2PO0A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with adp in double conformation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase
molecule keywords Probable exosome complex exonuclease 1
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 75
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po0A01
4OO1A 4BA1B 3H1CA 4IFDA 1R6LA 3U1KA 2PNZA 2WNRA 1OYSA 4IFDB 2PO1A 5JEAE 3HKMA 5K36F 3GLLA 3M7NG 5JEAC 2NN6F 4OO1F 4AM3A 5JEAD 1UDNA 4BA1A 3L7ZA 3CDJA 2JE6B 2WP8A 5C0XA 3L7ZB 2PO2B 2WP8B 5K36E 3DD6A 1OYPA 5C0XB 2NN6E 4OO1E 2C38B 5K36C 5K36D 2NN6C 4OO1C 3CDIA 2NN6D 3M85G 4IFDF 3M7ND 1OYRA 4BA2B 4AIMA 5JEAA 2JE6A 1E3HA 5JEAB 2C37B 2PO2A 2JEAA 2JEBA 2C39B 4NBQA 2BA1G 2BA0G 2JEAB 2BR2A 2C38A 2JEBB 1UDOA 2BR2B 1UDSA 4IFDE 4BA2A 2PO0B 4OO1D 3GMEA 4IFDC 5C0XF 5K36A 4IFDD 2NN6A 1R6MA 2C37A 3M85D 5K36B 2C39A 2NN6B 4OO1B 2PNZB 2WNRB 3KRNA 2PO1B 5JEAF 3GCMA 2BA1D 2BA0D 2PO0A 4AIDA 5C0XE 1E3PA 3B4TA 5C0XC 1UDQA 5C0XD
chains in the Genus database with same CATH superfamily
4OO1A 1OJ4A 1Y4UA 2GQ0A 4ZVIA 3U1KA 4WUBA 3T1HE 4DR6I 4U3BA 3HKMA 2UXBI 4GQUA 1VISA 4AQYI 5DRPA 1XMQI 2J65A 2NN6F 4OO1F 1IBKE 4I3HA 5ELWA 2BV3A 4LOMA 1WUUA 4USMA 4PU9A 4BA1A 1S16A 4WUCA 4B3MI 3P3CA 4DV4E 4DV7I 2WP8A 5A2QC 4OX9E 2PNLA 4LFAE 5C0XA 3K85A 3ZM7A 1IBLE 1IBME 1OYPA 2V2QA 1NHJA 3PYFA 1Y60A 4X64I 2VQFE 5FLXQ 4B3TE 4DR7I 2NN6D 4IFDF 5FWKA 4B3RI 1HNZE 1OYRA 4MU0A 4LF7I 5JEAA 4LFBI 4NXME 1FWLA 4MYTA 1H7UA 1YH8A 4DR3I 4NBQA 4MU4A 2BR2A 4DR4I 1H73A 4HACB 4DV2E 2WW4A 3OTOI 2F1DA 1XXEA 3HJCA 4USKA 1N0VC 2HFUA 4JV5I 2UXBE 2R3VA 5LL6R 1Z0EA 2OI2A 4IFDD 4FW6A 2C37A 4FWGA 2C39A 3M6AA 2NN6B 4OO1B 2IESA 4DV6E 4DR5I 4ED4A 1N36I 1IBKI 4DV7E 1Z0CA 3J7AG 1XNQI 3KRNA 4JI4I 4DPWA 1D6TA 4FW7A 4LCGA 3J80Q 3P06A 4JI7I 2BA0D 2PO0A 4NXNE 4AIDA 5GMEA 1H7SA 4JG4A 1E3PA 2HFSA 4OX9I 4DR7E 3PYGA 2HK2A 3GONA 2BM0A 4BA1B 2CGEA 1J5EE 4LF7E 4IZJA 4LFBE 4KQVA 2WNRA 5L3JA 4YHHI 2GO4A 4IFDB 2GO3A 2ZITA 3H4LA 3PS2A 1ZXNA 2VQFI 2IERA 5K36F 3GLLA 4DR3E 1HNZI 4P7AA 4AM3A 1UDNA 4JYAE 4YY3I 4DR4E 5LMNI 3OTOE 3QT7A 4X62E 1UEKA 3B8HA 4GKKE 1MG7A 1ZM4A 3LNUA 4DR2I 3ZKBA 4LPFA 2HKEA 3ZZUA 5DROA 3QT5A 3JAMQ 4DV2I 4DU7A 3L7ZB 4DUYI 2Z5CB 5LMUI 1Y4SA 2X7IA 3DD6A 2O1TA 1N32I 3WU6A 5EL9A 1XMOI 4JI3E 1A6FA 2NN6E 4OO1E 1ZM3A 3LTOA 5K36D 4DUZE 4DR5E 3P3EA 2NN6C 4OO1C 3U1YA 4JI6E 3WU5A 1N36E 4GKJI 2BM1A 4FWHA 1XNQE 4JI4E 2LJPA 3ZKDA 4ISAA 4JI7E 1DARA 3V2UC 2UUCI 4DV6I 4DV3I 3QT6A 2C37B 2PO2A 4PRXA 1Z5CA 2C39B 4Z7YA 2BA1G 1MU5A 4Z7CA 2JEAB 1USVA 4NXNI 2UUAE 2JEBB 4X65E 1XHKA 4IZKA 2O1WA 2O3ZA 1UDOA 1Y6ZA 4DV1I 4YHHE 1Z59A 4IFDE 1Z0GA 4BA2A 2VF3A 1Z0VA 4N3OA 2PO0B 4OO1D 2V34A 4IFDC 1HNWE 1PIEA 5C0XF 1J5EI 1KTVA 2Z5EA 1R6MA 4OKGA 4YY3E 3Q1QA 3QT8A 5K36B 2UXDE 4FW9A 5LMNE 4B3SE 5EKWA 4DR2E 4K0KI 2Z5BA 1VI7A 2WNRB 4JYAI 3T1YE 5JEAF 3J81Q 2XEXA 4GKKI 4X62I 4DUYE 4DPYA 5LMUE 1N32E 3ZZ0A 2IOPA 3V5RA 1XMOE 5FLXC 4URLA 2R42A 4JI0E 3PYEA 2UUBI 3B78A 5C0XD 5BR8E 4GKJE 1EA6A 1U2RA 4OZEA 3B82A 3CWVA 4JI3I 5IT9Q 1R6LA 2PNZA 2Q2EB 2UUCE 5DNLA 4X66I 1OYSA 4DUZI 4DV3E 4DR1E 4JI6I 4WUDA 4DPUA 3M7NG 5DNXA 4JI8I 3J81C 4JI2E 5JEAD 1N0UA 1RREA 2UU9I 2GS8A 4DV1E 3P76A 3UHMA 4UTGA 2HKJA 2UUAI 4X65I 1KKHA 2AJ4A 2PO2B 1P42A 2WP8B 4UT4A 5K36E 3NZKA 5C0XB 5K36C 1HNWI 4LF4E 1XNRI 4IZKB 4K0KE 4JI5E 1FKAE 3K1JA 4HYMA 3J80C 3WU4A 3M85G 1K47A 1Z5BA 2UXDI 4PRVA 2CVEA 2O1UA 4RPFA 4B3SI 4BA2B 1Z0TA 4AIMA 1H72C 1USUA 2JE6A 4EMDA 3LPSA 4QNJA 3PRYA 4FW4A 1KIJA 2DEIA 5JEAB 4DPXA 2VESA 1H74A 3T1YI 2UUBE 2DEJA 4R1FA 5DRRA 2JT2A 2C38A 1N34E 2X36A 1HK7A 4KHPE 2Z5BB 4LF6I 1HR0E 2BR2B 4JI0I 1NHIA 4X66E 5GMDA 1FJGI 2CG9A 1RHYA 5BR8I 2A2DA 4JI8E 1PKPA 4IZJD 2NN6A 2UU9E 5A2QQ 1B63A 2V8PA 2UXCE 4DR1I 3K17A 2F4VI 1ZM2A 1FI4A 1FNMA 3JAMC 3F0NA 4JI2I 2PNZB 4DXLA 1I94E 1ZM9A 4LF9I 2J7KA 4LFCE 2BA1D 4LCHA 4DU8A 5C0XE 2CZ9A 2AE8A 2ZBKB 3B4TA 5C0XC 1XNRE 1UDQA 4JI1I 2E5LE 3H1CA 4MQYA 4IFDA 4DV5I 2A2CA 1Y5YA 2V2VA 4J3DA 4LF4I 2ZM6E 5IWAI 2IOQA 4FWDA 4JI5I 2PO1A 3PS1A 4IZJB 1QZRA 4FW5A 5JEAE 4LF8I 1N33E 2VQEE 5JEAC 2PNMA 1ELOA 1KVKA 4LF6E 2EFGA 1FWKA 2NPFA 1FJGE 3L7ZA 4LF5I 3CDJA 2JE6B 1N34I 1BKNA 2Z5CA 4KHPI 3J7AM 1HR0I 2O1VA 4MYUA 1PVGA 2HHHI 1HNXI 2F4VE 2C38B 4DV0I 4DR6E 3CDIA 1Z0WA 3PYDA 4AQYE 3M7ND 4XTJA 1XMQE 4MU1A 4LF9E 2UXCI 3T1HI 1Z5AA 1E3HA 3ZZTA 2JEAA 1S4EA 1I94I 4M1KA 2JEBA 4JI1E 3P3GA 1Z0BA 3WU3A 4B3ME 5IT9C 2BA0G 4LFCI 4U3DA 3D4JA 4DPTA 3PS3A 3Q6NA 4DV5E 4LCFA 1UDSA 5IWAE 3Q6MA 4LF8E 4DV4I 4FN5A 3GMEA 2E5LI 5K36A 4HXZA 4X64E 4LFAI 4IS9A 1IBLI 4B3RE 3M85D 1IBMI 1EI1A 2ZM6I 1ZXMA 1N33I 1YHCA 4HACA 2VQEI 5DRQA 4B3TI 4LF5E 2V2ZA 2PO1B 3GCMA 1NHHA 4MDTA 2E1RA 4QNKA 2HK3A 4MU3A 1NZ0A 4NXMI 4FW3A 1RR9A 2HHHE 1B62A 1HNXE 4HY1A 1MX0A 4DV0E 4JV5E 4P52A 3HULA
chains in the Genus database with same CATH topology
4OO1A 4BA1B 3H1CA 4IFDA 1R6LA 3U1KA 2PNZA 2WNRA 1OYSA 4IFDB 2PO1A 5JEAE 3HKMA 5K36F 3GLLA 3M7NG 5JEAC 2NN6F 4OO1F 4AM3A 5JEAD 1UDNA 4BA1A 3L7ZA 3CDJA 2JE6B 2WP8A 5C0XA 3L7ZB 2PO2B 2WP8B 5K36E 3DD6A 1OYPA 5C0XB 2NN6E 4OO1E 2C38B 5K36C 5K36D 2NN6C 4OO1C 3CDIA 2NN6D 3M85G 4IFDF 3M7ND 1OYRA 4BA2B 4AIMA 5JEAA 2JE6A 1E3HA 5JEAB 2C37B 2PO2A 2JEAA 2JEBA 2C39B 4NBQA 2BA1G 2BA0G 2JEAB 2BR2A 2C38A 2JEBB 1UDOA 2BR2B 1UDSA 4IFDE 4BA2A 2PO0B 4OO1D 3GMEA 4IFDC 5C0XF 5K36A 4IFDD 2NN6A 1R6MA 2C37A 3M85D 5K36B 2C39A 2NN6B 4OO1B 2PNZB 2WNRB 3KRNA 2PO1B 5JEAF 3GCMA 2BA1D 2BA0D 2PO0A 4AIDA 5C0XE 1E3PA 3B4TA 5C0XC 1UDQA 5C0XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 A;  4BA1 B;  3H1C A;  4IFD A;  1R6L A;  3U1K A;  2PNZ A;  2WNR A;  1OYS A;  4IFD B;  2PO1 A;  5JEA E;  3HKM A;  5K36 F;  3GLL A;  3M7N G;  5JEA C;  2NN6 F;  4OO1 F;  4AM3 A;  5JEA D;  1UDN A;  4BA1 A;  3L7Z A;  3CDJ A;  2JE6 B;  2WP8 A;  5C0X A;  3L7Z B;  2PO2 B;  2WP8 B;  5K36 E;  3DD6 A;  1OYP A;  5C0X B;  2NN6 E;  4OO1 E;  2C38 B;  5K36 C;  5K36 D;  2NN6 C;  4OO1 C;  3CDI A;  2NN6 D;  3M85 G;  4IFD F;  3M7N D;  1OYR A;  4BA2 B;  4AIM A;  5JEA A;  2JE6 A;  1E3H A;  5JEA B;  2C37 B;  2PO2 A;  2JEA A;  2JEB A;  2C39 B;  4NBQ A;  2BA1 G;  2BA0 G;  2JEA B;  2BR2 A;  2C38 A;  2JEB B;  1UDO A;  2BR2 B;  1UDS A;  4IFD E;  4BA2 A;  2PO0 B;  4OO1 D;  3GME A;  4IFD C;  5C0X F;  5K36 A;  4IFD D;  2NN6 A;  1R6M A;  2C37 A;  3M85 D;  5K36 B;  2C39 A;  2NN6 B;  4OO1 B;  2PNZ B;  2WNR B;  3KRN A;  2PO1 B;  5JEA F;  3GCM A;  2BA1 D;  2BA0 D;  2PO0 A;  4AID A;  5C0X E;  1E3P A;  3B4T A;  5C0X C;  1UDQ A;  5C0X D; 
#chains in the Genus database with same CATH topology
 4OO1 A;  1OJ4 A;  1Y4U A;  2GQ0 A;  4ZVI A;  3U1K A;  4WUB A;  3T1H E;  4DR6 I;  4U3B A;  3HKM A;  2UXB I;  4GQU A;  1VIS A;  4AQY I;  5DRP A;  1XMQ I;  2J65 A;  2NN6 F;  4OO1 F;  1IBK E;  4I3H A;  5ELW A;  2BV3 A;  4LOM A;  1WUU A;  4USM A;  4PU9 A;  4BA1 A;  1S16 A;  4WUC A;  4B3M I;  3P3C A;  4DV4 E;  4DV7 I;  2WP8 A;  5A2Q C;  4OX9 E;  2PNL A;  4LFA E;  5C0X A;  3K85 A;  3ZM7 A;  1IBL E;  1IBM E;  1OYP A;  2V2Q A;  1NHJ A;  3PYF A;  1Y60 A;  4X64 I;  2VQF E;  5FLX Q;  4B3T E;  4DR7 I;  2NN6 D;  4IFD F;  5FWK A;  4B3R I;  1HNZ E;  1OYR A;  4MU0 A;  4LF7 I;  5JEA A;  4LFB I;  4NXM E;  1FWL A;  4MYT A;  1H7U A;  1YH8 A;  4DR3 I;  4NBQ A;  4MU4 A;  2BR2 A;  4DR4 I;  1H73 A;  4HAC B;  4DV2 E;  2WW4 A;  3OTO I;  2F1D A;  1XXE A;  3HJC A;  4USK A;  1N0V C;  2HFU A;  4JV5 I;  2UXB E;  2R3V A;  5LL6 R;  1Z0E A;  2OI2 A;  4IFD D;  4FW6 A;  2C37 A;  4FWG A;  2C39 A;  3M6A A;  2NN6 B;  4OO1 B;  2IES A;  4DV6 E;  4DR5 I;  4ED4 A;  1N36 I;  1IBK I;  4DV7 E;  1Z0C A;  3J7A G;  1XNQ I;  3KRN A;  4JI4 I;  4DPW A;  1D6T A;  4FW7 A;  4LCG A;  3J80 Q;  3P06 A;  4JI7 I;  2BA0 D;  2PO0 A;  4NXN E;  4AID A;  5GME A;  1H7S A;  4JG4 A;  1E3P A;  2HFS A;  4OX9 I;  4DR7 E;  3PYG A;  2HK2 A;  3GON A;  2BM0 A;  4BA1 B;  2CGE A;  1J5E E;  4LF7 E;  4IZJ A;  4LFB E;  4KQV A;  2WNR A;  5L3J A;  4YHH I;  2GO4 A;  4IFD B;  2GO3 A;  2ZIT A;  3H4L A;  3PS2 A;  1ZXN A;  2VQF I;  2IER A;  5K36 F;  3GLL A;  4DR3 E;  1HNZ I;  4P7A A;  4AM3 A;  1UDN A;  4JYA E;  4YY3 I;  4DR4 E;  5LMN I;  3OTO E;  3QT7 A;  4X62 E;  1UEK A;  3B8H A;  4GKK E;  1MG7 A;  1ZM4 A;  3LNU A;  4DR2 I;  3ZKB A;  4LPF A;  2HKE A;  3ZZU A;  5DRO A;  3QT5 A;  3JAM Q;  4DV2 I;  4DU7 A;  3L7Z B;  4DUY I;  2Z5C B;  5LMU I;  1Y4S A;  2X7I A;  3DD6 A;  2O1T A;  1N32 I;  3WU6 A;  5EL9 A;  1XMO I;  4JI3 E;  1A6F A;  2NN6 E;  4OO1 E;  1ZM3 A;  3LTO A;  5K36 D;  4DUZ E;  4DR5 E;  3P3E A;  2NN6 C;  4OO1 C;  3U1Y A;  4JI6 E;  3WU5 A;  1N36 E;  4GKJ I;  2BM1 A;  4FWH A;  1XNQ E;  4JI4 E;  2LJP A;  3ZKD A;  4ISA A;  4JI7 E;  1DAR A;  3V2U C;  2UUC I;  4DV6 I;  4DV3 I;  3QT6 A;  2C37 B;  2PO2 A;  4PRX A;  1Z5C A;  2C39 B;  4Z7Y A;  2BA1 G;  1MU5 A;  4Z7C A;  2JEA B;  1USV A;  4NXN I;  2UUA E;  2JEB B;  4X65 E;  1XHK A;  4IZK A;  2O1W A;  2O3Z A;  1UDO A;  1Y6Z A;  4DV1 I;  4YHH E;  1Z59 A;  4IFD E;  1Z0G A;  4BA2 A;  2VF3 A;  1Z0V A;  4N3O A;  2PO0 B;  4OO1 D;  2V34 A;  4IFD C;  1HNW E;  1PIE A;  5C0X F;  1J5E I;  1KTV A;  2Z5E A;  1R6M A;  4OKG A;  4YY3 E;  3Q1Q A;  3QT8 A;  5K36 B;  2UXD E;  4FW9 A;  5LMN E;  4B3S E;  5EKW A;  4DR2 E;  4K0K I;  2Z5B A;  1VI7 A;  2WNR B;  4JYA I;  3T1Y E;  5JEA F;  3J81 Q;  2XEX A;  4GKK I;  4X62 I;  4DUY E;  4DPY A;  5LMU E;  1N32 E;  3ZZ0 A;  2IOP A;  3V5R A;  1XMO E;  5FLX C;  4URL A;  2R42 A;  4JI0 E;  3PYE A;  2UUB I;  3B78 A;  5C0X D;  5BR8 E;  4GKJ E;  1EA6 A;  1U2R A;  4OZE A;  3B82 A;  3CWV A;  4JI3 I;  5IT9 Q;  1R6L A;  2PNZ A;  2Q2E B;  2UUC E;  5DNL A;  4X66 I;  1OYS A;  4DUZ I;  4DV3 E;  4DR1 E;  4JI6 I;  4WUD A;  4DPU A;  3M7N G;  5DNX A;  4JI8 I;  3J81 C;  4JI2 E;  5JEA D;  1N0U A;  1RRE A;  2UU9 I;  2GS8 A;  4DV1 E;  3P76 A;  3UHM A;  4UTG A;  2HKJ A;  2UUA I;  4X65 I;  1KKH A;  2AJ4 A;  2PO2 B;  1P42 A;  2WP8 B;  4UT4 A;  5K36 E;  3NZK A;  5C0X B;  5K36 C;  1HNW I;  4LF4 E;  1XNR I;  4IZK B;  4K0K E;  4JI5 E;  1FKA E;  3K1J A;  4HYM A;  3J80 C;  3WU4 A;  3M85 G;  1K47 A;  1Z5B A;  2UXD I;  4PRV A;  2CVE A;  2O1U A;  4RPF A;  4B3S I;  4BA2 B;  1Z0T A;  4AIM A;  1H72 C;  1USU A;  2JE6 A;  4EMD A;  3LPS A;  4QNJ A;  3PRY A;  4FW4 A;  1KIJ A;  2DEI A;  5JEA B;  4DPX A;  2VES A;  1H74 A;  3T1Y I;  2UUB E;  2DEJ A;  4R1F A;  5DRR A;  2JT2 A;  2C38 A;  1N34 E;  2X36 A;  1HK7 A;  4KHP E;  2Z5B B;  4LF6 I;  1HR0 E;  2BR2 B;  4JI0 I;  1NHI A;  4X66 E;  5GMD A;  1FJG I;  2CG9 A;  1RHY A;  5BR8 I;  2A2D A;  4JI8 E;  1PKP A;  4IZJ D;  2NN6 A;  2UU9 E;  5A2Q Q;  1B63 A;  2V8P A;  2UXC E;  4DR1 I;  3K17 A;  2F4V I;  1ZM2 A;  1FI4 A;  1FNM A;  3JAM C;  3F0N A;  4JI2 I;  2PNZ B;  4DXL A;  1I94 E;  1ZM9 A;  4LF9 I;  2J7K A;  4LFC E;  2BA1 D;  4LCH A;  4DU8 A;  5C0X E;  2CZ9 A;  2AE8 A;  2ZBK B;  3B4T A;  5C0X C;  1XNR E;  1UDQ A;  4JI1 I;  2E5L E;  3H1C A;  4MQY A;  4IFD A;  4DV5 I;  2A2C A;  1Y5Y A;  2V2V A;  4J3D A;  4LF4 I;  2ZM6 E;  5IWA I;  2IOQ A;  4FWD A;  4JI5 I;  2PO1 A;  3PS1 A;  4IZJ B;  1QZR A;  4FW5 A;  5JEA E;  4LF8 I;  1N33 E;  2VQE E;  5JEA C;  2PNM A;  1ELO A;  1KVK A;  4LF6 E;  2EFG A;  1FWK A;  2NPF A;  1FJG E;  3L7Z A;  4LF5 I;  3CDJ A;  2JE6 B;  1N34 I;  1BKN A;  2Z5C A;  4KHP I;  3J7A M;  1HR0 I;  2O1V A;  4MYU A;  1PVG A;  2HHH I;  1HNX I;  2F4V E;  2C38 B;  4DV0 I;  4DR6 E;  3CDI A;  1Z0W A;  3PYD A;  4AQY E;  3M7N D;  4XTJ A;  1XMQ E;  4MU1 A;  4LF9 E;  2UXC I;  3T1H I;  1Z5A A;  1E3H A;  3ZZT A;  2JEA A;  1S4E A;  1I94 I;  4M1K A;  2JEB A;  4JI1 E;  3P3G A;  1Z0B A;  3WU3 A;  4B3M E;  5IT9 C;  2BA0 G;  4LFC I;  4U3D A;  3D4J A;  4DPT A;  3PS3 A;  3Q6N A;  4DV5 E;  4LCF A;  1UDS A;  5IWA E;  3Q6M A;  4LF8 E;  4DV4 I;  4FN5 A;  3GME A;  2E5L I;  5K36 A;  4HXZ A;  4X64 E;  4LFA I;  4IS9 A;  1IBL I;  4B3R E;  3M85 D;  1IBM I;  1EI1 A;  2ZM6 I;  1ZXM A;  1N33 I;  1YHC A;  4HAC A;  2VQE I;  5DRQ A;  4B3T I;  4LF5 E;  2V2Z A;  2PO1 B;  3GCM A;  1NHH A;  4MDT A;  2E1R A;  4QNK A;  2HK3 A;  4MU3 A;  1NZ0 A;  4NXM I;  4FW3 A;  1RR9 A;  2HHH E;  1B62 A;  1HNX E;  4HY1 A;  1MX0 A;  4DV0 E;  4JV5 E;  4P52 A;  3HUL A; 
#chains in the Genus database with same CATH homology
 4OO1 A;  4BA1 B;  3H1C A;  4IFD A;  1R6L A;  3U1K A;  2PNZ A;  2WNR A;  1OYS A;  4IFD B;  2PO1 A;  5JEA E;  3HKM A;  5K36 F;  3GLL A;  3M7N G;  5JEA C;  2NN6 F;  4OO1 F;  4AM3 A;  5JEA D;  1UDN A;  4BA1 A;  3L7Z A;  3CDJ A;  2JE6 B;  2WP8 A;  5C0X A;  3L7Z B;  2PO2 B;  2WP8 B;  5K36 E;  3DD6 A;  1OYP A;  5C0X B;  2NN6 E;  4OO1 E;  2C38 B;  5K36 C;  5K36 D;  2NN6 C;  4OO1 C;  3CDI A;  2NN6 D;  3M85 G;  4IFD F;  3M7N D;  1OYR A;  4BA2 B;  4AIM A;  5JEA A;  2JE6 A;  1E3H A;  5JEA B;  2C37 B;  2PO2 A;  2JEA A;  2JEB A;  2C39 B;  4NBQ A;  2BA1 G;  2BA0 G;  2JEA B;  2BR2 A;  2C38 A;  2JEB B;  1UDO A;  2BR2 B;  1UDS A;  4IFD E;  4BA2 A;  2PO0 B;  4OO1 D;  3GME A;  4IFD C;  5C0X F;  5K36 A;  4IFD D;  2NN6 A;  1R6M A;  2C37 A;  3M85 D;  5K36 B;  2C39 A;  2NN6 B;  4OO1 B;  2PNZ B;  2WNR B;  3KRN A;  2PO1 B;  5JEA F;  3GCM A;  2BA1 D;  2BA0 D;  2PO0 A;  4AID A;  5C0X E;  1E3P A;  3B4T A;  5C0X C;  1UDQ A;  5C0X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...