2PO0A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with adp in double conformation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
total genus 75
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po0A01
4AIDA 2PNZB 4IFDB 2C39A 5C0XB 2PNZA 4IFDA 5C0XA 3GLLA 2BA1G 4OO1B 2JE6B 2WNRB 4OO1A 2JE6A 2WNRA 3B4TA 1UDOA 2JEBB 3M7ND 3KRNA 2PO2B 2JEBA 5JEAE 2JEAB 2PO2A 2C39B 2JEAA 2C37B 5K36E 2C37A 2NN6E 2WP8B 3GMEA 3HKMA 2WP8A 5K36F 1E3HA 1R6LA 5C0XE 2NN6F 5K36C 1R6MA 2NN6C 4OO1E 1UDSA 3U1KA 2BA0D 3GCMA 4NBQA 2PO0B 5JEAD 2BR2B 3M85G 4AM3A 5JEAF 2PO0A 3CDJA 2C38B 2BR2A 5JEAC 4BA2B 5K36D 2C38A 4BA1B 4IFDE 2NN6D 4BA2A 4BA1A 2BA1D 1E3PA 5C0XD 5JEAB 3M7NG 1UDQA 5C0XF 3DD6A 5JEAA 4OO1D 5C0XC 5K36B 4OO1F 2NN6B 5K36A 4OO1C 3CDIA 2NN6A 4AIMA 3M85D 3L7ZB 1OYPA 3L7ZA 2BA0G 2PO1B 4IFDD 1UDNA 4IFDF 1OYRA 2PO1A 4IFDC 1OYSA 3H1CA
chains in the Genus database with same CATH superfamily
4JI6I 4JI3I 2PNZB 4DPUA 4IFDB 4DV0E 2Z5CA 1Z0VA 4IZKA 5C0XB 1FKAE 4HY1A 4AQYI 3Q6NA 5IWAI 1IBMI 4UTGA 4DR6I 2HKEA 2JE6A 1HNWI 4LCHA 1USVA 4USMA 5DNLA 1HNXI 1Z0CA 3B4TA 4LFBE 1UDOA 4JI8I 4JI5I 2CVEA 3J81C 2PO2B 3T1YE 5JEAE 2UUCI 3WU3A 2C39B 1J5EE 1I94E 3ZZTA 4DV4I 4LF9I 4DR1I 4U3BA 5K36E 1S4EA 4OX9I 1N33E 5EL9A 4DR3E 2WP8B 1ZXNA 4QNKA 3JAMQ 1HNZI 3HKMA 4JI4I 2IOQA 4DV1E 4LF6E 4HACA 1R6LA 5K36C 1Z0EA 1FI4A 2UXDE 4Z7CA 1XNQE 4B3SI 2V34A 4JI6E 2BA0D 3GCMA 1N34I 3H4LA 1USUA 4DPTA 4WUBA 4GKKE 4DPXA 4AQYE 2A2CA 3J80Q 5IWAE 5JEAD 3M85G 2V8PA 2AJ4A 2PO0A 2C38B 4MYUA 2HHHI 1NHIA 3K85A 4NXMI 2X7IA 3J7AG 5K36D 3K17A 5FLXQ 2BA1D 4XTJA 2CG9A 2Z5BA 4JI5E 3K1JA 3J7AM 3F0NA 5JEAB 2UUCE 2A2DA 4M1KA 4JI7I 1S16A 1Z0BA 3B82A 3ZKDA 4ISAA 5K36B 4DR1E 3LTOA 4OO1F 3OTOI 4OX9E 5IT9Q 1QZRA 3P06A 3D4JA 1Z5CA 3PYDA 1HNZE 4DV3I 1N32I 1ZM2A 4HXZA 3PYGA 1H72C 2VESA 2UXCI 3M6AA 1Y5YA 4MYTA 3L7ZA 5DROA 3QT7A 1N34E 4DV2I 1FJGI 2HFUA 1UDNA 2O1WA 3CWVA 2PO1A 3NZKA 4IFDC 1OYSA 1PVGA 1H73A 2Z5CB 3PRYA 4DPWA 4NXME 4R1FA 4AIDA 4IZKB 2IESA 5FWKA 2O1UA 2NPFA 2HK3A 4X65I 4MU0A 3GLLA 5L3JA 2JE6B 1HR0E 4DV5I 4OKGA 3ZM7A 4DPYA 2R42A 4PRVA 1Z0GA 3OTOE 1MX0A 3M7ND 3KRNA 1N32E 3B78A 4J3DA 5LMUI 2VF3A 4LF8E 4FN5A 1ZM9A 1PKPA 2UXCE 4IZJA 2IOPA 4MU3A 1KVKA 4DV6E 3GMEA 2VQEI 4HACB 1FJGE 4URLA 2GO3A 2O1TA 1Y4SA 1N0VC 2NN6F 4MU4A 1XHKA 4KQVA 1R6MA 2JT2A 1WUUA 4OO1E 1UDSA 2PNLA 3UHMA 3JAMC 4LF7I 2HK2A 1BKNA 4JI2I 4LCFA 1ELOA 1EA6A 3PS1A 4FW4A 4X66I 4DXLA 2PO0B 4AM3A 5LMNE 4DV5E 2BR2A 5JEAC 1HK7A 2F1DA 4DUYE 2Z5BB 4BA2A 4BA1A 1UEKA 3PYEA 4B3TE 1NHJA 3J80C 5LMUE 2GQ0A 5C0XF 3DD6A 4IS9A 4DU8A 4OO1D 4JI3E 1IBKI 4MQYA 5FLXC 2IERA 4ED4A 3CDIA 4LCGA 4I3HA 3WU4A 2VQEE 3PS2A 3QT8A 2OI2A 1IBME 3M85D 4YHHI 4DR6E 1XMOI 2BM1A 3L7ZB 1HNWE 1OYPA 3ZZ0A 3QT5A 4JI0I 1HNXE 4UT4A 3U1YA 5IT9C 1IBLI 1ZM4A 5DRQA 1XMQI 4B3RI 2BA0G 1NHHA 2PO1B 4FW5A 4JI8E 4DU7A 1OYRA 4JI2E 1MG7A 1Z0WA 1A6FA 1FWLA 3P3CA 1DARA 2ZBKB 5DRRA 5GMDA 4WUCA 2VQFI 5LL6R 4LF9E 4DV4E 4P7AA 4MDTA 3WU6A 4DR2I 2C39A 4JI4E 4K0KI 2E1RA 2BA1G 1RREA 4B3SE 3LPSA 4IZJD 4OO1A 4USKA 2EFGA 2WNRA 1XNRI 1IBKE 2E5LI 2Z5EA 2GS8A 4LOMA 1VI7A 2O3ZA 5BR8I 5A2QC 2JEBA 3Q6MA 2UU9I 3T1HI 4YHHE 1ZM3A 4IZJB 4WUDA 1XMOE 2HHHE 2JEAA 4X64I 4JI0E 1KIJA 2AE8A 2C37A 4P52A 1XMQE 5EKWA 2F4VI 1KTVA 4FWHA 3V2UC 1Y60A 4DR5I 5K36F 1E3HA 2ZITA 5C0XE 2UUBI 5GMEA 3PS3A 4JI7E 2VQFE 3U1KA 1U2RA 1YHCA 4DR2E 1Z0TA 4DV3E 1B63A 4K0KE 1MU5A 2HFSA 1H7UA 4DR7I 4U3DA 2BR2B 3T1YI 4QNJA 2R3VA 3CDJA 1Y4UA 1N36I 4DV2E 4BA2B 1XNRE 4BA1B 1N33I 4DR3I 2DEJA 4GKJI 1PIEA 4KHPI 4JI1I 5BR8E 1FWKA 5C0XD 3T1HE 4FWGA 3M7NG 5ELWA 4MU1A 4PU9A 3P76A 2UXDI 1XNQI 1B62A 4X64E 1Y6ZA 1VISA 5DRPA 4ZVIA 4OO1C 2F4VE 4LF4I 2NN6A 4FWDA 4X65E 4DR5E 4GKKI 1KKHA 2UUBE 1EI1A 2X36A 4FW6A 4LFCI 4GQUA 1N0UA 4IFDF 3GONA 3HULA 3LNUA 2Q2EB 1XXEA 3P3GA 3H1CA 2HKJA 4DR7E 4NXNI 2V2QA 2XEXA 1N36E 1D6TA 2PNZA 4IFDA 4GKJE 4LFAI 1RHYA 4KHPE 4JI1E 1Z5AA 2UUAI 5C0XA 3J81Q 4OO1B 2BM0A 2WNRB 2V2VA 4LPFA 4DR4I 4LF7E 2BV3A 4OZEA 4LF4E 2JEBB 4LF5I 4X62I 1YH8A 4X66E 3V5RA 2V2ZA 3ZKBA 2DEIA 2JEAB 4B3MI 1ZXMA 2PO2A 4DV7I 2UXBI 5DNXA 4RPFA 1FNMA 4JYAI 2C37B 1Z59A 3QT6A 4YY3I 4LFCE 2NN6E 4N3OA 2WP8A 3WU5A 4PRXA 2ZM6I 2WW4A 4JV5I 2NN6C 1OJ4A 4NXNE 3Q1QA 1Z5BA 1HR0I 1K47A 1RR9A 2CZ9A 4DUZI 4Z7YA 1H7SA 4LFAE 3P3EA 4FW9A 2UUAE 4NBQA 4EMDA 4HYMA 3HJCA 5JEAF 1IBLE 4LF8I 4B3RE 2C38A 4DR4E 4IFDE 4DV0I 2GO4A 2NN6D 4DV6I 4LF5E 4X62E 1E3PA 2J65A 4FW3A 2PNMA 1UDQA 4B3ME 4DV7E 2UXBE 5JEAA 4JYAE 5C0XC 2NN6B 4YY3E 5K36A 4LFBI 4AIMA 1H74A 4FW7A 4JG4A 3ZZUA 2ZM6E 4JV5E 1NZ0A 2J7KA 5A2QQ 5LMNI 1J5EI 1I94I 1P42A 2E5LE 2LJPA 3B8HA 2O1VA 4DUYI 4IFDD 4DUZE 2CGEA 4DV1I 4LF6I 3PYFA 2UU9E 4B3TI
chains in the Genus database with same CATH topology
4AIDA 2PNZB 4IFDB 2C39A 5C0XB 2PNZA 4IFDA 5C0XA 3GLLA 2BA1G 4OO1B 2JE6B 2WNRB 4OO1A 2JE6A 2WNRA 3B4TA 1UDOA 2JEBB 3M7ND 3KRNA 2PO2B 2JEBA 5JEAE 2JEAB 2PO2A 2C39B 2JEAA 2C37B 5K36E 2C37A 2NN6E 2WP8B 3GMEA 3HKMA 2WP8A 5K36F 1E3HA 1R6LA 5C0XE 2NN6F 5K36C 1R6MA 2NN6C 4OO1E 1UDSA 3U1KA 2BA0D 3GCMA 4NBQA 2PO0B 5JEAD 2BR2B 3M85G 4AM3A 5JEAF 2PO0A 3CDJA 2C38B 2BR2A 5JEAC 4BA2B 5K36D 2C38A 4BA1B 4IFDE 2NN6D 4BA2A 4BA1A 2BA1D 1E3PA 5C0XD 5JEAB 3M7NG 1UDQA 5C0XF 3DD6A 5JEAA 4OO1D 5C0XC 5K36B 4OO1F 2NN6B 5K36A 4OO1C 3CDIA 2NN6A 4AIMA 3M85D 3L7ZB 1OYPA 3L7ZA 2BA0G 2PO1B 4IFDD 1UDNA 4IFDF 1OYRA 2PO1A 4IFDC 1OYSA 3H1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AID A;  2PNZ B;  4IFD B;  2C39 A;  5C0X B;  2PNZ A;  4IFD A;  5C0X A;  3GLL A;  2BA1 G;  4OO1 B;  2JE6 B;  2WNR B;  4OO1 A;  2JE6 A;  2WNR A;  3B4T A;  1UDO A;  2JEB B;  3M7N D;  3KRN A;  2PO2 B;  2JEB A;  5JEA E;  2JEA B;  2PO2 A;  2C39 B;  2JEA A;  2C37 B;  5K36 E;  2C37 A;  2NN6 E;  2WP8 B;  3GME A;  3HKM A;  2WP8 A;  5K36 F;  1E3H A;  1R6L A;  5C0X E;  2NN6 F;  5K36 C;  1R6M A;  2NN6 C;  4OO1 E;  1UDS A;  3U1K A;  2BA0 D;  3GCM A;  4NBQ A;  2PO0 B;  5JEA D;  2BR2 B;  3M85 G;  4AM3 A;  5JEA F;  2PO0 A;  3CDJ A;  2C38 B;  2BR2 A;  5JEA C;  4BA2 B;  5K36 D;  2C38 A;  4BA1 B;  4IFD E;  2NN6 D;  4BA2 A;  4BA1 A;  2BA1 D;  1E3P A;  5C0X D;  5JEA B;  3M7N G;  1UDQ A;  5C0X F;  3DD6 A;  5JEA A;  4OO1 D;  5C0X C;  5K36 B;  4OO1 F;  2NN6 B;  5K36 A;  4OO1 C;  3CDI A;  2NN6 A;  4AIM A;  3M85 D;  3L7Z B;  1OYP A;  3L7Z A;  2BA0 G;  2PO1 B;  4IFD D;  1UDN A;  4IFD F;  1OYR A;  2PO1 A;  4IFD C;  1OYS A;  3H1C A; 
#chains in the Genus database with same CATH topology
 4JI6 I;  4JI3 I;  2PNZ B;  4DPU A;  4IFD B;  4DV0 E;  2Z5C A;  1Z0V A;  4IZK A;  5C0X B;  1FKA E;  4HY1 A;  4AQY I;  3Q6N A;  5IWA I;  1IBM I;  4UTG A;  4DR6 I;  2HKE A;  2JE6 A;  1HNW I;  4LCH A;  1USV A;  4USM A;  5DNL A;  1HNX I;  1Z0C A;  3B4T A;  4LFB E;  1UDO A;  4JI8 I;  4JI5 I;  2CVE A;  3J81 C;  2PO2 B;  3T1Y E;  5JEA E;  2UUC I;  3WU3 A;  2C39 B;  1J5E E;  1I94 E;  3ZZT A;  4DV4 I;  4LF9 I;  4DR1 I;  4U3B A;  5K36 E;  1S4E A;  4OX9 I;  1N33 E;  5EL9 A;  4DR3 E;  2WP8 B;  1ZXN A;  4QNK A;  3JAM Q;  1HNZ I;  3HKM A;  4JI4 I;  2IOQ A;  4DV1 E;  4LF6 E;  4HAC A;  1R6L A;  5K36 C;  1Z0E A;  1FI4 A;  2UXD E;  4Z7C A;  1XNQ E;  4B3S I;  2V34 A;  4JI6 E;  2BA0 D;  3GCM A;  1N34 I;  3H4L A;  1USU A;  4DPT A;  4WUB A;  4GKK E;  4DPX A;  4AQY E;  2A2C A;  3J80 Q;  5IWA E;  5JEA D;  3M85 G;  2V8P A;  2AJ4 A;  2PO0 A;  2C38 B;  4MYU A;  2HHH I;  1NHI A;  3K85 A;  4NXM I;  2X7I A;  3J7A G;  5K36 D;  3K17 A;  5FLX Q;  2BA1 D;  4XTJ A;  2CG9 A;  2Z5B A;  4JI5 E;  3K1J A;  3J7A M;  3F0N A;  5JEA B;  2UUC E;  2A2D A;  4M1K A;  4JI7 I;  1S16 A;  1Z0B A;  3B82 A;  3ZKD A;  4ISA A;  5K36 B;  4DR1 E;  3LTO A;  4OO1 F;  3OTO I;  4OX9 E;  5IT9 Q;  1QZR A;  3P06 A;  3D4J A;  1Z5C A;  3PYD A;  1HNZ E;  4DV3 I;  1N32 I;  1ZM2 A;  4HXZ A;  3PYG A;  1H72 C;  2VES A;  2UXC I;  3M6A A;  1Y5Y A;  4MYT A;  3L7Z A;  5DRO A;  3QT7 A;  1N34 E;  4DV2 I;  1FJG I;  2HFU A;  1UDN A;  2O1W A;  3CWV A;  2PO1 A;  3NZK A;  4IFD C;  1OYS A;  1PVG A;  1H73 A;  2Z5C B;  3PRY A;  4DPW A;  4NXM E;  4R1F A;  4AID A;  4IZK B;  2IES A;  5FWK A;  2O1U A;  2NPF A;  2HK3 A;  4X65 I;  4MU0 A;  3GLL A;  5L3J A;  2JE6 B;  1HR0 E;  4DV5 I;  4OKG A;  3ZM7 A;  4DPY A;  2R42 A;  4PRV A;  1Z0G A;  3OTO E;  1MX0 A;  3M7N D;  3KRN A;  1N32 E;  3B78 A;  4J3D A;  5LMU I;  2VF3 A;  4LF8 E;  4FN5 A;  1ZM9 A;  1PKP A;  2UXC E;  4IZJ A;  2IOP A;  4MU3 A;  1KVK A;  4DV6 E;  3GME A;  2VQE I;  4HAC B;  1FJG E;  4URL A;  2GO3 A;  2O1T A;  1Y4S A;  1N0V C;  2NN6 F;  4MU4 A;  1XHK A;  4KQV A;  1R6M A;  2JT2 A;  1WUU A;  4OO1 E;  1UDS A;  2PNL A;  3UHM A;  3JAM C;  4LF7 I;  2HK2 A;  1BKN A;  4JI2 I;  4LCF A;  1ELO A;  1EA6 A;  3PS1 A;  4FW4 A;  4X66 I;  4DXL A;  2PO0 B;  4AM3 A;  5LMN E;  4DV5 E;  2BR2 A;  5JEA C;  1HK7 A;  2F1D A;  4DUY E;  2Z5B B;  4BA2 A;  4BA1 A;  1UEK A;  3PYE A;  4B3T E;  1NHJ A;  3J80 C;  5LMU E;  2GQ0 A;  5C0X F;  3DD6 A;  4IS9 A;  4DU8 A;  4OO1 D;  4JI3 E;  1IBK I;  4MQY A;  5FLX C;  2IER A;  4ED4 A;  3CDI A;  4LCG A;  4I3H A;  3WU4 A;  2VQE E;  3PS2 A;  3QT8 A;  2OI2 A;  1IBM E;  3M85 D;  4YHH I;  4DR6 E;  1XMO I;  2BM1 A;  3L7Z B;  1HNW E;  1OYP A;  3ZZ0 A;  3QT5 A;  4JI0 I;  1HNX E;  4UT4 A;  3U1Y A;  5IT9 C;  1IBL I;  1ZM4 A;  5DRQ A;  1XMQ I;  4B3R I;  2BA0 G;  1NHH A;  2PO1 B;  4FW5 A;  4JI8 E;  4DU7 A;  1OYR A;  4JI2 E;  1MG7 A;  1Z0W A;  1A6F A;  1FWL A;  3P3C A;  1DAR A;  2ZBK B;  5DRR A;  5GMD A;  4WUC A;  2VQF I;  5LL6 R;  4LF9 E;  4DV4 E;  4P7A A;  4MDT A;  3WU6 A;  4DR2 I;  2C39 A;  4JI4 E;  4K0K I;  2E1R A;  2BA1 G;  1RRE A;  4B3S E;  3LPS A;  4IZJ D;  4OO1 A;  4USK A;  2EFG A;  2WNR A;  1XNR I;  1IBK E;  2E5L I;  2Z5E A;  2GS8 A;  4LOM A;  1VI7 A;  2O3Z A;  5BR8 I;  5A2Q C;  2JEB A;  3Q6M A;  2UU9 I;  3T1H I;  4YHH E;  1ZM3 A;  4IZJ B;  4WUD A;  1XMO E;  2HHH E;  2JEA A;  4X64 I;  4JI0 E;  1KIJ A;  2AE8 A;  2C37 A;  4P52 A;  1XMQ E;  5EKW A;  2F4V I;  1KTV A;  4FWH A;  3V2U C;  1Y60 A;  4DR5 I;  5K36 F;  1E3H A;  2ZIT A;  5C0X E;  2UUB I;  5GME A;  3PS3 A;  4JI7 E;  2VQF E;  3U1K A;  1U2R A;  1YHC A;  4DR2 E;  1Z0T A;  4DV3 E;  1B63 A;  4K0K E;  1MU5 A;  2HFS A;  1H7U A;  4DR7 I;  4U3D A;  2BR2 B;  3T1Y I;  4QNJ A;  2R3V A;  3CDJ A;  1Y4U A;  1N36 I;  4DV2 E;  4BA2 B;  1XNR E;  4BA1 B;  1N33 I;  4DR3 I;  2DEJ A;  4GKJ I;  1PIE A;  4KHP I;  4JI1 I;  5BR8 E;  1FWK A;  5C0X D;  3T1H E;  4FWG A;  3M7N G;  5ELW A;  4MU1 A;  4PU9 A;  3P76 A;  2UXD I;  1XNQ I;  1B62 A;  4X64 E;  1Y6Z A;  1VIS A;  5DRP A;  4ZVI A;  4OO1 C;  2F4V E;  4LF4 I;  2NN6 A;  4FWD A;  4X65 E;  4DR5 E;  4GKK I;  1KKH A;  2UUB E;  1EI1 A;  2X36 A;  4FW6 A;  4LFC I;  4GQU A;  1N0U A;  4IFD F;  3GON A;  3HUL A;  3LNU A;  2Q2E B;  1XXE A;  3P3G A;  3H1C A;  2HKJ A;  4DR7 E;  4NXN I;  2V2Q A;  2XEX A;  1N36 E;  1D6T A;  2PNZ A;  4IFD A;  4GKJ E;  4LFA I;  1RHY A;  4KHP E;  4JI1 E;  1Z5A A;  2UUA I;  5C0X A;  3J81 Q;  4OO1 B;  2BM0 A;  2WNR B;  2V2V A;  4LPF A;  4DR4 I;  4LF7 E;  2BV3 A;  4OZE A;  4LF4 E;  2JEB B;  4LF5 I;  4X62 I;  1YH8 A;  4X66 E;  3V5R A;  2V2Z A;  3ZKB A;  2DEI A;  2JEA B;  4B3M I;  1ZXM A;  2PO2 A;  4DV7 I;  2UXB I;  5DNX A;  4RPF A;  1FNM A;  4JYA I;  2C37 B;  1Z59 A;  3QT6 A;  4YY3 I;  4LFC E;  2NN6 E;  4N3O A;  2WP8 A;  3WU5 A;  4PRX A;  2ZM6 I;  2WW4 A;  4JV5 I;  2NN6 C;  1OJ4 A;  4NXN E;  3Q1Q A;  1Z5B A;  1HR0 I;  1K47 A;  1RR9 A;  2CZ9 A;  4DUZ I;  4Z7Y A;  1H7S A;  4LFA E;  3P3E A;  4FW9 A;  2UUA E;  4NBQ A;  4EMD A;  4HYM A;  3HJC A;  5JEA F;  1IBL E;  4LF8 I;  4B3R E;  2C38 A;  4DR4 E;  4IFD E;  4DV0 I;  2GO4 A;  2NN6 D;  4DV6 I;  4LF5 E;  4X62 E;  1E3P A;  2J65 A;  4FW3 A;  2PNM A;  1UDQ A;  4B3M E;  4DV7 E;  2UXB E;  5JEA A;  4JYA E;  5C0X C;  2NN6 B;  4YY3 E;  5K36 A;  4LFB I;  4AIM A;  1H74 A;  4FW7 A;  4JG4 A;  3ZZU A;  2ZM6 E;  4JV5 E;  1NZ0 A;  2J7K A;  5A2Q Q;  5LMN I;  1J5E I;  1I94 I;  1P42 A;  2E5L E;  2LJP A;  3B8H A;  2O1V A;  4DUY I;  4IFD D;  4DUZ E;  2CGE A;  4DV1 I;  4LF6 I;  3PYF A;  2UU9 E;  4B3T I; 
#chains in the Genus database with same CATH homology
 4AID A;  2PNZ B;  4IFD B;  2C39 A;  5C0X B;  2PNZ A;  4IFD A;  5C0X A;  3GLL A;  2BA1 G;  4OO1 B;  2JE6 B;  2WNR B;  4OO1 A;  2JE6 A;  2WNR A;  3B4T A;  1UDO A;  2JEB B;  3M7N D;  3KRN A;  2PO2 B;  2JEB A;  5JEA E;  2JEA B;  2PO2 A;  2C39 B;  2JEA A;  2C37 B;  5K36 E;  2C37 A;  2NN6 E;  2WP8 B;  3GME A;  3HKM A;  2WP8 A;  5K36 F;  1E3H A;  1R6L A;  5C0X E;  2NN6 F;  5K36 C;  1R6M A;  2NN6 C;  4OO1 E;  1UDS A;  3U1K A;  2BA0 D;  3GCM A;  4NBQ A;  2PO0 B;  5JEA D;  2BR2 B;  3M85 G;  4AM3 A;  5JEA F;  2PO0 A;  3CDJ A;  2C38 B;  2BR2 A;  5JEA C;  4BA2 B;  5K36 D;  2C38 A;  4BA1 B;  4IFD E;  2NN6 D;  4BA2 A;  4BA1 A;  2BA1 D;  1E3P A;  5C0X D;  5JEA B;  3M7N G;  1UDQ A;  5C0X F;  3DD6 A;  5JEA A;  4OO1 D;  5C0X C;  5K36 B;  4OO1 F;  2NN6 B;  5K36 A;  4OO1 C;  3CDI A;  2NN6 A;  4AIM A;  3M85 D;  3L7Z B;  1OYP A;  3L7Z A;  2BA0 G;  2PO1 B;  4IFD D;  1UDN A;  4IFD F;  1OYR A;  2PO1 A;  4IFD C;  1OYS A;  3H1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...