4LPFA

Crystal structure of mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
molecule keywords Imidazoleglycerol-phosphate dehydratase
total genus 60
structure length 190
sequence length 190
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA02
4MU3A 4QNJA 2F1DA 4MU0A 5EL9A 2AE8A 5ELWA 5EKWA 1RHYA 4LPFA 4LOMA 4MU1A 5DNLA 4QNKA 4MU4A 4GQUA 5DNXA
chains in the Genus database with same CATH superfamily
4DR1E 4DV5E 1B63A 5IWAE 2PO1A 2IOPA 4MU4A 2JT2A 4JI7E 2XEXA 5BR8E 2UXDE 1XMOI 2JEBB 2HKJA 4MU1A 2HK3A 5IT9Q 1Y6ZA 1EI1A 4B3TE 3B4TA 4LFAI 4JYAE 3ZKDA 4WUBA 4JI3I 1Z5AA 2VQFE 4DV3I 2ZM6I 4LF8E 1Z0VA 2BM0A 4DR2E 5LL6R 3M85D 4IZKB 2BR2B 1HK7A 4MDTA 1E3HA 5JEAF 4B3RI 3ZZTA 4IFDD 2J7KA 2NN6A 4JG4A 4QNJA 3ZZUA 1KVKA 3KRNA 3PS3A 3LNUA 4XTJA 3J81Q 3T1HI 3J7AM 1PKPA 4AIMA 4HACA 2WP8B 4HYMA 3H4LA 3QT5A 2UU9I 4DU8A 5IWAI 4B3MI 1U2RA 3P3EA 4AQYI 4NXMI 4FW9A 1YHCA 2HFUA 5DNLA 4IFDE 2BR2A 4MQYA 1USVA 4DR6I 1H73A 3T1YE 4LF9I 2UUBI 4YY3I 2C37B 4BA2A 1KIJA 4DV2I 2C39B 4DV7I 2NN6F 4YHHE 4JI5I 2V8PA 2O1VA 1HR0E 3PYFA 3K1JA 4AQYE 4NXME 4PU9A 2F4VE 4X66I 4B3TI 4LFAE 3WU4A 1IBME 4HXZA 1I94I 3QT8A 2GO3A 2VQFI 4DV3E 2Z5BA 5C0XE 4DUYE 2NPFA 4X65I 1I94E 4DR3E 2CG9A 4DV6I 4MU0A 3Q6NA 4QNKA 4HACB 5A2QQ 1PVGA 4NXNE 4U3BA 1MU5A 2UUAI 2WW4A 2PO0B 3WU5A 2BA1G 2F4VI 3GLLA 4MYTA 4LCHA 4DV2E 3D4JA 1XMQE 1Y4SA 1XNRE 4K0KE 4DV4E 1N34E 2F1DA 4YY3E 2GO4A 4DR5E 5DROA 4FN5A 4DR2I 2VF3A 3ZKBA 2Z5CA 4LCGA 5DRQA 4GKKI 1EA6A 4X64E 4DUYI 2C39A 4FWDA 1ZXMA 4DR3I 2PO1B 3H1CA 3J7AG 1J5EE 1Z0WA 4GQUA 4JI2E 4DR4I 2Z5EA 4WUDA 2V2ZA 5JEAA 3LPSA 1XNQE 4LCFA 1FKAE 5K36E 3ZZ0A 1IBLI 4Z7YA 5IT9C 4JYAI 1HR0I 4DV6E 3OTOE 4JI4E 3PYGA 1N0VC 1Z5BA 1XNRI 5DRRA 4OX9E 4LFCE 5BR8I 1Z0GA 2JE6B 1KKHA 3GCMA 1IBMI 4DR7E 2NN6B 3PS2A 3J81C 4OO1E 2WNRB 1OYSA 4DR6E 2R42A 2GQ0A 2V2QA 5K36D 1HNZE 1OJ4A 4JI5E 4KQVA 1Z0CA 2R3VA 3PYDA 3JAMQ 2X36A 5C0XF 1FWKA 4OX9I 2VQEI 2IESA 5DRPA 1N33I 4LOMA 4MYUA 4DV0I 1S16A 1RR9A 2ZM6E 3V2UC 2E1RA 4B3SI 1RHYA 2HHHE 2BA1D 4OO1F 2ZITA 4IZJD 2C37A 2DEJA 5C0XD 1J5EI 2O3ZA 2UXDI 1UDSA 2X7IA 2PNLA 4JI0E 4DPUA 5K36F 3J80Q 2PNZB 2JE6A 4LFBI 2BA0D 1VISA 5LMNE 2HFSA 4DXLA 1HNWE 2ZBKB 3L7ZB 4R1FA 5A2QC 3P3GA 4YHHI 4B3ME 4K0KI 1N34I 2UXCI 1N36E 4OO1A 4DPTA 2VQEE 1Z0BA 4DV1E 2Z5BB 2UUAE 2PO2A 2PNMA 1Y5YA 1QZRA 2NN6C 2BV3A 1ZM9A 5LMUI 2GS8A 5C0XC 1HNWI 4DR4E 2Z5CB 4LF7I 4ZVIA 4USKA 2CVEA 1P42A 4JI0I 3CDIA 1N32E 1DARA 1E3PA 1A6FA 1IBLE 2PO2B 3HKMA 2Q2EB 4FWGA 3OTOI 4BA1B 1UDNA 4OO1C 4FW4A 2WP8A 4DPXA 4JV5E 2UUCI 2DEIA 4Z7CA 4AIDA 2WNRA 4DV4I 1K47A 4I3HA 4OKGA 2V2VA 4MU3A 4NBQA 4LF8I 4DV1I 3LTOA 4IS9A 4JI1I 3L7ZA 4EMDA 4LF5I 2UUBE 1Z59A 5JEAE 3B82A 1OYRA 4IFDC 3M7ND 3K85A 2C38A 4DR1I 2A2CA 4P52A 2O1TA 5JEAB 1N0UA 4DR5I 4LFBE 5C0XA 1ZM3A 4JI6I 2BA0G 4IZJA 2IOQA 2UXBE 5DNXA 1FWLA 3Q1QA 4X62E 3HJCA 5ELWA 1VI7A 1HNXI 4B3RE 4JI2I 3UHMA 4JV5I 1FJGE 1HNXE 2V34A 3JAMC 1ZXNA 4NXNI 1H7SA 2CZ9A 4UT4A 5GMEA 1UDQA 1UEKA 4ISAA 4ED4A 1IBKE 5K36A 4GKKE 2JEAB 4DU7A 4PRVA 3U1KA 2HHHI 1B62A 1IBKI 3NZKA 2UUCE 4JI8I 3J80C 2NN6E 1FNMA 3F0NA 3CWVA 1H72C 1NZ0A 4M1KA 3ZM7A 3PRYA 5FWKA 1Z5CA 4JI3E 1N36I 1H7UA 4RPFA 3QT6A 2UXBI 4WUCA 3M7NG 1MX0A 4DPYA 1OYPA 5GMDA 4IFDF 4DV7E 4JI4I 5JEAD 5K36B 1ZM4A 3GMEA 4FW7A 4P7AA 5LMUE 2HKEA 4HY1A 1D6TA 4N3OA 4LF4I 4LF6E 4URLA 1NHHA 4KHPI 2A2DA 4AM3A 4U3DA 3HULA 1XMQI 4X65E 4LPFA 4J3DA 4PRXA 3DD6A 4IZJB 2BM1A 1MG7A 4FW6A 1FJGI 4BA2B 5FLXC 1XMOE 5K36C 4LF7E 5C0XB 4OZEA 5EL9A 4OO1D 2J65A 3M6AA 1N33E 4LF6I 4B3SE 3Q6MA 1H74A 5L3JA 3PS1A 1Y4UA 3B8HA 1PIEA 1RREA 3WU6A 5FLXQ 2PO0A 2AE8A 4DUZE 4FW5A 1HNZI 3T1YI 4LF9E 1Z0TA 4JI7I 1R6LA 4FWHA 4JI6E 2O1WA 4LF4E 1USUA 2E5LI 4GKJE 4KHPE 2JEAA 3T1HE 1NHJA 4LFCI 2E5LE 4X62I 4GKJI 4DV5I 2UU9E 4DR7I 2UXCE 3CDJA 2OI2A 5EKWA 4DUZI 2VESA 1S4EA 3GONA 4UTGA 2JEBA 2IERA 5LMNI 1Z0EA 3PYEA 4JI8E 1XNQI 2EFGA 1UDOA 3K17A 2CGEA 4USMA 2AJ4A 1WUUA 5JEAC 4OO1B 3P06A 2C38B 1N32I 1XHKA 3V5RA 1YH8A 1NHIA 4X66E 1ELOA 4IFDB 1KTVA 3M85G 4X64I 1Y60A 4DV0E 3QT7A 3U1YA 2HK2A 1XXEA 2PNZA 4DPWA 3P3CA 3WU3A 1ZM2A 2NN6D 3P76A 1FI4A 3B78A 4IZKA 4IFDA 4BA1A 4JI1E 2O1UA 4LF5E 1R6MA 2LJPA 1BKNA 4FW3A
chains in the Genus database with same CATH topology
4MU3A 4QNJA 2F1DA 4MU0A 5EL9A 2AE8A 5ELWA 5EKWA 1RHYA 4LPFA 4LOMA 4MU1A 5DNLA 4QNKA 4MU4A 4GQUA 5DNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MU3 A;  4QNJ A;  2F1D A;  4MU0 A;  5EL9 A;  2AE8 A;  5ELW A;  5EKW A;  1RHY A;  4LPF A;  4LOM A;  4MU1 A;  5DNL A;  4QNK A;  4MU4 A;  4GQU A;  5DNX A; 
#chains in the Genus database with same CATH topology
 4DR1 E;  4DV5 E;  1B63 A;  5IWA E;  2PO1 A;  2IOP A;  4MU4 A;  2JT2 A;  4JI7 E;  2XEX A;  5BR8 E;  2UXD E;  1XMO I;  2JEB B;  2HKJ A;  4MU1 A;  2HK3 A;  5IT9 Q;  1Y6Z A;  1EI1 A;  4B3T E;  3B4T A;  4LFA I;  4JYA E;  3ZKD A;  4WUB A;  4JI3 I;  1Z5A A;  2VQF E;  4DV3 I;  2ZM6 I;  4LF8 E;  1Z0V A;  2BM0 A;  4DR2 E;  5LL6 R;  3M85 D;  4IZK B;  2BR2 B;  1HK7 A;  4MDT A;  1E3H A;  5JEA F;  4B3R I;  3ZZT A;  4IFD D;  2J7K A;  2NN6 A;  4JG4 A;  4QNJ A;  3ZZU A;  1KVK A;  3KRN A;  3PS3 A;  3LNU A;  4XTJ A;  3J81 Q;  3T1H I;  3J7A M;  1PKP A;  4AIM A;  4HAC A;  2WP8 B;  4HYM A;  3H4L A;  3QT5 A;  2UU9 I;  4DU8 A;  5IWA I;  4B3M I;  1U2R A;  3P3E A;  4AQY I;  4NXM I;  4FW9 A;  1YHC A;  2HFU A;  5DNL A;  4IFD E;  2BR2 A;  4MQY A;  1USV A;  4DR6 I;  1H73 A;  3T1Y E;  4LF9 I;  2UUB I;  4YY3 I;  2C37 B;  4BA2 A;  1KIJ A;  4DV2 I;  2C39 B;  4DV7 I;  2NN6 F;  4YHH E;  4JI5 I;  2V8P A;  2O1V A;  1HR0 E;  3PYF A;  3K1J A;  4AQY E;  4NXM E;  4PU9 A;  2F4V E;  4X66 I;  4B3T I;  4LFA E;  3WU4 A;  1IBM E;  4HXZ A;  1I94 I;  3QT8 A;  2GO3 A;  2VQF I;  4DV3 E;  2Z5B A;  5C0X E;  4DUY E;  2NPF A;  4X65 I;  1I94 E;  4DR3 E;  2CG9 A;  4DV6 I;  4MU0 A;  3Q6N A;  4QNK A;  4HAC B;  5A2Q Q;  1PVG A;  4NXN E;  4U3B A;  1MU5 A;  2UUA I;  2WW4 A;  2PO0 B;  3WU5 A;  2BA1 G;  2F4V I;  3GLL A;  4MYT A;  4LCH A;  4DV2 E;  3D4J A;  1XMQ E;  1Y4S A;  1XNR E;  4K0K E;  4DV4 E;  1N34 E;  2F1D A;  4YY3 E;  2GO4 A;  4DR5 E;  5DRO A;  4FN5 A;  4DR2 I;  2VF3 A;  3ZKB A;  2Z5C A;  4LCG A;  5DRQ A;  4GKK I;  1EA6 A;  4X64 E;  4DUY I;  2C39 A;  4FWD A;  1ZXM A;  4DR3 I;  2PO1 B;  3H1C A;  3J7A G;  1J5E E;  1Z0W A;  4GQU A;  4JI2 E;  4DR4 I;  2Z5E A;  4WUD A;  2V2Z A;  5JEA A;  3LPS A;  1XNQ E;  4LCF A;  1FKA E;  5K36 E;  3ZZ0 A;  1IBL I;  4Z7Y A;  5IT9 C;  4JYA I;  1HR0 I;  4DV6 E;  3OTO E;  4JI4 E;  3PYG A;  1N0V C;  1Z5B A;  1XNR I;  5DRR A;  4OX9 E;  4LFC E;  5BR8 I;  1Z0G A;  2JE6 B;  1KKH A;  3GCM A;  1IBM I;  4DR7 E;  2NN6 B;  3PS2 A;  3J81 C;  4OO1 E;  2WNR B;  1OYS A;  4DR6 E;  2R42 A;  2GQ0 A;  2V2Q A;  5K36 D;  1HNZ E;  1OJ4 A;  4JI5 E;  4KQV A;  1Z0C A;  2R3V A;  3PYD A;  3JAM Q;  2X36 A;  5C0X F;  1FWK A;  4OX9 I;  2VQE I;  2IES A;  5DRP A;  1N33 I;  4LOM A;  4MYU A;  4DV0 I;  1S16 A;  1RR9 A;  2ZM6 E;  3V2U C;  2E1R A;  4B3S I;  1RHY A;  2HHH E;  2BA1 D;  4OO1 F;  2ZIT A;  4IZJ D;  2C37 A;  2DEJ A;  5C0X D;  1J5E I;  2O3Z A;  2UXD I;  1UDS A;  2X7I A;  2PNL A;  4JI0 E;  4DPU A;  5K36 F;  3J80 Q;  2PNZ B;  2JE6 A;  4LFB I;  2BA0 D;  1VIS A;  5LMN E;  2HFS A;  4DXL A;  1HNW E;  2ZBK B;  3L7Z B;  4R1F A;  5A2Q C;  3P3G A;  4YHH I;  4B3M E;  4K0K I;  1N34 I;  2UXC I;  1N36 E;  4OO1 A;  4DPT A;  2VQE E;  1Z0B A;  4DV1 E;  2Z5B B;  2UUA E;  2PO2 A;  2PNM A;  1Y5Y A;  1QZR A;  2NN6 C;  2BV3 A;  1ZM9 A;  5LMU I;  2GS8 A;  5C0X C;  1HNW I;  4DR4 E;  2Z5C B;  4LF7 I;  4ZVI A;  4USK A;  2CVE A;  1P42 A;  4JI0 I;  3CDI A;  1N32 E;  1DAR A;  1E3P A;  1A6F A;  1IBL E;  2PO2 B;  3HKM A;  2Q2E B;  4FWG A;  3OTO I;  4BA1 B;  1UDN A;  4OO1 C;  4FW4 A;  2WP8 A;  4DPX A;  4JV5 E;  2UUC I;  2DEI A;  4Z7C A;  4AID A;  2WNR A;  4DV4 I;  1K47 A;  4I3H A;  4OKG A;  2V2V A;  4MU3 A;  4NBQ A;  4LF8 I;  4DV1 I;  3LTO A;  4IS9 A;  4JI1 I;  3L7Z A;  4EMD A;  4LF5 I;  2UUB E;  1Z59 A;  5JEA E;  3B82 A;  1OYR A;  4IFD C;  3M7N D;  3K85 A;  2C38 A;  4DR1 I;  2A2C A;  4P52 A;  2O1T A;  5JEA B;  1N0U A;  4DR5 I;  4LFB E;  5C0X A;  1ZM3 A;  4JI6 I;  2BA0 G;  4IZJ A;  2IOQ A;  2UXB E;  5DNX A;  1FWL A;  3Q1Q A;  4X62 E;  3HJC A;  5ELW A;  1VI7 A;  1HNX I;  4B3R E;  4JI2 I;  3UHM A;  4JV5 I;  1FJG E;  1HNX E;  2V34 A;  3JAM C;  1ZXN A;  4NXN I;  1H7S A;  2CZ9 A;  4UT4 A;  5GME A;  1UDQ A;  1UEK A;  4ISA A;  4ED4 A;  1IBK E;  5K36 A;  4GKK E;  2JEA B;  4DU7 A;  4PRV A;  3U1K A;  2HHH I;  1B62 A;  1IBK I;  3NZK A;  2UUC E;  4JI8 I;  3J80 C;  2NN6 E;  1FNM A;  3F0N A;  3CWV A;  1H72 C;  1NZ0 A;  4M1K A;  3ZM7 A;  3PRY A;  5FWK A;  1Z5C A;  4JI3 E;  1N36 I;  1H7U A;  4RPF A;  3QT6 A;  2UXB I;  4WUC A;  3M7N G;  1MX0 A;  4DPY A;  1OYP A;  5GMD A;  4IFD F;  4DV7 E;  4JI4 I;  5JEA D;  5K36 B;  1ZM4 A;  3GME A;  4FW7 A;  4P7A A;  5LMU E;  2HKE A;  4HY1 A;  1D6T A;  4N3O A;  4LF4 I;  4LF6 E;  4URL A;  1NHH A;  4KHP I;  2A2D A;  4AM3 A;  4U3D A;  3HUL A;  1XMQ I;  4X65 E;  4LPF A;  4J3D A;  4PRX A;  3DD6 A;  4IZJ B;  2BM1 A;  1MG7 A;  4FW6 A;  1FJG I;  4BA2 B;  5FLX C;  1XMO E;  5K36 C;  4LF7 E;  5C0X B;  4OZE A;  5EL9 A;  4OO1 D;  2J65 A;  3M6A A;  1N33 E;  4LF6 I;  4B3S E;  3Q6M A;  1H74 A;  5L3J A;  3PS1 A;  1Y4U A;  3B8H A;  1PIE A;  1RRE A;  3WU6 A;  5FLX Q;  2PO0 A;  2AE8 A;  4DUZ E;  4FW5 A;  1HNZ I;  3T1Y I;  4LF9 E;  1Z0T A;  4JI7 I;  1R6L A;  4FWH A;  4JI6 E;  2O1W A;  4LF4 E;  1USU A;  2E5L I;  4GKJ E;  4KHP E;  2JEA A;  3T1H E;  1NHJ A;  4LFC I;  2E5L E;  4X62 I;  4GKJ I;  4DV5 I;  2UU9 E;  4DR7 I;  2UXC E;  3CDJ A;  2OI2 A;  5EKW A;  4DUZ I;  2VES A;  1S4E A;  3GON A;  4UTG A;  2JEB A;  2IER A;  5LMN I;  1Z0E A;  3PYE A;  4JI8 E;  1XNQ I;  2EFG A;  1UDO A;  3K17 A;  2CGE A;  4USM A;  2AJ4 A;  1WUU A;  5JEA C;  4OO1 B;  3P06 A;  2C38 B;  1N32 I;  1XHK A;  3V5R A;  1YH8 A;  1NHI A;  4X66 E;  1ELO A;  4IFD B;  1KTV A;  3M85 G;  4X64 I;  1Y60 A;  4DV0 E;  3QT7 A;  3U1Y A;  2HK2 A;  1XXE A;  2PNZ A;  4DPW A;  3P3C A;  3WU3 A;  1ZM2 A;  2NN6 D;  3P76 A;  1FI4 A;  3B78 A;  4IZK A;  4IFD A;  4BA1 A;  4JI1 E;  2O1U A;  4LF5 E;  1R6M A;  2LJP A;  1BKN A;  4FW3 A; 
#chains in the Genus database with same CATH homology
 4MU3 A;  4QNJ A;  2F1D A;  4MU0 A;  5EL9 A;  2AE8 A;  5ELW A;  5EKW A;  1RHY A;  4LPF A;  4LOM A;  4MU1 A;  5DNL A;  4QNK A;  4MU4 A;  4GQU A;  5DNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...