2F4VE

30s ribosome + designer antibiotic
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2f4vE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2f4vE02
2DMYA 1XNRE 5LMNI 3PYEA 1H74A 4NXNE 2HK3A 1T4OA 2V2QA 4DV7E 4NXME 5BR8E 1UILA 1FWKA 3Q1QA 4XTJA 4DV4I 1ZXNA 3VYXA 2E5LI 1U2RA 1RC7A 4JI0E 3P1XA 1FNMA 1H7SA 2ZITA 3J81Q 3T1HI 2L3JA 3D4JA 2DEIA 4HACA 1EA6A 4DKKA 1XHKA 4JI4E 2DIXA 5LMNE 2OI2A 3LTOA 2R3VA 3HTXA 1UEKA 4DPUA 1N32I 4WUCA 2HKEA 2AJ4A 5LMUI 1IBLI 4DV4E 2NPFA 3QT8A 4ED4A 1Z0WA 5IWAI 2B3TB 3T1HE 4M2ZA 1PIEA 3QT6A 4JV5I 3ZZ0A 2UUCI 2LTSA 1Z0TA 3JAMC 4DR5I 1T4LB 2DEJA 1XMQI 1WHQA 3WU6A 4DR1I 2KHXA 4LF4I 1IBKI 3ADGA 2VF3A 1YYWA 5LMUE 1IBLE 4DV2I 3GONA 4HY1A 4Z7YA 3B8HA 2EFGA 5IWAE 1PKPA 1YYKA 1Z59A 4JV5E 3K17A 1XMOI 2UUCE 3PYGA 3ADLA 4JG4A 4X64I 4FN5A 4B3TI 3H4LA 2NA2A 1XMQE 1ZXMA 4DR3I 1GQEA 4JI5I 4JI4I 4DR1E 5GMEA 1HR0I 4JI3I 1FKAE 4LF4E 1IBKE 1PVGA 1FWLA 3V2UC 2UU9I 2F4VI 2RS7A 3C4TA 1Z0EA 2UUAI 4DV0I 1J5EI 4WFTA 4MYUA 4JI2E 4LF5I 2UXDI 2N3HA 3VYYA 4GKKI 1QZRA 2LRSA 4JI1I 2HK2A 5FLXQ 4X64E 4B3TE 1N0VC 4DV5E 3LLHA 5LL6R 4DR3E 4JI5E 4JI6I 1HR0E 4JI3E 2CPNA 2LJHA 3PYDA 2VQFI 3ADIA 3T1YI 2VQEI 2UXCE 2UU9E 2F4VE 1ZM9A 1Z0VA 2X36A 1N0UA 3J81C 2UUAE 4LF6I 2RS6A 4DV0E 1KIJA 4LF9E 1J5EE 4FW9A 1I94I 2XEXA 3B78A 2JY9A 1HNZI 2N3GA 4M30A 4LF5E 2UXDE 4URLA 4LFBI 1H73A 1H72C 4B3SI 2LBSB 4B3MI 4DXLA 4GKKE 3OTOI 4JI1E 2L33A 1N33I 4P7AA 4OX9I 2LUQA 1DARA 4JI6E 4LF7I 2LJPA 1OJ4A 4DUZI 1A6FA 2VQFE 1KKHA 1KVKA 2HKJA 4USMA 2VQEE 1EI1A 5A2QQ 1N36I 4LF6E 4YY3I 2A2DA 2E5LE 1NZ0A 2L2MA 3J80C 1I94E 5IT9C 4I3HA 2V8PA 4LFBE 4B3SE 4B3ME 1YYOA 2MDRA 4LFCI 4OX9E 1Z5BA 3ADJA 4RPFA 1N32E 1HNWI 4DPXA 2A2CA 4X66I 3ZZUA 4DUYI 1N36E 4X65I 4DV1I 2NUGA 3QT7A 4USKA 1FJGI 1X47A 4DR5E 2Q2EB 2R42A 1ZBTA 2JVAA 4YHHI 1T4NA 4M1KA 4DR7I 3F0NA 1NHHA 4WYQB 1WUUA 4JI8I 4DPWA 4AQYI 2WW4A 4OOGC 1HNWE 1WHNA 4X66E 4DV2E 1Z0GA 3HULA 4X65E 4DV1E 4B3RI 1Z5AA 5CFFE 1XMOE 2UUBI 1ELOA 1FJGE 4DU8A 5FLXC 3J7AM 2BM1A 4PU9A 4FWHA 4JI8E 2GS8A 3J7Yp 1FI4A 1ZM2A 3M6AA 3WU3A 4DU7A 4UTGA 1H7UA 4UT4A 4B3RE 1DI2A 3ZKBA 4X8WA 4X62I 3WU5A 4DV6I 2ZM6I 2UUBE 1ZM4A 4KQVA 1MG7A 2DB2A 2V2ZA 4K0KI 3LNUA 3B82A 3LPSA 4JI7I 4HXZA 1X48A 4DR2I 5A2QC 1S4EA 4DV3I 1NHIA 1IBMI 4DR6I 3T1YE 1BKNA 2L3CA 1N34I 2E1RA 3QT5A 1HNXI 1HNZE 4X62E 2J7KA 4DV6E 2ZM6E 1B62A 4MYTA 4FWGA 2B7VA 4LFAI 2X7IA 1O0WA 3OTOE 1RQ0A 1STUA 2RTXA 1YZ9A 4K0KE 1N33E 1MU5A 2ZBKB 4LF8I 4DPYA 4JI7E 1XNQI 1ZM3A 4LF7E 4DR2E 4DUZE 3J7AG 3J80Q 4DV3E 5IT9Q 1IBME 4DR6E 4YY3E 4KHPI 1N34E 2HHHI 2NUEA 3ZM7A 1HNXE 1VISA 3JAMQ 1S16A 4PRXA 2B7TA 3ZZTA 1RR9A 4LFAE 4DR4I 1EKZA 2CZ9A 1Z5CA 4JYAI 4WUBA 4LF8E 4LFCE 2LTRA 3K1JA 4GKJI 1XNQE 2UXBI 2LUPB 1K47A 3CWVA 1X49A 5GMDA 4JI2I 1B63A 4DUYE 3C4BA 4HYMA 4KHPE 3V5RA 1XNRI 4Z7CA 2HHHE 1NHJA 4ZVIA 1UHZA 2HFUA 4NXNI 2IHR1 4DV5I 1J26A 2L2NA 4DPTA 4PRVA 1Z0CA 4EMDA 4DR4E 2RSMA 4DV7I 1MX0A 4YHHE 2V34A 4NXMI 4DR7E 2HFSA 5BR8I 4JYAE 2NUFA 2UXCI 5L3JA 4HACB 4GKJE 4AQYE 4JI0I 1Z0BA 1D6TA 4LF9I 2UXBE 2V2VA 3ZKDA 4FWDA 2BV3A 1KTVA 2YT4A 2L2KB 3WU4A 3PYFA 4WUDA 2EZ6A 1QU6A 2BM0A 1RREA 4P52A 4R1FA
chains in the Genus database with same CATH superfamily
2DMYA 1XNRE 5LMNI 3PYEA 2Z5BB 2JPAA 1H74A 4MU0A 2JWOA 5K36C 4FK5C 1T39A 2D9HA 4NXNE 3RMPA 4F9CB 2JEAA 4YY3I 2V83A 2HK3A 3IWCA 4IZJB 5DNXA 4GEQB 2EJ4A 1T4OA 4R2RA 2V2QA 4R8OA 4DV7E 2EMIA 2WCC3 1EH6A 4NXME 5BR8E 2EOXA 4DMIA 1UILA 1FWKA 3Q1QA 2BA1D 3PS2A 5DNLA 4XTJA 4DV4I 4O43A 5C0XE 1ZXNA 2LV2A 3VYXA 2E5LI 1RC7A 1U2RA 1F2IG 3P1XA 4JI0E 1FNMA 1H7SA 3AV0A 2ZITA 3J81Q 3T1HI 2FTXB 4BBYA 2L3JA 5TSEA 3D4JA 2DEIA 4R2SA 3P3EA 4HACA 1EA6A 3GLLA 2PO1B 4AIDA 4DKKA 2EPUA 4HEIA 4JI4E 1XHKA 2DIXA 1IMUA 4IJDA 2J65A 2C39A 5LMNE 2OI2A 4R2QA 3LTOA 5K36D 4IS1C 2R3VA 3HTXA 3HQ1A 2YPNA 4P7DA 5KL4A 3MSWA 2ENCA 2YTOA 4MLQA 2EPLX 4NHRA 2MC5A 1UEKA 1TF6A 4DPUA 2DLQA 2HC5A 2CG9A 1N32I 4WUCA 4WX9A 1AAYA 2JT2A 2HKEA 4WXCA 2EL4A 2PNLA 2EN7A 4WSPA 2AJ4A 2WP8B 5A6KA 2MKNA 2EM6A 2CT1A 2YU8A 5C0XD 5LMUI 1IBLI 3P3CA 2EPMX 4DV4E 2NPFA 2YTEA 1L4SA 1Z0WA 5AE2A 3QT8A 4BA1B 4ED4A 2Q8UA 5IWAI 2B3TB 3T1HE 1XXEA 4M2ZA 2BA0D 1PIEA 3QT6A 4JV5I 3ZZ0A 1WRJA 2UUCI 2R1FA 2LTSA 3THOB 2B9DA 2EPXA 1Z0TA 2NN6D 4LTYA 3JAMC 4DR5I 2L92A 1T4LB 4R2AA 2DEJA 4R2CA 4NZVA 1IQOA 1XMQI 1WHQA 2EOJA 1E3HA 3TQMA 2CSHA 2M1SA 1G2DC 3BIDA 1EH8A 3WU6A 3M99B 2N8XA 4X9JA 4DR1I 2KHXA 2VF1A 2EMAA 4LF4I 5C0XA 2A25A 4F6NA 1IBKI 3ADGA 2JE6B 2VF3A 2JOBA 1YYWA 5LMUE 1IBLE 3VK6A 4DV2I 3GONA 3BF2A 2L6MA 4HY1A 2WP8A 1YHCA 4Z7YA 3B8HA 5AE3A 3F6HA 4M9VC 2EFGA 5IWAE 2C38A 1PKPA 1YYKA 1Z59A 1OYPA 3C6KA 1YUJA 4JV5E 3K17A 1XMOI 5KL7A 2UUCE 2CTDA 2NN6A 2JEAB 4F9BB 3ADLA 3PYGA 1P47A 1YSAC 3M85G 2EPPA 1USUA 4JG4A 3DD6A 4X64I 2EM9A 1NCSA 4FN5A 4B3TI 4BA2B 3H4LA 2ODRC 2EPKX 2NA2A 1XMQE 1ZXMA 1A1IA 4DR3I 4IFDC 1GQEA 4JI5I 4JI4I 4R2PA 4OO1C 2EMCA 4DR1E 5GMEA 1HR0I 1FKAE 4JI3I 4LF6I 4LF4E 3KZYA 1IBKE 1PVGA 2ELYA 1FWLA 3V2UC 2UU9I 2F4VI 2RS7A 3C4TA 1Z0EA 2UUAI 4DV0I 5JEAC 1J5EI 1JK1A 2JE6A 3L00A 4AM3A 2EM8A 2EM5A 3EPLA 2YU5A 2EOYA 4WFTA 2Z5EA 3UHMA 4MYUA 4FW7A 4LCHA 5KL3A 2YRMA 4O5GA 4JI2E 4LF5I 2UXDI 2EOMA 2N3HA 4I8OA 2EMXA 1GZ6A 3VYYA 3CDJA 4GKKI 2HJJA 1QZRA 2LRSA 3EQ1A 1SR9A 4JI1I 5K36E 2HK2A 5FLXQ 5T6JA 4X64E 1A1FA 4B3TE 2EOEA 4ZYDA 1G2FC 1RMDA 2ENHA 1N0VC 4DV5E 3LLHA 1X3CA 5LL6R 2LMZA 4DR3E 5A6BD 2YTIA 2LJUA 4JI5E 4TUGA 2EM0A 3P76A 4JI6I 2YTJA 1BBOA 1HR0E 3Q6NA 3ECRA 4JI3E 2CPNA 2LJHA 4BA2A 1PJSA 4MU1A 3PYDA 2FV4B 3KRNA 2VQFI 2EM7A 2JYAA 4L8NA 3ADIA 3T1YI 2VQEI 2UXCE 2UU9E 2F4VE 1RHYA 1Z0VA 1ZM9A 1N0UA 3J81C 2UUAE 2X36A 2V86A 2RS6A 2YRHA 4DV0E 1LLMC 3P3GA 5JEAD 2DMIA 2EORA 1KIJA 1TN9A 4R2EA 1ZR9A 1J5EE 4LF9E 2JEBB 2XEXA 5IXMB 4FW9A 4J3DA 5K36B 3B78A 2JY9A 2YTGA 2JXPA 2IOQA 1HNZI 2N3GA 2EMLA 4M30A 4BC9A 2JR1A 1UDNA 2YTPA 4LF5E 2UXDE 4Q35B 4URLA 4LFBI 1H73A 1H72C 4B3SI 2LBSB 4B3MI 2J7JA 2WBUA 4DXLA 4GKKE 3OTOI 2NN6E 4FW5A 2V88A 4JI1E 2L33A 4OZEA 1PJTA 2IERA 1N33I 4KZSA 5A6BA 3H1CA 4P7AA 5C0XB 4OX9I 2YTDA 4IZJD 4BC7A 4QNJA 2EMFA 2LUQA 1DARA 3FIGA 4JI6E 2PNMA 3HPSA 2YTNA 4LF7I 2LJPA 2EN1A 1OJ4A 4DUZI 2YWQA 1A6FA 2VQFE 1R6MA 2M9AA 1KKHA 1KVKA 1UBDC 2C38B 2HKJA 2VRDA 2VQEE 1EI1A 4USMA 5A2QQ 1N36I 2EMGA 2RQLA 4R03A 2EOSA 5LLQA 4LF6E 2A2DA 2E5LE 1NZ0A 5ADZA 2L2MA 1R6LA 2NN6B 3J80C 1KJKA 1I94E 5IT9C 4MQYA 4WPYA 1UDOA 5C0XF 1Y4UA 2EMBA 3PS3A 4I3HA 5AC4A 2V8PA 5KL6A 2JEBA 5AE1A 4TUIA 4LFBE 3P06A 2EP3A 4OKGA 5K36A 4B3SE 4B3ME 2EN8A 3DJWA 5A69A 2L8TA 3AUZA 2EOZA 3JTZA 1YYOA 5DRPA 3HXLA 2MDRA 5A6JA 4GZNC 2EM4A 1X6FA 4LFCI 3JU0A 1ZAAC 4OX9E 1Z5BA 3ADJA 2NN6F 2M7QA 3K6QA 4RPFA 4ISAA 2GO3A 2WNRA 3EPKA 2EPNA 1N32E 1HNWI 1BBGA 4DPXA 3KWRA 2A2CA 5EL9A 4X66I 1A1GA 2F8BA 2EPCA 3ZZUA 2KOUA 2EOHA 2MDGA 2PO2A 4DUYI 4LU9A 1N36E 3M7NG 5FWKA 4X65I 4DV1I 2NUGA 3QT7A 2LCEA 4USKA 4LCFA 2GQ0A 2YZTA 2V8QB 1B69A 2CGEA 1PJQA 4KWYA 2DLKA 1FJGI 2BB8A 1X47A 4DR5E 2Q2EB 3C6MA 1ZBTA 2JVAA 2YTQA 2R42A 4YHHI 1T4NA 5KL5A 4IS9A 4M1KA 4DR7I 3F0NA 1NHHA 2GLIA 3BGHA 1WJPA 4WYQB 1WUUA 4JI8I 4DPWA 4BCAA 1Z1BA 4IFDE 4AQYI 2WW4A 1Y5YA 5ELWA 4OOGC 4OO1E 1HNWE 3M85D 1WHNA 1EH7A 3K85A 4X66E 4LOMA 2JP9A 4DV2E 2EL5A 1Z0GA 5AASA 4FW6A 3HJCA 4F54A 3HULA 5A6AA 1ZU1A 4X65E 4DV1E 5IV8B 2I9IA 4IZKB 5JEAE 1SFEA 4R2DA 1Z5AA 4B3RI 2G7HA 5CFFE 2EE8A 2DRPA 1XMOE 3GMEA 2RSIA 2WBTA 2UUBI 4L5NC 2C37A 1ELOA 2O3ZA 1FJGE 4DU8A 5FLXC 2BR2A 2EPRA 1YUIA 3J7AM 2ADRA 1BB8A 2DSYA 2WBSA 2BM1A 4PU9A 4FWHA 1AH5A 2ODRD 2DGCA 2O1WA 4IFDD 2EQ1A 2VE7C 4JI8E 2GS8A 3MHSC 3J7Yp 4OO1D 2K4VA 1FI4A 5JEAB 3B4TA 2PNZA 2VESA 2PO0B 3BBGA 1ZM2A 2EM3A 4OO1F 3M6AA 3WU3A 4DU7A 5DRQA 4UTGA 4RH8A 1H7UA 4UT4A 4B3RE 2EQ0A 2F1DA 4M0VA 1DI2A 3ZKBA 1YFHA 4X8WA 1A1HA 4X62I 3WU5A 4DV6I 2EMZA 2EN3A 2BA1G 1OYRA 2ZM6I 4IZKA 1UN6B 5JEAF 2UUBE 3IWBA 4LCGA 5DROA 4U3BA 1ZM4A 3ZOQB 1I94I 1X6EA 1A1JA 2EN2A 4KQVA 1MG7A 2DB2A 2V87A 2HGHA 2V2ZA 1UDQA 2WNRB 4FW4A 4IFDA 2E72A 3LNUA 3B82A 4K0KI 3LPSA 4OO1A 5C0XC 3PRYA 5AC5A 3UK3C 4JI7I 5K36F 3H09A 1ZBQA 2PO2B 4HXZA 1X48A 4DR2I 2YSPA 2EOFA 5A2QC 1S4EA 4DV3I 1NHIA 4AIMA 4F6MA 1MEYC 4WXDA 1IBMI 4DR6I 5JEAA 3T1YE 1BKNA 2L3CA 2M4IA 2PO0A 3KZZA 1DQ3A 2JOXA 1N34I 2NN6C 2EOOA 3VHTB 1GTKA 2E1RA 3QT5A 1HNXI 4U3DA 2EPZA 1HNZE 1USVA 4X62E 2J7KA 4DV6E 2ZM6E 2LT7A 1B62A 4MYTA 1OYSA 2Z5BA 2LVHA 5EKWA 1Y60A 4LPFA 1PDAA 4FWGA 2B7VA 4LFAI 2GHFA 2X7IA 1O0WA 3OTOE 1RQ0A 3DF6A 1Y6ZA 1STUA 2RTXA 2BA0G 2ENAA 5DRRA 1YZ9A 1X5WA 4K0KE 1N33E 3PS1A 4IZJA 4NBQA 4ZYEA 1MU5A 2ZBKB 4MU3A 4LF8I 2MKDA 4DPYA 2FGGA 4JI7E 1XNQI 1DGCA 4MDTA 1ZM3A 4LF7E 2I13A 2PO1A 4DR2E 4DUZE 4P78A 3J7AG 4N4RB 3J80Q 4DV3E 1NEIA 2EM2A 1UDSA 5IT9Q 1IBME 2KONA 4DR6E 4Q28A 3U1YA 4YY3E 4KHPI 1N34E 1A1KA 2HHHI 2R76A 2V89A 2NUEA 2C37B 2O1UA 3ZM7A 4J8ZA 2ELZA 1HNXE 1VISA 2BR2B 2E1MA 1KYQA 3QG5C 3JAMQ 4RHBB 4BHCA 1S16A 1TF3A 3L7ZB 4PRXA 2IOPA 2GPIA 3U1KA 2B7TA 5DNYA 3ZZTA 1RR9A 3MHHC 4QNKA 4FW3A 3M7ND 4WSGA 4LFAE 1HK7A 4DR4I 3GCMA 1JK2A 1IQSA 1EKZA 1WXRA 4N3OA 1P42A 2CZ9A 4BS9A 1Z5CA 4JYAI 2EPAA 4ZYHA 4WUBA 2PNZB 4LF8E 1N3GA 2NABA 2LTRA 4LFCE 2Z5CB 2O1TA 3K1JA 2LO3A 4GKJI 4F2JC 1XNQE 1VI7A 2H36X 2UXBI 2LUPB 4ZYGA 3CDIA 2EOIA 4BMJA 2AE8A 1K47A 1YH8A 3CWVA 4MU4A 4BA1A 1YPNA 1X49A 1T38A 5GMDA 4JI2I 1B63A 2O1VA 4DUYE 3C4BA 3EPJA 3THNA 2LE2A 4KHPE 4HYMA 2EN4A 3HPZA 3V5RA 1XNRI 4Z7CA 1E3PA 2HHHE 1NHJA 4ZVIA 1UHZA 2HFUA 4NXNI 4O4KA 2EMHA 4O24A 4MLVA 3EPHA 2GO4A 2EPOA 2K7IA 2YRKA 2IHR1 4DV5I 4GQUA 1J26A 4IFDB 3Q6MA 2RPCA 1X6HA 2L2NA 2YSOA 4PRVA 1Z0CA 4DPTA 4EMDA 4OO1B 2BBGA 4DR4E 2RSMA 4BHBA 1MX0A 4DV7I 3L7ZA 2EMWA 4YHHE 2IESA 2V34A 4NXMI 4DR7E 2HFSA 5BR8I 2MC6A 3F6GA 4JYAE 2NUFA 2CVEA 2UXCI 2EQ3A 5L3JA 1MGTA 4HACB 3IWDA 1Y4SA 2EL6A 1QNTA 3LMLA 1A1LA 4AQYE 4GKJE 1Z0BA 4JI0I 4LF9I 1D6TA 2UXBE 2V2VA 3ZKDA 2EMKA 4FWDA 3OMLA 2PRTA 2EMYA 2WZOA 1KTVA 2BV3A 4F9AB 2C39B 2EOQA 2Z5CA 3HKMA 2YT4A 4HTGA 2L2KB 3WU4A 2EWLA 3PYFA 4WUDA 4IFDF 2EZ6A 2EN6A 1QU6A 2V85A 5KL2A 5F3WA 2BM0A 2YTFA 1RREA 3NZKA 4P52A 4R1FA
chains in the Genus database with same CATH topology
2DMYA 1XNRE 5LMNI 3PYEA 2Z5BB 1H74A 2JWOA 4NXNE 3RMPA 4F9CB 2V83A 2HK3A 3IWCA 4IZJB 4GEQB 1T4OA 2V2QA 4R8OA 4DV7E 4NXME 5BR8E 4DMIA 1UILA 1FWKA 3Q1QA 4XTJA 4DV4I 1ZXNA 3VYXA 2E5LI 1RC7A 1U2RA 4JI0E 3P1XA 1FNMA 1H7SA 3AV0A 2ZITA 3J81Q 3T1HI 2FTXB 4BBYA 2L3JA 3D4JA 2DEIA 4HACA 1EA6A 4DKKA 1XHKA 4JI4E 2DIXA 5LMNE 2OI2A 3LTOA 2R3VA 3HTXA 3HQ1A 4P7DA 3MSWA 2MC5A 1UEKA 4DPUA 2CG9A 1N32I 4WUCA 2HKEA 2PNLA 4WSPA 2AJ4A 5LMUI 1IBLI 4DV4E 2NPFA 3QT8A 4ED4A 1Z0WA 5AE2A 5IWAI 2B3TB 3T1HE 4M2ZA 1PIEA 3QT6A 4JV5I 3ZZ0A 2UUCI 2LTSA 2B9DA 1Z0TA 4LTYA 3JAMC 4DR5I 2L92A 1T4LB 2DEJA 1XMQI 1WHQA 2M1SA 3WU6A 4DR1I 2KHXA 2VF1A 4LF4I 1IBKI 3ADGA 2VF3A 2JOBA 1YYWA 5LMUE 1IBLE 3VK6A 4DV2I 3GONA 2L6MA 4HY1A 4Z7YA 3B8HA 5AE3A 3F6HA 2EFGA 5IWAE 1PKPA 1YYKA 1Z59A 4JV5E 3K17A 1XMOI 2UUCE 4F9BB 3ADLA 3PYGA 1USUA 4JG4A 4X64I 4FN5A 4B3TI 3H4LA 2ODRC 2NA2A 1XMQE 1ZXMA 4DR3I 1GQEA 4JI5I 4JI4I 4DR1E 5GMEA 1HR0I 4JI3I 1FKAE 4LF4E 1IBKE 1PVGA 1FWLA 3V2UC 2UU9I 2F4VI 2RS7A 3C4TA 1Z0EA 2UUAI 4DV0I 1J5EI 4WFTA 2Z5EA 4MYUA 4JI2E 4LF5I 2UXDI 2N3HA 4I8OA 1GZ6A 3VYYA 4GKKI 1QZRA 2LRSA 1SR9A 4JI1I 2HK2A 5FLXQ 5T6JA 4X64E 4B3TE 1N0VC 4DV5E 3LLHA 5LL6R 2LMZA 4DR3E 4JI5E 4TUGA 4JI6I 1HR0E 3Q6NA 4JI3E 2CPNA 2LJHA 3PYDA 2FV4B 2VQFI 4L8NA 3ADIA 3T1YI 2VQEI 2UXCE 2UU9E 2F4VE 1ZM9A 1Z0VA 2X36A 1N0UA 3J81C 2UUAE 4LF6I 2V86A 2RS6A 4DV0E 1KIJA 4LF9E 1J5EE 4FW9A 1I94I 2XEXA 3B78A 2JY9A 2IOQA 1HNZI 2N3GA 4M30A 4BC9A 2JR1A 4LF5E 2UXDE 4URLA 4LFBI 1H73A 1H72C 4B3SI 2LBSB 4B3MI 4DXLA 4GKKE 3OTOI 2V88A 4JI1E 2L33A 1N33I 4KZSA 4P7AA 4OX9I 4IZJD 4BC7A 2LUQA 1DARA 3FIGA 4JI6E 2PNMA 3HPSA 4LF7I 2LJPA 1OJ4A 4DUZI 1A6FA 2VQFE 1KKHA 1KVKA 2HKJA 4USMA 2VQEE 1EI1A 5A2QQ 1N36I 4LF6E 4R03A 4YY3I 2A2DA 2E5LE 1NZ0A 5ADZA 2L2MA 3J80C 1I94E 5IT9C 4WPYA 1Y4UA 4I3HA 2V8PA 5AE1A 4TUIA 4LFBE 3P06A 4B3SE 4B3ME 3DJWA 2L8TA 3AUZA 3JTZA 1YYOA 3HXLA 2MDRA 4LFCI 3JU0A 4OX9E 1Z5BA 3ADJA 2M7QA 3K6QA 4RPFA 1N32E 1HNWI 4DPXA 3KWRA 2A2CA 4X66I 2F8BA 3ZZUA 2KOUA 4DUYI 4LU9A 1N36E 5FWKA 4X65I 4DV1I 2NUGA 3QT7A 4USKA 2GQ0A 2YZTA 2V8QB 2CGEA 1FJGI 1X47A 4DR5E 2Q2EB 2R42A 1ZBTA 2JVAA 4YHHI 1T4NA 4M1KA 4DR7I 3F0NA 1NHHA 4WYQB 1WUUA 4JI8I 4DPWA 4BCAA 4AQYI 2WW4A 4OOGC 1HNWE 1WHNA 3K85A 4X66E 4DV2E 1Z0GA 5AASA 3HJCA 4F54A 3HULA 4X65E 4DV1E 4IZKB 4B3RI 1Z5AA 2G7HA 5CFFE 1XMOE 2UUBI 4L5NC 1ELOA 1FJGE 4DU8A 5FLXC 3J7AM 2DSYA 2BM1A 4PU9A 4FWHA 2ODRD 2O1WA 2VE7C 4JI8E 2GS8A 3J7Yp 2K4VA 1FI4A 1ZM2A 3M6AA 3WU3A 4DU7A 4UTGA 1H7UA 4UT4A 4B3RE 4M0VA 1DI2A 3ZKBA 4X8WA 4X62I 3WU5A 4DV6I 2ZM6I 4IZKA 2UUBE 3IWBA 1ZM4A 3ZOQB 4KQVA 1MG7A 2DB2A 2V87A 2V2ZA 4K0KI 3LNUA 3B82A 3LPSA 3PRYA 4JI7I 3H09A 1ZBQA 4HXZA 1X48A 4DR2I 5A2QC 1S4EA 4DV3I 1NHIA 1IBMI 4DR6I 3T1YE 1BKNA 2L3CA 2M4IA 1DQ3A 2JOXA 1N34I 2E1RA 3QT5A 1HNXI 1HNZE 1USVA 4X62E 2J7KA 4DV6E 2ZM6E 1B62A 4MYTA 2Z5BA 4FWGA 2B7VA 4LFAI 2X7IA 1O0WA 3OTOE 1RQ0A 3DF6A 1Y6ZA 1STUA 2RTXA 1YZ9A 4K0KE 1N33E 4IZJA 1MU5A 2ZBKB 4LF8I 4DPYA 2FGGA 4JI7E 1XNQI 1ZM3A 4LF7E 4DR2E 4DUZE 4P78A 3J7AG 3J80Q 4DV3E 5IT9Q 1IBME 2KONA 4DR6E 4Q28A 4YY3E 4KHPI 1N34E 2HHHI 2NUEA 2V89A 2O1UA 3ZM7A 4J8ZA 1HNXE 1VISA 3JAMQ 2E1MA 1S16A 4PRXA 2IOPA 2B7TA 5DNYA 3ZZTA 1RR9A 4LFAE 1HK7A 4DR4I 1EKZA 1WXRA 4N3OA 2CZ9A 4BS9A 1Z5CA 4JYAI 4WUBA 4LF8E 4LFCE 2LTRA 2Z5CB 3K1JA 2O1TA 4GKJI 1XNQE 2H36X 2UXBI 2LUPB 4BMJA 1K47A 3CWVA 1X49A 5GMDA 4JI2I 1B63A 2O1VA 4DUYE 3C4BA 2LE2A 4KHPE 4HYMA 3HPZA 3V5RA 1XNRI 4Z7CA 2HHHE 1NHJA 4ZVIA 1UHZA 2HFUA 4NXNI 2IHR1 4DV5I 1J26A 3Q6MA 2L2NA 4DPTA 4PRVA 1Z0CA 4EMDA 4DR4E 2RSMA 4DV7I 1MX0A 4YHHE 2V34A 4NXMI 4DR7E 2HFSA 5BR8I 2MC6A 3F6GA 4JYAE 2NUFA 2UXCI 5L3JA 4HACB 3IWDA 1Y4SA 3LMLA 4GKJE 4AQYE 4JI0I 1Z0BA 1D6TA 4LF9I 2UXBE 2V2VA 3ZKDA 4FWDA 3OMLA 2BV3A 2WZOA 1KTVA 4F9AB 2Z5CA 2YT4A 2L2KB 3WU4A 2EWLA 3PYFA 4WUDA 2EZ6A 1QU6A 2V85A 5F3WA 2BM0A 1RREA 4P52A 4R1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMY A;  1XNR E;  5LMN I;  3PYE A;  1H74 A;  4NXN E;  2HK3 A;  1T4O A;  2V2Q A;  4DV7 E;  4NXM E;  5BR8 E;  1UIL A;  1FWK A;  3Q1Q A;  4XTJ A;  4DV4 I;  1ZXN A;  3VYX A;  2E5L I;  1U2R A;  1RC7 A;  4JI0 E;  3P1X A;  1FNM A;  1H7S A;  2ZIT A;  3J81 Q;  3T1H I;  2L3J A;  3D4J A;  2DEI A;  4HAC A;  1EA6 A;  4DKK A;  1XHK A;  4JI4 E;  2DIX A;  5LMN E;  2OI2 A;  3LTO A;  2R3V A;  3HTX A;  1UEK A;  4DPU A;  1N32 I;  4WUC A;  2HKE A;  2AJ4 A;  5LMU I;  1IBL I;  4DV4 E;  2NPF A;  3QT8 A;  4ED4 A;  1Z0W A;  5IWA I;  2B3T B;  3T1H E;  4M2Z A;  1PIE A;  3QT6 A;  4JV5 I;  3ZZ0 A;  2UUC I;  2LTS A;  1Z0T A;  3JAM C;  4DR5 I;  1T4L B;  2DEJ A;  1XMQ I;  1WHQ A;  3WU6 A;  4DR1 I;  2KHX A;  4LF4 I;  1IBK I;  3ADG A;  2VF3 A;  1YYW A;  5LMU E;  1IBL E;  4DV2 I;  3GON A;  4HY1 A;  4Z7Y A;  3B8H A;  2EFG A;  5IWA E;  1PKP A;  1YYK A;  1Z59 A;  4JV5 E;  3K17 A;  1XMO I;  2UUC E;  3PYG A;  3ADL A;  4JG4 A;  4X64 I;  4FN5 A;  4B3T I;  3H4L A;  2NA2 A;  1XMQ E;  1ZXM A;  4DR3 I;  1GQE A;  4JI5 I;  4JI4 I;  4DR1 E;  5GME A;  1HR0 I;  4JI3 I;  1FKA E;  4LF4 E;  1IBK E;  1PVG A;  1FWL A;  3V2U C;  2UU9 I;  2F4V I;  2RS7 A;  3C4T A;  1Z0E A;  2UUA I;  4DV0 I;  1J5E I;  4WFT A;  4MYU A;  4JI2 E;  4LF5 I;  2UXD I;  2N3H A;  3VYY A;  4GKK I;  1QZR A;  2LRS A;  4JI1 I;  2HK2 A;  5FLX Q;  4X64 E;  4B3T E;  1N0V C;  4DV5 E;  3LLH A;  5LL6 R;  4DR3 E;  4JI5 E;  4JI6 I;  1HR0 E;  4JI3 E;  2CPN A;  2LJH A;  3PYD A;  2VQF I;  3ADI A;  3T1Y I;  2VQE I;  2UXC E;  2UU9 E;  2F4V E;  1ZM9 A;  1Z0V A;  2X36 A;  1N0U A;  3J81 C;  2UUA E;  4LF6 I;  2RS6 A;  4DV0 E;  1KIJ A;  4LF9 E;  1J5E E;  4FW9 A;  1I94 I;  2XEX A;  3B78 A;  2JY9 A;  1HNZ I;  2N3G A;  4M30 A;  4LF5 E;  2UXD E;  4URL A;  4LFB I;  1H73 A;  1H72 C;  4B3S I;  2LBS B;  4B3M I;  4DXL A;  4GKK E;  3OTO I;  4JI1 E;  2L33 A;  1N33 I;  4P7A A;  4OX9 I;  2LUQ A;  1DAR A;  4JI6 E;  4LF7 I;  2LJP A;  1OJ4 A;  4DUZ I;  1A6F A;  2VQF E;  1KKH A;  1KVK A;  2HKJ A;  4USM A;  2VQE E;  1EI1 A;  5A2Q Q;  1N36 I;  4LF6 E;  4YY3 I;  2A2D A;  2E5L E;  1NZ0 A;  2L2M A;  3J80 C;  1I94 E;  5IT9 C;  4I3H A;  2V8P A;  4LFB E;  4B3S E;  4B3M E;  1YYO A;  2MDR A;  4LFC I;  4OX9 E;  1Z5B A;  3ADJ A;  4RPF A;  1N32 E;  1HNW I;  4DPX A;  2A2C A;  4X66 I;  3ZZU A;  4DUY I;  1N36 E;  4X65 I;  4DV1 I;  2NUG A;  3QT7 A;  4USK A;  1FJG I;  1X47 A;  4DR5 E;  2Q2E B;  2R42 A;  1ZBT A;  2JVA A;  4YHH I;  1T4N A;  4M1K A;  4DR7 I;  3F0N A;  1NHH A;  4WYQ B;  1WUU A;  4JI8 I;  4DPW A;  4AQY I;  2WW4 A;  4OOG C;  1HNW E;  1WHN A;  4X66 E;  4DV2 E;  1Z0G A;  3HUL A;  4X65 E;  4DV1 E;  4B3R I;  1Z5A A;  5CFF E;  1XMO E;  2UUB I;  1ELO A;  1FJG E;  4DU8 A;  5FLX C;  3J7A M;  2BM1 A;  4PU9 A;  4FWH A;  4JI8 E;  2GS8 A;  3J7Y p;  1FI4 A;  1ZM2 A;  3M6A A;  3WU3 A;  4DU7 A;  4UTG A;  1H7U A;  4UT4 A;  4B3R E;  1DI2 A;  3ZKB A;  4X8W A;  4X62 I;  3WU5 A;  4DV6 I;  2ZM6 I;  2UUB E;  1ZM4 A;  4KQV A;  1MG7 A;  2DB2 A;  2V2Z A;  4K0K I;  3LNU A;  3B82 A;  3LPS A;  4JI7 I;  4HXZ A;  1X48 A;  4DR2 I;  5A2Q C;  1S4E A;  4DV3 I;  1NHI A;  1IBM I;  4DR6 I;  3T1Y E;  1BKN A;  2L3C A;  1N34 I;  2E1R A;  3QT5 A;  1HNX I;  1HNZ E;  4X62 E;  2J7K A;  4DV6 E;  2ZM6 E;  1B62 A;  4MYT A;  4FWG A;  2B7V A;  4LFA I;  2X7I A;  1O0W A;  3OTO E;  1RQ0 A;  1STU A;  2RTX A;  1YZ9 A;  4K0K E;  1N33 E;  1MU5 A;  2ZBK B;  4LF8 I;  4DPY A;  4JI7 E;  1XNQ I;  1ZM3 A;  4LF7 E;  4DR2 E;  4DUZ E;  3J7A G;  3J80 Q;  4DV3 E;  5IT9 Q;  1IBM E;  4DR6 E;  4YY3 E;  4KHP I;  1N34 E;  2HHH I;  2NUE A;  3ZM7 A;  1HNX E;  1VIS A;  3JAM Q;  1S16 A;  4PRX A;  2B7T A;  3ZZT A;  1RR9 A;  4LFA E;  4DR4 I;  1EKZ A;  2CZ9 A;  1Z5C A;  4JYA I;  4WUB A;  4LF8 E;  4LFC E;  2LTR A;  3K1J A;  4GKJ I;  1XNQ E;  2UXB I;  2LUP B;  1K47 A;  3CWV A;  1X49 A;  5GMD A;  4JI2 I;  1B63 A;  4DUY E;  3C4B A;  4HYM A;  4KHP E;  3V5R A;  1XNR I;  4Z7C A;  2HHH E;  1NHJ A;  4ZVI A;  1UHZ A;  2HFU A;  4NXN I;  2IHR 1;  4DV5 I;  1J26 A;  2L2N A;  4DPT A;  4PRV A;  1Z0C A;  4EMD A;  4DR4 E;  2RSM A;  4DV7 I;  1MX0 A;  4YHH E;  2V34 A;  4NXM I;  4DR7 E;  2HFS A;  5BR8 I;  4JYA E;  2NUF A;  2UXC I;  5L3J A;  4HAC B;  4GKJ E;  4AQY E;  4JI0 I;  1Z0B A;  1D6T A;  4LF9 I;  2UXB E;  2V2V A;  3ZKD A;  4FWD A;  2BV3 A;  1KTV A;  2YT4 A;  2L2K B;  3WU4 A;  3PYF A;  4WUD A;  2EZ6 A;  1QU6 A;  2BM0 A;  1RRE A;  4P52 A;  4R1F A; 
#chains in the Genus database with same CATH topology
 2DMY A;  1XNR E;  5LMN I;  3PYE A;  2Z5B B;  2JPA A;  1H74 A;  4MU0 A;  2JWO A;  5K36 C;  4FK5 C;  1T39 A;  2D9H A;  4NXN E;  3RMP A;  4F9C B;  2JEA A;  4YY3 I;  2V83 A;  2HK3 A;  3IWC A;  4IZJ B;  5DNX A;  4GEQ B;  2EJ4 A;  1T4O A;  4R2R A;  2V2Q A;  4R8O A;  4DV7 E;  2EMI A;  2WCC 3;  1EH6 A;  4NXM E;  5BR8 E;  2EOX A;  4DMI A;  1UIL A;  1FWK A;  3Q1Q A;  2BA1 D;  3PS2 A;  5DNL A;  4XTJ A;  4DV4 I;  4O43 A;  5C0X E;  1ZXN A;  2LV2 A;  3VYX A;  2E5L I;  1RC7 A;  1U2R A;  1F2I G;  3P1X A;  4JI0 E;  1FNM A;  1H7S A;  3AV0 A;  2ZIT A;  3J81 Q;  3T1H I;  2FTX B;  4BBY A;  2L3J A;  5TSE A;  3D4J A;  2DEI A;  4R2S A;  3P3E A;  4HAC A;  1EA6 A;  3GLL A;  2PO1 B;  4AID A;  4DKK A;  2EPU A;  4HEI A;  4JI4 E;  1XHK A;  2DIX A;  1IMU A;  4IJD A;  2J65 A;  2C39 A;  5LMN E;  2OI2 A;  4R2Q A;  3LTO A;  5K36 D;  4IS1 C;  2R3V A;  3HTX A;  3HQ1 A;  2YPN A;  4P7D A;  5KL4 A;  3MSW A;  2ENC A;  2YTO A;  4MLQ A;  2EPL X;  4NHR A;  2MC5 A;  1UEK A;  1TF6 A;  4DPU A;  2DLQ A;  2HC5 A;  2CG9 A;  1N32 I;  4WUC A;  4WX9 A;  1AAY A;  2JT2 A;  2HKE A;  4WXC A;  2EL4 A;  2PNL A;  2EN7 A;  4WSP A;  2AJ4 A;  2WP8 B;  5A6K A;  2MKN A;  2EM6 A;  2CT1 A;  2YU8 A;  5C0X D;  5LMU I;  1IBL I;  3P3C A;  2EPM X;  4DV4 E;  2NPF A;  2YTE A;  1L4S A;  1Z0W A;  5AE2 A;  3QT8 A;  4BA1 B;  4ED4 A;  2Q8U A;  5IWA I;  2B3T B;  3T1H E;  1XXE A;  4M2Z A;  2BA0 D;  1PIE A;  3QT6 A;  4JV5 I;  3ZZ0 A;  1WRJ A;  2UUC I;  2R1F A;  2LTS A;  3THO B;  2B9D A;  2EPX A;  1Z0T A;  2NN6 D;  4LTY A;  3JAM C;  4DR5 I;  2L92 A;  1T4L B;  4R2A A;  2DEJ A;  4R2C A;  4NZV A;  1IQO A;  1XMQ I;  1WHQ A;  2EOJ A;  1E3H A;  3TQM A;  2CSH A;  2M1S A;  1G2D C;  3BID A;  1EH8 A;  3WU6 A;  3M99 B;  2N8X A;  4X9J A;  4DR1 I;  2KHX A;  2VF1 A;  2EMA A;  4LF4 I;  5C0X A;  2A25 A;  4F6N A;  1IBK I;  3ADG A;  2JE6 B;  2VF3 A;  2JOB A;  1YYW A;  5LMU E;  1IBL E;  3VK6 A;  4DV2 I;  3GON A;  3BF2 A;  2L6M A;  4HY1 A;  2WP8 A;  1YHC A;  4Z7Y A;  3B8H A;  5AE3 A;  3F6H A;  4M9V C;  2EFG A;  5IWA E;  2C38 A;  1PKP A;  1YYK A;  1Z59 A;  1OYP A;  3C6K A;  1YUJ A;  4JV5 E;  3K17 A;  1XMO I;  5KL7 A;  2UUC E;  2CTD A;  2NN6 A;  2JEA B;  4F9B B;  3ADL A;  3PYG A;  1P47 A;  1YSA C;  3M85 G;  2EPP A;  1USU A;  4JG4 A;  3DD6 A;  4X64 I;  2EM9 A;  1NCS A;  4FN5 A;  4B3T I;  4BA2 B;  3H4L A;  2ODR C;  2EPK X;  2NA2 A;  1XMQ E;  1ZXM A;  1A1I A;  4DR3 I;  4IFD C;  1GQE A;  4JI5 I;  4JI4 I;  4R2P A;  4OO1 C;  2EMC A;  4DR1 E;  5GME A;  1HR0 I;  1FKA E;  4JI3 I;  4LF6 I;  4LF4 E;  3KZY A;  1IBK E;  1PVG A;  2ELY A;  1FWL A;  3V2U C;  2UU9 I;  2F4V I;  2RS7 A;  3C4T A;  1Z0E A;  2UUA I;  4DV0 I;  5JEA C;  1J5E I;  1JK1 A;  2JE6 A;  3L00 A;  4AM3 A;  2EM8 A;  2EM5 A;  3EPL A;  2YU5 A;  2EOY A;  4WFT A;  2Z5E A;  3UHM A;  4MYU A;  4FW7 A;  4LCH A;  5KL3 A;  2YRM A;  4O5G A;  4JI2 E;  4LF5 I;  2UXD I;  2EOM A;  2N3H A;  4I8O A;  2EMX A;  1GZ6 A;  3VYY A;  3CDJ A;  4GKK I;  2HJJ A;  1QZR A;  2LRS A;  3EQ1 A;  1SR9 A;  4JI1 I;  5K36 E;  2HK2 A;  5FLX Q;  5T6J A;  4X64 E;  1A1F A;  4B3T E;  2EOE A;  4ZYD A;  1G2F C;  1RMD A;  2ENH A;  1N0V C;  4DV5 E;  3LLH A;  1X3C A;  5LL6 R;  2LMZ A;  4DR3 E;  5A6B D;  2YTI A;  2LJU A;  4JI5 E;  4TUG A;  2EM0 A;  3P76 A;  4JI6 I;  2YTJ A;  1BBO A;  1HR0 E;  3Q6N A;  3ECR A;  4JI3 E;  2CPN A;  2LJH A;  4BA2 A;  1PJS A;  4MU1 A;  3PYD A;  2FV4 B;  3KRN A;  2VQF I;  2EM7 A;  2JYA A;  4L8N A;  3ADI A;  3T1Y I;  2VQE I;  2UXC E;  2UU9 E;  2F4V E;  1RHY A;  1Z0V A;  1ZM9 A;  1N0U A;  3J81 C;  2UUA E;  2X36 A;  2V86 A;  2RS6 A;  2YRH A;  4DV0 E;  1LLM C;  3P3G A;  5JEA D;  2DMI A;  2EOR A;  1KIJ A;  1TN9 A;  4R2E A;  1ZR9 A;  1J5E E;  4LF9 E;  2JEB B;  2XEX A;  5IXM B;  4FW9 A;  4J3D A;  5K36 B;  3B78 A;  2JY9 A;  2YTG A;  2JXP A;  2IOQ A;  1HNZ I;  2N3G A;  2EML A;  4M30 A;  4BC9 A;  2JR1 A;  1UDN A;  2YTP A;  4LF5 E;  2UXD E;  4Q35 B;  4URL A;  4LFB I;  1H73 A;  1H72 C;  4B3S I;  2LBS B;  4B3M I;  2J7J A;  2WBU A;  4DXL A;  4GKK E;  3OTO I;  2NN6 E;  4FW5 A;  2V88 A;  4JI1 E;  2L33 A;  4OZE A;  1PJT A;  2IER A;  1N33 I;  4KZS A;  5A6B A;  3H1C A;  4P7A A;  5C0X B;  4OX9 I;  2YTD A;  4IZJ D;  4BC7 A;  4QNJ A;  2EMF A;  2LUQ A;  1DAR A;  3FIG A;  4JI6 E;  2PNM A;  3HPS A;  2YTN A;  4LF7 I;  2LJP A;  2EN1 A;  1OJ4 A;  4DUZ I;  2YWQ A;  1A6F A;  2VQF E;  1R6M A;  2M9A A;  1KKH A;  1KVK A;  1UBD C;  2C38 B;  2HKJ A;  2VRD A;  2VQE E;  1EI1 A;  4USM A;  5A2Q Q;  1N36 I;  2EMG A;  2RQL A;  4R03 A;  2EOS A;  5LLQ A;  4LF6 E;  2A2D A;  2E5L E;  1NZ0 A;  5ADZ A;  2L2M A;  1R6L A;  2NN6 B;  3J80 C;  1KJK A;  1I94 E;  5IT9 C;  4MQY A;  4WPY A;  1UDO A;  5C0X F;  1Y4U A;  2EMB A;  3PS3 A;  4I3H A;  5AC4 A;  2V8P A;  5KL6 A;  2JEB A;  5AE1 A;  4TUI A;  4LFB E;  3P06 A;  2EP3 A;  4OKG A;  5K36 A;  4B3S E;  4B3M E;  2EN8 A;  3DJW A;  5A69 A;  2L8T A;  3AUZ A;  2EOZ A;  3JTZ A;  1YYO A;  5DRP A;  3HXL A;  2MDR A;  5A6J A;  4GZN C;  2EM4 A;  1X6F A;  4LFC I;  3JU0 A;  1ZAA C;  4OX9 E;  1Z5B A;  3ADJ A;  2NN6 F;  2M7Q A;  3K6Q A;  4RPF A;  4ISA A;  2GO3 A;  2WNR A;  3EPK A;  2EPN A;  1N32 E;  1HNW I;  1BBG A;  4DPX A;  3KWR A;  2A2C A;  5EL9 A;  4X66 I;  1A1G A;  2F8B A;  2EPC A;  3ZZU A;  2KOU A;  2EOH A;  2MDG A;  2PO2 A;  4DUY I;  4LU9 A;  1N36 E;  3M7N G;  5FWK A;  4X65 I;  4DV1 I;  2NUG A;  3QT7 A;  2LCE A;  4USK A;  4LCF A;  2GQ0 A;  2YZT A;  2V8Q B;  1B69 A;  2CGE A;  1PJQ A;  4KWY A;  2DLK A;  1FJG I;  2BB8 A;  1X47 A;  4DR5 E;  2Q2E B;  3C6M A;  1ZBT A;  2JVA A;  2YTQ A;  2R42 A;  4YHH I;  1T4N A;  5KL5 A;  4IS9 A;  4M1K A;  4DR7 I;  3F0N A;  1NHH A;  2GLI A;  3BGH A;  1WJP A;  4WYQ B;  1WUU A;  4JI8 I;  4DPW A;  4BCA A;  1Z1B A;  4IFD E;  4AQY I;  2WW4 A;  1Y5Y A;  5ELW A;  4OOG C;  4OO1 E;  1HNW E;  3M85 D;  1WHN A;  1EH7 A;  3K85 A;  4X66 E;  4LOM A;  2JP9 A;  4DV2 E;  2EL5 A;  1Z0G A;  5AAS A;  4FW6 A;  3HJC A;  4F54 A;  3HUL A;  5A6A A;  1ZU1 A;  4X65 E;  4DV1 E;  5IV8 B;  2I9I A;  4IZK B;  5JEA E;  1SFE A;  4R2D A;  1Z5A A;  4B3R I;  2G7H A;  5CFF E;  2EE8 A;  2DRP A;  1XMO E;  3GME A;  2RSI A;  2WBT A;  2UUB I;  4L5N C;  2C37 A;  1ELO A;  2O3Z A;  1FJG E;  4DU8 A;  5FLX C;  2BR2 A;  2EPR A;  1YUI A;  3J7A M;  2ADR A;  1BB8 A;  2DSY A;  2WBS A;  2BM1 A;  4PU9 A;  4FWH A;  1AH5 A;  2ODR D;  2DGC A;  2O1W A;  4IFD D;  2EQ1 A;  2VE7 C;  4JI8 E;  2GS8 A;  3MHS C;  3J7Y p;  4OO1 D;  2K4V A;  1FI4 A;  5JEA B;  3B4T A;  2PNZ A;  2VES A;  2PO0 B;  3BBG A;  1ZM2 A;  2EM3 A;  4OO1 F;  3M6A A;  3WU3 A;  4DU7 A;  5DRQ A;  4UTG A;  4RH8 A;  1H7U A;  4UT4 A;  4B3R E;  2EQ0 A;  2F1D A;  4M0V A;  1DI2 A;  3ZKB A;  1YFH A;  4X8W A;  1A1H A;  4X62 I;  3WU5 A;  4DV6 I;  2EMZ A;  2EN3 A;  2BA1 G;  1OYR A;  2ZM6 I;  4IZK A;  1UN6 B;  5JEA F;  2UUB E;  3IWB A;  4LCG A;  5DRO A;  4U3B A;  1ZM4 A;  3ZOQ B;  1I94 I;  1X6E A;  1A1J A;  2EN2 A;  4KQV A;  1MG7 A;  2DB2 A;  2V87 A;  2HGH A;  2V2Z A;  1UDQ A;  2WNR B;  4FW4 A;  4IFD A;  2E72 A;  3LNU A;  3B82 A;  4K0K I;  3LPS A;  4OO1 A;  5C0X C;  3PRY A;  5AC5 A;  3UK3 C;  4JI7 I;  5K36 F;  3H09 A;  1ZBQ A;  2PO2 B;  4HXZ A;  1X48 A;  4DR2 I;  2YSP A;  2EOF A;  5A2Q C;  1S4E A;  4DV3 I;  1NHI A;  4AIM A;  4F6M A;  1MEY C;  4WXD A;  1IBM I;  4DR6 I;  5JEA A;  3T1Y E;  1BKN A;  2L3C A;  2M4I A;  2PO0 A;  3KZZ A;  1DQ3 A;  2JOX A;  1N34 I;  2NN6 C;  2EOO A;  3VHT B;  1GTK A;  2E1R A;  3QT5 A;  1HNX I;  4U3D A;  2EPZ A;  1HNZ E;  1USV A;  4X62 E;  2J7K A;  4DV6 E;  2ZM6 E;  2LT7 A;  1B62 A;  4MYT A;  1OYS A;  2Z5B A;  2LVH A;  5EKW A;  1Y60 A;  4LPF A;  1PDA A;  4FWG A;  2B7V A;  4LFA I;  2GHF A;  2X7I A;  1O0W A;  3OTO E;  1RQ0 A;  3DF6 A;  1Y6Z A;  1STU A;  2RTX A;  2BA0 G;  2ENA A;  5DRR A;  1YZ9 A;  1X5W A;  4K0K E;  1N33 E;  3PS1 A;  4IZJ A;  4NBQ A;  4ZYE A;  1MU5 A;  2ZBK B;  4MU3 A;  4LF8 I;  2MKD A;  4DPY A;  2FGG A;  4JI7 E;  1XNQ I;  1DGC A;  4MDT A;  1ZM3 A;  4LF7 E;  2I13 A;  2PO1 A;  4DR2 E;  4DUZ E;  4P78 A;  3J7A G;  4N4R B;  3J80 Q;  4DV3 E;  1NEI A;  2EM2 A;  1UDS A;  5IT9 Q;  1IBM E;  2KON A;  4DR6 E;  4Q28 A;  3U1Y A;  4YY3 E;  4KHP I;  1N34 E;  1A1K A;  2HHH I;  2R76 A;  2V89 A;  2NUE A;  2C37 B;  2O1U A;  3ZM7 A;  4J8Z A;  2ELZ A;  1HNX E;  1VIS A;  2BR2 B;  2E1M A;  1KYQ A;  3QG5 C;  3JAM Q;  4RHB B;  4BHC A;  1S16 A;  1TF3 A;  3L7Z B;  4PRX A;  2IOP A;  2GPI A;  3U1K A;  2B7T A;  5DNY A;  3ZZT A;  1RR9 A;  3MHH C;  4QNK A;  4FW3 A;  3M7N D;  4WSG A;  4LFA E;  1HK7 A;  4DR4 I;  3GCM A;  1JK2 A;  1IQS A;  1EKZ A;  1WXR A;  4N3O A;  1P42 A;  2CZ9 A;  4BS9 A;  1Z5C A;  4JYA I;  2EPA A;  4ZYH A;  4WUB A;  2PNZ B;  4LF8 E;  1N3G A;  2NAB A;  2LTR A;  4LFC E;  2Z5C B;  2O1T A;  3K1J A;  2LO3 A;  4GKJ I;  4F2J C;  1XNQ E;  1VI7 A;  2H36 X;  2UXB I;  2LUP B;  4ZYG A;  3CDI A;  2EOI A;  4BMJ A;  2AE8 A;  1K47 A;  1YH8 A;  3CWV A;  4MU4 A;  4BA1 A;  1YPN A;  1X49 A;  1T38 A;  5GMD A;  4JI2 I;  1B63 A;  2O1V A;  4DUY E;  3C4B A;  3EPJ A;  3THN A;  2LE2 A;  4KHP E;  4HYM A;  2EN4 A;  3HPZ A;  3V5R A;  1XNR I;  4Z7C A;  1E3P A;  2HHH E;  1NHJ A;  4ZVI A;  1UHZ A;  2HFU A;  4NXN I;  4O4K A;  2EMH A;  4O24 A;  4MLV A;  3EPH A;  2GO4 A;  2EPO A;  2K7I A;  2YRK A;  2IHR 1;  4DV5 I;  4GQU A;  1J26 A;  4IFD B;  3Q6M A;  2RPC A;  1X6H A;  2L2N A;  2YSO A;  4PRV A;  1Z0C A;  4DPT A;  4EMD A;  4OO1 B;  2BBG A;  4DR4 E;  2RSM A;  4BHB A;  1MX0 A;  4DV7 I;  3L7Z A;  2EMW A;  4YHH E;  2IES A;  2V34 A;  4NXM I;  4DR7 E;  2HFS A;  5BR8 I;  2MC6 A;  3F6G A;  4JYA E;  2NUF A;  2CVE A;  2UXC I;  2EQ3 A;  5L3J A;  1MGT A;  4HAC B;  3IWD A;  1Y4S A;  2EL6 A;  1QNT A;  3LML A;  1A1L A;  4AQY E;  4GKJ E;  1Z0B A;  4JI0 I;  4LF9 I;  1D6T A;  2UXB E;  2V2V A;  3ZKD A;  2EMK A;  4FWD A;  3OML A;  2PRT A;  2EMY A;  2WZO A;  1KTV A;  2BV3 A;  4F9A B;  2C39 B;  2EOQ A;  2Z5C A;  3HKM A;  2YT4 A;  4HTG A;  2L2K B;  3WU4 A;  2EWL A;  3PYF A;  4WUD A;  4IFD F;  2EZ6 A;  2EN6 A;  1QU6 A;  2V85 A;  5KL2 A;  5F3W A;  2BM0 A;  2YTF A;  1RRE A;  3NZK A;  4P52 A;  4R1F A; 
#chains in the Genus database with same CATH homology
 2DMY A;  1XNR E;  5LMN I;  3PYE A;  2Z5B B;  1H74 A;  2JWO A;  4NXN E;  3RMP A;  4F9C B;  2V83 A;  2HK3 A;  3IWC A;  4IZJ B;  4GEQ B;  1T4O A;  2V2Q A;  4R8O A;  4DV7 E;  4NXM E;  5BR8 E;  4DMI A;  1UIL A;  1FWK A;  3Q1Q A;  4XTJ A;  4DV4 I;  1ZXN A;  3VYX A;  2E5L I;  1RC7 A;  1U2R A;  4JI0 E;  3P1X A;  1FNM A;  1H7S A;  3AV0 A;  2ZIT A;  3J81 Q;  3T1H I;  2FTX B;  4BBY A;  2L3J A;  3D4J A;  2DEI A;  4HAC A;  1EA6 A;  4DKK A;  1XHK A;  4JI4 E;  2DIX A;  5LMN E;  2OI2 A;  3LTO A;  2R3V A;  3HTX A;  3HQ1 A;  4P7D A;  3MSW A;  2MC5 A;  1UEK A;  4DPU A;  2CG9 A;  1N32 I;  4WUC A;  2HKE A;  2PNL A;  4WSP A;  2AJ4 A;  5LMU I;  1IBL I;  4DV4 E;  2NPF A;  3QT8 A;  4ED4 A;  1Z0W A;  5AE2 A;  5IWA I;  2B3T B;  3T1H E;  4M2Z A;  1PIE A;  3QT6 A;  4JV5 I;  3ZZ0 A;  2UUC I;  2LTS A;  2B9D A;  1Z0T A;  4LTY A;  3JAM C;  4DR5 I;  2L92 A;  1T4L B;  2DEJ A;  1XMQ I;  1WHQ A;  2M1S A;  3WU6 A;  4DR1 I;  2KHX A;  2VF1 A;  4LF4 I;  1IBK I;  3ADG A;  2VF3 A;  2JOB A;  1YYW A;  5LMU E;  1IBL E;  3VK6 A;  4DV2 I;  3GON A;  2L6M A;  4HY1 A;  4Z7Y A;  3B8H A;  5AE3 A;  3F6H A;  2EFG A;  5IWA E;  1PKP A;  1YYK A;  1Z59 A;  4JV5 E;  3K17 A;  1XMO I;  2UUC E;  4F9B B;  3ADL A;  3PYG A;  1USU A;  4JG4 A;  4X64 I;  4FN5 A;  4B3T I;  3H4L A;  2ODR C;  2NA2 A;  1XMQ E;  1ZXM A;  4DR3 I;  1GQE A;  4JI5 I;  4JI4 I;  4DR1 E;  5GME A;  1HR0 I;  4JI3 I;  1FKA E;  4LF4 E;  1IBK E;  1PVG A;  1FWL A;  3V2U C;  2UU9 I;  2F4V I;  2RS7 A;  3C4T A;  1Z0E A;  2UUA I;  4DV0 I;  1J5E I;  4WFT A;  2Z5E A;  4MYU A;  4JI2 E;  4LF5 I;  2UXD I;  2N3H A;  4I8O A;  1GZ6 A;  3VYY A;  4GKK I;  1QZR A;  2LRS A;  1SR9 A;  4JI1 I;  2HK2 A;  5FLX Q;  5T6J A;  4X64 E;  4B3T E;  1N0V C;  4DV5 E;  3LLH A;  5LL6 R;  2LMZ A;  4DR3 E;  4JI5 E;  4TUG A;  4JI6 I;  1HR0 E;  3Q6N A;  4JI3 E;  2CPN A;  2LJH A;  3PYD A;  2FV4 B;  2VQF I;  4L8N A;  3ADI A;  3T1Y I;  2VQE I;  2UXC E;  2UU9 E;  2F4V E;  1ZM9 A;  1Z0V A;  2X36 A;  1N0U A;  3J81 C;  2UUA E;  4LF6 I;  2V86 A;  2RS6 A;  4DV0 E;  1KIJ A;  4LF9 E;  1J5E E;  4FW9 A;  1I94 I;  2XEX A;  3B78 A;  2JY9 A;  2IOQ A;  1HNZ I;  2N3G A;  4M30 A;  4BC9 A;  2JR1 A;  4LF5 E;  2UXD E;  4URL A;  4LFB I;  1H73 A;  1H72 C;  4B3S I;  2LBS B;  4B3M I;  4DXL A;  4GKK E;  3OTO I;  2V88 A;  4JI1 E;  2L33 A;  1N33 I;  4KZS A;  4P7A A;  4OX9 I;  4IZJ D;  4BC7 A;  2LUQ A;  1DAR A;  3FIG A;  4JI6 E;  2PNM A;  3HPS A;  4LF7 I;  2LJP A;  1OJ4 A;  4DUZ I;  1A6F A;  2VQF E;  1KKH A;  1KVK A;  2HKJ A;  4USM A;  2VQE E;  1EI1 A;  5A2Q Q;  1N36 I;  4LF6 E;  4R03 A;  4YY3 I;  2A2D A;  2E5L E;  1NZ0 A;  5ADZ A;  2L2M A;  3J80 C;  1I94 E;  5IT9 C;  4WPY A;  1Y4U A;  4I3H A;  2V8P A;  5AE1 A;  4TUI A;  4LFB E;  3P06 A;  4B3S E;  4B3M E;  3DJW A;  2L8T A;  3AUZ A;  3JTZ A;  1YYO A;  3HXL A;  2MDR A;  4LFC I;  3JU0 A;  4OX9 E;  1Z5B A;  3ADJ A;  2M7Q A;  3K6Q A;  4RPF A;  1N32 E;  1HNW I;  4DPX A;  3KWR A;  2A2C A;  4X66 I;  2F8B A;  3ZZU A;  2KOU A;  4DUY I;  4LU9 A;  1N36 E;  5FWK A;  4X65 I;  4DV1 I;  2NUG A;  3QT7 A;  4USK A;  2GQ0 A;  2YZT A;  2V8Q B;  2CGE A;  1FJG I;  1X47 A;  4DR5 E;  2Q2E B;  2R42 A;  1ZBT A;  2JVA A;  4YHH I;  1T4N A;  4M1K A;  4DR7 I;  3F0N A;  1NHH A;  4WYQ B;  1WUU A;  4JI8 I;  4DPW A;  4BCA A;  4AQY I;  2WW4 A;  4OOG C;  1HNW E;  1WHN A;  3K85 A;  4X66 E;  4DV2 E;  1Z0G A;  5AAS A;  3HJC A;  4F54 A;  3HUL A;  4X65 E;  4DV1 E;  4IZK B;  4B3R I;  1Z5A A;  2G7H A;  5CFF E;  1XMO E;  2UUB I;  4L5N C;  1ELO A;  1FJG E;  4DU8 A;  5FLX C;  3J7A M;  2DSY A;  2BM1 A;  4PU9 A;  4FWH A;  2ODR D;  2O1W A;  2VE7 C;  4JI8 E;  2GS8 A;  3J7Y p;  2K4V A;  1FI4 A;  1ZM2 A;  3M6A A;  3WU3 A;  4DU7 A;  4UTG A;  1H7U A;  4UT4 A;  4B3R E;  4M0V A;  1DI2 A;  3ZKB A;  4X8W A;  4X62 I;  3WU5 A;  4DV6 I;  2ZM6 I;  4IZK A;  2UUB E;  3IWB A;  1ZM4 A;  3ZOQ B;  4KQV A;  1MG7 A;  2DB2 A;  2V87 A;  2V2Z A;  4K0K I;  3LNU A;  3B82 A;  3LPS A;  3PRY A;  4JI7 I;  3H09 A;  1ZBQ A;  4HXZ A;  1X48 A;  4DR2 I;  5A2Q C;  1S4E A;  4DV3 I;  1NHI A;  1IBM I;  4DR6 I;  3T1Y E;  1BKN A;  2L3C A;  2M4I A;  1DQ3 A;  2JOX A;  1N34 I;  2E1R A;  3QT5 A;  1HNX I;  1HNZ E;  1USV A;  4X62 E;  2J7K A;  4DV6 E;  2ZM6 E;  1B62 A;  4MYT A;  2Z5B A;  4FWG A;  2B7V A;  4LFA I;  2X7I A;  1O0W A;  3OTO E;  1RQ0 A;  3DF6 A;  1Y6Z A;  1STU A;  2RTX A;  1YZ9 A;  4K0K E;  1N33 E;  4IZJ A;  1MU5 A;  2ZBK B;  4LF8 I;  4DPY A;  2FGG A;  4JI7 E;  1XNQ I;  1ZM3 A;  4LF7 E;  4DR2 E;  4DUZ E;  4P78 A;  3J7A G;  3J80 Q;  4DV3 E;  5IT9 Q;  1IBM E;  2KON A;  4DR6 E;  4Q28 A;  4YY3 E;  4KHP I;  1N34 E;  2HHH I;  2NUE A;  2V89 A;  2O1U A;  3ZM7 A;  4J8Z A;  1HNX E;  1VIS A;  3JAM Q;  2E1M A;  1S16 A;  4PRX A;  2IOP A;  2B7T A;  5DNY A;  3ZZT A;  1RR9 A;  4LFA E;  1HK7 A;  4DR4 I;  1EKZ A;  1WXR A;  4N3O A;  2CZ9 A;  4BS9 A;  1Z5C A;  4JYA I;  4WUB A;  4LF8 E;  4LFC E;  2LTR A;  2Z5C B;  3K1J A;  2O1T A;  4GKJ I;  1XNQ E;  2H36 X;  2UXB I;  2LUP B;  4BMJ A;  1K47 A;  3CWV A;  1X49 A;  5GMD A;  4JI2 I;  1B63 A;  2O1V A;  4DUY E;  3C4B A;  2LE2 A;  4KHP E;  4HYM A;  3HPZ A;  3V5R A;  1XNR I;  4Z7C A;  2HHH E;  1NHJ A;  4ZVI A;  1UHZ A;  2HFU A;  4NXN I;  2IHR 1;  4DV5 I;  1J26 A;  3Q6M A;  2L2N A;  4DPT A;  4PRV A;  1Z0C A;  4EMD A;  4DR4 E;  2RSM A;  4DV7 I;  1MX0 A;  4YHH E;  2V34 A;  4NXM I;  4DR7 E;  2HFS A;  5BR8 I;  2MC6 A;  3F6G A;  4JYA E;  2NUF A;  2UXC I;  5L3J A;  4HAC B;  3IWD A;  1Y4S A;  3LML A;  4GKJ E;  4AQY E;  4JI0 I;  1Z0B A;  1D6T A;  4LF9 I;  2UXB E;  2V2V A;  3ZKD A;  4FWD A;  3OML A;  2BV3 A;  2WZO A;  1KTV A;  4F9A B;  2Z5C A;  2YT4 A;  2L2K B;  3WU4 A;  2EWL A;  3PYF A;  4WUD A;  2EZ6 A;  1QU6 A;  2V85 A;  5F3W A;  2BM0 A;  1RRE A;  4P52 A;  4R1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...