DXL A;  1ZXN A;  4DV0 I;  4EMD A;  4DUZ I;  1OJ4 A;  4UT4 A;  1MG7 A;  2OI2 A;  5LMN I;  1I94 E;  1Z0E A;  4HAC B;  4LFB I;  4UTG A;  4WUB A;  4MYU A;  2UXC E;  4JI7 I;  2E1R A;  1FWK A;  1N32 E;  2UU9 E;  4DR5 I;  1PIE A;  2UUB I;  1QZR A;  1N36 E;  1KTV A;  4LFC E;  1XNQ I;  1H73 A;  5LMU I;  2F4V I;  2ZM6 I;  1B63 A;  4LF8 I;  4DV1 E;  5IT9 Q;  4B3T E; 
#chains in the Genus database with same CATH topology
 2CQD A;  5EKW A;  4ILL A;  1QY7 A;  2WAQ D;  3BJY A;  1HK7 A;  1RE1 B;  4DV0 F;  1XMQ I;  2FHJ A;  3GTY X;  1K73 T;  1ARO P;  4JI6 I;  2F65 A;  3KXD A;  1T9W A;  1RAH B;  5SUH A;  3IGN A;  4X64 J;  4NCA A;  3CWJ A;  3ET6 B;  2HVE A;  2XS7 A;  3EPG A;  1FHT A;  1S1T A;  1Y5L B;  1B0P A;  2RRN A;  1WOR A;  1C4A A;  3UI3 A;  3KYL A;  3D0I E;  4PZV A;  5KFU A;  1CC8 A;  4QW8 A;  2PE8 A;  2VQF J;  2FY8 A;  3ZTS A;  1L3U A;  3DCA A;  2B9X A;  5DZ7 A;  5HL7 Q;  5DG7 A;  4LOM A;  1OY6 A;  2BUN A;  4MKA A;  3PG9 A;  5EHH A;  1U7L A;  4MK8 A;  2VPY B;  5KG5 A;  1X9W A;  1Z1Z A;  1NK5 A;  3K7R A;  4ED1 A;  1WG5 A;  2C37 B;  4I3H A;  4F26 A;  3DOL B;  5KFH A;  5J1E A;  3PRD A;  3KK1 A;  4A48 A;  4DR6 F;  2BJE A;  4X2B A;  1DJ0 A;  2P9E A;  5LJ3 Y;  3Q89 A;  1NK8 A;  2VG6 B;  4Y2M A;  2DPI A;  2XZT B;  4WFX A;  3H1C A;  3TAM A;  1M5S A;  4DV4 F;  4AID A;  3C14 B;  3TEH B;  2WON B;  2FZK B;  4DSL A;  2LXF A;  1Y10 A;  4DV0 J;  4DUZ J;  3VTI A;  2BW7 A;  3HKM A;  4DR7 I;  3GPA A;  1HBO A;  1LFW A;  4P2X A;  1UVM A;  5FDL B;  2FGC A;  3PYD A;  1QSS A;  3HHK A;  4ID8 A;  3SCK E;  4WCE Q;  1WEY A;  1YJU A;  2W2Q P;  2KTQ A;  2L48 A;  4DUT A;  1JK9 B;  4AND A;  4OYM A;  2F4V F;  4ED8 A;  1UET A;  2XMV A;  4J9V A;  2F8M A;  3DOM B;  2YKO A;  1R27 B;  5K8O A;  1RB0 A;  1S9F A;  5LMU E;  4QZV B;  3GJQ B;  3IR5 B;  4FXW A;  5KT2 A;  2UVR A;  3ONQ A;  5D0R A;  3VHQ A;  5I3U B;  2FJA B;  1JJ4 A;  2MST A;  3L9Z A;  2YKQ A;  2XGP A;  4JBC A;  3MED B;  2UXC I;  3G4S S;  2GIQ A;  2CNL B;  1V5I B;  1RYS A;  3M9O B;  3W5Z A;  3B8H A;  2CJQ A;  3LWL A;  2DRB A;  5J2N A;  2NXE A;  1U49 A;  4DR6 J;  4TVA B;  1HI1 A;  1PAE X;  2B4V A;  2DPJ A;  4IFD B;  2HHS A;  3NG8 A;  3DU5 A;  2B0G A;  3I82 A;  4C8K A;  3A13 A;  1QUP A;  3GIR A;  1WSR A;  3FNN A;  3PKY A;  4ZPD A;  2CXE A;  4DV4 J;  2O1U A;  1UW4 A;  4BA1 B;  3JSR A;  4DSJ A;  4HTJ A;  1TKZ B;  5ELW A;  4OZE A;  2XY5 A;  5J2Q A;  1UFW A;  4NLR A;  4ECU A;  3QAT A;  3DKD A;  3NBP A;  1YRT A;  1JMT A;  2JT2 A;  4FXD A;  1ZA1 B;  3WBZ A;  1W2I A;  2C3O A;  2ROE A;  4KGK A;  4M5D B;  4J3D A;  2MXY A;  1D8Y A;  1J5O B;  3J7Z T;  1D9D A;  3SFG A;  4A8X A;  2B9Y A;  3QWU A;  4C3M A;  2D1C A;  4JV1 A;  3CCV S;  4DL4 A;  4X66 E;  4DCO B;  3PXG a;  1KQS R;  5KT3 A;  4GQU A;  3CC4 S;  1RQ0 A;  3LP0 A;  3OT9 A;  3W8G A;  1R31 A;  1T03 A;  1AYE A;  2MMY A;  3M85 G;  2NPF A;  2X36 A;  4NLY A;  5H9E J;  2FZC B;  1N32 I;  2DXE A;  3ZZU A;  4PG7 A;  5F41 A;  4CLU A;  3VQT A;  1SL2 A;  4H4M B;  2J7U A;  4IOC Q;  4YR0 A;  4JI1 E;  3TZX A;  2R4F A;  4HYM A;  1N34 I;  3Q8U A;  2F5G A;  2MLX A;  3R27 A;  1RTH B;  2EBG A;  1QSL A;  3HJC A;  4LRF A;  4CLT A;  4I7F A;  2FVS A;  3OXG A;  3DN9 A;  2N4D A;  5LMN I;  3W64 A;  2MHE A;  3S6E A;  2C39 A;  4EGL A;  1PYS B;  4MYU A;  3CDB A;  2FLP A;  2UU9 E;  4CNY A;  4B3S F;  1U45 A;  3I56 S;  3OVB A;  2VU5 A;  3M32 B;  1BGX T;  4DV1 E;  5HI7 A;  4K4S A;  4R8U B;  3UVJ A;  1T9V A;  3A8J A;  4IOB A;  3IWL A;  2PNM A;  4KGX B;  1FRJ A;  3MPD A;  1NH8 A;  1FJC A;  1MWY A;  2GGP B;  4AQY F;  3QT6 A;  3W2W A;  1TK5 A;  4JUZ A;  2GQC A;  3AAW B;  1L3K A;  4P7T A;  1WOS A;  3IC1 A;  5B0C A;  4KFB B;  3BN4 A;  1VQO S;  4LF7 I;  1FJG F;  4LCF A;  1IVZ A;  4ZP9 A;  4LFA I;  3IFE A;  2CPE A;  3FEZ A;  1RWX B;  4A8Q A;  4NOH A;  3DYA B;  1C0U B;  2WHO A;  4LF6 I;  4MKV A;  3EWG A;  4O3N A;  1CJT A;  3MEK A;  4KHP I;  1VLY A;  4OLO A;  2CJB A;  2HMI B;  3GFY A;  1RHQ B;  4JV0 A;  2CWX A;  3Q23 A;  3HMJ G;  2UXD I;  3AY0 A;  4A47 A;  1RWM B;  3R5C A;  3T41 A;  4HYK A;  1KON A;  4PCQ A;  3TOQ A;  4Q8F A;  2YH0 A;  4B17 A;  2ZVS A;  4J7C A;  4PQU B;  2BBE A;  5F8J A;  2Q6B A;  3E8O A;  4QYZ J;  4B3S J;  2QMW A;  4OI2 A;  1QTN B;  4ZP7 A;  4A8W A;  2DHS A;  3H40 A;  1R0B G;  2PMH A;  1DLO A;  1RI7 A;  3FEY B;  3HFZ B;  1NPK A;  4DQQ A;  2C42 A;  4K2X A;  2BAN B;  1FKP A;  3N9U C;  4ZVU B;  4LRC A;  2KO1 A;  3P4U B;  5AXN A;  5F8M A;  1KSP A;  2XCA A;  2EXU A;  2V2K A;  5K36 E;  1EZZ B;  1RT2 B;  3LTO A;  1URN A;  2ZKT A;  2KB2 A;  5KFI A;  4EI2 A;  9RUB A;  3H42 A;  3IS9 A;  3IRW P;  1FJG J;  2LQ5 A;  2E9Z A;  3G8Q A;  2Z5E A;  2PC6 A;  4ZKA A;  2ZDP A;  4ZVF A;  3GE9 A;  5KG1 A;  3KUH A;  1TFY A;  3JQM A;  4ZVQ B;  2IM1 A;  3PW2 A;  4J9N A;  1SC4 B;  1NK6 A;  3M9M B;  5L1J A;  2L3M A;  3PW5 A;  2HHQ A;  4OQJ A;  2C38 B;  2KYZ A;  3SSS A;  1JJH A;  1S16 A;  4OKG A;  3GSI A;  4P75 A;  3HVR A;  2IHR 1;  4JI8 F;  1TR0 A;  3QLH A;  5DRO A;  1S1W A;  5ETQ A;  4OI1 A;  2J9D A;  3Q24 A;  2W2O P;  3GJR B;  1FTR A;  3WIU A;  4IS9 A;  2JJ4 D;  4C6A A;  3H0P A;  4FW5 A;  4FPR A;  4JI2 E;  4L73 A;  1TL5 A;  1RT1 A;  3UQS A;  4YUD A;  3DLH A;  4LF4 E;  1B0V A;  1U1Q A;  3M8Y A;  3VCD A;  5D0E A;  2RE1 A;  1OIA A;  2K3I A;  2FUG 9;  3BGL A;  3IAM 9;  1RHJ B;  1N5Y B;  4WFB Q;  4V19 X;  2O66 A;  1HWL A;  1CPZ A;  1X60 A;  2MZJ A;  1JLQ B;  1KLM B;  2BJD A;  1KDN A;  4IQX A;  2XWX A;  3UE2 A;  3F44 A;  3QJL A;  1KIJ A;  3W2V B;  4P2M A;  3SQG B;  1PC4 A;  1R8H A;  2O67 A;  4ES3 A;  4NE9 C;  1EET B;  2JOQ A;  3FQL A;  2VFT A;  4IFD E;  1S1V B;  3CCW A;  2J8A A;  4YN3 B;  5DG8 A;  4I56 A;  4J5O A;  4C3L A;  1BE4 A;  4Y00 A;  3MUR P;  1AZS A;  1NHV A;  2G0C A;  1H6K X;  1Y4Z B;  1SKW A;  1TL1 B;  2AV5 A;  3MMJ A;  4NI2 B;  2XZW A;  4I2Q B;  3ZZY A;  1W25 A;  3GIJ A;  2ZJR Q;  2VJU A;  3HVT B;  3HDS A;  3RR8 A;  4JI8 J;  1NPR A;  5E3Q A;  5HMZ A;  1DHM A;  3PW4 A;  4DV1 I;  2RUS A;  2DNO A;  4J91 A;  1XNR F;  2UXB F;  2YPY A;  1WEX A;  5FD1 A;  4B3R E;  2VA3 A;  2VPX B;  5DDQ C;  3US5 A;  1RLD A;  4MK7 A;  5A0Y B;  2VIC A;  2ZDO A;  3R7N B;  1LXN A;  2CPY A;  5MAO A;  3DRP A;  3DDN A;  3TZY A;  1WI8 A;  3N6N A;  4KT0 C;  4UOH A;  5DDO C;  1APS A;  4EBE A;  3W3S A;  1BLU A;  1Z2Z A;  3DXS X;  2F1D A;  3TNV A;  2OPP A;  4FBU A;  1E6Y B;  1TL7 A;  4LR9 A;  2L9W A;  1CUL B;  2DGQ A;  1V3R A;  5DM6 Q;  1HL6 A;  4JI0 E;  1Q5V A;  4F0K A;  4KQZ A;  4M5J A;  1S57 A;  4I2P B;  2G0I A;  4DL6 A;  3PS3 A;  4X4O A;  1HW8 A;  4L3K A;  4FW7 A;  4YEA A;  2HWT A;  1UA0 A;  2WVF A;  5IM0 A;  3W5Y A;  3OTO E;  4JV5 I;  2ASL A;  2MLY A;  2G13 A;  5K8P A;  1UKU A;  4WBF A;  4O0N A;  1R8P A;  2P5V A;  5LXR A;  2ZD1 A;  1RJJ A;  3VGV A;  1RWV B;  2DGO A;  2Q6C A;  2UUA E;  3DMJ A;  3DC2 A;  2XY6 A;  1QSY A;  2KXF A;  4TY9 A;  3VAF A;  1YWX A;  1S1U B;  2CQ3 A;  3NS7 B;  4AFF A;  1UJ6 A;  2X1B A;  1B0T A;  2KRB A;  2GMJ A;  1XNR J;  3BH7 B;  2UXB J;  1HNW F;  2PEB A;  2H1Y A;  2CJY B;  1CSJ A;  3EGV A;  3P45 B;  3K0J A;  1RAI B;  4IFD C;  2RT3 A;  2POK A;  4GC7 A;  5DS7 A;  2AE8 A;  3TP2 A;  3EZ5 A;  2AEJ A;  1Q79 A;  1YKW A;  4U95 A;  5JEA D;  2BQ3 A;  2K1R A;  1S9E B;  4NYO A;  1F2G A;  5C0X D;  2ZE2 B;  4ZOS A;  1H2V Z;  5K14 B;  4NLU A;  3R1H A;  4DPU A;  1ZXM A;  5L38 A;  5K36 D;  4OHY A;  1FEH A;  1HNX I;  3MEG A;  3TUI C;  1IKW A;  3PEJ A;  2WTF A;  1N5Q A;  3J80 Y;  4ISA A;  3UDE A;  2IAJ A;  2CYY A;  2R7Q A;  1HNV B;  3AQP A;  4N8O A;  3M7N D;  4KY3 A;  4HXZ A;  1SJ3 P;  3WU3 A;  1RHR B;  3ZZO A;  5DRQ A;  4CP5 A;  2VBX A;  5AXM A;  4DR5 F;  4HT7 A;  3VAI A;  3CJK A;  4LF8 F;  3THT A;  1LEO A;  3AOA A;  5B0F A;  1HBN A;  3R8Y A;  2OPS A;  3OVA A;  1QM9 A;  2E5H A;  3QGP A;  1FNM A;  4O3R A;  3HD1 A;  1WHY A;  1GT8 A;  1NJI T;  1P9Q C;  2XNQ A;  1U1P A;  2ALZ A;  4Q0B B;  4YHH E;  1HNW J;  5IQ6 A;  3C16 A;  1JJ2 R;  3I0R A;  1RAA B;  3UDL A;  3PO4 A;  3QSY B;  2EW9 A;  2Y1L B;  4ZIV A;  1RT6 A;  2XB2 D;  2JEA B;  2CQP A;  4NXN F;  3H2U B;  5LM7 E;  5HMW A;  1R0C B;  2O1P A;  3GB0 A;  1KWM A;  2Y1R I;  5K20 B;  1OO0 B;  4UUW A;  2GC8 A;  2QL5 B;  3V6D B;  2H5E A;  4IH7 A;  3SV3 A;  4YB1 P;  3QT8 A;  1RAD B;  3V81 B;  3IM9 A;  4PAA A;  4DLE A;  4KH0 B;  1JWW A;  1X7V A;  2CKW A;  3J7A G;  2D3O R;  1T95 A;  3I9V 9;  5KFL A;  2BRL A;  4LF9 I;  4Z2X A;  2DR5 A;  1ZAX A;  4LR7 A;  4JI5 I;  2HFZ A;  1JLE B;  3CCL S;  2RHQ B;  5F0W A;  1FRL A;  2IFX A;  1AT1 B;  4BS2 A;  1TK8 A;  4C48 A;  4J9Q A;  3UNG C;  1RHY A;  2CPF A;  2DEI A;  2MDA A;  3W66 A;  4DR5 J;  4ZP6 A;  4LF5 F;  1VR6 A;  4B3R I;  3V4I B;  4LF8 J;  3MM9 A;  3BH6 B;  1IKX A;  4OHV A;  1RUS A;  1HNI B;  4PRF A;  2W7O A;  3POT A;  3BB5 A;  2R7W A;  1BWV A;  1AFI A;  4XTT A;  1R7I A;  1MWQ A;  2LDI A;  2YNF A;  1SJF A;  2QT7 A;  1MMD A;  4RW4 A;  3SXL A;  3PRY A;  1JXV A;  2CPH A;  2VBY A;  3CDW A;  1YI2 S;  1MU5 A;  1FRI A;  1JX4 A;  1RTI A;  4Q2L A;  3BBB A;  4M5M A;  3L7Z B;  3OHA A;  3ZNJ 1;  1IBM F;  5BR8 F;  2P6S A;  3PRB A;  1HR0 E;  1D6T A;  2SXL A;  5JEA A;  1AUD A;  4KO0 A;  4AL6 A;  3VAH A;  2YNH B;  5C42 B;  2ZH7 A;  2HFN A;  4PXC A;  3ENW A;  5I3Q A;  4OV6 A;  3ISN D;  4JI0 I;  2OD4 A;  2FVP A;  2JHE A;  2MTL A;  3BQ1 A;  3AJ2 A;  1I94 F;  2VBW A;  2RDJ A;  2YY3 A;  3U1Y A;  3R7B B;  3V4M A;  3MEC B;  2DR6 A;  3S01 A;  2YH1 A;  4TY8 A;  1S5Z A;  4ZN1 A;  2CNO B;  1LQ9 A;  4DFM A;  1N36 F;  3DGP B;  4TYA A;  1NDL A;  4B3T F;  1UDN A;  4FZV A;  2HQD A;  3Q2S C;  3CT9 A;  3SZ2 A;  1B63 A;  3D6T B;  4DL7 A;  4RNH A;  2GO3 A;  1X4A A;  4LF5 J;  2VES A;  3D0G E;  3PNI A;  2JFK A;  5KFE A;  4R25 A;  3EXY A;  4URQ U;  1JLA A;  4QU6 A;  4HR2 A;  4NPO A;  5KFB A;  2C3U A;  4HT5 A;  5GMK a;  4FWG A;  3LO3 A;  1S4F A;  1LWF A;  1N0U A;  4P73 A;  2QG9 B;  4DX8 H;  2YKN A;  2HG4 A;  3AQO A;  4MIW A;  3D6F B;  1KC8 T;  1GQE A;  3QJJ A;  2LVW A;  2A2D A;  3DU6 A;  3PAC A;  2KG0 A;  1H38 A;  3AJD A;  1IBM J;  5BR8 J;  5U47 A;  2IES A;  3GLJ A;  2VQE F;  3EUN A;  4LBP A;  1HQU A;  4WKY A;  1S48 A;  3J80 U;  2RIJ A;  4OO1 F;  3FCW A;  4NLP A;  3BKU A;  1NAQ A;  3A3P B;  2FC9 A;  3DOK A;