4LPFA

Crystal structure of mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazoleglycerol-phosphate dehydratase
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
total genus 60
structure length 190
sequence length 190
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA02
4QNJA 5ELWA 4LOMA 5DNLA 4MU3A 2AE8A 4MU1A 4QNKA 4LPFA 5EKWA 1RHYA 4MU0A 5EL9A 4GQUA 2F1DA 5DNXA 4MU4A
chains in the Genus database with same CATH superfamily
3ZZ0A 2PNLA 1K47A 2IOPA 4DUYI 1IBLI 1EI1A 4DV1E 5DNLA 4JI6E 5LL6R 2UUCE 3PYFA 2XEXA 4FWDA 2HHHI 1HNXI 1FWKA 1N32E 1H72C 4DR4I 2BM1A 1H7SA 1HNWE 1H74A 3T1YE 1A6FA 1J5EI 4DR2I 5K36A 4JI8I 2UXCI 2O1TA 4LF8I 4MDTA 4WUBA 3GONA 3M7ND 3NZKA 2Z5EA 1UDNA 4DU8A 4NXNE 1N33E 2CVEA 1RREA 2JEBA 2NN6A 4BA2A 4LCGA 1N34E 4PU9A 4JV5I 5IT9Q 1OJ4A 3PYEA 1Y5YA 4IFDD 1FNMA 1Z0TA 2BR2B 4YY3E 2UUBI 1IBMI 1ZM4A 4OO1D 3PS2A 4MU0A 3LNUA 4X62I 2JE6A 2PO1B 4DV0I 1HK7A 4DPTA 4B3ME 3QT5A 4HACA 3L7ZA 4IZJB 3J81Q 4DUZE 2UXBE 4JI7I 1Z59A 4FWGA 1XHKA 3M7NG 4X66I 5JEAE 4RPFA 5C0XA 2X36A 4MU4A 5JEAC 1UDOA 5DRPA 1Y4SA 2V2ZA 2VQFI 2IERA 3H4LA 4DR3I 3CDJA 4LF6E 3HULA 2DEJA 1Z0GA 4DV4E 5JEAB 1OYRA 4K0KI 4JI2E 1PKPA 1PVGA 1IBKE 4LF5I 1S4EA 3J7AG 3CDIA 3OTOE 5IT9C 4YHHE 1HNZE 3M85G 1KTVA 4AIDA 4DV5E 1FI4A 4DR1I 2J7KA 3QT6A 5K36D 5A2QQ 1Z5AA 4DV7I 1N36E 2OI2A 2IESA 2UU9I 4FWHA 3J81C 4J3DA 4OZEA 3T1HE 2E5LE 1MG7A 3Q6NA 1ZM3A 4JI1I 2DEIA 3J7AM 3U1YA 5GMDA 1EA6A 4JI3E 2NN6D 4R1FA 2BM0A 2WP8A 4IFDF 3B82A 4DR5I 4ED4A 3DD6A 4GKJI 2O1VA 3PS3A 4OO1A 4EMDA 1B62A 4OO1F 1XMOE 2V34A 4FW5A 1ZM2A 1HR0I 4B3TE 4HY1A 4DV7E 2C38B 2WNRB 1Z5BA 2ZM6I 4I3HA 4HYMA 4AQYI 5A2QC 3P3GA 1R6LA 1FJGI 4JI5I 1XNRI 4JI0E 2HK3A 4DPXA 1VISA 3B4TA 2BA0D 4AIMA 2PO0A 5C0XD 2IOQA 3Q6MA 1D6TA 2GS8A 2C39B 2A2CA 4FW7A 2NN6C 2PO2B 2NPFA 4OX9I 3HKMA 4AM3A 1S16A 2Q2EB 3QT7A 4Z7CA 4GKKI 4UTGA 1YHCA 4B3RI 3PRYA 4BA2B 1U2RA 4KQVA 5K36F 4NXMI 1XMQI 3B78A 2Z5BA 2CG9A 2O3ZA 4USKA 3H1CA 4DUYE 4WUCA 1IBLE 2JEAA 4ISAA 4FW9A 2PNMA 5LMNI 1R6MA 2UUAI 4IZKA 2HHHE 1HNXE 4DV2I 4DV6I 4DR4E 2JT2A 4GQUA 3L7ZB 5DRQA 3QT8A 3V2UC 2CZ9A 2NN6F 2ZBKB 1UDQA 3K85A 4MU1A 1Z0CA 3JAMQ 4LFBI 4X65I 3GLLA 1J5EE 4DR2E 3J80Q 1PIEA 4JI8E 2VQEI 2UXCE 1NZ0A 4NXME 4U3BA 4LFAI 4DU7A 4PRVA 4LCFA 4LF8E 2UXDI 4HXZA 4LCHA 4X64I 4JI4I 1KIJA 1BKNA 5ELWA 5LMNE 1Z0WA 1OYSA 1DARA 4QNJA 3WU6A 4LOMA 4DPWA 5C0XF 4JV5E 3ZKBA 2BV3A 4JYAI 1UDSA 1XXEA 1Z0BA 5BR8I 1YH8A 2UUBE 4IFDE 1IBME 2HKJA 1H73A 4DR7I 4IFDC 3JAMC 4X62E 4OO1E 1USUA 4DV0E 5IWAI 1I94I 4LF7I 2E1RA 4OO1C 2F1DA 2GQ0A 3J80C 4B3SI 4JI7E 4IFDB 4DV3I 2BR2A 2C37A 4X66E 4OO1B 2AJ4A 2VQFE 2PO1A 1UEKA 2V8PA 4DR3E 5L3JA 4P52A 4IZJA 1XNQI 2AE8A 4N3OA 3LPSA 5EKWA 2WW4A 4PRXA 4LFCI 5BR8E 2CGEA 4DR6I 4K0KE 2Z5CB 1B63A 4OKGA 4LF9I 4LF5E 1E3HA 1QZRA 2GO4A 4DXLA 4P7AA 4DPYA 4KHPI 4DR1E 2PNZA 4LF4I 1OYPA 2PO0B 1ZM9A 5LMUI 4FW3A 5K36E 1N0UA 2UU9E 5K36C 3PS1A 3P3EA 4JI1E 4DV1I 1NHIA 4JI6I 3U1KA 2UUCI 5K36B 2HK2A 1MX0A 1Z5CA 5FWKA 1N32I 2X7IA 2NN6E 4DR5E 4GKJE 1HNWI 1ELOA 4QNKA 3P3CA 3T1YI 2BA1D 1H7UA 3LTOA 1HR0E 1RR9A 2JEBB 2NN6B 2ZM6E 1FKAE 4AQYE 3ZZTA 3PYGA 4U3DA 1FJGE 4JI5E 1XNRE 3K17A 4NXNI 4DPUA 1N33I 3M6AA 2V2QA 4Z7YA 2C38A 2WNRA 5DRRA 2JE6B 3D4JA 3V5RA 2HKEA 4BA1A 5C0XE 2BA0G 1N34I 5EL9A 2GO3A 4HACB 4IZJD 5C0XC 4OX9E 1MU5A 1Z0VA 4YY3I 2BA1G 4GKKE 1KVKA 4B3RE 4M1KA 5C0XB 3F0NA 3WU3A 2VESA 2HFUA 2C39A 3GCMA 1ZXMA 4NBQA 4B3MI 2ZITA 1XMQE 2PO2A 3Q1QA 4WUDA 4DUZI 3ZZUA 2UXBI 2O1WA 3ZKDA 5JEAD 3HJCA 2R42A 3PYDA 1VI7A 2UUAE 2A2DA 4XTJA 4DV2E 4DV6E 4LF6I 1ZXNA 1NHJA 2O1UA 4DV4I 5FLXQ 2C37B 3CWVA 4LFBE 4X65E 4JI2I 1IBKI 3M85D 3OTOI 4YHHI 2VQEE 1HNZI 4LFAE 4DV5I 3WU4A 1Y4UA 5GMEA 2UXDE 3KRNA 4MYTA 1NHHA 4X64E 1E3PA 4JI4E 2R3VA 1WUUA 4MYUA 2EFGA 1N36I 2WP8B 1KKHA 3T1HI 2E5LI 4LPFA 2PNZB 4JYAE 4JI3I 3P06A 5DNXA 2F4VI 1Y6ZA 2V2VA 5FLXC 4DR7E 4ZVIA 1XMOI 5IWAE 1I94E 4LF7E 4B3TI 4MQYA 3K1JA 2VF3A 4B3SE 3P76A 4DV3E 5JEAA 4IS9A 5JEAF 1RHYA 2J65A 4USMA 4UT4A 2HFSA 1USVA 1Z0EA 4JI0I 5LMUE 4URLA 1XNQE 3WU5A 4LFCE 4IFDA 2F4VE 4DR6E 3ZM7A 1N0VC 1FWLA 4FW6A 4LF9E 4FN5A 1Y60A 3B8HA 3GMEA 2LJPA 2Z5BB 3UHMA 4KHPE 4JG4A 2JEAB 4FW4A 4LF4E 5DROA 4BA1B 4IZKB 2Z5CA 1P42A 4MU3A
chains in the Genus database with same CATH topology
4QNJA 5ELWA 4LOMA 5DNLA 4MU3A 2AE8A 4MU1A 4QNKA 4LPFA 5EKWA 1RHYA 4MU0A 5EL9A 4GQUA 2F1DA 5DNXA 4MU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNJ A;  5ELW A;  4LOM A;  5DNL A;  4MU3 A;  2AE8 A;  4MU1 A;  4QNK A;  4LPF A;  5EKW A;  1RHY A;  4MU0 A;  5EL9 A;  4GQU A;  2F1D A;  5DNX A;  4MU4 A; 
#chains in the Genus database with same CATH topology
 3ZZ0 A;  2PNL A;  1K47 A;  2IOP A;  4DUY I;  1IBL I;  1EI1 A;  4DV1 E;  5DNL A;  4JI6 E;  5LL6 R;  2UUC E;  3PYF A;  2XEX A;  4FWD A;  2HHH I;  1HNX I;  1FWK A;  1N32 E;  1H72 C;  4DR4 I;  2BM1 A;  1H7S A;  1HNW E;  1H74 A;  3T1Y E;  1A6F A;  1J5E I;  4DR2 I;  5K36 A;  4JI8 I;  2UXC I;  2O1T A;  4LF8 I;  4MDT A;  4WUB A;  3GON A;  3M7N D;  3NZK A;  2Z5E A;  1UDN A;  4DU8 A;  4NXN E;  1N33 E;  2CVE A;  1RRE A;  2JEB A;  2NN6 A;  4BA2 A;  4LCG A;  1N34 E;  4PU9 A;  4JV5 I;  5IT9 Q;  1OJ4 A;  3PYE A;  1Y5Y A;  4IFD D;  1FNM A;  1Z0T A;  2BR2 B;  4YY3 E;  2UUB I;  1IBM I;  1ZM4 A;  4OO1 D;  3PS2 A;  4MU0 A;  3LNU A;  4X62 I;  2JE6 A;  2PO1 B;  4DV0 I;  1HK7 A;  4DPT A;  4B3M E;  3QT5 A;  4HAC A;  3L7Z A;  4IZJ B;  3J81 Q;  4DUZ E;  2UXB E;  4JI7 I;  1Z59 A;  4FWG A;  1XHK A;  3M7N G;  4X66 I;  5JEA E;  4RPF A;  5C0X A;  2X36 A;  4MU4 A;  5JEA C;  1UDO A;  5DRP A;  1Y4S A;  2V2Z A;  2VQF I;  2IER A;  3H4L A;  4DR3 I;  3CDJ A;  4LF6 E;  3HUL A;  2DEJ A;  1Z0G A;  4DV4 E;  5JEA B;  1OYR A;  4K0K I;  4JI2 E;  1PKP A;  1PVG A;  1IBK E;  4LF5 I;  1S4E A;  3J7A G;  3CDI A;  3OTO E;  5IT9 C;  4YHH E;  1HNZ E;  3M85 G;  1KTV A;  4AID A;  4DV5 E;  1FI4 A;  4DR1 I;  2J7K A;  3QT6 A;  5K36 D;  5A2Q Q;  1Z5A A;  4DV7 I;  1N36 E;  2OI2 A;  2IES A;  2UU9 I;  4FWH A;  3J81 C;  4J3D A;  4OZE A;  3T1H E;  2E5L E;  1MG7 A;  3Q6N A;  1ZM3 A;  4JI1 I;  2DEI A;  3J7A M;  3U1Y A;  5GMD A;  1EA6 A;  4JI3 E;  2NN6 D;  4R1F A;  2BM0 A;  2WP8 A;  4IFD F;  3B82 A;  4DR5 I;  4ED4 A;  3DD6 A;  4GKJ I;  2O1V A;  3PS3 A;  4OO1 A;  4EMD A;  1B62 A;  4OO1 F;  1XMO E;  2V34 A;  4FW5 A;  1ZM2 A;  1HR0 I;  4B3T E;  4HY1 A;  4DV7 E;  2C38 B;  2WNR B;  1Z5B A;  2ZM6 I;  4I3H A;  4HYM A;  4AQY I;  5A2Q C;  3P3G A;  1R6L A;  1FJG I;  4JI5 I;  1XNR I;  4JI0 E;  2HK3 A;  4DPX A;  1VIS A;  3B4T A;  2BA0 D;  4AIM A;  2PO0 A;  5C0X D;  2IOQ A;  3Q6M A;  1D6T A;  2GS8 A;  2C39 B;  2A2C A;  4FW7 A;  2NN6 C;  2PO2 B;  2NPF A;  4OX9 I;  3HKM A;  4AM3 A;  1S16 A;  2Q2E B;  3QT7 A;  4Z7C A;  4GKK I;  4UTG A;  1YHC A;  4B3R I;  3PRY A;  4BA2 B;  1U2R A;  4KQV A;  5K36 F;  4NXM I;  1XMQ I;  3B78 A;  2Z5B A;  2CG9 A;  2O3Z A;  4USK A;  3H1C A;  4DUY E;  4WUC A;  1IBL E;  2JEA A;  4ISA A;  4FW9 A;  2PNM A;  5LMN I;  1R6M A;  2UUA I;  4IZK A;  2HHH E;  1HNX E;  4DV2 I;  4DV6 I;  4DR4 E;  2JT2 A;  4GQU A;  3L7Z B;  5DRQ A;  3QT8 A;  3V2U C;  2CZ9 A;  2NN6 F;  2ZBK B;  1UDQ A;  3K85 A;  4MU1 A;  1Z0C A;  3JAM Q;  4LFB I;  4X65 I;  3GLL A;  1J5E E;  4DR2 E;  3J80 Q;  1PIE A;  4JI8 E;  2VQE I;  2UXC E;  1NZ0 A;  4NXM E;  4U3B A;  4LFA I;  4DU7 A;  4PRV A;  4LCF A;  4LF8 E;  2UXD I;  4HXZ A;  4LCH A;  4X64 I;  4JI4 I;  1KIJ A;  1BKN A;  5ELW A;  5LMN E;  1Z0W A;  1OYS A;  1DAR A;  4QNJ A;  3WU6 A;  4LOM A;  4DPW A;  5C0X F;  4JV5 E;  3ZKB A;  2BV3 A;  4JYA I;  1UDS A;  1XXE A;  1Z0B A;  5BR8 I;  1YH8 A;  2UUB E;  4IFD E;  1IBM E;  2HKJ A;  1H73 A;  4DR7 I;  4IFD C;  3JAM C;  4X62 E;  4OO1 E;  1USU A;  4DV0 E;  5IWA I;  1I94 I;  4LF7 I;  2E1R A;  4OO1 C;  2F1D A;  2GQ0 A;  3J80 C;  4B3S I;  4JI7 E;  4IFD B;  4DV3 I;  2BR2 A;  2C37 A;  4X66 E;  4OO1 B;  2AJ4 A;  2VQF E;  2PO1 A;  1UEK A;  2V8P A;  4DR3 E;  5L3J A;  4P52 A;  4IZJ A;  1XNQ I;  2AE8 A;  4N3O A;  3LPS A;  5EKW A;  2WW4 A;  4PRX A;  4LFC I;  5BR8 E;  2CGE A;  4DR6 I;  4K0K E;  2Z5C B;  1B63 A;  4OKG A;  4LF9 I;  4LF5 E;  1E3H A;  1QZR A;  2GO4 A;  4DXL A;  4P7A A;  4DPY A;  4KHP I;  4DR1 E;  2PNZ A;  4LF4 I;  1OYP A;  2PO0 B;  1ZM9 A;  5LMU I;  4FW3 A;  5K36 E;  1N0U A;  2UU9 E;  5K36 C;  3PS1 A;  3P3E A;  4JI1 E;  4DV1 I;  1NHI A;  4JI6 I;  3U1K A;  2UUC I;  5K36 B;  2HK2 A;  1MX0 A;  1Z5C A;  5FWK A;  1N32 I;  2X7I A;  2NN6 E;  4DR5 E;  4GKJ E;  1HNW I;  1ELO A;  4QNK A;  3P3C A;  3T1Y I;  2BA1 D;  1H7U A;  3LTO A;  1HR0 E;  1RR9 A;  2JEB B;  2NN6 B;  2ZM6 E;  1FKA E;  4AQY E;  3ZZT A;  3PYG A;  4U3D A;  1FJG E;  4JI5 E;  1XNR E;  3K17 A;  4NXN I;  4DPU A;  1N33 I;  3M6A A;  2V2Q A;  4Z7Y A;  2C38 A;  2WNR A;  5DRR A;  2JE6 B;  3D4J A;  3V5R A;  2HKE A;  4BA1 A;  5C0X E;  2BA0 G;  1N34 I;  5EL9 A;  2GO3 A;  4HAC B;  4IZJ D;  5C0X C;  4OX9 E;  1MU5 A;  1Z0V A;  4YY3 I;  2BA1 G;  4GKK E;  1KVK A;  4B3R E;  4M1K A;  5C0X B;  3F0N A;  3WU3 A;  2VES A;  2HFU A;  2C39 A;  3GCM A;  1ZXM A;  4NBQ A;  4B3M I;  2ZIT A;  1XMQ E;  2PO2 A;  3Q1Q A;  4WUD A;  4DUZ I;  3ZZU A;  2UXB I;  2O1W A;  3ZKD A;  5JEA D;  3HJC A;  2R42 A;  3PYD A;  1VI7 A;  2UUA E;  2A2D A;  4XTJ A;  4DV2 E;  4DV6 E;  4LF6 I;  1ZXN A;  1NHJ A;  2O1U A;  4DV4 I;  5FLX Q;  2C37 B;  3CWV A;  4LFB E;  4X65 E;  4JI2 I;  1IBK I;  3M85 D;  3OTO I;  4YHH I;  2VQE E;  1HNZ I;  4LFA E;  4DV5 I;  3WU4 A;  1Y4U A;  5GME A;  2UXD E;  3KRN A;  4MYT A;  1NHH A;  4X64 E;  1E3P A;  4JI4 E;  2R3V A;  1WUU A;  4MYU A;  2EFG A;  1N36 I;  2WP8 B;  1KKH A;  3T1H I;  2E5L I;  4LPF A;  2PNZ B;  4JYA E;  4JI3 I;  3P06 A;  5DNX A;  2F4V I;  1Y6Z A;  2V2V A;  5FLX C;  4DR7 E;  4ZVI A;  1XMO I;  5IWA E;  1I94 E;  4LF7 E;  4B3T I;  4MQY A;  3K1J A;  2VF3 A;  4B3S E;  3P76 A;  4DV3 E;  5JEA A;  4IS9 A;  5JEA F;  1RHY A;  2J65 A;  4USM A;  4UT4 A;  2HFS A;  1USV A;  1Z0E A;  4JI0 I;  5LMU E;  4URL A;  1XNQ E;  3WU5 A;  4LFC E;  4IFD A;  2F4V E;  4DR6 E;  3ZM7 A;  1N0V C;  1FWL A;  4FW6 A;  4LF9 E;  4FN5 A;  1Y60 A;  3B8H A;  3GME A;  2LJP A;  2Z5B B;  3UHM A;  4KHP E;  4JG4 A;  2JEA B;  4FW4 A;  4LF4 E;  5DRO A;  4BA1 B;  4IZK B;  2Z5C A;  1P42 A;  4MU3 A; 
#chains in the Genus database with same CATH homology
 4QNJ A;  5ELW A;  4LOM A;  5DNL A;  4MU3 A;  2AE8 A;  4MU1 A;  4QNK A;  4LPF A;  5EKW A;  1RHY A;  4MU0 A;  5EL9 A;  4GQU A;  2F1D A;  5DNX A;  4MU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...