4LPFA

Crystal structure of mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
molecule keywords Imidazoleglycerol-phosphate dehydratase
total genus 60
structure length 190
sequence length 190
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA02
4MU0A 4MU1A 4LOMA 5EL9A 5EKWA 5ELWA 5DNLA 1RHYA 4MU3A 4QNJA 2F1DA 4MU4A 4QNKA 5DNXA 4GQUA 4LPFA 2AE8A
chains in the Genus database with same CATH superfamily
1Z5AA 4IZJD 1UDOA 4FW3A 5A2QQ 4N3OA 4QNKA 4YHHI 3M85G 4LF9E 2DEJA 3B8HA 3J80C 4JI1I 2C39B 2Z5CB 2O1VA 3J81Q 4LF9I 2R3VA 1H72C 1A6FA 3L7ZB 1IBKI 5K36E 1N33E 5C0XB 1N0UA 2E5LE 2JT2A 3GONA 1IBKE 4OKGA 1QZRA 2X36A 1FNMA 2CG9A 4OX9I 3P76A 4OZEA 4DR2I 3LNUA 2HKJA 1U2RA 2UXCI 4IZKB 4DV2E 2E5LI 4R1FA 4J3DA 5DRQA 3ZKDA 4LCHA 2E1RA 1J5EE 1USUA 3D4JA 4AQYE 5LMUE 2BA0G 2BV3A 4FW9A 4MU4A 2OI2A 4FW7A 4NXME 5C0XC 2UXDE 1XMQE 3GCMA 4WUDA 1XXEA 1I94I 4X66I 4LF6I 3P3CA 3P3GA 4U3DA 1HNZI 2NN6B 4JI4E 1IBLI 4DUYI 2WW4A 1UDSA 4DV2I 1XMQI 5DNLA 4JI0I 2V2ZA 4PRXA 4LCFA 4DU8A 3QT5A 1HNXE 4HXZA 4DR4I 4OO1B 1ELOA 1XNQE 2UUCE 2Z5BB 4DV1I 3M7ND 4DPYA 2UUBI 5FWKA 4X62E 3HJCA 3WU3A 2PO0A 2XEXA 4DXLA 1KKHA 2PNZA 1E3PA 4BA2B 1IBMI 1IBLE 2UXBI 1BKNA 4X62I 1IBME 4MU0A 4DR3I 3B4TA 3J80Q 2VQFI 1B62A 4HACA 4LF8E 2WP8A 1XMOE 2VQFE 1FWKA 5IT9Q 1H73A 2O1UA 5IWAI 4MU3A 1XNRI 2HHHE 2HFUA 2AE8A 3OTOI 1HR0E 1XNRE 2NPFA 4FWDA 3M85D 4AQYI 2O3ZA 2WP8B 5C0XF 5K36A 2C38B 4DR5I 3OTOE 1Z59A 4DV6I 4DPXA 4BA2A 4QNJA 4DR2E 3V2UC 4LF4E 3ZKBA 2UXDI 4IFDA 1UEKA 4B3ME 1ZM4A 3J7AG 3P3EA 1EA6A 2JEAB 4DR4E 1NHJA 2F4VE 4MDTA 4DU7A 2F4VI 4NXMI 4JI2I 1PKPA 4JI5I 4LFCI 1Z5CA 1DARA 1S4EA 4DR5E 1HNWE 1HNXI 4FW6A 3J81C 1MG7A 2JEBA 3WU6A 4LF6E 4I3HA 1FWLA 1H7SA 4MU1A 5LL6R 4JI6I 4AM3A 4DUYE 4LFCE 3NZKA 1NHHA 5FLXQ 1FKAE 2C38A 4LF8I 4KHPI 4URLA 5DRPA 1Y4UA 1Z5BA 4NXNE 4X66E 3F0NA 4AIDA 1Z0TA 4JI4I 5IWAE 4DV4I 2IERA 1ZM2A 1YHCA 4DV4E 1KIJA 4LPFA 3H4LA 2NN6F 1YH8A 1N0VC 2BR2B 4IFDC 2EFGA 4YHHE 5C0XA 1HK7A 5ELWA 2VQEE 3Q6NA 4DR7E 1E3HA 4MQYA 4JG4A 4LOMA 4NBQA 4HY1A 3M6AA 4DR6I 2WNRB 4B3MI 4JV5E 5K36B 4MYTA 5JEAA 2Z5BA 2A2CA 5BR8E 4UTGA 4LCGA 1Z0EA 3PYGA 1PIEA 1XMOI 3T1YE 2C37A 4FN5A 1NZ0A 4JI8E 1Y60A 4P7AA 2IOPA 5GMDA 3WU5A 2J65A 4USMA 3Q1QA 3Q6MA 3PYDA 4B3SE 4DV6E 1HR0I 4LF5E 4FW5A 3T1YI 1S16A 1ZXNA 2GO4A 2Z5EA 4HACB 4DV3E 1N36I 5A2QC 3U1KA 4IS9A 4IFDE 2CGEA 3PYFA 1KVKA 5IT9C 4KHPE 3DD6A 4EMDA 2GS8A 2HFSA 4DV5E 2PO0B 4X65E 4DV0E 1OYPA 2C37B 1FJGI 4X65I 4JI5E 4DUZE 1ZM9A 1N32E 4M1KA 3P06A 2UU9I 5EL9A 1XNQI 4DR1E 3PRYA 2NN6C 4JI6E 3LTOA 4IFDF 1Y4SA 4JI2E 2UUBE 4DV7E 5DRRA 1MU5A 2V2VA 3CDIA 2BA1G 5LMNE 2GQ0A 2NN6A 2LJPA 5K36F 4GKKI 4DR7I 1K47A 4DPWA 2HK2A 3T1HE 2UXBE 4PRVA 2CZ9A 4JV5I 4FWGA 4IZJB 2VQEI 4B3TE 2JE6B 2UUAI 2ZM6I 4ED4A 5BR8I 2A2DA 4WUCA 4DUZI 4DR6E 3CWVA 4GKJI 1P42A 1RREA 4OO1F 4GKJE 2HHHI 1VI7A 2NN6D 2ZITA 5C0XE 4PU9A 1Z0GA 5DNXA 2ZBKB 1OYSA 1R6LA 3PS2A 4RPFA 2HKEA 1J5EI 2JEBB 5JEAD 4B3SI 5JEAF 3L7ZA 2BA1D 4K0KE 2UUAE 4K0KI 3ZZ0A 1FI4A 1Z0VA 4ZVIA 4LF7I 3GMEA 5DROA 4LFAE 4JI7I 3KRNA 4LF7E 2DEIA 4IZJA 1NHIA 2Q2EB 4IFDB 4DV0I 1ZM3A 3HKMA 2BA0D 4XTJA 4JI8I 4Z7CA 4IFDD 4JI3E 5JEAE 1Y6ZA 1Y5YA 4JI7E 2IESA 1VISA 3HULA 4BA1B 5K36C 4LF5I 1KTVA 3ZZUA 2BM1A 4LFBI 2PO2A 4FWHA 4DV7I 1EI1A 3T1HI 4U3BA 3WU4A 3ZM7A 3K17A 3LPSA 1N34I 4YY3I 1N34E 4B3RE 3JAMQ 2V2QA 3QT8A 4GKKE 4AIMA 1N32I 5GMEA 3K1JA 4NXNI 3PS1A 2UU9E 4LFBE 1XHKA 3QT6A 4DV5I 4WUBA 4OO1C 1H7UA 2IOQA 1FJGE 1Z0BA 4JI3I 2ZM6E 1Z0CA 1USVA 4JI1E 4FW4A 5LMNI 4B3RI 4IZKA 2WNRA 4X64I 4X64E 5L3JA 2PNZB 4JYAI 3GLLA 2HK3A 4OX9E 1RR9A 5JEAC 1OJ4A 3H1CA 2AJ4A 1MX0A 2PNMA 4B3TI 4Z7YA 3PYEA 2VESA 2BR2A 4USKA 3U1YA 1OYRA 2JE6A 2O1WA 5EKWA 3K85A 4OO1D 3UHMA 3B78A 2NN6E 5C0XD 2PO2B 4LFAI 5JEAB 1B63A 3B82A 4GQUA 4ISAA 4LF4I 2R42A 1N33I 2V34A 1RHYA 1WUUA 2O1TA 2PO1A 4UT4A 2F1DA 1Z0WA 2UUCI 2BM0A 1HNZE 3CDJA 2J7KA 4DV3I 1N36E 4OO1A 4HYMA 1HNWI 4DPTA 5LMUI 2V8PA 1UDNA 4MYUA 2VF3A 4DV1E 1PVGA 4OO1E 3V5RA 4DR3E 3J7AM 2JEAA 4YY3E 3ZZTA 2PNLA 1I94E 2GO3A 4P52A 4KQVA 3JAMC 3PS3A 1H74A 3QT7A 2X7IA 4BA1A 5K36D 4DPUA 4DR1I 3M7NG 2PO1B 5FLXC 4JYAE 2CVEA 1D6TA 2C39A 2Z5CA 4JI0E 1UDQA 1R6MA 1ZXMA 2UXCE
chains in the Genus database with same CATH topology
4MU0A 4MU1A 4LOMA 5EL9A 5EKWA 5ELWA 5DNLA 1RHYA 4MU3A 4QNJA 2F1DA 4MU4A 4QNKA 5DNXA 4GQUA 4LPFA 2AE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MU0 A;  4MU1 A;  4LOM A;  5EL9 A;  5EKW A;  5ELW A;  5DNL A;  1RHY A;  4MU3 A;  4QNJ A;  2F1D A;  4MU4 A;  4QNK A;  5DNX A;  4GQU A;  4LPF A;  2AE8 A; 
#chains in the Genus database with same CATH topology
 1Z5A A;  4IZJ D;  1UDO A;  4FW3 A;  5A2Q Q;  4N3O A;  4QNK A;  4YHH I;  3M85 G;  4LF9 E;  2DEJ A;  3B8H A;  3J80 C;  4JI1 I;  2C39 B;  2Z5C B;  2O1V A;  3J81 Q;  4LF9 I;  2R3V A;  1H72 C;  1A6F A;  3L7Z B;  1IBK I;  5K36 E;  1N33 E;  5C0X B;  1N0U A;  2E5L E;  2JT2 A;  3GON A;  1IBK E;  4OKG A;  1QZR A;  2X36 A;  1FNM A;  2CG9 A;  4OX9 I;  3P76 A;  4OZE A;  4DR2 I;  3LNU A;  2HKJ A;  1U2R A;  2UXC I;  4IZK B;  4DV2 E;  2E5L I;  4R1F A;  4J3D A;  5DRQ A;  3ZKD A;  4LCH A;  2E1R A;  1J5E E;  1USU A;  3D4J A;  4AQY E;  5LMU E;  2BA0 G;  2BV3 A;  4FW9 A;  4MU4 A;  2OI2 A;  4FW7 A;  4NXM E;  5C0X C;  2UXD E;  1XMQ E;  3GCM A;  4WUD A;  1XXE A;  1I94 I;  4X66 I;  4LF6 I;  3P3C A;  3P3G A;  4U3D A;  1HNZ I;  2NN6 B;  4JI4 E;  1IBL I;  4DUY I;  2WW4 A;  1UDS A;  4DV2 I;  1XMQ I;  5DNL A;  4JI0 I;  2V2Z A;  4PRX A;  4LCF A;  4DU8 A;  3QT5 A;  1HNX E;  4HXZ A;  4DR4 I;  4OO1 B;  1ELO A;  1XNQ E;  2UUC E;  2Z5B B;  4DV1 I;  3M7N D;  4DPY A;  2UUB I;  5FWK A;  4X62 E;  3HJC A;  3WU3 A;  2PO0 A;  2XEX A;  4DXL A;  1KKH A;  2PNZ A;  1E3P A;  4BA2 B;  1IBM I;  1IBL E;  2UXB I;  1BKN A;  4X62 I;  1IBM E;  4MU0 A;  4DR3 I;  3B4T A;  3J80 Q;  2VQF I;  1B62 A;  4HAC A;  4LF8 E;  2WP8 A;  1XMO E;  2VQF E;  1FWK A;  5IT9 Q;  1H73 A;  2O1U A;  5IWA I;  4MU3 A;  1XNR I;  2HHH E;  2HFU A;  2AE8 A;  3OTO I;  1HR0 E;  1XNR E;  2NPF A;  4FWD A;  3M85 D;  4AQY I;  2O3Z A;  2WP8 B;  5C0X F;  5K36 A;  2C38 B;  4DR5 I;  3OTO E;  1Z59 A;  4DV6 I;  4DPX A;  4BA2 A;  4QNJ A;  4DR2 E;  3V2U C;  4LF4 E;  3ZKB A;  2UXD I;  4IFD A;  1UEK A;  4B3M E;  1ZM4 A;  3J7A G;  3P3E A;  1EA6 A;  2JEA B;  4DR4 E;  1NHJ A;  2F4V E;  4MDT A;  4DU7 A;  2F4V I;  4NXM I;  4JI2 I;  1PKP A;  4JI5 I;  4LFC I;  1Z5C A;  1DAR A;  1S4E A;  4DR5 E;  1HNW E;  1HNX I;  4FW6 A;  3J81 C;  1MG7 A;  2JEB A;  3WU6 A;  4LF6 E;  4I3H A;  1FWL A;  1H7S A;  4MU1 A;  5LL6 R;  4JI6 I;  4AM3 A;  4DUY E;  4LFC E;  3NZK A;  1NHH A;  5FLX Q;  1FKA E;  2C38 A;  4LF8 I;  4KHP I;  4URL A;  5DRP A;  1Y4U A;  1Z5B A;  4NXN E;  4X66 E;  3F0N A;  4AID A;  1Z0T A;  4JI4 I;  5IWA E;  4DV4 I;  2IER A;  1ZM2 A;  1YHC A;  4DV4 E;  1KIJ A;  4LPF A;  3H4L A;  2NN6 F;  1YH8 A;  1N0V C;  2BR2 B;  4IFD C;  2EFG A;  4YHH E;  5C0X A;  1HK7 A;  5ELW A;  2VQE E;  3Q6N A;  4DR7 E;  1E3H A;  4MQY A;  4JG4 A;  4LOM A;  4NBQ A;  4HY1 A;  3M6A A;  4DR6 I;  2WNR B;  4B3M I;  4JV5 E;  5K36 B;  4MYT A;  5JEA A;  2Z5B A;  2A2C A;  5BR8 E;  4UTG A;  4LCG A;  1Z0E A;  3PYG A;  1PIE A;  1XMO I;  3T1Y E;  2C37 A;  4FN5 A;  1NZ0 A;  4JI8 E;  1Y60 A;  4P7A A;  2IOP A;  5GMD A;  3WU5 A;  2J65 A;  4USM A;  3Q1Q A;  3Q6M A;  3PYD A;  4B3S E;  4DV6 E;  1HR0 I;  4LF5 E;  4FW5 A;  3T1Y I;  1S16 A;  1ZXN A;  2GO4 A;  2Z5E A;  4HAC B;  4DV3 E;  1N36 I;  5A2Q C;  3U1K A;  4IS9 A;  4IFD E;  2CGE A;  3PYF A;  1KVK A;  5IT9 C;  4KHP E;  3DD6 A;  4EMD A;  2GS8 A;  2HFS A;  4DV5 E;  2PO0 B;  4X65 E;  4DV0 E;  1OYP A;  2C37 B;  1FJG I;  4X65 I;  4JI5 E;  4DUZ E;  1ZM9 A;  1N32 E;  4M1K A;  3P06 A;  2UU9 I;  5EL9 A;  1XNQ I;  4DR1 E;  3PRY A;  2NN6 C;  4JI6 E;  3LTO A;  4IFD F;  1Y4S A;  4JI2 E;  2UUB E;  4DV7 E;  5DRR A;  1MU5 A;  2V2V A;  3CDI A;  2BA1 G;  5LMN E;  2GQ0 A;  2NN6 A;  2LJP A;  5K36 F;  4GKK I;  4DR7 I;  1K47 A;  4DPW A;  2HK2 A;  3T1H E;  2UXB E;  4PRV A;  2CZ9 A;  4JV5 I;  4FWG A;  4IZJ B;  2VQE I;  4B3T E;  2JE6 B;  2UUA I;  2ZM6 I;  4ED4 A;  5BR8 I;  2A2D A;  4WUC A;  4DUZ I;  4DR6 E;  3CWV A;  4GKJ I;  1P42 A;  1RRE A;  4OO1 F;  4GKJ E;  2HHH I;  1VI7 A;  2NN6 D;  2ZIT A;  5C0X E;  4PU9 A;  1Z0G A;  5DNX A;  2ZBK B;  1OYS A;  1R6L A;  3PS2 A;  4RPF A;  2HKE A;  1J5E I;  2JEB B;  5JEA D;  4B3S I;  5JEA F;  3L7Z A;  2BA1 D;  4K0K E;  2UUA E;  4K0K I;  3ZZ0 A;  1FI4 A;  1Z0V A;  4ZVI A;  4LF7 I;  3GME A;  5DRO A;  4LFA E;  4JI7 I;  3KRN A;  4LF7 E;  2DEI A;  4IZJ A;  1NHI A;  2Q2E B;  4IFD B;  4DV0 I;  1ZM3 A;  3HKM A;  2BA0 D;  4XTJ A;  4JI8 I;  4Z7C A;  4IFD D;  4JI3 E;  5JEA E;  1Y6Z A;  1Y5Y A;  4JI7 E;  2IES A;  1VIS A;  3HUL A;  4BA1 B;  5K36 C;  4LF5 I;  1KTV A;  3ZZU A;  2BM1 A;  4LFB I;  2PO2 A;  4FWH A;  4DV7 I;  1EI1 A;  3T1H I;  4U3B A;  3WU4 A;  3ZM7 A;  3K17 A;  3LPS A;  1N34 I;  4YY3 I;  1N34 E;  4B3R E;  3JAM Q;  2V2Q A;  3QT8 A;  4GKK E;  4AIM A;  1N32 I;  5GME A;  3K1J A;  4NXN I;  3PS1 A;  2UU9 E;  4LFB E;  1XHK A;  3QT6 A;  4DV5 I;  4WUB A;  4OO1 C;  1H7U A;  2IOQ A;  1FJG E;  1Z0B A;  4JI3 I;  2ZM6 E;  1Z0C A;  1USV A;  4JI1 E;  4FW4 A;  5LMN I;  4B3R I;  4IZK A;  2WNR A;  4X64 I;  4X64 E;  5L3J A;  2PNZ B;  4JYA I;  3GLL A;  2HK3 A;  4OX9 E;  1RR9 A;  5JEA C;  1OJ4 A;  3H1C A;  2AJ4 A;  1MX0 A;  2PNM A;  4B3T I;  4Z7Y A;  3PYE A;  2VES A;  2BR2 A;  4USK A;  3U1Y A;  1OYR A;  2JE6 A;  2O1W A;  5EKW A;  3K85 A;  4OO1 D;  3UHM A;  3B78 A;  2NN6 E;  5C0X D;  2PO2 B;  4LFA I;  5JEA B;  1B63 A;  3B82 A;  4GQU A;  4ISA A;  4LF4 I;  2R42 A;  1N33 I;  2V34 A;  1RHY A;  1WUU A;  2O1T A;  2PO1 A;  4UT4 A;  2F1D A;  1Z0W A;  2UUC I;  2BM0 A;  1HNZ E;  3CDJ A;  2J7K A;  4DV3 I;  1N36 E;  4OO1 A;  4HYM A;  1HNW I;  4DPT A;  5LMU I;  2V8P A;  1UDN A;  4MYU A;  2VF3 A;  4DV1 E;  1PVG A;  4OO1 E;  3V5R A;  4DR3 E;  3J7A M;  2JEA A;  4YY3 E;  3ZZT A;  2PNL A;  1I94 E;  2GO3 A;  4P52 A;  4KQV A;  3JAM C;  3PS3 A;  1H74 A;  3QT7 A;  2X7I A;  4BA1 A;  5K36 D;  4DPU A;  4DR1 I;  3M7N G;  2PO1 B;  5FLX C;  4JYA E;  2CVE A;  1D6T A;  2C39 A;  2Z5C A;  4JI0 E;  1UDQ A;  1R6M A;  1ZXM A;  2UXC E; 
#chains in the Genus database with same CATH homology
 4MU0 A;  4MU1 A;  4LOM A;  5EL9 A;  5EKW A;  5ELW A;  5DNL A;  1RHY A;  4MU3 A;  4QNJ A;  2F1D A;  4MU4 A;  4QNK A;  5DNX A;  4GQU A;  4LPF A;  2AE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...