2PO0A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with adp in double conformation
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase
molecule keywords Probable exosome complex exonuclease 1
total genus 75
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po0A01
2PNZA 3H1CA 1UDQA 3U1KA 2PNZB 4BA1A 2PO2B 3L7ZA 3M85D 2C38B 4BA1B 3GMEA 2C37A 2C39B 2WNRB 3DD6A 3GLLA 2C38A 2BA1G 2BA0D 4IFDC 1OYPA 4OO1C 3L7ZB 5JEAA 1R6MA 3KRNA 2JE6B 4BA2B 5C0XA 2NN6B 5C0XD 3M7NG 5JEAF 2JEAA 4NBQA 1OYRA 5JEAD 4BA2A 5C0XF 4AIDA 3CDIA 4OO1F 2BA0G 2BA1D 5K36D 4IFDB 3M85G 2PO0A 1OYSA 1UDOA 2NN6D 2WP8A 2PO1A 4OO1D 5JEAC 5K36F 1E3PA 2NN6E 4OO1A 5K36E 4IFDA 2NN6F 5C0XC 5K36B 2BR2A 2PO1B 5K36A 4AIMA 2NN6A 3GCMA 2JEAB 3M7ND 4IFDD 3HKMA 2C37B 2BR2B 3CDJA 2WNRA 3B4TA 5JEAB 5JEAE 2WP8B 2JEBA 2PO0B 2NN6C 5C0XB 5K36C 1UDSA 2C39A 1R6LA 5C0XE 1UDNA 1E3HA 4IFDF 4AM3A 4IFDE 4OO1E 2JEBB 4OO1B 2JE6A 2PO2A
chains in the Genus database with same CATH superfamily
4JI6I 2PNZA 4IZJD 4DV3I 1NHJA 2Z5BB 1HNWI 2HK3A 2PNZB 4GKJI 1MG7A 5DNLA 1H74A 3J81Q 1S4EA 2UU9E 4FW3A 2Z5BA 3P06A 3P3EA 2UXCI 4BA1B 4KHPE 3T1HI 4X65I 2X7IA 2C37A 4HY1A 3V2UC 4IZJA 4YY3E 1J5EE 2C39B 5LMUE 1N36I 4LCHA 2UXBE 2V2VA 4ISAA 3DD6A 1NHHA 4IZJB 1Z59A 2O1TA 5A2QQ 2UUBI 3T1YE 4AQYE 4USKA 1R6MA 1DARA 1NHIA 3KRNA 1PIEA 4DR2E 4BA2B 4DV1I 1N33I 2NN6B 4Z7CA 4HACB 2UXBI 1XMQE 3LPSA 4JI6E 2HKEA 3M7NG 4LFBI 4DUZI 4NBQA 4JI0E 3J7AM 4GQUA 1OYRA 4JI8I 4LF6I 1ZXNA 4DR3E 2IESA 5FLXC 1H7UA 4K0KE 3ZM7A 1FNMA 2BA1D 4FW6A 4LF9E 4IFDB 4OO1D 2WP8A 1OYSA 2PO1A 1J5EI 2F4VE 2NN6E 2O3ZA 4DR3I 3J7AG 2NN6F 5C0XC 4J3DA 5GMDA 2UU9I 4DR1E 2UXDI 4XTJA 1P42A 1RR9A 4DV4I 1ZM4A 5DRRA 4DR2I 4DPUA 4B3MI 4P7AA 4DXLA 4LF8E 2JEAB 4X66E 1I94E 4LF4E 2LJPA 4DR5E 4B3SI 5IT9Q 1QZRA 1YH8A 2J7KA 5EL9A 2E1RA 4DV4E 4DR4E 2WNRA 2CGEA 4LF7E 4Z7YA 3Q1QA 4K0KI 5JEAB 1Z0CA 2V34A 4U3DA 3P76A 2PO0B 4PU9A 3JAMC 2NN6C 3K85A 4JI0I 2C39A 3P3GA 5C0XE 1E3HA 4GKJE 2GO3A 5DRQA 4OO1B 1WUUA 1Z5CA 2Z5CA 2PO2A 1PKPA 2O1UA 4GKKE 4DV2E 4AQYI 3QT6A 3JAMQ 3T1YI 4MYUA 4X64I 2CVEA 2BM1A 2IOQA 1ZM2A 1XMOI 2C38B 4X65E 4DUYE 4M1KA 3GMEA 4B3SE 1HR0I 5IWAE 3M6AA 4IZKB 4B3RI 4DV7I 4JI4I 2C38A 2BA1G 4LF9I 4LFBE 1OYPA 2AE8A 4LFAE 3V5RA 3WU3A 2VESA 4ED4A 1FWKA 4JI2E 4UT4A 2VQFE 3ZKDA 4QNJA 4FWHA 4JI5E 1USUA 1N32E 2R3VA 4QNKA 4DV2I 5ELWA 5JEAF 2VF3A 2JEAA 1KKHA 2X36A 2EFGA 4FW7A 1K47A 5FLXQ 4DV7E 4AIDA 4DR7I 3CDIA 1FJGI 5DRPA 1IBME 3ZZTA 4LF8I 1Z0BA 4JI7E 2HKJA 2A2DA 3B82A 3F0NA 3M85G 1FWLA 2IERA 4MDTA 4LF7I 2O1WA 1Z5BA 4B3TE 5DROA 1U2RA 5K36B 4DR6E 1FKAE 4JYAI 2CZ9A 3WU5A 4JI1I 5A2QC 1UEKA 2Z5CB 5K36A 4AIMA 5IWAI 3GONA 3NZKA 3P3CA 4FW4A 1S16A 1VI7A 1KIJA 3M7ND 2NPFA 4JG4A 4P52A 4DR5I 4OZEA 1Y6ZA 2BR2B 3D4JA 4U3BA 2GS8A 4X64E 4LCFA 2UUCI 1EA6A 2ZM6E 2GQ0A 4JYAE 4LOMA 1XMOE 5C0XB 5EKWA 5LL6R 4IS9A 1UDNA 1B62A 4FW9A 4OO1E 2F1DA 2JEBB 5L3JA 2JE6A 5GMEA 3ZZUA 4GKKI 4DR1I 4FN5A 1FI4A 4DV6I 1UDQA 3LTOA 4DV3E 1N34I 1XNRI 4B3TI 4BA1A 3L7ZA 4OKGA 2HK2A 3M85D 4DV5E 2E5LI 2ZITA 2UUAE 3GLLA 4MU3A 2BA0D 4JI7I 1USVA 3PYGA 4OO1C 4WUCA 5JEAA 3PS2A 3ZZ0A 4X62I 1HR0E 2J65A 4HXZA 4N3OA 5IT9C 4RPFA 1N0VC 4WUBA 5C0XD 4YHHI 2WW4A 4DU7A 4BA2A 1ZM3A 4JI8E 1RHYA 5C0XF 4LF6E 2UUAI 1IBMI 2ZBKB 1IBLI 5DNXA 3B78A 2Z5EA 3U1YA 4DUYI 1H72C 3J80Q 4NXNE 3K1JA 1UDOA 5LMUI 5K36F 1E3PA 4JV5I 4OO1A 5K36E 4IFDA 4DR6I 1A6FA 4DV5I 2BR2A 4LFAI 2PO1B 1H73A 3PRYA 5BR8E 4DPWA 2VQEE 1D6TA 2V2QA 3B8HA 2V8PA 3HJCA 1H7SA 2OI2A 2ZM6I 5LMNE 1HNXE 2AJ4A 4JV5E 1KVKA 1VISA 2DEJA 4LPFA 4X66I 3HKMA 2JT2A 4PRXA 1Y4UA 2PNLA 2VQEI 1HNZI 3B4TA 2UUCE 4YY3I 4DR4I 1Z0TA 1IBKI 3PS3A 3PS1A 1XHKA 5K36C 3WU6A 4MQYA 1KTVA 4MU0A 1Y4SA 4IFDF 2O1VA 4FW5A 2BV3A 1HNWE 4I3HA 4IFDE 4HYMA 4JI4E 4EMDA 4OX9I 1IBLE 2R42A 4LF4I 4JI1E 2HHHE 3PYDA 4DPTA 1N32I 4MU1A 3HULA 3CWVA 5FWKA 4DV0I 1XNQE 3J81C 3H1CA 3U1KA 3PYFA 2VQFI 1Z0WA 4USMA 2PO2B 2XEXA 1ZM9A 2Q2EB 4ZVIA 1MU5A 2PNMA 1XXEA 2DEIA 4DV0E 1XNQI 3UHMA 2F4VI 1HNXI 4B3RE 2WNRB 4OX9E 1Y5YA 4WUDA 5LMNI 4JI3E 4YHHE 4IFDC 4MU4A 3H4LA 3L7ZB 1Z0GA 4IZKA 1HNZE 2E5LE 2IOPA 2A2CA 4URLA 1MX0A 2JE6B 1RREA 3LNUA 5C0XA 4NXMI 3Q6NA 2HHHI 4NXNI 1XMQI 1Z0EA 4LCGA 4FWGA 4DV6E 5JEAD 1N34E 2CG9A 2HFSA 3ZKBA 2HFUA 4OO1F 2BA0G 4LFCI 2UUBE 4PRVA 1N0UA 5K36D 3PYEA 4DU8A 2PO0A 2NN6D 4DUZE 5JEAC 3QT7A 3OTOI 4JI3I 2V2ZA 3Q6MA 1Z0VA 4JI5I 2GO4A 1Z5AA 1Y60A 4KQVA 4LF5E 2NN6A 4JI2I 4DPXA 1BKNA 1ZXMA 3GCMA 1XNRE 3QT5A 1N36E 1FJGE 4DR7E 4IFDD 1NZ0A 3J80C 2C37B 4KHPI 1OJ4A 4DPYA 3T1HE 3CDJA 1ELOA 1PVGA 4LF5I 2BM0A 3K17A 1YHCA 4NXME 3OTOE 4DV1E 5JEAE 2WP8B 2JEBA 1N33E 4MYTA 4R1FA 1B63A 2UXDE 1UDSA 1R6LA 4X62E 4AM3A 1HK7A 4B3ME 1EI1A 4HACA 4UTGA 3QT8A 2UXCE 4LFCE 1IBKE 1I94I 4FWDA 3WU4A 5BR8I
chains in the Genus database with same CATH topology
2PNZA 3H1CA 1UDQA 3U1KA 2PNZB 4BA1A 2PO2B 3L7ZA 3M85D 2C38B 4BA1B 3GMEA 2C37A 2C39B 2WNRB 3DD6A 3GLLA 2C38A 2BA1G 2BA0D 4IFDC 1OYPA 4OO1C 3L7ZB 5JEAA 1R6MA 3KRNA 2JE6B 4BA2B 5C0XA 2NN6B 5C0XD 3M7NG 5JEAF 2JEAA 4NBQA 1OYRA 5JEAD 4BA2A 5C0XF 4AIDA 3CDIA 4OO1F 2BA0G 2BA1D 5K36D 4IFDB 3M85G 2PO0A 1OYSA 1UDOA 2NN6D 2WP8A 2PO1A 4OO1D 5JEAC 5K36F 1E3PA 2NN6E 4OO1A 5K36E 4IFDA 2NN6F 5C0XC 5K36B 2BR2A 2PO1B 5K36A 4AIMA 2NN6A 3GCMA 2JEAB 3M7ND 4IFDD 3HKMA 2C37B 2BR2B 3CDJA 2WNRA 3B4TA 5JEAB 5JEAE 2WP8B 2JEBA 2PO0B 2NN6C 5C0XB 5K36C 1UDSA 2C39A 1R6LA 5C0XE 1UDNA 1E3HA 4IFDF 4AM3A 4IFDE 4OO1E 2JEBB 4OO1B 2JE6A 2PO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNZ A;  3H1C A;  1UDQ A;  3U1K A;  2PNZ B;  4BA1 A;  2PO2 B;  3L7Z A;  3M85 D;  2C38 B;  4BA1 B;  3GME A;  2C37 A;  2C39 B;  2WNR B;  3DD6 A;  3GLL A;  2C38 A;  2BA1 G;  2BA0 D;  4IFD C;  1OYP A;  4OO1 C;  3L7Z B;  5JEA A;  1R6M A;  3KRN A;  2JE6 B;  4BA2 B;  5C0X A;  2NN6 B;  5C0X D;  3M7N G;  5JEA F;  2JEA A;  4NBQ A;  1OYR A;  5JEA D;  4BA2 A;  5C0X F;  4AID A;  3CDI A;  4OO1 F;  2BA0 G;  2BA1 D;  5K36 D;  4IFD B;  3M85 G;  2PO0 A;  1OYS A;  1UDO A;  2NN6 D;  2WP8 A;  2PO1 A;  4OO1 D;  5JEA C;  5K36 F;  1E3P A;  2NN6 E;  4OO1 A;  5K36 E;  4IFD A;  2NN6 F;  5C0X C;  5K36 B;  2BR2 A;  2PO1 B;  5K36 A;  4AIM A;  2NN6 A;  3GCM A;  2JEA B;  3M7N D;  4IFD D;  3HKM A;  2C37 B;  2BR2 B;  3CDJ A;  2WNR A;  3B4T A;  5JEA B;  5JEA E;  2WP8 B;  2JEB A;  2PO0 B;  2NN6 C;  5C0X B;  5K36 C;  1UDS A;  2C39 A;  1R6L A;  5C0X E;  1UDN A;  1E3H A;  4IFD F;  4AM3 A;  4IFD E;  4OO1 E;  2JEB B;  4OO1 B;  2JE6 A;  2PO2 A; 
#chains in the Genus database with same CATH topology
 4JI6 I;  2PNZ A;  4IZJ D;  4DV3 I;  1NHJ A;  2Z5B B;  1HNW I;  2HK3 A;  2PNZ B;  4GKJ I;  1MG7 A;  5DNL A;  1H74 A;  3J81 Q;  1S4E A;  2UU9 E;  4FW3 A;  2Z5B A;  3P06 A;  3P3E A;  2UXC I;  4BA1 B;  4KHP E;  3T1H I;  4X65 I;  2X7I A;  2C37 A;  4HY1 A;  3V2U C;  4IZJ A;  4YY3 E;  1J5E E;  2C39 B;  5LMU E;  1N36 I;  4LCH A;  2UXB E;  2V2V A;  4ISA A;  3DD6 A;  1NHH A;  4IZJ B;  1Z59 A;  2O1T A;  5A2Q Q;  2UUB I;  3T1Y E;  4AQY E;  4USK A;  1R6M A;  1DAR A;  1NHI A;  3KRN A;  1PIE A;  4DR2 E;  4BA2 B;  4DV1 I;  1N33 I;  2NN6 B;  4Z7C A;  4HAC B;  2UXB I;  1XMQ E;  3LPS A;  4JI6 E;  2HKE A;  3M7N G;  4LFB I;  4DUZ I;  4NBQ A;  4JI0 E;  3J7A M;  4GQU A;  1OYR A;  4JI8 I;  4LF6 I;  1ZXN A;  4DR3 E;  2IES A;  5FLX C;  1H7U A;  4K0K E;  3ZM7 A;  1FNM A;  2BA1 D;  4FW6 A;  4LF9 E;  4IFD B;  4OO1 D;  2WP8 A;  1OYS A;  2PO1 A;  1J5E I;  2F4V E;  2NN6 E;  2O3Z A;  4DR3 I;  3J7A G;  2NN6 F;  5C0X C;  4J3D A;  5GMD A;  2UU9 I;  4DR1 E;  2UXD I;  4XTJ A;  1P42 A;  1RR9 A;  4DV4 I;  1ZM4 A;  5DRR A;  4DR2 I;  4DPU A;  4B3M I;  4P7A A;  4DXL A;  4LF8 E;  2JEA B;  4X66 E;  1I94 E;  4LF4 E;  2LJP A;  4DR5 E;  4B3S I;  5IT9 Q;  1QZR A;  1YH8 A;  2J7K A;  5EL9 A;  2E1R A;  4DV4 E;  4DR4 E;  2WNR A;  2CGE A;  4LF7 E;  4Z7Y A;  3Q1Q A;  4K0K I;  5JEA B;  1Z0C A;  2V34 A;  4U3D A;  3P76 A;  2PO0 B;  4PU9 A;  3JAM C;  2NN6 C;  3K85 A;  4JI0 I;  2C39 A;  3P3G A;  5C0X E;  1E3H A;  4GKJ E;  2GO3 A;  5DRQ A;  4OO1 B;  1WUU A;  1Z5C A;  2Z5C A;  2PO2 A;  1PKP A;  2O1U A;  4GKK E;  4DV2 E;  4AQY I;  3QT6 A;  3JAM Q;  3T1Y I;  4MYU A;  4X64 I;  2CVE A;  2BM1 A;  2IOQ A;  1ZM2 A;  1XMO I;  2C38 B;  4X65 E;  4DUY E;  4M1K A;  3GME A;  4B3S E;  1HR0 I;  5IWA E;  3M6A A;  4IZK B;  4B3R I;  4DV7 I;  4JI4 I;  2C38 A;  2BA1 G;  4LF9 I;  4LFB E;  1OYP A;  2AE8 A;  4LFA E;  3V5R A;  3WU3 A;  2VES A;  4ED4 A;  1FWK A;  4JI2 E;  4UT4 A;  2VQF E;  3ZKD A;  4QNJ A;  4FWH A;  4JI5 E;  1USU A;  1N32 E;  2R3V A;  4QNK A;  4DV2 I;  5ELW A;  5JEA F;  2VF3 A;  2JEA A;  1KKH A;  2X36 A;  2EFG A;  4FW7 A;  1K47 A;  5FLX Q;  4DV7 E;  4AID A;  4DR7 I;  3CDI A;  1FJG I;  5DRP A;  1IBM E;  3ZZT A;  4LF8 I;  1Z0B A;  4JI7 E;  2HKJ A;  2A2D A;  3B82 A;  3F0N A;  3M85 G;  1FWL A;  2IER A;  4MDT A;  4LF7 I;  2O1W A;  1Z5B A;  4B3T E;  5DRO A;  1U2R A;  5K36 B;  4DR6 E;  1FKA E;  4JYA I;  2CZ9 A;  3WU5 A;  4JI1 I;  5A2Q C;  1UEK A;  2Z5C B;  5K36 A;  4AIM A;  5IWA I;  3GON A;  3NZK A;  3P3C A;  4FW4 A;  1S16 A;  1VI7 A;  1KIJ A;  3M7N D;  2NPF A;  4JG4 A;  4P52 A;  4DR5 I;  4OZE A;  1Y6Z A;  2BR2 B;  3D4J A;  4U3B A;  2GS8 A;  4X64 E;  4LCF A;  2UUC I;  1EA6 A;  2ZM6 E;  2GQ0 A;  4JYA E;  4LOM A;  1XMO E;  5C0X B;  5EKW A;  5LL6 R;  4IS9 A;  1UDN A;  1B62 A;  4FW9 A;  4OO1 E;  2F1D A;  2JEB B;  5L3J A;  2JE6 A;  5GME A;  3ZZU A;  4GKK I;  4DR1 I;  4FN5 A;  1FI4 A;  4DV6 I;  1UDQ A;  3LTO A;  4DV3 E;  1N34 I;  1XNR I;  4B3T I;  4BA1 A;  3L7Z A;  4OKG A;  2HK2 A;  3M85 D;  4DV5 E;  2E5L I;  2ZIT A;  2UUA E;  3GLL A;  4MU3 A;  2BA0 D;  4JI7 I;  1USV A;  3PYG A;  4OO1 C;  4WUC A;  5JEA A;  3PS2 A;  3ZZ0 A;  4X62 I;  1HR0 E;  2J65 A;  4HXZ A;  4N3O A;  5IT9 C;  4RPF A;  1N0V C;  4WUB A;  5C0X D;  4YHH I;  2WW4 A;  4DU7 A;  4BA2 A;  1ZM3 A;  4JI8 E;  1RHY A;  5C0X F;  4LF6 E;  2UUA I;  1IBM I;  2ZBK B;  1IBL I;  5DNX A;  3B78 A;  2Z5E A;  3U1Y A;  4DUY I;  1H72 C;  3J80 Q;  4NXN E;  3K1J A;  1UDO A;  5LMU I;  5K36 F;  1E3P A;  4JV5 I;  4OO1 A;  5K36 E;  4IFD A;  4DR6 I;  1A6F A;  4DV5 I;  2BR2 A;  4LFA I;  2PO1 B;  1H73 A;  3PRY A;  5BR8 E;  4DPW A;  2VQE E;  1D6T A;  2V2Q A;  3B8H A;  2V8P A;  3HJC A;  1H7S A;  2OI2 A;  2ZM6 I;  5LMN E;  1HNX E;  2AJ4 A;  4JV5 E;  1KVK A;  1VIS A;  2DEJ A;  4LPF A;  4X66 I;  3HKM A;  2JT2 A;  4PRX A;  1Y4U A;  2PNL A;  2VQE I;  1HNZ I;  3B4T A;  2UUC E;  4YY3 I;  4DR4 I;  1Z0T A;  1IBK I;  3PS3 A;  3PS1 A;  1XHK A;  5K36 C;  3WU6 A;  4MQY A;  1KTV A;  4MU0 A;  1Y4S A;  4IFD F;  2O1V A;  4FW5 A;  2BV3 A;  1HNW E;  4I3H A;  4IFD E;  4HYM A;  4JI4 E;  4EMD A;  4OX9 I;  1IBL E;  2R42 A;  4LF4 I;  4JI1 E;  2HHH E;  3PYD A;  4DPT A;  1N32 I;  4MU1 A;  3HUL A;  3CWV A;  5FWK A;  4DV0 I;  1XNQ E;  3J81 C;  3H1C A;  3U1K A;  3PYF A;  2VQF I;  1Z0W A;  4USM A;  2PO2 B;  2XEX A;  1ZM9 A;  2Q2E B;  4ZVI A;  1MU5 A;  2PNM A;  1XXE A;  2DEI A;  4DV0 E;  1XNQ I;  3UHM A;  2F4V I;  1HNX I;  4B3R E;  2WNR B;  4OX9 E;  1Y5Y A;  4WUD A;  5LMN I;  4JI3 E;  4YHH E;  4IFD C;  4MU4 A;  3H4L A;  3L7Z B;  1Z0G A;  4IZK A;  1HNZ E;  2E5L E;  2IOP A;  2A2C A;  4URL A;  1MX0 A;  2JE6 B;  1RRE A;  3LNU A;  5C0X A;  4NXM I;  3Q6N A;  2HHH I;  4NXN I;  1XMQ I;  1Z0E A;  4LCG A;  4FWG A;  4DV6 E;  5JEA D;  1N34 E;  2CG9 A;  2HFS A;  3ZKB A;  2HFU A;  4OO1 F;  2BA0 G;  4LFC I;  2UUB E;  4PRV A;  1N0U A;  5K36 D;  3PYE A;  4DU8 A;  2PO0 A;  2NN6 D;  4DUZ E;  5JEA C;  3QT7 A;  3OTO I;  4JI3 I;  2V2Z A;  3Q6M A;  1Z0V A;  4JI5 I;  2GO4 A;  1Z5A A;  1Y60 A;  4KQV A;  4LF5 E;  2NN6 A;  4JI2 I;  4DPX A;  1BKN A;  1ZXM A;  3GCM A;  1XNR E;  3QT5 A;  1N36 E;  1FJG E;  4DR7 E;  4IFD D;  1NZ0 A;  3J80 C;  2C37 B;  4KHP I;  1OJ4 A;  4DPY A;  3T1H E;  3CDJ A;  1ELO A;  1PVG A;  4LF5 I;  2BM0 A;  3K17 A;  1YHC A;  4NXM E;  3OTO E;  4DV1 E;  5JEA E;  2WP8 B;  2JEB A;  1N33 E;  4MYT A;  4R1F A;  1B63 A;  2UXD E;  1UDS A;  1R6L A;  4X62 E;  4AM3 A;  1HK7 A;  4B3M E;  1EI1 A;  4HAC A;  4UTG A;  3QT8 A;  2UXC E;  4LFC E;  1IBK E;  1I94 I;  4FWD A;  3WU4 A;  5BR8 I; 
#chains in the Genus database with same CATH homology
 2PNZ A;  3H1C A;  1UDQ A;  3U1K A;  2PNZ B;  4BA1 A;  2PO2 B;  3L7Z A;  3M85 D;  2C38 B;  4BA1 B;  3GME A;  2C37 A;  2C39 B;  2WNR B;  3DD6 A;  3GLL A;  2C38 A;  2BA1 G;  2BA0 D;  4IFD C;  1OYP A;  4OO1 C;  3L7Z B;  5JEA A;  1R6M A;  3KRN A;  2JE6 B;  4BA2 B;  5C0X A;  2NN6 B;  5C0X D;  3M7N G;  5JEA F;  2JEA A;  4NBQ A;  1OYR A;  5JEA D;  4BA2 A;  5C0X F;  4AID A;  3CDI A;  4OO1 F;  2BA0 G;  2BA1 D;  5K36 D;  4IFD B;  3M85 G;  2PO0 A;  1OYS A;  1UDO A;  2NN6 D;  2WP8 A;  2PO1 A;  4OO1 D;  5JEA C;  5K36 F;  1E3P A;  2NN6 E;  4OO1 A;  5K36 E;  4IFD A;  2NN6 F;  5C0X C;  5K36 B;  2BR2 A;  2PO1 B;  5K36 A;  4AIM A;  2NN6 A;  3GCM A;  2JEA B;  3M7N D;  4IFD D;  3HKM A;  2C37 B;  2BR2 B;  3CDJ A;  2WNR A;  3B4T A;  5JEA B;  5JEA E;  2WP8 B;  2JEB A;  2PO0 B;  2NN6 C;  5C0X B;  5K36 C;  1UDS A;  2C39 A;  1R6L A;  5C0X E;  1UDN A;  1E3H A;  4IFD F;  4AM3 A;  4IFD E;  4OO1 E;  2JEB B;  4OO1 B;  2JE6 A;  2PO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...