2PO0A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with adp in double conformation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
236
structure length
236
Chain Sequence
b'KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
total genus 75
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po0A01
5C0XD 4IFDB 2C37B 5K36D 2JEAB 3L7ZB 4OO1D 3M85D 3CDJA 3H1CA 5K36F 2BA1G 5JEAD 3M85G 4AIMA 3HKMA 2WNRA 4IFDF 1UDNA 1UDSA 2BA0D 1OYSA 1UDOA 2WNRB 5K36E 3U1KA 1E3PA 1OYRA 4OO1E 3B4TA 4IFDD 5JEAE 2WP8A 1OYPA 4AIDA 3M7ND 2WP8B 3GMEA 2C38A 2BR2A 4BA1A 2C38B 2C39A 2BR2B 2BA0G 2NN6C 4BA1B 5C0XC 4IFDE 2C39B 5K36C 2NN6A 5C0XA 5K36A 4OO1C 4OO1A 2JEBA 2NN6B 1UDQA 5C0XB 4AM3A 2PNZA 4NBQA 5K36B 3GLLA 4OO1B 2JEBB 5JEAC 2PNZB 5JEAA 2NN6D 3M7NG 3GCMA 1R6MA 2JE6A 1R6LA 3CDIA 2PO1A 5JEAB 1E3HA 2BA1D 2JE6B 2NN6F 5C0XF 2PO1B 4OO1F 2PO2A 2PO0A 4IFDC 3DD6A 4BA2A 4IFDA 2NN6E 2C37A 2PO2B 5C0XE 2PO0B 2JEAA 3L7ZA 5JEAF 3KRNA 4BA2B
chains in the Genus database with same CATH superfamily
4DR6E 1ZXNA 4DV5E 3ZKDA 1N0UA 2GO3A 5EKWA 3J80Q 2UUAE 5L3JA 2VQEI 4PRVA 4DR7E 4JI8I 2UXCE 3PRYA 4JI4E 2BA1G 1WUUA 1XNQI 5EL9A 4DPTA 5LMNE 4JI2I 2VF3A 4DR3I 2BA0D 4HYMA 1PVGA 4LFAE 4B3ME 2WNRB 2GO4A 1E3PA 4LF6I 4OO1E 4LFBI 2AE8A 3B8HA 4DV4E 4X64I 3V5RA 4YHHE 4P52A 4DPWA 3V2UC 3CWVA 3QT7A 2WP8A 4NXNI 4B3TI 1OYPA 3QT8A 1FWLA 2BM1A 4GKKI 3GMEA 3WU5A 2C38A 4WUDA 4JG4A 2UU9I 4JI0E 4HACB 4MU0A 2HHHE 5LL6R 2C39A 4HXZA 2BR2B 4DV0I 1H72C 1XMQE 2ZITA 4LF9I 2BA0G 2F4VE 1N33I 4BA1B 5C0XC 4IFDE 2HFSA 5K36C 4JI7E 3ZZUA 3P3EA 5C0XA 4DV5I 5K36A 1Z5CA 4FWGA 3GLLA 4JI1I 2UUAI 3J81C 2UXDI 4DR2E 2JEBB 2UXCI 4JI4I 2PNZB 5LMUE 4R1FA 4FW5A 2NN6D 4DR4I 3B82A 2V2VA 1Z0BA 5FLXQ 4YY3I 4LFAI 4USKA 2JE6B 4KQVA 4P7AA 1MU5A 4ISAA 2LJPA 4LF7E 2O1WA 4KHPI 1N32I 3P76A 3HJCA 4YHHI 3PS1A 4DUYE 5DNLA 1Z5AA 1Z0VA 4ED4A 3L7ZA 4X62I 1VISA 3T1YE 5C0XD 4AQYE 3JAMQ 2C37B 2E5LI 4PRXA 5K36D 2R3VA 1Z0CA 4JI0I 2ZM6E 3H1CA 2HHHI 3OTOI 4JYAE 2CVEA 3D4JA 1XMQI 2JT2A 4JV5E 4K0KE 3M85G 2F4VI 3LNUA 4AIMA 1FJGE 4JI7I 2BV3A 4LOMA 4DPYA 4Z7CA 4DV1E 1N36E 3WU6A 4IS9A 4DV6E 2PNMA 4LCHA 2VESA 2HK2A 3ZKBA 2UUBE 1UEKA 1NHJA 5FWKA 4DR2I 1FWKA 4IZKA 1IBLE 5LMUI 3J7AG 5A2QC 5JEAE 1PKPA 4FW4A 4JI3I 3U1YA 3K1JA 2WP8B 2HK3A 4XTJA 1RR9A 1Z0WA 2F1DA 4MU4A 4JI5I 1FNMA 1IBME 2EFGA 4DUYI 1H7SA 2Z5EA 2IOQA 3QT6A 1HR0E 2C38B 3Q1QA 4QNJA 4LCGA 4DU8A 2NN6C 3T1YI 4GKJE 2C39B 4AQYI 4M1KA 2NN6A 2IOPA 4OO1C 3J80C 4OO1A 4LF4E 5C0XB 2UXBI 3F0NA 1U2RA 4X66I 2HKEA 4DUZE 5K36B 1Y4UA 1HNZI 4B3RI 4X65E 4JV5I 4K0KI 4NXME 2CZ9A 4LF8I 2DEJA 4MU3A 4DV3I 3H4LA 3GCMA 4FW3A 2PNLA 3WU3A 4IZJD 1N36I 1E3HA 2UUCI 1Z59A 3PS2A 5C0XF 2UUBI 1MG7A 1KIJA 4DR6I 1A6FA 3J81Q 4DV2E 2PO2A 4N3OA 3Q6NA 1IBKE 4IFDC 4IFDA 2GQ0A 5C0XE 2JEAA 4LF5E 4DR7I 2V2QA 1KVKA 1Z0TA 5LMNI 5IT9C 2VQFE 2NPFA 3L7ZB 1N34E 2J7KA 3NZKA 4LFCE 4OO1D 4B3MI 3M85D 1ELOA 1D6TA 4ZVIA 4MQYA 4FN5A 4DV7E 2Z5BA 2V8PA 4DV4I 1ZM9A 1YH8A 1UDNA 1UDSA 2HKJA 1HNWE 4LF4I 1HK7A 2O3ZA 2O1VA 4RPFA 4DUZI 1FKAE 5DRRA 3P3GA 3PYEA 5DRQA 2BM0A 3M6AA 1XNRE 4JI8E 4NXMI 4WUBA 1XXEA 4OZEA 2ZBKB 5DRPA 5FLXC 1ZM4A 4JI2E 1S16A 1NHHA 4DR3E 4IFDD 2X7IA 4IZKB 4AIDA 3M7ND 1XHKA 4DR1E 1Z0EA 4Z7YA 2A2CA 1Z0GA 4WUCA 1NZ0A 1IBKI 2IERA 4JI6E 5A2QQ 4NXNE 4LPFA 1Z5BA 3JAMC 1J5EE 4MYUA 1YHCA 1PIEA 2VQFI 1Y5YA 4LFCI 2UU9E 1Y6ZA 1BKNA 1OJ4A 3LPSA 4IZJA 2NN6B 1UDQA 1H74A 4NBQA 1EA6A 4DR5E 5IWAE 4DV0E 4LF9E 4GQUA 4I3HA 4LF7I 1VI7A 4U3BA 4OO1B 5JEAC 4EMDA 2Z5CA 3ZZ0A 1N33E 4U3DA 2O1TA 4DU7A 4MYTA 5JEAA 1ZM3A 4MDTA 3M7NG 4LCFA 2AJ4A 1R6LA 2DEIA 5DROA 3PYDA 1P42A 3UHMA 4DPUA 3CDIA 2PO1A 1HNWI 4OX9E 2V2ZA 1DARA 2NN6F 2X36A 4JI1E 4UTGA 2UXDE 1XNRI 2Q2EB 1XMOE 4OO1F 3P3CA 4DR4E 1B62A 3LTOA 2ZM6I 2PO0A 4URLA 4FW7A 4YY3E 4J3DA 4BA2A 4PU9A 4JYAI 1B63A 2NN6E 2PO2B 4FW6A 3KRNA 3PYGA 1FJGI 4DR1I 4KHPE 4IFDB 1RHYA 1N32E 2JEAB 4DPXA 4DV1I 3CDJA 4FW9A 4DV6I 3ZZTA 4JI6I 3PS3A 5K36F 1EI1A 4X62E 5JEAD 3ZM7A 2CGEA 3T1HE 1J5EI 3K17A 1USUA 1IBLI 2R42A 4FWDA 3HULA 2E5LE 3HKMA 2WNRA 4IFDF 5IT9Q 1FI4A 3WU4A 2Z5BB 1OYSA 1UDOA 1H7UA 5K36E 1HNXE 3OTOE 4B3SE 2XEXA 3U1KA 4DR5I 4FWHA 5IWAI 1OYRA 3B4TA 2A2DA 1I94E 1IBMI 5BR8E 3K85A 1S4EA 5DNXA 1HR0I 5GMEA 1ZM2A 4OX9I 1KTVA 1N0VC 3P06A 3PYFA 1USVA 2WW4A 2O1UA 4GKJI 4HACA 1NHIA 3QT5A 1XMOI 2BR2A 4BA1A 5GMDA 2VQEE 1Y60A 4JI3E 4X65I 5ELWA 1XNQE 2OI2A 2J65A 3J7AM 4JI5E 3GONA 2HFUA 2CG9A 2JEBA 4AM3A 2PNZA 4LF6E 4LFBE 4IZJB 3Q6MA 1H73A 3T1HI 1QZRA 4X64E 4DV2I 1KKHA 1R6MA 2JE6A 2Z5CB 4USMA 1K47A 1MX0A 1RREA 4UT4A 2IESA 5JEAB 4B3TE 2BA1D 2UXBE 4LF5I 4X66E 3B78A 1HNXI 4B3SI 4GKKE 2PO1B 4MU1A 1Y4SA 1HNZE 4B3RE 1ZXMA 4HY1A 1N34I 4LF8E 4DV3E 2E1RA 2V34A 1I94I 4OKGA 3DD6A 5BR8I 4QNKA 4DXLA 2GS8A 2UUCE 2C37A 2PO0B 5JEAF 4BA2B 4DV7I
chains in the Genus database with same CATH topology
5C0XD 4IFDB 2C37B 5K36D 2JEAB 3L7ZB 4OO1D 3M85D 3CDJA 3H1CA 5K36F 2BA1G 5JEAD 3M85G 4AIMA 3HKMA 2WNRA 4IFDF 1UDNA 1UDSA 2BA0D 1OYSA 1UDOA 2WNRB 5K36E 3U1KA 1E3PA 1OYRA 4OO1E 3B4TA 4IFDD 5JEAE 2WP8A 1OYPA 4AIDA 3M7ND 2WP8B 3GMEA 2C38A 2BR2A 4BA1A 2C38B 2C39A 2BR2B 2BA0G 2NN6C 4BA1B 5C0XC 4IFDE 2C39B 5K36C 2NN6A 5C0XA 5K36A 4OO1C 4OO1A 2JEBA 2NN6B 1UDQA 5C0XB 4AM3A 2PNZA 4NBQA 5K36B 3GLLA 4OO1B 2JEBB 5JEAC 2PNZB 5JEAA 2NN6D 3M7NG 3GCMA 1R6MA 2JE6A 1R6LA 3CDIA 2PO1A 5JEAB 1E3HA 2BA1D 2JE6B 2NN6F 5C0XF 2PO1B 4OO1F 2PO2A 2PO0A 4IFDC 3DD6A 4BA2A 4IFDA 2NN6E 2C37A 2PO2B 5C0XE 2PO0B 2JEAA 3L7ZA 5JEAF 3KRNA 4BA2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X D;  4IFD B;  2C37 B;  5K36 D;  2JEA B;  3L7Z B;  4OO1 D;  3M85 D;  3CDJ A;  3H1C A;  5K36 F;  2BA1 G;  5JEA D;  3M85 G;  4AIM A;  3HKM A;  2WNR A;  4IFD F;  1UDN A;  1UDS A;  2BA0 D;  1OYS A;  1UDO A;  2WNR B;  5K36 E;  3U1K A;  1E3P A;  1OYR A;  4OO1 E;  3B4T A;  4IFD D;  5JEA E;  2WP8 A;  1OYP A;  4AID A;  3M7N D;  2WP8 B;  3GME A;  2C38 A;  2BR2 A;  4BA1 A;  2C38 B;  2C39 A;  2BR2 B;  2BA0 G;  2NN6 C;  4BA1 B;  5C0X C;  4IFD E;  2C39 B;  5K36 C;  2NN6 A;  5C0X A;  5K36 A;  4OO1 C;  4OO1 A;  2JEB A;  2NN6 B;  1UDQ A;  5C0X B;  4AM3 A;  2PNZ A;  4NBQ A;  5K36 B;  3GLL A;  4OO1 B;  2JEB B;  5JEA C;  2PNZ B;  5JEA A;  2NN6 D;  3M7N G;  3GCM A;  1R6M A;  2JE6 A;  1R6L A;  3CDI A;  2PO1 A;  5JEA B;  1E3H A;  2BA1 D;  2JE6 B;  2NN6 F;  5C0X F;  2PO1 B;  4OO1 F;  2PO2 A;  2PO0 A;  4IFD C;  3DD6 A;  4BA2 A;  4IFD A;  2NN6 E;  2C37 A;  2PO2 B;  5C0X E;  2PO0 B;  2JEA A;  3L7Z A;  5JEA F;  3KRN A;  4BA2 B; 
#chains in the Genus database with same CATH topology
 4DR6 E;  1ZXN A;  4DV5 E;  3ZKD A;  1N0U A;  2GO3 A;  5EKW A;  3J80 Q;  2UUA E;  5L3J A;  2VQE I;  4PRV A;  4DR7 E;  4JI8 I;  2UXC E;  3PRY A;  4JI4 E;  2BA1 G;  1WUU A;  1XNQ I;  5EL9 A;  4DPT A;  5LMN E;  4JI2 I;  2VF3 A;  4DR3 I;  2BA0 D;  4HYM A;  1PVG A;  4LFA E;  4B3M E;  2WNR B;  2GO4 A;  1E3P A;  4LF6 I;  4OO1 E;  4LFB I;  2AE8 A;  3B8H A;  4DV4 E;  4X64 I;  3V5R A;  4YHH E;  4P52 A;  4DPW A;  3V2U C;  3CWV A;  3QT7 A;  2WP8 A;  4NXN I;  4B3T I;  1OYP A;  3QT8 A;  1FWL A;  2BM1 A;  4GKK I;  3GME A;  3WU5 A;  2C38 A;  4WUD A;  4JG4 A;  2UU9 I;  4JI0 E;  4HAC B;  4MU0 A;  2HHH E;  5LL6 R;  2C39 A;  4HXZ A;  2BR2 B;  4DV0 I;  1H72 C;  1XMQ E;  2ZIT A;  4LF9 I;  2BA0 G;  2F4V E;  1N33 I;  4BA1 B;  5C0X C;  4IFD E;  2HFS A;  5K36 C;  4JI7 E;  3ZZU A;  3P3E A;  5C0X A;  4DV5 I;  5K36 A;  1Z5C A;  4FWG A;  3GLL A;  4JI1 I;  2UUA I;  3J81 C;  2UXD I;  4DR2 E;  2JEB B;  2UXC I;  4JI4 I;  2PNZ B;  5LMU E;  4R1F A;  4FW5 A;  2NN6 D;  4DR4 I;  3B82 A;  2V2V A;  1Z0B A;  5FLX Q;  4YY3 I;  4LFA I;  4USK A;  2JE6 B;  4KQV A;  4P7A A;  1MU5 A;  4ISA A;  2LJP A;  4LF7 E;  2O1W A;  4KHP I;  1N32 I;  3P76 A;  3HJC A;  4YHH I;  3PS1 A;  4DUY E;  5DNL A;  1Z5A A;  1Z0V A;  4ED4 A;  3L7Z A;  4X62 I;  1VIS A;  3T1Y E;  5C0X D;  4AQY E;  3JAM Q;  2C37 B;  2E5L I;  4PRX A;  5K36 D;  2R3V A;  1Z0C A;  4JI0 I;  2ZM6 E;  3H1C A;  2HHH I;  3OTO I;  4JYA E;  2CVE A;  3D4J A;  1XMQ I;  2JT2 A;  4JV5 E;  4K0K E;  3M85 G;  2F4V I;  3LNU A;  4AIM A;  1FJG E;  4JI7 I;  2BV3 A;  4LOM A;  4DPY A;  4Z7C A;  4DV1 E;  1N36 E;  3WU6 A;  4IS9 A;  4DV6 E;  2PNM A;  4LCH A;  2VES A;  2HK2 A;  3ZKB A;  2UUB E;  1UEK A;  1NHJ A;  5FWK A;  4DR2 I;  1FWK A;  4IZK A;  1IBL E;  5LMU I;  3J7A G;  5A2Q C;  5JEA E;  1PKP A;  4FW4 A;  4JI3 I;  3U1Y A;  3K1J A;  2WP8 B;  2HK3 A;  4XTJ A;  1RR9 A;  1Z0W A;  2F1D A;  4MU4 A;  4JI5 I;  1FNM A;  1IBM E;  2EFG A;  4DUY I;  1H7S A;  2Z5E A;  2IOQ A;  3QT6 A;  1HR0 E;  2C38 B;  3Q1Q A;  4QNJ A;  4LCG A;  4DU8 A;  2NN6 C;  3T1Y I;  4GKJ E;  2C39 B;  4AQY I;  4M1K A;  2NN6 A;  2IOP A;  4OO1 C;  3J80 C;  4OO1 A;  4LF4 E;  5C0X B;  2UXB I;  3F0N A;  1U2R A;  4X66 I;  2HKE A;  4DUZ E;  5K36 B;  1Y4U A;  1HNZ I;  4B3R I;  4X65 E;  4JV5 I;  4K0K I;  4NXM E;  2CZ9 A;  4LF8 I;  2DEJ A;  4MU3 A;  4DV3 I;  3H4L A;  3GCM A;  4FW3 A;  2PNL A;  3WU3 A;  4IZJ D;  1N36 I;  1E3H A;  2UUC I;  1Z59 A;  3PS2 A;  5C0X F;  2UUB I;  1MG7 A;  1KIJ A;  4DR6 I;  1A6F A;  3J81 Q;  4DV2 E;  2PO2 A;  4N3O A;  3Q6N A;  1IBK E;  4IFD C;  4IFD A;  2GQ0 A;  5C0X E;  2JEA A;  4LF5 E;  4DR7 I;  2V2Q A;  1KVK A;  1Z0T A;  5LMN I;  5IT9 C;  2VQF E;  2NPF A;  3L7Z B;  1N34 E;  2J7K A;  3NZK A;  4LFC E;  4OO1 D;  4B3M I;  3M85 D;  1ELO A;  1D6T A;  4ZVI A;  4MQY A;  4FN5 A;  4DV7 E;  2Z5B A;  2V8P A;  4DV4 I;  1ZM9 A;  1YH8 A;  1UDN A;  1UDS A;  2HKJ A;  1HNW E;  4LF4 I;  1HK7 A;  2O3Z A;  2O1V A;  4RPF A;  4DUZ I;  1FKA E;  5DRR A;  3P3G A;  3PYE A;  5DRQ A;  2BM0 A;  3M6A A;  1XNR E;  4JI8 E;  4NXM I;  4WUB A;  1XXE A;  4OZE A;  2ZBK B;  5DRP A;  5FLX C;  1ZM4 A;  4JI2 E;  1S16 A;  1NHH A;  4DR3 E;  4IFD D;  2X7I A;  4IZK B;  4AID A;  3M7N D;  1XHK A;  4DR1 E;  1Z0E A;  4Z7Y A;  2A2C A;  1Z0G A;  4WUC A;  1NZ0 A;  1IBK I;  2IER A;  4JI6 E;  5A2Q Q;  4NXN E;  4LPF A;  1Z5B A;  3JAM C;  1J5E E;  4MYU A;  1YHC A;  1PIE A;  2VQF I;  1Y5Y A;  4LFC I;  2UU9 E;  1Y6Z A;  1BKN A;  1OJ4 A;  3LPS A;  4IZJ A;  2NN6 B;  1UDQ A;  1H74 A;  4NBQ A;  1EA6 A;  4DR5 E;  5IWA E;  4DV0 E;  4LF9 E;  4GQU A;  4I3H A;  4LF7 I;  1VI7 A;  4U3B A;  4OO1 B;  5JEA C;  4EMD A;  2Z5C A;  3ZZ0 A;  1N33 E;  4U3D A;  2O1T A;  4DU7 A;  4MYT A;  5JEA A;  1ZM3 A;  4MDT A;  3M7N G;  4LCF A;  2AJ4 A;  1R6L A;  2DEI A;  5DRO A;  3PYD A;  1P42 A;  3UHM A;  4DPU A;  3CDI A;  2PO1 A;  1HNW I;  4OX9 E;  2V2Z A;  1DAR A;  2NN6 F;  2X36 A;  4JI1 E;  4UTG A;  2UXD E;  1XNR I;  2Q2E B;  1XMO E;  4OO1 F;  3P3C A;  4DR4 E;  1B62 A;  3LTO A;  2ZM6 I;  2PO0 A;  4URL A;  4FW7 A;  4YY3 E;  4J3D A;  4BA2 A;  4PU9 A;  4JYA I;  1B63 A;  2NN6 E;  2PO2 B;  4FW6 A;  3KRN A;  3PYG A;  1FJG I;  4DR1 I;  4KHP E;  4IFD B;  1RHY A;  1N32 E;  2JEA B;  4DPX A;  4DV1 I;  3CDJ A;  4FW9 A;  4DV6 I;  3ZZT A;  4JI6 I;  3PS3 A;  5K36 F;  1EI1 A;  4X62 E;  5JEA D;  3ZM7 A;  2CGE A;  3T1H E;  1J5E I;  3K17 A;  1USU A;  1IBL I;  2R42 A;  4FWD A;  3HUL A;  2E5L E;  3HKM A;  2WNR A;  4IFD F;  5IT9 Q;  1FI4 A;  3WU4 A;  2Z5B B;  1OYS A;  1UDO A;  1H7U A;  5K36 E;  1HNX E;  3OTO E;  4B3S E;  2XEX A;  3U1K A;  4DR5 I;  4FWH A;  5IWA I;  1OYR A;  3B4T A;  2A2D A;  1I94 E;  1IBM I;  5BR8 E;  3K85 A;  1S4E A;  5DNX A;  1HR0 I;  5GME A;  1ZM2 A;  4OX9 I;  1KTV A;  1N0V C;  3P06 A;  3PYF A;  1USV A;  2WW4 A;  2O1U A;  4GKJ I;  4HAC A;  1NHI A;  3QT5 A;  1XMO I;  2BR2 A;  4BA1 A;  5GMD A;  2VQE E;  1Y60 A;  4JI3 E;  4X65 I;  5ELW A;  1XNQ E;  2OI2 A;  2J65 A;  3J7A M;  4JI5 E;  3GON A;  2HFU A;  2CG9 A;  2JEB A;  4AM3 A;  2PNZ A;  4LF6 E;  4LFB E;  4IZJ B;  3Q6M A;  1H73 A;  3T1H I;  1QZR A;  4X64 E;  4DV2 I;  1KKH A;  1R6M A;  2JE6 A;  2Z5C B;  4USM A;  1K47 A;  1MX0 A;  1RRE A;  4UT4 A;  2IES A;  5JEA B;  4B3T E;  2BA1 D;  2UXB E;  4LF5 I;  4X66 E;  3B78 A;  1HNX I;  4B3S I;  4GKK E;  2PO1 B;  4MU1 A;  1Y4S A;  1HNZ E;  4B3R E;  1ZXM A;  4HY1 A;  1N34 I;  4LF8 E;  4DV3 E;  2E1R A;  2V34 A;  1I94 I;  4OKG A;  3DD6 A;  5BR8 I;  4QNK A;  4DXL A;  2GS8 A;  2UUC E;  2C37 A;  2PO0 B;  5JEA F;  4BA2 B;  4DV7 I; 
#chains in the Genus database with same CATH homology
 5C0X D;  4IFD B;  2C37 B;  5K36 D;  2JEA B;  3L7Z B;  4OO1 D;  3M85 D;  3CDJ A;  3H1C A;  5K36 F;  2BA1 G;  5JEA D;  3M85 G;  4AIM A;  3HKM A;  2WNR A;  4IFD F;  1UDN A;  1UDS A;  2BA0 D;  1OYS A;  1UDO A;  2WNR B;  5K36 E;  3U1K A;  1E3P A;  1OYR A;  4OO1 E;  3B4T A;  4IFD D;  5JEA E;  2WP8 A;  1OYP A;  4AID A;  3M7N D;  2WP8 B;  3GME A;  2C38 A;  2BR2 A;  4BA1 A;  2C38 B;  2C39 A;  2BR2 B;  2BA0 G;  2NN6 C;  4BA1 B;  5C0X C;  4IFD E;  2C39 B;  5K36 C;  2NN6 A;  5C0X A;  5K36 A;  4OO1 C;  4OO1 A;  2JEB A;  2NN6 B;  1UDQ A;  5C0X B;  4AM3 A;  2PNZ A;  4NBQ A;  5K36 B;  3GLL A;  4OO1 B;  2JEB B;  5JEA C;  2PNZ B;  5JEA A;  2NN6 D;  3M7N G;  3GCM A;  1R6M A;  2JE6 A;  1R6L A;  3CDI A;  2PO1 A;  5JEA B;  1E3H A;  2BA1 D;  2JE6 B;  2NN6 F;  5C0X F;  2PO1 B;  4OO1 F;  2PO2 A;  2PO0 A;  4IFD C;  3DD6 A;  4BA2 A;  4IFD A;  2NN6 E;  2C37 A;  2PO2 B;  5C0X E;  2PO0 B;  2JEA A;  3L7Z A;  5JEA F;  3KRN A;  4BA2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...