2F4VE

30s ribosome + designer antibiotic
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2f4vE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2f4vE02
1Z0TA 3J81C 4LFAI 3QT8A 1N0VC 1OJ4A 3M6AA 4LF4E 1ZM3A 2A2CA 4JI0E 3J80Q 4URLA 3OTOE 2AJ4A 2LBSB 1HNWI 4JYAI 1D6TA 1K47A 1U2RA 4LFCI 2DEJA 1DARA 4DPYA 4LF8I 2L2KB 1FJGE 2UU9E 2LTSA 3P1XA 1HR0I 1HNZI 1S16A 4B3TE 4UTGA 4DUZE 1DI2A 2JVAA 4JI3E 1B62A 2UXBE 5BR8I 4P52A 4DV2E 1MG7A 1N33I 4DV4I 2ZM6I 4AQYE 1RREA 1WUUA 3J7Yp 3WU4A 1IBKE 4MYTA 1EA6A 1GQEA 3T1YE 3JAMC 2UUCE 4LF4I 4DPWA 4X62E 2E1RA 4HACA 2RS7A 1H7SA 3ADGA 2N3HA 4M30A 1Z0GA 4JI0I 3J80C 4DU7A 3OTOI 1UHZA 2LUQA 4GKJE 2B7TA 1WHQA 2YT4A 2WW4A 1T4NA 2X36A 1KIJA 4R1FA 3LNUA 2J7KA 4M1KA 4HYMA 3J7AG 4DR3E 3ADIA 1T4LB 1FJGI 1NHIA 2UU9I 4DR1E 3C4TA 4JI6E 2EZ6A 4RPFA 4B3TI 4DUZI 4JI3I 3ZZ0A 2UUAE 4NXNE 4OOGC 2UXBI 2VQFE 4KQVA 4JI4E 2L33A 4DV2I 3J81Q 3T1HE 4DR5E 1N32E 2LRSA 1IBKI 1YZ9A 3HTXA 3T1YI 2N3GA 1ELOA 2VF3A 2UUCI 2VQEE 3Q1QA 1ZM9A 4USKA 4X62I 3C4BA 3ZKBA 3V2UC 4I3HA 4DV0E 4OX9E 4GKKE 3ZKDA 1HNZE 4GKJI 2V2ZA 1B63A 4K0KE 4ED4A 4DR3I 4WUDA 1YYKA 2L3JA 4JI6I 2V8PA 3CWVA 3F0NA 1MX0A 4PRXA 2LJPA 4NXNI 2UUAI 2VQFI 2LJHA 4JI4I 1QZRA 3JAMQ 3T1HI 1H74A 4DR5I 1N32I 3K1JA 1ZXMA 4X65E 1HNXE 1FWLA 4DPXA 1Z0VA 1N34E 4EMDA 1ZM4A 1J26A 1I94E 3QT5A 2VQEI 2L3CA 3B8HA 2UXCE 1KVKA 4YY3E 2IHR1 3B78A 4DV0I 1O0WA 4M2ZA 4OX9I 4GKKI 2GS8A 2V34A 1IBME 2HFSA 1EKZA 1Z0EA 2HK2A 2BM1A 4FN5A 1X49A 4JI2E 3H4LA 4K0KI 4LF9E 4B3RE 4DV7E 1YYOA 2EFGA 5IT9C 4WUBA 1Z5AA 1XMQE 3QT7A 4X65I 1HNXI 1XNRE 2DIXA 3K17A 1N34I 1H7UA 2RSMA 1I94I 4WUCA 1BKNA 4Z7CA 2UXCI 4YY3I 4YHHE 3PYGA 1RR9A 3WU6A 3GONA 4DR6E 1RC7A 4NXME 4PRVA 1YYWA 1IBMI 1PIEA 2NUEA 1Z5BA 1KKHA 4JI2I 1X48A 2MDRA 2RS6A 2LUPB 3ADLA 1KTVA 3PYFA 4LF9I 4B3RI 4B3ME 5A2QC 4DV7I 2LTRA 3WU3A 4DUYI 5IWAE 4X66E 4DR2E 4JI5E 4JV5E 1UEKA 5CFFE 4FW9A 1XMQI 2L2MA 5LMUE 2CPNA 1XNRI 1FI4A 2HHHE 4JI1E 1Z5CA 1UILA 1XNQE 2L2NA 1T4OA 4X64E 2DEIA 1XMOE 4Z7YA 1ZM2A 4YHHI 2DB2A 4HY1A 3ZZTA 4JI8E 4DXLA 4DR6I 1NHJA 4NXMI 5LL6R 2E5LE 1J5EE 2UUBE 2F4VE 2Q2EB 4B3MI 5IT9Q 1FWKA 1Z0CA 4ZVIA 1ZXNA 3PYDA 5IWAI 4X66I 2HFUA 4DR2I 4JI5I 4JV5I 3VYXA 4FWGA 2X7IA 4PU9A 4LFBE 5LMUI 4KHPE 4B3SE 4HXZA 2HHHI 4JI1I 4DV1E 1XNQI 4FWHA 2CZ9A 4FWDA 4X64I 1XMOI 2V2QA 2KHXA 1PKPA 3LPSA 2UXDE 2B7VA 2NPFA 4JI8I 1MU5A 3PYEA 4USMA 1Z0WA 4DPTA 2NUFA 1ZBTA 1S4EA 4LF5E 5A2QQ 1VISA 4DV3E 4WYQB 2BM0A 2OI2A 4DV6I 3D4JA 4DUYE 3J7AM 2E5LI 2A2DA 1WHNA 4HACB 2BV3A 1J5EI 2UUBI 1N0UA 2F4VI 1X47A 5GMEA 2DMYA 1IBLE 1A6FA 1NHHA 5FLXQ 4JI7E 1N36E 4DR7E 2HKEA 2RTXA 4LFBI 2NUGA 2R3VA 4KHPI 4B3SI 1PVGA 4DPUA 1RQ0A 4DV1I 3WU5A 2JY9A 1FNMA 3ADJA 2NA2A 3QT6A 1NZ0A 2UXDI 1Z0BA 1FKAE 1QU6A 5L3JA 4DKKA 2R42A 4DR4E 4LF5I 5LMNE 4DV3I 1XHKA 4LF6E 2HKJA 3HULA 4LF7E 2V2VA 5FLXC 4WFTA 5GMDA 4DV5E 4JG4A 1IBLI 4X8WA 4LFAE 3LTOA 1Z59A 2HK3A 4AQYI 4P7AA 4JI7I 1N36I 4DR7I 2ZBKB 1EI1A 3VYYA 4UT4A 4XTJA 1HNWE 1H72C 3ZM7A 4JYAE 1H73A 2XEXA 3ZZUA 4LFCE 4LF8E 4DV6E 2ZITA 4DU8A 4MYUA 1STUA 1HR0E 2B3TB 4DR4I 5LMNI 3LLHA 5BR8E 4LF6I 1N33E 4DV4E 2ZM6E 3V5RA 4DR1I 4LF7I 4DV5I 3B82A
chains in the Genus database with same CATH superfamily
1Z0TA 4MU4A 3J81C 1G2FC 2Z5BB 2YRKA 4MLQA 5JEAC 4LFAI 3BGHA 3QT8A 1N0VC 3UHMA 1OJ4A 3M6AA 4LF4E 5F3WA 5C0XF 1ZM3A 3M99B 1YH8A 4MLVA 5AC5A 2EWLA 3HPZA 1A1HA 2ADRA 5KL5A 2EOJA 2EOQA 2A2CA 5A6BD 2C38B 2PO1B 5C0XD 2M7QA 4JI0E 2H36X 3JU0A 3GCMA 2L6MA 3J80Q 4URLA 3OTOE 3ZOQB 1T39A 3K85A 2LT7A 4FK5C 2LBSB 2AJ4A 1HNWI 1XXEA 1N3GA 2V83A 4JYAI 4OO1E 4ZYEA 1UN6B 1WXRA 1D6TA 1K47A 4R2QA 1U2RA 3BBGA 2YPNA 4LFCI 2O1VA 3EQ1A 1DARA 1ZBQA 2DEJA 1IQSA 2EM7A 2FGGA 3H09A 4M9VC 2NN6B 2L2KB 1FJGE 2UU9E 2JE6B 4LF8I 4LCGA 2LTSA 3P1XA 1HR0I 1HNZI 1S16A 4B3TE 4UTGA 2EOZA 4DUZE 2JVAA 3IWDA 2DRPA 4JI3E 1DI2A 1YSAC 1B62A 5AASA 2YRMA 2YTJA 2UXBE 2PO0A 5BR8I 4P52A 4DV2E 1MG7A 1USVA 3Q6NA 2KOUA 4DV4I 2ZM6I 1N33I 3IWBA 4AQYE 1DQ3A 1RREA 1WUUA 3EPJA 2BR2B 3J7Yp 4BMJA 3WU4A 3K6QA 3MHSC 1IBKE 4MYTA 5A6AA 2EM9A 1EA6A 3LMLA 1GQEA 5KL2A 3T1YE 5C0XC 3JAMC 1WJPA 2UUCE 1PJQA 5LLQA 4LF4I 4DPWA 4X62E 2E1RA 4HACA 3HXLA 2RS7A 1H7SA 5T6JA 1VI7A 2MKDA 3MHHC 2EMKA 3ADGA 1QNTA 2N3HA 4J8ZA 4M30A 4WSPA 1Z0GA 4JI0I 1X5WA 3J80C 3DF6A 2E72A 4DU7A 3OTOI 1UHZA 2LUQA 5AE1A 4GKJE 2B7TA 1WHQA 2YSOA 2V88A 2YT4A 4IS1C 2WW4A 1T4NA 2X36A 2EL5A 1GZ6A 2EOXA 1KIJA 4IZJA 4R1FA 2JP9A 2J7KA 3LNUA 4M1KA 4HYMA 2BB8A 3J7AG 4IZJD 2EM3A 4DR3E 4RH8A 3ADIA 1T4LB 1FJGI 1NHIA 2UU9I 2EMGA 4DR1E 3C4TA 1PDAA 4JI6E 2WNRA 2EZ6A 2VF1A 4RPFA 4B3TI 3QG5C 2EOIA 4DUZI 1TF6A 4JI3I 3ZZ0A 4Q28A 2UUAE 4NXNE 5FWKA 4OOGC 2UXBI 2VQFE 2O1WA 1NEIA 2K4VA 2L33A 4JI4E 2C39A 4KQVA 3J81Q 2L8TA 4DV2I 3M7NG 2PNZB 3T1HE 3TQMA 3U1KA 2EMZA 2EORA 4DR5E 1N32E 5JEAB 3AV0A 4WXCA 2MKNA 4ZYDA 4U3BA 2LRSA 2C37B 1IBKI 2EPXA 1YZ9A 3HTXA 3T1YI 2N3GA 2YWQA 1ELOA 1A1GA 2VF3A 2UUCI 2R76A 3M85D 4M0VA 2VQEE 3CDJA 1ZM9A 2JEAB 3Q1QA 4USKA 1A1KA 4X62I 3C4BA 2YZTA 2R1FA 4GZNC 1HK7A 3ZKBA 3V2UC 2MC6A 4BS9A 4I3HA 1WRJA 1SFEA 4DV0E 4ZYHA 1USUA 3DD6A 4OX9E 4GKKE 2FTXB 1A1LA 3ZKDA 2LO3A 2JWOA 2YSPA 1HNZE 2CG9A 2JEBA 2EPUA 4GKJI 5K36E 2EL6A 2V2ZA 3C6KA 1B63A 2IOQA 4K0KE 1F2IG 4ED4A 4F6NA 4DR3I 4IFDF 2GPIA 4WUDA 1YYKA 2RSIA 2L3JA 4JI6I 2CSHA 2V8PA 4TUIA 5KL7A 3CWVA 3F0NA 2Z5CA 1MX0A 4PRXA 5K36A 2ODRD 5A6JA 5DRPA 2WBSA 2EOMA 2YTDA 2LJPA 4NZVA 4NXNI 2UUAI 1EH7A 2VQFI 2LJHA 2V87A 4JI4I 2EM4A 2EN1A 4Q35B 1QZRA 3JAMQ 2EMYA 1H74A 3T1HI 2DGCA 2I13A 5C0XB 4DR5I 1N32I 4OO1F 3K1JA 2L92A 1Y60A 1ZXMA 4LTYA 2EOHA 4X65E 4P78A 1HNXE 2HGHA 2ENCA 4BCAA 1FWLA 1R6MA 1Z0VA 3P06A 1N34E 4OO1A 4WX9A 4EMDA 4OO1D 1ZM4A 3BIDA 1UBDC 1J26A 1I94E 3QT5A 1KYQA 4F6MA 4FW3A 2VQEI 4GQUA 2EPZA 2L3CA 3P76A 3B8HA 2EMFA 2EMWA 2UXCE 5C0XE 5DNYA 4YY3E 1KVKA 4O5GA 2N8XA 1OYPA 2IHR1 2PNMA 2DMIA 3B78A 3EPLA 1OYRA 4DV0I 4O24A 2KONA 3B4TA 2WP8A 1O0WA 2EPPA 4BBYA 4WPYA 4KWYA 4M2ZA 2Z5BA 4LCHA 4OX9I 4GKKI 2EN2A 1P47A 2GS8A 3PS3A 2V34A 1IBME 2YTIA 1EKZA 1BBOA 1Z0EA 2BA1D 2HFSA 2ODRC 2HK2A 2PNLA 4FW6A 4IFDC 2BM1A 4FN5A 1X49A 2EMHA 4F54A 2B9DA 4JI2E 3H4LA 2EPAA 2YTPA 4K0KI 2CTDA 3VHTB 4LPFA 2PO1A 5IV8B 5KL4A 2NN6E 1R6LA 4LF9E 4B3RE 3P3GA 4DV7E 2Q8UA 2JT2A 2EM0A 1TN9A 4IZKB 2DSYA 1X3CA 3C6MA 3NZKA 1YYOA 4AIDA 2LVHA 2EFGA 4OO1C 3FIGA 2NN6A 5IT9C 2JE6A 4WUBA 1Z5AA 1X6EA 1XMQE 3QT7A 2VRDA 4DMIA 2EOFA 4X65I 1HNXI 1XNRE 2DIXA 3K17A 2BA0D 1N34I 1H7UA 3GMEA 2RSMA 1G2DC 2WCC3 2J7JA 2O1TA 1I94I 4WUCA 1BKNA 1ZU1A 2EN8A 2M9AA 4LU9A 2EOEA 4Z7CA 2UXCI 4YY3I 2JOBA 2GO3A 2BR2A 3CDIA 3GLLA 2RPCA 3P3CA 3IWCA 4BA2B 2LJUA 4YHHE 3PYGA 1RR9A 4NHRA 3WU6A 3VK6A 2GLIA 1OYSA 3GONA 4L5NC 4DR6E 3THNA 2GQ0A 1RC7A 4NXME 4PRVA 1YYWA 1IBMI 1PIEA 1Y6ZA 2NUEA 4IJDA 3EPHA 1KKHA 2EMXA 1Z5BA 4JI2I 1X48A 2MDRA 2RS6A 3OMLA 3HJCA 4L8NA 2LUPB 4NBQA 4R2PA 2EM2A 3ADLA 1KTVA 2IOPA 3PYFA 4LF9I 2HJJA 4B3RI 4B3ME 5KL3A 5A2QC 4DV7I 2IERA 2LTRA 5DRRA 4DPYA 2EPRA 4BHBA 1P42A 2EMIA 1RMDA 3PS1A 3WU3A 4DUYI 5IWAE 4X66E 4DR2E 1Z1BA 1MEYC 4JI5E 5CFFE 4JV5E 1UEKA 2V86A 2EP3A 1JK2A 1L4SA 4BA1A 2EM5A 4FW9A 5JEAE 2EN6A 1XMQI 2L2MA 4F9AB 2MC5A 5LMUE 2CPNA 2YTOA 2LMZA 1XNRI 1UDOA 2PO2A 1FI4A 2HHHE 4HEIA 4O4KA 4JI1E 1UILA 1Z5CA 3L7ZA 1XNQE 2L2NA 1T4OA 2EMLA 4WXDA 4X64E 2DEIA 4R2AA 2JPAA 2O3ZA 2PNZA 1XMOE 4Z7YA 5EKWA 5JEAA 3HPSA 4P7DA 4DPXA 2BBGA 4I8OA 1ZM2A 2C37A 2WBUA 2DB2A 4YHHI 2EJ4A 1YUIA 4HY1A 2J65A 5EL9A 3ZZTA 4IFDB 2DLQA 4JI8E 4DXLA 2EPMX 4DR6I 5K36F 4R2SA 1NHJA 1A1IA 2JEAA 4NXMI 5LL6R 5A6KA 4N3OA 2EQ1A 5K36D 2YTGA 2JOXA 2E5LE 3MSWA 2FV4B 2YTNA 1J5EE 1SR9A 2UUBE 2F4VE 2Q2EB 4IFDE 2EQ3A 1JK1A 4B3MI 5IT9Q 1FWKA 4OO1B 3RMPA 1X6HA 2VESA 3L00A 1Z0CA 3P3EA 4ZVIA 2IESA 1IQOA 4F9CB 1ZXNA 3PYDA 1PJTA 5AC4A 5IWAI 4FW7A 4X66I 2EPOA 2PRTA 2I9IA 2HFUA 4DR2I 4JI5I 4JV5I 3VYXA 4FWGA 1BBGA 2X7IA 4PU9A 3JTZA 3F6GA 2DLKA 4LFBE 3M7ND 2EOOA 2EPCA 4TUGA 4R2EA 2WP8B 5LMUI 4KHPE 5ADZA 4B3SE 4HXZA 2EN3A 3KRNA 2HHHI 2EL4A 4JI1I 2M4IA 2EM8A 1E3PA 4DV1E 1XNQI 1A1JA 1RHYA 4FWHA 2CZ9A 2JXPA 1EH8A 4HTGA 4FWDA 3UK3C 4X64I 2F8BA 4BHCA 5A6BA 1XMOI 2V2QA 5C0XA 2PO0B 2KHXA 1PKPA 5K36C 2V85A 1PJSA 3LPSA 2UXDE 2B7VA 2C38A 4U3DA 4FW4A 2NPFA 4JI8I 4AIMA 1MU5A 3DJWA 3PYEA 1Z0WA 4USMA 4DPTA 2NUFA 2ELZA 4KZSA 1ZBTA 1S4EA 4LF5E 5A2QQ 2JR1A 1VISA 4MDTA 4DV3E 2NABA 4MU1A 4WYQB 2AE8A 4MU3A 2BM0A 2OI2A 4QNJA 2EMAA 2NN6F 4DV6I 4ISAA 3D4JA 4DUYE 3J7AM 2E5LI 2YTQA 2A2DA 1WHNA 4HACB 2BV3A 1J5EI 2UUBI 1N0UA 3Q6MA 2F4VI 1X47A 1B69A 5DRQA 5GMEA 2CGEA 2DMYA 2NN6D 2D9HA 1IBLE 1A6FA 1NHHA 5FLXQ 3M85G 4R03A 3AUZA 2JYAA 2O1UA 2YRHA 4IZJB 4JI7E 1N36E 4DR7E 2HKEA 2RTXA 5DROA 4LFBI 2NUGA 2R3VA 1AAYA 4KHPI 4B3SI 4IZKA 5AE2A 4LCFA 4BC7A 1E3HA 1EH6A 1BB8A 1PVGA 2WNRB 1TF3A 1RQ0A 4DPUA 2EQ0A 2G7HA 4DV1I 2VE7C 3WU5A 1YFHA 2EMBA 2EOSA 2JY9A 3BF2A 3KZYA 4WSGA 1GTKA 1FNMA 5DNXA 1Y4UA 3H1CA 3ADJA 3HQ1A 1Y4SA 4R2CA 2NA2A 1ZAAC 2C39B 4LOMA 3KWRA 3QT6A 1NZ0A 2WZOA 4R2DA 2UXDI 1UDNA 1Z0BA 4OZEA 1FKAE 4BC9A 1QU6A 2NN6C 5L3JA 4DKKA 2CT1A 2R42A 4DR4E 4LF5I 4IFDD 2EPLX 5LMNE 4DV3I 1XHKA 4RHBB 5ELWA 1MGTA 1AH5A 2EMCA 4LF6E 2E1MA 2LE2A 3KZZA 2GO4A 5IXMB 4J3DA 4OKGA 4BA2A 2HC5A 2V8QB 4F9BB 3U1YA 4BA1B 2HKJA 2EN7A 5TSEA 3ECRA 3HULA 4LF7E 1KJKA 2V2VA 5FLXC 4WFTA 1A1FA 5GMDA 4DV5E 4JG4A 1IBLI 2PO2B 4X8WA 3L7ZB 2GHFA 2YU5A 4LFAE 3F6HA 2CVEA 3LTOA 1Z59A 1UDQA 5AE3A 4MQYA 2LV2A 1UDSA 2HK3A 2WBTA 3THOB 1YHCA 2JEBB 4AQYI 1LLMC 4F2JC 3HKMA 4P7AA 3PS2A 1X6FA 5DNLA 1ZR9A 5JEAF 2M1SA 1T38A 1N36I 1DGCA 4JI7I 2LCEA 4DR7I 4O43A 1IMUA 1EI1A 2YTFA 2ZBKB 2K7IA 2EE8A 5JEAD 4AM3A 3VYYA 4QNKA 2BA1G 4UT4A 4XTJA 1Y5YA 2Z5EA 1HNWE 4N4RB 2F1DA 1H72C 2Z5CB 4MU0A 2EN4A 5K36B 2YU8A 3ZM7A 4JYAE 2MDGA 1H73A 2EOYA 2XEXA 1YPNA 2ELYA 3ZZUA 2EM6A 1NCSA 4ZYGA 4LFCE 2EPNA 2ENHA 4LF8E 4DV6E 4FW5A 2ZITA 2RQLA 4DU8A 4MYUA 1STUA 1HR0E 3PRYA 5A69A 2V89A 4R2RA 2B3TB 2EPKX 1YUJA 4DR4I 4R8OA 4X9JA 4GEQB 5LMNI 5KL6A 3LLHA 5BR8E 4IS9A 4LF6I 1N33E 4DV4E 2ENAA 2ZM6E 3V5RA 4DR1I 2A25A 2BA0G 4IFDA 3EPKA 4LF7I 2YTEA 4DV5I 3B82A
chains in the Genus database with same CATH topology
1Z0TA 3J81C 2Z5BB 4LFAI 3QT8A 1N0VC 1OJ4A 3M6AA 4LF4E 5F3WA 1ZM3A 2EWLA 3HPZA 2A2CA 2M7QA 4JI0E 2H36X 3JU0A 2L6MA 3J80Q 4URLA 3OTOE 3ZOQB 3K85A 2AJ4A 2LBSB 1HNWI 2V83A 4JYAI 1WXRA 1D6TA 1K47A 1U2RA 4LFCI 2O1VA 2DEJA 1DARA 1ZBQA 4DPYA 2FGGA 3H09A 4LF8I 2L2KB 1FJGE 2UU9E 2LTSA 3P1XA 1HR0I 1HNZI 1S16A 4B3TE 4UTGA 4DUZE 1DI2A 2JVAA 3IWDA 4JI3E 1B62A 5AASA 2UXBE 5BR8I 4P52A 4DV2E 1MG7A 1USVA 3Q6NA 2KOUA 4DV4I 2ZM6I 1N33I 3IWBA 4AQYE 1DQ3A 1RREA 1WUUA 3J7Yp 4BMJA 3WU4A 3K6QA 1IBKE 4MYTA 1EA6A 3LMLA 1GQEA 3T1YE 3JAMC 2UUCE 4LF4I 4DPWA 4X62E 2E1RA 4HACA 3HXLA 2RS7A 1H7SA 5T6JA 3ADGA 2N3HA 4J8ZA 4M30A 4WSPA 1Z0GA 4JI0I 3J80C 3DF6A 4DU7A 3OTOI 1UHZA 2LUQA 5AE1A 4GKJE 2B7TA 1WHQA 2V88A 2YT4A 2WW4A 1T4NA 2X36A 1GZ6A 1KIJA 4IZJA 4R1FA 3LNUA 2J7KA 4M1KA 4HYMA 4IZJD 3J7AG 4DR3E 3ADIA 1T4LB 1FJGI 1NHIA 2UU9I 4DR1E 3C4TA 4JI6E 2EZ6A 2VF1A 4RPFA 4B3TI 4DUZI 4JI3I 3ZZ0A 4Q28A 2UUAE 4NXNE 5FWKA 4OOGC 2UXBI 2VQFE 2O1WA 4JI4E 2K4VA 2L33A 4KQVA 3J81Q 4DV2I 2L8TA 3T1HE 4DR5E 1N32E 3AV0A 2LRSA 1IBKI 1YZ9A 3HTXA 3T1YI 2N3GA 1ELOA 2VF3A 2UUCI 4M0VA 2VQEE 3Q1QA 1ZM9A 4USKA 4X62I 3C4BA 2YZTA 1HK7A 3ZKBA 3V2UC 2MC6A 4BS9A 4I3HA 4DV0E 1USUA 4OX9E 4GKKE 2FTXB 3ZKDA 2JWOA 1HNZE 2CG9A 4GKJI 2V2ZA 1B63A 2IOQA 4K0KE 4ED4A 4DR3I 4WUDA 1YYKA 2L3JA 4JI6I 2V8PA 4TUIA 3CWVA 3F0NA 2Z5CA 1MX0A 4PRXA 2ODRD 2LJPA 4NXNI 2UUAI 2VQFI 2LJHA 2V87A 4JI4I 1QZRA 3JAMQ 3T1HI 1H74A 4DR5I 1N32I 3K1JA 2L92A 1ZXMA 4LTYA 4X65E 4P78A 1HNXE 1FWLA 4BCAA 1Z0VA 3P06A 4DPXA 1N34E 4EMDA 1ZM4A 1J26A 1I94E 3QT5A 2VQEI 2L3CA 3B8HA 2UXCE 5DNYA 4YY3E 1KVKA 2PNMA 2IHR1 3B78A 4DV0I 2KONA 1O0WA 4BBYA 4WPYA 4M2ZA 2Z5BA 4OX9I 4GKKI 2GS8A 2V34A 1IBME 2HFSA 1EKZA 1Z0EA 2PNLA 2ODRC 2HK2A 2BM1A 4FN5A 1X49A 4F54A 4JI2E 2B9DA 3H4LA 4K0KI 4LF9E 4B3RE 4DV7E 4IZKB 2DSYA 1YYOA 2EFGA 3FIGA 5IT9C 4WUBA 1Z5AA 1XMQE 3QT7A 4DMIA 4X65I 1HNXI 1XNRE 2DIXA 3K17A 1N34I 1H7UA 2RSMA 2O1TA 1I94I 4WUCA 1BKNA 4Z7CA 2UXCI 4LU9A 4YY3I 2JOBA 3IWCA 4YHHE 3PYGA 1RR9A 3WU6A 3VK6A 3GONA 4L5NC 4DR6E 2GQ0A 1RC7A 4NXME 4PRVA 1YYWA 1IBMI 1PIEA 1Y6ZA 2NUEA 1Z5BA 1KKHA 4JI2I 1X48A 2RS6A 2MDRA 3OMLA 3HJCA 4L8NA 2LUPB 3ADLA 1KTVA 2IOPA 3PYFA 4LF9I 4B3RI 4B3ME 5A2QC 4DV7I 2LTRA 3WU3A 4DUYI 5IWAE 4X66E 4DR2E 4JI5E 4JV5E 1UEKA 5CFFE 2V86A 4FW9A 1XMQI 2L2MA 4F9AB 2MC5A 5LMUE 2CPNA 2LMZA 1XNRI 1FI4A 2HHHE 4JI1E 1Z5CA 1UILA 1XNQE 2L2NA 1T4OA 4X64E 2DEIA 1XMOE 4Z7YA 3HPSA 4P7DA 4I8OA 1ZM2A 4YHHI 2DB2A 4HY1A 3ZZTA 4JI8E 4DXLA 4DR6I 1NHJA 4NXMI 5LL6R 4N3OA 2JOXA 2E5LE 3MSWA 2FV4B 1J5EE 2UUBE 1SR9A 2F4VE 2Q2EB 4B3MI 5IT9Q 1FWKA 3RMPA 1Z0CA 4ZVIA 4F9CB 1ZXNA 3PYDA 5IWAI 4X66I 2HFUA 4DR2I 4JI5I 4JV5I 3VYXA 4FWGA 2X7IA 4PU9A 3JTZA 3F6GA 4LFBE 4TUGA 5LMUI 4KHPE 5ADZA 4B3SE 4HXZA 2HHHI 4JI1I 2M4IA 4DV1E 1XNQI 4FWHA 2CZ9A 4FWDA 4X64I 2F8BA 1XMOI 2V2QA 2KHXA 1PKPA 2V85A 3LPSA 2UXDE 2B7VA 2NPFA 4JI8I 1MU5A 3DJWA 3PYEA 1Z0WA 4USMA 4DPTA 2NUFA 4KZSA 1ZBTA 1S4EA 4LF5E 5A2QQ 2JR1A 1VISA 4DV3E 4WYQB 2BM0A 2OI2A 4DV6I 3D4JA 4DUYE 3J7AM 2E5LI 2A2DA 1WHNA 4HACB 2BV3A 1J5EI 2UUBI 1N0UA 3Q6MA 2F4VI 1X47A 5GMEA 2CGEA 2DMYA 1IBLE 1A6FA 1NHHA 5FLXQ 4R03A 3AUZA 2O1UA 4IZJB 4JI7E 1N36E 4DR7E 2HKEA 2RTXA 4LFBI 2NUGA 2R3VA 4KHPI 4B3SI 4IZKA 5AE2A 4BC7A 1PVGA 4DPUA 1RQ0A 4DV1I 2G7HA 2VE7C 3WU5A 2JY9A 1FNMA 1Y4UA 3ADJA 3HQ1A 1Y4SA 2NA2A 3KWRA 3QT6A 1NZ0A 2WZOA 2UXDI 1Z0BA 1FKAE 4BC9A 1QU6A 5L3JA 4DKKA 2R42A 4DR4E 4LF5I 5LMNE 4DV3I 1XHKA 4LF6E 2E1MA 2LE2A 2V8QB 4F9BB 2HKJA 3HULA 4LF7E 2V2VA 5FLXC 4WFTA 5GMDA 4DV5E 4JG4A 1IBLI 4X8WA 4LFAE 3F6HA 3LTOA 1Z59A 5AE3A 2HK3A 4AQYI 4P7AA 2M1SA 1N36I 4JI7I 4DR7I 2ZBKB 1EI1A 3VYYA 4UT4A 4XTJA 2Z5EA 1HNWE 1H72C 2Z5CB 3ZM7A 4JYAE 1H73A 2XEXA 3ZZUA 4LFCE 4LF8E 4DV6E 2ZITA 4DU8A 4MYUA 1STUA 1HR0E 3PRYA 2V89A 2B3TB 4DR4I 4R8OA 4GEQB 5LMNI 3LLHA 5BR8E 4LF6I 1N33E 4DV4E 2ZM6E 3V5RA 4DR1I 4LF7I 4DV5I 3B82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0T A;  3J81 C;  4LFA I;  3QT8 A;  1N0V C;  1OJ4 A;  3M6A A;  4LF4 E;  1ZM3 A;  2A2C A;  4JI0 E;  3J80 Q;  4URL A;  3OTO E;  2AJ4 A;  2LBS B;  1HNW I;  4JYA I;  1D6T A;  1K47 A;  1U2R A;  4LFC I;  2DEJ A;  1DAR A;  4DPY A;  4LF8 I;  2L2K B;  1FJG E;  2UU9 E;  2LTS A;  3P1X A;  1HR0 I;  1HNZ I;  1S16 A;  4B3T E;  4UTG A;  4DUZ E;  1DI2 A;  2JVA A;  4JI3 E;  1B62 A;  2UXB E;  5BR8 I;  4P52 A;  4DV2 E;  1MG7 A;  1N33 I;  4DV4 I;  2ZM6 I;  4AQY E;  1RRE A;  1WUU A;  3J7Y p;  3WU4 A;  1IBK E;  4MYT A;  1EA6 A;  1GQE A;  3T1Y E;  3JAM C;  2UUC E;  4LF4 I;  4DPW A;  4X62 E;  2E1R A;  4HAC A;  2RS7 A;  1H7S A;  3ADG A;  2N3H A;  4M30 A;  1Z0G A;  4JI0 I;  3J80 C;  4DU7 A;  3OTO I;  1UHZ A;  2LUQ A;  4GKJ E;  2B7T A;  1WHQ A;  2YT4 A;  2WW4 A;  1T4N A;  2X36 A;  1KIJ A;  4R1F A;  3LNU A;  2J7K A;  4M1K A;  4HYM A;  3J7A G;  4DR3 E;  3ADI A;  1T4L B;  1FJG I;  1NHI A;  2UU9 I;  4DR1 E;  3C4T A;  4JI6 E;  2EZ6 A;  4RPF A;  4B3T I;  4DUZ I;  4JI3 I;  3ZZ0 A;  2UUA E;  4NXN E;  4OOG C;  2UXB I;  2VQF E;  4KQV A;  4JI4 E;  2L33 A;  4DV2 I;  3J81 Q;  3T1H E;  4DR5 E;  1N32 E;  2LRS A;  1IBK I;  1YZ9 A;  3HTX A;  3T1Y I;  2N3G A;  1ELO A;  2VF3 A;  2UUC I;  2VQE E;  3Q1Q A;  1ZM9 A;  4USK A;  4X62 I;  3C4B A;  3ZKB A;  3V2U C;  4I3H A;  4DV0 E;  4OX9 E;  4GKK E;  3ZKD A;  1HNZ E;  4GKJ I;  2V2Z A;  1B63 A;  4K0K E;  4ED4 A;  4DR3 I;  4WUD A;  1YYK A;  2L3J A;  4JI6 I;  2V8P A;  3CWV A;  3F0N A;  1MX0 A;  4PRX A;  2LJP A;  4NXN I;  2UUA I;  2VQF I;  2LJH A;  4JI4 I;  1QZR A;  3JAM Q;  3T1H I;  1H74 A;  4DR5 I;  1N32 I;  3K1J A;  1ZXM A;  4X65 E;  1HNX E;  1FWL A;  4DPX A;  1Z0V A;  1N34 E;  4EMD A;  1ZM4 A;  1J26 A;  1I94 E;  3QT5 A;  2VQE I;  2L3C A;  3B8H A;  2UXC E;  1KVK A;  4YY3 E;  2IHR 1;  3B78 A;  4DV0 I;  1O0W A;  4M2Z A;  4OX9 I;  4GKK I;  2GS8 A;  2V34 A;  1IBM E;  2HFS A;  1EKZ A;  1Z0E A;  2HK2 A;  2BM1 A;  4FN5 A;  1X49 A;  4JI2 E;  3H4L A;  4K0K I;  4LF9 E;  4B3R E;  4DV7 E;  1YYO A;  2EFG A;  5IT9 C;  4WUB A;  1Z5A A;  1XMQ E;  3QT7 A;  4X65 I;  1HNX I;  1XNR E;  2DIX A;  3K17 A;  1N34 I;  1H7U A;  2RSM A;  1I94 I;  4WUC A;  1BKN A;  4Z7C A;  2UXC I;  4YY3 I;  4YHH E;  3PYG A;  1RR9 A;  3WU6 A;  3GON A;  4DR6 E;  1RC7 A;  4NXM E;  4PRV A;  1YYW A;  1IBM I;  1PIE A;  2NUE A;  1Z5B A;  1KKH A;  4JI2 I;  1X48 A;  2MDR A;  2RS6 A;  2LUP B;  3ADL A;  1KTV A;  3PYF A;  4LF9 I;  4B3R I;  4B3M E;  5A2Q C;  4DV7 I;  2LTR A;  3WU3 A;  4DUY I;  5IWA E;  4X66 E;  4DR2 E;  4JI5 E;  4JV5 E;  1UEK A;  5CFF E;  4FW9 A;  1XMQ I;  2L2M A;  5LMU E;  2CPN A;  1XNR I;  1FI4 A;  2HHH E;  4JI1 E;  1Z5C A;  1UIL A;  1XNQ E;  2L2N A;  1T4O A;  4X64 E;  2DEI A;  1XMO E;  4Z7Y A;  1ZM2 A;  4YHH I;  2DB2 A;  4HY1 A;  3ZZT A;  4JI8 E;  4DXL A;  4DR6 I;  1NHJ A;  4NXM I;  5LL6 R;  2E5L E;  1J5E E;  2UUB E;  2F4V E;  2Q2E B;  4B3M I;  5IT9 Q;  1FWK A;  1Z0C A;  4ZVI A;  1ZXN A;  3PYD A;  5IWA I;  4X66 I;  2HFU A;  4DR2 I;  4JI5 I;  4JV5 I;  3VYX A;  4FWG A;  2X7I A;  4PU9 A;  4LFB E;  5LMU I;  4KHP E;  4B3S E;  4HXZ A;  2HHH I;  4JI1 I;  4DV1 E;  1XNQ I;  4FWH A;  2CZ9 A;  4FWD A;  4X64 I;  1XMO I;  2V2Q A;  2KHX A;  1PKP A;  3LPS A;  2UXD E;  2B7V A;  2NPF A;  4JI8 I;  1MU5 A;  3PYE A;  4USM A;  1Z0W A;  4DPT A;  2NUF A;  1ZBT A;  1S4E A;  4LF5 E;  5A2Q Q;  1VIS A;  4DV3 E;  4WYQ B;  2BM0 A;  2OI2 A;  4DV6 I;  3D4J A;  4DUY E;  3J7A M;  2E5L I;  2A2D A;  1WHN A;  4HAC B;  2BV3 A;  1J5E I;  2UUB I;  1N0U A;  2F4V I;  1X47 A;  5GME A;  2DMY A;  1IBL E;  1A6F A;  1NHH A;  5FLX Q;  4JI7 E;  1N36 E;  4DR7 E;  2HKE A;  2RTX A;  4LFB I;  2NUG A;  2R3V A;  4KHP I;  4B3S I;  1PVG A;  4DPU A;  1RQ0 A;  4DV1 I;  3WU5 A;  2JY9 A;  1FNM A;  3ADJ A;  2NA2 A;  3QT6 A;  1NZ0 A;  2UXD I;  1Z0B A;  1FKA E;  1QU6 A;  5L3J A;  4DKK A;  2R42 A;  4DR4 E;  4LF5 I;  5LMN E;  4DV3 I;  1XHK A;  4LF6 E;  2HKJ A;  3HUL A;  4LF7 E;  2V2V A;  5FLX C;  4WFT A;  5GMD A;  4DV5 E;  4JG4 A;  1IBL I;  4X8W A;  4LFA E;  3LTO A;  1Z59 A;  2HK3 A;  4AQY I;  4P7A A;  4JI7 I;  1N36 I;  4DR7 I;  2ZBK B;  1EI1 A;  3VYY A;  4UT4 A;  4XTJ A;  1HNW E;  1H72 C;  3ZM7 A;  4JYA E;  1H73 A;  2XEX A;  3ZZU A;  4LFC E;  4LF8 E;  4DV6 E;  2ZIT A;  4DU8 A;  4MYU A;  1STU A;  1HR0 E;  2B3T B;  4DR4 I;  5LMN I;  3LLH A;  5BR8 E;  4LF6 I;  1N33 E;  4DV4 E;  2ZM6 E;  3V5R A;  4DR1 I;  4LF7 I;  4DV5 I;  3B82 A; 
#chains in the Genus database with same CATH topology
 1Z0T A;  4MU4 A;  3J81 C;  1G2F C;  2Z5B B;  2YRK A;  4MLQ A;  5JEA C;  4LFA I;  3BGH A;  3QT8 A;  1N0V C;  3UHM A;  1OJ4 A;  3M6A A;  4LF4 E;  5F3W A;  5C0X F;  1ZM3 A;  3M99 B;  1YH8 A;  4MLV A;  5AC5 A;  2EWL A;  3HPZ A;  1A1H A;  2ADR A;  5KL5 A;  2EOJ A;  2EOQ A;  2A2C A;  5A6B D;  2C38 B;  2PO1 B;  5C0X D;  2M7Q A;  4JI0 E;  2H36 X;  3JU0 A;  3GCM A;  2L6M A;  3J80 Q;  4URL A;  3OTO E;  3ZOQ B;  1T39 A;  3K85 A;  2LT7 A;  4FK5 C;  2LBS B;  2AJ4 A;  1HNW I;  1XXE A;  1N3G A;  2V83 A;  4JYA I;  4OO1 E;  4ZYE A;  1UN6 B;  1WXR A;  1D6T A;  1K47 A;  4R2Q A;  1U2R A;  3BBG A;  2YPN A;  4LFC I;  2O1V A;  3EQ1 A;  1DAR A;  1ZBQ A;  2DEJ A;  1IQS A;  2EM7 A;  2FGG A;  3H09 A;  4M9V C;  2NN6 B;  2L2K B;  1FJG E;  2UU9 E;  2JE6 B;  4LF8 I;  4LCG A;  2LTS A;  3P1X A;  1HR0 I;  1HNZ I;  1S16 A;  4B3T E;  4UTG A;  2EOZ A;  4DUZ E;  2JVA A;  3IWD A;  2DRP A;  4JI3 E;  1DI2 A;  1YSA C;  1B62 A;  5AAS A;  2YRM A;  2YTJ A;  2UXB E;  2PO0 A;  5BR8 I;  4P52 A;  4DV2 E;  1MG7 A;  1USV A;  3Q6N A;  2KOU A;  4DV4 I;  2ZM6 I;  1N33 I;  3IWB A;  4AQY E;  1DQ3 A;  1RRE A;  1WUU A;  3EPJ A;  2BR2 B;  3J7Y p;  4BMJ A;  3WU4 A;  3K6Q A;  3MHS C;  1IBK E;  4MYT A;  5A6A A;  2EM9 A;  1EA6 A;  3LML A;  1GQE A;  5KL2 A;  3T1Y E;  5C0X C;  3JAM C;  1WJP A;  2UUC E;  1PJQ A;  5LLQ A;  4LF4 I;  4DPW A;  4X62 E;  2E1R A;  4HAC A;  3HXL A;  2RS7 A;  1H7S A;  5T6J A;  1VI7 A;  2MKD A;  3MHH C;  2EMK A;  3ADG A;  1QNT A;  2N3H A;  4J8Z A;  4M30 A;  4WSP A;  1Z0G A;  4JI0 I;  1X5W A;  3J80 C;  3DF6 A;  2E72 A;  4DU7 A;  3OTO I;  1UHZ A;  2LUQ A;  5AE1 A;  4GKJ E;  2B7T A;  1WHQ A;  2YSO A;  2V88 A;  2YT4 A;  4IS1 C;  2WW4 A;  1T4N A;  2X36 A;  2EL5 A;  1GZ6 A;  2EOX A;  1KIJ A;  4IZJ A;  4R1F A;  2JP9 A;  2J7K A;  3LNU A;  4M1K A;  4HYM A;  2BB8 A;  3J7A G;  4IZJ D;  2EM3 A;  4DR3 E;  4RH8 A;  3ADI A;  1T4L B;  1FJG I;  1NHI A;  2UU9 I;  2EMG A;  4DR1 E;  3C4T A;  1PDA A;  4JI6 E;  2WNR A;  2EZ6 A;  2VF1 A;  4RPF A;  4B3T I;  3QG5 C;  2EOI A;  4DUZ I;  1TF6 A;  4JI3 I;  3ZZ0 A;  4Q28 A;  2UUA E;  4NXN E;  5FWK A;  4OOG C;  2UXB I;  2VQF E;  2O1W A;  1NEI A;  2K4V A;  2L33 A;  4JI4 E;  2C39 A;  4KQV A;  3J81 Q;  2L8T A;  4DV2 I;  3M7N G;  2PNZ B;  3T1H E;  3TQM A;  3U1K A;  2EMZ A;  2EOR A;  4DR5 E;  1N32 E;  5JEA B;  3AV0 A;  4WXC A;  2MKN A;  4ZYD A;  4U3B A;  2LRS A;  2C37 B;  1IBK I;  2EPX A;  1YZ9 A;  3HTX A;  3T1Y I;  2N3G A;  2YWQ A;  1ELO A;  1A1G A;  2VF3 A;  2UUC I;  2R76 A;  3M85 D;  4M0V A;  2VQE E;  3CDJ A;  1ZM9 A;  2JEA B;  3Q1Q A;  4USK A;  1A1K A;  4X62 I;  3C4B A;  2YZT A;  2R1F A;  4GZN C;  1HK7 A;  3ZKB A;  3V2U C;  2MC6 A;  4BS9 A;  4I3H A;  1WRJ A;  1SFE A;  4DV0 E;  4ZYH A;  1USU A;  3DD6 A;  4OX9 E;  4GKK E;  2FTX B;  1A1L A;  3ZKD A;  2LO3 A;  2JWO A;  2YSP A;  1HNZ E;  2CG9 A;  2JEB A;  2EPU A;  4GKJ I;  5K36 E;  2EL6 A;  2V2Z A;  3C6K A;  1B63 A;  2IOQ A;  4K0K E;  1F2I G;  4ED4 A;  4F6N A;  4DR3 I;  4IFD F;  2GPI A;  4WUD A;  1YYK A;  2RSI A;  2L3J A;  4JI6 I;  2CSH A;  2V8P A;  4TUI A;  5KL7 A;  3CWV A;  3F0N A;  2Z5C A;  1MX0 A;  4PRX A;  5K36 A;  2ODR D;  5A6J A;  5DRP A;  2WBS A;  2EOM A;  2YTD A;  2LJP A;  4NZV A;  4NXN I;  2UUA I;  1EH7 A;  2VQF I;  2LJH A;  2V87 A;  4JI4 I;  2EM4 A;  2EN1 A;  4Q35 B;  1QZR A;  3JAM Q;  2EMY A;  1H74 A;  3T1H I;  2DGC A;  2I13 A;  5C0X B;  4DR5 I;  1N32 I;  4OO1 F;  3K1J A;  2L92 A;  1Y60 A;  1ZXM A;  4LTY A;  2EOH A;  4X65 E;  4P78 A;  1HNX E;  2HGH A;  2ENC A;  4BCA A;  1FWL A;  1R6M A;  1Z0V A;  3P06 A;  1N34 E;  4OO1 A;  4WX9 A;  4EMD A;  4OO1 D;  1ZM4 A;  3BID A;  1UBD C;  1J26 A;  1I94 E;  3QT5 A;  1KYQ A;  4F6M A;  4FW3 A;  2VQE I;  4GQU A;  2EPZ A;  2L3C A;  3P76 A;  3B8H A;  2EMF A;  2EMW A;  2UXC E;  5C0X E;  5DNY A;  4YY3 E;  1KVK A;  4O5G A;  2N8X A;  1OYP A;  2IHR 1;  2PNM A;  2DMI A;  3B78 A;  3EPL A;  1OYR A;  4DV0 I;  4O24 A;  2KON A;  3B4T A;  2WP8 A;  1O0W A;  2EPP A;  4BBY A;  4WPY A;  4KWY A;  4M2Z A;  2Z5B A;  4LCH A;  4OX9 I;  4GKK I;  2EN2 A;  1P47 A;  2GS8 A;  3PS3 A;  2V34 A;  1IBM E;  2YTI A;  1EKZ A;  1BBO A;  1Z0E A;  2BA1 D;  2HFS A;  2ODR C;  2HK2 A;  2PNL A;  4FW6 A;  4IFD C;  2BM1 A;  4FN5 A;  1X49 A;  2EMH A;  4F54 A;  2B9D A;  4JI2 E;  3H4L A;  2EPA A;  2YTP A;  4K0K I;  2CTD A;  3VHT B;  4LPF A;  2PO1 A;  5IV8 B;  5KL4 A;  2NN6 E;  1R6L A;  4LF9 E;  4B3R E;  3P3G A;  4DV7 E;  2Q8U A;  2JT2 A;  2EM0 A;  1TN9 A;  4IZK B;  2DSY A;  1X3C A;  3C6M A;  3NZK A;  1YYO A;  4AID A;  2LVH A;  2EFG A;  4OO1 C;  3FIG A;  2NN6 A;  5IT9 C;  2JE6 A;  4WUB A;  1Z5A A;  1X6E A;  1XMQ E;  3QT7 A;  2VRD A;  4DMI A;  2EOF A;  4X65 I;  1HNX I;  1XNR E;  2DIX A;  3K17 A;  2BA0 D;  1N34 I;  1H7U A;  3GME A;  2RSM A;  1G2D C;  2WCC 3;  2J7J A;  2O1T A;  1I94 I;  4WUC A;  1BKN A;  1ZU1 A;  2EN8 A;  2M9A A;  4LU9 A;  2EOE A;  4Z7C A;  2UXC I;  4YY3 I;  2JOB A;  2GO3 A;  2BR2 A;  3CDI A;  3GLL A;  2RPC A;  3P3C A;  3IWC A;  4BA2 B;  2LJU A;  4YHH E;  3PYG A;  1RR9 A;  4NHR A;  3WU6 A;  3VK6 A;  2GLI A;  1OYS A;  3GON A;  4L5N C;  4DR6 E;  3THN A;  2GQ0 A;  1RC7 A;  4NXM E;  4PRV A;  1YYW A;  1IBM I;  1PIE A;  1Y6Z A;  2NUE A;  4IJD A;  3EPH A;  1KKH A;  2EMX A;  1Z5B A;  4JI2 I;  1X48 A;  2MDR A;  2RS6 A;  3OML A;  3HJC A;  4L8N A;  2LUP B;  4NBQ A;  4R2P A;  2EM2 A;  3ADL A;  1KTV A;  2IOP A;  3PYF A;  4LF9 I;  2HJJ A;  4B3R I;  4B3M E;  5KL3 A;  5A2Q C;  4DV7 I;  2IER A;  2LTR A;  5DRR A;  4DPY A;  2EPR A;  4BHB A;  1P42 A;  2EMI A;  1RMD A;  3PS1 A;  3WU3 A;  4DUY I;  5IWA E;  4X66 E;  4DR2 E;  1Z1B A;  1MEY C;  4JI5 E;  5CFF E;  4JV5 E;  1UEK A;  2V86 A;  2EP3 A;  1JK2 A;  1L4S A;  4BA1 A;  2EM5 A;  4FW9 A;  5JEA E;  2EN6 A;  1XMQ I;  2L2M A;  4F9A B;  2MC5 A;  5LMU E;  2CPN A;  2YTO A;  2LMZ A;  1XNR I;  1UDO A;  2PO2 A;  1FI4 A;  2HHH E;  4HEI A;  4O4K A;  4JI1 E;  1UIL A;  1Z5C A;  3L7Z A;  1XNQ E;  2L2N A;  1T4O A;  2EML A;  4WXD A;  4X64 E;  2DEI A;  4R2A A;  2JPA A;  2O3Z A;  2PNZ A;  1XMO E;  4Z7Y A;  5EKW A;  5JEA A;  3HPS A;  4P7D A;  4DPX A;  2BBG A;  4I8O A;  1ZM2 A;  2C37 A;  2WBU A;  2DB2 A;  4YHH I;  2EJ4 A;  1YUI A;  4HY1 A;  2J65 A;  5EL9 A;  3ZZT A;  4IFD B;  2DLQ A;  4JI8 E;  4DXL A;  2EPM X;  4DR6 I;  5K36 F;  4R2S A;  1NHJ A;  1A1I A;  2JEA A;  4NXM I;  5LL6 R;  5A6K A;  4N3O A;  2EQ1 A;  5K36 D;  2YTG A;  2JOX A;  2E5L E;  3MSW A;  2FV4 B;  2YTN A;  1J5E E;  1SR9 A;  2UUB E;  2F4V E;  2Q2E B;  4IFD E;  2EQ3 A;  1JK1 A;  4B3M I;  5IT9 Q;  1FWK A;  4OO1 B;  3RMP A;  1X6H A;  2VES A;  3L00 A;  1Z0C A;  3P3E A;  4ZVI A;  2IES A;  1IQO A;  4F9C B;  1ZXN A;  3PYD A;  1PJT A;  5AC4 A;  5IWA I;  4FW7 A;  4X66 I;  2EPO A;  2PRT A;  2I9I A;  2HFU A;  4DR2 I;  4JI5 I;  4JV5 I;  3VYX A;  4FWG A;  1BBG A;  2X7I A;  4PU9 A;  3JTZ A;  3F6G A;  2DLK A;  4LFB E;  3M7N D;  2EOO A;  2EPC A;  4TUG A;  4R2E A;  2WP8 B;  5LMU I;  4KHP E;  5ADZ A;  4B3S E;  4HXZ A;  2EN3 A;  3KRN A;  2HHH I;  2EL4 A;  4JI1 I;  2M4I A;  2EM8 A;  1E3P A;  4DV1 E;  1XNQ I;  1A1J A;  1RHY A;  4FWH A;  2CZ9 A;  2JXP A;  1EH8 A;  4HTG A;  4FWD A;  3UK3 C;  4X64 I;  2F8B A;  4BHC A;  5A6B A;  1XMO I;  2V2Q A;  5C0X A;  2PO0 B;  2KHX A;  1PKP A;  5K36 C;  2V85 A;  1PJS A;  3LPS A;  2UXD E;  2B7V A;  2C38 A;  4U3D A;  4FW4 A;  2NPF A;  4JI8 I;  4AIM A;  1MU5 A;  3DJW A;  3PYE A;  1Z0W A;  4USM A;  4DPT A;  2NUF A;  2ELZ A;  4KZS A;  1ZBT A;  1S4E A;  4LF5 E;  5A2Q Q;  2JR1 A;  1VIS A;  4MDT A;  4DV3 E;  2NAB A;  4MU1 A;  4WYQ B;  2AE8 A;  4MU3 A;  2BM0 A;  2OI2 A;  4QNJ A;  2EMA A;  2NN6 F;  4DV6 I;  4ISA A;  3D4J A;  4DUY E;  3J7A M;  2E5L I;  2YTQ A;  2A2D A;  1WHN A;  4HAC B;  2BV3 A;  1J5E I;  2UUB I;  1N0U A;  3Q6M A;  2F4V I;  1X47 A;  1B69 A;  5DRQ A;  5GME A;  2CGE A;  2DMY A;  2NN6 D;  2D9H A;  1IBL E;  1A6F A;  1NHH A;  5FLX Q;  3M85 G;  4R03 A;  3AUZ A;  2JYA A;  2O1U A;  2YRH A;  4IZJ B;  4JI7 E;  1N36 E;  4DR7 E;  2HKE A;  2RTX A;  5DRO A;  4LFB I;  2NUG A;  2R3V A;  1AAY A;  4KHP I;  4B3S I;  4IZK A;  5AE2 A;  4LCF A;  4BC7 A;  1E3H A;  1EH6 A;  1BB8 A;  1PVG A;  2WNR B;  1TF3 A;  1RQ0 A;  4DPU A;  2EQ0 A;  2G7H A;  4DV1 I;  2VE7 C;  3WU5 A;  1YFH A;  2EMB A;  2EOS A;  2JY9 A;  3BF2 A;  3KZY A;  4WSG A;  1GTK A;  1FNM A;  5DNX A;  1Y4U A;  3H1C A;  3ADJ A;  3HQ1 A;  1Y4S A;  4R2C A;  2NA2 A;  1ZAA C;  2C39 B;  4LOM A;  3KWR A;  3QT6 A;  1NZ0 A;  2WZO A;  4R2D A;  2UXD I;  1UDN A;  1Z0B A;  4OZE A;  1FKA E;  4BC9 A;  1QU6 A;  2NN6 C;  5L3J A;  4DKK A;  2CT1 A;  2R42 A;  4DR4 E;  4LF5 I;  4IFD D;  2EPL X;  5LMN E;  4DV3 I;  1XHK A;  4RHB B;  5ELW A;  1MGT A;  1AH5 A;  2EMC A;  4LF6 E;  2E1M A;  2LE2 A;  3KZZ A;  2GO4 A;  5IXM B;  4J3D A;  4OKG A;  4BA2 A;  2HC5 A;  2V8Q B;  4F9B B;  3U1Y A;  4BA1 B;  2HKJ A;  2EN7 A;  5TSE A;  3ECR A;  3HUL A;  4LF7 E;  1KJK A;  2V2V A;  5FLX C;  4WFT A;  1A1F A;  5GMD A;  4DV5 E;  4JG4 A;  1IBL I;  2PO2 B;  4X8W A;  3L7Z B;  2GHF A;  2YU5 A;  4LFA E;  3F6H A;  2CVE A;  3LTO A;  1Z59 A;  1UDQ A;  5AE3 A;  4MQY A;  2LV2 A;  1UDS A;  2HK3 A;  2WBT A;  3THO B;  1YHC A;  2JEB B;  4AQY I;  1LLM C;  4F2J C;  3HKM A;  4P7A A;  3PS2 A;  1X6F A;  5DNL A;  1ZR9 A;  5JEA F;  2M1S A;  1T38 A;  1N36 I;  1DGC A;  4JI7 I;  2LCE A;  4DR7 I;  4O43 A;  1IMU A;  1EI1 A;  2YTF A;  2ZBK B;  2K7I A;  2EE8 A;  5JEA D;  4AM3 A;  3VYY A;  4QNK A;  2BA1 G;  4UT4 A;  4XTJ A;  1Y5Y A;  2Z5E A;  1HNW E;  4N4R B;  2F1D A;  1H72 C;  2Z5C B;  4MU0 A;  2EN4 A;  5K36 B;  2YU8 A;  3ZM7 A;  4JYA E;  2MDG A;  1H73 A;  2EOY A;  2XEX A;  1YPN A;  2ELY A;  3ZZU A;  2EM6 A;  1NCS A;  4ZYG A;  4LFC E;  2EPN A;  2ENH A;  4LF8 E;  4DV6 E;  4FW5 A;  2ZIT A;  2RQL A;  4DU8 A;  4MYU A;  1STU A;  1HR0 E;  3PRY A;  5A69 A;  2V89 A;  4R2R A;  2B3T B;  2EPK X;  1YUJ A;  4DR4 I;  4R8O A;  4X9J A;  4GEQ B;  5LMN I;  5KL6 A;  3LLH A;  5BR8 E;  4IS9 A;  4LF6 I;  1N33 E;  4DV4 E;  2ENA A;  2ZM6 E;  3V5R A;  4DR1 I;  2A25 A;  2BA0 G;  4IFD A;  3EPK A;  4LF7 I;  2YTE A;  4DV5 I;  3B82 A; 
#chains in the Genus database with same CATH homology
 1Z0T A;  3J81 C;  2Z5B B;  4LFA I;  3QT8 A;  1N0V C;  1OJ4 A;  3M6A A;  4LF4 E;  5F3W A;  1ZM3 A;  2EWL A;  3HPZ A;  2A2C A;  2M7Q A;  4JI0 E;  2H36 X;  3JU0 A;  2L6M A;  3J80 Q;  4URL A;  3OTO E;  3ZOQ B;  3K85 A;  2AJ4 A;  2LBS B;  1HNW I;  2V83 A;  4JYA I;  1WXR A;  1D6T A;  1K47 A;  1U2R A;  4LFC I;  2O1V A;  2DEJ A;  1DAR A;  1ZBQ A;  4DPY A;  2FGG A;  3H09 A;  4LF8 I;  2L2K B;  1FJG E;  2UU9 E;  2LTS A;  3P1X A;  1HR0 I;  1HNZ I;  1S16 A;  4B3T E;  4UTG A;  4DUZ E;  1DI2 A;  2JVA A;  3IWD A;  4JI3 E;  1B62 A;  5AAS A;  2UXB E;  5BR8 I;  4P52 A;  4DV2 E;  1MG7 A;  1USV A;  3Q6N A;  2KOU A;  4DV4 I;  2ZM6 I;  1N33 I;  3IWB A;  4AQY E;  1DQ3 A;  1RRE A;  1WUU A;  3J7Y p;  4BMJ A;  3WU4 A;  3K6Q A;  1IBK E;  4MYT A;  1EA6 A;  3LML A;  1GQE A;  3T1Y E;  3JAM C;  2UUC E;  4LF4 I;  4DPW A;  4X62 E;  2E1R A;  4HAC A;  3HXL A;  2RS7 A;  1H7S A;  5T6J A;  3ADG A;  2N3H A;  4J8Z A;  4M30 A;  4WSP A;  1Z0G A;  4JI0 I;  3J80 C;  3DF6 A;  4DU7 A;  3OTO I;  1UHZ A;  2LUQ A;  5AE1 A;  4GKJ E;  2B7T A;  1WHQ A;  2V88 A;  2YT4 A;  2WW4 A;  1T4N A;  2X36 A;  1GZ6 A;  1KIJ A;  4IZJ A;  4R1F A;  3LNU A;  2J7K A;  4M1K A;  4HYM A;  4IZJ D;  3J7A G;  4DR3 E;  3ADI A;  1T4L B;  1FJG I;  1NHI A;  2UU9 I;  4DR1 E;  3C4T A;  4JI6 E;  2EZ6 A;  2VF1 A;  4RPF A;  4B3T I;  4DUZ I;  4JI3 I;  3ZZ0 A;  4Q28 A;  2UUA E;  4NXN E;  5FWK A;  4OOG C;  2UXB I;  2VQF E;  2O1W A;  4JI4 E;  2K4V A;  2L33 A;  4KQV A;  3J81 Q;  4DV2 I;  2L8T A;  3T1H E;  4DR5 E;  1N32 E;  3AV0 A;  2LRS A;  1IBK I;  1YZ9 A;  3HTX A;  3T1Y I;  2N3G A;  1ELO A;  2VF3 A;  2UUC I;  4M0V A;  2VQE E;  3Q1Q A;  1ZM9 A;  4USK A;  4X62 I;  3C4B A;  2YZT A;  1HK7 A;  3ZKB A;  3V2U C;  2MC6 A;  4BS9 A;  4I3H A;  4DV0 E;  1USU A;  4OX9 E;  4GKK E;  2FTX B;  3ZKD A;  2JWO A;  1HNZ E;  2CG9 A;  4GKJ I;  2V2Z A;  1B63 A;  2IOQ A;  4K0K E;  4ED4 A;  4DR3 I;  4WUD A;  1YYK A;  2L3J A;  4JI6 I;  2V8P A;  4TUI A;  3CWV A;  3F0N A;  2Z5C A;  1MX0 A;  4PRX A;  2ODR D;  2LJP A;  4NXN I;  2UUA I;  2VQF I;  2LJH A;  2V87 A;  4JI4 I;  1QZR A;  3JAM Q;  3T1H I;  1H74 A;  4DR5 I;  1N32 I;  3K1J A;  2L92 A;  1ZXM A;  4LTY A;  4X65 E;  4P78 A;  1HNX E;  1FWL A;  4BCA A;  1Z0V A;  3P06 A;  4DPX A;  1N34 E;  4EMD A;  1ZM4 A;  1J26 A;  1I94 E;  3QT5 A;  2VQE I;  2L3C A;  3B8H A;  2UXC E;  5DNY A;  4YY3 E;  1KVK A;  2PNM A;  2IHR 1;  3B78 A;  4DV0 I;  2KON A;  1O0W A;  4BBY A;  4WPY A;  4M2Z A;  2Z5B A;  4OX9 I;  4GKK I;  2GS8 A;  2V34 A;  1IBM E;  2HFS A;  1EKZ A;  1Z0E A;  2PNL A;  2ODR C;  2HK2 A;  2BM1 A;  4FN5 A;  1X49 A;  4F54 A;  4JI2 E;  2B9D A;  3H4L A;  4K0K I;  4LF9 E;  4B3R E;  4DV7 E;  4IZK B;  2DSY A;  1YYO A;  2EFG A;  3FIG A;  5IT9 C;  4WUB A;  1Z5A A;  1XMQ E;  3QT7 A;  4DMI A;  4X65 I;  1HNX I;  1XNR E;  2DIX A;  3K17 A;  1N34 I;  1H7U A;  2RSM A;  2O1T A;  1I94 I;  4WUC A;  1BKN A;  4Z7C A;  2UXC I;  4LU9 A;  4YY3 I;  2JOB A;  3IWC A;  4YHH E;  3PYG A;  1RR9 A;  3WU6 A;  3VK6 A;  3GON A;  4L5N C;  4DR6 E;  2GQ0 A;  1RC7 A;  4NXM E;  4PRV A;  1YYW A;  1IBM I;  1PIE A;  1Y6Z A;  2NUE A;  1Z5B A;  1KKH A;  4JI2 I;  1X48 A;  2RS6 A;  2MDR A;  3OML A;  3HJC A;  4L8N A;  2LUP B;  3ADL A;  1KTV A;  2IOP A;  3PYF A;  4LF9 I;  4B3R I;  4B3M E;  5A2Q C;  4DV7 I;  2LTR A;  3WU3 A;  4DUY I;  5IWA E;  4X66 E;  4DR2 E;  4JI5 E;  4JV5 E;  1UEK A;  5CFF E;  2V86 A;  4FW9 A;  1XMQ I;  2L2M A;  4F9A B;  2MC5 A;  5LMU E;  2CPN A;  2LMZ A;  1XNR I;  1FI4 A;  2HHH E;  4JI1 E;  1Z5C A;  1UIL A;  1XNQ E;  2L2N A;  1T4O A;  4X64 E;  2DEI A;  1XMO E;  4Z7Y A;  3HPS A;  4P7D A;  4I8O A;  1ZM2 A;  4YHH I;  2DB2 A;  4HY1 A;  3ZZT A;  4JI8 E;  4DXL A;  4DR6 I;  1NHJ A;  4NXM I;  5LL6 R;  4N3O A;  2JOX A;  2E5L E;  3MSW A;  2FV4 B;  1J5E E;  2UUB E;  1SR9 A;  2F4V E;  2Q2E B;  4B3M I;  5IT9 Q;  1FWK A;  3RMP A;  1Z0C A;  4ZVI A;  4F9C B;  1ZXN A;  3PYD A;  5IWA I;  4X66 I;  2HFU A;  4DR2 I;  4JI5 I;  4JV5 I;  3VYX A;  4FWG A;  2X7I A;  4PU9 A;  3JTZ A;  3F6G A;  4LFB E;  4TUG A;  5LMU I;  4KHP E;  5ADZ A;  4B3S E;  4HXZ A;  2HHH I;  4JI1 I;  2M4I A;  4DV1 E;  1XNQ I;  4FWH A;  2CZ9 A;  4FWD A;  4X64 I;  2F8B A;  1XMO I;  2V2Q A;  2KHX A;  1PKP A;  2V85 A;  3LPS A;  2UXD E;  2B7V A;  2NPF A;  4JI8 I;  1MU5 A;  3DJW A;  3PYE A;  1Z0W A;  4USM A;  4DPT A;  2NUF A;  4KZS A;  1ZBT A;  1S4E A;  4LF5 E;  5A2Q Q;  2JR1 A;  1VIS A;  4DV3 E;  4WYQ B;  2BM0 A;  2OI2 A;  4DV6 I;  3D4J A;  4DUY E;  3J7A M;  2E5L I;  2A2D A;  1WHN A;  4HAC B;  2BV3 A;  1J5E I;  2UUB I;  1N0U A;  3Q6M A;  2F4V I;  1X47 A;  5GME A;  2CGE A;  2DMY A;  1IBL E;  1A6F A;  1NHH A;  5FLX Q;  4R03 A;  3AUZ A;  2O1U A;  4IZJ B;  4JI7 E;  1N36 E;  4DR7 E;  2HKE A;  2RTX A;  4LFB I;  2NUG A;  2R3V A;  4KHP I;  4B3S I;  4IZK A;  5AE2 A;  4BC7 A;  1PVG A;  4DPU A;  1RQ0 A;  4DV1 I;  2G7H A;  2VE7 C;  3WU5 A;  2JY9 A;  1FNM A;  1Y4U A;  3ADJ A;  3HQ1 A;  1Y4S A;  2NA2 A;  3KWR A;  3QT6 A;  1NZ0 A;  2WZO A;  2UXD I;  1Z0B A;  1FKA E;  4BC9 A;  1QU6 A;  5L3J A;  4DKK A;  2R42 A;  4DR4 E;  4LF5 I;  5LMN E;  4DV3 I;  1XHK A;  4LF6 E;  2E1M A;  2LE2 A;  2V8Q B;  4F9B B;  2HKJ A;  3HUL A;  4LF7 E;  2V2V A;  5FLX C;  4WFT A;  5GMD A;  4DV5 E;  4JG4 A;  1IBL I;  4X8W A;  4LFA E;  3F6H A;  3LTO A;  1Z59 A;  5AE3 A;  2HK3 A;  4AQY I;  4P7A A;  2M1S A;  1N36 I;  4JI7 I;  4DR7 I;  2ZBK B;  1EI1 A;  3VYY A;  4UT4 A;  4XTJ A;  2Z5E A;  1HNW E;  1H72 C;  2Z5C B;  3ZM7 A;  4JYA E;  1H73 A;  2XEX A;  3ZZU A;  4LFC E;  4LF8 E;  4DV6 E;  2ZIT A;  4DU8 A;  4MYU A;  1STU A;  1HR0 E;  3PRY A;  2V89 A;  2B3T B;  4DR4 I;  4R8O A;  4GEQ B;  5LMN I;  3LLH A;  5BR8 E;  4LF6 I;  1N33 E;  4DV4 E;  2ZM6 E;  3V5R A;  4DR1 I;  4LF7 I;  4DV5 I;  3B82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...