2F4VE

30s ribosome + designer antibiotic
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2f4vE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2f4vE02
4YHHI 3QT5A 2HFUA 4HYMA 3WU4A 5IWAI 3T1YI 4GKJE 4DPWA 3WU6A 3J7AM 4P7AA 1BKNA 1MG7A 2UUBI 1H7UA 4DR7E 3LNUA 1N32E 2R42A 1QU6A 2AJ4A 4DR5I 2L2MA 1HNXE 4R1FA 4WUCA 1Z0GA 3OTOE 4DV2I 1STUA 5BR8I 2L33A 3B78A 2UUAI 4DUYE 4JV5E 4HACA 1H7SA 4DV6E 1Z0VA 4LFBI 1S4EA 4LF6I 4NXNI 5LMNE 2GS8A 4HXZA 2A2DA 1PVGA 4DR6I 2NUEA 2ZM6I 4PU9A 1QZRA 2DIXA 1B63A 4UT4A 5GMDA 4X65I 2UUCE 4B3RI 1X49A 1I94E 4JI2I 3CWVA 4K0KE 4DV0I 4DR1E 2L3CA 1T4LB 3C4BA 2A2CA 4URLA 4USKA 2UXDI 1FNMA 4B3TI 1XNRI 4B3SE 2YT4A 4FWDA 4DR4I 4DPXA 4X64E 3ADLA 4JI5I 1NHJA 2MDRA 4JYAI 2X36A 1XMQE 1T4OA 4M1KA 2HHHI 4KHPI 4FWHA 3J81C 5IT9C 4HY1A 2VQFE 4OX9E 3HTXA 3B82A 4JI0I 3QT7A 1X47A 1N33E 2V34A 5L3JA 2UXBI 4AQYE 1HNXI 3V5RA 1N36E 1XNQE 4KQVA 3OTOI 4LF9E 2DMYA 1HNZE 1IBLE 4YY3I 1J5EI 4B3MI 2X7IA 4UTGA 4DUZI 4XTJA 4X66I 1FWKA 5IT9Q 5CFFE 4GKKE 2KHXA 3J80C 4JI7E 2VQEI 2JVAA 3H4LA 2E5LI 2RTXA 4WUDA 1EI1A 4Z7YA 2NPFA 2LTRA 2UUCI 1XMOE 4LF7E 3K17A 5FLXC 2NUFA 4DV1I 3T1HE 2UU9E 3LLHA 3LPSA 4JG4A 2F4VE 1H72C 1HR0E 1ZM3A 4EMDA 3ZZTA 4USMA 4PRXA 3ZKBA 1YZ9A 1DARA 4DV5E 4X8WA 4B3SI 3JAMC 1UILA 1NZ0A 3PYFA 1Z0WA 3M6AA 2WW4A 1ZXNA 2V2VA 3ZKDA 5FLXQ 1FJGE 4DR3I 1WUUA 2NUGA 4LF4E 4DR2E 1FWLA 2VF3A 1X48A 3QT6A 4M2ZA 4DV3I 2HKEA 3VYXA 2Q2EB 3P1XA 4JI4E 2N3HA 4ED4A 4LFAI 5LL6R 4JI1E 4DV7E 4JI3E 2V2ZA 4LF9I 5A2QC 4PRVA 1Z5BA 1ZM2A 4JI1I 4DXLA 1ZM9A 4RPFA 5IWAE 2NA2A 4DU7A 1NHIA 1N34I 4NXMI 3ZZUA 1HNWE 2HFSA 2HKJA 4LF8E 4X62E 4MYUA 2UUBE 2B7TA 3D4JA 4HACB 2OI2A 1PKPA 4GKJI 2LUPB 4Z7CA 2J7KA 4DR5E 1WHQA 3ADGA 3LTOA 1OJ4A 4P52A 1VISA 1J26A 2JY9A 1IBKE 2BM1A 2UXCE 2LJPA 5BR8E 4DR7I 2UU9I 4DU8A 2L3JA 1N32I 4FW9A 2UUAE 3ADJA 1HR0I 2B3TB 4LFBE 4LF6E 2EZ6A 4NXNE 2ZBKB 4DPUA 2DEJA 4WUBA 4LF5E 4DUYI 4JV5I 2LJHA 2CPNA 4OOGC 4DR6E 2ZM6E 1UEKA 4DV6I 2R3VA 5LMNI 1EKZA 4X65E 3J81Q 1Z0CA 4B3RE 4LF4I 4DR2I 4JI2E 2N3GA 1S16A 4JI8E 2B7VA 4DV0E 4FWGA 4DPYA 4MYTA 4JI4I 1Z5AA 2UXDE 3QT8A 1FI4A 4B3TE 4LFCE 1XNRE 2L2NA 4DV7I 1ZM4A 1I94I 4JI3I 1A6FA 2LUQA 4K0KI 4DR4E 1Z5CA 3ZZ0A 4DR1I 3WU5A 4JI5E 4DV4E 4JI6E 3J7AG 1DI2A 1WHNA 3Q1QA 4JYAE 1HNWI 3B8HA 3C4TA 2HHHE 1UHZA 1IBME 4KHPE 3J80Q 4X62I 4LF8I 1EA6A 4X64I 2CZ9A 1YYWA 1Z0BA 4JI0E 3F0NA 4M30A 2RS7A 1RQ0A 1K47A 2UXBE 1FKAE 4I3HA 1H73A 1IBKI 1XMQI 1Z0TA 1GQEA 5LMUE 2UXCI 1NHHA 1T4NA 1YYOA 1RC7A 1KVKA 2LRSA 2VQFI 4OX9I 2EFGA 3PYGA 4ZVIA 1N33I 4YY3E 1J5EE 4B3ME 4AQYI 1N36I 4DUZE 1XNQI 3PYEA 3JAMQ 4YHHE 4X66E 3ADIA 3K1JA 5GMEA 1HNZI 4LF5I 3T1YE 1IBLI 1KIJA 1KKHA 1D6TA 4DKKA 2VQEE 3WU3A 1RREA 4WYQB 3GONA 2E5LE 2RSMA 2V8PA 4DPTA 2L2KB 4GKKI 4DV1E 4FN5A 2HK2A 1ZXMA 4JI8I 4JI7I 3PYDA 2LBSB 3V2UC 2E1RA 3J7Yp 1KTVA 5A2QQ 4DV2E 1XMOI 4LF7I 1RR9A 1Z59A 3T1HI 4LFCI 1ZBTA 2F4VI 1MX0A 2HK3A 4DV4I 4JI6I 1B62A 1O0WA 2XEXA 2BM0A 2RS6A 3HULA 4DV5I 1N0UA 4DR3E 1Z0EA 2BV3A 1IBMI 1U2RA 2IHR1 4DV3E 1PIEA 3VYYA 3ZM7A 4LFAE 1FJGI 2ZITA 5LMUI 1N0VC 1MU5A 2V2QA 1YYKA 1XHKA 1H74A 2LTSA 1N34E 4NXME 4WFTA 2DEIA 1ELOA 2DB2A
chains in the Genus database with same CATH superfamily
4YHHI 5C0XB 2MDGA 4F9CB 1TF3A 3QT5A 2HFUA 4HYMA 2EQ1A 2EPKX 2ENHA 3M85G 3JTZA 2BR2B 3WU4A 3K6QA 5IWAI 2VRDA 3T1YI 4LOMA 2RPCA 2V88A 2YU5A 4GKJE 2PO0A 4IZJD 4O43A 5A69A 4DPWA 1A1IA 2GPIA 2JXPA 2NN6A 2PNMA 2Z5BA 2V8QB 2YZTA 4WSPA 2LT7A 3THNA 2EPUA 1UN6B 3MHHC 3WU6A 3J7AM 4P7AA 1BKNA 5K36D 1MG7A 2UUBI 1H7UA 3GCMA 4DR7E 2YWQA 3LNUA 4NHRA 2MKNA 1N32E 1WRJA 2R42A 1QU6A 2AJ4A 4DR5I 2L2MA 1HNXE 2GQ0A 4R1FA 2EOFA 5JEAA 4WUCA 1Z0GA 5JEAC 3OTOE 3MHSC 3IWCA 4KZSA 4DV2I 2O1UA 1STUA 3EQ1A 5BR8I 3PS1A 2JOBA 2NN6E 2O1TA 4OO1A 1X3CA 2L33A 2BA1G 4OO1C 3B78A 2UUAI 2CSHA 4DUYE 4JV5E 1G2FC 2ENAA 4HACA 1H7SA 4DV6E 1RHYA 1Z0VA 1X5WA 4LFBI 5DNYA 1SFEA 2EMZA 1YSAC 1S4EA 2WNRA 3B4TA 4LF6I 2JP9A 2EOZA 2PNLA 4IJDA 3PRYA 4NXNI 5LMNE 2GS8A 4F2JC 4HXZA 2EN6A 2A2DA 2YTJA 4L5NC 1PVGA 1L4SA 1JK1A 5JEAE 2DLQA 4DR6I 2NUEA 2ZM6I 5K36C 1KJKA 4PU9A 2PO0B 1QZRA 2YTOA 4U3DA 2F1DA 2DIXA 1B63A 2EMLA 2J7JA 4OO1E 2M9AA 2EN3A 2N8XA 4WSGA 2NN6B 2Z5BB 5GMDA 4UT4A 3VK6A 4X65I 4ISAA 1YUJA 2UUCE 5C0XD 2JOXA 4ZYHA 3KZZA 4B3RI 1IQSA 5DRRA 1X49A 5A6AA 1I94E 4JI2I 3CWVA 4WPYA 4K0KE 4AM3A 2EPCA 2YTIA 2EOOA 4IZKA 4DV0I 3NZKA 4DR1E 2L3CA 1T4LB 3C4BA 2A2CA 4GQUA 4URLA 1UDNA 4USKA 2YRKA 2Z5EA 2UXDI 2HC5A 2C37A 1A1KA 5JEAB 1T38A 1FNMA 4KWYA 2V83A 4B3TI 1XNRI 4B3SE 2YT4A 3C6MA 2EOIA 4FWDA 4DR4I 2GLIA 4OO1D 4FW3A 4DPXA 4X64E 3ADLA 4JI5I 2H36X 1NHJA 3P3GA 2EPRA 1PJSA 4IFDF 4Q35B 4QNKA 2MDRA 3P76A 2BB8A 2EM7A 2EOEA 2L92A 4JYAI 1GTKA 5IV8B 3THOB 5KL5A 1XMQE 1T4OA 2X36A 4M1KA 2HHHI 4GEQB 3OMLA 4KHPI 3BIDA 4FWHA 4MDTA 5AE2A 3J81C 5IT9C 3F6GA 2DMIA 2VQFE 4HY1A 2EMGA 4OX9E 3HTXA 3B82A 4JI0I 3QT7A 2L8TA 1X47A 1MEYC 2VESA 2ADRA 2EM5A 1N33E 2V34A 5L3JA 2UXBI 4AQYE 1VI7A 1HNXI 5DRQA 1N36E 3V5RA 4BA1B 1XNQE 3P06A 2IERA 4KQVA 4HEIA 3OTOI 4LF9E 2EMAA 1NEIA 4MU0A 2DMYA 2EM6A 2EMYA 2JEAA 1HNZE 4DMIA 4FW5A 2LO3A 4IZKB 1IBLE 3PS3A 4YY3I 1J5EI 4B3MI 2X7IA 4UTGA 1LLMC 2NN6D 2EPLX 4NBQA 4RHBB 3BBGA 4XTJA 4X9JA 2PO2B 2C37B 4DUZI 1QNTA 2O1VA 1Y6ZA 4X66I 1FWKA 1KYQA 1A1GA 2CT1A 4MQYA 5IT9Q 5CFFE 4GKKE 2F8BA 3KRNA 5T6JA 4AIMA 2KHXA 3J80C 2RQLA 4JI7E 1X6HA 2C39A 2VQEI 2EN2A 2JVAA 2LE2A 3H4LA 2EPOA 2YSOA 4BA2A 2EPPA 4LU9A 2RTXA 1USUA 2E5LI 2IOPA 2EMBA 4L8NA 5A6BA 2EE8A 1EI1A 4WUDA 4Z7YA 2NPFA 2LTRA 3HQ1A 5KL4A 4F6NA 4R2SA 5EL9A 2UUCI 4ZYEA 2WCC3 5FLXC 4F9BB 1XMOE 2NUFA 3T1HE 4LF7E 3K17A 4DV1I 2UU9E 3LLHA 3LPSA 2EPXA 4JG4A 2F4VE 5AC5A 1H72C 1HR0E 1ZM3A 5KL7A 4O24A 1PJTA 2CVEA 4EMDA 3ZZTA 3QG5C 4USMA 4ZYDA 4PRXA 4BBYA 5DNLA 3ZKBA 1YZ9A 4IFDA 4IFDC 5C0XF 1DARA 2EQ0A 4DV5E 4X8WA 4N4RB 4B3SI 3JAMC 2WBTA 1UILA 2PNZB 1NZ0A 2DSYA 4OKGA 2ELZA 2YTDA 2JE6A 2EOMA 3PYFA 4LCHA 5KL2A 4MLVA 1T39A 1TN9A 1Z0WA 3UHMA 3M7ND 4M9VC 4IZJA 4LPFA 4R2EA 2EL6A 2YTGA 3M6AA 2WW4A 1ZXNA 2V2VA 3ZKDA 1E3PA 5FLXQ 2LCEA 1Z1BA 1FJGE 4DR3I 2YTFA 1WUUA 4N3OA 2NUGA 4LF4E 4DR2E 2WP8A 5TSEA 4O5GA 1FWLA 1X48A 2VF3A 4BHCA 3QT6A 5K36A 3HJCA 4FW6A 1X6EA 1JK2A 4M2ZA 1X6FA 4IFDE 4DV3I 2HKEA 3VYXA 4FW4A 2BBGA 2Q2EB 3P1XA 2EOSA 1XXEA 1BB8A 2D9HA 2V87A 1SR9A 4JI4E 2N3HA 4ED4A 2EOHA 2EMCA 5KL6A 4WXCA 4LFAI 4MLQA 5LL6R 2LMZA 5A6JA 4JI1E 4DV7E 4JI3E 2V2ZA 2R1FA 2CTDA 2EN1A 2ODRD 4LF9I 2PO1A 5A2QC 4PRVA 1Z5BA 1G2DC 1ZM2A 4JI1I 4DXLA 1ZM9A 4RPFA 4F6MA 2B9DA 2EL4A 5IWAE 2NA2A 3EPJA 3M99B 4DU7A 5FWKA 1NHIA 2C38A 4HACB 5K36E 2EM0A 3EPKA 1N34I 1AAYA 3ZZUA 2AE8A 4NXMI 1R6LA 1EH6A 4IFDB 1HNWE 2EN8A 2HFSA 2PRTA 5AC4A 4OO1B 2BA0D 2HKJA 4P78A 4LCFA 5KL3A 4X62E 4LF8E 2UUBE 2JT2A 4MYUA 2B7TA 3LMLA 4R03A 4BCAA 5IXMB 3D4JA 3TQMA 2JE6B 2OI2A 1PKPA 3GMEA 4R2DA 2RSIA 4HTGA 2LUPB 3K85A 1UDSA 4MU4A 4Z7CA 4GKJI 2WNRB 2J7KA 1ZR9A 4DR5E 1WHQA 2K4VA 3ADGA 2EMHA 1UDOA 1Y4UA 2NN6F 4BS9A 1OJ4A 3LTOA 4IZJB 2EOQA 1J26A 1VISA 4P52A 3VHTB 3HXLA 2JY9A 1IBKE 1P42A 1PDAA 2BM1A 2UXCE 2I13A 2LJPA 3EPHA 2YU8A 2WP8B 5BR8E 1TF6A 5C0XC 1YUIA 4R2AA 4NZVA 4DU8A 2ENCA 2L3JA 2EMIA 2EM4A 3P3EA 2UU9I 1N32I 2DLKA 4FW9A 1HK7A 2BR2A 2UUAE 3ADJA 1HR0I 2B3TB 1DQ3A 4LFBE 3DJWA 4LF6E 4F9AB 5DNXA 2FGGA 3HPZA 2EZ6A 2R76A 4R2PA 4NXNE 2ZBKB 4DPUA 3DF6A 2DEJA 4WUBA 3Q6MA 4TUIA 4LF5E 2EN4A 2MKDA 2EQ3A 4DUYI 3M7NG 2CGEA 2EOJA 4JV5I 5K36B 2LJUA 2LJHA 3AUZA 2CPNA 4OOGC 4WX9A 2EORA 2ZM6E 1A1FA 4DR6E 1F2IG 1UEKA 1IQOA 3L7ZA 4DV6I 3IWBA 2C38B 2EMKA 2E72A 2ELYA 3L00A 2KONA 2R3VA 5LMNI 1EKZA 4X65E 3P3CA 2G7HA 3J81Q 1Z0CA 4B3RE 1WXRA 2WZOA 4LF4I 2EM8A 2NABA 3JU0A 3HKMA 4DR2I 4JI2E 2N3GA 2JR1A 1S16A 4JI8E 1AH5A 2YRMA 2HJJA 2B7VA 5ELWA 4DV0E 3BGHA 1UBDC 4FWGA 4DPYA 2FV4B 1UDQA 1OYRA 5JEAD 4MYTA 4JI4I 4R2RA 1Z5AA 2UXDE 3QT8A 2DGCA 2EM2A 2EN7A 2A25A 4B3TE 4LFCE 1XNRE 2L2NA 1FI4A 1ZM4A 4DV7I 1I94I 4JI3I 1A6FA 2LUQA 3EPLA 1Y4SA 1ZU1A 4K0KI 4DR4E 1YFHA 2JEBA 2YTEA 2VE7C 1Z5CA 3ZZ0A 3RMPA 4DR1I 3CDJA 2JPAA 4JI5E 3WU5A 3U1YA 4BC7A 4DV4E 4JI6E 1BBGA 3C6KA 3J7AG 5LLQA 3ZOQB 4J3DA 1DI2A 4MU3A 1WHNA 4R2CA 4BHBA 2V89A 2YPNA 2BA0G 2NN6C 2O1WA 4JYAE 3Q1QA 1NCSA 3KZYA 4P7DA 1HNWI 3B8HA 3C4TA 2HHHE 2JEAB 1N3GA 1UHZA 2V86A 1IBME 4KHPE 4X62I 3HPSA 4FK5C 1EA6A 3J80Q 4LF8I 2K7IA 2M7QA 1USVA 4X64I 1EH7A 2CZ9A 1YYWA 1Z0BA 4JI0E 2WBUA 4M30A 2RS7A 3F0NA 3L7ZB 5DROA 2JYAA 1RQ0A 1A1LA 4GZNC 2UXBE 1K47A 2YTNA 4WXDA 1FKAE 4QNJA 4TUGA 4I3HA 2MC5A 2IESA 2EPAA 1H73A 5ADZA 1IBKI 5AASA 1XMQI 2JWOA 1GQEA 5LMUE 1Z0TA 2UXCI 2KOUA 1NHHA 2Z5CA 1T4NA 2EM9A 1YYOA 2YTPA 1RC7A 3H09A 1KVKA 2LRSA 2VQFI 2EOXA 1ZAAC 4OX9I 2EMXA 2EFGA 3IWDA 4O4KA 2C39B 3PYGA 4ZVIA 1N33I 2EOYA 4YY3E 1J5EE 4B3ME 4MU1A 4AQYI 4BA2B 2HGHA 2J65A 1N36I 4DUZE 5EKWA 1XNQI 2EJ4A 4LTYA 3PYEA 1BBOA 3JAMQ 4YHHE 4X66E 1RMDA 2MC6A 3MSWA 4RH8A 3ADIA 2EPNA 5A6KA 3K1JA 5GMEA 1B69A 1GZ6A 3ECRA 1HNZI 2LV2A 5F3WA 2JEBB 4LF5I 2I9IA 3T1YE 2GO3A 4M0VA 1IBLI 1KIJA 1YHCA 3M85D 1KKHA 1D6TA 4DKKA 2VQEE 3FIGA 4IS1C 1RREA 2VF1A 1PJQA 4WYQB 3WU3A 3GONA 2E5LE 2RSMA 2V8PA 2O3ZA 4AIDA 4BA1A 4DPTA 2YSPA 2L2KB 3BF2A 4GKKI 4U3BA 4DV1E 3Q6NA 2EP3A 3F6HA 4FN5A 2HK2A 3UK3C 3AV0A 1ZXMA 4JI8I 4JI7I 4R8OA 3PYDA 2LBSB 5DRPA 4BMJA 2E1RA 1OYPA 3V2UC 3J7Yp 1Y60A 2V85A 1KTVA 3GLLA 2PO2A 3KWRA 5A2QQ 4DV2E 1XMOI 4LF7I 2E1MA 2EWLA 1RR9A 4ZYGA 1Z59A 5C0XA 3T1HI 4LFCI 2Z5CB 1EH8A 1ZBTA 1Y5YA 4FW7A 2F4VI 2ODRC 2M1SA 2BA1D 4F54A 3U1KA 4DR7I 2EPZA 1MX0A 2HK3A 4DV4I 2EM3A 2DRPA 5JEAF 4JI6I 1IMUA 2EMWA 1R6MA 1ZBQA 1B62A 2EMFA 3H1CA 1O0WA 2EPMX 1WJPA 2XEXA 2BM0A 2RS6A 3HULA 4DV5I 1N0UA 4DR3E 3DD6A 1Z0EA 4OO1F 2BV3A 1YPNA 1IBMI 1U2RA 2PO1B 2GHFA 1DGCA 2IHR1 4DV3E 2L6MA 4I8OA 4R2QA 1A1JA 1PIEA 5C0XE 2EL5A 2YRHA 3VYYA 3ZM7A 5A6BD 2IOQA 1MGTA 4IS9A 3PS2A 2LVHA 4OZEA 5AE3A 4LFAE 1FJGI 2ZITA 3CDIA 4LCGA 5AE1A 5LMUI 5K36F 1P47A 2YTQA 4Q28A 1E3HA 1N0VC 2Q8UA 2PNZA 1MU5A 2V2QA 4BC9A 2M4IA 2GO4A 4J8ZA 2FTXB 1YH8A 1YYKA 1OYSA 1H74A 1XHKA 4IFDD 1A1HA 2LTSA 1N34E 4NXME 4WFTA 2WBSA 2DEIA 2CG9A 1ELOA 2DB2A
chains in the Genus database with same CATH topology
4YHHI 4F9CB 3QT5A 2HFUA 4HYMA 3JTZA 3WU4A 3K6QA 5IWAI 3T1YI 2V88A 4GKJE 4IZJD 4DPWA 2Z5BA 2V8QB 2YZTA 4WSPA 3WU6A 3J7AM 4P7AA 1BKNA 1MG7A 2UUBI 1H7UA 4DR7E 3LNUA 1N32E 2R42A 1QU6A 2AJ4A 4DR5I 2L2MA 1HNXE 2GQ0A 4R1FA 4WUCA 1Z0GA 3OTOE 3IWCA 4KZSA 4DV2I 2O1UA 1STUA 5BR8I 2JOBA 2O1TA 2L33A 3B78A 2UUAI 4DUYE 4JV5E 4HACA 1H7SA 4DV6E 1Z0VA 4LFBI 5DNYA 1S4EA 4LF6I 2PNLA 3PRYA 4NXNI 5LMNE 2GS8A 4HXZA 2A2DA 4L5NC 1PVGA 4DR6I 2NUEA 2ZM6I 4PU9A 1QZRA 2DIXA 1B63A 2Z5BB 4UT4A 5GMDA 3VK6A 4X65I 2UUCE 2JOXA 4B3RI 1X49A 1I94E 4JI2I 3CWVA 4WPYA 4K0KE 4IZKA 4DV0I 4DR1E 2L3CA 1T4LB 3C4BA 2A2CA 4URLA 4USKA 2UXDI 2Z5EA 1FNMA 2V83A 4B3TI 1XNRI 4B3SE 2YT4A 4FWDA 4DR4I 4DPXA 4X64E 3ADLA 4JI5I 2H36X 1NHJA 2MDRA 4JYAI 2L92A 2X36A 1XMQE 1T4OA 4M1KA 2HHHI 4GEQB 3OMLA 4KHPI 4FWHA 5AE2A 3J81C 5IT9C 3F6GA 4HY1A 2VQFE 4OX9E 3HTXA 3B82A 4JI0I 3QT7A 2L8TA 1X47A 1N33E 2V34A 5L3JA 2UXBI 4AQYE 1HNXI 3V5RA 1N36E 1XNQE 3P06A 4KQVA 3OTOI 4LF9E 2DMYA 1HNZE 4DMIA 4IZKB 1IBLE 4YY3I 1J5EI 4B3MI 2X7IA 4UTGA 4DUZI 4XTJA 2O1VA 1Y6ZA 4X66I 1FWKA 5IT9Q 5CFFE 4GKKE 2F8BA 5T6JA 2KHXA 3J80C 4JI7E 2VQEI 2JVAA 2LE2A 3H4LA 1USUA 4LU9A 2RTXA 2E5LI 2IOPA 4L8NA 4WUDA 1EI1A 4Z7YA 2NPFA 2LTRA 3HQ1A 2UUCI 1XMOE 4LF7E 5FLXC 4F9BB 2NUFA 3K17A 3T1HE 4DV1I 2UU9E 3LLHA 3LPSA 4JG4A 2F4VE 1H72C 1HR0E 1ZM3A 4EMDA 3ZZTA 4USMA 4PRXA 4BBYA 3ZKBA 1YZ9A 1DARA 4DV5E 4X8WA 4B3SI 3JAMC 1UILA 1NZ0A 2DSYA 3PYFA 1Z0WA 4IZJA 3M6AA 2WW4A 1ZXNA 2V2VA 3ZKDA 5FLXQ 1FJGE 4DR3I 4N3OA 1WUUA 2NUGA 4LF4E 4DR2E 1FWLA 2VF3A 1X48A 3QT6A 3HJCA 4M2ZA 4DV3I 2HKEA 3VYXA 2Q2EB 3P1XA 2V87A 1SR9A 4JI4E 2N3HA 4ED4A 4LFAI 5LL6R 2LMZA 4JI1E 4DV7E 4JI3E 2V2ZA 4LF9I 2ODRD 5A2QC 4PRVA 1Z5BA 1ZM2A 4JI1I 4DXLA 1ZM9A 4RPFA 2B9DA 5IWAE 2NA2A 4DU7A 5FWKA 1NHIA 1N34I 4NXMI 3ZZUA 1HNWE 2HFSA 2HKJA 4P78A 4LF8E 4X62E 4MYUA 2UUBE 2B7TA 3LMLA 4R03A 4BCAA 3D4JA 4HACB 2OI2A 1PKPA 3K85A 4GKJI 2LUPB 4Z7CA 2J7KA 4DR5E 2PNMA 1WHQA 2K4VA 3ADGA 4IZJB 1Y4UA 3LTOA 4BS9A 1OJ4A 4P52A 1VISA 1J26A 3HXLA 2JY9A 1IBKE 2BM1A 2UXCE 2LJPA 5BR8E 4DR7I 2UU9I 4DU8A 2L3JA 1N32I 4FW9A 1HK7A 2UUAE 3ADJA 1HR0I 2B3TB 1DQ3A 4LFBE 3DJWA 4LF6E 4F9AB 2FGGA 3HPZA 2EZ6A 4NXNE 2ZBKB 4DPUA 3DF6A 2DEJA 4WUBA 3Q6MA 4TUIA 4LF5E 4DUYI 2CGEA 4JV5I 2LJHA 3AUZA 2CPNA 4OOGC 4DR6E 2ZM6E 1UEKA 4DV6I 3IWBA 2KONA 2R3VA 5LMNI 1EKZA 4X65E 2G7HA 3J81Q 1Z0CA 4B3RE 1WXRA 2WZOA 4LF4I 3JU0A 4DR2I 4JI2E 2N3GA 2JR1A 1S16A 4JI8E 2B7VA 4DV0E 4FWGA 4DPYA 2FV4B 4MYTA 4JI4I 1Z5AA 2UXDE 3QT8A 1FI4A 4B3TE 4LFCE 1XNRE 2L2NA 4DV7I 1ZM4A 1I94I 4JI3I 1A6FA 2LUQA 1Y4SA 4K0KI 4DR4E 2VE7C 1Z5CA 3ZZ0A 3RMPA 4DR1I 3WU5A 4JI5E 4BC7A 4DV4E 4JI6E 3J7AG 3ZOQB 1DI2A 1WHNA 2V89A 2O1WA 3Q1QA 4JYAE 4P7DA 1HNWI 3B8HA 3C4TA 2HHHE 1UHZA 4KHPE 2V86A 1IBME 4X62I 3HPSA 1EA6A 3J80Q 4LF8I 2M7QA 1USVA 4X64I 2CZ9A 1YYWA 1Z0BA 4JI0E 3F0NA 4M30A 2RS7A 1RQ0A 2UXBE 1K47A 1FKAE 4I3HA 4TUGA 2MC5A 1H73A 5ADZA 1IBKI 5AASA 1XMQI 2JWOA 1GQEA 5LMUE 1Z0TA 2UXCI 2KOUA 1NHHA 2Z5CA 1T4NA 1YYOA 1RC7A 3H09A 1KVKA 2LRSA 2VQFI 4OX9I 2EFGA 3IWDA 3PYGA 4ZVIA 1N33I 4YY3E 1J5EE 4B3ME 4AQYI 1N36I 4DUZE 1XNQI 4LTYA 3PYEA 3JAMQ 4YHHE 4X66E 2MC6A 3MSWA 3ADIA 3K1JA 5GMEA 1GZ6A 1HNZI 4LF5I 5F3WA 3T1YE 4M0VA 1IBLI 1KIJA 1KKHA 1D6TA 4DKKA 2VQEE 3FIGA 1RREA 3WU3A 2VF1A 4WYQB 3GONA 2E5LE 2RSMA 2V8PA 4DPTA 2L2KB 4GKKI 4DV1E 3Q6NA 3F6HA 4FN5A 2HK2A 3AV0A 1ZXMA 4JI8I 4JI7I 4R8OA 3PYDA 2LBSB 3V2UC 4BMJA 2E1RA 3J7Yp 2V85A 1KTVA 5A2QQ 3KWRA 4DV2E 1XMOI 4LF7I 2E1MA 2EWLA 1RR9A 1Z59A 3T1HI 4LFCI 2Z5CB 1ZBTA 2F4VI 2ODRC 2M1SA 4F54A 1MX0A 2HK3A 4DV4I 4JI6I 1ZBQA 1B62A 1O0WA 2XEXA 2BM0A 2RS6A 3HULA 4DV5I 1N0UA 4DR3E 1Z0EA 2BV3A 1IBMI 1U2RA 2IHR1 4DV3E 2L6MA 4I8OA 1PIEA 3VYYA 3ZM7A 2IOQA 5AE3A 4LFAE 1FJGI 2ZITA 5AE1A 5LMUI 4Q28A 1N0VC 1MU5A 2V2QA 4BC9A 2M4IA 4J8ZA 2FTXB 1YYKA 1XHKA 1H74A 2LTSA 1N34E 4NXME 4WFTA 2DEIA 2CG9A 1ELOA 2DB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH I;  3QT5 A;  2HFU A;  4HYM A;  3WU4 A;  5IWA I;  3T1Y I;  4GKJ E;  4DPW A;  3WU6 A;  3J7A M;  4P7A A;  1BKN A;  1MG7 A;  2UUB I;  1H7U A;  4DR7 E;  3LNU A;  1N32 E;  2R42 A;  1QU6 A;  2AJ4 A;  4DR5 I;  2L2M A;  1HNX E;  4R1F A;  4WUC A;  1Z0G A;  3OTO E;  4DV2 I;  1STU A;  5BR8 I;  2L33 A;  3B78 A;  2UUA I;  4DUY E;  4JV5 E;  4HAC A;  1H7S A;  4DV6 E;  1Z0V A;  4LFB I;  1S4E A;  4LF6 I;  4NXN I;  5LMN E;  2GS8 A;  4HXZ A;  2A2D A;  1PVG A;  4DR6 I;  2NUE A;  2ZM6 I;  4PU9 A;  1QZR A;  2DIX A;  1B63 A;  4UT4 A;  5GMD A;  4X65 I;  2UUC E;  4B3R I;  1X49 A;  1I94 E;  4JI2 I;  3CWV A;  4K0K E;  4DV0 I;  4DR1 E;  2L3C A;  1T4L B;  3C4B A;  2A2C A;  4URL A;  4USK A;  2UXD I;  1FNM A;  4B3T I;  1XNR I;  4B3S E;  2YT4 A;  4FWD A;  4DR4 I;  4DPX A;  4X64 E;  3ADL A;  4JI5 I;  1NHJ A;  2MDR A;  4JYA I;  2X36 A;  1XMQ E;  1T4O A;  4M1K A;  2HHH I;  4KHP I;  4FWH A;  3J81 C;  5IT9 C;  4HY1 A;  2VQF E;  4OX9 E;  3HTX A;  3B82 A;  4JI0 I;  3QT7 A;  1X47 A;  1N33 E;  2V34 A;  5L3J A;  2UXB I;  4AQY E;  1HNX I;  3V5R A;  1N36 E;  1XNQ E;  4KQV A;  3OTO I;  4LF9 E;  2DMY A;  1HNZ E;  1IBL E;  4YY3 I;  1J5E I;  4B3M I;  2X7I A;  4UTG A;  4DUZ I;  4XTJ A;  4X66 I;  1FWK A;  5IT9 Q;  5CFF E;  4GKK E;  2KHX A;  3J80 C;  4JI7 E;  2VQE I;  2JVA A;  3H4L A;  2E5L I;  2RTX A;  4WUD A;  1EI1 A;  4Z7Y A;  2NPF A;  2LTR A;  2UUC I;  1XMO E;  4LF7 E;  3K17 A;  5FLX C;  2NUF A;  4DV1 I;  3T1H E;  2UU9 E;  3LLH A;  3LPS A;  4JG4 A;  2F4V E;  1H72 C;  1HR0 E;  1ZM3 A;  4EMD A;  3ZZT A;  4USM A;  4PRX A;  3ZKB A;  1YZ9 A;  1DAR A;  4DV5 E;  4X8W A;  4B3S I;  3JAM C;  1UIL A;  1NZ0 A;  3PYF A;  1Z0W A;  3M6A A;  2WW4 A;  1ZXN A;  2V2V A;  3ZKD A;  5FLX Q;  1FJG E;  4DR3 I;  1WUU A;  2NUG A;  4LF4 E;  4DR2 E;  1FWL A;  2VF3 A;  1X48 A;  3QT6 A;  4M2Z A;  4DV3 I;  2HKE A;  3VYX A;  2Q2E B;  3P1X A;  4JI4 E;  2N3H A;  4ED4 A;  4LFA I;  5LL6 R;  4JI1 E;  4DV7 E;  4JI3 E;  2V2Z A;  4LF9 I;  5A2Q C;  4PRV A;  1Z5B A;  1ZM2 A;  4JI1 I;  4DXL A;  1ZM9 A;  4RPF A;  5IWA E;  2NA2 A;  4DU7 A;  1NHI A;  1N34 I;  4NXM I;  3ZZU A;  1HNW E;  2HFS A;  2HKJ A;  4LF8 E;  4X62 E;  4MYU A;  2UUB E;  2B7T A;  3D4J A;  4HAC B;  2OI2 A;  1PKP A;  4GKJ I;  2LUP B;  4Z7C A;  2J7K A;  4DR5 E;  1WHQ A;  3ADG A;  3LTO A;  1OJ4 A;  4P52 A;  1VIS A;  1J26 A;  2JY9 A;  1IBK E;  2BM1 A;  2UXC E;  2LJP A;  5BR8 E;  4DR7 I;  2UU9 I;  4DU8 A;  2L3J A;  1N32 I;  4FW9 A;  2UUA E;  3ADJ A;  1HR0 I;  2B3T B;  4LFB E;  4LF6 E;  2EZ6 A;  4NXN E;  2ZBK B;  4DPU A;  2DEJ A;  4WUB A;  4LF5 E;  4DUY I;  4JV5 I;  2LJH A;  2CPN A;  4OOG C;  4DR6 E;  2ZM6 E;  1UEK A;  4DV6 I;  2R3V A;  5LMN I;  1EKZ A;  4X65 E;  3J81 Q;  1Z0C A;  4B3R E;  4LF4 I;  4DR2 I;  4JI2 E;  2N3G A;  1S16 A;  4JI8 E;  2B7V A;  4DV0 E;  4FWG A;  4DPY A;  4MYT A;  4JI4 I;  1Z5A A;  2UXD E;  3QT8 A;  1FI4 A;  4B3T E;  4LFC E;  1XNR E;  2L2N A;  4DV7 I;  1ZM4 A;  1I94 I;  4JI3 I;  1A6F A;  2LUQ A;  4K0K I;  4DR4 E;  1Z5C A;  3ZZ0 A;  4DR1 I;  3WU5 A;  4JI5 E;  4DV4 E;  4JI6 E;  3J7A G;  1DI2 A;  1WHN A;  3Q1Q A;  4JYA E;  1HNW I;  3B8H A;  3C4T A;  2HHH E;  1UHZ A;  1IBM E;  4KHP E;  3J80 Q;  4X62 I;  4LF8 I;  1EA6 A;  4X64 I;  2CZ9 A;  1YYW A;  1Z0B A;  4JI0 E;  3F0N A;  4M30 A;  2RS7 A;  1RQ0 A;  1K47 A;  2UXB E;  1FKA E;  4I3H A;  1H73 A;  1IBK I;  1XMQ I;  1Z0T A;  1GQE A;  5LMU E;  2UXC I;  1NHH A;  1T4N A;  1YYO A;  1RC7 A;  1KVK A;  2LRS A;  2VQF I;  4OX9 I;  2EFG A;  3PYG A;  4ZVI A;  1N33 I;  4YY3 E;  1J5E E;  4B3M E;  4AQY I;  1N36 I;  4DUZ E;  1XNQ I;  3PYE A;  3JAM Q;  4YHH E;  4X66 E;  3ADI A;  3K1J A;  5GME A;  1HNZ I;  4LF5 I;  3T1Y E;  1IBL I;  1KIJ A;  1KKH A;  1D6T A;  4DKK A;  2VQE E;  3WU3 A;  1RRE A;  4WYQ B;  3GON A;  2E5L E;  2RSM A;  2V8P A;  4DPT A;  2L2K B;  4GKK I;  4DV1 E;  4FN5 A;  2HK2 A;  1ZXM A;  4JI8 I;  4JI7 I;  3PYD A;  2LBS B;  3V2U C;  2E1R A;  3J7Y p;  1KTV A;  5A2Q Q;  4DV2 E;  1XMO I;  4LF7 I;  1RR9 A;  1Z59 A;  3T1H I;  4LFC I;  1ZBT A;  2F4V I;  1MX0 A;  2HK3 A;  4DV4 I;  4JI6 I;  1B62 A;  1O0W A;  2XEX A;  2BM0 A;  2RS6 A;  3HUL A;  4DV5 I;  1N0U A;  4DR3 E;  1Z0E A;  2BV3 A;  1IBM I;  1U2R A;  2IHR 1;  4DV3 E;  1PIE A;  3VYY A;  3ZM7 A;  4LFA E;  1FJG I;  2ZIT A;  5LMU I;  1N0V C;  1MU5 A;  2V2Q A;  1YYK A;  1XHK A;  1H74 A;  2LTS A;  1N34 E;  4NXM E;  4WFT A;  2DEI A;  1ELO A;  2DB2 A; 
#chains in the Genus database with same CATH topology
 4YHH I;  5C0X B;  2MDG A;  4F9C B;  1TF3 A;  3QT5 A;  2HFU A;  4HYM A;  2EQ1 A;  2EPK X;  2ENH A;  3M85 G;  3JTZ A;  2BR2 B;  3WU4 A;  3K6Q A;  5IWA I;  2VRD A;  3T1Y I;  4LOM A;  2RPC A;  2V88 A;  2YU5 A;  4GKJ E;  2PO0 A;  4IZJ D;  4O43 A;  5A69 A;  4DPW A;  1A1I A;  2GPI A;  2JXP A;  2NN6 A;  2PNM A;  2Z5B A;  2V8Q B;  2YZT A;  4WSP A;  2LT7 A;  3THN A;  2EPU A;  1UN6 B;  3MHH C;  3WU6 A;  3J7A M;  4P7A A;  1BKN A;  5K36 D;  1MG7 A;  2UUB I;  1H7U A;  3GCM A;  4DR7 E;  2YWQ A;  3LNU A;  4NHR A;  2MKN A;  1N32 E;  1WRJ A;  2R42 A;  1QU6 A;  2AJ4 A;  4DR5 I;  2L2M A;  1HNX E;  2GQ0 A;  4R1F A;  2EOF A;  5JEA A;  4WUC A;  1Z0G A;  5JEA C;  3OTO E;  3MHS C;  3IWC A;  4KZS A;  4DV2 I;  2O1U A;  1STU A;  3EQ1 A;  5BR8 I;  3PS1 A;  2JOB A;  2NN6 E;  2O1T A;  4OO1 A;  1X3C A;  2L33 A;  2BA1 G;  4OO1 C;  3B78 A;  2UUA I;  2CSH A;  4DUY E;  4JV5 E;  1G2F C;  2ENA A;  4HAC A;  1H7S A;  4DV6 E;  1RHY A;  1Z0V A;  1X5W A;  4LFB I;  5DNY A;  1SFE A;  2EMZ A;  1YSA C;  1S4E A;  2WNR A;  3B4T A;  4LF6 I;  2JP9 A;  2EOZ A;  2PNL A;  4IJD A;  3PRY A;  4NXN I;  5LMN E;  2GS8 A;  4F2J C;  4HXZ A;  2EN6 A;  2A2D A;  2YTJ A;  4L5N C;  1PVG A;  1L4S A;  1JK1 A;  5JEA E;  2DLQ A;  4DR6 I;  2NUE A;  2ZM6 I;  5K36 C;  1KJK A;  4PU9 A;  2PO0 B;  1QZR A;  2YTO A;  4U3D A;  2F1D A;  2DIX A;  1B63 A;  2EML A;  2J7J A;  4OO1 E;  2M9A A;  2EN3 A;  2N8X A;  4WSG A;  2NN6 B;  2Z5B B;  5GMD A;  4UT4 A;  3VK6 A;  4X65 I;  4ISA A;  1YUJ A;  2UUC E;  5C0X D;  2JOX A;  4ZYH A;  3KZZ A;  4B3R I;  1IQS A;  5DRR A;  1X49 A;  5A6A A;  1I94 E;  4JI2 I;  3CWV A;  4WPY A;  4K0K E;  4AM3 A;  2EPC A;  2YTI A;  2EOO A;  4IZK A;  4DV0 I;  3NZK A;  4DR1 E;  2L3C A;  1T4L B;  3C4B A;  2A2C A;  4GQU A;  4URL A;  1UDN A;  4USK A;  2YRK A;  2Z5E A;  2UXD I;  2HC5 A;  2C37 A;  1A1K A;  5JEA B;  1T38 A;  1FNM A;  4KWY A;  2V83 A;  4B3T I;  1XNR I;  4B3S E;  2YT4 A;  3C6M A;  2EOI A;  4FWD A;  4DR4 I;  2GLI A;  4OO1 D;  4FW3 A;  4DPX A;  4X64 E;  3ADL A;  4JI5 I;  2H36 X;  1NHJ A;  3P3G A;  2EPR A;  1PJS A;  4IFD F;  4Q35 B;  4QNK A;  2MDR A;  3P76 A;  2BB8 A;  2EM7 A;  2EOE A;  2L92 A;  4JYA I;  1GTK A;  5IV8 B;  3THO B;  5KL5 A;  1XMQ E;  1T4O A;  2X36 A;  4M1K A;  2HHH I;  4GEQ B;  3OML A;  4KHP I;  3BID A;  4FWH A;  4MDT A;  5AE2 A;  3J81 C;  5IT9 C;  3F6G A;  2DMI A;  2VQF E;  4HY1 A;  2EMG A;  4OX9 E;  3HTX A;  3B82 A;  4JI0 I;  3QT7 A;  2L8T A;  1X47 A;  1MEY C;  2VES A;  2ADR A;  2EM5 A;  1N33 E;  2V34 A;  5L3J A;  2UXB I;  4AQY E;  1VI7 A;  1HNX I;  5DRQ A;  1N36 E;  3V5R A;  4BA1 B;  1XNQ E;  3P06 A;  2IER A;  4KQV A;  4HEI A;  3OTO I;  4LF9 E;  2EMA A;  1NEI A;  4MU0 A;  2DMY A;  2EM6 A;  2EMY A;  2JEA A;  1HNZ E;  4DMI A;  4FW5 A;  2LO3 A;  4IZK B;  1IBL E;  3PS3 A;  4YY3 I;  1J5E I;  4B3M I;  2X7I A;  4UTG A;  1LLM C;  2NN6 D;  2EPL X;  4NBQ A;  4RHB B;  3BBG A;  4XTJ A;  4X9J A;  2PO2 B;  2C37 B;  4DUZ I;  1QNT A;  2O1V A;  1Y6Z A;  4X66 I;  1FWK A;  1KYQ A;  1A1G A;  2CT1 A;  4MQY A;  5IT9 Q;  5CFF E;  4GKK E;  2F8B A;  3KRN A;  5T6J A;  4AIM A;  2KHX A;  3J80 C;  2RQL A;  4JI7 E;  1X6H A;  2C39 A;  2VQE I;  2EN2 A;  2JVA A;  2LE2 A;  3H4L A;  2EPO A;  2YSO A;  4BA2 A;  2EPP A;  4LU9 A;  2RTX A;  1USU A;  2E5L I;  2IOP A;  2EMB A;  4L8N A;  5A6B A;  2EE8 A;  1EI1 A;  4WUD A;  4Z7Y A;  2NPF A;  2LTR A;  3HQ1 A;  5KL4 A;  4F6N A;  4R2S A;  5EL9 A;  2UUC I;  4ZYE A;  2WCC 3;  5FLX C;  4F9B B;  1XMO E;  2NUF A;  3T1H E;  4LF7 E;  3K17 A;  4DV1 I;  2UU9 E;  3LLH A;  3LPS A;  2EPX A;  4JG4 A;  2F4V E;  5AC5 A;  1H72 C;  1HR0 E;  1ZM3 A;  5KL7 A;  4O24 A;  1PJT A;  2CVE A;  4EMD A;  3ZZT A;  3QG5 C;  4USM A;  4ZYD A;  4PRX A;  4BBY A;  5DNL A;  3ZKB A;  1YZ9 A;  4IFD A;  4IFD C;  5C0X F;  1DAR A;  2EQ0 A;  4DV5 E;  4X8W A;  4N4R B;  4B3S I;  3JAM C;  2WBT A;  1UIL A;  2PNZ B;  1NZ0 A;  2DSY A;  4OKG A;  2ELZ A;  2YTD A;  2JE6 A;  2EOM A;  3PYF A;  4LCH A;  5KL2 A;  4MLV A;  1T39 A;  1TN9 A;  1Z0W A;  3UHM A;  3M7N D;  4M9V C;  4IZJ A;  4LPF A;  4R2E A;  2EL6 A;  2YTG A;  3M6A A;  2WW4 A;  1ZXN A;  2V2V A;  3ZKD A;  1E3P A;  5FLX Q;  2LCE A;  1Z1B A;  1FJG E;  4DR3 I;  2YTF A;  1WUU A;  4N3O A;  2NUG A;  4LF4 E;  4DR2 E;  2WP8 A;  5TSE A;  4O5G A;  1FWL A;  1X48 A;  2VF3 A;  4BHC A;  3QT6 A;  5K36 A;  3HJC A;  4FW6 A;  1X6E A;  1JK2 A;  4M2Z A;  1X6F A;  4IFD E;  4DV3 I;  2HKE A;  3VYX A;  4FW4 A;  2BBG A;  2Q2E B;  3P1X A;  2EOS A;  1XXE A;  1BB8 A;  2D9H A;  2V87 A;  1SR9 A;  4JI4 E;  2N3H A;  4ED4 A;  2EOH A;  2EMC A;  5KL6 A;  4WXC A;  4LFA I;  4MLQ A;  5LL6 R;  2LMZ A;  5A6J A;  4JI1 E;  4DV7 E;  4JI3 E;  2V2Z A;  2R1F A;  2CTD A;  2EN1 A;  2ODR D;  4LF9 I;  2PO1 A;  5A2Q C;  4PRV A;  1Z5B A;  1G2D C;  1ZM2 A;  4JI1 I;  4DXL A;  1ZM9 A;  4RPF A;  4F6M A;  2B9D A;  2EL4 A;  5IWA E;  2NA2 A;  3EPJ A;  3M99 B;  4DU7 A;  5FWK A;  1NHI A;  2C38 A;  4HAC B;  5K36 E;  2EM0 A;  3EPK A;  1N34 I;  1AAY A;  3ZZU A;  2AE8 A;  4NXM I;  1R6L A;  1EH6 A;  4IFD B;  1HNW E;  2EN8 A;  2HFS A;  2PRT A;  5AC4 A;  4OO1 B;  2BA0 D;  2HKJ A;  4P78 A;  4LCF A;  5KL3 A;  4X62 E;  4LF8 E;  2UUB E;  2JT2 A;  4MYU A;  2B7T A;  3LML A;  4R03 A;  4BCA A;  5IXM B;  3D4J A;  3TQM A;  2JE6 B;  2OI2 A;  1PKP A;  3GME A;  4R2D A;  2RSI A;  4HTG A;  2LUP B;  3K85 A;  1UDS A;  4MU4 A;  4Z7C A;  4GKJ I;  2WNR B;  2J7K A;  1ZR9 A;  4DR5 E;  1WHQ A;  2K4V A;  3ADG A;  2EMH A;  1UDO A;  1Y4U A;  2NN6 F;  4BS9 A;  1OJ4 A;  3LTO A;  4IZJ B;  2EOQ A;  1J26 A;  1VIS A;  4P52 A;  3VHT B;  3HXL A;  2JY9 A;  1IBK E;  1P42 A;  1PDA A;  2BM1 A;  2UXC E;  2I13 A;  2LJP A;  3EPH A;  2YU8 A;  2WP8 B;  5BR8 E;  1TF6 A;  5C0X C;  1YUI A;  4R2A A;  4NZV A;  4DU8 A;  2ENC A;  2L3J A;  2EMI A;  2EM4 A;  3P3E A;  2UU9 I;  1N32 I;  2DLK A;  4FW9 A;  1HK7 A;  2BR2 A;  2UUA E;  3ADJ A;  1HR0 I;  2B3T B;  1DQ3 A;  4LFB E;  3DJW A;  4LF6 E;  4F9A B;  5DNX A;  2FGG A;  3HPZ A;  2EZ6 A;  2R76 A;  4R2P A;  4NXN E;  2ZBK B;  4DPU A;  3DF6 A;  2DEJ A;  4WUB A;  3Q6M A;  4TUI A;  4LF5 E;  2EN4 A;  2MKD A;  2EQ3 A;  4DUY I;  3M7N G;  2CGE A;  2EOJ A;  4JV5 I;  5K36 B;  2LJU A;  2LJH A;  3AUZ A;  2CPN A;  4OOG C;  4WX9 A;  2EOR A;  2ZM6 E;  1A1F A;  4DR6 E;  1F2I G;  1UEK A;  1IQO A;  3L7Z A;  4DV6 I;  3IWB A;  2C38 B;  2EMK A;  2E72 A;  2ELY A;  3L00 A;  2KON A;  2R3V A;  5LMN I;  1EKZ A;  4X65 E;  3P3C A;  2G7H A;  3J81 Q;  1Z0C A;  4B3R E;  1WXR A;  2WZO A;  4LF4 I;  2EM8 A;  2NAB A;  3JU0 A;  3HKM A;  4DR2 I;  4JI2 E;  2N3G A;  2JR1 A;  1S16 A;  4JI8 E;  1AH5 A;  2YRM A;  2HJJ A;  2B7V A;  5ELW A;  4DV0 E;  3BGH A;  1UBD C;  4FWG A;  4DPY A;  2FV4 B;  1UDQ A;  1OYR A;  5JEA D;  4MYT A;  4JI4 I;  4R2R A;  1Z5A A;  2UXD E;  3QT8 A;  2DGC A;  2EM2 A;  2EN7 A;  2A25 A;  4B3T E;  4LFC E;  1XNR E;  2L2N A;  1FI4 A;  1ZM4 A;  4DV7 I;  1I94 I;  4JI3 I;  1A6F A;  2LUQ A;  3EPL A;  1Y4S A;  1ZU1 A;  4K0K I;  4DR4 E;  1YFH A;  2JEB A;  2YTE A;  2VE7 C;  1Z5C A;  3ZZ0 A;  3RMP A;  4DR1 I;  3CDJ A;  2JPA A;  4JI5 E;  3WU5 A;  3U1Y A;  4BC7 A;  4DV4 E;  4JI6 E;  1BBG A;  3C6K A;  3J7A G;  5LLQ A;  3ZOQ B;  4J3D A;  1DI2 A;  4MU3 A;  1WHN A;  4R2C A;  4BHB A;  2V89 A;  2YPN A;  2BA0 G;  2NN6 C;  2O1W A;  4JYA E;  3Q1Q A;  1NCS A;  3KZY A;  4P7D A;  1HNW I;  3B8H A;  3C4T A;  2HHH E;  2JEA B;  1N3G A;  1UHZ A;  2V86 A;  1IBM E;  4KHP E;  4X62 I;  3HPS A;  4FK5 C;  1EA6 A;  3J80 Q;  4LF8 I;  2K7I A;  2M7Q A;  1USV A;  4X64 I;  1EH7 A;  2CZ9 A;  1YYW A;  1Z0B A;  4JI0 E;  2WBU A;  4M30 A;  2RS7 A;  3F0N A;  3L7Z B;  5DRO A;  2JYA A;  1RQ0 A;  1A1L A;  4GZN C;  2UXB E;  1K47 A;  2YTN A;  4WXD A;  1FKA E;  4QNJ A;  4TUG A;  4I3H A;  2MC5 A;  2IES A;  2EPA A;  1H73 A;  5ADZ A;  1IBK I;  5AAS A;  1XMQ I;  2JWO A;  1GQE A;  5LMU E;  1Z0T A;  2UXC I;  2KOU A;  1NHH A;  2Z5C A;  1T4N A;  2EM9 A;  1YYO A;  2YTP A;  1RC7 A;  3H09 A;  1KVK A;  2LRS A;  2VQF I;  2EOX A;  1ZAA C;  4OX9 I;  2EMX A;  2EFG A;  3IWD A;  4O4K A;  2C39 B;  3PYG A;  4ZVI A;  1N33 I;  2EOY A;  4YY3 E;  1J5E E;  4B3M E;  4MU1 A;  4AQY I;  4BA2 B;  2HGH A;  2J65 A;  1N36 I;  4DUZ E;  5EKW A;  1XNQ I;  2EJ4 A;  4LTY A;  3PYE A;  1BBO A;  3JAM Q;  4YHH E;  4X66 E;  1RMD A;  2MC6 A;  3MSW A;  4RH8 A;  3ADI A;  2EPN A;  5A6K A;  3K1J A;  5GME A;  1B69 A;  1GZ6 A;  3ECR A;  1HNZ I;  2LV2 A;  5F3W A;  2JEB B;  4LF5 I;  2I9I A;  3T1Y E;  2GO3 A;  4M0V A;  1IBL I;  1KIJ A;  1YHC A;  3M85 D;  1KKH A;  1D6T A;  4DKK A;  2VQE E;  3FIG A;  4IS1 C;  1RRE A;  2VF1 A;  1PJQ A;  4WYQ B;  3WU3 A;  3GON A;  2E5L E;  2RSM A;  2V8P A;  2O3Z A;  4AID A;  4BA1 A;  4DPT A;  2YSP A;  2L2K B;  3BF2 A;  4GKK I;  4U3B A;  4DV1 E;  3Q6N A;  2EP3 A;  3F6H A;  4FN5 A;  2HK2 A;  3UK3 C;  3AV0 A;  1ZXM A;  4JI8 I;  4JI7 I;  4R8O A;  3PYD A;  2LBS B;  5DRP A;  4BMJ A;  2E1R A;  1OYP A;  3V2U C;  3J7Y p;  1Y60 A;  2V85 A;  1KTV A;  3GLL A;  2PO2 A;  3KWR A;  5A2Q Q;  4DV2 E;  1XMO I;  4LF7 I;  2E1M A;  2EWL A;  1RR9 A;  4ZYG A;  1Z59 A;  5C0X A;  3T1H I;  4LFC I;  2Z5C B;  1EH8 A;  1ZBT A;  1Y5Y A;  4FW7 A;  2F4V I;  2ODR C;  2M1S A;  2BA1 D;  4F54 A;  3U1K A;  4DR7 I;  2EPZ A;  1MX0 A;  2HK3 A;  4DV4 I;  2EM3 A;  2DRP A;  5JEA F;  4JI6 I;  1IMU A;  2EMW A;  1R6M A;  1ZBQ A;  1B62 A;  2EMF A;  3H1C A;  1O0W A;  2EPM X;  1WJP A;  2XEX A;  2BM0 A;  2RS6 A;  3HUL A;  4DV5 I;  1N0U A;  4DR3 E;  3DD6 A;  1Z0E A;  4OO1 F;  2BV3 A;  1YPN A;  1IBM I;  1U2R A;  2PO1 B;  2GHF A;  1DGC A;  2IHR 1;  4DV3 E;  2L6M A;  4I8O A;  4R2Q A;  1A1J A;  1PIE A;  5C0X E;  2EL5 A;  2YRH A;  3VYY A;  3ZM7 A;  5A6B D;  2IOQ A;  1MGT A;  4IS9 A;  3PS2 A;  2LVH A;  4OZE A;  5AE3 A;  4LFA E;  1FJG I;  2ZIT A;  3CDI A;  4LCG A;  5AE1 A;  5LMU I;  5K36 F;  1P47 A;  2YTQ A;  4Q28 A;  1E3H A;  1N0V C;  2Q8U A;  2PNZ A;  1MU5 A;  2V2Q A;  4BC9 A;  2M4I A;  2GO4 A;  4J8Z A;  2FTX B;  1YH8 A;  1YYK A;  1OYS A;  1H74 A;  1XHK A;  4IFD D;  1A1H A;  2LTS A;  1N34 E;  4NXM E;  4WFT A;  2WBS A;  2DEI A;  2CG9 A;  1ELO A;  2DB2 A; 
#chains in the Genus database with same CATH homology
 4YHH I;  4F9C B;  3QT5 A;  2HFU A;  4HYM A;  3JTZ A;  3WU4 A;  3K6Q A;  5IWA I;  3T1Y I;  2V88 A;  4GKJ E;  4IZJ D;  4DPW A;  2Z5B A;  2V8Q B;  2YZT A;  4WSP A;  3WU6 A;  3J7A M;  4P7A A;  1BKN A;  1MG7 A;  2UUB I;  1H7U A;  4DR7 E;  3LNU A;  1N32 E;  2R42 A;  1QU6 A;  2AJ4 A;  4DR5 I;  2L2M A;  1HNX E;  2GQ0 A;  4R1F A;  4WUC A;  1Z0G A;  3OTO E;  3IWC A;  4KZS A;  4DV2 I;  2O1U A;  1STU A;  5BR8 I;  2JOB A;  2O1T A;  2L33 A;  3B78 A;  2UUA I;  4DUY E;  4JV5 E;  4HAC A;  1H7S A;  4DV6 E;  1Z0V A;  4LFB I;  5DNY A;  1S4E A;  4LF6 I;  2PNL A;  3PRY A;  4NXN I;  5LMN E;  2GS8 A;  4HXZ A;  2A2D A;  4L5N C;  1PVG A;  4DR6 I;  2NUE A;  2ZM6 I;  4PU9 A;  1QZR A;  2DIX A;  1B63 A;  2Z5B B;  4UT4 A;  5GMD A;  3VK6 A;  4X65 I;  2UUC E;  2JOX A;  4B3R I;  1X49 A;  1I94 E;  4JI2 I;  3CWV A;  4WPY A;  4K0K E;  4IZK A;  4DV0 I;  4DR1 E;  2L3C A;  1T4L B;  3C4B A;  2A2C A;  4URL A;  4USK A;  2UXD I;  2Z5E A;  1FNM A;  2V83 A;  4B3T I;  1XNR I;  4B3S E;  2YT4 A;  4FWD A;  4DR4 I;  4DPX A;  4X64 E;  3ADL A;  4JI5 I;  2H36 X;  1NHJ A;  2MDR A;  4JYA I;  2L92 A;  2X36 A;  1XMQ E;  1T4O A;  4M1K A;  2HHH I;  4GEQ B;  3OML A;  4KHP I;  4FWH A;  5AE2 A;  3J81 C;  5IT9 C;  3F6G A;  4HY1 A;  2VQF E;  4OX9 E;  3HTX A;  3B82 A;  4JI0 I;  3QT7 A;  2L8T A;  1X47 A;  1N33 E;  2V34 A;  5L3J A;  2UXB I;  4AQY E;  1HNX I;  3V5R A;  1N36 E;  1XNQ E;  3P06 A;  4KQV A;  3OTO I;  4LF9 E;  2DMY A;  1HNZ E;  4DMI A;  4IZK B;  1IBL E;  4YY3 I;  1J5E I;  4B3M I;  2X7I A;  4UTG A;  4DUZ I;  4XTJ A;  2O1V A;  1Y6Z A;  4X66 I;  1FWK A;  5IT9 Q;  5CFF E;  4GKK E;  2F8B A;  5T6J A;  2KHX A;  3J80 C;  4JI7 E;  2VQE I;  2JVA A;  2LE2 A;  3H4L A;  1USU A;  4LU9 A;  2RTX A;  2E5L I;  2IOP A;  4L8N A;  4WUD A;  1EI1 A;  4Z7Y A;  2NPF A;  2LTR A;  3HQ1 A;  2UUC I;  1XMO E;  4LF7 E;  5FLX C;  4F9B B;  2NUF A;  3K17 A;  3T1H E;  4DV1 I;  2UU9 E;  3LLH A;  3LPS A;  4JG4 A;  2F4V E;  1H72 C;  1HR0 E;  1ZM3 A;  4EMD A;  3ZZT A;  4USM A;  4PRX A;  4BBY A;  3ZKB A;  1YZ9 A;  1DAR A;  4DV5 E;  4X8W A;  4B3S I;  3JAM C;  1UIL A;  1NZ0 A;  2DSY A;  3PYF A;  1Z0W A;  4IZJ A;  3M6A A;  2WW4 A;  1ZXN A;  2V2V A;  3ZKD A;  5FLX Q;  1FJG E;  4DR3 I;  4N3O A;  1WUU A;  2NUG A;  4LF4 E;  4DR2 E;  1FWL A;  2VF3 A;  1X48 A;  3QT6 A;  3HJC A;  4M2Z A;  4DV3 I;  2HKE A;  3VYX A;  2Q2E B;  3P1X A;  2V87 A;  1SR9 A;  4JI4 E;  2N3H A;  4ED4 A;  4LFA I;  5LL6 R;  2LMZ A;  4JI1 E;  4DV7 E;  4JI3 E;  2V2Z A;  4LF9 I;  2ODR D;  5A2Q C;  4PRV A;  1Z5B A;  1ZM2 A;  4JI1 I;  4DXL A;  1ZM9 A;  4RPF A;  2B9D A;  5IWA E;  2NA2 A;  4DU7 A;  5FWK A;  1NHI A;  1N34 I;  4NXM I;  3ZZU A;  1HNW E;  2HFS A;  2HKJ A;  4P78 A;  4LF8 E;  4X62 E;  4MYU A;  2UUB E;  2B7T A;  3LML A;  4R03 A;  4BCA A;  3D4J A;  4HAC B;  2OI2 A;  1PKP A;  3K85 A;  4GKJ I;  2LUP B;  4Z7C A;  2J7K A;  4DR5 E;  2PNM A;  1WHQ A;  2K4V A;  3ADG A;  4IZJ B;  1Y4U A;  3LTO A;  4BS9 A;  1OJ4 A;  4P52 A;  1VIS A;  1J26 A;  3HXL A;  2JY9 A;  1IBK E;  2BM1 A;  2UXC E;  2LJP A;  5BR8 E;  4DR7 I;  2UU9 I;  4DU8 A;  2L3J A;  1N32 I;  4FW9 A;  1HK7 A;  2UUA E;  3ADJ A;  1HR0 I;  2B3T B;  1DQ3 A;  4LFB E;  3DJW A;  4LF6 E;  4F9A B;  2FGG A;  3HPZ A;  2EZ6 A;  4NXN E;  2ZBK B;  4DPU A;  3DF6 A;  2DEJ A;  4WUB A;  3Q6M A;  4TUI A;  4LF5 E;  4DUY I;  2CGE A;  4JV5 I;  2LJH A;  3AUZ A;  2CPN A;  4OOG C;  4DR6 E;  2ZM6 E;  1UEK A;  4DV6 I;  3IWB A;  2KON A;  2R3V A;  5LMN I;  1EKZ A;  4X65 E;  2G7H A;  3J81 Q;  1Z0C A;  4B3R E;  1WXR A;  2WZO A;  4LF4 I;  3JU0 A;  4DR2 I;  4JI2 E;  2N3G A;  2JR1 A;  1S16 A;  4JI8 E;  2B7V A;  4DV0 E;  4FWG A;  4DPY A;  2FV4 B;  4MYT A;  4JI4 I;  1Z5A A;  2UXD E;  3QT8 A;  1FI4 A;  4B3T E;  4LFC E;  1XNR E;  2L2N A;  4DV7 I;  1ZM4 A;  1I94 I;  4JI3 I;  1A6F A;  2LUQ A;  1Y4S A;  4K0K I;  4DR4 E;  2VE7 C;  1Z5C A;  3ZZ0 A;  3RMP A;  4DR1 I;  3WU5 A;  4JI5 E;  4BC7 A;  4DV4 E;  4JI6 E;  3J7A G;  3ZOQ B;  1DI2 A;  1WHN A;  2V89 A;  2O1W A;  3Q1Q A;  4JYA E;  4P7D A;  1HNW I;  3B8H A;  3C4T A;  2HHH E;  1UHZ A;  4KHP E;  2V86 A;  1IBM E;  4X62 I;  3HPS A;  1EA6 A;  3J80 Q;  4LF8 I;  2M7Q A;  1USV A;  4X64 I;  2CZ9 A;  1YYW A;  1Z0B A;  4JI0 E;  3F0N A;  4M30 A;  2RS7 A;  1RQ0 A;  2UXB E;  1K47 A;  1FKA E;  4I3H A;  4TUG A;  2MC5 A;  1H73 A;  5ADZ A;  1IBK I;  5AAS A;  1XMQ I;  2JWO A;  1GQE A;  5LMU E;  1Z0T A;  2UXC I;  2KOU A;  1NHH A;  2Z5C A;  1T4N A;  1YYO A;  1RC7 A;  3H09 A;  1KVK A;  2LRS A;  2VQF I;  4OX9 I;  2EFG A;  3IWD A;  3PYG A;  4ZVI A;  1N33 I;  4YY3 E;  1J5E E;  4B3M E;  4AQY I;  1N36 I;  4DUZ E;  1XNQ I;  4LTY A;  3PYE A;  3JAM Q;  4YHH E;  4X66 E;  2MC6 A;  3MSW A;  3ADI A;  3K1J A;  5GME A;  1GZ6 A;  1HNZ I;  4LF5 I;  5F3W A;  3T1Y E;  4M0V A;  1IBL I;  1KIJ A;  1KKH A;  1D6T A;  4DKK A;  2VQE E;  3FIG A;  1RRE A;  3WU3 A;  2VF1 A;  4WYQ B;  3GON A;  2E5L E;  2RSM A;  2V8P A;  4DPT A;  2L2K B;  4GKK I;  4DV1 E;  3Q6N A;  3F6H A;  4FN5 A;  2HK2 A;  3AV0 A;  1ZXM A;  4JI8 I;  4JI7 I;  4R8O A;  3PYD A;  2LBS B;  3V2U C;  4BMJ A;  2E1R A;  3J7Y p;  2V85 A;  1KTV A;  5A2Q Q;  3KWR A;  4DV2 E;  1XMO I;  4LF7 I;  2E1M A;  2EWL A;  1RR9 A;  1Z59 A;  3T1H I;  4LFC I;  2Z5C B;  1ZBT A;  2F4V I;  2ODR C;  2M1S A;  4F54 A;  1MX0 A;  2HK3 A;  4DV4 I;  4JI6 I;  1ZBQ A;  1B62 A;  1O0W A;  2XEX A;  2BM0 A;  2RS6 A;  3HUL A;  4DV5 I;  1N0U A;  4DR3 E;  1Z0E A;  2BV3 A;  1IBM I;  1U2R A;  2IHR 1;  4DV3 E;  2L6M A;  4I8O A;  1PIE A;  3VYY A;  3ZM7 A;  2IOQ A;  5AE3 A;  4LFA E;  1FJG I;  2ZIT A;  5AE1 A;  5LMU I;  4Q28 A;  1N0V C;  1MU5 A;  2V2Q A;  4BC9 A;  2M4I A;  4J8Z A;  2FTX B;  1YYK A;  1XHK A;  1H74 A;  2LTS A;  1N34 E;  4NXM E;  4WFT A;  2DEI A;  2CG9 A;  1ELO A;  2DB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...