2PO0A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with adp in double conformation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
molecule keywords Probable exosome complex exonuclease 1
total genus 75
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po0A01
5JEAF 3GLLA 3L7ZA 1UDOA 2PO1B 2JEBB 4IFDA 2WNRB 4OO1F 5K36F 3CDIA 3L7ZB 4IFDF 2C39B 3M7NG 5C0XF 1E3HA 5JEAA 5K36A 4OO1A 2C37A 2JEAA 2JEBA 2WNRA 1UDSA 4OO1B 4NBQA 2C38A 5JEAC 2BA1G 2PO0A 5C0XA 2C38B 4BA1B 2PNZB 1UDQA 1OYRA 3GCMA 2NN6C 2BR2B 2PO2B 4OO1D 3U1KA 3HKMA 5C0XC 2JE6B 2PO2A 5C0XE 4AM3A 1R6LA 2PO1A 4IFDB 5C0XD 5JEAB 1R6MA 2C37B 2JE6A 2NN6A 2BA0D 3KRNA 5JEAE 2C39A 3H1CA 5JEAD 4AIMA 5C0XB 4BA2A 2NN6B 3M85G 1E3PA 2NN6D 2JEAB 3M85D 2NN6F 3DD6A 5K36D 3CDJA 2NN6E 4OO1E 2BA1D 5K36E 1OYPA 2PNZA 3M7ND 2BA0G 5K36B 5K36C 4OO1C 3GMEA 2WP8B 4IFDC 2PO0B 4IFDD 4AIDA 2WP8A 3B4TA 2BR2A 4BA2B 1OYSA 4IFDE 1UDNA 4BA1A
chains in the Genus database with same CATH superfamily
5JEAF 3V2UC 3P06A 2X7IA 2WNRB 4OO1F 1Y5YA 2VESA 4JI7E 3J80C 2UUBI 4B3TE 4JI3I 2C39B 4NXNI 3HJCA 2UXDI 2IOPA 4FWGA 2UXCE 1HR0I 4YHHE 1PVGA 4LOMA 1UDSA 4IZJB 5LMUI 2C38A 4OZEA 1N34I 5JEAC 1NHHA 3T1YI 4DV4E 2Q2EB 5C0XA 2C38B 1RREA 4BA1B 2PNZB 1UDQA 4LCGA 3QT8A 4JI2I 5FLXQ 4OO1D 4DR3I 4JG4A 5IWAE 2PNMA 3K17A 4DV0E 5C0XE 4JV5E 4DPTA 4Z7CA 4KQVA 4LPFA 5C0XD 1HNXI 1KVKA 2J65A 1K47A 4J3DA 2LJPA 4WUBA 2NN6A 2DEJA 3KRNA 4HXZA 1J5EI 4DXLA 4PRVA 4DR6I 1DARA 5FLXC 3H1CA 3T1YE 1N33I 1Y4SA 4DR5E 1B62A 2VF3A 5C0XB 1QZRA 1XNRE 1IBLE 1HNWI 1KTVA 1VISA 1FKAE 4USKA 4WUDA 2CGEA 4HY1A 4LF4E 3OTOE 4JI1E 4DV3E 2JEAB 4N3OA 1USUA 4NXNE 2UUCE 5K36D 2UUBE 4B3TI 3CDJA 2IESA 4JI3E 4LF5I 2F4VE 3PS2A 2VQEI 2UU9E 4OO1E 2BA1D 1Y6ZA 2BM0A 4LCHA 3Q1QA 2ZITA 1XNRI 5K36B 4KHPE 1IBME 5ELWA 3CWVA 1ZM3A 5GMDA 4I3HA 2WW4A 1EA6A 4M1KA 2DEIA 2WP8A 2ZM6I 3B4TA 4DV1E 1OYSA 3PS3A 2Z5BB 4DV4I 4K0KI 1XMQE 4GKJI 3Q6NA 2HHHE 4DR1E 1XXEA 1FNMA 1NHIA 1S4EA 4DUYI 4X66E 1FWKA 1UDOA 4B3MI 2JEBB 2O3ZA 5LMNI 3LNUA 1FJGE 4LF7I 2HKJA 4DR2I 4LFBE 4HACB 4LF7E 3M7NG 5C0XF 1HNZE 4PRXA 2CVEA 4JI5E 2BV3A 5K36A 1RR9A 1N0VC 2C37A 3QT6A 4DPXA 1ELOA 3F0NA 1Z0WA 1Z59A 4GKKI 1WUUA 2HHHI 4DR7E 5IWAI 4NBQA 4GKJE 4K0KE 4JI2E 2V34A 4IS9A 2BA1G 4LF4I 4DV6I 2PO0A 3J81Q 3QT7A 3PS1A 3GCMA 3PYGA 4EMDA 3JAMC 3ZKDA 4AQYI 4B3RI 4IZKA 4JI7I 2JE6B 2GO4A 5IT9C 1Y60A 4DPYA 2Z5CA 3B78A 4IZKB 2VQEE 2UU9I 4HACA 4UT4A 4DUZE 1R6LA 4FW5A 2PO1A 4IFDB 1N36E 4LF8I 2C37B 4X62I 4LFAI 2BA0D 5JEAE 4OKGA 3PYEA 1KKHA 1ZM4A 2V2VA 1HNWE 4DR1I 3B8HA 4R1FA 1B63A 1Z5AA 3ZM7A 2HFUA 1Z5CA 3M85G 1IBKE 2NN6D 1Z0VA 3M85D 4WUCA 2O1TA 2O1VA 4ED4A 4MU3A 5LMUE 4LFBI 2EFGA 2NN6E 5DRPA 4YHHI 1N32E 1FI4A 2R3VA 5K36E 4DV5I 1Z0EA 3M7ND 4P7AA 2BA0G 5K36C 4OO1C 4OX9I 2WP8B 1XMQI 4IFDC 1HK7A 4JI8E 3UHMA 5IT9Q 4AIDA 1IBKI 2E5LI 5BR8I 2VQFE 3P3GA 4P52A 1XNQE 1NHJA 1Z0CA 4DPUA 4FW6A 2AE8A 2HKEA 1XMOI 1N32I 4U3BA 3PYFA 5L3JA 5K36F 3CDIA 4DV2I 2NPFA 3T1HE 4U3DA 4JI1I 1E3HA 3OTOI 2Z5EA 5JEAA 4DV5E 4LCFA 2JEAA 2WNRA 3B82A 3U1YA 1IBLI 4PU9A 2UUAE 2JT2A 3GONA 2ZBKB 2E5LE 3NZKA 4UTGA 1PKPA 1Z0TA 4LF9I 5DROA 4JI6I 4YY3I 2BR2B 2BM1A 1Z0BA 2PO2B 3P3CA 3HKMA 2Z5CB 5C0XC 2XEXA 5DRQA 4FW4A 4DUZI 3J80Q 2PO2A 3J7AG 4DR4E 3LPSA 4AM3A 4QNKA 4QNJA 3D4JA 1H7UA 4LFAE 4DV0I 1NZ0A 3J7AM 3WU3A 5JEAB 4DR3E 2UUCI 2V8PA 4JYAE 4MDTA 4DV3I 4GQUA 2O1WA 5A2QQ 4DV6E 3ZZ0A 4X66I 5DNXA 1Z5BA 1XNQI 5JEAD 1YHCA 4AIMA 4BA2A 3K1JA 4MYUA 5BR8E 4AQYE 1USVA 4MU0A 3P76A 2NN6B 1A6FA 4NXME 2AJ4A 4JI5I 1HNZI 2UXCI 1OJ4A 4LF8E 4OX9E 2NN6F 3DD6A 5DRRA 3ZZTA 4HYMA 1ZXMA 4GKKE 2CG9A 3PYDA 4RPFA 1OYPA 3K85A 1H73A 3Q6MA 1H74A 2PNZA 3P3EA 5FWKA 4LF5E 2F4VI 2V2ZA 4XTJA 2GQ0A 4DR2E 2F1DA 1RHYA 2PO0B 4IFDD 1FJGI 4Z7YA 3HULA 2BR2A 4X64I 4BA2B 4NXMI 4IFDE 4DU8A 2V2QA 4B3SI 4X65E 4DV7E 2E1RA 3WU4A 1N34E 1HNXE 2J7KA 4DR5I 4B3SE 3M6AA 3GLLA 4DR6E 2R42A 4DPWA 4USMA 3L7ZA 1UEKA 1J5EE 2ZM6E 2PO1B 1Y4UA 4FWDA 4IFDA 1D6TA 5GMEA 1I94I 4FWHA 4X62E 3L7ZB 4IFDF 4FN5A 2A2CA 2OI2A 1I94E 4MU4A 5EL9A 1MG7A 4B3ME 1YH8A 4MU1A 4OO1A 4URLA 2HK3A 2O1UA 2JEBA 1H72C 5DNLA 1S16A 3WU5A 4DU7A 4OO1B 1ZM2A 2UUAI 4MQYA 4X65I 2VQFI 4DV7I 1FWLA 1MX0A 2X36A 4JI6E 4X64E 3LTOA 2PNLA 1ZM9A 1OYRA 1U2RA 3WU6A 2NN6C 4JI8I 2UXBI 4IZJD 1IBMI 4KHPI 3U1KA 4DR7I 1PIEA 3JAMQ 4LFCI 4DR4I 1MU5A 4LFCE 2UXDE 2HK2A 1R6MA 4B3RE 3V5RA 4YY3E 2JE6A 5LMNE 1VI7A 2A2DA 3QT5A 2C39A 1XMOE 4JI4E 4JV5I 4DUYE 1KIJA 5LL6R 4FW7A 2IOQA 3ZZUA 3H4LA 4ISAA 2HFSA 1HR0E 4DV1I 3PRYA 1E3PA 4JYAI 4FW9A 4ZVIA 1P42A 1XHKA 1EI1A 1H7SA 4FW3A 1Z0GA 2CZ9A 2GO3A 5EKWA 3J81C 1BKNA 3GMEA 4DV2E 3T1HI 2UXBE 4LF6I 4LF9E 4MYTA 4JI4I 4IZJA 2GS8A 4LF6E 1ZXNA 4JI0I 5A2QC 1N0UA 1UDNA 2Z5BA 4BA1A 1N36I 2IERA 1N33E 3ZKBA 4JI0E
chains in the Genus database with same CATH topology
5JEAF 3GLLA 3L7ZA 1UDOA 2PO1B 2JEBB 4IFDA 2WNRB 4OO1F 5K36F 3CDIA 3L7ZB 4IFDF 2C39B 3M7NG 5C0XF 1E3HA 5JEAA 5K36A 4OO1A 2C37A 2JEAA 2JEBA 2WNRA 1UDSA 4OO1B 4NBQA 2C38A 5JEAC 2BA1G 2PO0A 5C0XA 2C38B 4BA1B 2PNZB 1UDQA 1OYRA 3GCMA 2NN6C 2BR2B 2PO2B 4OO1D 3U1KA 3HKMA 5C0XC 2JE6B 2PO2A 5C0XE 4AM3A 1R6LA 2PO1A 4IFDB 5C0XD 5JEAB 1R6MA 2C37B 2JE6A 2NN6A 2BA0D 3KRNA 5JEAE 2C39A 3H1CA 5JEAD 4AIMA 5C0XB 4BA2A 2NN6B 3M85G 1E3PA 2NN6D 2JEAB 3M85D 2NN6F 3DD6A 5K36D 3CDJA 2NN6E 4OO1E 2BA1D 5K36E 1OYPA 2PNZA 3M7ND 2BA0G 5K36B 5K36C 4OO1C 3GMEA 2WP8B 4IFDC 2PO0B 4IFDD 4AIDA 2WP8A 3B4TA 2BR2A 4BA2B 1OYSA 4IFDE 1UDNA 4BA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA F;  3GLL A;  3L7Z A;  1UDO A;  2PO1 B;  2JEB B;  4IFD A;  2WNR B;  4OO1 F;  5K36 F;  3CDI A;  3L7Z B;  4IFD F;  2C39 B;  3M7N G;  5C0X F;  1E3H A;  5JEA A;  5K36 A;  4OO1 A;  2C37 A;  2JEA A;  2JEB A;  2WNR A;  1UDS A;  4OO1 B;  4NBQ A;  2C38 A;  5JEA C;  2BA1 G;  2PO0 A;  5C0X A;  2C38 B;  4BA1 B;  2PNZ B;  1UDQ A;  1OYR A;  3GCM A;  2NN6 C;  2BR2 B;  2PO2 B;  4OO1 D;  3U1K A;  3HKM A;  5C0X C;  2JE6 B;  2PO2 A;  5C0X E;  4AM3 A;  1R6L A;  2PO1 A;  4IFD B;  5C0X D;  5JEA B;  1R6M A;  2C37 B;  2JE6 A;  2NN6 A;  2BA0 D;  3KRN A;  5JEA E;  2C39 A;  3H1C A;  5JEA D;  4AIM A;  5C0X B;  4BA2 A;  2NN6 B;  3M85 G;  1E3P A;  2NN6 D;  2JEA B;  3M85 D;  2NN6 F;  3DD6 A;  5K36 D;  3CDJ A;  2NN6 E;  4OO1 E;  2BA1 D;  5K36 E;  1OYP A;  2PNZ A;  3M7N D;  2BA0 G;  5K36 B;  5K36 C;  4OO1 C;  3GME A;  2WP8 B;  4IFD C;  2PO0 B;  4IFD D;  4AID A;  2WP8 A;  3B4T A;  2BR2 A;  4BA2 B;  1OYS A;  4IFD E;  1UDN A;  4BA1 A; 
#chains in the Genus database with same CATH topology
 5JEA F;  3V2U C;  3P06 A;  2X7I A;  2WNR B;  4OO1 F;  1Y5Y A;  2VES A;  4JI7 E;  3J80 C;  2UUB I;  4B3T E;  4JI3 I;  2C39 B;  4NXN I;  3HJC A;  2UXD I;  2IOP A;  4FWG A;  2UXC E;  1HR0 I;  4YHH E;  1PVG A;  4LOM A;  1UDS A;  4IZJ B;  5LMU I;  2C38 A;  4OZE A;  1N34 I;  5JEA C;  1NHH A;  3T1Y I;  4DV4 E;  2Q2E B;  5C0X A;  2C38 B;  1RRE A;  4BA1 B;  2PNZ B;  1UDQ A;  4LCG A;  3QT8 A;  4JI2 I;  5FLX Q;  4OO1 D;  4DR3 I;  4JG4 A;  5IWA E;  2PNM A;  3K17 A;  4DV0 E;  5C0X E;  4JV5 E;  4DPT A;  4Z7C A;  4KQV A;  4LPF A;  5C0X D;  1HNX I;  1KVK A;  2J65 A;  1K47 A;  4J3D A;  2LJP A;  4WUB A;  2NN6 A;  2DEJ A;  3KRN A;  4HXZ A;  1J5E I;  4DXL A;  4PRV A;  4DR6 I;  1DAR A;  5FLX C;  3H1C A;  3T1Y E;  1N33 I;  1Y4S A;  4DR5 E;  1B62 A;  2VF3 A;  5C0X B;  1QZR A;  1XNR E;  1IBL E;  1HNW I;  1KTV A;  1VIS A;  1FKA E;  4USK A;  4WUD A;  2CGE A;  4HY1 A;  4LF4 E;  3OTO E;  4JI1 E;  4DV3 E;  2JEA B;  4N3O A;  1USU A;  4NXN E;  2UUC E;  5K36 D;  2UUB E;  4B3T I;  3CDJ A;  2IES A;  4JI3 E;  4LF5 I;  2F4V E;  3PS2 A;  2VQE I;  2UU9 E;  4OO1 E;  2BA1 D;  1Y6Z A;  2BM0 A;  4LCH A;  3Q1Q A;  2ZIT A;  1XNR I;  5K36 B;  4KHP E;  1IBM E;  5ELW A;  3CWV A;  1ZM3 A;  5GMD A;  4I3H A;  2WW4 A;  1EA6 A;  4M1K A;  2DEI A;  2WP8 A;  2ZM6 I;  3B4T A;  4DV1 E;  1OYS A;  3PS3 A;  2Z5B B;  4DV4 I;  4K0K I;  1XMQ E;  4GKJ I;  3Q6N A;  2HHH E;  4DR1 E;  1XXE A;  1FNM A;  1NHI A;  1S4E A;  4DUY I;  4X66 E;  1FWK A;  1UDO A;  4B3M I;  2JEB B;  2O3Z A;  5LMN I;  3LNU A;  1FJG E;  4LF7 I;  2HKJ A;  4DR2 I;  4LFB E;  4HAC B;  4LF7 E;  3M7N G;  5C0X F;  1HNZ E;  4PRX A;  2CVE A;  4JI5 E;  2BV3 A;  5K36 A;  1RR9 A;  1N0V C;  2C37 A;  3QT6 A;  4DPX A;  1ELO A;  3F0N A;  1Z0W A;  1Z59 A;  4GKK I;  1WUU A;  2HHH I;  4DR7 E;  5IWA I;  4NBQ A;  4GKJ E;  4K0K E;  4JI2 E;  2V34 A;  4IS9 A;  2BA1 G;  4LF4 I;  4DV6 I;  2PO0 A;  3J81 Q;  3QT7 A;  3PS1 A;  3GCM A;  3PYG A;  4EMD A;  3JAM C;  3ZKD A;  4AQY I;  4B3R I;  4IZK A;  4JI7 I;  2JE6 B;  2GO4 A;  5IT9 C;  1Y60 A;  4DPY A;  2Z5C A;  3B78 A;  4IZK B;  2VQE E;  2UU9 I;  4HAC A;  4UT4 A;  4DUZ E;  1R6L A;  4FW5 A;  2PO1 A;  4IFD B;  1N36 E;  4LF8 I;  2C37 B;  4X62 I;  4LFA I;  2BA0 D;  5JEA E;  4OKG A;  3PYE A;  1KKH A;  1ZM4 A;  2V2V A;  1HNW E;  4DR1 I;  3B8H A;  4R1F A;  1B63 A;  1Z5A A;  3ZM7 A;  2HFU A;  1Z5C A;  3M85 G;  1IBK E;  2NN6 D;  1Z0V A;  3M85 D;  4WUC A;  2O1T A;  2O1V A;  4ED4 A;  4MU3 A;  5LMU E;  4LFB I;  2EFG A;  2NN6 E;  5DRP A;  4YHH I;  1N32 E;  1FI4 A;  2R3V A;  5K36 E;  4DV5 I;  1Z0E A;  3M7N D;  4P7A A;  2BA0 G;  5K36 C;  4OO1 C;  4OX9 I;  2WP8 B;  1XMQ I;  4IFD C;  1HK7 A;  4JI8 E;  3UHM A;  5IT9 Q;  4AID A;  1IBK I;  2E5L I;  5BR8 I;  2VQF E;  3P3G A;  4P52 A;  1XNQ E;  1NHJ A;  1Z0C A;  4DPU A;  4FW6 A;  2AE8 A;  2HKE A;  1XMO I;  1N32 I;  4U3B A;  3PYF A;  5L3J A;  5K36 F;  3CDI A;  4DV2 I;  2NPF A;  3T1H E;  4U3D A;  4JI1 I;  1E3H A;  3OTO I;  2Z5E A;  5JEA A;  4DV5 E;  4LCF A;  2JEA A;  2WNR A;  3B82 A;  3U1Y A;  1IBL I;  4PU9 A;  2UUA E;  2JT2 A;  3GON A;  2ZBK B;  2E5L E;  3NZK A;  4UTG A;  1PKP A;  1Z0T A;  4LF9 I;  5DRO A;  4JI6 I;  4YY3 I;  2BR2 B;  2BM1 A;  1Z0B A;  2PO2 B;  3P3C A;  3HKM A;  2Z5C B;  5C0X C;  2XEX A;  5DRQ A;  4FW4 A;  4DUZ I;  3J80 Q;  2PO2 A;  3J7A G;  4DR4 E;  3LPS A;  4AM3 A;  4QNK A;  4QNJ A;  3D4J A;  1H7U A;  4LFA E;  4DV0 I;  1NZ0 A;  3J7A M;  3WU3 A;  5JEA B;  4DR3 E;  2UUC I;  2V8P A;  4JYA E;  4MDT A;  4DV3 I;  4GQU A;  2O1W A;  5A2Q Q;  4DV6 E;  3ZZ0 A;  4X66 I;  5DNX A;  1Z5B A;  1XNQ I;  5JEA D;  1YHC A;  4AIM A;  4BA2 A;  3K1J A;  4MYU A;  5BR8 E;  4AQY E;  1USV A;  4MU0 A;  3P76 A;  2NN6 B;  1A6F A;  4NXM E;  2AJ4 A;  4JI5 I;  1HNZ I;  2UXC I;  1OJ4 A;  4LF8 E;  4OX9 E;  2NN6 F;  3DD6 A;  5DRR A;  3ZZT A;  4HYM A;  1ZXM A;  4GKK E;  2CG9 A;  3PYD A;  4RPF A;  1OYP A;  3K85 A;  1H73 A;  3Q6M A;  1H74 A;  2PNZ A;  3P3E A;  5FWK A;  4LF5 E;  2F4V I;  2V2Z A;  4XTJ A;  2GQ0 A;  4DR2 E;  2F1D A;  1RHY A;  2PO0 B;  4IFD D;  1FJG I;  4Z7Y A;  3HUL A;  2BR2 A;  4X64 I;  4BA2 B;  4NXM I;  4IFD E;  4DU8 A;  2V2Q A;  4B3S I;  4X65 E;  4DV7 E;  2E1R A;  3WU4 A;  1N34 E;  1HNX E;  2J7K A;  4DR5 I;  4B3S E;  3M6A A;  3GLL A;  4DR6 E;  2R42 A;  4DPW A;  4USM A;  3L7Z A;  1UEK A;  1J5E E;  2ZM6 E;  2PO1 B;  1Y4U A;  4FWD A;  4IFD A;  1D6T A;  5GME A;  1I94 I;  4FWH A;  4X62 E;  3L7Z B;  4IFD F;  4FN5 A;  2A2C A;  2OI2 A;  1I94 E;  4MU4 A;  5EL9 A;  1MG7 A;  4B3M E;  1YH8 A;  4MU1 A;  4OO1 A;  4URL A;  2HK3 A;  2O1U A;  2JEB A;  1H72 C;  5DNL A;  1S16 A;  3WU5 A;  4DU7 A;  4OO1 B;  1ZM2 A;  2UUA I;  4MQY A;  4X65 I;  2VQF I;  4DV7 I;  1FWL A;  1MX0 A;  2X36 A;  4JI6 E;  4X64 E;  3LTO A;  2PNL A;  1ZM9 A;  1OYR A;  1U2R A;  3WU6 A;  2NN6 C;  4JI8 I;  2UXB I;  4IZJ D;  1IBM I;  4KHP I;  3U1K A;  4DR7 I;  1PIE A;  3JAM Q;  4LFC I;  4DR4 I;  1MU5 A;  4LFC E;  2UXD E;  2HK2 A;  1R6M A;  4B3R E;  3V5R A;  4YY3 E;  2JE6 A;  5LMN E;  1VI7 A;  2A2D A;  3QT5 A;  2C39 A;  1XMO E;  4JI4 E;  4JV5 I;  4DUY E;  1KIJ A;  5LL6 R;  4FW7 A;  2IOQ A;  3ZZU A;  3H4L A;  4ISA A;  2HFS A;  1HR0 E;  4DV1 I;  3PRY A;  1E3P A;  4JYA I;  4FW9 A;  4ZVI A;  1P42 A;  1XHK A;  1EI1 A;  1H7S A;  4FW3 A;  1Z0G A;  2CZ9 A;  2GO3 A;  5EKW A;  3J81 C;  1BKN A;  3GME A;  4DV2 E;  3T1H I;  2UXB E;  4LF6 I;  4LF9 E;  4MYT A;  4JI4 I;  4IZJ A;  2GS8 A;  4LF6 E;  1ZXN A;  4JI0 I;  5A2Q C;  1N0U A;  1UDN A;  2Z5B A;  4BA1 A;  1N36 I;  2IER A;  1N33 E;  3ZKB A;  4JI0 E; 
#chains in the Genus database with same CATH homology
 5JEA F;  3GLL A;  3L7Z A;  1UDO A;  2PO1 B;  2JEB B;  4IFD A;  2WNR B;  4OO1 F;  5K36 F;  3CDI A;  3L7Z B;  4IFD F;  2C39 B;  3M7N G;  5C0X F;  1E3H A;  5JEA A;  5K36 A;  4OO1 A;  2C37 A;  2JEA A;  2JEB A;  2WNR A;  1UDS A;  4OO1 B;  4NBQ A;  2C38 A;  5JEA C;  2BA1 G;  2PO0 A;  5C0X A;  2C38 B;  4BA1 B;  2PNZ B;  1UDQ A;  1OYR A;  3GCM A;  2NN6 C;  2BR2 B;  2PO2 B;  4OO1 D;  3U1K A;  3HKM A;  5C0X C;  2JE6 B;  2PO2 A;  5C0X E;  4AM3 A;  1R6L A;  2PO1 A;  4IFD B;  5C0X D;  5JEA B;  1R6M A;  2C37 B;  2JE6 A;  2NN6 A;  2BA0 D;  3KRN A;  5JEA E;  2C39 A;  3H1C A;  5JEA D;  4AIM A;  5C0X B;  4BA2 A;  2NN6 B;  3M85 G;  1E3P A;  2NN6 D;  2JEA B;  3M85 D;  2NN6 F;  3DD6 A;  5K36 D;  3CDJ A;  2NN6 E;  4OO1 E;  2BA1 D;  5K36 E;  1OYP A;  2PNZ A;  3M7N D;  2BA0 G;  5K36 B;  5K36 C;  4OO1 C;  3GME A;  2WP8 B;  4IFD C;  2PO0 B;  4IFD D;  4AID A;  2WP8 A;  3B4T A;  2BR2 A;  4BA2 B;  1OYS A;  4IFD E;  1UDN A;  4BA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...