4DV6I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv6I00
4DUYI 1IBME 2WW4A 4LF8E 4FWDA 4R1FA 1NHJA 4OX9I 2UXDE 4DV2I 4DPTA 2UUAI 5LMUE 4B3TE 1BKNA 1HNXI 4AQYI 2V8PA 3ZKDA 4FW9A 1DARA 5IWAE 2X7IA 4JI7I 4UTGA 4LF9E 3B82A 4LF4E 4DR6E 2HK2A 3OTOE 2ZITA 4DV7I 3CWVA 4DR5E 2F4VE 4DV0E 2BM1A 2ZM6E 4NXNE 1XHKA 1J5EE 4DV4E 3ZKBA 2BV3A 2HFUA 4JI8E 4P52A 4FWGA 4JV5I 1NHHA 1ZXMA 5BR8E 1ZXNA 4DPYA 4LF6E 1HR0E 4ED4A 1XNQI 4DR1I 1N33I 1FNMA 1NHIA 4YY3I 4KQVA 1ZM4A 4DV2E 3PYDA 1FWLA 1PVGA 4DUZE 4B3SI 1ZM2A 2BM0A 1Z0BA 2A2DA 4M1KA 2Q2EB 4LFCE 4JI7E 4B3ME 3ZZUA 1ZM9A 4FWHA 1H74A 4PU9A 3Q1QA 2NPFA 4LFAI 1MG7A 1FWKA 1A6FA 1ELOA 3J7AM 4HACB 3T1HE 4K0KI 4NXMI 4DR3E 1S4EA 3QT8A 1XMQE 4LF5I 4DR2I 3PYGA 1NZ0A 1ZM3A 4DV1E 3T1YI 4KHPE 2UXBI 1XNRI 1N34I 3WU3A 4UT4A 4HACA 4JI2I 4JI4I 3K1JA 1Z5CA 5IT9C 3LPSA 3QT5A 5L3JA 2R3VA 3QT7A 4JI1E 4YHHI 4JI3I 1H7UA 3F0NA 5LMNE 4JYAI 2AJ4A 4DR7I 3J81C 1I94I 4DXLA 4DR4E 2E5LE 3PYEA 4DPXA 2CZ9A 4LFAE 2HKJA 1FJGI 4DV5I 2HHHI 1HNZI 2UU9I 4X65I 1HNWI 2EFGA 4K0KE 3WU6A 1S16A 1Z0CA 1XMOE 4NXME 4GKKI 4X64I 4X66E 3WU4A 2V2ZA 4WUCA 4DPWA 4MYUA 1KVKA 2GS8A 2UXCI 3M6AA 4JI0I 2VQEE 3T1YE 1XNRE 5IT9Q 4GKJI 1N34E 4DU8A 3LTOA 4JI2E 3LNUA 4DUYE 3PYFA 5FLXC 1Z0TA 1EI1A 4OX9E 4B3RI 3J81Q 2VQFI 4JI3E 2UUAE 3V2UC 1HNXE 4JI5I 1H7SA 4AQYE 1I94E 1OJ4A 2X36A 1KIJA 3K17A 1IBMI 1N0UA 2V2VA 3V5RA 1N36I 4DV7E 4DV3I 3HULA 2HHHE 1Z0GA 1MX0A 1HNZE 5LMUI 2E1RA 4DPUA 1HNWE 1KKHA 3D4JA 5IWAI 4GKKE 4LF9I 3JAMC 2LJPA 2V34A 4LF4I 4JV5E 4JI6I 3ZZ0A 5GMEA 1QZRA 2F4VI 1B62A 1PIEA 2OI2A 5FLXQ 1XNQE 1J5EI 4USMA 1Z59A 4X62I 4HYMA 4DR1E 1N33E 4LF7I 2VF3A 4YY3E 1Z0VA 4B3SE 4LF6I 1HR0I 4FN5A 1Z0EA 3H4LA 4HY1A 1D6TA 3ZM7A 3B8HA 4PRXA 1N36E 4RPFA 1K47A 2UUCI 1FI4A 4DV3E 1N32I 4DU7A 1RR9A 2UUBI 4DUZI 4LFBI 3JAMQ 4DV6I 1B63A 3J7AG 4LFCI 1KTVA 4Z7YA 4B3MI 1FKAE 1MU5A 4JI6E 4LF5E 1IBKI 4DR2E 4URLA 4PRVA 3WU5A 4XTJA 2UXBE 1WUUA 1Z5BA 4X62E 2DEJA 4LF7E 3T1HI 4HXZA 4JI4E 4DR3I 1XMQI 2ZBKB 4WUBA 1RREA 4YHHE 4JYAE 4DV1I 4KHPI 2DEIA 5GMDA 3QT6A 1IBLI 4DR7E 1Z0WA 2A2CA 2R42A 2HK3A 3J80C 4LF8I 5A2QC 5LL6R 2UUCE 1U2RA 4JI1I 1N32E 2UXDI 1FJGE 2UUBE 1UEKA 4DV5E 4LFBE 5LMNI 2UU9E 4DV6E 4B3TI 3ZZTA 4USKA 4X65E 4P7AA 4X64E 4DR4I 2E5LI 2V2QA 1IBKE 4DR6I 3OTOI 4I3HA 4EMDA 2XEXA 2HFSA 4DR5I 2UXCE 4JI0E 4Z7CA 4DV0I 2ZM6I 4GKJE 4NXNI 1EA6A 4DV4I 2HKEA 1H73A 1XMOI 4JG4A 4JI8I 4X66I 1Z5AA 4WUDA 3B78A 1VISA 1PKPA 4ZVIA 4B3RE 3GONA 2VQFE 5BR8I 1H72C 2VQEI 1N0VC 4JI5E 1IBLE 3J80Q 5A2QQ 2J7KA 4MYTA
chains in the Genus database with same CATH superfamily
5DRQA 4DUYI 1IBME 2IERA 2WW4A 4LF8E 4FWDA 4R1FA 1NHJA 4OX9I 2UXDE 4DV2I 4DPTA 1R6MA 2UUAI 4MQYA 5LMUE 4B3TE 1BKNA 1HNXI 2WNRA 1Y4UA 4AQYI 1USVA 2V8PA 3ZKDA 4FW9A 1DARA 5IWAE 2X7IA 4JI7I 4UTGA 4LF9E 3B82A 4LF4E 4DR6E 2HK2A 3OTOE 2ZITA 2BR2B 4DV7I 3CWVA 4DR5E 2F4VE 4DV0E 2BM1A 3GLLA 2ZM6E 4NXNE 1XHKA 3U1YA 1J5EE 4DV4E 3GCMA 1UDSA 4IZJB 3H1CA 3ZKBA 2BV3A 2HFUA 4JI8E 4P52A 4FWGA 4IZKB 4JV5I 3DD6A 5EL9A 1NHHA 4OKGA 1ZXMA 2BR2A 2JT2A 5BR8E 1ZXNA 2O1UA 4DPYA 5ELWA 5C0XB 4LF6E 1HR0E 4ED4A 1XNQI 4LPFA 2F1DA 4BA2A 4DR1I 1N33I 1FNMA 1NHIA 3KRNA 1Y6ZA 4LCGA 4KQVA 4YY3I 1ZM4A 4DV2E 3PYDA 1FWLA 1PVGA 4DUZE 4B3SI 1ZM2A 1P42A 2BM0A 4AM3A 1Z0BA 2A2DA 4M1KA 2Q2EB 2JEAB 4LFCE 4JI7E 4B3ME 3ZZUA 1ZM9A 4FWHA 2NN6D 5K36F 1H74A 4PU9A 3Q1QA 4IFDF 1YHCA 2NPFA 4LFAI 1MG7A 1FWKA 2O3ZA 5K36B 2CG9A 1A6FA 1ELOA 2JEAA 3J7AM 4HACB 3T1HE 5C0XE 4K0KI 3PRYA 2PO0B 4NXMI 1Y60A 4DR3E 1S4EA 3QT8A 1XMQE 4LF5I 4DR2I 3PYGA 3P06A 1NZ0A 1ZM3A 4DV1E 3T1YI 4KHPE 5K36A 2UXBI 1XNRI 2WNRB 3HJCA 3M85D 1UDOA 1N34I 3WU3A 4IFDA 4UT4A 5DRRA 4LCFA 4HACA 4JI2I 4JI4I 1XXEA 4OO1F 2PO0A 3K1JA 1Z5CA 3P76A 5IT9C 3LPSA 3QT5A 5L3JA 2R3VA 3QT7A 4MDTA 4JI1E 4YHHI 4JI3I 1H7UA 4ISAA 3F0NA 5C0XC 5LMNE 4JYAI 1UDQA 1Y5YA 3PS2A 4AIMA 2O1TA 2AJ4A 4DR7I 3J81C 2NN6F 1I94I 5DNXA 2C38B 4DXLA 4DR4E 2BA1G 2Z5EA 2E5LE 5JEAD 2PNMA 5K36D 3PYEA 4AIDA 2AE8A 4DPXA 2CZ9A 4LFAE 4IFDD 2NN6B 2C37B 2HKJA 1FJGI 3B4TA 4DV5I 2HHHI 2JE6A 1HNZI 4OO1A 2UU9I 4LOMA 5EKWA 4X65I 4BA2B 1HNWI 2EFGA 4K0KE 3WU6A 1S16A 1Z0CA 2C38A 1XMOE 4NXME 4X64I 4GKKI 3K85A 4X66E 3WU4A 2V2ZA 5DRPA 4WUCA 4DPWA 4MYUA 2BA0G 2NN6A 3CDIA 2C37A 4LCHA 1KVKA 2GS8A 2UXCI 3M6AA 4JI0I 2VQEE 3T1YE 4MU1A 1XNRE 5IT9Q 4GKJI 1N34E 4DU8A 3LTOA 2GQ0A 4JI2E 3LNUA 4FW3A 4DUYE 3PYFA 5FLXC 1OYPA 4OO1D 5FWKA 3P3EA 4FW4A 1Z0TA 1EI1A 4OX9E 1OYSA 1RHYA 4B3RI 3J81Q 2VQFI 4JI3E 2UUAE 3V2UC 1HNXE 4JI5I 4MU0A 1H7SA 4AQYE 1I94E 4MU4A 1OJ4A 2X36A 1KIJA 5JEAF 1Y4SA 4U3BA 3K17A 1IBMI 2WP8A 1N0UA 2V2VA 4BA1A 3UHMA 3V5RA 1N36I 1UDNA 4DV7E 2IOPA 4DV3I 5JEAB 3HULA 2HHHE 1Z0GA 1MX0A 1HNZE 5LMUI 2E1RA 2VESA 3NZKA 4DPUA 4IFDB 1HNWE 1KKHA 3D4JA 5IWAI 3U1KA 4GKKE 4LF9I 3JAMC 2LJPA 2V34A 4LF4I 4JV5E 4JI6I 2JEBA 3ZZ0A 2O1WA 2NN6C 5GMEA 1QZRA 2C39A 3L7ZA 5JEAA 3Q6NA 2F4VI 4J3DA 1B62A 1PIEA 2J65A 2OI2A 5FLXQ 1XNQE 1J5EI 4USMA 1Z59A 2O1VA 4X62I 4HYMA 4DR1E 1N33E 4LF7I 2PNZB 2VF3A 2Z5BA 4YY3E 4QNJA 1Z0VA 4U3DA 4FW6A 4B3SE 3M7NG 2JE6B 4OO1B 4QNKA 4LF6I 2PO1A 1HR0I 2BA1D 4FN5A 1Z0EA 5K36E 2PNZA 3H4LA 4HY1A 3M85G 1D6TA 3GMEA 3ZM7A 3B8HA 4IFDE 4PRXA 1N36E 4RPFA 4FW7A 1K47A 2UUCI 4GQUA 1FI4A 4DV3E 1N32I 4DU7A 1RR9A 2UUBI 4DUZI 4LFBI 3JAMQ 4DV6I 2IESA 1B63A 3J7AG 4LFCI 1KTVA 4Z7YA 2GO3A 4B3MI 2BA0D 1FKAE 1MU5A 1HK7A 4JI6E 4FW5A 4LF5E 1IBKI 4DR2E 4URLA 1R6LA 1VI7A 4PRVA 4NBQA 3WU5A 5JEAC 5K36C 4XTJA 2UXBE 2CGEA 1WUUA 4IFDC 1Z5BA 4X62E 2DEJA 4LF7E 3T1HI 4HXZA 5DNLA 4JI4E 4OO1E 5C0XF 2WP8B 4DR3I 4BA1B 1XMQI 2ZBKB 4WUBA 1RREA 1USUA 4YHHE 4JYAE 4DV1I 4KHPI 2DEIA 5GMDA 3QT6A 1IBLI 4OZEA 2NN6E 1YH8A 4DR7E 3P3CA 4IZJA 2PO2B 1Z0WA 2A2CA 2R42A 2HK3A 3J80C 2JEBB 4IZKA 4LF8I 5A2QC 5LL6R 2UUCE 1U2RA 4JI1I 1N32E 2UXDI 1FJGE 2C39B 3L7ZB 1UEKA 4DV5E 2UUBE 4N3OA 3PS1A 4LFBE 5LMNI 4OO1C 5C0XA 2UU9E 3PS3A 4DV6E 4B3TI 3ZZTA 4USKA 4X65E 2IOQA 3Q6MA 1E3HA 2PO2A 2Z5BB 4P7AA 3HKMA 4X64E 4DR4I 2E5LI 2PNLA 2V2QA 1IBKE 4DR6I 3OTOI 2Z5CB 4I3HA 4EMDA 2XEXA 2HFSA 4DR5I 2UXCE 4JI0E 4IZJD 4Z7CA 2CVEA 4DV0I 2PO1B 2ZM6I 4GKJE 4NXNI 1EA6A 4DV4I 2GO4A 2HKEA 1E3PA 1H73A 1XMOI 4IS9A 4JG4A 4JI8I 4X66I 3M7ND 5C0XD 1Z5AA 4WUDA 4MU3A 3B78A 3CDJA 1VISA 1PKPA 2Z5CA 4ZVIA 3GONA 2VQFE 5BR8I 4B3RE 1H72C 1OYRA 2VQEI 1N0VC 4JI5E 1IBLE 5DROA 3J80Q 3P3GA 5A2QQ 2J7KA 5JEAE 4MYTA
chains in the Genus database with same CATH topology
4DUYI 1IBME 2WW4A 4LF8E 4FWDA 4R1FA 1NHJA 4OX9I 2UXDE 4DV2I 4DPTA 2UUAI 5LMUE 4B3TE 1BKNA 1HNXI 1Y4UA 4AQYI 1USVA 2V8PA 3ZKDA 4FW9A 1DARA 5IWAE 2X7IA 4JI7I 4UTGA 4LF9E 3B82A 4LF4E 4DR6E 2HK2A 3OTOE 2ZITA 4DV7I 3CWVA 4DR5E 2F4VE 4DV0E 2BM1A 2ZM6E 4NXNE 1XHKA 1J5EE 4DV4E 4IZJB 3ZKBA 2BV3A 2HFUA 4JI8E 4P52A 4FWGA 4IZKB 4JV5I 1NHHA 1ZXMA 5BR8E 1ZXNA 2O1UA 4DPYA 4LF6E 1HR0E 4ED4A 1XNQI 4DR1I 1N33I 1FNMA 1NHIA 1Y6ZA 4YY3I 4KQVA 1ZM4A 4DV2E 3PYDA 1FWLA 1PVGA 4DUZE 4B3SI 1ZM2A 2BM0A 1Z0BA 2A2DA 4M1KA 2Q2EB 4LFCE 4JI7E 4B3ME 3ZZUA 1ZM9A 4FWHA 1H74A 4PU9A 3Q1QA 2NPFA 4LFAI 1MG7A 1FWKA 2CG9A 1A6FA 1ELOA 3J7AM 4HACB 3T1HE 4K0KI 3PRYA 4NXMI 4DR3E 1S4EA 3QT8A 1XMQE 4LF5I 4DR2I 3PYGA 3P06A 1NZ0A 1ZM3A 4DV1E 3T1YI 4KHPE 2UXBI 1XNRI 3HJCA 1N34I 3WU3A 4UT4A 4HACA 4JI2I 4JI4I 3K1JA 1Z5CA 5IT9C 3LPSA 3QT5A 5L3JA 2R3VA 3QT7A 4JI1E 4YHHI 4JI3I 1H7UA 3F0NA 5LMNE 4JYAI 2O1TA 2AJ4A 4DR7I 3J81C 1I94I 4DXLA 4DR4E 2Z5EA 2E5LE 2PNMA 3PYEA 4DPXA 2CZ9A 4LFAE 2HKJA 1FJGI 4DV5I 2HHHI 1HNZI 2UU9I 4X65I 1HNWI 2EFGA 4K0KE 3WU6A 1S16A 1Z0CA 1XMOE 4NXME 4GKKI 4X64I 3K85A 4X66E 3WU4A 2V2ZA 4WUCA 4DPWA 4MYUA 1KVKA 2GS8A 2UXCI 3M6AA 4JI0I 2VQEE 3T1YE 1XNRE 5IT9Q 4GKJI 1N34E 4DU8A 3LTOA 2GQ0A 4JI2E 3LNUA 4DUYE 3PYFA 5FLXC 5FWKA 1Z0TA 1EI1A 4OX9E 4B3RI 3J81Q 2VQFI 4JI3E 2UUAE 3V2UC 1HNXE 4JI5I 1H7SA 4AQYE 1I94E 1OJ4A 2X36A 1KIJA 1Y4SA 3K17A 1IBMI 1N0UA 2V2VA 3V5RA 1N36I 4DV7E 2IOPA 4DV3I 3HULA 2HHHE 1Z0GA 1MX0A 1HNZE 5LMUI 2E1RA 4DPUA 1HNWE 1KKHA 3D4JA 5IWAI 4GKKE 4LF9I 3JAMC 2LJPA 2V34A 4LF4I 4JV5E 4JI6I 3ZZ0A 2O1WA 5GMEA 1QZRA 3Q6NA 2F4VI 1B62A 1PIEA 2OI2A 5FLXQ 1XNQE 1J5EI 4USMA 1Z59A 2O1VA 4X62I 4HYMA 4DR1E 1N33E 4LF7I 2VF3A 2Z5BA 4YY3E 1Z0VA 4B3SE 4LF6I 1HR0I 4FN5A 1Z0EA 3H4LA 4HY1A 1D6TA 3ZM7A 3B8HA 4PRXA 1N36E 4RPFA 1K47A 2UUCI 1FI4A 4DV3E 1N32I 4DU7A 1RR9A 2UUBI 4DUZI 4LFBI 3JAMQ 4DV6I 1B63A 3J7AG 4LFCI 1KTVA 4Z7YA 4B3MI 1FKAE 1MU5A 1HK7A 4JI6E 4LF5E 1IBKI 4DR2E 4URLA 4PRVA 3WU5A 4XTJA 2UXBE 2CGEA 1WUUA 1Z5BA 4X62E 2DEJA 4LF7E 3T1HI 4HXZA 4JI4E 4DR3I 1XMQI 2ZBKB 4WUBA 1RREA 1USUA 4YHHE 4JYAE 4DV1I 4KHPI 2DEIA 5GMDA 3QT6A 1IBLI 4DR7E 4IZJA 1Z0WA 2A2CA 2R42A 2HK3A 3J80C 4IZKA 4LF8I 5A2QC 5LL6R 2UUCE 1U2RA 4JI1I 1N32E 2UXDI 1FJGE 2UUBE 1UEKA 4DV5E 4N3OA 4LFBE 5LMNI 2UU9E 4DV6E 4B3TI 3ZZTA 4USKA 4X65E 2IOQA 3Q6MA 2Z5BB 4P7AA 4X64E 4DR4I 2E5LI 2PNLA 2V2QA 1IBKE 4DR6I 3OTOI 2Z5CB 4I3HA 4EMDA 2XEXA 2HFSA 4DR5I 2UXCE 4JI0E 4IZJD 4Z7CA 4DV0I 2ZM6I 4GKJE 4NXNI 1EA6A 4DV4I 2HKEA 1H73A 1XMOI 4JG4A 4JI8I 4X66I 1Z5AA 4WUDA 3B78A 1VISA 1PKPA 2Z5CA 4ZVIA 3GONA 2VQFE 5BR8I 4B3RE 1H72C 2VQEI 1N0VC 4JI5E 1IBLE 3J80Q 5A2QQ 2J7KA 4MYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY I;  1IBM E;  2WW4 A;  4LF8 E;  4FWD A;  4R1F A;  1NHJ A;  4OX9 I;  2UXD E;  4DV2 I;  4DPT A;  2UUA I;  5LMU E;  4B3T E;  1BKN A;  1HNX I;  4AQY I;  2V8P A;  3ZKD A;  4FW9 A;  1DAR A;  5IWA E;  2X7I A;  4JI7 I;  4UTG A;  4LF9 E;  3B82 A;  4LF4 E;  4DR6 E;  2HK2 A;  3OTO E;  2ZIT A;  4DV7 I;  3CWV A;  4DR5 E;  2F4V E;  4DV0 E;  2BM1 A;  2ZM6 E;  4NXN E;  1XHK A;  1J5E E;  4DV4 E;  3ZKB A;  2BV3 A;  2HFU A;  4JI8 E;  4P52 A;  4FWG A;  4JV5 I;  1NHH A;  1ZXM A;  5BR8 E;  1ZXN A;  4DPY A;  4LF6 E;  1HR0 E;  4ED4 A;  1XNQ I;  4DR1 I;  1N33 I;  1FNM A;  1NHI A;  4YY3 I;  4KQV A;  1ZM4 A;  4DV2 E;  3PYD A;  1FWL A;  1PVG A;  4DUZ E;  4B3S I;  1ZM2 A;  2BM0 A;  1Z0B A;  2A2D A;  4M1K A;  2Q2E B;  4LFC E;  4JI7 E;  4B3M E;  3ZZU A;  1ZM9 A;  4FWH A;  1H74 A;  4PU9 A;  3Q1Q A;  2NPF A;  4LFA I;  1MG7 A;  1FWK A;  1A6F A;  1ELO A;  3J7A M;  4HAC B;  3T1H E;  4K0K I;  4NXM I;  4DR3 E;  1S4E A;  3QT8 A;  1XMQ E;  4LF5 I;  4DR2 I;  3PYG A;  1NZ0 A;  1ZM3 A;  4DV1 E;  3T1Y I;  4KHP E;  2UXB I;  1XNR I;  1N34 I;  3WU3 A;  4UT4 A;  4HAC A;  4JI2 I;  4JI4 I;  3K1J A;  1Z5C A;  5IT9 C;  3LPS A;  3QT5 A;  5L3J A;  2R3V A;  3QT7 A;  4JI1 E;  4YHH I;  4JI3 I;  1H7U A;  3F0N A;  5LMN E;  4JYA I;  2AJ4 A;  4DR7 I;  3J81 C;  1I94 I;  4DXL A;  4DR4 E;  2E5L E;  3PYE A;  4DPX A;  2CZ9 A;  4LFA E;  2HKJ A;  1FJG I;  4DV5 I;  2HHH I;  1HNZ I;  2UU9 I;  4X65 I;  1HNW I;  2EFG A;  4K0K E;  3WU6 A;  1S16 A;  1Z0C A;  1XMO E;  4NXM E;  4GKK I;  4X64 I;  4X66 E;  3WU4 A;  2V2Z A;  4WUC A;  4DPW A;  4MYU A;  1KVK A;  2GS8 A;  2UXC I;  3M6A A;  4JI0 I;  2VQE E;  3T1Y E;  1XNR E;  5IT9 Q;  4GKJ I;  1N34 E;  4DU8 A;  3LTO A;  4JI2 E;  3LNU A;  4DUY E;  3PYF A;  5FLX C;  1Z0T A;  1EI1 A;  4OX9 E;  4B3R I;  3J81 Q;  2VQF I;  4JI3 E;  2UUA E;  3V2U C;  1HNX E;  4JI5 I;  1H7S A;  4AQY E;  1I94 E;  1OJ4 A;  2X36 A;  1KIJ A;  3K17 A;  1IBM I;  1N0U A;  2V2V A;  3V5R A;  1N36 I;  4DV7 E;  4DV3 I;  3HUL A;  2HHH E;  1Z0G A;  1MX0 A;  1HNZ E;  5LMU I;  2E1R A;  4DPU A;  1HNW E;  1KKH A;  3D4J A;  5IWA I;  4GKK E;  4LF9 I;  3JAM C;  2LJP A;  2V34 A;  4LF4 I;  4JV5 E;  4JI6 I;  3ZZ0 A;  5GME A;  1QZR A;  2F4V I;  1B62 A;  1PIE A;  2OI2 A;  5FLX Q;  1XNQ E;  1J5E I;  4USM A;  1Z59 A;  4X62 I;  4HYM A;  4DR1 E;  1N33 E;  4LF7 I;  2VF3 A;  4YY3 E;  1Z0V A;  4B3S E;  4LF6 I;  1HR0 I;  4FN5 A;  1Z0E A;  3H4L A;  4HY1 A;  1D6T A;  3ZM7 A;  3B8H A;  4PRX A;  1N36 E;  4RPF A;  1K47 A;  2UUC I;  1FI4 A;  4DV3 E;  1N32 I;  4DU7 A;  1RR9 A;  2UUB I;  4DUZ I;  4LFB I;  3JAM Q;  4DV6 I;  1B63 A;  3J7A G;  4LFC I;  1KTV A;  4Z7Y A;  4B3M I;  1FKA E;  1MU5 A;  4JI6 E;  4LF5 E;  1IBK I;  4DR2 E;  4URL A;  4PRV A;  3WU5 A;  4XTJ A;  2UXB E;  1WUU A;  1Z5B A;  4X62 E;  2DEJ A;  4LF7 E;  3T1H I;  4HXZ A;  4JI4 E;  4DR3 I;  1XMQ I;  2ZBK B;  4WUB A;  1RRE A;  4YHH E;  4JYA E;  4DV1 I;  4KHP I;  2DEI A;  5GMD A;  3QT6 A;  1IBL I;  4DR7 E;  1Z0W A;  2A2C A;  2R42 A;  2HK3 A;  3J80 C;  4LF8 I;  5A2Q C;  5LL6 R;  2UUC E;  1U2R A;  4JI1 I;  1N32 E;  2UXD I;  1FJG E;  2UUB E;  1UEK A;  4DV5 E;  4LFB E;  5LMN I;  2UU9 E;  4DV6 E;  4B3T I;  3ZZT A;  4USK A;  4X65 E;  4P7A A;  4X64 E;  4DR4 I;  2E5L I;  2V2Q A;  1IBK E;  4DR6 I;  3OTO I;  4I3H A;  4EMD A;  2XEX A;  2HFS A;  4DR5 I;  2UXC E;  4JI0 E;  4Z7C A;  4DV0 I;  2ZM6 I;  4GKJ E;  4NXN I;  1EA6 A;  4DV4 I;  2HKE A;  1H73 A;  1XMO I;  4JG4 A;  4JI8 I;  4X66 I;  1Z5A A;  4WUD A;  3B78 A;  1VIS A;  1PKP A;  4ZVI A;  4B3R E;  3GON A;  2VQF E;  5BR8 I;  1H72 C;  2VQE I;  1N0V C;  4JI5 E;  1IBL E;  3J80 Q;  5A2Q Q;  2J7K A;  4MYT A; 
#chains in the Genus database with same CATH topology
 5DRQ A;  4DUY I;  1IBM E;  2IER A;  2WW4 A;  4LF8 E;  4FWD A;  4R1F A;  1NHJ A;  4OX9 I;  2UXD E;  4DV2 I;  4DPT A;  1R6M A;  2UUA I;  4MQY A;  5LMU E;  4B3T E;  1BKN A;  1HNX I;  2WNR A;  1Y4U A;  4AQY I;  1USV A;  2V8P A;  3ZKD A;  4FW9 A;  1DAR A;  5IWA E;  2X7I A;  4JI7 I;  4UTG A;  4LF9 E;  3B82 A;  4LF4 E;  4DR6 E;  2HK2 A;  3OTO E;  2ZIT A;  2BR2 B;  4DV7 I;  3CWV A;  4DR5 E;  2F4V E;  4DV0 E;  2BM1 A;  3GLL A;  2ZM6 E;  4NXN E;  1XHK A;  3U1Y A;  1J5E E;  4DV4 E;  3GCM A;  1UDS A;  4IZJ B;  3H1C A;  3ZKB A;  2BV3 A;  2HFU A;  4JI8 E;  4P52 A;  4FWG A;  4IZK B;  4JV5 I;  3DD6 A;  5EL9 A;  1NHH A;  4OKG A;  1ZXM A;  2BR2 A;  2JT2 A;  5BR8 E;  1ZXN A;  2O1U A;  4DPY A;  5ELW A;  5C0X B;  4LF6 E;  1HR0 E;  4ED4 A;  1XNQ I;  4LPF A;  2F1D A;  4BA2 A;  4DR1 I;  1N33 I;  1FNM A;  1NHI A;  3KRN A;  1Y6Z A;  4LCG A;  4KQV A;  4YY3 I;  1ZM4 A;  4DV2 E;  3PYD A;  1FWL A;  1PVG A;  4DUZ E;  4B3S I;  1ZM2 A;  1P42 A;  2BM0 A;  4AM3 A;  1Z0B A;  2A2D A;  4M1K A;  2Q2E B;  2JEA B;  4LFC E;  4JI7 E;  4B3M E;  3ZZU A;  1ZM9 A;  4FWH A;  2NN6 D;  5K36 F;  1H74 A;  4PU9 A;  3Q1Q A;  4IFD F;  1YHC A;  2NPF A;  4LFA I;  1MG7 A;  1FWK A;  2O3Z A;  5K36 B;  2CG9 A;  1A6F A;  1ELO A;  2JEA A;  3J7A M;  4HAC B;  3T1H E;  5C0X E;  4K0K I;  3PRY A;  2PO0 B;  4NXM I;  1Y60 A;  4DR3 E;  1S4E A;  3QT8 A;  1XMQ E;  4LF5 I;  4DR2 I;  3PYG A;  3P06 A;  1NZ0 A;  1ZM3 A;  4DV1 E;  3T1Y I;  4KHP E;  5K36 A;  2UXB I;  1XNR I;  2WNR B;  3HJC A;  3M85 D;  1UDO A;  1N34 I;  3WU3 A;  4IFD A;  4UT4 A;  5DRR A;  4LCF A;  4HAC A;  4JI2 I;  4JI4 I;  1XXE A;  4OO1 F;  2PO0 A;  3K1J A;  1Z5C A;  3P76 A;  5IT9 C;  3LPS A;  3QT5 A;  5L3J A;  2R3V A;  3QT7 A;  4MDT A;  4JI1 E;  4YHH I;  4JI3 I;  1H7U A;  4ISA A;  3F0N A;  5C0X C;  5LMN E;  4JYA I;  1UDQ A;  1Y5Y A;  3PS2 A;  4AIM A;  2O1T A;  2AJ4 A;  4DR7 I;  3J81 C;  2NN6 F;  1I94 I;  5DNX A;  2C38 B;  4DXL A;  4DR4 E;  2BA1 G;  2Z5E A;  2E5L E;  5JEA D;  2PNM A;  5K36 D;  3PYE A;  4AID A;  2AE8 A;  4DPX A;  2CZ9 A;  4LFA E;  4IFD D;  2NN6 B;  2C37 B;  2HKJ A;  1FJG I;  3B4T A;  4DV5 I;  2HHH I;  2JE6 A;  1HNZ I;  4OO1 A;  2UU9 I;  4LOM A;  5EKW A;  4X65 I;  4BA2 B;  1HNW I;  2EFG A;  4K0K E;  3WU6 A;  1S16 A;  1Z0C A;  2C38 A;  1XMO E;  4NXM E;  4X64 I;  4GKK I;  3K85 A;  4X66 E;  3WU4 A;  2V2Z A;  5DRP A;  4WUC A;  4DPW A;  4MYU A;  2BA0 G;  2NN6 A;  3CDI A;  2C37 A;  4LCH A;  1KVK A;  2GS8 A;  2UXC I;  3M6A A;  4JI0 I;  2VQE E;  3T1Y E;  4MU1 A;  1XNR E;  5IT9 Q;  4GKJ I;  1N34 E;  4DU8 A;  3LTO A;  2GQ0 A;  4JI2 E;  3LNU A;  4FW3 A;  4DUY E;  3PYF A;  5FLX C;  1OYP A;  4OO1 D;  5FWK A;  3P3E A;  4FW4 A;  1Z0T A;  1EI1 A;  4OX9 E;  1OYS A;  1RHY A;  4B3R I;  3J81 Q;  2VQF I;  4JI3 E;  2UUA E;  3V2U C;  1HNX E;  4JI5 I;  4MU0 A;  1H7S A;  4AQY E;  1I94 E;  4MU4 A;  1OJ4 A;  2X36 A;  1KIJ A;  5JEA F;  1Y4S A;  4U3B A;  3K17 A;  1IBM I;  2WP8 A;  1N0U A;  2V2V A;  4BA1 A;  3UHM A;  3V5R A;  1N36 I;  1UDN A;  4DV7 E;  2IOP A;  4DV3 I;  5JEA B;  3HUL A;  2HHH E;  1Z0G A;  1MX0 A;  1HNZ E;  5LMU I;  2E1R A;  2VES A;  3NZK A;  4DPU A;  4IFD B;  1HNW E;  1KKH A;  3D4J A;  5IWA I;  3U1K A;  4GKK E;  4LF9 I;  3JAM C;  2LJP A;  2V34 A;  4LF4 I;  4JV5 E;  4JI6 I;  2JEB A;  3ZZ0 A;  2O1W A;  2NN6 C;  5GME A;  1QZR A;  2C39 A;  3L7Z A;  5JEA A;  3Q6N A;  2F4V I;  4J3D A;  1B62 A;  1PIE A;  2J65 A;  2OI2 A;  5FLX Q;  1XNQ E;  1J5E I;  4USM A;  1Z59 A;  2O1V A;  4X62 I;  4HYM A;  4DR1 E;  1N33 E;  4LF7 I;  2PNZ B;  2VF3 A;  2Z5B A;  4YY3 E;  4QNJ A;  1Z0V A;  4U3D A;  4FW6 A;  4B3S E;  3M7N G;  2JE6 B;  4OO1 B;  4QNK A;  4LF6 I;  2PO1 A;  1HR0 I;  2BA1 D;  4FN5 A;  1Z0E A;  5K36 E;  2PNZ A;  3H4L A;  4HY1 A;  3M85 G;  1D6T A;  3GME A;  3ZM7 A;  3B8H A;  4IFD E;  4PRX A;  1N36 E;  4RPF A;  4FW7 A;  1K47 A;  2UUC I;  4GQU A;  1FI4 A;  4DV3 E;  1N32 I;  4DU7 A;  1RR9 A;  2UUB I;  4DUZ I;  4LFB I;  3JAM Q;  4DV6 I;  2IES A;  1B63 A;  3J7A G;  4LFC I;  1KTV A;  4Z7Y A;  2GO3 A;  4B3M I;  2BA0 D;  1FKA E;  1MU5 A;  1HK7 A;  4JI6 E;  4FW5 A;  4LF5 E;  1IBK I;  4DR2 E;  4URL A;  1R6L A;  1VI7 A;  4PRV A;  4NBQ A;  3WU5 A;  5JEA C;  5K36 C;  4XTJ A;  2UXB E;  2CGE A;  1WUU A;  4IFD C;  1Z5B A;  4X62 E;  2DEJ A;  4LF7 E;  3T1H I;  4HXZ A;  5DNL A;  4JI4 E;  4OO1 E;  5C0X F;  2WP8 B;  4DR3 I;  4BA1 B;  1XMQ I;  2ZBK B;  4WUB A;  1RRE A;  1USU A;  4YHH E;  4JYA E;  4DV1 I;  4KHP I;  2DEI A;  5GMD A;  3QT6 A;  1IBL I;  4OZE A;  2NN6 E;  1YH8 A;  4DR7 E;  3P3C A;  4IZJ A;  2PO2 B;  1Z0W A;  2A2C A;  2R42 A;  2HK3 A;  3J80 C;  2JEB B;  4IZK A;  4LF8 I;  5A2Q C;  5LL6 R;  2UUC E;  1U2R A;  4JI1 I;  1N32 E;  2UXD I;  1FJG E;  2C39 B;  3L7Z B;  1UEK A;  4DV5 E;  2UUB E;  4N3O A;  3PS1 A;  4LFB E;  5LMN I;  4OO1 C;  5C0X A;  2UU9 E;  3PS3 A;  4DV6 E;  4B3T I;  3ZZT A;  4USK A;  4X65 E;  2IOQ A;  3Q6M A;  1E3H A;  2PO2 A;  2Z5B B;  4P7A A;  3HKM A;  4X64 E;  4DR4 I;  2E5L I;  2PNL A;  2V2Q A;  1IBK E;  4DR6 I;  3OTO I;  2Z5C B;  4I3H A;  4EMD A;  2XEX A;  2HFS A;  4DR5 I;  2UXC E;  4JI0 E;  4IZJ D;  4Z7C A;  2CVE A;  4DV0 I;  2PO1 B;  2ZM6 I;  4GKJ E;  4NXN I;  1EA6 A;  4DV4 I;  2GO4 A;  2HKE A;  1E3P A;  1H73 A;  1XMO I;  4IS9 A;  4JG4 A;  4JI8 I;  4X66 I;  3M7N D;  5C0X D;  1Z5A A;  4WUD A;  4MU3 A;  3B78 A;  3CDJ A;  1VIS A;  1PKP A;  2Z5C A;  4ZVI A;  3GON A;  2VQF E;  5BR8 I;  4B3R E;  1H72 C;  1OYR A;  2VQE I;  1N0V C;  4JI5 E;  1IBL E;  5DRO A;  3J80 Q;  3P3G A;  5A2Q Q;  2J7K A;  5JEA E;  4MYT A; 
#chains in the Genus database with same CATH homology
 4DUY I;  1IBM E;  2WW4 A;  4LF8 E;  4FWD A;  4R1F A;  1NHJ A;  4OX9 I;  2UXD E;  4DV2 I;  4DPT A;  2UUA I;  5LMU E;  4B3T E;  1BKN A;  1HNX I;  1Y4U A;  4AQY I;  1USV A;  2V8P A;  3ZKD A;  4FW9 A;  1DAR A;  5IWA E;  2X7I A;  4JI7 I;  4UTG A;  4LF9 E;  3B82 A;  4LF4 E;  4DR6 E;  2HK2 A;  3OTO E;  2ZIT A;  4DV7 I;  3CWV A;  4DR5 E;  2F4V E;  4DV0 E;  2BM1 A;  2ZM6 E;  4NXN E;  1XHK A;  1J5E E;  4DV4 E;  4IZJ B;  3ZKB A;  2BV3 A;  2HFU A;  4JI8 E;  4P52 A;  4FWG A;  4IZK B;  4JV5 I;  1NHH A;  1ZXM A;  5BR8 E;  1ZXN A;  2O1U A;  4DPY A;  4LF6 E;  1HR0 E;  4ED4 A;  1XNQ I;  4DR1 I;  1N33 I;  1FNM A;  1NHI A;  1Y6Z A;  4YY3 I;  4KQV A;  1ZM4 A;  4DV2 E;  3PYD A;  1FWL A;  1PVG A;  4DUZ E;  4B3S I;  1ZM2 A;  2BM0 A;  1Z0B A;  2A2D A;  4M1K A;  2Q2E B;  4LFC E;  4JI7 E;  4B3M E;  3ZZU A;  1ZM9 A;  4FWH A;  1H74 A;  4PU9 A;  3Q1Q A;  2NPF A;  4LFA I;  1MG7 A;  1FWK A;  2CG9 A;  1A6F A;  1ELO A;  3J7A M;  4HAC B;  3T1H E;  4K0K I;  3PRY A;  4NXM I;  4DR3 E;  1S4E A;  3QT8 A;  1XMQ E;  4LF5 I;  4DR2 I;  3PYG A;  3P06 A;  1NZ0 A;  1ZM3 A;  4DV1 E;  3T1Y I;  4KHP E;  2UXB I;  1XNR I;  3HJC A;  1N34 I;  3WU3 A;  4UT4 A;  4HAC A;  4JI2 I;  4JI4 I;  3K1J A;  1Z5C A;  5IT9 C;  3LPS A;  3QT5 A;  5L3J A;  2R3V A;  3QT7 A;  4JI1 E;  4YHH I;  4JI3 I;  1H7U A;  3F0N A;  5LMN E;  4JYA I;  2O1T A;  2AJ4 A;  4DR7 I;  3J81 C;  1I94 I;  4DXL A;  4DR4 E;  2Z5E A;  2E5L E;  2PNM A;  3PYE A;  4DPX A;  2CZ9 A;  4LFA E;  2HKJ A;  1FJG I;  4DV5 I;  2HHH I;  1HNZ I;  2UU9 I;  4X65 I;  1HNW I;  2EFG A;  4K0K E;  3WU6 A;  1S16 A;  1Z0C A;  1XMO E;  4NXM E;  4GKK I;  4X64 I;  3K85 A;  4X66 E;  3WU4 A;  2V2Z A;  4WUC A;  4DPW A;  4MYU A;  1KVK A;  2GS8 A;  2UXC I;  3M6A A;  4JI0 I;  2VQE E;  3T1Y E;  1XNR E;  5IT9 Q;  4GKJ I;  1N34 E;  4DU8 A;  3LTO A;  2GQ0 A;  4JI2 E;  3LNU A;  4DUY E;  3PYF A;  5FLX C;  5FWK A;  1Z0T A;  1EI1 A;  4OX9 E;  4B3R I;  3J81 Q;  2VQF I;  4JI3 E;  2UUA E;  3V2U C;  1HNX E;  4JI5 I;  1H7S A;  4AQY E;  1I94 E;  1OJ4 A;  2X36 A;  1KIJ A;  1Y4S A;  3K17 A;  1IBM I;  1N0U A;  2V2V A;  3V5R A;  1N36 I;  4DV7 E;  2IOP A;  4DV3 I;  3HUL A;  2HHH E;  1Z0G A;  1MX0 A;  1HNZ E;  5LMU I;  2E1R A;  4DPU A;  1HNW E;  1KKH A;  3D4J A;  5IWA I;  4GKK E;  4LF9 I;  3JAM C;  2LJP A;  2V34 A;  4LF4 I;  4JV5 E;  4JI6 I;  3ZZ0 A;  2O1W A;  5GME A;  1QZR A;  3Q6N A;  2F4V I;  1B62 A;  1PIE A;  2OI2 A;  5FLX Q;  1XNQ E;  1J5E I;  4USM A;  1Z59 A;  2O1V A;  4X62 I;  4HYM A;  4DR1 E;  1N33 E;  4LF7 I;  2VF3 A;  2Z5B A;  4YY3 E;  1Z0V A;  4B3S E;  4LF6 I;  1HR0 I;  4FN5 A;  1Z0E A;  3H4L A;  4HY1 A;  1D6T A;  3ZM7 A;  3B8H A;  4PRX A;  1N36 E;  4RPF A;  1K47 A;  2UUC I;  1FI4 A;  4DV3 E;  1N32 I;  4DU7 A;  1RR9 A;  2UUB I;  4DUZ I;  4LFB I;  3JAM Q;  4DV6 I;  1B63 A;  3J7A G;  4LFC I;  1KTV A;  4Z7Y A;  4B3M I;  1FKA E;  1MU5 A;  1HK7 A;  4JI6 E;  4LF5 E;  1IBK I;  4DR2 E;  4URL A;  4PRV A;  3WU5 A;  4XTJ A;  2UXB E;  2CGE A;  1WUU A;  1Z5B A;  4X62 E;  2DEJ A;  4LF7 E;  3T1H I;  4HXZ A;  4JI4 E;  4DR3 I;  1XMQ I;  2ZBK B;  4WUB A;  1RRE A;  1USU A;  4YHH E;  4JYA E;  4DV1 I;  4KHP I;  2DEI A;  5GMD A;  3QT6 A;  1IBL I;  4DR7 E;  4IZJ A;  1Z0W A;  2A2C A;  2R42 A;  2HK3 A;  3J80 C;  4IZK A;  4LF8 I;  5A2Q C;  5LL6 R;  2UUC E;  1U2R A;  4JI1 I;  1N32 E;  2UXD I;  1FJG E;  2UUB E;  1UEK A;  4DV5 E;  4N3O A;  4LFB E;  5LMN I;  2UU9 E;  4DV6 E;  4B3T I;  3ZZT A;  4USK A;  4X65 E;  2IOQ A;  3Q6M A;  2Z5B B;  4P7A A;  4X64 E;  4DR4 I;  2E5L I;  2PNL A;  2V2Q A;  1IBK E;  4DR6 I;  3OTO I;  2Z5C B;  4I3H A;  4EMD A;  2XEX A;  2HFS A;  4DR5 I;  2UXC E;  4JI0 E;  4IZJ D;  4Z7C A;  4DV0 I;  2ZM6 I;  4GKJ E;  4NXN I;  1EA6 A;  4DV4 I;  2HKE A;  1H73 A;  1XMO I;  4JG4 A;  4JI8 I;  4X66 I;  1Z5A A;  4WUD A;  3B78 A;  1VIS A;  1PKP A;  2Z5C A;  4ZVI A;  3GON A;  2VQF E;  5BR8 I;  4B3R E;  1H72 C;  2VQE I;  1N0V C;  4JI5 E;  1IBL E;  3J80 Q;  5A2Q Q;  2J7K A;  4MYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...