4DV6I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv6I00
1HNWI 4LF9I 2R42A 2VQFE 4JI0E 4JG4A 4JI4E 4LF8I 4X64E 4NXNE 1WUUA 4DPUA 3K17A 2UXCI 4DUZE 4DR7E 4FWHA 1N34E 4X66E 2V34A 1RREA 5LMNE 2VQEI 2CZ9A 1IBME 4JI1I 4ED4A 1QZRA 1N32I 4LF5I 2WW4A 3ZZUA 1KVKA 3QT5A 3ZZTA 4MYTA 3J7AG 2AJ4A 4JI6I 1HNWE 4LF9E 1MX0A 1H7UA 4WUDA 4LF8E 3K1JA 3Q1QA 4R1FA 4JI5I 3T1HI 1PVGA 1KKHA 5GMEA 1XNRI 2UUCI 1Z0WA 2UUAE 4JI3I 2VQEE 2R3VA 4JI1E 1N32E 4LF5E 2A2DA 4GKKI 3D4JA 2X36A 1HNZI 2DEJA 4JI6E 3M6AA 3CWVA 3V2UC 4PRVA 2V2QA 4XTJA 5GMDA 1XMQI 4JI5E 4OX9I 1U2RA 3J80Q 1ZM2A 4LF6I 1K47A 3T1HE 1N36E 4DUYI 4JI7I 2EFGA 2F4VI 1ZM4A 2HK3A 1Z0BA 1XNRE 2UUCE 4URLA 1MG7A 1VISA 4JI3E 3LNUA 4DR4I 4PU9A 1FJGI 2ZBKB 4GKKE 4MYUA 4DV5I 4DV2I 4FW9A 1NHIA 1HNZE 1A6FA 4PRXA 1I94I 4LFBI 5IT9Q 4DV4I 1NZ0A 2HKJA 4DU8A 1KTVA 4FN5A 1XMQE 4OX9E 1IBKI 4DUYE 4JI7E 1S4EA 3B78A 4HACB 3V5RA 2F4VE 1OJ4A 4HACA 2DEIA 2E1RA 5FLXQ 4DV0I 4B3SI 4JI8I 1RR9A 4DR4E 1FJGE 2X7IA 4DV5E 4DV2E 2NPFA 2A2CA 3ZKBA 1I94E 4LFBE 4DR5I 4DV4E 4B3MI 4M1KA 4B3TI 4DPWA 3F0NA 4LFAI 4JYAI 2LJPA 2OI2A 3GONA 4HY1A 1IBKE 2UXCE 5A2QC 2ZITA 4KHPI 4ZVIA 4DV0E 1EA6A 4B3SE 2BM0A 4JI8E 1HR0I 2BV3A 4LF7I 4WUCA 1FWKA 2V2ZA 3QT6A 1Z5CA 1H74A 3J81C 2V2VA 4AQYI 4P7AA 3J80C 4DR5E 4B3ME 4B3TE 4HXZA 1NHJA 1Z0VA 4RPFA 1B63A 4LF4I 4LFAE 3JAMC 1HNXI 4K0KI 4JYAE 4B3RI 2V8PA 3ZZ0A 1H7SA 3B82A 5BR8I 1FI4A 4X62I 4KHPE 4FWGA 2UUBI 4JI0I 4LFCI 4JI2I 2ZM6I 1KIJA 1IBLI 2XEXA 1HR0E 4LF7E 5IT9C 4USKA 4DV6I 4JV5I 4NXMI 1H72C 4AQYE 4X66I 4GKJI 3HULA 2HFSA 1UEKA 2J7KA 4DU7A 3QT8A 4LF4E 3T1YI 1HNXE 4K0KE 4B3RE 4UTGA 1MU5A 4USMA 4LF6E 1BKNA 1N33I 2HK2A 4FWDA 5BR8E 4P52A 4KQVA 2BM1A 4X62E 4WUBA 4YY3I 1FKAE 1EI1A 2UUBE 1J5EI 4DR2I 1D6TA 1Z0CA 4DV3I 1XNQI 1H73A 4DR6I 4LFCE 4JI2E 2ZM6E 4DR1I 1IBLE 4DV7I 4DV6E 2UXDI 3PYGA 2GS8A 1N0UA 4NXME 4JV5E 1ZM3A 1Z5BA 4DXLA 3ZKDA 4YHHI 1FWLA 4GKJE 2UU9I 3PYFA 1Z5AA 2UXBI 3WU4A 2UUAI 3T1YE 3H4LA 2HHHI 4X65I 5IWAI 1N33E 2Q2EB 3WU5A 4YY3E 1ELOA 1NHHA 1J5EE 4DR2E 4Z7YA 1Z59A 3WU3A 4DV3E 1XNQE 4DR6E 5LL6R 1S16A 4DR1E 4DV7E 2UXDE 3WU6A 4EMDA 1N36I 2VF3A 4HYMA 4DPTA 4DR3I 4YHHE 1XMOI 2UU9E 3B8HA 4DPYA 4DPXA 2UXBE 3PYEA 1PIEA 3OTOI 3QT7A 1B62A 5A2QQ 3ZM7A 5LMUI 2HKEA 4DV1I 2HFUA 2HHHE 4X65E 5IWAE 1ZXNA 4I3HA 1Z0GA 1FNMA 1Z0EA 3PYDA 2E5LI 2VQFI 4UT4A 4JI4I 3J81Q 4X64I 4NXNI 4DUZI 4DR7I 4DR3E 1XHKA 1N34I 1XMOE 3JAMQ 1PKPA 5LMNI 1ZXMA 3LPSA 5L3JA 3OTOE 1IBMI 1Z0TA 3LTOA 5LMUE 4DV1E 4Z7CA 5FLXC 1ZM9A 3J7AM 1DARA 1N0VC 2E5LE
chains in the Genus database with same CATH superfamily
1HNWI 2JEAB 4LF9I 2R42A 2VQFE 2NN6F 4JI0E 2O1VA 4IZJD 4JG4A 4JI4E 5K36C 2JEAA 4LF8I 2NN6B 3P3GA 4X64E 4NXNE 1WUUA 3Q6MA 4DPUA 2AE8A 3K17A 2NN6A 2UXCI 2JE6B 4DUZE 4DR7E 4FWHA 2IESA 3L7ZB 1N34E 4X66E 3L7ZA 2V34A 1RREA 2NN6D 5LMNE 1HK7A 2VQEI 2CZ9A 1IBME 2PNMA 4JI1I 4ED4A 1QZRA 1N32I 4QNKA 4LF5I 2CVEA 2WW4A 3ZZUA 1KVKA 3QT5A 3ZZTA 4MYTA 3J7AG 3M85D 2C38B 2AJ4A 4JI6I 1HNWE 4LF9E 1MX0A 2PO0B 1H7UA 2C38A 4FW7A 3PS2A 4WUDA 4LF8E 3K1JA 3Q1QA 4R1FA 4JI5I 4MU4A 5C0XC 3T1HI 1PVGA 3CDIA 3M7NG 1KKHA 5EL9A 5GMEA 3HKMA 2C39B 1XNRI 2UUCI 1Z0WA 2UUAE 2BA1D 4JI3I 2C39A 2VQEE 2R3VA 4JI1E 1N32E 4LF5E 2A2DA 4GKKI 2GO4A 3D4JA 2X36A 2PO2B 1HNZI 2IOPA 2DEJA 2PO2A 5JEAF 4JI6E 1Y6ZA 3P3EA 5ELWA 3M6AA 3CWVA 4IZKB 2O1TA 2O1UA 3V2UC 4ISAA 4FW5A 4IZKA 4XTJA 2V2QA 4PRVA 5GMDA 1XMQI 3PRYA 4JI5E 4OX9I 1U2RA 3J80Q 1ZM2A 4LF6I 1K47A 3T1HE 1N36E 4DUYI 4JI7I 3GCMA 2EFGA 2NN6E 2F4VI 1ZM4A 2HK3A 1UDOA 1Z0BA 1XNRE 2BR2A 2UUCE 3P06A 5DRPA 4URLA 1MG7A 4IFDF 1VISA 4JI3E 1UDSA 3LNUA 4MU1A 2GQ0A 2Z5EA 4OO1F 4IFDB 4DR4I 4PU9A 1FJGI 2ZBKB 4GKKE 4MYUA 4DV5I 4IFDA 4DV2I 4FW9A 4LCHA 4FW4A 1R6MA 4MDTA 1NHIA 4OO1A 1HNZE 1A6FA 4PRXA 1I94I 4LFBI 5K36F 5IT9Q 4IFDD 4DV4I 5K36B 2J65A 1NZ0A 2HKJA 4DU8A 1KTVA 5K36A 4FN5A 2C37A 4MU3A 4LPFA 1XMQE 4OX9E 3U1KA 3HJCA 1IBKI 1OYSA 4DUYE 4JI7E 1Y4UA 1S4EA 3B78A 4HACB 4N3OA 3V5RA 1USUA 5K36D 4FW6A 3M7ND 2F4VE 4OKGA 1OJ4A 4HACA 2DEIA 2E1RA 5FLXQ 4DV0I 4LCFA 4B3SI 4JI8I 3K85A 1RR9A 4DR4E 2Z5CB 1FJGE 2NN6C 2X7IA 4DV5E 4DV2E 2Z5CA 1Y60A 2NPFA 3U1YA 2A2CA 3ZKBA 1I94E 4LFBE 4OZEA 4DR5I 4DV4E 1P42A 4B3MI 4M1KA 4B3TI 4DPWA 3F0NA 4LFAI 4JYAI 2LJPA 2OI2A 3GONA 4HY1A 1IBKE 2UXCE 2CG9A 5A2QC 2ZITA 5DRQA 4KHPI 4ZVIA 2BA0D 4DV0E 4LCGA 3B4TA 1EA6A 4B3SE 2BM0A 4JI8E 2GO3A 1HR0I 2BV3A 4LF7I 4WUCA 2IERA 3CDJA 1FWKA 2V2ZA 3QT6A 1Z5CA 1H74A 2F1DA 3J81C 2V2VA 4AQYI 4P7AA 4IFDE 3J80C 4DR5E 4OO1E 5DROA 4B3ME 5JEAB 4B3TE 4HXZA 1NHJA 1E3PA 1Z0VA 2Z5BA 4RPFA 1B63A 4LF4I 4U3BA 5JEAA 3JAMC 1HNXI 4LFAE 4JYAE 4K0KI 4B3RI 1RHYA 2CGEA 2V8PA 5K36E 3ZZ0A 1H7SA 3B82A 5BR8I 2WP8B 5JEAD 2BR2B 1FI4A 1VI7A 4U3DA 4X62I 4KHPE 4BA2B 2BA0G 2WP8A 4FWGA 2UUBI 4J3DA 4JI0I 4BA2A 4LFCI 4JI2I 2ZM6I 1KIJA 1IBLI 2XEXA 1HR0E 4LF7E 5IT9C 4USKA 4DV6I 4GQUA 4OO1B 4JV5I 4NXMI 4FW3A 3GLLA 1H72C 4AQYE 1Y5YA 2JEBB 4X66I 4GKJI 3HULA 2HFSA 1UEKA 2J7KA 4DU7A 2C37B 2JEBA 3QT8A 4OO1D 4LF4E 3T1YI 1HNXE 4K0KE 4B3RE 4UTGA 1MU5A 4IFDC 2PNLA 4AIMA 3P3CA 4USMA 4LF6E 1BKNA 1YHCA 2PNZB 1N33I 2IOQA 2HK2A 4FWDA 5BR8E 2PNZA 4P52A 4KQVA 2BM1A 3P76A 4X62E 3PS1A 4WUBA 4AIDA 4YY3I 1FKAE 1EI1A 1J5EI 4DR2I 2UUBE 1D6TA 1Z0CA 4DV3I 1XNQI 1H73A 4DR6I 5EKWA 4LFCE 4JI2E 2ZM6E 4DR1I 1IBLE 3H1CA 4QNJA 4IS9A 4DV7I 1OYPA 5DRRA 4DV6E 2UXDI 3PYGA 2GS8A 1N0UA 3GMEA 4NXME 1ZM3A 4JV5E 1Z5BA 4DXLA 3ZKDA 2JE6A 4YHHI 1FWLA 4MU0A 4GKJE 2UU9I 3PYFA 1Z5AA 2UXBI 3UHMA 3WU4A 2UUAI 4AM3A 2WNRB 5C0XF 3T1YE 2VESA 3H4LA 5C0XB 2WNRA 2HHHI 5JEAE 4X65I 5IWAI 1N33E 2Q2EB 1E3HA 5C0XA 3WU5A 1YH8A 1XXEA 4YY3E 1ELOA 3DD6A 1NHHA 1J5EE 4DR2E 4Z7YA 1Z59A 3WU3A 5C0XD 4DV3E 1XNQE 4DR6E 5LL6R 1S16A 4DR1E 2JT2A 5DNXA 2PO0A 4DV7E 2UXDE 2O3ZA 3WU6A 3PS3A 4EMDA 1N36I 2VF3A 4HYMA 4DPTA 4DR3I 4YHHE 1XMOI 2Z5BB 2UU9E 3B8HA 4DPYA 4DPXA 2UXBE 3PYEA 1PIEA 3OTOI 3QT7A 1B62A 5A2QQ 3ZM7A 5LMUI 1USVA 2HKEA 4DV1I 2HFUA 2HHHE 4X65E 5IWAE 1Y4SA 1ZXNA 4I3HA 1Z0GA 1FNMA 4BA1B 3M85G 1UDQA 1Z0EA 3PYDA 3NZKA 2E5LI 4BA1A 2VQFI 1R6LA 4UT4A 4JI4I 5JEAC 4NBQA 4X64I 3J81Q 4NXNI 4DUZI 4DR7I 2O1WA 1UDNA 4DR3E 1XHKA 4LOMA 1N34I 1XMOE 3JAMQ 3KRNA 3Q6NA 2BA1G 1PKPA 5LMNI 1ZXMA 3LPSA 4MQYA 5FWKA 5L3JA 3OTOE 1IBMI 1Z0TA 3LTOA 5LMUE 4DV1E 4Z7CA 5DNLA 5FLXC 4IZJB 2PO1B 1ZM9A 4OO1C 3J7AM 1DARA 4IZJA 1N0VC 2PO1A 1OYRA 5C0XE 2E5LE
chains in the Genus database with same CATH topology
1HNWI 4LF9I 2R42A 2VQFE 4JI0E 2O1VA 4IZJD 4JG4A 4JI4E 4LF8I 4X64E 4NXNE 1WUUA 3Q6MA 4DPUA 3K17A 2UXCI 4DUZE 4DR7E 4FWHA 1N34E 4X66E 2V34A 1RREA 5LMNE 1HK7A 2VQEI 2CZ9A 1IBME 2PNMA 4JI1I 4ED4A 1QZRA 1N32I 4LF5I 2WW4A 3ZZUA 1KVKA 3QT5A 3ZZTA 4MYTA 3J7AG 2AJ4A 4JI6I 1HNWE 4LF9E 1MX0A 1H7UA 4WUDA 4LF8E 3K1JA 3Q1QA 4R1FA 4JI5I 3T1HI 1PVGA 1KKHA 5GMEA 1XNRI 2UUCI 1Z0WA 2UUAE 4JI3I 2VQEE 2R3VA 4JI1E 1N32E 4LF5E 2A2DA 4GKKI 3D4JA 2X36A 1HNZI 2IOPA 2DEJA 4JI6E 1Y6ZA 3M6AA 3CWVA 4IZKB 2O1TA 2O1UA 3V2UC 4IZKA 2V2QA 4PRVA 4XTJA 5GMDA 1XMQI 3PRYA 4JI5E 4OX9I 1U2RA 3J80Q 1ZM2A 4LF6I 1K47A 3T1HE 1N36E 4DUYI 4JI7I 2EFGA 2F4VI 1ZM4A 2HK3A 1Z0BA 1XNRE 2UUCE 3P06A 4URLA 1MG7A 1VISA 4JI3E 3LNUA 2GQ0A 2Z5EA 4DR4I 4PU9A 1FJGI 2ZBKB 4GKKE 4MYUA 4DV5I 4DV2I 4FW9A 1NHIA 1HNZE 1A6FA 4PRXA 1I94I 4LFBI 5IT9Q 4DV4I 1NZ0A 2HKJA 4DU8A 1KTVA 4FN5A 1XMQE 4OX9E 3HJCA 1IBKI 4DUYE 4JI7E 1Y4UA 1S4EA 3B78A 4HACB 4N3OA 3V5RA 1USUA 2F4VE 1OJ4A 4HACA 2DEIA 2E1RA 5FLXQ 4DV0I 4B3SI 4JI8I 3K85A 1RR9A 4DR4E 2Z5CB 1FJGE 2X7IA 4DV5E 4DV2E 2Z5CA 2NPFA 2A2CA 3ZKBA 1I94E 4LFBE 4DR5I 4DV4E 4B3MI 4M1KA 4B3TI 4DPWA 3F0NA 4LFAI 4JYAI 2LJPA 2OI2A 3GONA 4HY1A 1IBKE 2UXCE 2CG9A 5A2QC 2ZITA 4KHPI 4ZVIA 4DV0E 1EA6A 4B3SE 2BM0A 4JI8E 1HR0I 2BV3A 4LF7I 4WUCA 1FWKA 2V2ZA 3QT6A 1Z5CA 1H74A 3J81C 2V2VA 4AQYI 4P7AA 3J80C 4DR5E 4B3ME 4B3TE 4HXZA 1NHJA 1Z0VA 2Z5BA 4RPFA 1B63A 4LF4I 4LFAE 3JAMC 1HNXI 4K0KI 4JYAE 4B3RI 2CGEA 2V8PA 3ZZ0A 1H7SA 3B82A 5BR8I 1FI4A 4X62I 4KHPE 4FWGA 2UUBI 4JI0I 4LFCI 4JI2I 2ZM6I 1KIJA 1IBLI 2XEXA 1HR0E 4LF7E 5IT9C 4USKA 4DV6I 4JV5I 4NXMI 1H72C 4AQYE 4X66I 4GKJI 3HULA 2HFSA 1UEKA 2J7KA 4DU7A 3QT8A 4LF4E 3T1YI 1HNXE 4K0KE 4B3RE 4UTGA 1MU5A 2PNLA 4USMA 4LF6E 1BKNA 1N33I 2IOQA 2HK2A 4FWDA 5BR8E 4P52A 4KQVA 2BM1A 4X62E 4WUBA 4YY3I 1FKAE 1EI1A 1J5EI 4DR2I 2UUBE 1D6TA 1Z0CA 4DV3I 1XNQI 1H73A 4DR6I 4LFCE 4JI2E 2ZM6E 4DR1I 1IBLE 4DV7I 4DV6E 2UXDI 3PYGA 2GS8A 1N0UA 4NXME 4JV5E 1ZM3A 1Z5BA 4DXLA 3ZKDA 4YHHI 1FWLA 4GKJE 2UU9I 3PYFA 1Z5AA 2UXBI 3WU4A 2UUAI 3T1YE 3H4LA 2HHHI 4X65I 5IWAI 1N33E 2Q2EB 3WU5A 4YY3E 1ELOA 1NHHA 1J5EE 4DR2E 4Z7YA 1Z59A 3WU3A 4DV3E 1XNQE 4DR6E 5LL6R 1S16A 4DR1E 4DV7E 2UXDE 3WU6A 4EMDA 1N36I 2VF3A 4HYMA 4DPTA 4DR3I 4YHHE 1XMOI 2Z5BB 2UU9E 3B8HA 4DPYA 4DPXA 2UXBE 3PYEA 1PIEA 3OTOI 3QT7A 1B62A 5A2QQ 3ZM7A 5LMUI 1USVA 2HKEA 4DV1I 2HFUA 2HHHE 4X65E 5IWAE 1Y4SA 1ZXNA 4I3HA 1Z0GA 1FNMA 1Z0EA 3PYDA 2E5LI 2VQFI 4UT4A 4JI4I 3J81Q 4X64I 4NXNI 4DUZI 4DR7I 2O1WA 4DR3E 1XHKA 1N34I 1XMOE 3JAMQ 3Q6NA 1PKPA 5LMNI 1ZXMA 3LPSA 5FWKA 5L3JA 3OTOE 1IBMI 1Z0TA 3LTOA 5LMUE 4DV1E 4Z7CA 5FLXC 4IZJB 1ZM9A 3J7AM 1DARA 4IZJA 1N0VC 2E5LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW I;  4LF9 I;  2R42 A;  2VQF E;  4JI0 E;  4JG4 A;  4JI4 E;  4LF8 I;  4X64 E;  4NXN E;  1WUU A;  4DPU A;  3K17 A;  2UXC I;  4DUZ E;  4DR7 E;  4FWH A;  1N34 E;  4X66 E;  2V34 A;  1RRE A;  5LMN E;  2VQE I;  2CZ9 A;  1IBM E;  4JI1 I;  4ED4 A;  1QZR A;  1N32 I;  4LF5 I;  2WW4 A;  3ZZU A;  1KVK A;  3QT5 A;  3ZZT A;  4MYT A;  3J7A G;  2AJ4 A;  4JI6 I;  1HNW E;  4LF9 E;  1MX0 A;  1H7U A;  4WUD A;  4LF8 E;  3K1J A;  3Q1Q A;  4R1F A;  4JI5 I;  3T1H I;  1PVG A;  1KKH A;  5GME A;  1XNR I;  2UUC I;  1Z0W A;  2UUA E;  4JI3 I;  2VQE E;  2R3V A;  4JI1 E;  1N32 E;  4LF5 E;  2A2D A;  4GKK I;  3D4J A;  2X36 A;  1HNZ I;  2DEJ A;  4JI6 E;  3M6A A;  3CWV A;  3V2U C;  4PRV A;  2V2Q A;  4XTJ A;  5GMD A;  1XMQ I;  4JI5 E;  4OX9 I;  1U2R A;  3J80 Q;  1ZM2 A;  4LF6 I;  1K47 A;  3T1H E;  1N36 E;  4DUY I;  4JI7 I;  2EFG A;  2F4V I;  1ZM4 A;  2HK3 A;  1Z0B A;  1XNR E;  2UUC E;  4URL A;  1MG7 A;  1VIS A;  4JI3 E;  3LNU A;  4DR4 I;  4PU9 A;  1FJG I;  2ZBK B;  4GKK E;  4MYU A;  4DV5 I;  4DV2 I;  4FW9 A;  1NHI A;  1HNZ E;  1A6F A;  4PRX A;  1I94 I;  4LFB I;  5IT9 Q;  4DV4 I;  1NZ0 A;  2HKJ A;  4DU8 A;  1KTV A;  4FN5 A;  1XMQ E;  4OX9 E;  1IBK I;  4DUY E;  4JI7 E;  1S4E A;  3B78 A;  4HAC B;  3V5R A;  2F4V E;  1OJ4 A;  4HAC A;  2DEI A;  2E1R A;  5FLX Q;  4DV0 I;  4B3S I;  4JI8 I;  1RR9 A;  4DR4 E;  1FJG E;  2X7I A;  4DV5 E;  4DV2 E;  2NPF A;  2A2C A;  3ZKB A;  1I94 E;  4LFB E;  4DR5 I;  4DV4 E;  4B3M I;  4M1K A;  4B3T I;  4DPW A;  3F0N A;  4LFA I;  4JYA I;  2LJP A;  2OI2 A;  3GON A;  4HY1 A;  1IBK E;  2UXC E;  5A2Q C;  2ZIT A;  4KHP I;  4ZVI A;  4DV0 E;  1EA6 A;  4B3S E;  2BM0 A;  4JI8 E;  1HR0 I;  2BV3 A;  4LF7 I;  4WUC A;  1FWK A;  2V2Z A;  3QT6 A;  1Z5C A;  1H74 A;  3J81 C;  2V2V A;  4AQY I;  4P7A A;  3J80 C;  4DR5 E;  4B3M E;  4B3T E;  4HXZ A;  1NHJ A;  1Z0V A;  4RPF A;  1B63 A;  4LF4 I;  4LFA E;  3JAM C;  1HNX I;  4K0K I;  4JYA E;  4B3R I;  2V8P A;  3ZZ0 A;  1H7S A;  3B82 A;  5BR8 I;  1FI4 A;  4X62 I;  4KHP E;  4FWG A;  2UUB I;  4JI0 I;  4LFC I;  4JI2 I;  2ZM6 I;  1KIJ A;  1IBL I;  2XEX A;  1HR0 E;  4LF7 E;  5IT9 C;  4USK A;  4DV6 I;  4JV5 I;  4NXM I;  1H72 C;  4AQY E;  4X66 I;  4GKJ I;  3HUL A;  2HFS A;  1UEK A;  2J7K A;  4DU7 A;  3QT8 A;  4LF4 E;  3T1Y I;  1HNX E;  4K0K E;  4B3R E;  4UTG A;  1MU5 A;  4USM A;  4LF6 E;  1BKN A;  1N33 I;  2HK2 A;  4FWD A;  5BR8 E;  4P52 A;  4KQV A;  2BM1 A;  4X62 E;  4WUB A;  4YY3 I;  1FKA E;  1EI1 A;  2UUB E;  1J5E I;  4DR2 I;  1D6T A;  1Z0C A;  4DV3 I;  1XNQ I;  1H73 A;  4DR6 I;  4LFC E;  4JI2 E;  2ZM6 E;  4DR1 I;  1IBL E;  4DV7 I;  4DV6 E;  2UXD I;  3PYG A;  2GS8 A;  1N0U A;  4NXM E;  4JV5 E;  1ZM3 A;  1Z5B A;  4DXL A;  3ZKD A;  4YHH I;  1FWL A;  4GKJ E;  2UU9 I;  3PYF A;  1Z5A A;  2UXB I;  3WU4 A;  2UUA I;  3T1Y E;  3H4L A;  2HHH I;  4X65 I;  5IWA I;  1N33 E;  2Q2E B;  3WU5 A;  4YY3 E;  1ELO A;  1NHH A;  1J5E E;  4DR2 E;  4Z7Y A;  1Z59 A;  3WU3 A;  4DV3 E;  1XNQ E;  4DR6 E;  5LL6 R;  1S16 A;  4DR1 E;  4DV7 E;  2UXD E;  3WU6 A;  4EMD A;  1N36 I;  2VF3 A;  4HYM A;  4DPT A;  4DR3 I;  4YHH E;  1XMO I;  2UU9 E;  3B8H A;  4DPY A;  4DPX A;  2UXB E;  3PYE A;  1PIE A;  3OTO I;  3QT7 A;  1B62 A;  5A2Q Q;  3ZM7 A;  5LMU I;  2HKE A;  4DV1 I;  2HFU A;  2HHH E;  4X65 E;  5IWA E;  1ZXN A;  4I3H A;  1Z0G A;  1FNM A;  1Z0E A;  3PYD A;  2E5L I;  2VQF I;  4UT4 A;  4JI4 I;  3J81 Q;  4X64 I;  4NXN I;  4DUZ I;  4DR7 I;  4DR3 E;  1XHK A;  1N34 I;  1XMO E;  3JAM Q;  1PKP A;  5LMN I;  1ZXM A;  3LPS A;  5L3J A;  3OTO E;  1IBM I;  1Z0T A;  3LTO A;  5LMU E;  4DV1 E;  4Z7C A;  5FLX C;  1ZM9 A;  3J7A M;  1DAR A;  1N0V C;  2E5L E; 
#chains in the Genus database with same CATH topology
 1HNW I;  2JEA B;  4LF9 I;  2R42 A;  2VQF E;  2NN6 F;  4JI0 E;  2O1V A;  4IZJ D;  4JG4 A;  4JI4 E;  5K36 C;  2JEA A;  4LF8 I;  2NN6 B;  3P3G A;  4X64 E;  4NXN E;  1WUU A;  3Q6M A;  4DPU A;  2AE8 A;  3K17 A;  2NN6 A;  2UXC I;  2JE6 B;  4DUZ E;  4DR7 E;  4FWH A;  2IES A;  3L7Z B;  1N34 E;  4X66 E;  3L7Z A;  2V34 A;  1RRE A;  2NN6 D;  5LMN E;  1HK7 A;  2VQE I;  2CZ9 A;  1IBM E;  2PNM A;  4JI1 I;  4ED4 A;  1QZR A;  1N32 I;  4QNK A;  4LF5 I;  2CVE A;  2WW4 A;  3ZZU A;  1KVK A;  3QT5 A;  3ZZT A;  4MYT A;  3J7A G;  3M85 D;  2C38 B;  2AJ4 A;  4JI6 I;  1HNW E;  4LF9 E;  1MX0 A;  2PO0 B;  1H7U A;  2C38 A;  4FW7 A;  3PS2 A;  4WUD A;  4LF8 E;  3K1J A;  3Q1Q A;  4R1F A;  4JI5 I;  4MU4 A;  5C0X C;  3T1H I;  1PVG A;  3CDI A;  3M7N G;  1KKH A;  5EL9 A;  5GME A;  3HKM A;  2C39 B;  1XNR I;  2UUC I;  1Z0W A;  2UUA E;  2BA1 D;  4JI3 I;  2C39 A;  2VQE E;  2R3V A;  4JI1 E;  1N32 E;  4LF5 E;  2A2D A;  4GKK I;  2GO4 A;  3D4J A;  2X36 A;  2PO2 B;  1HNZ I;  2IOP A;  2DEJ A;  2PO2 A;  5JEA F;  4JI6 E;  1Y6Z A;  3P3E A;  5ELW A;  3M6A A;  3CWV A;  4IZK B;  2O1T A;  2O1U A;  3V2U C;  4ISA A;  4FW5 A;  4IZK A;  4XTJ A;  2V2Q A;  4PRV A;  5GMD A;  1XMQ I;  3PRY A;  4JI5 E;  4OX9 I;  1U2R A;  3J80 Q;  1ZM2 A;  4LF6 I;  1K47 A;  3T1H E;  1N36 E;  4DUY I;  4JI7 I;  3GCM A;  2EFG A;  2NN6 E;  2F4V I;  1ZM4 A;  2HK3 A;  1UDO A;  1Z0B A;  1XNR E;  2BR2 A;  2UUC E;  3P06 A;  5DRP A;  4URL A;  1MG7 A;  4IFD F;  1VIS A;  4JI3 E;  1UDS A;  3LNU A;  4MU1 A;  2GQ0 A;  2Z5E A;  4OO1 F;  4IFD B;  4DR4 I;  4PU9 A;  1FJG I;  2ZBK B;  4GKK E;  4MYU A;  4DV5 I;  4IFD A;  4DV2 I;  4FW9 A;  4LCH A;  4FW4 A;  1R6M A;  4MDT A;  1NHI A;  4OO1 A;  1HNZ E;  1A6F A;  4PRX A;  1I94 I;  4LFB I;  5K36 F;  5IT9 Q;  4IFD D;  4DV4 I;  5K36 B;  2J65 A;  1NZ0 A;  2HKJ A;  4DU8 A;  1KTV A;  5K36 A;  4FN5 A;  2C37 A;  4MU3 A;  4LPF A;  1XMQ E;  4OX9 E;  3U1K A;  3HJC A;  1IBK I;  1OYS A;  4DUY E;  4JI7 E;  1Y4U A;  1S4E A;  3B78 A;  4HAC B;  4N3O A;  3V5R A;  1USU A;  5K36 D;  4FW6 A;  3M7N D;  2F4V E;  4OKG A;  1OJ4 A;  4HAC A;  2DEI A;  2E1R A;  5FLX Q;  4DV0 I;  4LCF A;  4B3S I;  4JI8 I;  3K85 A;  1RR9 A;  4DR4 E;  2Z5C B;  1FJG E;  2NN6 C;  2X7I A;  4DV5 E;  4DV2 E;  2Z5C A;  1Y60 A;  2NPF A;  3U1Y A;  2A2C A;  3ZKB A;  1I94 E;  4LFB E;  4OZE A;  4DR5 I;  4DV4 E;  1P42 A;  4B3M I;  4M1K A;  4B3T I;  4DPW A;  3F0N A;  4LFA I;  4JYA I;  2LJP A;  2OI2 A;  3GON A;  4HY1 A;  1IBK E;  2UXC E;  2CG9 A;  5A2Q C;  2ZIT A;  5DRQ A;  4KHP I;  4ZVI A;  2BA0 D;  4DV0 E;  4LCG A;  3B4T A;  1EA6 A;  4B3S E;  2BM0 A;  4JI8 E;  2GO3 A;  1HR0 I;  2BV3 A;  4LF7 I;  4WUC A;  2IER A;  3CDJ A;  1FWK A;  2V2Z A;  3QT6 A;  1Z5C A;  1H74 A;  2F1D A;  3J81 C;  2V2V A;  4AQY I;  4P7A A;  4IFD E;  3J80 C;  4DR5 E;  4OO1 E;  5DRO A;  4B3M E;  5JEA B;  4B3T E;  4HXZ A;  1NHJ A;  1E3P A;  1Z0V A;  2Z5B A;  4RPF A;  1B63 A;  4LF4 I;  4U3B A;  5JEA A;  3JAM C;  1HNX I;  4LFA E;  4JYA E;  4K0K I;  4B3R I;  1RHY A;  2CGE A;  2V8P A;  5K36 E;  3ZZ0 A;  1H7S A;  3B82 A;  5BR8 I;  2WP8 B;  5JEA D;  2BR2 B;  1FI4 A;  1VI7 A;  4U3D A;  4X62 I;  4KHP E;  4BA2 B;  2BA0 G;  2WP8 A;  4FWG A;  2UUB I;  4J3D A;  4JI0 I;  4BA2 A;  4LFC I;  4JI2 I;  2ZM6 I;  1KIJ A;  1IBL I;  2XEX A;  1HR0 E;  4LF7 E;  5IT9 C;  4USK A;  4DV6 I;  4GQU A;  4OO1 B;  4JV5 I;  4NXM I;  4FW3 A;  3GLL A;  1H72 C;  4AQY E;  1Y5Y A;  2JEB B;  4X66 I;  4GKJ I;  3HUL A;  2HFS A;  1UEK A;  2J7K A;  4DU7 A;  2C37 B;  2JEB A;  3QT8 A;  4OO1 D;  4LF4 E;  3T1Y I;  1HNX E;  4K0K E;  4B3R E;  4UTG A;  1MU5 A;  4IFD C;  2PNL A;  4AIM A;  3P3C A;  4USM A;  4LF6 E;  1BKN A;  1YHC A;  2PNZ B;  1N33 I;  2IOQ A;  2HK2 A;  4FWD A;  5BR8 E;  2PNZ A;  4P52 A;  4KQV A;  2BM1 A;  3P76 A;  4X62 E;  3PS1 A;  4WUB A;  4AID A;  4YY3 I;  1FKA E;  1EI1 A;  1J5E I;  4DR2 I;  2UUB E;  1D6T A;  1Z0C A;  4DV3 I;  1XNQ I;  1H73 A;  4DR6 I;  5EKW A;  4LFC E;  4JI2 E;  2ZM6 E;  4DR1 I;  1IBL E;  3H1C A;  4QNJ A;  4IS9 A;  4DV7 I;  1OYP A;  5DRR A;  4DV6 E;  2UXD I;  3PYG A;  2GS8 A;  1N0U A;  3GME A;  4NXM E;  1ZM3 A;  4JV5 E;  1Z5B A;  4DXL A;  3ZKD A;  2JE6 A;  4YHH I;  1FWL A;  4MU0 A;  4GKJ E;  2UU9 I;  3PYF A;  1Z5A A;  2UXB I;  3UHM A;  3WU4 A;  2UUA I;  4AM3 A;  2WNR B;  5C0X F;  3T1Y E;  2VES A;  3H4L A;  5C0X B;  2WNR A;  2HHH I;  5JEA E;  4X65 I;  5IWA I;  1N33 E;  2Q2E B;  1E3H A;  5C0X A;  3WU5 A;  1YH8 A;  1XXE A;  4YY3 E;  1ELO A;  3DD6 A;  1NHH A;  1J5E E;  4DR2 E;  4Z7Y A;  1Z59 A;  3WU3 A;  5C0X D;  4DV3 E;  1XNQ E;  4DR6 E;  5LL6 R;  1S16 A;  4DR1 E;  2JT2 A;  5DNX A;  2PO0 A;  4DV7 E;  2UXD E;  2O3Z A;  3WU6 A;  3PS3 A;  4EMD A;  1N36 I;  2VF3 A;  4HYM A;  4DPT A;  4DR3 I;  4YHH E;  1XMO I;  2Z5B B;  2UU9 E;  3B8H A;  4DPY A;  4DPX A;  2UXB E;  3PYE A;  1PIE A;  3OTO I;  3QT7 A;  1B62 A;  5A2Q Q;  3ZM7 A;  5LMU I;  1USV A;  2HKE A;  4DV1 I;  2HFU A;  2HHH E;  4X65 E;  5IWA E;  1Y4S A;  1ZXN A;  4I3H A;  1Z0G A;  1FNM A;  4BA1 B;  3M85 G;  1UDQ A;  1Z0E A;  3PYD A;  3NZK A;  2E5L I;  4BA1 A;  2VQF I;  1R6L A;  4UT4 A;  4JI4 I;  5JEA C;  4NBQ A;  4X64 I;  3J81 Q;  4NXN I;  4DUZ I;  4DR7 I;  2O1W A;  1UDN A;  4DR3 E;  1XHK A;  4LOM A;  1N34 I;  1XMO E;  3JAM Q;  3KRN A;  3Q6N A;  2BA1 G;  1PKP A;  5LMN I;  1ZXM A;  3LPS A;  4MQY A;  5FWK A;  5L3J A;  3OTO E;  1IBM I;  1Z0T A;  3LTO A;  5LMU E;  4DV1 E;  4Z7C A;  5DNL A;  5FLX C;  4IZJ B;  2PO1 B;  1ZM9 A;  4OO1 C;  3J7A M;  1DAR A;  4IZJ A;  1N0V C;  2PO1 A;  1OYR A;  5C0X E;  2E5L E; 
#chains in the Genus database with same CATH homology
 1HNW I;  4LF9 I;  2R42 A;  2VQF E;  4JI0 E;  2O1V A;  4IZJ D;  4JG4 A;  4JI4 E;  4LF8 I;  4X64 E;  4NXN E;  1WUU A;  3Q6M A;  4DPU A;  3K17 A;  2UXC I;  4DUZ E;  4DR7 E;  4FWH A;  1N34 E;  4X66 E;  2V34 A;  1RRE A;  5LMN E;  1HK7 A;  2VQE I;  2CZ9 A;  1IBM E;  2PNM A;  4JI1 I;  4ED4 A;  1QZR A;  1N32 I;  4LF5 I;  2WW4 A;  3ZZU A;  1KVK A;  3QT5 A;  3ZZT A;  4MYT A;  3J7A G;  2AJ4 A;  4JI6 I;  1HNW E;  4LF9 E;  1MX0 A;  1H7U A;  4WUD A;  4LF8 E;  3K1J A;  3Q1Q A;  4R1F A;  4JI5 I;  3T1H I;  1PVG A;  1KKH A;  5GME A;  1XNR I;  2UUC I;  1Z0W A;  2UUA E;  4JI3 I;  2VQE E;  2R3V A;  4JI1 E;  1N32 E;  4LF5 E;  2A2D A;  4GKK I;  3D4J A;  2X36 A;  1HNZ I;  2IOP A;  2DEJ A;  4JI6 E;  1Y6Z A;  3M6A A;  3CWV A;  4IZK B;  2O1T A;  2O1U A;  3V2U C;  4IZK A;  2V2Q A;  4PRV A;  4XTJ A;  5GMD A;  1XMQ I;  3PRY A;  4JI5 E;  4OX9 I;  1U2R A;  3J80 Q;  1ZM2 A;  4LF6 I;  1K47 A;  3T1H E;  1N36 E;  4DUY I;  4JI7 I;  2EFG A;  2F4V I;  1ZM4 A;  2HK3 A;  1Z0B A;  1XNR E;  2UUC E;  3P06 A;  4URL A;  1MG7 A;  1VIS A;  4JI3 E;  3LNU A;  2GQ0 A;  2Z5E A;  4DR4 I;  4PU9 A;  1FJG I;  2ZBK B;  4GKK E;  4MYU A;  4DV5 I;  4DV2 I;  4FW9 A;  1NHI A;  1HNZ E;  1A6F A;  4PRX A;  1I94 I;  4LFB I;  5IT9 Q;  4DV4 I;  1NZ0 A;  2HKJ A;  4DU8 A;  1KTV A;  4FN5 A;  1XMQ E;  4OX9 E;  3HJC A;  1IBK I;  4DUY E;  4JI7 E;  1Y4U A;  1S4E A;  3B78 A;  4HAC B;  4N3O A;  3V5R A;  1USU A;  2F4V E;  1OJ4 A;  4HAC A;  2DEI A;  2E1R A;  5FLX Q;  4DV0 I;  4B3S I;  4JI8 I;  3K85 A;  1RR9 A;  4DR4 E;  2Z5C B;  1FJG E;  2X7I A;  4DV5 E;  4DV2 E;  2Z5C A;  2NPF A;  2A2C A;  3ZKB A;  1I94 E;  4LFB E;  4DR5 I;  4DV4 E;  4B3M I;  4M1K A;  4B3T I;  4DPW A;  3F0N A;  4LFA I;  4JYA I;  2LJP A;  2OI2 A;  3GON A;  4HY1 A;  1IBK E;  2UXC E;  2CG9 A;  5A2Q C;  2ZIT A;  4KHP I;  4ZVI A;  4DV0 E;  1EA6 A;  4B3S E;  2BM0 A;  4JI8 E;  1HR0 I;  2BV3 A;  4LF7 I;  4WUC A;  1FWK A;  2V2Z A;  3QT6 A;  1Z5C A;  1H74 A;  3J81 C;  2V2V A;  4AQY I;  4P7A A;  3J80 C;  4DR5 E;  4B3M E;  4B3T E;  4HXZ A;  1NHJ A;  1Z0V A;  2Z5B A;  4RPF A;  1B63 A;  4LF4 I;  4LFA E;  3JAM C;  1HNX I;  4K0K I;  4JYA E;  4B3R I;  2CGE A;  2V8P A;  3ZZ0 A;  1H7S A;  3B82 A;  5BR8 I;  1FI4 A;  4X62 I;  4KHP E;  4FWG A;  2UUB I;  4JI0 I;  4LFC I;  4JI2 I;  2ZM6 I;  1KIJ A;  1IBL I;  2XEX A;  1HR0 E;  4LF7 E;  5IT9 C;  4USK A;  4DV6 I;  4JV5 I;  4NXM I;  1H72 C;  4AQY E;  4X66 I;  4GKJ I;  3HUL A;  2HFS A;  1UEK A;  2J7K A;  4DU7 A;  3QT8 A;  4LF4 E;  3T1Y I;  1HNX E;  4K0K E;  4B3R E;  4UTG A;  1MU5 A;  2PNL A;  4USM A;  4LF6 E;  1BKN A;  1N33 I;  2IOQ A;  2HK2 A;  4FWD A;  5BR8 E;  4P52 A;  4KQV A;  2BM1 A;  4X62 E;  4WUB A;  4YY3 I;  1FKA E;  1EI1 A;  1J5E I;  4DR2 I;  2UUB E;  1D6T A;  1Z0C A;  4DV3 I;  1XNQ I;  1H73 A;  4DR6 I;  4LFC E;  4JI2 E;  2ZM6 E;  4DR1 I;  1IBL E;  4DV7 I;  4DV6 E;  2UXD I;  3PYG A;  2GS8 A;  1N0U A;  4NXM E;  4JV5 E;  1ZM3 A;  1Z5B A;  4DXL A;  3ZKD A;  4YHH I;  1FWL A;  4GKJ E;  2UU9 I;  3PYF A;  1Z5A A;  2UXB I;  3WU4 A;  2UUA I;  3T1Y E;  3H4L A;  2HHH I;  4X65 I;  5IWA I;  1N33 E;  2Q2E B;  3WU5 A;  4YY3 E;  1ELO A;  1NHH A;  1J5E E;  4DR2 E;  4Z7Y A;  1Z59 A;  3WU3 A;  4DV3 E;  1XNQ E;  4DR6 E;  5LL6 R;  1S16 A;  4DR1 E;  4DV7 E;  2UXD E;  3WU6 A;  4EMD A;  1N36 I;  2VF3 A;  4HYM A;  4DPT A;  4DR3 I;  4YHH E;  1XMO I;  2Z5B B;  2UU9 E;  3B8H A;  4DPY A;  4DPX A;  2UXB E;  3PYE A;  1PIE A;  3OTO I;  3QT7 A;  1B62 A;  5A2Q Q;  3ZM7 A;  5LMU I;  1USV A;  2HKE A;  4DV1 I;  2HFU A;  2HHH E;  4X65 E;  5IWA E;  1Y4S A;  1ZXN A;  4I3H A;  1Z0G A;  1FNM A;  1Z0E A;  3PYD A;  2E5L I;  2VQF I;  4UT4 A;  4JI4 I;  3J81 Q;  4X64 I;  4NXN I;  4DUZ I;  4DR7 I;  2O1W A;  4DR3 E;  1XHK A;  1N34 I;  1XMO E;  3JAM Q;  3Q6N A;  1PKP A;  5LMN I;  1ZXM A;  3LPS A;  5FWK A;  5L3J A;  3OTO E;  1IBM I;  1Z0T A;  3LTO A;  5LMU E;  4DV1 E;  4Z7C A;  5FLX C;  4IZJ B;  1ZM9 A;  3J7A M;  1DAR A;  4IZJ A;  1N0V C;  2E5L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...