2F4VE

30s ribosome + designer antibiotic
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2f4vE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2f4vE02
4YHHI 3K1JA 1OJ4A 1Z5BA 1B62A 4DR2E 3ZKDA 2JY9A 1WUUA 4MYUA 2L2MA 2IHR1 2X36A 1Z5AA 4DV2I 4JYAI 4K0KE 1Z0EA 4DV5I 3WU6A 3QT6A 2V8PA 4KQVA 3WU3A 3ZZUA 1X49A 4JI4E 4JI5E 4I3HA 3ADIA 3P1XA 4DV7E 4NXMI 2HHHI 2L3CA 2UU9E 3ZZTA 1H72C 4AQYE 5CFFE 2CPNA 1ZM2A 1A6FA 4P7AA 2UUCI 1WHNA 4M2ZA 1ZM9A 3K17A 2HFUA 4DR4E 4LFCI 2Q2EB 2RTXA 1EI1A 4LF9E 3GONA 1I94I 1XMQI 1FJGI 1YYKA 1HR0E 4ZVIA 1UEKA 4UTGA 1KTVA 1XNQE 2UUAE 3V2UC 5GMEA 4DPTA 3LLHA 1QZRA 2LRSA 2HK2A 3J80C 4FWHA 4LF6E 3JAMQ 3ZKBA 3VYXA 1ZBTA 2UXDE 1YYOA 3M6AA 3Q1QA 1RC7A 4HACB 4JV5E 2UXCI 1HNXE 3J7Yp 4FW9A 4DR1I 1STUA 1NHHA 1ELOA 2NUFA 2RS6A 1IBLI 1VISA 1T4LB 3B8HA 1J26A 4DPWA 1O0WA 1N32E 2VQEE 1FNMA 5IT9Q 2ZITA 4DR2I 2LBSB 5LL6R 4DR3E 2GS8A 2DEIA 2RSMA 3PYGA 4JI2E 4LFAI 4K0KI 2V2VA 2R3VA 3C4TA 1XNRE 2VF3A 4JI4I 2NA2A 4JI5I 3J7AG 4DV7I 4DR6I 3CWVA 2ZM6E 1PKPA 4AQYI 1N36E 2HFSA 4LFBE 4NXNE 4DV4E 2VQFE 1J5EI 4USKA 4PU9A 4DR4I 2NUGA 2B3TB 3V5RA 2OI2A 1X47A 2E5LE 2L33A 1NHIA 1XNQI 4LF5E 5LMNI 4DV6E 2HK3A 3JAMC 1HNWI 1N33E 4DR7E 4X64E 4YY3E 2EFGA 1Z0TA 4LF6I 1XMOE 5GMDA 4R1FA 2A2DA 2RS7A 2DB2A 1HNXI 4JI0E 3PYDA 3T1HE 4B3ME 2L2KB 4DV3I 4JG4A 4X65I 5IT9C 4X62I 2VQEI 4M1KA 2X7IA 4JI6I 1EKZA 4DR3I 1RREA 5IWAE 3OTOE 4WYQB 4M30A 4OOGC 2L2NA 4JI2I 4EMDA 4WFTA 1ZM4A 1Z0VA 5BR8E 1IBME 1XNRI 2JVAA 1T4OA 4WUBA 4XTJA 1YZ9A 4KHPE 4B3RE 2ZM6I 4B3TE 2BM1A 2XEXA 4P52A 4YHHE 4NXNI 4DPYA 4LFBI 3J81Q 4DV0E 2VQFI 1IBKI 4DUZE 1Z0GA 2LTRA 4DUYE 2LJPA 5FLXQ 2UXBE 4DU7A 3ADJA 3PYFA 2E5LI 3ADGA 2J7KA 1N34E 1FWLA 4FWDA 4LF5I 4GKKE 1Z0WA 1H73A 1N33I 2NUEA 4YY3I 4X64I 2F4VE 3LPSA 3VYYA 4WUCA 1XMOI 1HNZE 2R42A 1S16A 4JI7E 1X48A 2V34A 2B7VA 4PRVA 3T1YE 1H74A 5A2QQ 4JI0I 1EA6A 4PRXA 4DV1E 3PYEA 4USMA 3T1HI 2UU9I 1KIJA 1MG7A 1I94E 2ZBKB 1RR9A 1KVKA 4OX9E 4RPFA 4X66E 1XHKA 5L3JA 4LF9I 4LF4E 1MX0A 5IWAI 1HR0I 1H7UA 1NHJA 2E1RA 2UXCE 2UUAI 4DPUA 4B3SE 1IBMI 3C4BA 4DU8A 3F0NA 4DR1E 4JI3E 2DEJA 4Z7CA 4B3RI 2UXDI 4LF7E 4GKJE 3J81C 4JV5I 2V2QA 4JI8E 1GQEA 2BV3A 4DV0I 1UILA 1QU6A 1N0VC 1FKAE 1ZM3A 1UHZA 5FLXC 4DUZI 2AJ4A 4DUYI 4DPXA 3WU5A 4LFAE 2UXBI 3LTOA 1Z59A 5LMUE 1N32I 1N34I 4MYTA 2LTSA 2DIXA 4GKKI 4DXLA 4DR5E 4DR6E 3B82A 2F4VI 5A2QC 1HNZI 1FI4A 4JI7I 2UUBE 3T1YI 1B63A 4JI1E 1J5EE 2A2CA 1U2RA 1ZXMA 1DARA 4DV1I 1PIEA 1PVGA 3H4LA 4FN5A 1D6TA 1N36I 2LUPB 1NZ0A 4LF8E 1K47A 4OX9I 4HXZA 2YT4A 3J7AM 4DV4I 2MDRA 1FWKA 5LMNE 4HACA 1S4EA 1HNWE 4X66I 3HTXA 4DV2E 4JYAE 4LF4I 4DV5E 4X8WA 1N0UA 2EZ6A 1H7SA 1MU5A 3D4JA 1Z5CA 4ED4A 4DV6I 4B3SI 4DR7I 4NXME 2HHHE 3ZZ0A 4JI3I 4DV3E 4HY1A 2WW4A 4X65E 4LF7I 4GKJI 2UUCE 1ZXNA 4HYMA 4X62E 2L3JA 4JI8I 2B7TA 1Z0BA 4LFCE 1WHQA 4FWGA 4JI6E 3ADLA 2CZ9A 4B3MI 3B78A 1XMQE 1FJGE 3QT8A 2V2ZA 1T4NA 2NPFA 4UT4A 3WU4A 2LUQA 5LMUI 3QT7A 1RQ0A 4DKKA 2HKEA 4URLA 2N3HA 4DR5I 2LJHA 4WUDA 3OTOI 1YYWA 2HKJA 1Z0CA 3J80Q 1KKHA 4Z7YA 2KHXA 1DI2A 5BR8I 2UUBI 3HULA 4JI1I 1IBKE 1BKNA 3LNUA 2BM0A 4KHPI 2N3GA 1IBLE 4B3TI 2DMYA 3QT5A 4LF8I 3ZM7A
chains in the Genus database with same CATH superfamily
4YHHI 3K1JA 2EL6A 1OJ4A 1Z5BA 1A1IA 1B62A 2Q8UA 4DR2E 3ZKDA 5A69A 2JY9A 1WUUA 1RHYA 4MYUA 2L2MA 4ISAA 2C37A 3KZZA 1Y4SA 4BA1A 2IHR1 5DNXA 3THNA 2L92A 1Z5AA 2X36A 4DV2I 3BF2A 4JYAI 4K0KE 3U1YA 1Z0EA 4DV5I 2EM5A 2YRHA 3WU6A 1UDSA 4LU9A 2EM7A 3QT6A 2V8PA 2YSOA 2EOJA 2YU5A 2EMCA 3FIGA 4KQVA 3WU3A 4J8ZA 2LO3A 1X49A 2ENHA 2VRDA 4JI4E 4O43A 4JI5E 4BC9A 3P1XA 4DV7E 3ADIA 2BA0D 4I3HA 4BA1B 2EM6A 2HHHI 2L3CA 2UU9E 2O1UA 3ZZTA 1H72C 2EPNA 5CFFE 4AQYE 4N4RB 4MLQA 2CPNA 2YU8A 2F8BA 2NN6C 2EP3A 2EQ0A 1ZM2A 2O3ZA 1A6FA 5K36A 4P7AA 2EPRA 4ZYGA 2JEBA 2EPOA 2UUCI 2ELZA 1WHNA 4M2ZA 1ZM9A 5JEAF 3HXLA 4R8OA 3K17A 4R2QA 1WRJA 2MDGA 4P78A 2WCC3 2F1DA 4DR4E 1E3PA 2HFUA 2Q2EB 4LFCI 2RTXA 1ZAAC 3U1KA 1EI1A 4AIMA 5C0XA 2HGHA 4LF9E 3GONA 1I94I 2KONA 1JK1A 1PJTA 5K36B 1EH6A 1XMQI 2B9DA 2EN7A 4F6MA 1FJGI 2JEBB 3M85D 1YYKA 1HR0E 2EM4A 4ZVIA 3GMEA 2LE2A 3K85A 1UEKA 4UTGA 3P3GA 1KTVA 1A1KA 1XNQE 2EQ3A 4ZYDA 2UUAE 2CT1A 5C0XB 2EE8A 2V87A 3EPLA 3V2UC 2IESA 5GMEA 4AM3A 1YSAC 4DPTA 3LLHA 1QZRA 2JWOA 2FV4B 2LRSA 2HK2A 3UHMA 2M4IA 1YHCA 2O1WA 3J80C 2JT2A 4FWHA 2WBSA 4BMJA 2GLIA 4LF6E 2ENCA 3JAMQ 3ZKBA 2ELYA 3K6QA 1ZBTA 3VYXA 1YYOA 2UXDE 3M6AA 2EOIA 3Q1QA 1RC7A 4I8OA 4HACB 4JV5E 2UXCI 2CGEA 3VHTB 4NZVA 3J7Yp 1HNXE 4FW9A 5ELWA 2BB8A 1UN6B 5K36D 4DR1I 1STUA 4U3BA 1NHHA 1ELOA 4O5GA 2NUFA 4RHBB 2R1FA 4WPYA 2JXPA 2RS6A 1IBLI 1VISA 2DGCA 1G2DC 3IWDA 3BBGA 1T4LB 2NN6D 3B8HA 2YTOA 5AE2A 1J26A 4DPWA 1O0WA 2EN1A 3IWBA 4WX9A 1N32E 2VQEE 3GLLA 1FNMA 3ZZUA 5JEAA 2EOXA 5IT9Q 2ZITA 4DR2I 2LBSB 1MGTA 5LL6R 2MC5A 4DR3E 2GS8A 2DEIA 2EM0A 2RSMA 1ZU1A 3HKMA 2EWLA 2YPNA 3PYGA 4JI2E 4LFAI 3KZYA 3B4TA 2M9AA 4FW3A 4K0KI 2V2VA 2BA1D 2R3VA 3C4TA 2LV2A 1XNRE 2EMZA 4AIDA 1ZBQA 2VF3A 2WP8A 5KL5A 4F9AB 4JI4I 2NA2A 4JI5I 3EPJA 3J7AG 4DV7I 4DR6I 2C37B 2GQ0A 1GZ6A 3CWVA 2JOBA 1PKPA 2ZM6E 4AQYI 2ODRC 2MKNA 3L00A 1N36E 1MEYC 2YTQA 1BBOA 2HFSA 2EOQA 5DNLA 5EKWA 2PO0B 4LFBE 4NXNE 4DV4E 2WP8B 4IZJA 1TF6A 4OO1A 2VQFE 2M1SA 2EPCA 4GZNC 1UBDC 3P3EA 2L6MA 1YPNA 2EM2A 3PS1A 4USKA 1AAYA 1R6MA 2V86A 4PU9A 4DR4I 4IS1C 1PDAA 3C6MA 2EMFA 2NUGA 1X6HA 2B3TB 2R76A 3MHSC 3V5RA 2GHFA 4NBQA 2VESA 2OI2A 1X47A 4IZJB 2EOZA 2E5LE 1Y60A 1F2IG 2I9IA 1A1LA 5IXMB 2EMBA 2L33A 5KL3A 1NHIA 1XNQI 4LF5E 5LMNI 4DV6E 2NN6E 2HK3A 2E1MA 3JAMC 1HNWI 1N33E 1NCSA 2EN3A 3DJWA 4DR7E 2M7QA 4YY3E 4X64E 2EFGA 2NN6F 2K4VA 1Z0TA 3C6KA 2YTJA 4LF6I 1XMOE 5GMDA 2GO4A 4R1FA 3M7NG 1USVA 2A2DA 1NEIA 2RS7A 2PO2A 3HJCA 5K36C 1X6FA 2DB2A 1HNXI 4JI0E 2DSYA 2DMIA 3PYDA 1X5WA 5AASA 1KJKA 3THOB 4M0VA 3T1HE 1SR9A 2JP9A 2EPXA 4B3ME 2V85A 2L2KB 5C0XC 4IFDA 4MDTA 2YRMA 1Y5YA 4DV3I 2JYAA 2PO2B 2C38A 4MU3A 2ADRA 4JG4A 2HC5A 2ODRD 4X65I 5IT9C 1BB8A 4X62I 4HTGA 2LJUA 2VQEI 1VI7A 3JU0A 2EM9A 2X7IA 4WXCA 4M1KA 4IFDB 4JI6I 2LMZA 1E3HA 1EKZA 3PRYA 2EN4A 3P3CA 2V8QB 2C38B 4DR3I 3PS3A 3HPSA 2KOUA 5IWAE 1RREA 4F9CB 3OTOE 4GQUA 4WYQB 4M30A 2L2NA 4OOGC 3H1CA 4JI2I 4F9BB 4LTYA 4EMDA 4GEQB 4WFTA 1ZM4A 1P47A 1Z0VA 4O24A 5BR8E 2EPMX 1IBME 5DRRA 1XNRI 2EPZA 2JVAA 2LCEA 2EMLA 1T4OA 3MHHC 2JPAA 4WUBA 2PO1A 2EMHA 4XTJA 1YZ9A 4KHPE 2DRPA 2DLKA 3EQ1A 5A6BA 4WXDA 4B3RE 2ZM6I 4B3TE 4KWYA 2BM1A 2XEXA 4FW4A 1J5EI 1ZR9A 2EPUA 4P52A 4ZYHA 2YTNA 4DMIA 4YHHE 4QNJA 4NXNI 2Z5BA 4DPYA 2N8XA 3J81Q 4LFBI 4DV0E 2VQFI 2PO1B 2IERA 1LLMC 1IBKI 2D9HA 2EN2A 3EPHA 4LCGA 2YTGA 2EOFA 4DUZE 1Z0GA 4IS9A 3VK6A 5C0XD 2LTRA 3J7AM 4DUYE 2LJPA 4OKGA 5FLXQ 2PNMA 2JOXA 2UXBE 4DU7A 3F6HA 3ADJA 5A6JA 3PYFA 2Z5BB 2E5LI 3ADGA 2J7KA 4L5NC 1N34E 3BIDA 1FWLA 2CSHA 2FTXB 4FWDA 2EPLX 5TSEA 4LF5I 4GKKE 2V88A 1Z0WA 1H73A 4LPFA 3DD6A 1N33I 1T38A 2NUEA 4YY3I 4X64I 5KL6A 1RMDA 2EORA 2EOEA 2EN8A 5IV8B 2F4VE 3LPSA 5A6AA 3VYYA 4WUCA 1XMOI 1HNZE 5DRQA 2R42A 1S16A 1XXEA 4JI7E 1X48A 2YRKA 2V34A 2B7VA 2LT7A 5JEAB 4FW6A 4PRVA 3T1YE 2V83A 1QNTA 4ZYEA 1H74A 4QNKA 4TUIA 5A2QQ 2YTEA 4L8NA 3Q6MA 4JI0I 2IOQA 1N3GA 2EMKA 1EA6A 2RPCA 4RH8A 1TN9A 2VF1A 4R2DA 4DV1E 4FW7A 5AC4A 4PRXA 2WBUA 3PYEA 1KYQA 4USMA 3H09A 2EM3A 3T1HI 2UU9I 1KIJA 3RMPA 1MG7A 1I94E 2ZBKB 1YUIA 1RR9A 1KVKA 3ZOQB 4OX9E 2A25A 3LMLA 2WZOA 5DNYA 3QG5C 2GPIA 3GCMA 4FK5C 1WXRA 3M7ND 4RPFA 4X66E 3UK3C 1IMUA 1XHKA 5DRPA 5FWKA 2JR1A 5L3JA 1HK7A 4LF9I 5K36E 5JEAD 5EL9A 2EMXA 2ENAA 2YZTA 4LF4E 4MLVA 1MX0A 5K36F 5IWAI 1HR0I 1H7UA 4OO1B 1A1FA 1UDOA 1NHJA 2WBTA 2E1RA 2GO3A 2UXCE 5C0XE 2UUAI 1B69A 4DPUA 5KL7A 4IJDA 1WJPA 2EM8A 4B3SE 3MSWA 3C4BA 4BHBA 5ADZA 3F0NA 4LCFA 4DU8A 5C0XF 1IBMI 2EOMA 4DR1E 1OYRA 2MKDA 2E72A 4JI3E 3L7ZA 2L8TA 2EN6A 2DEJA 4IFDC 4Z7CA 4B3RI 2UXDI 3JTZA 4LF7E 3J81C 4GKJE 2YSPA 3KWRA 4JV5I 2V2QA 4X9JA 2EL5A 2AE8A 4BA2A 3P76A 4JI8E 1GQEA 1X3CA 2BV3A 2EMWA 3IWCA 2V89A 1Y6ZA 1UILA 3L7ZB 1G2FC 4DV0I 1QU6A 1N0VC 2BBGA 4IZJD 2PNZA 1FKAE 2I13A 4OO1D 1ZM3A 1EH8A 1UHZA 5FLXC 4WSPA 2EOHA 2K7IA 2MC6A 4DUZI 4BBYA 2AJ4A 2YWQA 2VE7C 4WSGA 4DUYI 4DPXA 4BA2B 3WU5A 4LFAE 2Z5EA 2UXBI 2EJ4A 3ECRA 1OYSA 3LTOA 1Z59A 4LCHA 2EPAA 5LMUE 1N32I 1N34I 1PJSA 4MYTA 2PNZB 2LTSA 4BC7A 2DIXA 2YTIA 4GKKI 4DXLA 4O4KA 2PRTA 4DR5E 3P06A 4DR6E 2IOPA 3B82A 4F6NA 2F4VI 5A2QC 1HNZI 4R2EA 1FI4A 4JI7I 3Q6NA 1JK2A 5JEAE 2FGGA 4MU1A 2UUBE 3T1YI 4Q28A 1B63A 5T6JA 1DQ3A 4JI1E 1J5EE 2A2CA 1U2RA 1PJQA 2WNRA 2NABA 3PS2A 4U3DA 4NHRA 2YTFA 1ZXMA 4BCAA 1DARA 4DV1I 2NN6A 1A1HA 1PIEA 2RSIA 5KL4A 1PVGA 2JE6A 3H4LA 3OMLA 4FN5A 1N36I 1D6TA 2LUPB 2J65A 1NZ0A 4IFDD 4LF8E 1BBGA 2EOOA 1R6LA 1K47A 4OX9I 4HXZA 2YT4A 2BA0G 5DROA 4DV4I 3TQMA 4BHCA 2WNRB 4MU0A 2EMGA 2MDRA 1FWKA 2PNLA 5LMNE 4HACA 1S4EA 2NN6B 1HNWE 5JEAC 4X66I 4HEIA 2CTDA 2JE6B 1UDNA 2BR2A 2EL4A 2CG9A 4R2SA 4FW5A 3AV0A 3HTXA 4DV2E 4JYAE 2CVEA 4LF4I 4TUGA 4OO1E 4BS9A 4DV5E 2J7JA 3HPZA 4X8WA 2EZ6A 2EMAA 1H7SA 1MU5A 1N0UA 3D4JA 1Z5CA 4OO1F 4IZKA 2EMYA 1P42A 4ED4A 4DV6I 4R2RA 4KZSA 2BR2B 1YFHA 3BGHA 4B3SI 4R2AA 3M85G 4DR7I 2YTPA 4NXME 2HHHE 2EOYA 5F3WA 3F6GA 3ZZ0A 4JI3I 4J3DA 1T39A 2EPPA 2JEAA 4DV3E 3HQ1A 4HY1A 4MQYA 2WW4A 1X6EA 4MU4A 4IZKB 4X65E 1IQOA 3AUZA 2O1TA 5A6BD 5A6KA 4LF7I 2UUCE 1EH7A 4GKJI 1ZXNA 2EMIA 4HYMA 4X62E 1A1JA 1IQSA 3M99B 2L3JA 4JI8I 2B7TA 1Z0BA 5KL2A 4OZEA 4LFCE 4OO1C 5AC5A 1WHQA 4FWGA 1DGCA 4JI6E 2H36X 3ADLA 2CZ9A 2JEAB 4B3MI 3B78A 4M9VC 1XMQE 2C39A 1FJGE 3NZKA 1Z1BA 2V2ZA 3QT8A 4R2CA 1T4NA 2NPFA 5AE3A 3KRNA 4UT4A 3WU4A 1GTKA 2LUQA 5LMUI 5AE1A 1Y4UA 4IFDE 3QT7A 2PO0A 1OYPA 1RQ0A 1TF3A 3EPKA 4DKKA 2C39B 2HKEA 2O1VA 4IFDF 4URLA 1L4SA 2N3HA 4NXMI 4DR5I 4F54A 2EQ1A 2LJHA 4WUDA 3DF6A 3OTOI 2Z5CA 3CDIA 1YYWA 2HKJA 2RQLA 1Z0CA 3J80Q 1UDQA 1KKHA 1USUA 4Z7YA 1A1GA 1AH5A 4R03A 2KHXA 1DI2A 5BR8I 2DLQA 3HULA 2UUBI 2EOSA 1YUJA 4JI1I 4N3OA 5LLQA 1SFEA 1IBKE 1BKNA 3LNUA 2Z5CB 2BM0A 4Q35B 4KHPI 2G7HA 2HJJA 2YTDA 2BA1G 4R2PA 3CDJA 2N3GA 4P7DA 1IBLE 4LOMA 1YH8A 4B3TI 2DMYA 4F2JC 3QT5A 2EPKX 4LF8I 3ZM7A 2LVHA
chains in the Genus database with same CATH topology
4YHHI 3K1JA 1OJ4A 1Z5BA 1B62A 4DR2E 3ZKDA 2JY9A 1WUUA 4MYUA 2L2MA 1Y4SA 2IHR1 2X36A 2L92A 1Z5AA 4DV2I 4JYAI 4K0KE 1Z0EA 4DV5I 3WU6A 4LU9A 3QT6A 2V8PA 3FIGA 4KQVA 3WU3A 4J8ZA 2PNMA 1X49A 4JI4E 3ZZUA 4JI5E 4I3HA 4BC9A 3P1XA 4DV7E 3ADIA 4NXMI 2HHHI 2L3CA 2UU9E 2O1UA 3ZZTA 1H72C 4AQYE 5CFFE 2CPNA 2F8BA 1ZM2A 1A6FA 4P7AA 2UUCI 1WHNA 4M2ZA 1ZM9A 3HXLA 4R8OA 3K17A 4P78A 2HFUA 4DR4E 4LFCI 2Q2EB 2RTXA 1EI1A 4LF9E 3GONA 1I94I 2KONA 1XMQI 2B9DA 1FJGI 1YYKA 1HR0E 4ZVIA 2LE2A 3K85A 1UEKA 4UTGA 1KTVA 1XNQE 2UUAE 2V87A 3V2UC 5GMEA 4DPTA 3LLHA 1QZRA 2JWOA 2FV4B 2LRSA 2HK2A 2M4IA 2O1WA 3J80C 4FWHA 4BMJA 4LF6E 3JAMQ 3ZKBA 3K6QA 1ZBTA 3VYXA 1YYOA 2UXDE 3M6AA 3Q1QA 1RC7A 4I8OA 4HACB 4JV5E 2UXCI 2CGEA 1HNXE 3J7Yp 4FW9A 4DR1I 1STUA 1NHHA 1ELOA 2NUFA 4WPYA 2RS6A 1IBLI 1VISA 3IWDA 1T4LB 3B8HA 5AE2A 1J26A 4DPWA 1O0WA 3IWBA 1N32E 2VQEE 1FNMA 5IT9Q 2ZITA 4DR2I 2LBSB 5LL6R 2MC5A 4DR3E 2GS8A 2DEIA 2RSMA 2EWLA 3PYGA 4JI2E 4LFAI 4K0KI 2V2VA 2R3VA 3C4TA 1XNRE 1ZBQA 2VF3A 4F9AB 4JI4I 2NA2A 4JI5I 3J7AG 4DV7I 4DR6I 2GQ0A 1GZ6A 3CWVA 2JOBA 1PKPA 2ZM6E 4AQYI 2ODRC 1N36E 2HFSA 4LFBE 4NXNE 4DV4E 4IZJA 2VQFE 2M1SA 1J5EI 4USKA 2L6MA 2V86A 4PU9A 4DR4I 2NUGA 2B3TB 3V5RA 2OI2A 1X47A 4IZJB 2E5LE 2L33A 1NHIA 1XNQI 4LF5E 5LMNI 4DV6E 2HK3A 2E1MA 3JAMC 1HNWI 1N33E 3DJWA 4DR7E 2M7QA 4YY3E 4X64E 2EFGA 2K4VA 1Z0TA 4LF6I 1XMOE 5GMDA 4R1FA 1USVA 2A2DA 2RS7A 3HJCA 2DB2A 1HNXI 4JI0E 2DSYA 3PYDA 5AASA 4M0VA 3T1HE 1SR9A 4B3ME 2V85A 2L2KB 4DV3I 4JG4A 4X65I 2ODRD 5IT9C 4X62I 2VQEI 4M1KA 3JU0A 2X7IA 4JI6I 2LMZA 3PRYA 1EKZA 2V8QB 4DR3I 3HPSA 2KOUA 5IWAE 1RREA 4F9CB 3OTOE 4WYQB 4M30A 2L2NA 4OOGC 4JI2I 4F9BB 4LTYA 4EMDA 4GEQB 4WFTA 1ZM4A 1Z0VA 5BR8E 1IBME 1XNRI 2JVAA 1T4OA 4WUBA 4XTJA 1YZ9A 4KHPE 4B3RE 2ZM6I 4B3TE 2BM1A 2XEXA 4P52A 4DMIA 4YHHE 4NXNI 4DPYA 4LFBI 2Z5BA 3J81Q 4DV0E 2VQFI 1IBKI 4DUZE 1Z0GA 3VK6A 2LTRA 4DUYE 2LJPA 5FLXQ 2JOXA 2UXBE 4DU7A 3F6HA 3ADJA 3PYFA 2Z5BB 2E5LI 3ADGA 2J7KA 4L5NC 1N34E 1FWLA 4FWDA 2FTXB 4LF5I 4GKKE 2V88A 1Z0WA 1H73A 1N33I 2NUEA 4YY3I 4X64I 2F4VE 3LPSA 3VYYA 4WUCA 1XMOI 1HNZE 2R42A 1S16A 4JI7E 1X48A 2V34A 2B7VA 4PRVA 3T1YE 2V83A 1H74A 4TUIA 5A2QQ 4L8NA 3Q6MA 4JI0I 2IOQA 1EA6A 2VF1A 4PRXA 4DV1E 3PYEA 4USMA 3T1HI 3H09A 2UU9I 1KIJA 3RMPA 1MG7A 1I94E 2ZBKB 1RR9A 1KVKA 3ZOQB 4OX9E 3LMLA 2WZOA 5DNYA 1WXRA 4RPFA 4X66E 1XHKA 5FWKA 2JR1A 5L3JA 1HK7A 4LF9I 2YZTA 4LF4E 1MX0A 5IWAI 1HR0I 1H7UA 1NHJA 2E1RA 2UXCE 2UUAI 4DPUA 4B3SE 3MSWA 3C4BA 5ADZA 4DU8A 3F0NA 1IBMI 4DR1E 4JI3E 2L8TA 2DEJA 4Z7CA 4B3RI 2UXDI 3JTZA 4LF7E 3J81C 4GKJE 3KWRA 4JV5I 2V2QA 4JI8E 1GQEA 2BV3A 3IWCA 2V89A 1Y6ZA 1UILA 4DV0I 1QU6A 1N0VC 4IZJD 1FKAE 1ZM3A 1UHZA 5FLXC 4WSPA 2MC6A 4DUZI 4BBYA 2AJ4A 2VE7C 4DUYI 4DPXA 3WU5A 4LFAE 2Z5EA 2UXBI 3LTOA 1Z59A 5LMUE 1N32I 1N34I 4MYTA 2LTSA 4BC7A 2DIXA 4GKKI 4DXLA 4DR5E 3P06A 4DR6E 2IOPA 3B82A 2F4VI 5A2QC 1HNZI 1FI4A 4JI7I 3Q6NA 2FGGA 2UUBE 3T1YI 4Q28A 1B63A 5T6JA 1DQ3A 4JI1E 1J5EE 2A2CA 1U2RA 1ZXMA 4BCAA 1DARA 4DV1I 1PIEA 1PVGA 3H4LA 3OMLA 4FN5A 1N36I 1D6TA 2LUPB 1NZ0A 4LF8E 1K47A 4OX9I 4HXZA 2YT4A 3J7AM 4DV4I 2MDRA 1FWKA 2PNLA 5LMNE 4HACA 1S4EA 1HNWE 4X66I 2CG9A 3AV0A 3HTXA 4DV2E 4JYAE 4LF4I 4TUGA 4BS9A 4DV5E 3HPZA 4X8WA 2EZ6A 1H7SA 1N0UA 1MU5A 3D4JA 1Z5CA 4IZKA 4ED4A 4DV6I 4KZSA 4B3SI 4DR7I 4NXME 2HHHE 5F3WA 3F6GA 3ZZ0A 4JI3I 4DV3E 3HQ1A 4HY1A 2WW4A 4IZKB 4X65E 3AUZA 2O1TA 4LF7I 4GKJI 2UUCE 1ZXNA 4HYMA 4X62E 2L3JA 4JI8I 2B7TA 1Z0BA 4LFCE 1WHQA 4FWGA 4JI6E 3ADLA 2H36X 2CZ9A 4B3MI 3B78A 1XMQE 1FJGE 3QT8A 2V2ZA 1T4NA 2NPFA 5AE3A 4UT4A 3WU4A 2LUQA 5LMUI 5AE1A 1Y4UA 3QT7A 1RQ0A 4DKKA 2HKEA 2O1VA 4URLA 2N3HA 4DR5I 4F54A 2LJHA 4WUDA 3DF6A 3OTOI 2Z5CA 1YYWA 2HKJA 1Z0CA 3J80Q 1KKHA 1USUA 4Z7YA 4R03A 2KHXA 1DI2A 5BR8I 2UUBI 3HULA 4JI1I 4N3OA 1IBKE 1BKNA 3LNUA 2Z5CB 2BM0A 4KHPI 2G7HA 2N3GA 4P7DA 1IBLE 4B3TI 2DMYA 3QT5A 4LF8I 3ZM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH I;  3K1J A;  1OJ4 A;  1Z5B A;  1B62 A;  4DR2 E;  3ZKD A;  2JY9 A;  1WUU A;  4MYU A;  2L2M A;  2IHR 1;  2X36 A;  1Z5A A;  4DV2 I;  4JYA I;  4K0K E;  1Z0E A;  4DV5 I;  3WU6 A;  3QT6 A;  2V8P A;  4KQV A;  3WU3 A;  3ZZU A;  1X49 A;  4JI4 E;  4JI5 E;  4I3H A;  3ADI A;  3P1X A;  4DV7 E;  4NXM I;  2HHH I;  2L3C A;  2UU9 E;  3ZZT A;  1H72 C;  4AQY E;  5CFF E;  2CPN A;  1ZM2 A;  1A6F A;  4P7A A;  2UUC I;  1WHN A;  4M2Z A;  1ZM9 A;  3K17 A;  2HFU A;  4DR4 E;  4LFC I;  2Q2E B;  2RTX A;  1EI1 A;  4LF9 E;  3GON A;  1I94 I;  1XMQ I;  1FJG I;  1YYK A;  1HR0 E;  4ZVI A;  1UEK A;  4UTG A;  1KTV A;  1XNQ E;  2UUA E;  3V2U C;  5GME A;  4DPT A;  3LLH A;  1QZR A;  2LRS A;  2HK2 A;  3J80 C;  4FWH A;  4LF6 E;  3JAM Q;  3ZKB A;  3VYX A;  1ZBT A;  2UXD E;  1YYO A;  3M6A A;  3Q1Q A;  1RC7 A;  4HAC B;  4JV5 E;  2UXC I;  1HNX E;  3J7Y p;  4FW9 A;  4DR1 I;  1STU A;  1NHH A;  1ELO A;  2NUF A;  2RS6 A;  1IBL I;  1VIS A;  1T4L B;  3B8H A;  1J26 A;  4DPW A;  1O0W A;  1N32 E;  2VQE E;  1FNM A;  5IT9 Q;  2ZIT A;  4DR2 I;  2LBS B;  5LL6 R;  4DR3 E;  2GS8 A;  2DEI A;  2RSM A;  3PYG A;  4JI2 E;  4LFA I;  4K0K I;  2V2V A;  2R3V A;  3C4T A;  1XNR E;  2VF3 A;  4JI4 I;  2NA2 A;  4JI5 I;  3J7A G;  4DV7 I;  4DR6 I;  3CWV A;  2ZM6 E;  1PKP A;  4AQY I;  1N36 E;  2HFS A;  4LFB E;  4NXN E;  4DV4 E;  2VQF E;  1J5E I;  4USK A;  4PU9 A;  4DR4 I;  2NUG A;  2B3T B;  3V5R A;  2OI2 A;  1X47 A;  2E5L E;  2L33 A;  1NHI A;  1XNQ I;  4LF5 E;  5LMN I;  4DV6 E;  2HK3 A;  3JAM C;  1HNW I;  1N33 E;  4DR7 E;  4X64 E;  4YY3 E;  2EFG A;  1Z0T A;  4LF6 I;  1XMO E;  5GMD A;  4R1F A;  2A2D A;  2RS7 A;  2DB2 A;  1HNX I;  4JI0 E;  3PYD A;  3T1H E;  4B3M E;  2L2K B;  4DV3 I;  4JG4 A;  4X65 I;  5IT9 C;  4X62 I;  2VQE I;  4M1K A;  2X7I A;  4JI6 I;  1EKZ A;  4DR3 I;  1RRE A;  5IWA E;  3OTO E;  4WYQ B;  4M30 A;  4OOG C;  2L2N A;  4JI2 I;  4EMD A;  4WFT A;  1ZM4 A;  1Z0V A;  5BR8 E;  1IBM E;  1XNR I;  2JVA A;  1T4O A;  4WUB A;  4XTJ A;  1YZ9 A;  4KHP E;  4B3R E;  2ZM6 I;  4B3T E;  2BM1 A;  2XEX A;  4P52 A;  4YHH E;  4NXN I;  4DPY A;  4LFB I;  3J81 Q;  4DV0 E;  2VQF I;  1IBK I;  4DUZ E;  1Z0G A;  2LTR A;  4DUY E;  2LJP A;  5FLX Q;  2UXB E;  4DU7 A;  3ADJ A;  3PYF A;  2E5L I;  3ADG A;  2J7K A;  1N34 E;  1FWL A;  4FWD A;  4LF5 I;  4GKK E;  1Z0W A;  1H73 A;  1N33 I;  2NUE A;  4YY3 I;  4X64 I;  2F4V E;  3LPS A;  3VYY A;  4WUC A;  1XMO I;  1HNZ E;  2R42 A;  1S16 A;  4JI7 E;  1X48 A;  2V34 A;  2B7V A;  4PRV A;  3T1Y E;  1H74 A;  5A2Q Q;  4JI0 I;  1EA6 A;  4PRX A;  4DV1 E;  3PYE A;  4USM A;  3T1H I;  2UU9 I;  1KIJ A;  1MG7 A;  1I94 E;  2ZBK B;  1RR9 A;  1KVK A;  4OX9 E;  4RPF A;  4X66 E;  1XHK A;  5L3J A;  4LF9 I;  4LF4 E;  1MX0 A;  5IWA I;  1HR0 I;  1H7U A;  1NHJ A;  2E1R A;  2UXC E;  2UUA I;  4DPU A;  4B3S E;  1IBM I;  3C4B A;  4DU8 A;  3F0N A;  4DR1 E;  4JI3 E;  2DEJ A;  4Z7C A;  4B3R I;  2UXD I;  4LF7 E;  4GKJ E;  3J81 C;  4JV5 I;  2V2Q A;  4JI8 E;  1GQE A;  2BV3 A;  4DV0 I;  1UIL A;  1QU6 A;  1N0V C;  1FKA E;  1ZM3 A;  1UHZ A;  5FLX C;  4DUZ I;  2AJ4 A;  4DUY I;  4DPX A;  3WU5 A;  4LFA E;  2UXB I;  3LTO A;  1Z59 A;  5LMU E;  1N32 I;  1N34 I;  4MYT A;  2LTS A;  2DIX A;  4GKK I;  4DXL A;  4DR5 E;  4DR6 E;  3B82 A;  2F4V I;  5A2Q C;  1HNZ I;  1FI4 A;  4JI7 I;  2UUB E;  3T1Y I;  1B63 A;  4JI1 E;  1J5E E;  2A2C A;  1U2R A;  1ZXM A;  1DAR A;  4DV1 I;  1PIE A;  1PVG A;  3H4L A;  4FN5 A;  1D6T A;  1N36 I;  2LUP B;  1NZ0 A;  4LF8 E;  1K47 A;  4OX9 I;  4HXZ A;  2YT4 A;  3J7A M;  4DV4 I;  2MDR A;  1FWK A;  5LMN E;  4HAC A;  1S4E A;  1HNW E;  4X66 I;  3HTX A;  4DV2 E;  4JYA E;  4LF4 I;  4DV5 E;  4X8W A;  1N0U A;  2EZ6 A;  1H7S A;  1MU5 A;  3D4J A;  1Z5C A;  4ED4 A;  4DV6 I;  4B3S I;  4DR7 I;  4NXM E;  2HHH E;  3ZZ0 A;  4JI3 I;  4DV3 E;  4HY1 A;  2WW4 A;  4X65 E;  4LF7 I;  4GKJ I;  2UUC E;  1ZXN A;  4HYM A;  4X62 E;  2L3J A;  4JI8 I;  2B7T A;  1Z0B A;  4LFC E;  1WHQ A;  4FWG A;  4JI6 E;  3ADL A;  2CZ9 A;  4B3M I;  3B78 A;  1XMQ E;  1FJG E;  3QT8 A;  2V2Z A;  1T4N A;  2NPF A;  4UT4 A;  3WU4 A;  2LUQ A;  5LMU I;  3QT7 A;  1RQ0 A;  4DKK A;  2HKE A;  4URL A;  2N3H A;  4DR5 I;  2LJH A;  4WUD A;  3OTO I;  1YYW A;  2HKJ A;  1Z0C A;  3J80 Q;  1KKH A;  4Z7Y A;  2KHX A;  1DI2 A;  5BR8 I;  2UUB I;  3HUL A;  4JI1 I;  1IBK E;  1BKN A;  3LNU A;  2BM0 A;  4KHP I;  2N3G A;  1IBL E;  4B3T I;  2DMY A;  3QT5 A;  4LF8 I;  3ZM7 A; 
#chains in the Genus database with same CATH topology
 4YHH I;  3K1J A;  2EL6 A;  1OJ4 A;  1Z5B A;  1A1I A;  1B62 A;  2Q8U A;  4DR2 E;  3ZKD A;  5A69 A;  2JY9 A;  1WUU A;  1RHY A;  4MYU A;  2L2M A;  4ISA A;  2C37 A;  3KZZ A;  1Y4S A;  4BA1 A;  2IHR 1;  5DNX A;  3THN A;  2L92 A;  1Z5A A;  2X36 A;  4DV2 I;  3BF2 A;  4JYA I;  4K0K E;  3U1Y A;  1Z0E A;  4DV5 I;  2EM5 A;  2YRH A;  3WU6 A;  1UDS A;  4LU9 A;  2EM7 A;  3QT6 A;  2V8P A;  2YSO A;  2EOJ A;  2YU5 A;  2EMC A;  3FIG A;  4KQV A;  3WU3 A;  4J8Z A;  2LO3 A;  1X49 A;  2ENH A;  2VRD A;  4JI4 E;  4O43 A;  4JI5 E;  4BC9 A;  3P1X A;  4DV7 E;  3ADI A;  2BA0 D;  4I3H A;  4BA1 B;  2EM6 A;  2HHH I;  2L3C A;  2UU9 E;  2O1U A;  3ZZT A;  1H72 C;  2EPN A;  5CFF E;  4AQY E;  4N4R B;  4MLQ A;  2CPN A;  2YU8 A;  2F8B A;  2NN6 C;  2EP3 A;  2EQ0 A;  1ZM2 A;  2O3Z A;  1A6F A;  5K36 A;  4P7A A;  2EPR A;  4ZYG A;  2JEB A;  2EPO A;  2UUC I;  2ELZ A;  1WHN A;  4M2Z A;  1ZM9 A;  5JEA F;  3HXL A;  4R8O A;  3K17 A;  4R2Q A;  1WRJ A;  2MDG A;  4P78 A;  2WCC 3;  2F1D A;  4DR4 E;  1E3P A;  2HFU A;  2Q2E B;  4LFC I;  2RTX A;  1ZAA C;  3U1K A;  1EI1 A;  4AIM A;  5C0X A;  2HGH A;  4LF9 E;  3GON A;  1I94 I;  2KON A;  1JK1 A;  1PJT A;  5K36 B;  1EH6 A;  1XMQ I;  2B9D A;  2EN7 A;  4F6M A;  1FJG I;  2JEB B;  3M85 D;  1YYK A;  1HR0 E;  2EM4 A;  4ZVI A;  3GME A;  2LE2 A;  3K85 A;  1UEK A;  4UTG A;  3P3G A;  1KTV A;  1A1K A;  1XNQ E;  2EQ3 A;  4ZYD A;  2UUA E;  2CT1 A;  5C0X B;  2EE8 A;  2V87 A;  3EPL A;  3V2U C;  2IES A;  5GME A;  4AM3 A;  1YSA C;  4DPT A;  3LLH A;  1QZR A;  2JWO A;  2FV4 B;  2LRS A;  2HK2 A;  3UHM A;  2M4I A;  1YHC A;  2O1W A;  3J80 C;  2JT2 A;  4FWH A;  2WBS A;  4BMJ A;  2GLI A;  4LF6 E;  2ENC A;  3JAM Q;  3ZKB A;  2ELY A;  3K6Q A;  1ZBT A;  3VYX A;  1YYO A;  2UXD E;  3M6A A;  2EOI A;  3Q1Q A;  1RC7 A;  4I8O A;  4HAC B;  4JV5 E;  2UXC I;  2CGE A;  3VHT B;  4NZV A;  3J7Y p;  1HNX E;  4FW9 A;  5ELW A;  2BB8 A;  1UN6 B;  5K36 D;  4DR1 I;  1STU A;  4U3B A;  1NHH A;  1ELO A;  4O5G A;  2NUF A;  4RHB B;  2R1F A;  4WPY A;  2JXP A;  2RS6 A;  1IBL I;  1VIS A;  2DGC A;  1G2D C;  3IWD A;  3BBG A;  1T4L B;  2NN6 D;  3B8H A;  2YTO A;  5AE2 A;  1J26 A;  4DPW A;  1O0W A;  2EN1 A;  3IWB A;  4WX9 A;  1N32 E;  2VQE E;  3GLL A;  1FNM A;  3ZZU A;  5JEA A;  2EOX A;  5IT9 Q;  2ZIT A;  4DR2 I;  2LBS B;  1MGT A;  5LL6 R;  2MC5 A;  4DR3 E;  2GS8 A;  2DEI A;  2EM0 A;  2RSM A;  1ZU1 A;  3HKM A;  2EWL A;  2YPN A;  3PYG A;  4JI2 E;  4LFA I;  3KZY A;  3B4T A;  2M9A A;  4FW3 A;  4K0K I;  2V2V A;  2BA1 D;  2R3V A;  3C4T A;  2LV2 A;  1XNR E;  2EMZ A;  4AID A;  1ZBQ A;  2VF3 A;  2WP8 A;  5KL5 A;  4F9A B;  4JI4 I;  2NA2 A;  4JI5 I;  3EPJ A;  3J7A G;  4DV7 I;  4DR6 I;  2C37 B;  2GQ0 A;  1GZ6 A;  3CWV A;  2JOB A;  1PKP A;  2ZM6 E;  4AQY I;  2ODR C;  2MKN A;  3L00 A;  1N36 E;  1MEY C;  2YTQ A;  1BBO A;  2HFS A;  2EOQ A;  5DNL A;  5EKW A;  2PO0 B;  4LFB E;  4NXN E;  4DV4 E;  2WP8 B;  4IZJ A;  1TF6 A;  4OO1 A;  2VQF E;  2M1S A;  2EPC A;  4GZN C;  1UBD C;  3P3E A;  2L6M A;  1YPN A;  2EM2 A;  3PS1 A;  4USK A;  1AAY A;  1R6M A;  2V86 A;  4PU9 A;  4DR4 I;  4IS1 C;  1PDA A;  3C6M A;  2EMF A;  2NUG A;  1X6H A;  2B3T B;  2R76 A;  3MHS C;  3V5R A;  2GHF A;  4NBQ A;  2VES A;  2OI2 A;  1X47 A;  4IZJ B;  2EOZ A;  2E5L E;  1Y60 A;  1F2I G;  2I9I A;  1A1L A;  5IXM B;  2EMB A;  2L33 A;  5KL3 A;  1NHI A;  1XNQ I;  4LF5 E;  5LMN I;  4DV6 E;  2NN6 E;  2HK3 A;  2E1M A;  3JAM C;  1HNW I;  1N33 E;  1NCS A;  2EN3 A;  3DJW A;  4DR7 E;  2M7Q A;  4YY3 E;  4X64 E;  2EFG A;  2NN6 F;  2K4V A;  1Z0T A;  3C6K A;  2YTJ A;  4LF6 I;  1XMO E;  5GMD A;  2GO4 A;  4R1F A;  3M7N G;  1USV A;  2A2D A;  1NEI A;  2RS7 A;  2PO2 A;  3HJC A;  5K36 C;  1X6F A;  2DB2 A;  1HNX I;  4JI0 E;  2DSY A;  2DMI A;  3PYD A;  1X5W A;  5AAS A;  1KJK A;  3THO B;  4M0V A;  3T1H E;  1SR9 A;  2JP9 A;  2EPX A;  4B3M E;  2V85 A;  2L2K B;  5C0X C;  4IFD A;  4MDT A;  2YRM A;  1Y5Y A;  4DV3 I;  2JYA A;  2PO2 B;  2C38 A;  4MU3 A;  2ADR A;  4JG4 A;  2HC5 A;  2ODR D;  4X65 I;  5IT9 C;  1BB8 A;  4X62 I;  4HTG A;  2LJU A;  2VQE I;  1VI7 A;  3JU0 A;  2EM9 A;  2X7I A;  4WXC A;  4M1K A;  4IFD B;  4JI6 I;  2LMZ A;  1E3H A;  1EKZ A;  3PRY A;  2EN4 A;  3P3C A;  2V8Q B;  2C38 B;  4DR3 I;  3PS3 A;  3HPS A;  2KOU A;  5IWA E;  1RRE A;  4F9C B;  3OTO E;  4GQU A;  4WYQ B;  4M30 A;  2L2N A;  4OOG C;  3H1C A;  4JI2 I;  4F9B B;  4LTY A;  4EMD A;  4GEQ B;  4WFT A;  1ZM4 A;  1P47 A;  1Z0V A;  4O24 A;  5BR8 E;  2EPM X;  1IBM E;  5DRR A;  1XNR I;  2EPZ A;  2JVA A;  2LCE A;  2EML A;  1T4O A;  3MHH C;  2JPA A;  4WUB A;  2PO1 A;  2EMH A;  4XTJ A;  1YZ9 A;  4KHP E;  2DRP A;  2DLK A;  3EQ1 A;  5A6B A;  4WXD A;  4B3R E;  2ZM6 I;  4B3T E;  4KWY A;  2BM1 A;  2XEX A;  4FW4 A;  1J5E I;  1ZR9 A;  2EPU A;  4P52 A;  4ZYH A;  2YTN A;  4DMI A;  4YHH E;  4QNJ A;  4NXN I;  2Z5B A;  4DPY A;  2N8X A;  3J81 Q;  4LFB I;  4DV0 E;  2VQF I;  2PO1 B;  2IER A;  1LLM C;  1IBK I;  2D9H A;  2EN2 A;  3EPH A;  4LCG A;  2YTG A;  2EOF A;  4DUZ E;  1Z0G A;  4IS9 A;  3VK6 A;  5C0X D;  2LTR A;  3J7A M;  4DUY E;  2LJP A;  4OKG A;  5FLX Q;  2PNM A;  2JOX A;  2UXB E;  4DU7 A;  3F6H A;  3ADJ A;  5A6J A;  3PYF A;  2Z5B B;  2E5L I;  3ADG A;  2J7K A;  4L5N C;  1N34 E;  3BID A;  1FWL A;  2CSH A;  2FTX B;  4FWD A;  2EPL X;  5TSE A;  4LF5 I;  4GKK E;  2V88 A;  1Z0W A;  1H73 A;  4LPF A;  3DD6 A;  1N33 I;  1T38 A;  2NUE A;  4YY3 I;  4X64 I;  5KL6 A;  1RMD A;  2EOR A;  2EOE A;  2EN8 A;  5IV8 B;  2F4V E;  3LPS A;  5A6A A;  3VYY A;  4WUC A;  1XMO I;  1HNZ E;  5DRQ A;  2R42 A;  1S16 A;  1XXE A;  4JI7 E;  1X48 A;  2YRK A;  2V34 A;  2B7V A;  2LT7 A;  5JEA B;  4FW6 A;  4PRV A;  3T1Y E;  2V83 A;  1QNT A;  4ZYE A;  1H74 A;  4QNK A;  4TUI A;  5A2Q Q;  2YTE A;  4L8N A;  3Q6M A;  4JI0 I;  2IOQ A;  1N3G A;  2EMK A;  1EA6 A;  2RPC A;  4RH8 A;  1TN9 A;  2VF1 A;  4R2D A;  4DV1 E;  4FW7 A;  5AC4 A;  4PRX A;  2WBU A;  3PYE A;  1KYQ A;  4USM A;  3H09 A;  2EM3 A;  3T1H I;  2UU9 I;  1KIJ A;  3RMP A;  1MG7 A;  1I94 E;  2ZBK B;  1YUI A;  1RR9 A;  1KVK A;  3ZOQ B;  4OX9 E;  2A25 A;  3LML A;  2WZO A;  5DNY A;  3QG5 C;  2GPI A;  3GCM A;  4FK5 C;  1WXR A;  3M7N D;  4RPF A;  4X66 E;  3UK3 C;  1IMU A;  1XHK A;  5DRP A;  5FWK A;  2JR1 A;  5L3J A;  1HK7 A;  4LF9 I;  5K36 E;  5JEA D;  5EL9 A;  2EMX A;  2ENA A;  2YZT A;  4LF4 E;  4MLV A;  1MX0 A;  5K36 F;  5IWA I;  1HR0 I;  1H7U A;  4OO1 B;  1A1F A;  1UDO A;  1NHJ A;  2WBT A;  2E1R A;  2GO3 A;  2UXC E;  5C0X E;  2UUA I;  1B69 A;  4DPU A;  5KL7 A;  4IJD A;  1WJP A;  2EM8 A;  4B3S E;  3MSW A;  3C4B A;  4BHB A;  5ADZ A;  3F0N A;  4LCF A;  4DU8 A;  5C0X F;  1IBM I;  2EOM A;  4DR1 E;  1OYR A;  2MKD A;  2E72 A;  4JI3 E;  3L7Z A;  2L8T A;  2EN6 A;  2DEJ A;  4IFD C;  4Z7C A;  4B3R I;  2UXD I;  3JTZ A;  4LF7 E;  3J81 C;  4GKJ E;  2YSP A;  3KWR A;  4JV5 I;  2V2Q A;  4X9J A;  2EL5 A;  2AE8 A;  4BA2 A;  3P76 A;  4JI8 E;  1GQE A;  1X3C A;  2BV3 A;  2EMW A;  3IWC A;  2V89 A;  1Y6Z A;  1UIL A;  3L7Z B;  1G2F C;  4DV0 I;  1QU6 A;  1N0V C;  2BBG A;  4IZJ D;  2PNZ A;  1FKA E;  2I13 A;  4OO1 D;  1ZM3 A;  1EH8 A;  1UHZ A;  5FLX C;  4WSP A;  2EOH A;  2K7I A;  2MC6 A;  4DUZ I;  4BBY A;  2AJ4 A;  2YWQ A;  2VE7 C;  4WSG A;  4DUY I;  4DPX A;  4BA2 B;  3WU5 A;  4LFA E;  2Z5E A;  2UXB I;  2EJ4 A;  3ECR A;  1OYS A;  3LTO A;  1Z59 A;  4LCH A;  2EPA A;  5LMU E;  1N32 I;  1N34 I;  1PJS A;  4MYT A;  2PNZ B;  2LTS A;  4BC7 A;  2DIX A;  2YTI A;  4GKK I;  4DXL A;  4O4K A;  2PRT A;  4DR5 E;  3P06 A;  4DR6 E;  2IOP A;  3B82 A;  4F6N A;  2F4V I;  5A2Q C;  1HNZ I;  4R2E A;  1FI4 A;  4JI7 I;  3Q6N A;  1JK2 A;  5JEA E;  2FGG A;  4MU1 A;  2UUB E;  3T1Y I;  4Q28 A;  1B63 A;  5T6J A;  1DQ3 A;  4JI1 E;  1J5E E;  2A2C A;  1U2R A;  1PJQ A;  2WNR A;  2NAB A;  3PS2 A;  4U3D A;  4NHR A;  2YTF A;  1ZXM A;  4BCA A;  1DAR A;  4DV1 I;  2NN6 A;  1A1H A;  1PIE A;  2RSI A;  5KL4 A;  1PVG A;  2JE6 A;  3H4L A;  3OML A;  4FN5 A;  1N36 I;  1D6T A;  2LUP B;  2J65 A;  1NZ0 A;  4IFD D;  4LF8 E;  1BBG A;  2EOO A;  1R6L A;  1K47 A;  4OX9 I;  4HXZ A;  2YT4 A;  2BA0 G;  5DRO A;  4DV4 I;  3TQM A;  4BHC A;  2WNR B;  4MU0 A;  2EMG A;  2MDR A;  1FWK A;  2PNL A;  5LMN E;  4HAC A;  1S4E A;  2NN6 B;  1HNW E;  5JEA C;  4X66 I;  4HEI A;  2CTD A;  2JE6 B;  1UDN A;  2BR2 A;  2EL4 A;  2CG9 A;  4R2S A;  4FW5 A;  3AV0 A;  3HTX A;  4DV2 E;  4JYA E;  2CVE A;  4LF4 I;  4TUG A;  4OO1 E;  4BS9 A;  4DV5 E;  2J7J A;  3HPZ A;  4X8W A;  2EZ6 A;  2EMA A;  1H7S A;  1MU5 A;  1N0U A;  3D4J A;  1Z5C A;  4OO1 F;  4IZK A;  2EMY A;  1P42 A;  4ED4 A;  4DV6 I;  4R2R A;  4KZS A;  2BR2 B;  1YFH A;  3BGH A;  4B3S I;  4R2A A;  3M85 G;  4DR7 I;  2YTP A;  4NXM E;  2HHH E;  2EOY A;  5F3W A;  3F6G A;  3ZZ0 A;  4JI3 I;  4J3D A;  1T39 A;  2EPP A;  2JEA A;  4DV3 E;  3HQ1 A;  4HY1 A;  4MQY A;  2WW4 A;  1X6E A;  4MU4 A;  4IZK B;  4X65 E;  1IQO A;  3AUZ A;  2O1T A;  5A6B D;  5A6K A;  4LF7 I;  2UUC E;  1EH7 A;  4GKJ I;  1ZXN A;  2EMI A;  4HYM A;  4X62 E;  1A1J A;  1IQS A;  3M99 B;  2L3J A;  4JI8 I;  2B7T A;  1Z0B A;  5KL2 A;  4OZE A;  4LFC E;  4OO1 C;  5AC5 A;  1WHQ A;  4FWG A;  1DGC A;  4JI6 E;  2H36 X;  3ADL A;  2CZ9 A;  2JEA B;  4B3M I;  3B78 A;  4M9V C;  1XMQ E;  2C39 A;  1FJG E;  3NZK A;  1Z1B A;  2V2Z A;  3QT8 A;  4R2C A;  1T4N A;  2NPF A;  5AE3 A;  3KRN A;  4UT4 A;  3WU4 A;  1GTK A;  2LUQ A;  5LMU I;  5AE1 A;  1Y4U A;  4IFD E;  3QT7 A;  2PO0 A;  1OYP A;  1RQ0 A;  1TF3 A;  3EPK A;  4DKK A;  2C39 B;  2HKE A;  2O1V A;  4IFD F;  4URL A;  1L4S A;  2N3H A;  4NXM I;  4DR5 I;  4F54 A;  2EQ1 A;  2LJH A;  4WUD A;  3DF6 A;  3OTO I;  2Z5C A;  3CDI A;  1YYW A;  2HKJ A;  2RQL A;  1Z0C A;  3J80 Q;  1UDQ A;  1KKH A;  1USU A;  4Z7Y A;  1A1G A;  1AH5 A;  4R03 A;  2KHX A;  1DI2 A;  5BR8 I;  2DLQ A;  3HUL A;  2UUB I;  2EOS A;  1YUJ A;  4JI1 I;  4N3O A;  5LLQ A;  1SFE A;  1IBK E;  1BKN A;  3LNU A;  2Z5C B;  2BM0 A;  4Q35 B;  4KHP I;  2G7H A;  2HJJ A;  2YTD A;  2BA1 G;  4R2P A;  3CDJ A;  2N3G A;  4P7D A;  1IBL E;  4LOM A;  1YH8 A;  4B3T I;  2DMY A;  4F2J C;  3QT5 A;  2EPK X;  4LF8 I;  3ZM7 A;  2LVH A; 
#chains in the Genus database with same CATH homology
 4YHH I;  3K1J A;  1OJ4 A;  1Z5B A;  1B62 A;  4DR2 E;  3ZKD A;  2JY9 A;  1WUU A;  4MYU A;  2L2M A;  1Y4S A;  2IHR 1;  2X36 A;  2L92 A;  1Z5A A;  4DV2 I;  4JYA I;  4K0K E;  1Z0E A;  4DV5 I;  3WU6 A;  4LU9 A;  3QT6 A;  2V8P A;  3FIG A;  4KQV A;  3WU3 A;  4J8Z A;  2PNM A;  1X49 A;  4JI4 E;  3ZZU A;  4JI5 E;  4I3H A;  4BC9 A;  3P1X A;  4DV7 E;  3ADI A;  4NXM I;  2HHH I;  2L3C A;  2UU9 E;  2O1U A;  3ZZT A;  1H72 C;  4AQY E;  5CFF E;  2CPN A;  2F8B A;  1ZM2 A;  1A6F A;  4P7A A;  2UUC I;  1WHN A;  4M2Z A;  1ZM9 A;  3HXL A;  4R8O A;  3K17 A;  4P78 A;  2HFU A;  4DR4 E;  4LFC I;  2Q2E B;  2RTX A;  1EI1 A;  4LF9 E;  3GON A;  1I94 I;  2KON A;  1XMQ I;  2B9D A;  1FJG I;  1YYK A;  1HR0 E;  4ZVI A;  2LE2 A;  3K85 A;  1UEK A;  4UTG A;  1KTV A;  1XNQ E;  2UUA E;  2V87 A;  3V2U C;  5GME A;  4DPT A;  3LLH A;  1QZR A;  2JWO A;  2FV4 B;  2LRS A;  2HK2 A;  2M4I A;  2O1W A;  3J80 C;  4FWH A;  4BMJ A;  4LF6 E;  3JAM Q;  3ZKB A;  3K6Q A;  1ZBT A;  3VYX A;  1YYO A;  2UXD E;  3M6A A;  3Q1Q A;  1RC7 A;  4I8O A;  4HAC B;  4JV5 E;  2UXC I;  2CGE A;  1HNX E;  3J7Y p;  4FW9 A;  4DR1 I;  1STU A;  1NHH A;  1ELO A;  2NUF A;  4WPY A;  2RS6 A;  1IBL I;  1VIS A;  3IWD A;  1T4L B;  3B8H A;  5AE2 A;  1J26 A;  4DPW A;  1O0W A;  3IWB A;  1N32 E;  2VQE E;  1FNM A;  5IT9 Q;  2ZIT A;  4DR2 I;  2LBS B;  5LL6 R;  2MC5 A;  4DR3 E;  2GS8 A;  2DEI A;  2RSM A;  2EWL A;  3PYG A;  4JI2 E;  4LFA I;  4K0K I;  2V2V A;  2R3V A;  3C4T A;  1XNR E;  1ZBQ A;  2VF3 A;  4F9A B;  4JI4 I;  2NA2 A;  4JI5 I;  3J7A G;  4DV7 I;  4DR6 I;  2GQ0 A;  1GZ6 A;  3CWV A;  2JOB A;  1PKP A;  2ZM6 E;  4AQY I;  2ODR C;  1N36 E;  2HFS A;  4LFB E;  4NXN E;  4DV4 E;  4IZJ A;  2VQF E;  2M1S A;  1J5E I;  4USK A;  2L6M A;  2V86 A;  4PU9 A;  4DR4 I;  2NUG A;  2B3T B;  3V5R A;  2OI2 A;  1X47 A;  4IZJ B;  2E5L E;  2L33 A;  1NHI A;  1XNQ I;  4LF5 E;  5LMN I;  4DV6 E;  2HK3 A;  2E1M A;  3JAM C;  1HNW I;  1N33 E;  3DJW A;  4DR7 E;  2M7Q A;  4YY3 E;  4X64 E;  2EFG A;  2K4V A;  1Z0T A;  4LF6 I;  1XMO E;  5GMD A;  4R1F A;  1USV A;  2A2D A;  2RS7 A;  3HJC A;  2DB2 A;  1HNX I;  4JI0 E;  2DSY A;  3PYD A;  5AAS A;  4M0V A;  3T1H E;  1SR9 A;  4B3M E;  2V85 A;  2L2K B;  4DV3 I;  4JG4 A;  4X65 I;  2ODR D;  5IT9 C;  4X62 I;  2VQE I;  4M1K A;  3JU0 A;  2X7I A;  4JI6 I;  2LMZ A;  3PRY A;  1EKZ A;  2V8Q B;  4DR3 I;  3HPS A;  2KOU A;  5IWA E;  1RRE A;  4F9C B;  3OTO E;  4WYQ B;  4M30 A;  2L2N A;  4OOG C;  4JI2 I;  4F9B B;  4LTY A;  4EMD A;  4GEQ B;  4WFT A;  1ZM4 A;  1Z0V A;  5BR8 E;  1IBM E;  1XNR I;  2JVA A;  1T4O A;  4WUB A;  4XTJ A;  1YZ9 A;  4KHP E;  4B3R E;  2ZM6 I;  4B3T E;  2BM1 A;  2XEX A;  4P52 A;  4DMI A;  4YHH E;  4NXN I;  4DPY A;  4LFB I;  2Z5B A;  3J81 Q;  4DV0 E;  2VQF I;  1IBK I;  4DUZ E;  1Z0G A;  3VK6 A;  2LTR A;  4DUY E;  2LJP A;  5FLX Q;  2JOX A;  2UXB E;  4DU7 A;  3F6H A;  3ADJ A;  3PYF A;  2Z5B B;  2E5L I;  3ADG A;  2J7K A;  4L5N C;  1N34 E;  1FWL A;  4FWD A;  2FTX B;  4LF5 I;  4GKK E;  2V88 A;  1Z0W A;  1H73 A;  1N33 I;  2NUE A;  4YY3 I;  4X64 I;  2F4V E;  3LPS A;  3VYY A;  4WUC A;  1XMO I;  1HNZ E;  2R42 A;  1S16 A;  4JI7 E;  1X48 A;  2V34 A;  2B7V A;  4PRV A;  3T1Y E;  2V83 A;  1H74 A;  4TUI A;  5A2Q Q;  4L8N A;  3Q6M A;  4JI0 I;  2IOQ A;  1EA6 A;  2VF1 A;  4PRX A;  4DV1 E;  3PYE A;  4USM A;  3T1H I;  3H09 A;  2UU9 I;  1KIJ A;  3RMP A;  1MG7 A;  1I94 E;  2ZBK B;  1RR9 A;  1KVK A;  3ZOQ B;  4OX9 E;  3LML A;  2WZO A;  5DNY A;  1WXR A;  4RPF A;  4X66 E;  1XHK A;  5FWK A;  2JR1 A;  5L3J A;  1HK7 A;  4LF9 I;  2YZT A;  4LF4 E;  1MX0 A;  5IWA I;  1HR0 I;  1H7U A;  1NHJ A;  2E1R A;  2UXC E;  2UUA I;  4DPU A;  4B3S E;  3MSW A;  3C4B A;  5ADZ A;  4DU8 A;  3F0N A;  1IBM I;  4DR1 E;  4JI3 E;  2L8T A;  2DEJ A;  4Z7C A;  4B3R I;  2UXD I;  3JTZ A;  4LF7 E;  3J81 C;  4GKJ E;  3KWR A;  4JV5 I;  2V2Q A;  4JI8 E;  1GQE A;  2BV3 A;  3IWC A;  2V89 A;  1Y6Z A;  1UIL A;  4DV0 I;  1QU6 A;  1N0V C;  4IZJ D;  1FKA E;  1ZM3 A;  1UHZ A;  5FLX C;  4WSP A;  2MC6 A;  4DUZ I;  4BBY A;  2AJ4 A;  2VE7 C;  4DUY I;  4DPX A;  3WU5 A;  4LFA E;  2Z5E A;  2UXB I;  3LTO A;  1Z59 A;  5LMU E;  1N32 I;  1N34 I;  4MYT A;  2LTS A;  4BC7 A;  2DIX A;  4GKK I;  4DXL A;  4DR5 E;  3P06 A;  4DR6 E;  2IOP A;  3B82 A;  2F4V I;  5A2Q C;  1HNZ I;  1FI4 A;  4JI7 I;  3Q6N A;  2FGG A;  2UUB E;  3T1Y I;  4Q28 A;  1B63 A;  5T6J A;  1DQ3 A;  4JI1 E;  1J5E E;  2A2C A;  1U2R A;  1ZXM A;  4BCA A;  1DAR A;  4DV1 I;  1PIE A;  1PVG A;  3H4L A;  3OML A;  4FN5 A;  1N36 I;  1D6T A;  2LUP B;  1NZ0 A;  4LF8 E;  1K47 A;  4OX9 I;  4HXZ A;  2YT4 A;  3J7A M;  4DV4 I;  2MDR A;  1FWK A;  2PNL A;  5LMN E;  4HAC A;  1S4E A;  1HNW E;  4X66 I;  2CG9 A;  3AV0 A;  3HTX A;  4DV2 E;  4JYA E;  4LF4 I;  4TUG A;  4BS9 A;  4DV5 E;  3HPZ A;  4X8W A;  2EZ6 A;  1H7S A;  1N0U A;  1MU5 A;  3D4J A;  1Z5C A;  4IZK A;  4ED4 A;  4DV6 I;  4KZS A;  4B3S I;  4DR7 I;  4NXM E;  2HHH E;  5F3W A;  3F6G A;  3ZZ0 A;  4JI3 I;  4DV3 E;  3HQ1 A;  4HY1 A;  2WW4 A;  4IZK B;  4X65 E;  3AUZ A;  2O1T A;  4LF7 I;  4GKJ I;  2UUC E;  1ZXN A;  4HYM A;  4X62 E;  2L3J A;  4JI8 I;  2B7T A;  1Z0B A;  4LFC E;  1WHQ A;  4FWG A;  4JI6 E;  3ADL A;  2H36 X;  2CZ9 A;  4B3M I;  3B78 A;  1XMQ E;  1FJG E;  3QT8 A;  2V2Z A;  1T4N A;  2NPF A;  5AE3 A;  4UT4 A;  3WU4 A;  2LUQ A;  5LMU I;  5AE1 A;  1Y4U A;  3QT7 A;  1RQ0 A;  4DKK A;  2HKE A;  2O1V A;  4URL A;  2N3H A;  4DR5 I;  4F54 A;  2LJH A;  4WUD A;  3DF6 A;  3OTO I;  2Z5C A;  1YYW A;  2HKJ A;  1Z0C A;  3J80 Q;  1KKH A;  1USU A;  4Z7Y A;  4R03 A;  2KHX A;  1DI2 A;  5BR8 I;  2UUB I;  3HUL A;  4JI1 I;  4N3O A;  1IBK E;  1BKN A;  3LNU A;  2Z5C B;  2BM0 A;  4KHP I;  2G7H A;  2N3G A;  4P7D A;  1IBL E;  4B3T I;  2DMY A;  3QT5 A;  4LF8 I;  3ZM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...