4DV6I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv6I00
1H74A 2HHHI 4ED4A 1WUUA 1DARA 4LF4I 1I94E 1NHHA 2OI2A 1PKPA 4LFAI 4GKKI 2UXDI 4JI6E 2HKEA 4NXNE 1ZXMA 4B3ME 3T1HE 1N33E 4WUCA 4KQVA 4PRVA 1IBME 1FNMA 4JV5E 1KIJA 1Z0BA 2VQEI 3J7AM 1KTVA 4LF5E 4YHHI 2UXCE 5GMEA 4OX9I 4LF7I 5LMUI 4DV7I 4UT4A 5BR8E 2UUAE 1Z0TA 4HYMA 1IBLI 3PYDA 3T1YI 4UTGA 3ZKBA 4LF8E 4DV6E 3PYGA 2X36A 4B3SI 4KHPE 2GS8A 4X62E 4DR6I 5A2QQ 4DR2E 2ZITA 3QT5A 4DU7A 2X7IA 4LF9E 3JAMQ 4K0KE 1HR0I 1NHJA 1J5EE 1XMQI 4RPFA 5FLXQ 4M1KA 4LF8I 2F4VE 1NHIA 5A2QC 5IWAE 1MX0A 2V2ZA 1N0UA 4FWHA 1Z0VA 2UUCI 4ZVIA 3JAMC 4DR5I 1ZXNA 1N36E 4B3TI 5FLXC 1Z5BA 1N34E 4GKJI 1KVKA 2AJ4A 3K17A 2HKJA 4DV2E 2UU9E 3V2UC 4R1FA 1RR9A 2HK3A 4B3RE 3PYFA 1N36I 4AQYE 1A6FA 3ZM7A 1IBKE 4YY3E 1FKAE 4FWDA 4JI8I 2ZM6E 1S16A 2DEJA 1NZ0A 4LF6I 4DV5E 4JI4E 4X66E 1XMOE 2UUBI 4NXMI 4DUZE 4X65I 4DV3I 1BKNA 4JI3I 4JI7E 1HNXE 2VQFI 1N32E 1ELOA 2Q2EB 4I3HA 2XEXA 4DPYA 4DR1I 3B78A 4DUYE 2A2DA 5LMNE 4WUDA 3OTOE 2BM1A 1MU5A 1HNXI 2V34A 2NPFA 3QT8A 4JI5E 1I94I 4WUBA 3QT7A 1B62A 2BV3A 4JI6I 3LTOA 4NXNI 2J7KA 1B63A 3T1HI 4P7AA 4B3MI 1N33I 1FWLA 1H7SA 1IBMI 4JI0E 4JV5I 3HULA 4HXZA 4JYAE 3QT6A 4LFBE 1Z0WA 4LF5I 1HNWE 4DR4E 2UXCI 5BR8I 2UUAI 4Z7YA 1HNZE 2WW4A 4FN5A 2UXBE 3F0NA 4DV6I 4DR7E 4KHPI 4JG4A 4X62I 3M6AA 4DR2I 1PVGA 4URLA 1FI4A 4LF9I 4LFCE 3WU3A 3B82A 4K0KI 2R3VA 4DV0E 4USKA 5GMDA 4FW9A 1J5EI 4DPWA 2E5LE 2HFUA 2F4VI 3WU4A 1QZRA 5IWAI 1U2RA 4X64E 4DV1E 1ZM4A 1Z59A 5LL6R 4JI1E 3ZZUA 1N34I 4PRXA 3Q1QA 3H4LA 1ZM9A 4HACA 1FJGE 4JI2E 4DV4E 1KKHA 4X64I 4DV2I 2UU9I 4MYUA 1XNQE 4FWGA 3LNUA 4HACB 3B8HA 4B3RI 2HHHE 4DU8A 4AQYI 4EMDA 4DR3E 1IBKI 1H72C 1XNRE 4LF4E 4YY3I 2ZM6I 4LFAE 4DV5I 4GKKE 4JI4I 2UXDE 4X66I 1VISA 3J81Q 4DPXA 1XMOI 4DUZI 4DR3I 4JI7I 1XNRI 1Z5AA 3LPSA 2VQEE 1H73A 1N32I 4HY1A 2V8PA 3J81C 3ZZTA 4P52A 4YHHE 4OX9E 4LF7E 5LMUE 4DV7E 2V2VA 4DUYI 2R42A 1IBLE 5LMNI 3T1YE 1EI1A 3OTOI 1MG7A 1Z0CA 4B3SE 4XTJA 4DPTA 4DR6E 4JI5I 2V2QA 1Z0GA 1D6TA 1H7UA 3K1JA 1HR0E 1FWKA 3WU5A 1XMQE 1UEKA 2EFGA 2ZBKB 4PU9A 4JI0I 2DEIA 1RREA 4JYAI 3J7AG 3ZKDA 4LFBI 2UUCE 1OJ4A 1HNWI 4DR4I 4DR5E 5IT9Q 4B3TE 2LJPA 3CWVA 3J80Q 4GKJE 1HNZI 2E1RA 2CZ9A 5L3JA 2UXBI 3PYEA 2HK2A 4DR7I 5IT9C 1ZM3A 2HFSA 4DPUA 1PIEA 3J80C 4LFCI 4MYTA 1S4EA 4JI8E 4DV0I 4LF6E 2BM0A 2E5LI 2A2CA 3WU6A 1EA6A 4DV1I 2UUBE 4NXME 3V5RA 4X65E 4DV3E 1Z0EA 4USMA 4JI3E 4JI1I 4DXLA 2VQFE 1K47A 2VF3A 3ZZ0A 3D4JA 1FJGI 1N0VC 4JI2I 4DV4I 1ZM2A 4DR1E 1XHKA 1Z5CA 4Z7CA 1XNQI 3GONA
chains in the Genus database with same CATH superfamily
1H74A 2HHHI 4ED4A 1WUUA 1DARA 4LF4I 1I94E 5JEAC 1NHHA 2C37B 2OI2A 1PKPA 3Q6MA 4LFAI 4GKKI 2UXDI 2PO1B 3HJCA 4JI6E 2HKEA 4NXNE 1ZXMA 3T1HE 4B3ME 1Y5YA 1N33E 4WUCA 4KQVA 4PRVA 1IBME 1FNMA 2BA1D 2PNLA 4JV5E 1KIJA 1Z0BA 2VQEI 2JE6A 2JEAA 1Y4UA 2NN6F 2BA0D 2J65A 2BA1G 3J7AM 1KTVA 2O1UA 4LF5E 1HK7A 3M7ND 4YHHI 4MU4A 2UXCE 2BA0G 5GMEA 2JE6B 4OX9I 1E3HA 4LF7I 5LMUI 4LCHA 2JEAB 1RHYA 4DV7I 4UT4A 3M7NG 5BR8E 1UDQA 4U3BA 2UUAE 2BR2A 1Z0TA 4HYMA 1IBLI 2NN6A 3PYDA 3T1YI 4UTGA 3ZKBA 3K85A 4LF8E 4DV6E 3PYGA 2X36A 5C0XF 4B3SI 2BR2B 4KHPE 2IOQA 2GS8A 4X62E 4DR6I 5A2QQ 4DR2E 2NN6B 2WP8A 2ZITA 3QT5A 4DU7A 2X7IA 1YHCA 4LF9E 3JAMQ 4K0KE 1HR0I 2WP8B 5C0XA 1NHJA 1XMQI 1Y6ZA 3PS1A 1J5EE 4RPFA 5FLXQ 1R6LA 2CGEA 4M1KA 1NHIA 4LF8I 2F4VE 5A2QC 5IWAE 2PNMA 1Y60A 1MX0A 2V2ZA 1E3PA 1N0UA 4FWHA 1Z0VA 2UUCI 4AIDA 4ZVIA 5FWKA 1UDOA 3JAMC 4LCGA 4DR5I 1ZXNA 1N36E 5EL9A 2C38A 4B3TI 5K36D 5FLXC 1Z5BA 2Z5CA 1N34E 4GKJI 1KVKA 2AJ4A 2PO2A 4IFDF 3K17A 2C38B 2HKJA 2O3ZA 2Z5CB 4DV2E 4QNJA 4OZEA 4FW7A 2UU9E 4IZJD 3V2UC 4R1FA 1RR9A 2HK3A 2PO2B 2IERA 4B3RE 3PYFA 1N36I 4AQYE 1A6FA 3ZM7A 1IBKE 3UHMA 4IFDA 4YY3E 1FKAE 4OO1E 4FWDA 4JI8I 2ZM6E 1S16A 4QNKA 2DEJA 1NZ0A 4LF6I 4DV5E 3P3EA 3PS3A 4MDTA 4JI4E 4X66E 1OYPA 1XMOE 2UUBI 4NXMI 4DUZE 1YH8A 4X65I 4DV3I 4NBQA 4OO1C 2JT2A 1BKNA 2C37A 4JI3I 4JI7E 3HKMA 1HNXE 2VQFI 1N32E 1ELOA 2PO1A 2Q2EB 5JEAB 4I3HA 2XEXA 4DPYA 4DR1I 3B78A 4DUYE 2C39A 4N3OA 2A2DA 5LMNE 3CDJA 1OYRA 3P3GA 4WUDA 3OTOE 2NN6D 2BM1A 1MU5A 1HNXI 2C39B 2V34A 2NPFA 4MQYA 3QT8A 4JI5E 1I94I 4WUBA 2VESA 3QT7A 2PNZA 5DRQA 1B62A 4OKGA 4BA1A 2BV3A 4JI6I 3LTOA 4NXNI 1R6MA 2J7KA 1B63A 2O1WA 3T1HI 4P7AA 4B3MI 1N33I 1FWLA 2PNZB 1H7SA 5C0XD 1IBMI 4BA1B 4JI0E 4JV5I 3HULA 4HXZA 4JYAE 3QT6A 4LFBE 1Z0WA 4LF5I 1HNWE 4DR4E 2UXCI 3Q6NA 5DROA 1USUA 5BR8I 2UUAI 4IS9A 4Z7YA 1HNZE 1UDNA 2WW4A 2CVEA 4FN5A 2UXBE 3KRNA 3F0NA 4DV6I 4DR7E 2CG9A 4KHPI 4JG4A 4X62I 3M6AA 4DR2I 1PVGA 4URLA 1FI4A 4LF9I 4LFCE 5C0XE 3WU3A 3B82A 4K0KI 2R3VA 4DV0E 4USKA 4IFDD 5GMDA 4FW9A 1J5EI 4DPWA 2E5LE 2GO4A 2HFUA 2F4VI 3B4TA 3WU4A 1QZRA 5IWAI 1U2RA 4FW3A 4X64E 4DV1E 4U3DA 5C0XC 4FW5A 1ZM4A 4OO1F 1Z59A 5LL6R 4LOMA 4BA2A 4JI1E 3ZZUA 5JEAF 1N34I 4AIMA 4PRXA 3Q1QA 3H4LA 1ZM9A 4MU3A 4HACA 4OO1A 2PO0A 1FJGE 4JI2E 4BA2B 4DV4E 2O1VA 3GMEA 1KKHA 4X64I 4DV2I 2UU9I 4MYUA 5K36E 1XNQE 4AM3A 4FWGA 3LNUA 3L7ZA 4HACB 3B8HA 2PO0B 4OO1B 4B3RI 4IFDE 2Z5EA 5JEAA 2HHHE 4DU8A 4AQYI 4EMDA 4DR3E 4GQUA 1IBKI 1H72C 1XNRE 5DNLA 4LF4E 4YY3I 3L7ZB 2ZM6I 3GLLA 5DRPA 1USVA 2Z5BA 3DD6A 5K36C 4LFAE 4DV5I 4GKKE 3P76A 2WNRA 4IFDC 4JI4I 2UXDE 4X66I 1VISA 3J81Q 4DPXA 2GQ0A 3M85D 1XMOI 4DUZI 2Z5BB 2WNRB 4IZJB 4DR3I 5EKWA 3M85G 4IZKA 4JI7I 1XNRI 1Z5AA 3LPSA 2VQEE 1H73A 2IOPA 2GO3A 2O1TA 4LCFA 1N32I 3CDIA 4HY1A 2V8PA 3H1CA 3J81C 3ZZTA 2F1DA 4P52A 4IZKB 4YHHE 4OX9E 4LF7E 5LMUE 4DV7E 5ELWA 2V2VA 4DUYI 2R42A 1IBLE 5LMNI 2JEBA 3GCMA 3T1YE 1EI1A 3OTOI 1MG7A 1Z0CA 4B3SE 4XTJA 4DPTA 4MU1A 4DR6E 4JI5I 2JEBB 3PRYA 2V2QA 1Z0GA 1D6TA 1H7UA 3K1JA 3P3CA 2NN6E 1HR0E 1FWKA 5DNXA 3WU5A 1XMQE 1UEKA 2EFGA 2ZBKB 4PU9A 5DRRA 4JI0I 2DEIA 1RREA 4FW4A 4JYAI 3J7AG 3P06A 3ZKDA 4LFBI 2UUCE 1OJ4A 2NN6C 1VI7A 1HNWI 4DR4I 4DR5E 5IT9Q 4B3TE 2LJPA 3CWVA 3J80Q 4GKJE 1HNZI 2E1RA 4J3DA 3U1KA 2CZ9A 3NZKA 5L3JA 2UXBI 3PYEA 2HK2A 4OO1D 4DR7I 5C0XB 5IT9C 1ZM3A 1P42A 2HFSA 4LPFA 1PIEA 4DPUA 3J80C 4LFCI 5JEAD 4MYTA 1S4EA 4JI8E 4DV0I 5K36F 1OYSA 4FW6A 4LF6E 2BM0A 2IESA 2E5LI 3PS2A 2AE8A 2A2CA 3WU6A 1EA6A 4DV1I 2UUBE 4NXME 3V5RA 4X65E 4DV3E 4ISAA 1Z0EA 5K36A 4USMA 4JI3E 1UDSA 4MU0A 1Y4SA 4JI1I 4DXLA 2VQFE 3U1YA 1K47A 5K36B 2VF3A 3ZZ0A 3D4JA 1FJGI 4IFDB 1N0VC 4IZJA 4DV4I 4JI2I 1ZM2A 4DR1E 1XHKA 1Z5CA 5JEAE 4Z7CA 1XXEA 1XNQI 3GONA
chains in the Genus database with same CATH topology
1H74A 2HHHI 4ED4A 1WUUA 1DARA 4LF4I 1I94E 1NHHA 2OI2A 1PKPA 3Q6MA 4LFAI 4GKKI 2UXDI 3HJCA 4JI6E 2HKEA 4NXNE 1ZXMA 3T1HE 4B3ME 1N33E 4WUCA 4KQVA 4PRVA 1IBME 1FNMA 2PNLA 4JV5E 1KIJA 1Z0BA 2VQEI 1Y4UA 3J7AM 1KTVA 2O1UA 4LF5E 1HK7A 4YHHI 2UXCE 5GMEA 4OX9I 4LF7I 5LMUI 4DV7I 4UT4A 5BR8E 2UUAE 1Z0TA 4HYMA 1IBLI 3PYDA 3T1YI 4UTGA 3ZKBA 3K85A 4LF8E 4DV6E 3PYGA 2X36A 4B3SI 4KHPE 2IOQA 2GS8A 4X62E 4DR6I 5A2QQ 4DR2E 2ZITA 3QT5A 4DU7A 2X7IA 4LF9E 3JAMQ 4K0KE 1HR0I 1NHJA 1J5EE 1XMQI 1Y6ZA 4RPFA 5FLXQ 4M1KA 2CGEA 4LF8I 1NHIA 2F4VE 5A2QC 5IWAE 2PNMA 1MX0A 2V2ZA 1N0UA 4FWHA 1Z0VA 2UUCI 4ZVIA 5FWKA 3JAMC 4DR5I 1ZXNA 1N36E 4B3TI 5FLXC 1Z5BA 2Z5CA 1N34E 4GKJI 1KVKA 2AJ4A 3K17A 2HKJA 2Z5CB 4DV2E 2UU9E 4IZJD 3V2UC 4R1FA 1RR9A 2HK3A 4B3RE 3PYFA 1N36I 4AQYE 1A6FA 3ZM7A 1IBKE 4YY3E 1FKAE 4FWDA 4JI8I 2ZM6E 1S16A 2DEJA 1NZ0A 4LF6I 4DV5E 4JI4E 4X66E 1XMOE 2UUBI 4NXMI 4DUZE 4X65I 4DV3I 1BKNA 4JI3I 4JI7E 1HNXE 2VQFI 1N32E 1ELOA 2Q2EB 4I3HA 2XEXA 4DPYA 4DR1I 3B78A 4DUYE 4N3OA 2A2DA 5LMNE 4WUDA 3OTOE 2BM1A 1MU5A 1HNXI 2V34A 2NPFA 3QT8A 4JI5E 1I94I 4WUBA 3QT7A 1B62A 2BV3A 4JI6I 3LTOA 4NXNI 2J7KA 1B63A 2O1WA 3T1HI 4P7AA 4B3MI 1N33I 1FWLA 1H7SA 1IBMI 4JI0E 4JV5I 3HULA 4HXZA 4JYAE 3QT6A 4LFBE 1Z0WA 4LF5I 1HNWE 4DR4E 2UXCI 3Q6NA 1USUA 5BR8I 2UUAI 4Z7YA 1HNZE 2WW4A 4FN5A 2UXBE 3F0NA 4DV6I 4DR7E 2CG9A 4KHPI 4JG4A 4X62I 3M6AA 4DR2I 1PVGA 4URLA 1FI4A 4LF9I 4LFCE 3WU3A 3B82A 4K0KI 2R3VA 4DV0E 4USKA 5GMDA 4FW9A 1J5EI 4DPWA 2E5LE 2HFUA 2F4VI 3WU4A 1QZRA 5IWAI 1U2RA 4X64E 4DV1E 1ZM4A 1Z59A 5LL6R 4JI1E 3ZZUA 1N34I 4PRXA 3Q1QA 3H4LA 1ZM9A 4HACA 1FJGE 4JI2E 4DV4E 2O1VA 1KKHA 4X64I 4DV2I 2UU9I 4MYUA 1XNQE 4FWGA 3LNUA 4HACB 3B8HA 4B3RI 2Z5EA 2HHHE 4DU8A 4AQYI 4EMDA 4DR3E 1IBKI 1H72C 1XNRE 4LF4E 4YY3I 2ZM6I 1USVA 2Z5BA 4LFAE 4DV5I 4GKKE 4JI4I 2UXDE 4X66I 3J81Q 1VISA 4DPXA 2GQ0A 1XMOI 4DUZI 2Z5BB 4IZJB 4DR3I 4IZKA 4JI7I 1XNRI 1Z5AA 3LPSA 2VQEE 1H73A 2IOPA 2O1TA 1N32I 4HY1A 2V8PA 3J81C 3ZZTA 4P52A 4YHHE 4IZKB 4OX9E 4LF7E 5LMUE 4DV7E 2V2VA 4DUYI 2R42A 1IBLE 5LMNI 3T1YE 1EI1A 3OTOI 1MG7A 1Z0CA 4B3SE 4XTJA 4DPTA 4DR6E 4JI5I 3PRYA 2V2QA 1Z0GA 1D6TA 1H7UA 3K1JA 1HR0E 1FWKA 3WU5A 1XMQE 1UEKA 2EFGA 2ZBKB 4PU9A 4JI0I 2DEIA 1RREA 4JYAI 3J7AG 3P06A 3ZKDA 4LFBI 2UUCE 1OJ4A 1HNWI 4DR4I 4DR5E 5IT9Q 4B3TE 2LJPA 3CWVA 3J80Q 4GKJE 1HNZI 2E1RA 2CZ9A 5L3JA 2UXBI 3PYEA 2HK2A 4DR7I 5IT9C 1ZM3A 2HFSA 4DPUA 1PIEA 3J80C 4LFCI 4MYTA 1S4EA 4JI8E 4DV0I 4LF6E 2BM0A 2E5LI 2A2CA 3WU6A 1EA6A 4DV1I 2UUBE 4NXME 3V5RA 4X65E 4DV3E 1Z0EA 4USMA 4JI3E 1Y4SA 4JI1I 4DXLA 2VQFE 1K47A 2VF3A 3ZZ0A 3D4JA 1FJGI 1N0VC 4IZJA 4DV4I 4JI2I 1ZM2A 4DR1E 1XHKA 1Z5CA 4Z7CA 1XNQI 3GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H74 A;  2HHH I;  4ED4 A;  1WUU A;  1DAR A;  4LF4 I;  1I94 E;  1NHH A;  2OI2 A;  1PKP A;  4LFA I;  4GKK I;  2UXD I;  4JI6 E;  2HKE A;  4NXN E;  1ZXM A;  4B3M E;  3T1H E;  1N33 E;  4WUC A;  4KQV A;  4PRV A;  1IBM E;  1FNM A;  4JV5 E;  1KIJ A;  1Z0B A;  2VQE I;  3J7A M;  1KTV A;  4LF5 E;  4YHH I;  2UXC E;  5GME A;  4OX9 I;  4LF7 I;  5LMU I;  4DV7 I;  4UT4 A;  5BR8 E;  2UUA E;  1Z0T A;  4HYM A;  1IBL I;  3PYD A;  3T1Y I;  4UTG A;  3ZKB A;  4LF8 E;  4DV6 E;  3PYG A;  2X36 A;  4B3S I;  4KHP E;  2GS8 A;  4X62 E;  4DR6 I;  5A2Q Q;  4DR2 E;  2ZIT A;  3QT5 A;  4DU7 A;  2X7I A;  4LF9 E;  3JAM Q;  4K0K E;  1HR0 I;  1NHJ A;  1J5E E;  1XMQ I;  4RPF A;  5FLX Q;  4M1K A;  4LF8 I;  2F4V E;  1NHI A;  5A2Q C;  5IWA E;  1MX0 A;  2V2Z A;  1N0U A;  4FWH A;  1Z0V A;  2UUC I;  4ZVI A;  3JAM C;  4DR5 I;  1ZXN A;  1N36 E;  4B3T I;  5FLX C;  1Z5B A;  1N34 E;  4GKJ I;  1KVK A;  2AJ4 A;  3K17 A;  2HKJ A;  4DV2 E;  2UU9 E;  3V2U C;  4R1F A;  1RR9 A;  2HK3 A;  4B3R E;  3PYF A;  1N36 I;  4AQY E;  1A6F A;  3ZM7 A;  1IBK E;  4YY3 E;  1FKA E;  4FWD A;  4JI8 I;  2ZM6 E;  1S16 A;  2DEJ A;  1NZ0 A;  4LF6 I;  4DV5 E;  4JI4 E;  4X66 E;  1XMO E;  2UUB I;  4NXM I;  4DUZ E;  4X65 I;  4DV3 I;  1BKN A;  4JI3 I;  4JI7 E;  1HNX E;  2VQF I;  1N32 E;  1ELO A;  2Q2E B;  4I3H A;  2XEX A;  4DPY A;  4DR1 I;  3B78 A;  4DUY E;  2A2D A;  5LMN E;  4WUD A;  3OTO E;  2BM1 A;  1MU5 A;  1HNX I;  2V34 A;  2NPF A;  3QT8 A;  4JI5 E;  1I94 I;  4WUB A;  3QT7 A;  1B62 A;  2BV3 A;  4JI6 I;  3LTO A;  4NXN I;  2J7K A;  1B63 A;  3T1H I;  4P7A A;  4B3M I;  1N33 I;  1FWL A;  1H7S A;  1IBM I;  4JI0 E;  4JV5 I;  3HUL A;  4HXZ A;  4JYA E;  3QT6 A;  4LFB E;  1Z0W A;  4LF5 I;  1HNW E;  4DR4 E;  2UXC I;  5BR8 I;  2UUA I;  4Z7Y A;  1HNZ E;  2WW4 A;  4FN5 A;  2UXB E;  3F0N A;  4DV6 I;  4DR7 E;  4KHP I;  4JG4 A;  4X62 I;  3M6A A;  4DR2 I;  1PVG A;  4URL A;  1FI4 A;  4LF9 I;  4LFC E;  3WU3 A;  3B82 A;  4K0K I;  2R3V A;  4DV0 E;  4USK A;  5GMD A;  4FW9 A;  1J5E I;  4DPW A;  2E5L E;  2HFU A;  2F4V I;  3WU4 A;  1QZR A;  5IWA I;  1U2R A;  4X64 E;  4DV1 E;  1ZM4 A;  1Z59 A;  5LL6 R;  4JI1 E;  3ZZU A;  1N34 I;  4PRX A;  3Q1Q A;  3H4L A;  1ZM9 A;  4HAC A;  1FJG E;  4JI2 E;  4DV4 E;  1KKH A;  4X64 I;  4DV2 I;  2UU9 I;  4MYU A;  1XNQ E;  4FWG A;  3LNU A;  4HAC B;  3B8H A;  4B3R I;  2HHH E;  4DU8 A;  4AQY I;  4EMD A;  4DR3 E;  1IBK I;  1H72 C;  1XNR E;  4LF4 E;  4YY3 I;  2ZM6 I;  4LFA E;  4DV5 I;  4GKK E;  4JI4 I;  2UXD E;  4X66 I;  1VIS A;  3J81 Q;  4DPX A;  1XMO I;  4DUZ I;  4DR3 I;  4JI7 I;  1XNR I;  1Z5A A;  3LPS A;  2VQE E;  1H73 A;  1N32 I;  4HY1 A;  2V8P A;  3J81 C;  3ZZT A;  4P52 A;  4YHH E;  4OX9 E;  4LF7 E;  5LMU E;  4DV7 E;  2V2V A;  4DUY I;  2R42 A;  1IBL E;  5LMN I;  3T1Y E;  1EI1 A;  3OTO I;  1MG7 A;  1Z0C A;  4B3S E;  4XTJ A;  4DPT A;  4DR6 E;  4JI5 I;  2V2Q A;  1Z0G A;  1D6T A;  1H7U A;  3K1J A;  1HR0 E;  1FWK A;  3WU5 A;  1XMQ E;  1UEK A;  2EFG A;  2ZBK B;  4PU9 A;  4JI0 I;  2DEI A;  1RRE A;  4JYA I;  3J7A G;  3ZKD A;  4LFB I;  2UUC E;  1OJ4 A;  1HNW I;  4DR4 I;  4DR5 E;  5IT9 Q;  4B3T E;  2LJP A;  3CWV A;  3J80 Q;  4GKJ E;  1HNZ I;  2E1R A;  2CZ9 A;  5L3J A;  2UXB I;  3PYE A;  2HK2 A;  4DR7 I;  5IT9 C;  1ZM3 A;  2HFS A;  4DPU A;  1PIE A;  3J80 C;  4LFC I;  4MYT A;  1S4E A;  4JI8 E;  4DV0 I;  4LF6 E;  2BM0 A;  2E5L I;  2A2C A;  3WU6 A;  1EA6 A;  4DV1 I;  2UUB E;  4NXM E;  3V5R A;  4X65 E;  4DV3 E;  1Z0E A;  4USM A;  4JI3 E;  4JI1 I;  4DXL A;  2VQF E;  1K47 A;  2VF3 A;  3ZZ0 A;  3D4J A;  1FJG I;  1N0V C;  4JI2 I;  4DV4 I;  1ZM2 A;  4DR1 E;  1XHK A;  1Z5C A;  4Z7C A;  1XNQ I;  3GON A; 
#chains in the Genus database with same CATH topology
 1H74 A;  2HHH I;  4ED4 A;  1WUU A;  1DAR A;  4LF4 I;  1I94 E;  5JEA C;  1NHH A;  2C37 B;  2OI2 A;  1PKP A;  3Q6M A;  4LFA I;  4GKK I;  2UXD I;  2PO1 B;  3HJC A;  4JI6 E;  2HKE A;  4NXN E;  1ZXM A;  3T1H E;  4B3M E;  1Y5Y A;  1N33 E;  4WUC A;  4KQV A;  4PRV A;  1IBM E;  1FNM A;  2BA1 D;  2PNL A;  4JV5 E;  1KIJ A;  1Z0B A;  2VQE I;  2JE6 A;  2JEA A;  1Y4U A;  2NN6 F;  2BA0 D;  2J65 A;  2BA1 G;  3J7A M;  1KTV A;  2O1U A;  4LF5 E;  1HK7 A;  3M7N D;  4YHH I;  4MU4 A;  2UXC E;  2BA0 G;  5GME A;  2JE6 B;  4OX9 I;  1E3H A;  4LF7 I;  5LMU I;  4LCH A;  2JEA B;  1RHY A;  4DV7 I;  4UT4 A;  3M7N G;  5BR8 E;  1UDQ A;  4U3B A;  2UUA E;  2BR2 A;  1Z0T A;  4HYM A;  1IBL I;  2NN6 A;  3PYD A;  3T1Y I;  4UTG A;  3ZKB A;  3K85 A;  4LF8 E;  4DV6 E;  3PYG A;  2X36 A;  5C0X F;  4B3S I;  2BR2 B;  4KHP E;  2IOQ A;  2GS8 A;  4X62 E;  4DR6 I;  5A2Q Q;  4DR2 E;  2NN6 B;  2WP8 A;  2ZIT A;  3QT5 A;  4DU7 A;  2X7I A;  1YHC A;  4LF9 E;  3JAM Q;  4K0K E;  1HR0 I;  2WP8 B;  5C0X A;  1NHJ A;  1XMQ I;  1Y6Z A;  3PS1 A;  1J5E E;  4RPF A;  5FLX Q;  1R6L A;  2CGE A;  4M1K A;  1NHI A;  4LF8 I;  2F4V E;  5A2Q C;  5IWA E;  2PNM A;  1Y60 A;  1MX0 A;  2V2Z A;  1E3P A;  1N0U A;  4FWH A;  1Z0V A;  2UUC I;  4AID A;  4ZVI A;  5FWK A;  1UDO A;  3JAM C;  4LCG A;  4DR5 I;  1ZXN A;  1N36 E;  5EL9 A;  2C38 A;  4B3T I;  5K36 D;  5FLX C;  1Z5B A;  2Z5C A;  1N34 E;  4GKJ I;  1KVK A;  2AJ4 A;  2PO2 A;  4IFD F;  3K17 A;  2C38 B;  2HKJ A;  2O3Z A;  2Z5C B;  4DV2 E;  4QNJ A;  4OZE A;  4FW7 A;  2UU9 E;  4IZJ D;  3V2U C;  4R1F A;  1RR9 A;  2HK3 A;  2PO2 B;  2IER A;  4B3R E;  3PYF A;  1N36 I;  4AQY E;  1A6F A;  3ZM7 A;  1IBK E;  3UHM A;  4IFD A;  4YY3 E;  1FKA E;  4OO1 E;  4FWD A;  4JI8 I;  2ZM6 E;  1S16 A;  4QNK A;  2DEJ A;  1NZ0 A;  4LF6 I;  4DV5 E;  3P3E A;  3PS3 A;  4MDT A;  4JI4 E;  4X66 E;  1OYP A;  1XMO E;  2UUB I;  4NXM I;  4DUZ E;  1YH8 A;  4X65 I;  4DV3 I;  4NBQ A;  4OO1 C;  2JT2 A;  1BKN A;  2C37 A;  4JI3 I;  4JI7 E;  3HKM A;  1HNX E;  2VQF I;  1N32 E;  1ELO A;  2PO1 A;  2Q2E B;  5JEA B;  4I3H A;  2XEX A;  4DPY A;  4DR1 I;  3B78 A;  4DUY E;  2C39 A;  4N3O A;  2A2D A;  5LMN E;  3CDJ A;  1OYR A;  3P3G A;  4WUD A;  3OTO E;  2NN6 D;  2BM1 A;  1MU5 A;  1HNX I;  2C39 B;  2V34 A;  2NPF A;  4MQY A;  3QT8 A;  4JI5 E;  1I94 I;  4WUB A;  2VES A;  3QT7 A;  2PNZ A;  5DRQ A;  1B62 A;  4OKG A;  4BA1 A;  2BV3 A;  4JI6 I;  3LTO A;  4NXN I;  1R6M A;  2J7K A;  1B63 A;  2O1W A;  3T1H I;  4P7A A;  4B3M I;  1N33 I;  1FWL A;  2PNZ B;  1H7S A;  5C0X D;  1IBM I;  4BA1 B;  4JI0 E;  4JV5 I;  3HUL A;  4HXZ A;  4JYA E;  3QT6 A;  4LFB E;  1Z0W A;  4LF5 I;  1HNW E;  4DR4 E;  2UXC I;  3Q6N A;  5DRO A;  1USU A;  5BR8 I;  2UUA I;  4IS9 A;  4Z7Y A;  1HNZ E;  1UDN A;  2WW4 A;  2CVE A;  4FN5 A;  2UXB E;  3KRN A;  3F0N A;  4DV6 I;  4DR7 E;  2CG9 A;  4KHP I;  4JG4 A;  4X62 I;  3M6A A;  4DR2 I;  1PVG A;  4URL A;  1FI4 A;  4LF9 I;  4LFC E;  5C0X E;  3WU3 A;  3B82 A;  4K0K I;  2R3V A;  4DV0 E;  4USK A;  4IFD D;  5GMD A;  4FW9 A;  1J5E I;  4DPW A;  2E5L E;  2GO4 A;  2HFU A;  2F4V I;  3B4T A;  3WU4 A;  1QZR A;  5IWA I;  1U2R A;  4FW3 A;  4X64 E;  4DV1 E;  4U3D A;  5C0X C;  4FW5 A;  1ZM4 A;  4OO1 F;  1Z59 A;  5LL6 R;  4LOM A;  4BA2 A;  4JI1 E;  3ZZU A;  5JEA F;  1N34 I;  4AIM A;  4PRX A;  3Q1Q A;  3H4L A;  1ZM9 A;  4MU3 A;  4HAC A;  4OO1 A;  2PO0 A;  1FJG E;  4JI2 E;  4BA2 B;  4DV4 E;  2O1V A;  3GME A;  1KKH A;  4X64 I;  4DV2 I;  2UU9 I;  4MYU A;  5K36 E;  1XNQ E;  4AM3 A;  4FWG A;  3LNU A;  3L7Z A;  4HAC B;  3B8H A;  2PO0 B;  4OO1 B;  4B3R I;  4IFD E;  2Z5E A;  5JEA A;  2HHH E;  4DU8 A;  4AQY I;  4EMD A;  4DR3 E;  4GQU A;  1IBK I;  1H72 C;  1XNR E;  5DNL A;  4LF4 E;  4YY3 I;  3L7Z B;  2ZM6 I;  3GLL A;  5DRP A;  1USV A;  2Z5B A;  3DD6 A;  5K36 C;  4LFA E;  4DV5 I;  4GKK E;  3P76 A;  2WNR A;  4IFD C;  4JI4 I;  2UXD E;  4X66 I;  1VIS A;  3J81 Q;  4DPX A;  2GQ0 A;  3M85 D;  1XMO I;  4DUZ I;  2Z5B B;  2WNR B;  4IZJ B;  4DR3 I;  5EKW A;  3M85 G;  4IZK A;  4JI7 I;  1XNR I;  1Z5A A;  3LPS A;  2VQE E;  1H73 A;  2IOP A;  2GO3 A;  2O1T A;  4LCF A;  1N32 I;  3CDI A;  4HY1 A;  2V8P A;  3H1C A;  3J81 C;  3ZZT A;  2F1D A;  4P52 A;  4IZK B;  4YHH E;  4OX9 E;  4LF7 E;  5LMU E;  4DV7 E;  5ELW A;  2V2V A;  4DUY I;  2R42 A;  1IBL E;  5LMN I;  2JEB A;  3GCM A;  3T1Y E;  1EI1 A;  3OTO I;  1MG7 A;  1Z0C A;  4B3S E;  4XTJ A;  4DPT A;  4MU1 A;  4DR6 E;  4JI5 I;  2JEB B;  3PRY A;  2V2Q A;  1Z0G A;  1D6T A;  1H7U A;  3K1J A;  3P3C A;  2NN6 E;  1HR0 E;  1FWK A;  5DNX A;  3WU5 A;  1XMQ E;  1UEK A;  2EFG A;  2ZBK B;  4PU9 A;  5DRR A;  4JI0 I;  2DEI A;  1RRE A;  4FW4 A;  4JYA I;  3J7A G;  3P06 A;  3ZKD A;  4LFB I;  2UUC E;  1OJ4 A;  2NN6 C;  1VI7 A;  1HNW I;  4DR4 I;  4DR5 E;  5IT9 Q;  4B3T E;  2LJP A;  3CWV A;  3J80 Q;  4GKJ E;  1HNZ I;  2E1R A;  4J3D A;  3U1K A;  2CZ9 A;  3NZK A;  5L3J A;  2UXB I;  3PYE A;  2HK2 A;  4OO1 D;  4DR7 I;  5C0X B;  5IT9 C;  1ZM3 A;  1P42 A;  2HFS A;  4LPF A;  1PIE A;  4DPU A;  3J80 C;  4LFC I;  5JEA D;  4MYT A;  1S4E A;  4JI8 E;  4DV0 I;  5K36 F;  1OYS A;  4FW6 A;  4LF6 E;  2BM0 A;  2IES A;  2E5L I;  3PS2 A;  2AE8 A;  2A2C A;  3WU6 A;  1EA6 A;  4DV1 I;  2UUB E;  4NXM E;  3V5R A;  4X65 E;  4DV3 E;  4ISA A;  1Z0E A;  5K36 A;  4USM A;  4JI3 E;  1UDS A;  4MU0 A;  1Y4S A;  4JI1 I;  4DXL A;  2VQF E;  3U1Y A;  1K47 A;  5K36 B;  2VF3 A;  3ZZ0 A;  3D4J A;  1FJG I;  4IFD B;  1N0V C;  4IZJ A;  4DV4 I;  4JI2 I;  1ZM2 A;  4DR1 E;  1XHK A;  1Z5C A;  5JEA E;  4Z7C A;  1XXE A;  1XNQ I;  3GON A; 
#chains in the Genus database with same CATH homology
 1H74 A;  2HHH I;  4ED4 A;  1WUU A;  1DAR A;  4LF4 I;  1I94 E;  1NHH A;  2OI2 A;  1PKP A;  3Q6M A;  4LFA I;  4GKK I;  2UXD I;  3HJC A;  4JI6 E;  2HKE A;  4NXN E;  1ZXM A;  3T1H E;  4B3M E;  1N33 E;  4WUC A;  4KQV A;  4PRV A;  1IBM E;  1FNM A;  2PNL A;  4JV5 E;  1KIJ A;  1Z0B A;  2VQE I;  1Y4U A;  3J7A M;  1KTV A;  2O1U A;  4LF5 E;  1HK7 A;  4YHH I;  2UXC E;  5GME A;  4OX9 I;  4LF7 I;  5LMU I;  4DV7 I;  4UT4 A;  5BR8 E;  2UUA E;  1Z0T A;  4HYM A;  1IBL I;  3PYD A;  3T1Y I;  4UTG A;  3ZKB A;  3K85 A;  4LF8 E;  4DV6 E;  3PYG A;  2X36 A;  4B3S I;  4KHP E;  2IOQ A;  2GS8 A;  4X62 E;  4DR6 I;  5A2Q Q;  4DR2 E;  2ZIT A;  3QT5 A;  4DU7 A;  2X7I A;  4LF9 E;  3JAM Q;  4K0K E;  1HR0 I;  1NHJ A;  1J5E E;  1XMQ I;  1Y6Z A;  4RPF A;  5FLX Q;  4M1K A;  2CGE A;  4LF8 I;  1NHI A;  2F4V E;  5A2Q C;  5IWA E;  2PNM A;  1MX0 A;  2V2Z A;  1N0U A;  4FWH A;  1Z0V A;  2UUC I;  4ZVI A;  5FWK A;  3JAM C;  4DR5 I;  1ZXN A;  1N36 E;  4B3T I;  5FLX C;  1Z5B A;  2Z5C A;  1N34 E;  4GKJ I;  1KVK A;  2AJ4 A;  3K17 A;  2HKJ A;  2Z5C B;  4DV2 E;  2UU9 E;  4IZJ D;  3V2U C;  4R1F A;  1RR9 A;  2HK3 A;  4B3R E;  3PYF A;  1N36 I;  4AQY E;  1A6F A;  3ZM7 A;  1IBK E;  4YY3 E;  1FKA E;  4FWD A;  4JI8 I;  2ZM6 E;  1S16 A;  2DEJ A;  1NZ0 A;  4LF6 I;  4DV5 E;  4JI4 E;  4X66 E;  1XMO E;  2UUB I;  4NXM I;  4DUZ E;  4X65 I;  4DV3 I;  1BKN A;  4JI3 I;  4JI7 E;  1HNX E;  2VQF I;  1N32 E;  1ELO A;  2Q2E B;  4I3H A;  2XEX A;  4DPY A;  4DR1 I;  3B78 A;  4DUY E;  4N3O A;  2A2D A;  5LMN E;  4WUD A;  3OTO E;  2BM1 A;  1MU5 A;  1HNX I;  2V34 A;  2NPF A;  3QT8 A;  4JI5 E;  1I94 I;  4WUB A;  3QT7 A;  1B62 A;  2BV3 A;  4JI6 I;  3LTO A;  4NXN I;  2J7K A;  1B63 A;  2O1W A;  3T1H I;  4P7A A;  4B3M I;  1N33 I;  1FWL A;  1H7S A;  1IBM I;  4JI0 E;  4JV5 I;  3HUL A;  4HXZ A;  4JYA E;  3QT6 A;  4LFB E;  1Z0W A;  4LF5 I;  1HNW E;  4DR4 E;  2UXC I;  3Q6N A;  1USU A;  5BR8 I;  2UUA I;  4Z7Y A;  1HNZ E;  2WW4 A;  4FN5 A;  2UXB E;  3F0N A;  4DV6 I;  4DR7 E;  2CG9 A;  4KHP I;  4JG4 A;  4X62 I;  3M6A A;  4DR2 I;  1PVG A;  4URL A;  1FI4 A;  4LF9 I;  4LFC E;  3WU3 A;  3B82 A;  4K0K I;  2R3V A;  4DV0 E;  4USK A;  5GMD A;  4FW9 A;  1J5E I;  4DPW A;  2E5L E;  2HFU A;  2F4V I;  3WU4 A;  1QZR A;  5IWA I;  1U2R A;  4X64 E;  4DV1 E;  1ZM4 A;  1Z59 A;  5LL6 R;  4JI1 E;  3ZZU A;  1N34 I;  4PRX A;  3Q1Q A;  3H4L A;  1ZM9 A;  4HAC A;  1FJG E;  4JI2 E;  4DV4 E;  2O1V A;  1KKH A;  4X64 I;  4DV2 I;  2UU9 I;  4MYU A;  1XNQ E;  4FWG A;  3LNU A;  4HAC B;  3B8H A;  4B3R I;  2Z5E A;  2HHH E;  4DU8 A;  4AQY I;  4EMD A;  4DR3 E;  1IBK I;  1H72 C;  1XNR E;  4LF4 E;  4YY3 I;  2ZM6 I;  1USV A;  2Z5B A;  4LFA E;  4DV5 I;  4GKK E;  4JI4 I;  2UXD E;  4X66 I;  3J81 Q;  1VIS A;  4DPX A;  2GQ0 A;  1XMO I;  4DUZ I;  2Z5B B;  4IZJ B;  4DR3 I;  4IZK A;  4JI7 I;  1XNR I;  1Z5A A;  3LPS A;  2VQE E;  1H73 A;  2IOP A;  2O1T A;  1N32 I;  4HY1 A;  2V8P A;  3J81 C;  3ZZT A;  4P52 A;  4YHH E;  4IZK B;  4OX9 E;  4LF7 E;  5LMU E;  4DV7 E;  2V2V A;  4DUY I;  2R42 A;  1IBL E;  5LMN I;  3T1Y E;  1EI1 A;  3OTO I;  1MG7 A;  1Z0C A;  4B3S E;  4XTJ A;  4DPT A;  4DR6 E;  4JI5 I;  3PRY A;  2V2Q A;  1Z0G A;  1D6T A;  1H7U A;  3K1J A;  1HR0 E;  1FWK A;  3WU5 A;  1XMQ E;  1UEK A;  2EFG A;  2ZBK B;  4PU9 A;  4JI0 I;  2DEI A;  1RRE A;  4JYA I;  3J7A G;  3P06 A;  3ZKD A;  4LFB I;  2UUC E;  1OJ4 A;  1HNW I;  4DR4 I;  4DR5 E;  5IT9 Q;  4B3T E;  2LJP A;  3CWV A;  3J80 Q;  4GKJ E;  1HNZ I;  2E1R A;  2CZ9 A;  5L3J A;  2UXB I;  3PYE A;  2HK2 A;  4DR7 I;  5IT9 C;  1ZM3 A;  2HFS A;  4DPU A;  1PIE A;  3J80 C;  4LFC I;  4MYT A;  1S4E A;  4JI8 E;  4DV0 I;  4LF6 E;  2BM0 A;  2E5L I;  2A2C A;  3WU6 A;  1EA6 A;  4DV1 I;  2UUB E;  4NXM E;  3V5R A;  4X65 E;  4DV3 E;  1Z0E A;  4USM A;  4JI3 E;  1Y4S A;  4JI1 I;  4DXL A;  2VQF E;  1K47 A;  2VF3 A;  3ZZ0 A;  3D4J A;  1FJG I;  1N0V C;  4IZJ A;  4DV4 I;  4JI2 I;  1ZM2 A;  4DR1 E;  1XHK A;  1Z5C A;  4Z7C A;  1XNQ I;  3GON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...