1KKHA

Crystal structure of the methanococcus jannaschii mevalonate kinase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
317
structure length
317
Chain Sequence
PRGSHMIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGGGGCVIILVNEEKEKELLKELNKEDVRIFNCRMMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mevalonate Kinase
publication title Structure of the Methanococcus jannaschii mevalonate kinase, a member of the GHMP kinase superfamily.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 104
structure length 317
sequence length 317
ec nomenclature ec 2.7.1.36: Mevalonate kinase.
pdb deposition date 2001-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 1kkhA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1kkhA01
4LF9E 4JI7E 4LFAI 4JI1I 1HR0E 4UTGA 1H7SA 4Z7YA 1XMOE 4DXLA 1FI4A 1N36I 4WUCA 4DV1I 4ED4A 1FWKA 4LF6E 4FN5A 3Q1QA 3JAMQ 4DV7I 2UUBI 1ELOA 2ZITA 1Z0GA 2VQFI 3J80C 3K17A 4LF8E 1Z0VA 3J7AG 2X7IA 2Q2EB 1NHHA 5BR8E 4DV4I 4X65I 4B3RE 1XMQI 4EMDA 3WU6A 4I3HA 3J81Q 4DV5E 4KHPI 1N32E 4X62E 4JYAI 4X64I 4AQYI 4LFBE 4P52A 4NXNE 2DEJA 4DR6E 4DR3I 4B3SE 4DUYI 3PYGA 1XNQE 2F4VE 3WU4A 2R42A 3LTOA 1N34E 1XHKA 1HNXE 4Z7CA 3WU5A 4JI8E 3PYEA 1VISA 2UUCE 5IWAI 4LF5E 4LF4E 3T1YI 4DV2I 2DEIA 5A2QC 2E5LI 4LF7E 3D4JA 4K0KI 3LPSA 4JI0I 1NHJA 4GKJI 1FWLA 4B3TI 1KTVA 3ZKDA 3B8HA 2UUAI 1ZM3A 1U2RA 1MX0A 2HK3A 4DPWA 1DARA 5LMNI 4PRVA 1H74A 4DV3I 4JI2I 4DR4E 2HKJA 4DR1E 4USKA 2X36A 2R3VA 3ZZUA 3J7AM 1FJGE 5GMDA 4LF6I 3F0NA 3ZM7A 3ZZ0A 1I94I 4YY3I 1N33E 3JAMC 4YHHE 5LMUE 4R1FA 3V5RA 4JI4I 4DR7I 1KKHA 4LFAE 4JI1E 2UXBI 1B63A 4DUZI 1KVKA 1Z0CA 1Z0BA 4DR5I 3B78A 4DV5I 2WW4A 4X66I 2V34A 1Z0WA 3V2UC 1N36E 1HNWI 2AJ4A 3J81C 2V2VA 4DV7E 2UUBE 3J80Q 2GS8A 4PU9A 2BM0A 3OTOI 1ZM4A 4HYMA 2VQFE 4DR6I 4HACA 4DV6I 2EFGA 2VQEI 1IBLI 2BV3A 3ZZTA 2UXDI 1HNXI 3QT5A 2ZM6I 2V2ZA 1IBMI 1OJ4A 1XMQE 2HHHI 4JV5E 3T1HE 2UUCI 1PKPA 4LF5I 1N0VC 4DPXA 1RR9A 4NXME 4KHPE 4USMA 4P7AA 4X64E 4AQYE 3QT8A 2UXCI 4MYUA 4FWGA 1Z5AA 1IBKE 4DR3E 4DR2I 4DUYE 4LFCE 4JG4A 1HNZE 2LJPA 4JI3E 2UU9E 4GKKI 4DV0I 4DPYA 1XNRI 1EA6A 4B3MI 2XEXA 5A2QQ 1NHIA 4XTJA 2A2CA 3T1YE 1Z0TA 4DV2E 2E5LE 4OX9I 2J7KA 4KQVA 1ZXNA 5FLXQ 4JI5I 4K0KE 4LF9I 4JI7I 4WUDA 1HR0I 4WUBA 4JI0E 1KIJA 4GKJE 4JI6E 5IT9Q 4B3TE 5LL6R 1XMOI 1J5EE 2UUAE 1Z0EA 1BKNA 4M1KA 2A2DA 4HY1A 2NPFA 4LF8I 4DV3E 4JI2E 1ZXMA 2HK2A 3WU3A 1PIEA 4HACB 5BR8I 4MYTA 1S4EA 4HXZA 4B3RI 3HULA 1WUUA 1ZM2A 1K47A 4DU7A 1N32I 4DV1E 5L3JA 4X62I 4FWHA 1I94E 4YY3E 2V8PA 1Z5CA 2VF3A 1QZRA 4LFBI 4NXNI 4JI4E 4DR7E 4PRXA 2OI2A 4B3SI 3QT6A 3K1JA 1XNQI 1PVGA 2F4VI 1N34I 2UXBE 4DUZE 4JV5I 4DV4E 3T1HI 4X65E 1B62A 4DR5E 1FKAE 2ZBKB 4X66E 4JI8I 4NXMI 3QT7A 1HNWE 1FNMA 4LF4I 3B82A 4UT4A 1H72C 3ZKBA 2HFSA 4FWDA 3OTOE 4JYAE 1MU5A 1IBKI 4LF7I 1RREA 3CWVA 4LFCI 4DV6E 1HNZI 3LNUA 2VQEE 4JI3I 1IBLE 2UXDE 4FW9A 2ZM6E 2UU9I 3H4LA 2E1RA 1N0UA 1IBME 2HHHE 1H7UA 1UEKA 3M6AA 4DPUA 1H73A 1ZM9A 4URLA 5IWAE 2UXCE 2CZ9A 1MG7A 4ZVIA 3GONA 5FLXC 4DR2E 4DR4I 4DR1I 2BM1A 4JI6I 2V2QA 1D6TA 4DU8A 1J5EI 4GKKE 4DV0E 1Z59A 4RPFA 5IT9C 3PYFA 1XNRE 4B3ME 1FJGI 1EI1A 1NZ0A 1N33I 4YHHI 5LMUI 5GMEA 1A6FA 3PYDA 2HFUA 4DPTA 5LMNE 4OX9E 1S16A 4JI5E 1Z5BA 2HKEA
chains in the Genus database with same CATH superfamily
1RACB 2YKNA 4LRFA 4UTGA 3OFGA 1N5SA 2ZBQA 2QSFA 2CUYA 4F0MA 3GFZA 3GG0A 3J7AN 3C14B 5EDWA 2A0FB 4YY3J 1S76D 1XTZA 4KO0A 2GVZB 4J9MA 3OXFA 3OW2R 3K17A 3TAQA 3E3XA 1Y3JA 2GJFA 2G13A 3PW5A 1RZMA 2JFDA 1N88A 1M5VC 4DV5J 3QIDA 1NDLA 4A8XA 1SKRA 1AROP 3J80U 4I2QB 1NZ8A 4JBCA 4RUBA 3H1CA 4PG5A 5KFEA 3PW0A 4JV2A 1TL1A 4O3PA 1Y5IB 3D66A 4DFJA 5AXKA 4MDTA 1IKWB 2HRTA 3OR2B 1SJ3P 3SEOA 1UDNA 2H4YB 2HHSA 4R8UB 1XHKA 4ECYA 4QIWD 2JVRA 2PT0A 2PO1A 4CLFA 2HNYA 2VJUA 2BA0G 1YLXA 4F4WA 1UVNA 5JEAD 4NCGA 2E7WA 1NH8A 1JJHA 3HF5A 2ZC4A 4LF8F 2CNKB 4JOUA 1HMVB 1Y00A 1RQ0A 2HWTA 3ZXWA 4B3RF 4OLPA 3UE2A 4A4JA 1XNRJ 1X0PA 3E01A 1A6LA 3NY0A 1KTVA 1R8AA 3I55S 3BYRA 1FERA 3ENQA 1H2VZ 3CCSS 4B3SF 2MZ1A 3C46A 5B0CA 2LQBA 3ZTSA 2NXNA 2XLIA 1FFSB 3QZ7A 4RW8B 3K2YA 5E5NA 3MI7X 3CCTA 1SH0A 2K8GA 3I5AA 1O6XA 2QN6B 2YX4A 3HP6A 2KT2A 4LF7F 2Q79A 2BANB 4MU0A 4V19J 2GJ2A 3K5PA 2JVOA 5ITHA 1EETB 4P73A 4HT5A 1ZZNA 3OVBA 2ZJQQ 1MWZA 2AJ0A 2DPJA 4TQSA 4EO6A 2C2DA 1P9YA 3EICA 1M5OC 1YRXA 2LQ5A 1C1CA 4O4GA 1PAUB 3ZO7A 1N5VA 3DRRA 2ACMA 2UXDI 3RB3A 4JV5J 1TMMA 2IBOA 1OYDA 3HSJA 1U1KA 4NXMJ 4DPOA 2B56A 1N33F 1UWBB 1G2EA 1VBKA 2QA2A 5GAHI 1VS3A 4DUYJ 3J7YI 1YJWS 4LFCJ 2XB2D 2WP8A 4DR3E 2VB6A 1AXQA 5F3ZA 3UCZP 4X4SA 4ZVPB 1Q82T 4J37A 2NPIA 5E3PA 1LXJA 4U3BA 4GKKI 1CEZA 2FLNA 1NBEB 1S6PA 4G1PA 5A8KB 2DR7A 1B64A 1HLWA 3MDFA 2V94A 1VR6A 2RQCA 2DRBA 5HROB 2CPEA 4OO1C 4DSKA 5HATA 2ERRA 3D67A 4C0HA 2DNGA 2W2OP 5A8WB 1YG0A 4WUDA 3MR2A 1CULA 3IS9A 3TR5A 4XPEA 3MUVP 2HS3A 4ED2A 2IM3A 3DLKA 3C15A 4BLGA 3NMAA 3H8YA 1J5EE 2NUUG 4I64A 4FYWB 1YK9A 1VIOA 2GIQA 4J9OA 1VI7A 1CS4B 7FD1A 2KFZA 1SL0A 3MMJA 4I6AA 1NSAA 4EYHB 1V3RA 3J7ZT 1J27A 1ICEB 1S48A 3LPEA 2YWKA 4L72B 5GAEU 4DV1E 3ISZA 2WAQD 1RWOB 1VHIA 4LFBI 4IFDD 3IGVA 1T02A 3BDEA 2XY6A 1VGYA 4GKJF 4ZDNA 4FF4A 3FMBA 5F8NA 1JJ2R 4X65E 2C3UA 3IBWA 5KT3A 4C8OA 3ADAC 1RWMB 2AYMA 4KGVB 3KMQA 1KBRA 4OI6A 2IA6A 5LJ3Y 1F1BB 1SJQA 4B3OB 1MU5A 2GO9A 1FJEB 1K0VA 2EKYA 2YKQA 4K4VA 2V67A 5K36D 1ZETA 4K59A 3QRQA 2XO6A 4QYZK 1PILA 2G0CA 1IM6A 1TKZA 1IVZA 1U0HA 4JI4F 1WOPA 4QYRA 1N54B 1WC5A 1KONA 2PIIA 4ZVIA 2YVSA 4DV0J 1MROB 2WK4A 2HZAA 3ZTRA 4N3OA 1E6VB 2KHDA 2ROPA 1FJGI 2YKMB 3ZFVA 4OO1F 4GVBA 5DDQC 1OY6A 4LF9J 5LMNE 4ZIVA 4RW9A 4LR9A 2NREA 2FHJD 1B70B 4NLGA 1HNXF 4JI7E 4LFAI 1PAEX 2BW2A 3EVMA 3BSCA 3VALA 4K4TA 4LT6A 2RRAA 2R8KA 3HK2A 1SIZA 2CJYB 3VGUA 5LXYA 4AIDA 1PBAA 4DV7I 1RAJA 2BABA 1Q7YT 1Z0VA 3MEDB 2MB0B 2ZOGA 4BDPA 4UOHA 4B3MF 3GIMA 3BGOP 3KJVA 1L3SA 4GRSA 2QO3A 4N77A 2OPQA 3P06A 4M5KA 5L1KA 3JSMB 2CQ2A 1T05A 3PYEA 2RS2A 2UUCE 3MTKA 4LF5E 1EKSA 5L46A 2GQQA 2DNQA 1KOOA 4CO5A 5C24A 4NLOA 3L7PA 2F40A 2VC0A 3THTA 2UUWA 3BO4A 2HBRB 1OWXA 5FJ4A 4CLSA 1TU0B 1MX0A 3PR5B 2YY3A 4IRDA 4NWBA 3GILA 3ZC4A 4QIVA 3NMRA 1UDSA 4RNFA 3CJ8A 2G2ZA 1S5ZA 2HKJA 4DWIA 2E5HA 4ED1A 2KDOA 4ZN1A 5J2PB 1S99A 3X3UA 1PJ5A 2P8IA 3FEXB 4DQPA 3MECB 8RUCA 2HNDB 2F1FA 3V6JA 1I94I 4OFZA 3KFWX 2VUGA 2H54B 3PNIA 3JS9A 4MH8A 2BA1D 4QWBA 5LT5A 4PEOA 2VASA 3U1MA 4F36A 2JLEA 1KLMB 4ID5B 3B78A 3ILOA 2BRLA 4USTA 2AJ4A 2ZH4A 4ANEA 1RA7A 3MGJA 4CIOA 4DR6I 4CLUA 2G1DA 1U47A 3U1KA 2N4DA 3HVRA 2V2ZA 4ER8A 2OTJS 1NKCA 3OL6A 3C6UB 5A0YA 1TVRB 3K0JA 1K73T 5DG9A 3E8OA 3QIPB 4MYUA 2OMOA 4B9VA 1R7IA 4CYUA 4IZJB 4JG4A 3IRXA 3M1VB 4ELVA 4X4OA 1R0AA 5KG5A 3AB2B 3L4BC 4KBIA 5C5JA 1BWVA 1RT6B 4RW7A 2E5JA 3IG1B 5F0UA 2IFXA 4OLOA 3Q8QB 1GK8A 2Y1LB 2ZKUA 3RUBL 2G9OA 2EBEA 2Y8WA 1IKVB 4LF2A 3P8BB 4AD6A 1WTFA 1BD6A 4XK8C 4IG0A 2ADBA 2E7XA 1R8HA 4FXDA 3M8RA 3POTB 4KKOA 3PRDA 1S0OA 4IDKB 4B3TE 5LL6R 4DUTA 4K5RA 3DRYA 2E44A 2VKRA 4KH1B 2X1BA 4F25A 2BJDA 2IDLA 4HY1A 1U6BA 1R27B 4NASA 5JEAC 2RDJA 4PUOA 1L5UA 2Z5CB 4ATNA 1LQ9A 2CJXB 2IBKA 3BQ2A 4RLEA 1KN6A 4F04B 4F4ZA 2DNOA 4C11A 3VAJA 2LU1A 1HI1A 2VQFJ 1JK9B 3M2UB 1HNIA 1VQ6S 2ZBIA 3NCQA 4X66E 2CQHA 3AD9C 4R0EA 1S9GA 1PYTA 2ZHOA 1RDRA 2HWIA 1QDUB 4Y00A 2I6WA 4AYBD 5E0OA 3FBCA 1YBUA 2AJ1A 3JXOA 2GNKA 3GWCA 4JI3I 3TUZC 2QIFA 5D15A 2UU9I 1IBME 3BBCA 3Q2SC 3FZ2A 2H3EB 3DLEA 3UWTA 3DC2A 4CLPA 4J91A 1SJ1A 2LDYA 2HNZB 1NH7A 4K2JA 3LANA 2BOPA 3CF5Q 1R6YA 1T9UA 5C42A 3D6HB 4JI6I 1RWVB 2IJFA 1SCJB 3PYFA 1R43A 3CCLS 4OX9J 5KFDA 2VOOA 4Q45A 5B7WA 1PBUA 4YR0A 3CULA 4RWXA 2NXCA 1NK6A 1JLGA 1RTJA 4R5PA 3RBXA 2DR9A 2BJEA 1BY9A 2VDIA 4YOEA 2DO4A 4C8NA 5I3UA 1CQMA 2V8GA 2BZ2A 4NRUA 4ZVOB 3WX8A 3FMWA 3MF5A 2RQMA 2Q6BA 3SCKE 2W9CB 4L6V3 5HO4A 2XMUA 5BR8E 4M5GA 1VQLS 3HFZB 2J7WA 2CG9A 4DSEA 4NLUA 1U8WA 1S0VA 1T0TV 4NLDA 1JLAB 1NPRA 4JYAI 2RU9A 4AFFA 3R97A 3OSPA 4OMFG 1XNQJ 1YJRA 2M8DB 2FJAB 1UEUA 2VFVA 1S9EB 3DNCA 4JI8J 5KFUA 1CJVA 4JUZA 2C2NA 2OIHA 2ZE2A 4W92B 5D0EA 2OD6A 3THPA 2YQ0A 4K50A 1ZAVA 5ETKA 4MK7A 1S1XB 3HSZA 3HVAA 2C3MA 2BXJA 4JI0I 2GAHC 2GVDB 3U1NA 3BBFA 4IFDC 3GYNA 1RYSA 1UKUA 4TU9A 4N8NA 1N32F 1NJZA 2HYIB 4OV1A 4KQZA 1HW9A 4DR6F 1URNA 4URSA 4LBHA 1RTIB 3T1HF 3M6XA 3I56S 2ZJRQ 3HDSA 2C2MB 4V19X 5K36C 3LGMA 3DLBA 4ZK7M 1IBKF 5F8HA 3ZTQA 5LMUE 2ZWPA 1FE0A 1NK5A 1YRUA 1Y9OA 2JC0A 4WWSA 1Q8LA 2CQPA 2M70A 1KOHA 3OD2A 4LF1A 1R8PA 1SKUB 3MWBA 3MOZA 2YBVA 3BSNA 1N5QA 1W25A 2QMWA 1WG1A 1RE1B 2BJ8A 5H9FK 3J81C 2B43A 3I5BA 4KC5A 3EVWA 4MU4A 3NEKA 4WF9Q 4ZJOA 1C0UA 2LQJA 2QFJA 1D9DA 4OKGA 4C8ZA 5HBMB 2E9ZA 1I3OB 2NXJA 4MIAA 2ZM6I 5D8HB 3M8PA 4TY8B 1OJ4A 2PNMA 1FK9A 2ALYB 1UMJA 2PGCA 4DPXA 1T9TA 1CVJA 2K3KA 4FYYB 3RYLA 3LWLA 4LSLB 4MKVA 2M5YA 3HMJG 4FWGA 4JI1F 1LWEA 2WONB 4PRFA 3K8WA 4XTTA 2XCPA 2VPYB 4M5MA 3MHYA 4UF4A 4DV2J 2WVCA 5IOLA 2DRDA 4UUXA 4O3OA 4NBQA 3DOKA 5F8GA 2VG5A 5C0XC 4U8YA 3MPYA 2ILYA 4ISAA 3WBZA 3EYZA 3JB9k 1AW0A 2UUAJ 2ZD1A 4BS2A 4B9LA 4BWJA 1XMOI 2B5JB 1LNQA 4X64F 1VQ4S 2XYHB 3HHLC 3BO3A 2OTLS 1WEXA 2MTLA 4PCQA 1FT8A 3W2WB 4NI2A 1T95A 4O3SA 4ZVGA 2WBRA 4Y2CA 1SI9A 2AT1B 3GV5B 2O1VA 2B51A 4WFZA 2J9EA 2B6AA 4J5OA 1JLBA 2BE9B 2VONA 4WFNQ 5KFOA 1F2HA 2X3DA 1QAXA 2MKHA 4X62I 3HJVA 2E5LF 3MFHA 3LGNA 3RAMA 3EGZA 3OHAA 2DGQA 2FZCB 1UJ6A 1ZS6A 1W2IA 3D1HA 1O8BA 2BE2A 1SUQA 1FF2A 3PKMA 3K1JA 1RA6A 4JI6F 1IR0A 2RNEA 2YWFA 2QG9B 4NL5A 2IAJA 2RUSA 2P9CA 4OYIA 2BR0A 1T94A 4KRWA 4LOMA 4N5SA 2ZBKB 1OQ6A 3PKYA 4O3NA 1V5VA 1TR0A 3NGSA 2SXLA 2CQCA 3T41A 3GPAA 4WU2A 4LF4I 1FD8A 4P9SA 1S6PB 2QJ3A 5KG0A 1LFWA 2MQOA 1HNZI 3RBZA 1M5HA 2UXDE 1KDNA 1MNEA 1VQYA 5IQQA 4GO5X 1UVJA 1Y3KA 1EHWA 3G82A 2CQBA 2UXCJ 4EO8A 3PRYA 3DLKB 4YY3F 3JTPA 2W4DA 4KFBB 3C15B 2WCXA 2ZWOA 1ZOTA 1X8DA 1SJFA 2RB7A 1PCAA 4DR5F 4DV5F 5L9XA 3FSIA 4GKKE 4RPFA 4J9VA 3HVTA 5IT9C 3KKFA 5ETRA 5C0XF 2V69A 4JYAF 4DLEA 1GX6A 2DCLA 4PQUB 4PKDB 2UZAA 2VQEF 2E9RX 2BJ7A 2HHHF 4KT0C 2I2YA 3T6JA 4C97A 2C37A 1GTEA 2KL8A 5DLFA 5F3TA 1FWKA 2U1AA 3N6MA 1RISA 1MMLA 4MMOA 4AE5A 3VVUA 4DR2F 1V3SA 3J80C 2VL1A 3GP9A 4RU2A 4UOFA 3K8VA 3BB5A 1TL4A 4QWDA 2B9XA 2AEJA 4IRKA 1XMQI 3DLLQ 1XNRF 3KLFA 2AEMA 3HFKA 4O3QA 2I8EA 2QZ8A 2D9OA 1G7CB 4ECZA 4LFBE 2RH3A 1TKZB 2B4UA 1D09B 1U0HB 1RCOB 2JH3A 3KHLA 1WHWA 4M5JA 1O5JA 5J2MA 1JLQA 4B02A 4AL5A 3L9ZA 4CI0B 4YQWA 4X4NA 2G2YA 5F41A 1OY8A 5HMXA 3ET6B 1J2VA 2DEIA 1BC6A 1C4CA 1P1TA 4GVBB 1RUSA 5HMZA 1QM9A 2VG7A 4QZVB 3PW4A 5B0AA 2DNHA 5AXMA 5HMWA 1YZ7A 3R9LA 4X2BA 4G65A 3T6BA 4P2MA 1AFIA 2HK3A 3K89A 2AJ2A 2ZFHA 5KAKA 2RRNA 4PRVA 5CHCB 2ZBCA 3GZ7A 3T5KA 4DV3I 5IV4A 3LO3A 1RT5A 1R6VA 1VC6A 4JV5F 1KQFB 4NXMF 3CNQP 1JQGA 1FJGE 5GMDA 1EZZB 3WIUA 1A0OB 4ID8A 3ZM7A 2BA0D 3BN4A 4AL6A 1T9WA 3LP2B 2WOMA 3MXHP 4LFCF 5AJ3F 1D9AA 1CC7A 2HRUA 3OJSA 3ICLA 1RT1A 4LFAE 3MR5A 2JL9A 4UY85 1RADB 1UA0A 4OYXA 4QR1A 4CDIA 3R5CA 1XERA 1UETA 4IZKB 3FFIB 2RHSB 2X1GA 1T05B 3PTWA 4DV7E 3J80Q 1CG2A 3QMQA 2E66A 2KRRA 2AX0A 3ZZTA 2YQ3A 5C24B 1KP6A 3R3TA 3C66A 1S1WA 3H20A 3DCAA 4U7UD 4ZIWA 5IFMA 3KG4A 3M2VB 4MK9A 1I6JA 2KYZA 2VBWA 3HFVA 4DBQA 1HKAA 1N5TA 1WF1A 3I4PA 4FBUA 3R7NB 1X9MA 2IRUA 4DL5A 4OZ0A 3LGHA 2JEGA 2O1UA 3GYXB 2MGZA 1M5PC 2BX6A 2CPJA 1Z0TA 3AA9A 3OL7A 1Y4ZB 4DCPB 5JEAE 1RB0A 4JV0A 3VAFA 1NCLA 1W2BR 3JSYA 5KFQA 1HR0I 4ETZA 1WORA 3IGNA 4DFMA 4ILLA 2DHGA 2FD2A 3DI6B 3FCWA 4R0JA 3W66A 4I4BA 1TL3B 3RRKA 2F5GA 3MPWA 3FEYB 3HT3A 4CRJA 1WDDA 3KLEA 4NMXA 2A2DA 3DYAA 3N6LA 1R89A 1FFWB 2CGEA 1H98A 2DR5A 3EGVA 4FVCA 4KIAA 2OSRA 3CO9A 1FJ7A 3EMTA 8ATCB 3TI0A 2EK1A 2CAJA 2APOA 5L3JA 1I94E 4ZA1A 2MQNA 4F3MA 3OTCA 5A0YB 1QSSA 3QATA 4IFYB 1ZAXA 4H4KA 2AJQA 2IERA 1XMBA 4CYUB 1N34I 3C16A 4DV4E 2EFQA 5E7OB 1R8BA 2NSCA 1UVIA 1H6KX 3JQJA 4GQUA 1HWIA 1DJ0A 1R0AB 4MU1A 2JRSA 1PJ7A 2W7AA 1H72C 3AH6A 5E3RA 4JI2F 2I5JA 3CWVA 4ZVFA 2HHVA 4O3RA 1T03B 2CQGA 2Z2LA 4MK8A 4KKOB 3DD6A 1LW2B 2GC8A 5IWAE 3M9MB 3UN3A 4UZCA 4IOAQ 1GXLA 2KT3A 5KFRA 4B9TA 1S1VB 4KB7A 4LSZB 4PUOB 2O67A 2GQCA 2IYGA 2Z2MA 1LV5A 2GO8A 2XG8A 5HSPA 3W9IA 4ECWA 1NZ0A 4LSNA 5A6PA 3VV2B 4DPTA 3CWJA 4C11B 1D9FA 2VPZB 2AIRB 3L7OA 3DFEA 1HNIB 1VQ8S 4KGKA 5KT4A 1LOUA 4DZDA 3CDUA 5M2RA 5KFJA 3FUYA 3NRBA 4LF6J 1F5CA 2ZH1A 4CH7A 2V4QA 2KJVA 4URQU 3TA0A 3IR6B 2XMWA 3T19A 3IM9A 3CGIA 3HO1A 2OH2A 2E1AA 3DOLA 2QEXS 2MKSA 4MQYA 1LW0B 2JEFA 4X66J 2BKOA 1N6QA 1Q8BA 3PW2A 3MM7A 1M5KC 3SQGB 3ENWA 4ENOA 3CDJA 4AQYI 2WVBA 3I5CA 4B3SJ 4MJKA 2CADA 4KGZB 3CD5A 1TUGB 3D28A 3OTDA 1R0BG 4IFDE 1RTDA 3MEEA 2FVPA 5C42B 1UL3A 2NCKL 4U8VA 3CO0P 2DNLA 3CIMA 2R7QA 4U95A 2YH0A 2XZDB 3LA0A 3T1YI 2L3MA 2RQ4A 3TW0A 2KXFA 1BHNA 1YX2A 3LPSA 3GFXA 2KB2A 1X5TA 5K36E 4CO0A 4WTYA 5ETTA 1JLGB 4DN0A 2V2KA 5FLXU 2LKZA 3AOCA 1X5OA 2NN6D 1H74A 5I4MA 1CJKA 4MTPA 5I3UB 2Z0GA 5EWEA 2HAFA 1RU2A 1NPPA 3R2CJ 2FLPA 3V4IB 4N47A 1T9YA 2JEIA 4EBCA 3O8WA 1N33J 1ZBTA 2RILA 3W3SA 2DITA 2YNHB 2GA7A 2KO1A 2V6AA 2BDPA 3BSOA 4LVNP 1OY9A 2WBMA 1FDDA 4HEA9 1WC4A 1FKPB 2FPHX 1Z0BA 1YZ6A 2KH9A 2R2SA 2ZJPQ 2V2VA 3HKZD 2OEKA 3DXBA 2ZE2B 3ETMA 4HLBA 5T7LB 2W9BA 2EVZA 2HZCA 3PY8A 3H2VE 4N56A 4RNMA 2MJUA 2QL5B 2AP6A 2MZTA 2W4PA 3H90A 4NZ6A 3PO5A 1LK5A 2D3UA 2CQ4A 2JT2A 1OYEA 3H5YA 2LYVA 1Z5AA 3VGSA 2V50A 2EG2A 2E9TA 3Q23A 1DTQA 4UQGA 2R8JA 2B9WA 2V4JB 5G0RA 2UUBF 1KNZA 2A2CA 2VQFF 1VK3A 4PG6A 3BYPA 4BA2B 4GKJJ 3QLHA 1NAQA 2LQ9A 4RW4A 4J9RA 4JI0E 5JVGQ 5KFZA 4QWAA 2DIUA 3OHBA 5C25A 4IQMA 3H25A 1NDPA 5LMUJ 1ZYQA 5C7PA 5CYMA 3SSQA 4LRDA 1HBOB 3KNAA 3A3NB 4FXWA 1ZXMA 2HK2A 3U02A 1NKBA 3QGPA 1C0UB 2M0GB 1TL7A 4YUDA 4MKBA 4ZJQA 1A9NB 1HHQA 5C2GA 4DI6A 3DMJB 4LRCA 4EI2A 3JAMU 3W5XA 1RKIA 1FK9B 4DU7A 1QLNA 4FNIA 3CUNA 4JI4J 3RBDA 3J7Z5 2YNIA 2AF6A 1YBTA 1SC3B 3ONQA 3MM6A 1J5OA 1PVGA 2F4VI 3EPGA 1LWEB 3M7ND 4B17A 2JE6A 3I87A 2D7SA 3MD1A 3NAIA 2B8QA 3EZUA 4FYVB 2L9DA 3M8ZA 3UD4P 1U45A 3DOKB 4QQBA 5K8MA 5ETNA 2ZM6E 1TQLA 1XR6A 4ELTA 2E1RA 4L76A 4Q7AA 4F3QA 1X0FA 3DU6A 2ZD1B 4F67A 2XCAA 1H73A 1ZM9A 4ZCKA 1NJIT 5DNLA 2LMIA 2Z30B 4DR7F 1PC5A 3A3OB 4N8OA 1TK5A 2CFXA 5DS7A 4DR4I 4A8YA 3CCWA 4UOCA 3O1LA 1J5EI 3NXZA 1IJEB 1JLBB 4ES3A 2ZVSA 2J0QD 4LCGA 4ZPTR 5HJYA 2DXEA 2ROGA 1HBMA 4YHHI 3V6DA 1RYRA 1TV6A 4RNNA 2HVZA 1PJ6A 2BE2B 2ILZA 3CCRS 1SUQB 4F4XA 3TUJC 3OLBA 2C38A 4F4YA 1XMOE 2Z5EA 4DXLA 3W9JA 2IAJB 1TZ0A 4DV1I 1F2GA 1BQNA 4RJVA 2HZVA 1RK8A 3TAPA 3QBCA 2IIHA 3BM7A 3PS2A 5E3QA 5ADZA 4WYWA 5DETA 4X65I 3CMAS 2PNLA 3W9HA 3G8TA 4PZVA 3N5FA 4OI4A 1RT4A 4KHPI 2K7KA 4X62E 3G82B 4XDCA 3HJFA 4JI5F 5HVHA 4KR0B 1RBOB 3M9OB 4Q8FA 2BA9A 2UXDJ 1SXLA 3VVTA 1KRPA 4DUYI 1D8ZA 4K4YA 4C6AA 3DLGA 2EFVA 1HYSA 2XS2A 4NLPA 1HNXE 1YJNS 4KE5A 4EGLA 3GU0A 3SZ2A 2XMJA 1VISA 3R5DA 3SV3A 2HQIA 2FHOB 3HVTB 4LF4E 3GQCA 2RS8A 3FSYA 4K4WA 2YH1A 3D4JA 1DQAA 4Y34A 4GC7A 4YDXA 1N48A 3OSNA 1T8EA 2I0XA 1JKHB 1D8YA 1I51B 4CM2A 2IVYA 2LA6A 2F63A 5C2CA 5LMNI 2MXYA 1NEEA 2AZ1A 1KS2A 3JYTB 2RDDA 2WSEC 2C3PA 2CVEA 2GHVC 1PYSB 2DTJA 3QZ8A 2FYXA 4Y65A 3DDIA 3ZZ0A 1U1LA 1SL1A 1S1TA 4QU7A 4RX6A 5GAGI 1FO1A 4O44A 1SC6A 4MU3A 2DHHA 5KT7A 5IM0A 3DRXA 4DQRA 4QOTA 4MIWA 2H5JB 3FC9A 4WK1A 2ZC3A 3FBFA 2XWXA 3IWXA 3E51A 3NKYA 1YJ7A 4LFBJ 1VCTA 4LCFA 4NLXA 1HPZB 2Z2YB 2CQ1A 2EFGA 2DRAA 3UDVA 3KHRA 2ASLA 2XMTA 4QPTA 3QT5A 1XMQE 2WVFA 1Z4UA 4OV6A 3O2IA 2UUCI 2B8PA 4LF5I 2OPSA 3MAQA 3QT8A 5ETPA 2KN4A 1MW7A 1DURA 4MFBA 5LSRA 1USUA 4HDHA 5IC4B 2N7CA 2IOQA 3GCWP 4A8WA 4A47A 4DV0I 1HW8A 1VJWA 5AE3A 3D3BJ 5K5MA 3MM8A 4XTJA 2DB1A 3RBEA 3SSSA 2R7RA 2CJQA 3MMCA 2AQ4A 5DRKA 3DGPA 2ZH6A 4B08A 4I56A 1HWUA 1Y11A 4LF9I 5D4PA 3NAHA 3I4HX 1UPMB 1CBKA 5FWKA 1FDNA 1FJGJ 2P6SA 3HPOA 1UFKA 5EGYA 5HANA 4P6QA 3K5LA 3NWRA 2CQ0A 4NYPA 2XSJB 2LEBA 4H4OA 4DR3F 1RJJA 4LFAJ 2NQPA 2DGVA 4DV3E 3HJCA 2C3YA 3A12A 2VESA 1WG5A 2W2QP 3CD6S 3HSDA 2Q6CA 1YSJA 1X5SA 2QA1A 1SQEA 1S1WB 4DV7J 5JEAA 4FWHA 1QJHA 3UN5A 1M90T 2N82B 1KD1T 4NXNI 3WC0A 3W2VA 2OI2A 4RW6B 2XMVA 2HGMA 2MKIA 3H0PA 4ED0A 1RHJB 2NN6C 1J5EF 1EKRA 2GO3A 3T3FA 4KYZA 2B7BB 3RB6A 4L3NA 2KJWA 1IR2A 1BLUA 2MGZB 2EC0A 2GIRA 1LWXA 1IQTA 4BWMA 2AWZA 5JJBA 4M63A 2V68A 1RREA 4OZEA 2B3TB 4FF2A 1DHMA 2DT9A 1DQ8A 1GQEA 3JTOA 2H4WB 1N0UA 2HLTA 2Z56B 3FKBA 1RHQB 4DPUA 4DV1F 1F9EB 2VHGA 4ELUA 9RUBA 4ES1A 4PG8A 2MZJA 4RWWA 4DX5A 5B0FA 2FLLA 2XBPA 1IKXA 1KVJA 4DR1I 2BKPA 5I3QA 3DYAB 4X65F 3OL8A 2HG4A 3NGUA 5ETOA 3RRHA 1VRUA 1RAOA 3ZNUA 4EZ6A 4K4UA 5HVFA 1URRA 1ROFA 1GAOA 4PXCA 4EEYA 1FCAA 1C1BB 4NLQA 3MM5B 1GFWB 1S72S 1HR0E 3G87A 1CQNA 1S6OA 5B0GA 3IAM9 2MZSA 2UV8G 3C2PA 2HHXA 4TLQA 3NNHA 4DZ6A 3CPWR 4ED4A 1I94J 2GAGC 4P75A 4FYXB 1DLOB 4LQ9A 1ELOA 4J9NA 3SI8A 4CO4A 2AYEA 1SJ4P 1RGVA 3S6EA 3WC2A 5DDRC 1TAUA 3VCDA 3NLCA 2PEBA 2AKWB 1M5SA 2OPPA 3KJNB 1FDAA 1HQUA 2PO0A 2IOPA 4EMDA 1Q81T 2VIHA 1YJTA 4HTIA 4P2SA 3RW6A 5LMNF 2WVDA 4DR6J 1NHVA 2ZUAA 5EN1A 4JI7F 2CWXA 2HVDA 4LIRA 2ZBRA 1HI0P 1U25A 3TYTA 4BCAA 1N34E 4WKYA 3WQPA 2YX7A 1FDBA 2CDQA 3V6HA 2J0WA 1VQKS 3BSAA 2ZH7A 4LSNB 4QIEA 4TY9A 3AJ2A 2ADCA 4RNOA 2P5VA 4C2MA 1RSCA 2Z58B 3I0RA 2Y0SD 3BV8A 1JXLA 4MKAA 1U1QA 1M1GA 2QA4G 3HKWA 5F8IA 1Y6ZA 1FWPA 1NZAA 4IFDA 3LP0A 3UCUP 2Z4PA 1NK7A 3PDNA 3EXYA 1HWJA 3P96A 3M8QA 2HEKA 6FD1A 5B0BA 2J8SA 2CPZA 2R7XA 3K5NA 1N6QB 3SSRA 2AW0A 4BHQA 2WNRA 1K9MT 3H4DA 3PIOQ 5K36A 4ANCA 3MUTP 2W8KA 4DUZI 4NA2A 3W8GA 4M5NA 2PI4A 4DG1B 2GCFA 1XIQA 4CT8A 4ZP9A 1P1LA 3TJ9A 5CYQA 5BXIA 1JNRB 1RTDB 2JJ4D 2OMLA 2OLWA 5BYSA 2FHKA 4IFVB 4WJBA 4ZOSA 4DV6I 2DH8A 5K14A 2VFRA 3LPYA 2I1RA 3W64A 2EPIA 3T1HE 3FJ2A 2VBYA 2CPXA 3I31A 2OEMA 2JEAA 4AQYE 1AA1B 4IH7A 2FHJA 3OQ2A 1QAIA 4JI3J 1IBKE 4LRAA 2UU9J 3LP1B 2LJPA 1CJKB 2JEBA 1WOSA 1REVB 3S8SA 4DPYA 1Q95G 3NGRA 3T1YE 2MQ8A 5LOQA 1H2TZ 4OX9I 2J7KA 4KQVA 3MEGA 3S01A 5CA5A 2YNGA 1DTTB 5CXTA 1IR1A 5LL6d 4JI6J 3RZAA 1HL6A 3SDEA 1S79A 1Y0HA 4RUAA 3M85D 4KGXB 5F8MA 4UQTA 1Y5LB 5HK4A 4CO2A 4MKYA 5GADI 2MEWA 4WIIA 3RAXA 1H7XA 5FDLA 1KVIA 3EXCX 1S49A 4LJMA 2MY7A 2NXUA 3W62A 4WFBQ 3VHQA 1QUVA 1YRTA 3I82A 2FJVA 1NU4A 1PIEA 3HHLA 2W9BB 3PZPA 2OP5A 1Y4SA 4DX8H 1S4EA 3VGTA 1JLFA 3NBPB 4DMZA 2VD3A 2O5DA 2W25A 1NLKL 5K9FA 2N3OA 2V8PA 1HA1A 1S6QA 1X4AA 3CJ5A 1DRZA 1NSQA 4RBTA 3A13A 4OYWA 1XNQI 4DR5J 1RAFB 3M4XA 4EYIB 4B3TF 3OVAA 2VA2A 4FYDA 1FKAE 3N0VA 4JI8I 4FP9A 4JYAJ 2C1EB 4RO0A 4NX9A 3W60A 2R2UA 3FVYA 1DTQB 4FF1A 5G0RB 3B54A 2VQEJ 1RT3A 3PX6A 2Y1IA 3G8SA 2YWGA 2HHHJ 3AHPA 5IZHA 4ICLB 3TX8A 2XTJP 4LF6F 3VAGA 4IS9A 3KJFB 4OO1B 4C4WA 1WF2A 2M8HA 3M32A 1U2CA 4DR2J 3SCIE 4CLKA 3ZTOA 2MDAA 5C25B 2LXUA 4CLWA 2AYBA 2COLA 1IWGA 4J9KA 3BEGB 4N76A 4OX7A 3VAHA 3CVKA 4X66F 5J1EA 4FW7A 1TL7B 2IVFB 4ZMMA 3KK1A 4WFYA 1RTHB 2DO0A 2PA3A 3EVOA 1EI1A 5J2NA 3V81B 3IWNC 1SJRA 3PIPQ 4NCBA 5DO2A 3ITHA 1P6TA 3M8SA 4Z7YA 5D0GA 1IBMF 1QTMA 4ZN3A 1J5OB 1MSWD 4B9UA 1VDHA 2VPXB 5M2PA 2JE6B 1NO8A 5FLXY 4M5LA 2HWHA 3J7A1 1VC5A 2WSFC 1NK4A 4OI2A 2EG1A 2X3GA 2W01A 2BOAA 2R8HA 2UVRA 5L9NA 4IRCA 1RABB 1NHHA 5KG1A 5D78A 2VG6A 2MHNA 2CWKA 3C14A 5ETMA 1NK8A 1WKKA 4ECQA 1NK9A 5F0WA 2V8VA 2IY5B 4FW4A 4DV5E 4RBVA 3Q8YA 4M8LA 1TFYA 2QV6A 1BQMB 2JHEA 2ZM6J 2F4VE 2KYXA 4OYBA 5KFSA 2HHUA 5IQ6A 4J9LA 3NZKA 4WP8A 4YB1P 4DV2I 4USUA 4OI0A 5AJ3J 1IKWA 1YIJS 1FEHA 3CCMS 2XY7A 1VLYA 5BR8F 5KFVA 1U1OA 1TV6B 5HLFB 3AFGA 4WKRA 2CNNB 3BQ0A 3SCJE 2A10A 4OJ3A 4ECVA 1U49A 3PR4A 3P4UB 3B8HA 1B0VA 3UVJA 2UUAI 5KG7A 2C38B 2YWEA 4IO1A 5EKWA 1XQIA 4QW9A 3G71S 1BQNB 3NG8A 2E1CA 1HMVA 1U26A 4ECSA 2R7TA 4DR4E 8AT1B 3IR5B 3RB4A 3DU5A 3DRSB 3D2WA 1XMOJ 4ECXA 2XMMA 1L3UA 2DNPA 1VYAA 1U8SA 5D3GB 4YHHE 4M5IA 2YTCA 3FRZA 4ETXA 4C8MA 1SV5B 4A48A 4DX6A 3GB0A 2G2OA 3CSKA 3QO9B 2GHWA 3CD0A 3DLGB 1HYSB 5KFLA 1MWYA 1JWWA 2C2ZB 3M6UA 1EETA 2KHCA 2DGTA 2KT5A 1CJUB 1NDKA 5KFHA 2PC6A 3RB0A 1SQFA 4D3HA 2CNOB 4G6VB 3U27A 1TKDA 1EP4A 1HD0A 4JV5E 1LEOA 3JAMY 3R1LA 4LF4J 2XC9A 4NXME 1UZDA 4ZPCA 4KHPE 5FD1A 5LMUF 2UXCI 3DM2A 1HNZJ 4WZQA 1UP1A 2E7VA 4IH5A 4DUYE 2J9CA 4LFCE 2BA1G 3THVA 1GX5A 3H98A 1W7WA 4QJVA 3F56A 4ANDA 3HD2A 3DXSX 3KLGB 1KQSR 1FESA 2DGWA 2XEXA 2KM8C 1BUXA 1EQ0A 2OEJA 4YN3B 1Q0NA 2H51B 2HQ3A 5FLXQ 5B09A 1S1TB 4TYBA 5AXNA 4O44B 1PO6A 1WOOA 3I0SA 1TKTB 5IM0B 2XNRA 2QLWA 1HNVA 5A8KA 2HFNA 3FCHA 5HROA 4OX8A 5T14A 5EX0A 2HS4A 3ENAA 4JI2J 3PO4A 4NMLA 5A8WA 1H2UX 4Q44A 2D3O1 2IC3A 3A8IA 1X31C 2NN6E 1UZHA 3PX0A 3VWSA 3HX9A 2HS0A 1E6YA 3A1YG 1Q4RA 1SPBP 5KOWA 2W2MP 4PPZA 4LR8A 1QZRA 2OPSB 1X4EA 3BO2A 2YQ1A 4MFBB 4AXIA 2O1PA 3MPVA 3AB4B 4DL0C 1Y7PA 5GVQA 2J6TA 3RG6A 4QIFA 3TQEA 5KFGA 2KZMA 4UT4A 3FBEA 3GIKA 3ZKBA 4IOBA 4GC6A 2IDEA 2IMWP 3QWPA 3MM8B 2AV5A 4ECUA 3T5HA 2FGCA 3IR7B 1WSVA 4X4VA 1Z2ZA 1PC4A 3MMCB 1APSA 4E8UA 1QE1B 3EPIA 1RAHB 3DGPB 1U02A 3SIPB 2M2BA 5RUBA 2R2RA 1M1KT 3M6AA 4LQ3A 1DBDA 2EXUA 5L38A 2RE1A 4ZLNA 3GIJA 4B3OA 1X7VA 3L3CA 1NK0A 1VQSA 4F02A 1HBNA 3GONA 2XSFA 2OJ3A 4H4OB 3B4TA 4FNHA 5T41A 2OFGX 4DV0E 1KR4A 3GG1A 1TELA 4X84A 5DRQA 1RKJA 2HBZB 1E3HA 2GX8A 5JEAB 1KFSA 4DV3J 2XZTB 3TA1A 2UXDF 2YXLA 4LF9E 3NCPA 5KFCA 3CMES 1FVSA 4C3MA 3W2VB 1P9QC 5KFBA 1RT7A 1E6VA 2DHXA 2YKMA 2EW9A 1FI4A 1N36I 3MUMP 2C3OA 3NS6A 3JAMQ 3M2RA 1T9VA 2FVQA 2OELA 4FKYA 2E1MC 4NOHA 2J6SA 2CG8A 4KV8B 2ASJA 4ECRA 5ETSA 3D6TB 4YP3A 4DV4I 4GKKF 2QL7B 2PEHA 3BGLA 4HH0A 4I3HA 2JNJA 1QTNB 1YGYA 2H48B 2ZZMA 2VOPA 2ZZTA 4BA1A 3H5UA 3HHEA 1GMUA 4NXNE 2BACA 3BGFA 3R6LB 1YH8A 3MEDA 3UW1A 2BMBA 5HVGA 2R7WA 1IKXB 4C3KA 2PE8A 2PNZB 3ZNJ1 5IT0A 5IWAI 5M2UA 1RAIB 4ZVHA 4EU0A 1VRUB 1UVLA 2R8IA 4K0KI 3H59A 4TN2A 5D0RA 3Q24A 3TWZA 7FDRA 4I2PA 2VDHA 3JSMA 4PYAA 4QPXA 3H42A 5A2QU 2C2KB 4ZPBA 4Y2MA 3UDEA 1LWFA 4LFBF 4FW3A 1TKXA 2MZRA 4DCOB 4ALZA 4O0NA 1RWNB 4DR1E 1WTBA 2X36A 3R6GB 2CRLA 2N3LA 1SKWA 1FVQA 1R31A 2OPPB 1RT2B 4PXEA 2PO0B 5BYRA 2YX1A 2MQPA 2E1PA 4ZJLA 3R27A 2DR8A 3K85A 1U4BA 1IQZA 2HAIA 3R1HA 3KRNA 3NP5A 4E98A 4ECTA 4ZPDA 5J2PA 4DLGA 2UXBI 2L9NA 1B63A 4DSJA 3MECA 2WW8A 4PR6A 3X1LB 3MM9A 2V34A 2V8DA 2UUBJ 4OO1D 3V2UC 1R6MA 1HNWI 1U0SA 4F0HA 2ZOMA 2GS8A 5DGBA 3OTOI 4WE1B 4XIUA 3DDNA 2KFNA 2RQKA 2IA0A 1IBLI 3CB4A 1FJGF 1QVFR 1PKPA 1N0VC 1EIYB 4K8RA 2ZDPA 1F9FA 3F44A 1SQGA 1VFJA 1JXVA 4DSIA 1TUVA 5CD4A 3T5JA 3Q89A 4LFAF 2B4OA 3LQVA 5A76A 1TAQA 5HP1B 3G9CA 4A8FA 3BKFA 4NLYA 2F7VA 3UQSA 4DL3A 3HHNB 4OYMA 2J7UA 1EA6A 4LBPA 1VJQA 4DV7F 1N52B 3PCOB 3QIPA 3SBMA 1ZXNA 3LAMA 3VAKA 2WNRB 3M1VA 4DL4A 3PS1A 5E41A 3CDIA 3M8YA 2ZZNA 3Q8SB 1ACMB 1RT6A 3MZIA 3IG1A 3T1AA 2CPFA 5A8RA 1U6ZA 3B4DA 3IFEA 5CYQB 4CWBA 2KXHA 2HURA 3SXLA 2V63A 5E2QA 4LF8I 4NZ0A 2GQ2A 3QGHA 2DNRA 2HQGA 4ZS6A 2XULA 4LIWA 4B3RI 5DGAA 3MEKA 5H9EK 2K2PA 5K14B 2MQMA 4ZVRB 2VFUA 3CW2C 2DD8S 4DR7J 5JEAF 3U1YA 1RAGB 4AXJA 4B3SI 1CJTB 4DUZE 2ABYA 3J81U 3ZZRA 3KK2A 2QT7A 2JEBB 3PVXA 2QRRA 3HXMA 3MMAA 3W5YA 5BYQA 3W61A 3RW7A 4YEAA 1UAWA 1ZZFA 4LF7I 5LSLA 3BPSP 4DV6E 1RP5A 5MLCV 3AD7C 3MEGB 2YNGB 3VQSA 3W8PA 3JTNA 1IKYA 1XEZA 3M7VA 4CTAB 3SDEB 1UEKA 5C0XB 1I94F 3BS9A 2D9PA 2E5IA 2CZ9A 2QLJB 6FDRA 5FDLB 2DNYA 4C48A 2J5AA 5DJBA 1HI8A 2YKNB 1HFEL 3HHLB 4J9QA 2V8HA 1VIXA 2NSBA 3W1YC 3GFYA 4JI5J 1N33I 3BPDA 3K7RA 4KO0B 5GMEA 4MAKA 4OX9E 4EFAC 2DNKA 2KI2A 2HHTA 3GV8B 2C28A 4QIGA 3H5SA 4HTJA 1H7SA 3CC2S 1UVMA 3SFUA 1LFPA 1QD1A 1B99A 4QW8A 3Q1QA 2QMUB 4DX7A 3AOAA 3GJTB 1NRKA 2F8EX 1REGX 2KVQE 3C8YA 1TL1B 1V5IB 3J7AG 2EC2A 2X7IA 3OXGA 1D0EA 1GEHA 2AE8A 4LR7A 1P27B 4ZPAA 2PO1B 2HNYB 2RT3A 3FQLA 1C0TA 3H7HB 3MPUB 2O01C 2FDNA 1VMBA 4NCGB 4KY3A 3M32B 3PEHA 2W9CA 2PO4A 5HQLA 2DNZA 2MSSA 2BEFA 3PRBA 1XNQE 2RU3A 1HHTP 4FF3A 5K8PA 3EDQB 5H9EJ 4CO3A 1FNXH 3GMGA 3TQ1A 3WU5A 4NLRA 3E01B 1JLAA 2FTRA 2OD4A 4JI8E 2J9DE 3P6YC 3Q8UA 2FJEB 4U3DA 5J2NB 2FY1A 2B9EA 3HSGA 1SBRA 2YKAA 3PX4A 4FPIA 3BGRA 3ITHB 4GKJI 3UD3P 4F26A 4J9PA 1U2RA 4PG7A 3QRPA 3IP0A 1EARA 2BE7D 4IFDF 3IXQA 2GVDA 5IT9U 4USKA 3Q6MA 3EZ5A 2BQRA 3A8KA 3I32A 4IO9Q 2Q1LA 3RRGA 1TL5A 2VG6B 4YS2A 3GLLA 2MZQA 5L1LA 3MAHA 5KG2A 3G6ES 1NJWA 2KFYA 4PXBA 4R1FA 4JI4I 1C1CB 4HI1A 4O4GB 4JI3F 2DGOA 2HSEB 1RTIA 2W7PA 2UU9F 1H0HB 3DRRB 5K36F 1WD6A 1K1SA 1BMQB 1I5OB 1GMVA 3BBBA 4QWEA 1SKSA 4HR2A 4OJGA 1UFWA 4RL1A 4PU9A 2WHOA 3GCMA 1HWKA 1ZM4A 5DDOC 1HK7A 3KHGA 2F4VJ 2CYYA 2VBXA 2WP8B 2AZ3A 1HNXI 2L41A 2FLOA 2LXIA 5KFAA 4NLSA 1P42A 1ZTWA 4S0MA 4USMA 1XK8A 4ED8A 3UVJB 1VRQC 2VH7A 2QX0A 5K8NA 3DDKA 4DR3J 1NJXA 3TZXA 2QGFB 3LOUA 2CPHA 4HT7A 5HBMA 3G6YA 1YBAA 4TY8A 3GSDA 1CULB 5B0EA 2Q3PA 4KAIA 3UDCA 3IS9B 3O3LA 2F8MA 4B3MI 1KWMA 3HVWA 4LSLA 1T3NA 4DV2E 3W7BA 4CCHA 1YDLA 2J8AA 3AQPA 2WONA 4DR4J 2WRMA 2HFZA 4F8RA 1J5EJ 1OSDA 4Z2XA 3L7UA 3E2EA 2UUAE 3R5GA 3UNYA 4YHHJ 2QA4S 4U6PA 1RBLA 4PQAA 5GMKa 3PS3A 3PG9A 2YNFA 2RMLA 1RBAA 3CDBA 2B5JA 4Q43A 1RXOB 4OI1A 4DV1J 3HULA 4A8MP 3SCLE 1EP4B 5AE2A 3W2WA 4PYDA 1FTRA 4IZJD 2MLZA 3ULHA 1FRLA 1NM2A 3DM2B 3D6FB 4JI0F 4X65J 5KT2A 3LF0A 4IYQA 2B7CB 4TXSA 2G0JA 4C0OC 1GMWD 5CQGA 1FNOA 3LUYA 4KHPJ 2HMIA 5EX3A 2J76E 3KK3A 2NN6A 5DRPA 1X4DA 3G86A 5DLGA 4AIMA 4PPDA 5KFKA 4FW9A 4A8OA 1W26A 3I0SB 4ZP6A 5CCLA 1HNVB 5CH7B 2VFSA 2NXEA 5GAEI 2UXCE 1WDTA 2JSXA 2X1FA 4RW9B 4QR2A 2IC3B 4C0BA 4LMZA 1D6TA 2PO2A 1Z59A 4KFBA 1UDOA 4Z37A 4B9SA 5LMNJ 4C8LA 3DOMA 1E6YB 2Y1JA 2B4VA 2DKOB 4JI7J 3PYDA 1XXEA 3GIIA 1Z5BA 2HKEA 3FSXA 3PHTA 3T9NA 2ZM6F 3RGIA 2DNMA 1K8AT 3KWMA 4U96A 1S77D 1UFLA 3CJSA 4IKAA 4L75A 4P7VA 1KTQA 3DGVA 4PQUA 1U6FA 2VC1A 1IM4A 1S59A 2AHOB 3KJVB 4EK2A 3RU0A 2B9YA 1OMSA 1QSYA 2XHCA 5F8JA 5DDPC 1H7WA 1XBWA 3TP2A 5CD4H 2CVIA 1RCXB 2OPQB 2FJXA 3KOAA 3TZYA 1L3TA 4GVLA 2MKCA 4OQJA 4ZHRA 4RR5A 4BC7A 3UDLA 3CXCR 1R8CA 3WU4A 1V6HA 1HBNB 2R42A 3EGWB 4OZ1A 5DQHA 4Z7CA 1XMOF 2UUCJ 1JB0C 4LF5J 1VBXA 2LECA 4X4PA 1RHRB 1K44A 1C4AA 2W4CA 2EI5A 4FW6A 1RI7A 2X1AA 4DCJB 2C2RA 1FX4A 4YMEA 4TVAB 4N7TA 3IN5A 1NHJA 2K3IA 1FWLA 5HMYA 4HI2A 3ET6A 4FS2A 4X62F 1RT7B 4W98A 3D0GE 5KFIA 2V4RA 1U2FA 1SC4B 2GGPA 2QYCA 3M2RB 3C19A 1XJWB 2O1TA 4P72A 1B3TA 3NGDA 2XS5A 1F0XA 2JZ5A 3AODA 3QFWA 2HQFA 2OO4A 4LF4F 2LA4A 1PG5B 4AT1B 4YFUA 3W5ZA 2HBQB 2ATCB 2XHWA 3QGGA 1YVFA 1U1MA 2DPIA 1HNZF 3WZ0A 4BA1B 1NB2A 1LWCA 1NXIA 1NKEA 2FUG9 2A6MA 2F9JA 3H4BA 5C0XD 3CCZA 1N36E 4LBIA 1NJYA 2Y0BB 3LP2A 3A8JA 4TYAA 4ED3A 4NXNJ 1FEEA 2JX2A 3OLAA 5AT1B 4ZVEA 3BF4A 3PEJA 3OL9A 4RNHA 4HYKA 4HVZA 3ZZPA 5JMNA 4RUHA 3HHLD 3IRXB 3C6TA 1WNEA 4I2PB 3R8YA 1KC8T 4WTOB 4IZKA 4M5HA 3FFIA 4DFKA 4NA3A 1AT1B 4RW7B 2MPUA 4WFAQ 3PJWA 1B7FA 1LWFB 4AUKA 4I7FA 1X9WA 1X4BA 2LEAA 2I9SA 5J2QA 2FHMA 3K59A 2CPYA 1U09A 4IG0B 4ZCMA 1TKXB 2CDRB 4PWDA 2MKKA 5E33A 2XI3A 1AB8A 2WZ1A 3M2VA 3N28A 3D6MB 2ZDOA 3T9ZA 4Q8EA 3FBBA 3I9ZA 2ZH8A 4K0KE 4DR1J 4ZPVR 1F3FA 2AGQA 2GV1A 1Q5VA 4B3TJ 1XMQF 1KIJA 1M1HA 4QYZJ 2WB4A 5K20B 4V1Ak 4ZP8A 2GZOA 4HHUA 4K2XA 3MM9B 1BE4A 4M1KA 2M4MA 4G1QA 4WK3A 3H40A 3QAUA 4WU3A 2CJ9A 1XC9A 1Q16B 1BGXT 2LP4A 1BXNA 3UN2A 1U48A 1CLFA 1YJVA 3KLIA 3SYZA 1C2PA 5E3AA 1R6LA 2XMAA 4FDFA 3OTEA 2R8GA 3DI6A 4IG3A 1TL3A 3EUNA 3D1QA 1RHKB 1S9GB 1N32I 3UFCX 2XM3A 5DZ7A 2BBEA 2U2FA 3HCXA 5ETLA 2DHSA 4BC9A 2RVJA 2D1CA 2M9KA 2MMYA 2CJAA 2UXBE 3T1HI 2XO7A 5ELWA 4K5SA 3HZEA 1O51A 1YJ9S 1NB7A 3DLEB 4A8QA 1HNWE 3B82A 2C2EA 3Q2TC 4ES2A 1YI2S 4FWDA 3OTOE 1S10A 1IBKI 4DV3F 1RHYA 4CM0A 4IFYA 1LKZA 4G1IA 1FX2A 1IBMJ 2R7SA 2EWHA 2LCWA 1IBLE 3OTBA 1QY7A 3DN9A 1UCNA 3FDSA 1K0TA 2KG0A 2HIYA 3RTVA 2DHAA 5DM6Q 5I42A 5A8RB 3MFIA 2B4PA 2N4CA 1XR7A 4AM3A 3DKDA 1FXRA 4F50A 1T03A 1Z2LA 2CXEA 3M7NG 5AE1A 4KTQA 2W8LA 1RTJB 4R5PB 1LW2A 2F4FA 3CCUS 2E29A 3TJAA 2UVUA 2PD1A 2HFUA 4EUVA 2PN6A 1S1VA 3HHKA 4KHRA 4LUBA 1Q78A 4JI1I 3LALA 4DQQA 1KEKA 4QCLA 2POKA 3G4SS 2R4FA 5A2QY 3CJQA 4ZLLA 4KJIA 2XGPA 3KK2B 4LF6E 5ETQA 3TRGA 3UI3A 1DY3A 1VQPS 1Z0GA 3NOGA 3MMAB 5BR8J 4LF8E 1FRMA 2RF2A 4F0KA 3K5OA 3BREA 4OHWA 4DUZJ 5KG6A 2Y9HA 1QVGR 1RLCL 4B3RE 1L3VA 3TA2A 2EK6A 3WU6A 1CJVB 1IKYB 4QWCA 1WHXA 2CQDA 4X64I 3LWMA 2HVEA 2C22A 3OFEA 4DV6J 2QLXA 4C8YA 1HR0F 1RWUA 4B3SE 2GMLA 4OZLA 1LW0A 3BJYA 3CDAA 1VQMS 3LW5C 3NL0A 3SQGA 1AUDA 2DY9A 2EEYA 5EHHA 3L7ZA 2RHQB 5A2QC 2E5LI 2M52A 4LF7E 4Y28C 1PYOB 1K1QA 3BR9A 2QL9B 3BDPA 2OFHX 1P8GA 1RWKB 3AJ1A 2FC9A 2K1RA 3MCNA 4F4KA 3GTYX 4DPWA 5JUMA 2W9AA 4KGMA 2BQUA 1QAYA 1N34F 9ATCB 1FRHA 2J9DA 4LVOP 4K4SA 3KNGA 3KTQA 3QGIA 4Q2MA 2BYCA 4HH1A 1KSPA 4YY3I 1N33E 3P3CA 1C0TB 3QNWB 3MURP 3D5MA 2HGNA 2XI2A 3V4IA 4KHMA 2F3JA 2N7YA 3M8PB 3UPFA 4DR5I 3TNVA 2HW3A 4DV5I 2PI5A 4HKQA 2YNHA 2WSCC 3Q8VA 2ZKTA 4L3KA 1WEZA 1WWHA 2BM0A 1WC1A 1OO0B 3MAAA 2VQEI 3IC1A 3ILJA 1FKPA 2R7OA 3MR6A 2HHHI 1Y5NB 3BGRB 4ILRA 4P2XA 1WF0A 2BJ9A 4EZ9A 4ED7A 2HVIA 4P7AA 2JC1A 5T7LA 1L3KA 2IRYA 2VG5B 4DR2I 2PMZD 2HFOA 3NS7B 2FGOA 3J81Y 1BWEA 3FK4A 3CMQA 4L74A 4USVA 1F6TA 1XNRI 3CCVS 5A2QQ 1NHIA 1HBUA 4JB8B 2UVVA 2CJBA 3CC4S 1SB6A 3QJJA 2H9ZA 4NI2B 1DZ5A 3ZZZA 1AYEA 1DAXA 4YB7A 4CLYA 1WSRA 3TUIC 2DH9A 1DQ9A 2B6AB 4GKJE 4FPRA 2V4JA 2DJWA 2BQ3A 4HDGA 1F3VA 2HQDA 1Z0EA 2ASYA 4AQYF 3EGNA 4HHJA 4XAKA 1UA1A 3M9NB 3ILIA 2D3OR 4DN9A 3P49B 4BA2A 1R3NA 5F9NA 1WELA 1WC0A 3BGUA 2O1WA 5L1IA 1MWQA 1YJUA 4UUWA 4CNYA 3T5LA 4OZJA 1V9OA 3GIRA 1ZM2A 3T1YF 2VZ9A 1Q79A 1X60A 1HBOA 1WEYA 3OPKA 4JI4E 1FHTA 3UHMA 4LRBA 1HQEA 4TLRA 3Q8RB 1FRIA 5KFTA 3D3CJ 4P74A 3GMEA 1YHCA 3DMJA 4JV5I 4EWTA 2GJIA 2M88A 4NXMI 2V9KA 2F65A 2Y3YA 3KLHA 3Q86A 4ZITA 4OO1E 1NPKA 3GR1A 4LFCI 4WP9A 3VAMA 3P5BP 2E5GA 2PMHA 3IO1A 1Q53A 4F4AA 3Q83A 5K8OA 2JFKA 4NA1A 2W7OA 2NR0A 4O4RA 3ETOA 1UW4A 4PWWA 1VQ7S 5D0HA 3N5BA 4F7VA 4WYLA 1Q8IA 3EE3A 1KLNA 2MHEA 3OXLA 4GKKJ 2BM1A 3D9BA 2V2QA 1FKAF 3D0IE 2YWHA 3ELHA 2YNFB 3PJXA 2FZGB 1TK8A 2C37B 4B3ME 3NGKA 3N4WA 1VRTA 3MMBA 4NEZA 1RTZA 2ALZA 2Q43A 4TQRA 2D41A 2MJNA 4P10A 5LJ5Y 2DBBA 1NMEB 3P3DA 4B9MA 3KLFB 3FZBA 4F3OA 4WXOA 2HMIB 4UOGA 2C39A 3IRWP 3JQMA 3KK3B 2NN6B 1H3DA 5D77A 5IT9Y 3N01A 4OJ1A 5L39A 3AT1B 3PFOA 3PFEA 3OUYA 1Z1ZA 3TX0A 2V0NA 3FCVA 4OHVA 5J2MB 1JLQB 3J81Q 1B7YB 5ETVA 5D4LA 4NRTA 4E2FB 2HLUA 3DLJA 2DEJA 1B0TA 1YITS 3J81j 2RRBA 2YPZA 3CJ0A 3TAMA 1UPPA 3KUGA 2VG7B 2LXFA 1ZH5A 4OYZA 2PO2B 5H9FJ 5BJRA 3J80Y 5GAGU 2HHWA 1CC8A 5DG7A 1FRJA 3DOMB 3DRPA 1Y5YA 3JSRA 4CLZA 1G1XA 1MU2A 4RZRA 2CZVC 2DXFA 1D3WA 1RT5B 3CJRA 1KFDA 5G4DA 3UD5A 3ZKDA 2GFFA 4I68A 1TUWA 2HFVA 1VQOS 1DARA 2CKWA 2FVSA 2G1HA 2C2OB 1N5YA 2WOMB 3IMQJ 2F9DA 4FBTA 2F4VF 4JI2I 2H1YA 1YHQS 4M5DA 1RT1B 5JXSA 2IPOB 3M6WA 1JKHA 2XYPB 3W65A 4Y2IA 1XWLA 2R3VA 1JLEA 2ACYA 4X4TA 1UTAA 3OFFA 3HHDA 5KFNA 3JYTA 1G4CA 3PHEA 1U24A 3EJMA 3M05A 1OPIA 4IQXA 2LFVA 1RWPB 1KKHA 4ZHRB 4ZCLA 2AJFE 4IUFA 3V4MA 1Z0WA 2CQIA 2I38A 1X9SA 3O5TB 4HACA 4DR4F 3KLVA 2DIVA 2H65B 1N56A 5CZXA 5LM7E 7AT1B 4ED6A 1S97A 5KFXA 4KH0B 4OIXA 5IXUA 4YHHF 3LAKA 2NZCA 2OGUA 1HPZA 1JLCA 2GGPB 1VQ5S 2J0XA 5CYJA 2ROEA 3FGVA 4UW2A 4E0DA 3B4MA 5F8LA 2W1BA 4PWUA 3BH7B 2M3DA 3KLEB 2J65A 1YTYA 1RU1A 5KFYA 2DH7A 4QBUA 2FVRA 5IT9Q 1LWCB 2BJ3A 4KHPF 3CT9A 2VKZG 2KTQA 4J3DA 4ZPWR 3EX7B 1GXUA 1SH2A 4DUYF 2NPFA 3QJPA 3BQ1A 1U7LA 3WU3A 2Z5BA 5THWA 4MYTA 2FC8A 4HHHA 1EAYC 3C16B 3KYLA 4DSFA 1N36J 3K58A 5DZ6A 3P5TL 3C6TB 2DNNA 3BN7A 2XSJA 5EL9A 2GMHA 3K5MA 3AY0A 4KPYA 2R7VA 4WPAA 1NUEA 5KFMA 4CH1A 4LREA 3QT6A 2I5JB 4DV4J 4I7FB 2WTFA 1GTHA 4P2FA 5A6WA 5J2QB 4RKUC 4H4MA 3M85G 5KTQA 2HQCA 2GQ0A 3BH6B 4OYAA 1VBYA 4QU6A 1S7IA 2XYGB 1LK7A 4NLWA 4FVMA 4PWDB 1ZA2B 5HI7A 4DQSA 4LPFA 3BR8A 2XGQA 3QYYA 4RW6A 2IM2A 2NN6F 4H54A 3LNUA 2R9LA 4DF4A 5SUHA 1H7UA 5IWAJ 3GR0A 1USVA 2DXDA 2ZHAA 2PA8D 4CLTA 2XMKA 3MTJA 4K0KJ 1MG7A 4G1QB 3VTIA 2CNLB 4MT1A 4OL8A 2DGUA 3KLIB 1TP7A 3MCOA 4K7QA 3CJTA 2EFPA 4HL9A 4PG4A 2H5EA 1UEVA 4DJBA 4C3LA 4IG3B 2LEPA 4Q5VA 3AXKA 3M30A 4URGA 2F1DA 4J7CA 2KVIA 1RLDA 2RIJA 1GT8A 4QNJA 2BVZA 3DOLB 4FZVA 1AZSA 2JDJA 3ILLA 2UUCF 4LF5F 3QJLA 3Q0AA 4WUCA 1KQKA 3MM7B 1GH8A 2UUBI 2AGOA 1C1BA 3MM5A 4YR3A 4JP8A 4IOCQ 2VQFI 3TARA 2A18A 3FRYA 2VPWB 2UXBJ 2UP1A 4DV0F 3MEEB 4OZNA 4FW5A 4TU7A 1HNWJ 5L1JA 1DLOA 4NCAA 5DG8A 3R2DJ 2PFFB 1N32E 1RHMB 4Q0BA 3OTOJ 5EWFA 2Z57B 4P52A 2Z2ZA 4LF9F 4DR6E 1IBLJ 1EQMA 5KT5A 2ZBPA 5I42B 2UUTA 3UNGC 1V3ZA 5IS2A 3D68A 4WCEQ 5DM7Q 2VICA 5KFPA 3QQCD 4ZP7A 3BKUA 6AT1B 3O44A 2VJVA 2VU5A 2HVHA 4PABA 3A8EA 1MLAA 1QAJA 2R7UA 3QPIA 3GJRB 4A8SA 3LH2S 1VOMA 1ZM3A 2QSWA 3PV8A 2LQ8A 3DLHA 3NGTA 4CT9A 2KZZA 3AQOA 4OYOA 4NXNF 1FD2A 2MLYA 2OPRA 1NDCA 5KT6A 1MN7A 4R25A 4N41A 2BKNA 5J1NA 2QLFB 1X4FA 4ED5A 2RF2B 2W2PP 5D6GA 2ZVIA 2DGXA 1WC3A 3JSBA 4LF8J 2BW7A 3V5RA 4DR7I 3BKTA 4OJHA 4EBEA 4JI1E 1NNDA 5HQMA 4B3RJ 2VV5A 1OYPA 4ERDA 2P6TA 3CJKA 2CJKA 2L08A 3FEZA 3VF0B 3OBIA 4NE9C 5DQGA 4FXVA 4DHVA 3IBFB 2HRYA 3L7ZB 3OV7A 2L9WA 4DR1F 2BV3A 3FQKA 1YKWA 1ZAWA 4ZVTB 4DG1A 4DS5A 5GADU 3OR1A 2DY1A 1S1UA 2K1RB 4X64E 4B9NA 4IFVA 4LF7J 4D3GA 5HQ8A 3EM1A 1VC0A 3MR7A 5JVHQ 1G3OA 2IJNA 3OJUA 2EFOA 4JI3E 3QLHB 2GMJA 4RW4B 2UU9E 2RSQA 4I67A 2XZWA 2BR2A 4RU9A 1U1PA 2VBZA 4I69A 2E5LE 3HM9A 1WI8A 1QUPA 4JI5I 4JI0J 5CYMB 1AFJA 3LP1A 4FS1A 1REVA 4JI6E 2DISA 1T11A 2QFIA 4CQ1A 2AX1A 1R0CB 2FJWA 1UWAA 1BKNA 1WC6A 1DTTA 3U1LA 2YNIB 1SC1B 4GMKA 3ISND 4QR0A 4L73A 3MAAB 3MM6B 3MOJB 3WDOA 2KU7A 5AXLA 4HXZA 1CSJA 1WUUA 4I0WA 4XPCA 2RKIA 5IV3A 1FKOA 5HAOA 1K47A 4YY3E 4ZLPA 1Z5CA 2IESA 4USWA 3VGVA 1X4GA 4PRXA 4DFPA 3AJDA 3L95X 3NNAA 3N6NA 4P7TA 2K06A 2Q66A 1IXKA 3NBPA 4DR5E 2GVZA 3Q22A 4DOZA 2OUGA 2HGLA 5C0XE 2DGSA 4JYAE 3SV4A 1AUSL 5DQIA 1HBUB 4DF8A 4K4ZA 1S9FA 2VQEE 1UJ5A 3TZWA 3D54A 4IR9A 3H4LA 2YWWA 4I2QA 2KM8B 2HHHE 3A3PB 2Y1RI 1IN0A 3IWLA 1XR5A 1GXTA 3D0HE 1FA0A 1OS5A 4F2SA 4OHYA 3AD8C 1BQXA 3WIVA 3CE8A 3OR2A 1VBZA 2HIQA 2KRBA 1HBMB 4R8UA 3GYGA 5FLXC 3V6DB 4DR2E 3US5A 2P9EA 4DUZF 3VQTA 4ICLA 2XQCA 4Y3CA 4DEZA 1IUJA 1Y10A 1WKLA 3CDWA 4OO1A 1XNRE 5LXRA 1UJ4A 2JLGA 3Q6NA 3F73A 2KKHA 2ZNYA 2Y8YA 4DV6F 1FRKA 2D74B 3D1OA 4U9RA 1Q1KA 3G2XA 2KG1A 2A1BA 4QNKA 2HBYB 1HQEB 5IC6B 2RDIA 4MIBA 4ZVUB 1RTHA 5GAHU 1RWXB 5F9LA 2R2TA 1UVKA 3J7YU 1HQ2A 3V81A 1RT4B 1WG4A 1A7GE 3KLHB 5U47A 1LXNA 2MYFA 4RW8A 1S0MA 3OFHA 2Q2EB 3NCRA 3ZZOA 4G3IA 3BZQA 3SQOP 1IWAA 3KMSA 3MPDA 3RR8A 2CPDA 4X62J 2BANA 3MR3A 3H2UB 1I1GA 4K4XA 2MY8A 4OX9F 1NSPA 4OHXA 3L09A 4XO0A 1JXEA 3HLUA 4DR3I 3CIZA 1HNXJ 3PYGA 2DVIA 3IA0A 3VZIA 3LTOA 2FQQB 1HARA 3TJ8A 2LLZA 5KFWA 1FXLA 1BQMA 2GHPA 2QE5A 1VRTB 3HKMA 4XDDA 3MMBB 4BBYA 3G96A 1WACA 2O3ZA 4U67Q 1PSDA 4CLLA 3KUEA 3CCJS 4ZKAA 2VA3A 3EWGA 1M0SA 2HPUA 4B3MJ 1UWBA 1OSCA 3DHXA 4ZVSB 5LSOA 5DNXA 4JV1A 4P71A 1XNQF 1FJCA 3B6BA 3F41A 3CTRA 5HLFA 2C39B 1OYSA 3P3EA 3NWGA 4NLTA 1OPZA 4I6YA 1F5BA 1N4LA 2M7SA 4JI8F 3OUYB 3F0NA 3RJMB 1OIAA 3OT9A 3KG1A 3JAMC 2D69A 2XY5A 1ZPVA 2PDAA 4LCHA 4ITSA 2X51A 4DL7A 3DRSA 1KVKA 3TVZA 3TAMB 1Z0CA 1Q86T 2AYGA 2WW4A 2NYIA 3HT0A 3O6QA 1G6BA 3G8QA 5D3GA 1CS4A 3TVKA 1SV5A 3TO8A 3DRPB 1XMQJ 1TK0A 4IR1A 4ILMA 3QO9A 1E3PA 1B0PA 4X4RA 1MU2B 2GIFA 3NNCA 2ZUGA 1HD1A 3G6XA 5EUHA 1S7HA 2L48A 1CJUA 2C42A 5L8RC 2IHR1 5HJXA 3Q8PB 4Y2AA 1N5YB 2HHQA 1HNZE 4J9UE 3CDEA 3H5XA 1XN9A 3NOCA 2AGPA 4M5DB 3EZOA 4I1TA 4OHZA 2ZNZA 1JLEB 1F60B 1JNZB 3IM8A 1X5PA 1HIYA 1RHUB 2FVCA 1Q5YA 3N79A 4JI7I 4WUBA 4OZ3A 1B4SA 3FNNA 2JOQA 3KLGA 1ZPWX 1ULRA 2BRKA 1NHKL 4NYOA 2J6UA 4ZVQB 1CPZA 5CAAA 3U7JA 4Q2LA 1H38A 3KJQB 1YWXA 2ZHBA 1YQHA 1WJ9A 1JJCB 1MROA 1MMDA 1X4CA 4JI2E 3AOBA 5D4OA 4TNOA 4HACB 1TKTA 1TMJA 1Y60A 4UZBA 2UV8A 4OYPA 5SZTA 4J90A 3OVSA 2RAQA 2CA9A 4DV2F 1RAAB 3CC7S 2A3JA 3CJ4A 2VF3A 2EFNA 1X4HA 1PGZA 4NEYA 2LU2A 2EKNA 2CG4A 4Y2KA 4TU8A 1FE4A 3IAS9 1VQNS 4WIQA 1JLCB 3RR7A 2UUAF 1MN9A 2DCUB 2CQ3A 3P3GA 1D1UA 3QT7A 5J1PA 2CPIA 3M6VA 2MQLA 1T9XA 4CO1A 4NYZA 4YB6A 4CNZA 2FJDB 2FZKB 2IM1A 4F2RA 4DSLA 4W90B 3PRVA 3ZTPA 1FRXA 2AMCB 4Y6IA 4URLA 4IH6A 4YR2A 1QE1A 1N8RT 3P76A 2AD9A 1RWWB 3I9V9 4O23A 4TKTA 2MQQA 3QWUA 2B0GA 4DL6A 1JX4A 4DU8A 5KG3A 4AL7A 2Z5BB 4I6WA 4DS4A 1GNKA 3HD1A 3TANA 5CCMA 1HR0J 5B08A 3R5BA 2FY8A 2LVWA 1FTCA 3QRRA 3PM9A 1KHWA 1FXDA 3I6PA 5B0DA 3C3LA 1HQUB 1IJFB 2MLXA 4H4MB 3GE9A 4FN5A 2UXCF 4OZ2A 1SH3A 2ZITA 3TVYA 1RAEB 2OHDA 2Z8QA 5EWGA 4RBUA 3G6VA 4NZ7A 2W2NP 2JWNA 3PACA 3TEHB 4PXDA 1F9HA 1VK8A 2HNDA 2IMOA 5IT4A 1MMNA 1WI6A 2MSTA 1U1NA 5MAOA 2HHPA 4ZLJA 2O66A 3DHWC 4WBFA 4X4QA 4KV8A 4FKXA 1S6UA 4OZ5A 4OX6A 2DK2A 2ZEJA 1N34J 4C7QA 1KLMA 4ID5A 2XLKA 2W24A 4WZMA 5E3CA 3I0RB 3ISNC 3UR3C 1HHSA 2JLFA 2V9WA 3W63A 4C98A 1F5AA 2IJRA 2V5HG 3UO0A 4C8KA 1SIWB 3R5JB 2WVEA 4IFDB 2BJ1A 2QTWA 3LP0B 4Y0FA 2ZOFA 3M30B 4USIA 3KG0A 3I96A 3GFHA 2AU0A 2YKOA 3GJSB 2PNZA 2FB0A 3PXGa 4B3TI 3C6UA 3M8QB 4O0IA 1TVRA 4DL2A 1AZSB 2NS1B 1S57A 2P2CB 2KXNB 4IZJA 2DR6A 4WP3A 3VAIA 2PFDA 4RUCA 2XS7A 2YKPA 2UVWA 2K7JA 2QYGA 5K36B 1TFWA 2NZ4A 3QSIA 1NSKL 2G4BA 1GMWA 2DYAA 3ZZUA 5I3PA 3J7AM 2WB1D 1VLOA 4ZCIA 4LF6I 1ITPA 1IKVA 3JQKA 1JMTA 3UR0A 4M95A 4CH0S 3ZZYA 5KFFA 4Q0BB 2QC3A 4UY8T 1PKUA 3POTA 3QSYB 1HWLA 4IDKA 1KQGB 1WHVA 3V6KA 1RT2A 4X66I 4YB5A 1N32J 4U7UK 3PW7A 3CJ2A 5KOXA 2UUBE 1FFGB 4CP5A 4U7CA 4C9DA 2JEAB 4HYMA 2VQFE 3R5AA 2RD5C 2Z5CA 1S4FA 3T1HJ 1QSLA 2BUNA 2P9GA 1IBMI 5DROA 5FIIA 1VQ9S 3RAQA 3TEGA 2YPYA 4AQYJ 3AAWB 3IBCB 2ZH9A 1RR9A 3M2UA 2ZH3A 3P45B 3S7RA 1ZA1B 1U1RA 1IBKJ 1KHVA 4WE1A 3GJQB 3MD3A 1WKJA 1ZTTA 1Y4UA 2CZ4A 2OPRB 2VFTA 4USHA 3AA8A 1N36F 3T1YJ 3D7SB 3CCES 3PJ9A 3SFGA 5H1SV 3WX4A 2ASDA 2XNQA 4KSEB 2QLBB 1VHFA 3A4TA 5HP1A 2PMWA 2RJZA 3KDNA 4W4MA 1IBCB 4DV4F 2H5IB 3MCMA 2JEJA 4WFXA 2O3DA 2OAUA 4M94A 5D4NA 1EJ7L 3QFHA 2OKQA 2D3ZA 3KHHA 2HNZA 3VR1A 4CZCA 3TZZA 5HN0A 3VZHA 1JLFB 3CJKB 2J0SD 5HL7Q 2A6OA 4DQIA 4OI3A 2ZH2A 1S6QB 4JI1J 2NLWA 3N9UC 2CIMA 1NHUA 2F8HA 5BR8I 1SL2A 3HZGA 1S12A 1Q7LB 3TOQA 1O0PA 4KPCA 3TUPA 2EBGA 2IM0A 3KUHA 5KG4A 1Q8KA 5IWAF 2VODA 1TTHB 4NLVA 3KXDA 4H4KC 2ATLA 4EBDA 4NPOA 3OR1B 4DDFA 1S1UB 3WHIA 4K0KF 2RUGA 2FJBB 3M8WA 4DR7E 3AXMA 1RT3B 1T7PA 1S0NA 3CEDA 2MKYA 3H2LA 3UCGA 1WHYA 5CABA 3CD7A 4PAAA 1DFDA 2IRXA 1B62A 3GSIA 3R7SB 4X64J 1FNMA 1JIHA 3QAEA 3EDRB 2GW8A 2BR2B 2HFSA 1EX8A 3GLJA 5CZVA 1OYRA 4A46A 2FIUA 4WXWA 1CJTA 4YDDB 3SMZA 3KDOA 3R7BB 2GO4A 4J9SA 2PSZA 5J1EB 1SVDA 2QMXA 2IVMA 1UW9A 2MKJA 2E5LJ 3KK1B 3MCSA 2NYHA 3GCXP 1S9EA 2ZH5A 1UDQA 3K57A 3CCQS 2NUHA 4GO7X 3GV7B 4USJC 2UXBF 2XLJA 3HI9A 3S1TA 2AEFA 2G0IA 1EB0A 2LDIA 4CTAA 3CJ3A 5C0XA 1HNWF 4X4UA 5DRRA 2XWYA 3ENVA 3OTOF 2OSQA 1S1XA 1OQ3A 2IYIA 5LMUI 1A6FA 2RKIB 1JJ4A 1FKOB 1T3OA 1S16A 3NS5A 4JI5E 1IBLF 4A8KA
chains in the Genus database with same CATH topology
4LF9E 4JI7E 4LFAI 4JI1I 1HR0E 4UTGA 1H7SA 4Z7YA 1XMOE 2Z5EA 4DXLA 1FI4A 1N36I 4WUCA 4DV1I 4ED4A 1FWKA 4LF6E 4FN5A 3Q1QA 3JAMQ 4DV7I 2UUBI 1ELOA 2ZITA 1Z0GA 2VQFI 3J80C 3K17A 4LF8E 1Z0VA 3J7AG 2X7IA 2Q2EB 1NHHA 5BR8E 4DV4I 4X65I 2PNLA 4B3RE 1XMQI 2IOPA 4EMDA 2CG9A 3WU6A 4I3HA 3J81Q 4DV5E 4KHPI 1N32E 4X62E 4JYAI 4X64I 4AQYI 4LFBE 4P52A 4NXNE 2DEJA 4DR6E 4DR3I 4B3SE 4DUYI 3PYGA 1XNQE 2F4VE 3WU4A 2R42A 3LTOA 1N34E 1XHKA 1HNXE 4Z7CA 3P06A 3WU5A 4JI8E 3PYEA 1VISA 2UUCE 5IWAI 4LF5E 4LF4E 3T1YI 4DV2I 2DEIA 5A2QC 2E5LI 4LF7E 3D4JA 4K0KI 3LPSA 4JI0I 1NHJA 4GKJI 1FWLA 4B3TI 1KTVA 3ZKDA 3B8HA 2UUAI 1ZM3A 1U2RA 1Y6ZA 1MX0A 2HK3A 4DPWA 1DARA 5LMNI 4IZJA 4PRVA 1H74A 2O1TA 4DV3I 4JI2I 4DR4E 2HKJA 4DR1E 4USKA 3Q6MA 2X36A 2R3VA 3ZZUA 3J7AM 1FJGE 5GMDA 4LF6I 3F0NA 3ZM7A 3ZZ0A 1I94I 4YY3I 1N33E 3K85A 3JAMC 4YHHE 5LMUE 4R1FA 3V5RA 4JI4I 4DR7I 1KKHA 4LFAE 4JI1E 2UXBI 1B63A 4DUZI 1KVKA 1Z0CA 1Z0BA 4DR5I 3B78A 4DV5I 2WW4A 4X66I 2V34A 1Z0WA 3V2UC 1N36E 1HNWI 2AJ4A 3J81C 2V2VA 4IZKB 4DV7E 2UUBE 3J80Q 2GS8A 4PU9A 2BM0A 3OTOI 1ZM4A 4HYMA 2VQFE 4DR6I 4HACA 1HK7A 4DV6I 2EFGA 2Z5CA 2VQEI 1IBLI 2BV3A 3ZZTA 2UXDI 1HNXI 3QT5A 2ZM6I 2V2ZA 1IBMI 1OJ4A 1XMQE 2HHHI 2PNMA 4JV5E 3T1HE 2UUCI 1PKPA 4LF5I 1N0VC 4DPXA 4IZKA 1RR9A 4NXME 4KHPE 4USMA 4P7AA 4X64E 4AQYE 3QT8A 2UXCI 4MYUA 4FWGA 1USUA 1Z5AA 1IBKE 1Y4UA 4IZJB 4DR3E 4DR2I 4DUYE 2IOQA 4LFCE 4JG4A 1HNZE 2LJPA 4JI3E 2UU9E 4GKKI 4DV0I 2O1UA 4DPYA 1XNRI 1EA6A 4B3MI 2XEXA 5A2QQ 1NHIA 4XTJA 2A2CA 3T1YE 1Z0TA 4DV2E 2E5LE 4OX9I 2J7KA 4KQVA 1ZXNA 5FLXQ 4JI5I 4K0KE 4LF9I 4JI7I 4WUDA 1HR0I 4WUBA 4JI0E 1KIJA 4GKJE 4JI6E 5IT9Q 5FWKA 4B3TE 5LL6R 1XMOI 1J5EE 2UUAE 1Z0EA 1BKNA 4M1KA 2A2DA 4HY1A 2NPFA 4LF8I 2O1WA 4DV3E 4JI2E 2O1VA 3HJCA 1ZXMA 2HK2A 3WU3A 1PIEA 4HACB 2Z5BA 5BR8I 1Y4SA 2CGEA 4MYTA 1S4EA 4HXZA 2Z5CB 4B3RI 3HULA 1WUUA 1ZM2A 1K47A 4DU7A 1N32I 4DV1E 5L3JA 4X62I 4FWHA 1I94E 4YY3E 2V8PA 1Z5CA 4IZJD 2VF3A 1QZRA 4LFBI 4NXNI 4JI4E 4DR7E 4PRXA 2OI2A 4B3SI 3QT6A 3K1JA 1XNQI 1PVGA 2F4VI 1N34I 2UXBE 4DUZE 4JV5I 4DV4E 3T1HI 4X65E 1B62A 2GQ0A 4DR5E 1FKAE 2ZBKB 4X66E 4JI8I 4NXMI 3QT7A 1HNWE 1FNMA 4LF4I 3B82A 4UT4A 1H72C 3ZKBA 2HFSA 4FWDA 3OTOE 4JYAE 1MU5A 1IBKI 4LF7I 1RREA 3CWVA 4LFCI 4DV6E 1HNZI 3LNUA 2VQEE 4JI3I 1IBLE 2UXDE 4FW9A 2ZM6E 2UU9I 3H4LA 2E1RA 1N0UA 1IBME 2HHHE 1H7UA 1UEKA 3M6AA 4DPUA 1H73A 3PRYA 1ZM9A 1USVA 4URLA 5IWAE 2UXCE 2CZ9A 1MG7A 4ZVIA 3GONA 5FLXC 4DR2E 4DR4I 4DR1I 2BM1A 4JI6I 2V2QA 1D6TA 4DU8A 1J5EI 4GKKE 4DV0E 1Z59A 4RPFA 2Z5BB 5IT9C 4N3OA 3PYFA 1XNRE 4B3ME 1FJGI 3Q6NA 1EI1A 1NZ0A 1N33I 4YHHI 5LMUI 5GMEA 1A6FA 3PYDA 2HFUA 4DPTA 5LMNE 4OX9E 1S16A 4JI5E 1Z5BA 2HKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 E;  4JI7 E;  4LFA I;  4JI1 I;  1HR0 E;  4UTG A;  1H7S A;  4Z7Y A;  1XMO E;  4DXL A;  1FI4 A;  1N36 I;  4WUC A;  4DV1 I;  4ED4 A;  1FWK A;  4LF6 E;  4FN5 A;  3Q1Q A;  3JAM Q;  4DV7 I;  2UUB I;  1ELO A;  2ZIT A;  1Z0G A;  2VQF I;  3J80 C;  3K17 A;  4LF8 E;  1Z0V A;  3J7A G;  2X7I A;  2Q2E B;  1NHH A;  5BR8 E;  4DV4 I;  4X65 I;  4B3R E;  1XMQ I;  4EMD A;  3WU6 A;  4I3H A;  3J81 Q;  4DV5 E;  4KHP I;  1N32 E;  4X62 E;  4JYA I;  4X64 I;  4AQY I;  4LFB E;  4P52 A;  4NXN E;  2DEJ A;  4DR6 E;  4DR3 I;  4B3S E;  4DUY I;  3PYG A;  1XNQ E;  2F4V E;  3WU4 A;  2R42 A;  3LTO A;  1N34 E;  1XHK A;  1HNX E;  4Z7C A;  3WU5 A;  4JI8 E;  3PYE A;  1VIS A;  2UUC E;  5IWA I;  4LF5 E;  4LF4 E;  3T1Y I;  4DV2 I;  2DEI A;  5A2Q C;  2E5L I;  4LF7 E;  3D4J A;  4K0K I;  3LPS A;  4JI0 I;  1NHJ A;  4GKJ I;  1FWL A;  4B3T I;  1KTV A;  3ZKD A;  3B8H A;  2UUA I;  1ZM3 A;  1U2R A;  1MX0 A;  2HK3 A;  4DPW A;  1DAR A;  5LMN I;  4PRV A;  1H74 A;  4DV3 I;  4JI2 I;  4DR4 E;  2HKJ A;  4DR1 E;  4USK A;  2X36 A;  2R3V A;  3ZZU A;  3J7A M;  1FJG E;  5GMD A;  4LF6 I;  3F0N A;  3ZM7 A;  3ZZ0 A;  1I94 I;  4YY3 I;  1N33 E;  3JAM C;  4YHH E;  5LMU E;  4R1F A;  3V5R A;  4JI4 I;  4DR7 I;  1KKH A;  4LFA E;  4JI1 E;  2UXB I;  1B63 A;  4DUZ I;  1KVK A;  1Z0C A;  1Z0B A;  4DR5 I;  3B78 A;  4DV5 I;  2WW4 A;  4X66 I;  2V34 A;  1Z0W A;  3V2U C;  1N36 E;  1HNW I;  2AJ4 A;  3J81 C;  2V2V A;  4DV7 E;  2UUB E;  3J80 Q;  2GS8 A;  4PU9 A;  2BM0 A;  3OTO I;  1ZM4 A;  4HYM A;  2VQF E;  4DR6 I;  4HAC A;  4DV6 I;  2EFG A;  2VQE I;  1IBL I;  2BV3 A;  3ZZT A;  2UXD I;  1HNX I;  3QT5 A;  2ZM6 I;  2V2Z A;  1IBM I;  1OJ4 A;  1XMQ E;  2HHH I;  4JV5 E;  3T1H E;  2UUC I;  1PKP A;  4LF5 I;  1N0V C;  4DPX A;  1RR9 A;  4NXM E;  4KHP E;  4USM A;  4P7A A;  4X64 E;  4AQY E;  3QT8 A;  2UXC I;  4MYU A;  4FWG A;  1Z5A A;  1IBK E;  4DR3 E;  4DR2 I;  4DUY E;  4LFC E;  4JG4 A;  1HNZ E;  2LJP A;  4JI3 E;  2UU9 E;  4GKK I;  4DV0 I;  4DPY A;  1XNR I;  1EA6 A;  4B3M I;  2XEX A;  5A2Q Q;  1NHI A;  4XTJ A;  2A2C A;  3T1Y E;  1Z0T A;  4DV2 E;  2E5L E;  4OX9 I;  2J7K A;  4KQV A;  1ZXN A;  5FLX Q;  4JI5 I;  4K0K E;  4LF9 I;  4JI7 I;  4WUD A;  1HR0 I;  4WUB A;  4JI0 E;  1KIJ A;  4GKJ E;  4JI6 E;  5IT9 Q;  4B3T E;  5LL6 R;  1XMO I;  1J5E E;  2UUA E;  1Z0E A;  1BKN A;  4M1K A;  2A2D A;  4HY1 A;  2NPF A;  4LF8 I;  4DV3 E;  4JI2 E;  1ZXM A;  2HK2 A;  3WU3 A;  1PIE A;  4HAC B;  5BR8 I;  4MYT A;  1S4E A;  4HXZ A;  4B3R I;  3HUL A;  1WUU A;  1ZM2 A;  1K47 A;  4DU7 A;  1N32 I;  4DV1 E;  5L3J A;  4X62 I;  4FWH A;  1I94 E;  4YY3 E;  2V8P A;  1Z5C A;  2VF3 A;  1QZR A;  4LFB I;  4NXN I;  4JI4 E;  4DR7 E;  4PRX A;  2OI2 A;  4B3S I;  3QT6 A;  3K1J A;  1XNQ I;  1PVG A;  2F4V I;  1N34 I;  2UXB E;  4DUZ E;  4JV5 I;  4DV4 E;  3T1H I;  4X65 E;  1B62 A;  4DR5 E;  1FKA E;  2ZBK B;  4X66 E;  4JI8 I;  4NXM I;  3QT7 A;  1HNW E;  1FNM A;  4LF4 I;  3B82 A;  4UT4 A;  1H72 C;  3ZKB A;  2HFS A;  4FWD A;  3OTO E;  4JYA E;  1MU5 A;  1IBK I;  4LF7 I;  1RRE A;  3CWV A;  4LFC I;  4DV6 E;  1HNZ I;  3LNU A;  2VQE E;  4JI3 I;  1IBL E;  2UXD E;  4FW9 A;  2ZM6 E;  2UU9 I;  3H4L A;  2E1R A;  1N0U A;  1IBM E;  2HHH E;  1H7U A;  1UEK A;  3M6A A;  4DPU A;  1H73 A;  1ZM9 A;  4URL A;  5IWA E;  2UXC E;  2CZ9 A;  1MG7 A;  4ZVI A;  3GON A;  5FLX C;  4DR2 E;  4DR4 I;  4DR1 I;  2BM1 A;  4JI6 I;  2V2Q A;  1D6T A;  4DU8 A;  1J5E I;  4GKK E;  4DV0 E;  1Z59 A;  4RPF A;  5IT9 C;  3PYF A;  1XNR E;  4B3M E;  1FJG I;  1EI1 A;  1NZ0 A;  1N33 I;  4YHH I;  5LMU I;  5GME A;  1A6F A;  3PYD A;  2HFU A;  4DPT A;  5LMN E;  4OX9 E;  1S16 A;  4JI5 E;  1Z5B A;  2HKE A; 
#chains in the Genus database with same CATH topology
 1RAC B;  2YKN A;  4LRF A;  4UTG A;  3OFG A;  1N5S A;  2ZBQ A;  2QSF A;  2CUY A;  4F0M A;  3GFZ A;  3GG0 A;  3J7A N;  3C14 B;  5EDW A;  2A0F B;  4YY3 J;  1S76 D;  1XTZ A;  4KO0 A;  2GVZ B;  4J9M A;  3OXF A;  3OW2 R;  3K17 A;  3TAQ A;  3E3X A;  1Y3J A;  2GJF A;  2G13 A;  3PW5 A;  1RZM A;  2JFD A;  1N88 A;  1M5V C;  4DV5 J;  3QID A;  1NDL A;  4A8X A;  1SKR A;  1ARO P;  3J80 U;  4I2Q B;  1NZ8 A;  4JBC A;  4RUB A;  3H1C A;  4PG5 A;  5KFE A;  3PW0 A;  4JV2 A;  1TL1 A;  4O3P A;  1Y5I B;  3D66 A;  4DFJ A;  5AXK A;  4MDT A;  1IKW B;  2HRT A;  3OR2 B;  1SJ3 P;  3SEO A;  1UDN A;  2H4Y B;  2HHS A;  4R8U B;  1XHK A;  4ECY A;  4QIW D;  2JVR A;  2PT0 A;  2PO1 A;  4CLF A;  2HNY A;  2VJU A;  2BA0 G;  1YLX A;  4F4W A;  1UVN A;  5JEA D;  4NCG A;  2E7W A;  1NH8 A;  1JJH A;  3HF5 A;  2ZC4 A;  4LF8 F;  2CNK B;  4JOU A;  1HMV B;  1Y00 A;  1RQ0 A;  2HWT A;  3ZXW A;  4B3R F;  4OLP A;  3UE2 A;  4A4J A;  1XNR J;  1X0P A;  3E01 A;  1A6L A;  3NY0 A;  1KTV A;  1R8A A;  3I55 S;  3BYR A;  1FER A;  3ENQ A;  1H2V Z;  3CCS S;  4B3S F;  2MZ1 A;  3C46 A;  5B0C A;  2LQB A;  3ZTS A;  2NXN A;  2XLI A;  1FFS B;  3QZ7 A;  4RW8 B;  3K2Y A;  5E5N A;  3MI7 X;  3CCT A;  1SH0 A;  2K8G A;  3I5A A;  1O6X A;  2QN6 B;  2YX4 A;  3HP6 A;  2KT2 A;  4LF7 F;  2Q79 A;  2BAN B;  4MU0 A;  4V19 J;  2GJ2 A;  3K5P A;  2JVO A;  5ITH A;  1EET B;  4P73 A;  4HT5 A;  1ZZN A;  3OVB A;  2ZJQ Q;  1MWZ A;  2AJ0 A;  2DPJ A;  4TQS A;  4EO6 A;  2C2D A;  1P9Y A;  3EIC A;  1M5O C;  1YRX A;  2LQ5 A;  1C1C A;  4O4G A;  1PAU B;  3ZO7 A;  1N5V A;  3DRR A;  2ACM A;  2UXD I;  3RB3 A;  4JV5 J;  1TMM A;  2IBO A;  1OYD A;  3HSJ A;  1U1K A;  4NXM J;  4DPO A;  2B56 A;  1N33 F;  1UWB B;  1G2E A;  1VBK A;  2QA2 A;  5GAH I;  1VS3 A;  4DUY J;  3J7Y I;  1YJW S;  4LFC J;  2XB2 D;  2WP8 A;  4DR3 E;  2VB6 A;  1AXQ A;  5F3Z A;  3UCZ P;  4X4S A;  4ZVP B;  1Q82 T;  4J37 A;  2NPI A;  5E3P A;  1LXJ A;  4U3B A;  4GKK I;  1CEZ A;  2FLN A;  1NBE B;  1S6P A;  4G1P A;  5A8K B;  2DR7 A;  1B64 A;  1HLW A;  3MDF A;  2V94 A;  1VR6 A;  2RQC A;  2DRB A;  5HRO B;  2CPE A;  4OO1 C;  4DSK A;  5HAT A;  2ERR A;  3D67 A;  4C0H A;  2DNG A;  2W2O P;  5A8W B;  1YG0 A;  4WUD A;  3MR2 A;  1CUL A;  3IS9 A;  3TR5 A;  4XPE A;  3MUV P;  2HS3 A;  4ED2 A;  2IM3 A;  3DLK A;  3C15 A;  4BLG A;  3NMA A;  3H8Y A;  1J5E E;  2NUU G;  4I64 A;  4FYW B;  1YK9 A;  1VIO A;  2GIQ A;  4J9O A;  1VI7 A;  1CS4 B;  7FD1 A;  2KFZ A;  1SL0 A;  3MMJ A;  4I6A A;  1NSA A;  4EYH B;  1V3R A;  3J7Z T;  1J27 A;  1ICE B;  1S48 A;  3LPE A;  2YWK A;  4L72 B;  5GAE U;  4DV1 E;  3ISZ A;  2WAQ D;  1RWO B;  1VHI A;  4LFB I;  4IFD D;  3IGV A;  1T02 A;  3BDE A;  2XY6 A;  1VGY A;  4GKJ F;  4ZDN A;  4FF4 A;  3FMB A;  5F8N A;  1JJ2 R;  4X65 E;  2C3U A;  3IBW A;  5KT3 A;  4C8O A;  3ADA C;  1RWM B;  2AYM A;  4KGV B;  3KMQ A;  1KBR A;  4OI6 A;  2IA6 A;  5LJ3 Y;  1F1B B;  1SJQ A;  4B3O B;  1MU5 A;  2GO9 A;  1FJE B;  1K0V A;  2EKY A;  2YKQ A;  4K4V A;  2V67 A;  5K36 D;  1ZET A;  4K59 A;  3QRQ A;  2XO6 A;  4QYZ K;  1PIL A;  2G0C A;  1IM6 A;  1TKZ A;  1IVZ A;  1U0H A;  4JI4 F;  1WOP A;  4QYR A;  1N54 B;  1WC5 A;  1KON A;  2PII A;  4ZVI A;  2YVS A;  4DV0 J;  1MRO B;  2WK4 A;  2HZA A;  3ZTR A;  4N3O A;  1E6V B;  2KHD A;  2ROP A;  1FJG I;  2YKM B;  3ZFV A;  4OO1 F;  4GVB A;  5DDQ C;  1OY6 A;  4LF9 J;  5LMN E;  4ZIV A;  4RW9 A;  4LR9 A;  2NRE A;  2FHJ D;  1B70 B;  4NLG A;  1HNX F;  4JI7 E;  4LFA I;  1PAE X;  2BW2 A;  3EVM A;  3BSC A;  3VAL A;  4K4T A;  4LT6 A;  2RRA A;  2R8K A;  3HK2 A;  1SIZ A;  2CJY B;  3VGU A;  5LXY A;  4AID A;  1PBA A;  4DV7 I;  1RAJ A;  2BAB A;  1Q7Y T;  1Z0V A;  3MED B;  2MB0 B;  2ZOG A;  4BDP A;  4UOH A;  4B3M F;  3GIM A;  3BGO P;  3KJV A;  1L3S A;  4GRS A;  2QO3 A;  4N77 A;  2OPQ A;  3P06 A;  4M5K A;  5L1K A;  3JSM B;  2CQ2 A;  1T05 A;  3PYE A;  2RS2 A;  2UUC E;  3MTK A;  4LF5 E;  1EKS A;  5L46 A;  2GQQ A;  2DNQ A;  1KOO A;  4CO5 A;  5C24 A;  4NLO A;  3L7P A;  2F40 A;  2VC0 A;  3THT A;  2UUW A;  3BO4 A;  2HBR B;  1OWX A;  5FJ4 A;  4CLS A;  1TU0 B;  1MX0 A;  3PR5 B;  2YY3 A;  4IRD A;  4NWB A;  3GIL A;  3ZC4 A;  4QIV A;  3NMR A;  1UDS A;  4RNF A;  3CJ8 A;  2G2Z A;  1S5Z A;  2HKJ A;  4DWI A;  2E5H A;  4ED1 A;  2KDO A;  4ZN1 A;  5J2P B;  1S99 A;  3X3U A;  1PJ5 A;  2P8I A;  3FEX B;  4DQP A;  3MEC B;  8RUC A;  2HND B;  2F1F A;  3V6J A;  1I94 I;  4OFZ A;  3KFW X;  2VUG A;  2H54 B;  3PNI A;  3JS9 A;  4MH8 A;  2BA1 D;  4QWB A;  5LT5 A;  4PEO A;  2VAS A;  3U1M A;  4F36 A;  2JLE A;  1KLM B;  4ID5 B;  3B78 A;  3ILO A;  2BRL A;  4UST A;  2AJ4 A;  2ZH4 A;  4ANE A;  1RA7 A;  3MGJ A;  4CIO A;  4DR6 I;  4CLU A;  2G1D A;  1U47 A;  3U1K A;  2N4D A;  3HVR A;  2V2Z A;  4ER8 A;  2OTJ S;  1NKC A;  3OL6 A;  3C6U B;  5A0Y A;  1TVR B;  3K0J A;  1K73 T;  5DG9 A;  3E8O A;  3QIP B;  4MYU A;  2OMO A;  4B9V A;  1R7I A;  4CYU A;  4IZJ B;  4JG4 A;  3IRX A;  3M1V B;  4ELV A;  4X4O A;  1R0A A;  5KG5 A;  3AB2 B;  3L4B C;  4KBI A;  5C5J A;  1BWV A;  1RT6 B;  4RW7 A;  2E5J A;  3IG1 B;  5F0U A;  2IFX A;  4OLO A;  3Q8Q B;  1GK8 A;  2Y1L B;  2ZKU A;  3RUB L;  2G9O A;  2EBE A;  2Y8W A;  1IKV B;  4LF2 A;  3P8B B;  4AD6 A;  1WTF A;  1BD6 A;  4XK8 C;  4IG0 A;  2ADB A;  2E7X A;  1R8H A;  4FXD A;  3M8R A;  3POT B;  4KKO A;  3PRD A;  1S0O A;  4IDK B;  4B3T E;  5LL6 R;  4DUT A;  4K5R A;  3DRY A;  2E44 A;  2VKR A;  4KH1 B;  2X1B A;  4F25 A;  2BJD A;  2IDL A;  4HY1 A;  1U6B A;  1R27 B;  4NAS A;  5JEA C;  2RDJ A;  4PUO A;  1L5U A;  2Z5C B;  4ATN A;  1LQ9 A;  2CJX B;  2IBK A;  3BQ2 A;  4RLE A;  1KN6 A;  4F04 B;  4F4Z A;  2DNO A;  4C11 A;  3VAJ A;  2LU1 A;  1HI1 A;  2VQF J;  1JK9 B;  3M2U B;  1HNI A;  1VQ6 S;  2ZBI A;  3NCQ A;  4X66 E;  2CQH A;  3AD9 C;  4R0E A;  1S9G A;  1PYT A;  2ZHO A;  1RDR A;  2HWI A;  1QDU B;  4Y00 A;  2I6W A;  4AYB D;  5E0O A;  3FBC A;  1YBU A;  2AJ1 A;  3JXO A;  2GNK A;  3GWC A;  4JI3 I;  3TUZ C;  2QIF A;  5D15 A;  2UU9 I;  1IBM E;  3BBC A;  3Q2S C;  3FZ2 A;  2H3E B;  3DLE A;  3UWT A;  3DC2 A;  4CLP A;  4J91 A;  1SJ1 A;  2LDY A;  2HNZ B;  1NH7 A;  4K2J A;  3LAN A;  2BOP A;  3CF5 Q;  1R6Y A;  1T9U A;  5C42 A;  3D6H B;  4JI6 I;  1RWV B;  2IJF A;  1SCJ B;  3PYF A;  1R43 A;  3CCL S;  4OX9 J;  5KFD A;  2VOO A;  4Q45 A;  5B7W A;  1PBU A;  4YR0 A;  3CUL A;  4RWX A;  2NXC A;  1NK6 A;  1JLG A;  1RTJ A;  4R5P A;  3RBX A;  2DR9 A;  2BJE A;  1BY9 A;  2VDI A;  4YOE A;  2DO4 A;  4C8N A;  5I3U A;  1CQM A;  2V8G A;  2BZ2 A;  4NRU A;  4ZVO B;  3WX8 A;  3FMW A;  3MF5 A;  2RQM A;  2Q6B A;  3SCK E;  2W9C B;  4L6V 3;  5HO4 A;  2XMU A;  5BR8 E;  4M5G A;  1VQL S;  3HFZ B;  2J7W A;  2CG9 A;  4DSE A;  4NLU A;  1U8W A;  1S0V A;  1T0T V;  4NLD A;  1JLA B;  1NPR A;  4JYA I;  2RU9 A;  4AFF A;  3R97 A;  3OSP A;  4OMF G;  1XNQ J;  1YJR A;  2M8D B;  2FJA B;  1UEU A;  2VFV A;  1S9E B;  3DNC A;  4JI8 J;  5KFU A;  1CJV A;  4JUZ A;  2C2N A;  2OIH A;  2ZE2 A;  4W92 B;  5D0E A;  2OD6 A;  3THP A;  2YQ0 A;  4K50 A;  1ZAV A;  5ETK A;  4MK7 A;  1S1X B;  3HSZ A;  3HVA A;  2C3M A;  2BXJ A;  4JI0 I;  2GAH C;  2GVD B;  3U1N A;  3BBF A;  4IFD C;  3GYN A;  1RYS A;  1UKU A;  4TU9 A;  4N8N A;  1N32 F;  1NJZ A;  2HYI B;  4OV1 A;  4KQZ A;  1HW9 A;  4DR6 F;  1URN A;  4URS A;  4LBH A;  1RTI B;  3T1H F;  3M6X A;  3I56 S;  2ZJR Q;  3HDS A;  2C2M B;  4V19 X;  5K36 C;  3LGM A;  3DLB A;  4ZK7 M;  1IBK F;  5F8H A;  3ZTQ A;  5LMU E;  2ZWP A;  1FE0 A;  1NK5 A;  1YRU A;  1Y9O A;  2JC0 A;  4WWS A;  1Q8L A;  2CQP A;  2M70 A;  1KOH A;  3OD2 A;  4LF1 A;  1R8P A;  1SKU B;  3MWB A;  3MOZ A;  2YBV A;  3BSN A;  1N5Q A;  1W25 A;  2QMW A;  1WG1 A;  1RE1 B;  2BJ8 A;  5H9F K;  3J81 C;  2B43 A;  3I5B A;  4KC5 A;  3EVW A;  4MU4 A;  3NEK A;  4WF9 Q;  4ZJO A;  1C0U A;  2LQJ A;  2QFJ A;  1D9D A;  4OKG A;  4C8Z A;  5HBM B;  2E9Z A;  1I3O B;  2NXJ A;  4MIA A;  2ZM6 I;  5D8H B;  3M8P A;  4TY8 B;  1OJ4 A;  2PNM A;  1FK9 A;  2ALY B;  1UMJ A;  2PGC A;  4DPX A;  1T9T A;  1CVJ A;  2K3K A;  4FYY B;  3RYL A;  3LWL A;  4LSL B;  4MKV A;  2M5Y A;  3HMJ G;  4FWG A;  4JI1 F;  1LWE A;  2WON B;  4PRF A;  3K8W A;  4XTT A;  2XCP A;  2VPY B;  4M5M A;  3MHY A;  4UF4 A;  4DV2 J;  2WVC A;  5IOL A;  2DRD A;  4UUX A;  4O3O A;  4NBQ A;  3DOK A;  5F8G A;  2VG5 A;  5C0X C;  4U8Y A;  3MPY A;  2ILY A;  4ISA A;  3WBZ A;  3EYZ A;  3JB9 k;  1AW0 A;  2UUA J;  2ZD1 A;  4BS2 A;  4B9L A;  4BWJ A;  1XMO I;  2B5J B;  1LNQ A;  4X64 F;  1VQ4 S;  2XYH B;  3HHL C;  3BO3 A;  2OTL S;  1WEX A;  2MTL A;  4PCQ A;  1FT8 A;  3W2W B;  4NI2 A;  1T95 A;  4O3S A;  4ZVG A;  2WBR A;  4Y2C A;  1SI9 A;  2AT1 B;  3GV5 B;  2O1V A;  2B51 A;  4WFZ A;  2J9E A;  2B6A A;  4J5O A;  1JLB A;  2BE9 B;  2VON A;  4WFN Q;  5KFO A;  1F2H A;  2X3D A;  1QAX A;  2MKH A;  4X62 I;  3HJV A;  2E5L F;  3MFH A;  3LGN A;  3RAM A;  3EGZ A;  3OHA A;  2DGQ A;  2FZC B;  1UJ6 A;  1ZS6 A;  1W2I A;  3D1H A;  1O8B A;  2BE2 A;  1SUQ A;  1FF2 A;  3PKM A;  3K1J A;  1RA6 A;  4JI6 F;  1IR0 A;  2RNE A;  2YWF A;  2QG9 B;  4NL5 A;  2IAJ A;  2RUS A;  2P9C A;  4OYI A;  2BR0 A;  1T94 A;  4KRW A;  4LOM A;  4N5S A;  2ZBK B;  1OQ6 A;  3PKY A;  4O3N A;  1V5V A;  1TR0 A;  3NGS A;  2SXL A;  2CQC A;  3T41 A;  3GPA A;  4WU2 A;  4LF4 I;  1FD8 A;  4P9S A;  1S6P B;  2QJ3 A;  5KG0 A;  1LFW A;  2MQO A;  1HNZ I;  3RBZ A;  1M5H A;  2UXD E;  1KDN A;  1MNE A;  1VQY A;  5IQQ A;  4GO5 X;  1UVJ A;  1Y3K A;  1EHW A;  3G82 A;  2CQB A;  2UXC J;  4EO8 A;  3PRY A;  3DLK B;  4YY3 F;  3JTP A;  2W4D A;  4KFB B;  3C15 B;  2WCX A;  2ZWO A;  1ZOT A;  1X8D A;  1SJF A;  2RB7 A;  1PCA A;  4DR5 F;  4DV5 F;  5L9X A;  3FSI A;  4GKK E;  4RPF A;  4J9V A;  3HVT A;  5IT9 C;  3KKF A;  5ETR A;  5C0X F;  2V69 A;  4JYA F;  4DLE A;  1GX6 A;  2DCL A;  4PQU B;  4PKD B;  2UZA A;  2VQE F;  2E9R X;  2BJ7 A;  2HHH F;  4K