4LPFA

Crystal structure of mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Imidazoleglycerol-phosphate dehydratase
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis h37rv
total genus 60
structure length 190
sequence length 190
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA02
1RHYA 4MU3A 5EL9A 5DNXA 2AE8A 4GQUA 4MU1A 4LPFA 4QNKA 5ELWA 4QNJA 4MU0A 5EKWA 5DNLA 4LOMA 4MU4A 2F1DA
chains in the Genus database with same CATH superfamily
4DPUA 1N36I 1IBLE 3OTOE 1N34I 5LL6R 4BA1B 3M6AA 4YY3E 4Z7YA 2NN6E 1K47A 3H4LA 2WNRB 1PIEA 2C39B 4IZKB 5K36F 2XEXA 4IZJA 4DPYA 2VQEI 4LF5I 3LPSA 4IFDF 3F0NA 1N36E 2JT2A 5EL9A 5DNXA 2WW4A 4LPFA 4LFAI 2JEAA 1XMOI 2IOPA 2Q2EB 4DV1I 1RHYA 3P3GA 4LF4I 5C0XE 4DXLA 4DU8A 2O1VA 4FWDA 4LFAE 4KQVA 1XMOE 1USVA 4JI8E 1KIJA 3WU3A 3WU5A 4DV1E 4LF7I 1NZ0A 2V2VA 4DPTA 4DUZE 1ELOA 4LF4E 2JE6B 5JEAA 4YHHI 2IERA 2UUAI 1HNXI 3B4TA 1N33I 1FJGI 4JI5I 4MQYA 4FW7A 3P06A 5DRRA 2O1UA 3Q6NA 2NN6C 3U1KA 4LF7E 1FWLA 2BA0G 2PO0B 4B3TI 1KKHA 1MG7A 3ZZUA 2UUAE 2HHHI 4OO1D 1FJGE 4DV6E 3T1HI 1B62A 4MU4A 4JI3E 1UDQA 2F4VI 4LOMA 1VISA 2NN6B 1XNRI 4X66E 5C0XC 2UXBI 4FW9A 2J65A 1R6MA 2IESA 5LMUI 2PO2A 2HHHE 2VESA 3P3CA 1HNZE 5A2QQ 2CG9A 1E3HA 2HFUA 4NXME 3H1CA 3B8HA 4JI1I 1N0VC 4DPWA 2ZM6E 4JI2I 5C0XD 3ZZTA 5DRQA 1PVGA 4DR5I 5LMNI 4B3MI 4URLA 1UDSA 4X62E 4X65I 2WP8B 3B78A 4LF8I 4JI1E 3B82A 4JI2E 3GMEA 2PNMA 2AJ4A 4MDTA 4K0KE 1EA6A 5LMNE 1H72C 4FW6A 4GKKE 1FWKA 4X64I 4XTJA 4JYAI 3PYDA 1I94E 1A6FA 1IBLI 3OTOI 3CDIA 1U2RA 2BR2B 5K36E 4M1KA 2PO1B 4WUDA 4YY3I 4FWHA 2PO0A 1DARA 4IFDE 3GONA 1Y4SA 1XMQE 4JV5I 2CVEA 2GO3A 1XXEA 4LCFA 4JYAE 4R1FA 3L7ZA 1USUA 2J7KA 4HACB 4OO1A 2V8PA 4RPFA 4DPXA 3HKMA 1RR9A 3Q6MA 1Y5YA 3JAMQ 5A2QC 1Y6ZA 4JV5E 4B3RI 5GMDA 1ZM4A 1KVKA 2HKJA 2V34A 4EMDA 4DR4E 2IOQA 4DUYE 2O1TA 4JI8I 1Z0BA 4ZVIA 5IT9C 4DUZI 4DR3E 4B3RE 2C38A 5C0XA 4LCGA 1IBME 1YH8A 2R3VA 3LNUA 4FWGA 4AQYE 4DR2I 3DD6A 1ZM3A 3PYEA 2NPFA 1ZXNA 2EFGA 4OO1F 4AM3A 2VF3A 2GS8A 2PNZA 4J3DA 2C37B 1RREA 2Z5CB 4UTGA 3PYFA 4DV6I 1H73A 4DR2E 1S4EA 4Z7CA 3PRYA 4JI3I 4BA2A 3M85D 4FN5A 5K36B 4DR7E 2BA1G 1S16A 4X66I 4IFDB 3T1YI 4PU9A 2ZBKB 3U1YA 2JEBB 2DEJA 1Z5BA 1HNZI 3JAMC 3UHMA 4OKGA 4GKJE 3QT8A 4BA1A 5C0XF 2NN6D 3V2UC 4NXMI 2OI2A 3GLLA 2WNRA 2C39A 2ZM6I 4IZKA 3T1YE 3HJCA 1HNWI 1ZM2A 4AIDA 4DV2I 1YHCA 2UXCE 3WU4A 1Z0GA 1OYSA 3K17A 4X62I 1HK7A 2CZ9A 4LF6I 4DU7A 1Z0CA 5JEAF 1QZRA 3ZZ0A 3M7ND 4GQUA 1NHJA 4K0KI 1MX0A 1HNWE 4MYTA 5IWAE 3Q1QA 2BA1D 4DV2E 4GKKI 3P3EA 4I3HA 3PYGA 2A2CA 4LFCE 2Z5BB 1I94I 4IZJB 2A2DA 4LF6E 2UU9E 1MU5A 3HULA 4JI0I 5DRPA 1N32E 3CWVA 1XNQE 4DV7E 4WUBA 2ZITA 3PS3A 2JE6A 4ISAA 4OX9E 1XMQI 2V2QA 3LTOA 3ZKDA 4JI0E 3ZKBA 4DV0E 4JI6E 4DR6E 1P42A 4DV3I 1H7UA 2UUCE 2X36A 4DR1E 1Z0VA 1Z0EA 1Y4UA 3J7AM 4KHPE 4P7AA 1H74A 5JEAB 2UXDI 3K1JA 4B3SE 4DR4I 1FI4A 4DUYI 4MU1A 4DV3E 2NN6A 5ELWA 1OYPA 4DR3I 1OYRA 4USMA 1N0UA 1Z59A 1IBMI 2VQFE 1FNMA 2Z5EA 5L3JA 3M85G 4AQYI 2UXDE 4PRXA 5BR8I 5GMEA 4OO1E 3QT5A 4PRVA 4DV4E 1KTVA 1EI1A 1FKAE 1Z0WA 4IS9A 4HYMA 4HXZA 5DROA 5FLXQ 2Z5BA 1XHKA 2PO2B 2WP8A 1D6TA 5K36C 5BR8E 3J80Q 3NZKA 1N34E 2O1WA 4LF9I 3GCMA 3K85A 4IFDC 1UEKA 4JI7I 4DR7I 1ZM9A 4NBQA 1Y60A 1NHHA 2NN6F 4AIMA 3WU6A 2VQEE 4JG4A 1BKNA 4LF5E 3M7NG 5K36D 2BR2A 4P52A 4U3DA 4GKJI 4JI4I 3KRNA 2PO1A 1Z5AA 4LF9E 3ZM7A 4IFDD 4JI7E 2E1RA 4MU3A 1WUUA 1UDOA 2O3ZA 2UXCI 2E5LI 2LJPA 4HACA 5JEAE 3CDJA 1J5EI 4JI4E 4OO1C 5DNLA 2CGEA 1PKPA 4WUCA 1Z5CA 2DEIA 5FWKA 3J81Q 5IWAI 4UT4A 2E5LE 3D4JA 4MYUA 4YHHE 4LFCI 4MU0A 4FW3A 3QT6A 4U3BA 2UU9I 1J5EE 1N32I 1HNXE 1N33E 4USKA 4JI5E 1XNQI 3L7ZB 4QNJA 4DV7I 4OO1B 2V2ZA 2PNLA 2UUBI 5FLXC 3P76A 4OX9I 4IZJD 2GQ0A 4B3TE 2GO4A 3J80C 3QT7A 2HFSA 1ZXMA 1OJ4A 2X7IA 4FW4A 3T1HE 3V5RA 4DV0I 4JI6I 4DR6I 4OZEA 2UUBE 2F4VE 2JEAB 2HKEA 4QNKA 1R6LA 2HK2A 5EKWA 2UUCI 4DR1I 1NHIA 2C37A 1XNRE 2BV3A 2UXBE 2R42A 5JEAC 2Z5CA 1UDNA 4KHPI 5LMUE 2BA0D 1E3PA 4NXNI 2C38B 5C0XB 4LFBI 1HR0I 5IT9Q 4B3SI 5K36A 1B63A 3PS1A 4IFDA 2BM1A 1IBKI 5JEAD 4HY1A 2JEBA 1VI7A 4DR5E 4ED4A 4NXNE 4B3ME 4LCHA 2VQFI 4DV5I 4N3OA 4LFBE 2PNZB 1HR0E 3J81C 1H7SA 2F1DA 2HK3A 4X65E 2AE8A 4DV4I 3PS2A 4LF8E 3J7AG 4BA2B 1IBKE 2BM0A 4FW5A 4DV5E 1Z0TA 4X64E
chains in the Genus database with same CATH topology
1RHYA 4MU3A 5EL9A 5DNXA 2AE8A 4GQUA 4MU1A 4LPFA 4QNKA 5ELWA 4QNJA 4MU0A 5EKWA 5DNLA 4LOMA 4MU4A 2F1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHY A;  4MU3 A;  5EL9 A;  5DNX A;  2AE8 A;  4GQU A;  4MU1 A;  4LPF A;  4QNK A;  5ELW A;  4QNJ A;  4MU0 A;  5EKW A;  5DNL A;  4LOM A;  4MU4 A;  2F1D A; 
#chains in the Genus database with same CATH topology
 4DPU A;  1N36 I;  1IBL E;  3OTO E;  1N34 I;  5LL6 R;  4BA1 B;  3M6A A;  4YY3 E;  4Z7Y A;  2NN6 E;  1K47 A;  3H4L A;  2WNR B;  1PIE A;  2C39 B;  4IZK B;  5K36 F;  2XEX A;  4IZJ A;  4DPY A;  2VQE I;  4LF5 I;  3LPS A;  4IFD F;  3F0N A;  1N36 E;  2JT2 A;  5EL9 A;  5DNX A;  2WW4 A;  4LPF A;  4LFA I;  2JEA A;  1XMO I;  2IOP A;  2Q2E B;  4DV1 I;  1RHY A;  3P3G A;  4LF4 I;  5C0X E;  4DXL A;  4DU8 A;  2O1V A;  4FWD A;  4LFA E;  4KQV A;  1XMO E;  1USV A;  4JI8 E;  1KIJ A;  3WU3 A;  3WU5 A;  4DV1 E;  4LF7 I;  1NZ0 A;  2V2V A;  4DPT A;  4DUZ E;  1ELO A;  4LF4 E;  2JE6 B;  5JEA A;  4YHH I;  2IER A;  2UUA I;  1HNX I;  3B4T A;  1N33 I;  1FJG I;  4JI5 I;  4MQY A;  4FW7 A;  3P06 A;  5DRR A;  2O1U A;  3Q6N A;  2NN6 C;  3U1K A;  4LF7 E;  1FWL A;  2BA0 G;  2PO0 B;  4B3T I;  1KKH A;  1MG7 A;  3ZZU A;  2UUA E;  2HHH I;  4OO1 D;  1FJG E;  4DV6 E;  3T1H I;  1B62 A;  4MU4 A;  4JI3 E;  1UDQ A;  2F4V I;  4LOM A;  1VIS A;  2NN6 B;  1XNR I;  4X66 E;  5C0X C;  2UXB I;  4FW9 A;  2J65 A;  1R6M A;  2IES A;  5LMU I;  2PO2 A;  2HHH E;  2VES A;  3P3C A;  1HNZ E;  5A2Q Q;  2CG9 A;  1E3H A;  2HFU A;  4NXM E;  3H1C A;  3B8H A;  4JI1 I;  1N0V C;  4DPW A;  2ZM6 E;  4JI2 I;  5C0X D;  3ZZT A;  5DRQ A;  1PVG A;  4DR5 I;  5LMN I;  4B3M I;  4URL A;  1UDS A;  4X62 E;  4X65 I;  2WP8 B;  3B78 A;  4LF8 I;  4JI1 E;  3B82 A;  4JI2 E;  3GME A;  2PNM A;  2AJ4 A;  4MDT A;  4K0K E;  1EA6 A;  5LMN E;  1H72 C;  4FW6 A;  4GKK E;  1FWK A;  4X64 I;  4XTJ A;  4JYA I;  3PYD A;  1I94 E;  1A6F A;  1IBL I;  3OTO I;  3CDI A;  1U2R A;  2BR2 B;  5K36 E;  4M1K A;  2PO1 B;  4WUD A;  4YY3 I;  4FWH A;  2PO0 A;  1DAR A;  4IFD E;  3GON A;  1Y4S A;  1XMQ E;  4JV5 I;  2CVE A;  2GO3 A;  1XXE A;  4LCF A;  4JYA E;  4R1F A;  3L7Z A;  1USU A;  2J7K A;  4HAC B;  4OO1 A;  2V8P A;  4RPF A;  4DPX A;  3HKM A;  1RR9 A;  3Q6M A;  1Y5Y A;  3JAM Q;  5A2Q C;  1Y6Z A;  4JV5 E;  4B3R I;  5GMD A;  1ZM4 A;  1KVK A;  2HKJ A;  2V34 A;  4EMD A;  4DR4 E;  2IOQ A;  4DUY E;  2O1T A;  4JI8 I;  1Z0B A;  4ZVI A;  5IT9 C;  4DUZ I;  4DR3 E;  4B3R E;  2C38 A;  5C0X A;  4LCG A;  1IBM E;  1YH8 A;  2R3V A;  3LNU A;  4FWG A;  4AQY E;  4DR2 I;  3DD6 A;  1ZM3 A;  3PYE A;  2NPF A;  1ZXN A;  2EFG A;  4OO1 F;  4AM3 A;  2VF3 A;  2GS8 A;  2PNZ A;  4J3D A;  2C37 B;  1RRE A;  2Z5C B;  4UTG A;  3PYF A;  4DV6 I;  1H73 A;  4DR2 E;  1S4E A;  4Z7C A;  3PRY A;  4JI3 I;  4BA2 A;  3M85 D;  4FN5 A;  5K36 B;  4DR7 E;  2BA1 G;  1S16 A;  4X66 I;  4IFD B;  3T1Y I;  4PU9 A;  2ZBK B;  3U1Y A;  2JEB B;  2DEJ A;  1Z5B A;  1HNZ I;  3JAM C;  3UHM A;  4OKG A;  4GKJ E;  3QT8 A;  4BA1 A;  5C0X F;  2NN6 D;  3V2U C;  4NXM I;  2OI2 A;  3GLL A;  2WNR A;  2C39 A;  2ZM6 I;  4IZK A;  3T1Y E;  3HJC A;  1HNW I;  1ZM2 A;  4AID A;  4DV2 I;  1YHC A;  2UXC E;  3WU4 A;  1Z0G A;  1OYS A;  3K17 A;  4X62 I;  1HK7 A;  2CZ9 A;  4LF6 I;  4DU7 A;  1Z0C A;  5JEA F;  1QZR A;  3ZZ0 A;  3M7N D;  4GQU A;  1NHJ A;  4K0K I;  1MX0 A;  1HNW E;  4MYT A;  5IWA E;  3Q1Q A;  2BA1 D;  4DV2 E;  4GKK I;  3P3E A;  4I3H A;  3PYG A;  2A2C A;  4LFC E;  2Z5B B;  1I94 I;  4IZJ B;  2A2D A;  4LF6 E;  2UU9 E;  1MU5 A;  3HUL A;  4JI0 I;  5DRP A;  1N32 E;  3CWV A;  1XNQ E;  4DV7 E;  4WUB A;  2ZIT A;  3PS3 A;  2JE6 A;  4ISA A;  4OX9 E;  1XMQ I;  2V2Q A;  3LTO A;  3ZKD A;  4JI0 E;  3ZKB A;  4DV0 E;  4JI6 E;  4DR6 E;  1P42 A;  4DV3 I;  1H7U A;  2UUC E;  2X36 A;  4DR1 E;  1Z0V A;  1Z0E A;  1Y4U A;  3J7A M;  4KHP E;  4P7A A;  1H74 A;  5JEA B;  2UXD I;  3K1J A;  4B3S E;  4DR4 I;  1FI4 A;  4DUY I;  4MU1 A;  4DV3 E;  2NN6 A;  5ELW A;  1OYP A;  4DR3 I;  1OYR A;  4USM A;  1N0U A;  1Z59 A;  1IBM I;  2VQF E;  1FNM A;  2Z5E A;  5L3J A;  3M85 G;  4AQY I;  2UXD E;  4PRX A;  5BR8 I;  5GME A;  4OO1 E;  3QT5 A;  4PRV A;  4DV4 E;  1KTV A;  1EI1 A;  1FKA E;  1Z0W A;  4IS9 A;  4HYM A;  4HXZ A;  5DRO A;  5FLX Q;  2Z5B A;  1XHK A;  2PO2 B;  2WP8 A;  1D6T A;  5K36 C;  5BR8 E;  3J80 Q;  3NZK A;  1N34 E;  2O1W A;  4LF9 I;  3GCM A;  3K85 A;  4IFD C;  1UEK A;  4JI7 I;  4DR7 I;  1ZM9 A;  4NBQ A;  1Y60 A;  1NHH A;  2NN6 F;  4AIM A;  3WU6 A;  2VQE E;  4JG4 A;  1BKN A;  4LF5 E;  3M7N G;  5K36 D;  2BR2 A;  4P52 A;  4U3D A;  4GKJ I;  4JI4 I;  3KRN A;  2PO1 A;  1Z5A A;  4LF9 E;  3ZM7 A;  4IFD D;  4JI7 E;  2E1R A;  4MU3 A;  1WUU A;  1UDO A;  2O3Z A;  2UXC I;  2E5L I;  2LJP A;  4HAC A;  5JEA E;  3CDJ A;  1J5E I;  4JI4 E;  4OO1 C;  5DNL A;  2CGE A;  1PKP A;  4WUC A;  1Z5C A;  2DEI A;  5FWK A;  3J81 Q;  5IWA I;  4UT4 A;  2E5L E;  3D4J A;  4MYU A;  4YHH E;  4LFC I;  4MU0 A;  4FW3 A;  3QT6 A;  4U3B A;  2UU9 I;  1J5E E;  1N32 I;  1HNX E;  1N33 E;  4USK A;  4JI5 E;  1XNQ I;  3L7Z B;  4QNJ A;  4DV7 I;  4OO1 B;  2V2Z A;  2PNL A;  2UUB I;  5FLX C;  3P76 A;  4OX9 I;  4IZJ D;  2GQ0 A;  4B3T E;  2GO4 A;  3J80 C;  3QT7 A;  2HFS A;  1ZXM A;  1OJ4 A;  2X7I A;  4FW4 A;  3T1H E;  3V5R A;  4DV0 I;  4JI6 I;  4DR6 I;  4OZE A;  2UUB E;  2F4V E;  2JEA B;  2HKE A;  4QNK A;  1R6L A;  2HK2 A;  5EKW A;  2UUC I;  4DR1 I;  1NHI A;  2C37 A;  1XNR E;  2BV3 A;  2UXB E;  2R42 A;  5JEA C;  2Z5C A;  1UDN A;  4KHP I;  5LMU E;  2BA0 D;  1E3P A;  4NXN I;  2C38 B;  5C0X B;  4LFB I;  1HR0 I;  5IT9 Q;  4B3S I;  5K36 A;  1B63 A;  3PS1 A;  4IFD A;  2BM1 A;  1IBK I;  5JEA D;  4HY1 A;  2JEB A;  1VI7 A;  4DR5 E;  4ED4 A;  4NXN E;  4B3M E;  4LCH A;  2VQF I;  4DV5 I;  4N3O A;  4LFB E;  2PNZ B;  1HR0 E;  3J81 C;  1H7S A;  2F1D A;  2HK3 A;  4X65 E;  2AE8 A;  4DV4 I;  3PS2 A;  4LF8 E;  3J7A G;  4BA2 B;  1IBK E;  2BM0 A;  4FW5 A;  4DV5 E;  1Z0T A;  4X64 E; 
#chains in the Genus database with same CATH homology
 1RHY A;  4MU3 A;  5EL9 A;  5DNX A;  2AE8 A;  4GQU A;  4MU1 A;  4LPF A;  4QNK A;  5ELW A;  4QNJ A;  4MU0 A;  5EKW A;  5DNL A;  4LOM A;  4MU4 A;  2F1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...