4LPFA

Crystal structure of mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazoleglycerol-phosphate dehydratase
publication title Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
total genus 60
structure length 190
sequence length 190
ec nomenclature ec 4.2.1.19: Imidazoleglycerol-phosphate dehydratase.
pdb deposition date 2013-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA01
3.30.230.40 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Imidazole glycerol phosphate dehydratase; domain 1 4lpfA02
4GQUA 4MU3A 4LOMA 5DNXA 2F1DA 4MU0A 4LPFA 5ELWA 5EL9A 4MU4A 5DNLA 2AE8A 5EKWA 1RHYA 4QNJA 4MU1A 4QNKA
chains in the Genus database with same CATH superfamily
2BA0D 1B63A 2X36A 2IOQA 4HACB 4UTGA 4GQUA 2V34A 4JV5E 3PYFA 4FW9A 2UUCI 4UT4A 3PS3A 1N32E 2BM0A 1HK7A 3M85D 4JI6I 3Q6MA 4FWHA 4LCFA 1MU5A 4IFDE 1UDOA 4AM3A 1ELOA 2BA0G 1H72C 4QNJA 2PO0B 5JEAC 2ZM6E 1VI7A 2VQFE 2UUAE 2J7KA 5EKWA 2BV3A 2PNMA 3M85G 4X62E 2C37A 4B3ME 2V2VA 2ZM6I 2VQFI 2IERA 2UUAI 4P52A 2NN6A 2JEAB 1NHJA 5GMEA 5FWKA 1UEKA 1FI4A 1K47A 4MU4A 4DV2I 2R3VA 1PKPA 4DR6E 2HK2A 1I94E 2BR2A 4B3MI 1VISA 4USMA 2X7IA 2R42A 2LJPA 4DV0E 3P3GA 1QZRA 1UDSA 1FNMA 4AIDA 4DPUA 4DR6I 1D6TA 1Y60A 2JEBA 4KHPE 4B3TE 4HY1A 2Z5CB 4P7AA 4DV0I 1E3PA 4LF6E 1N33I 3WU3A 3T1HE 2UXCE 3J81Q 2BM1A 3QT6A 3PS1A 4BA2B 3ZKDA 5K36A 4WUBA 4DU8A 4KHPI 4B3TI 1Z59A 1KTVA 4LF4E 3QT7A 4DPTA 1ZXMA 2C37B 2E1RA 2NN6E 2WP8B 4Z7YA 4LF6I 5K36F 4FWDA 1YHCA 3T1HI 4RPFA 1FWLA 2UXCI 1RR9A 1MX0A 2NN6B 2GS8A 4GKKI 1ZM2A 2PNZA 1Y4UA 4IFDA 4DUZE 4LF4I 2O1WA 1UDNA 3PRYA 2UXBE 4Z7CA 4IFDF 3T1YE 1Z5BA 2BR2B 3V5RA 1YH8A 3ZZTA 2GQ0A 1OYRA 4LF5E 2PO2A 4IZJD 5IWAE 5DRQA 1S4EA 2CGEA 2NN6C 4ZVIA 2IOPA 2AJ4A 4DUZI 1WUUA 2PO1A 2UXBI 1Z0EA 2BA1D 2WW4A 5LMUE 4MYUA 2JEBB 1Z0VA 3T1YI 4DV7E 3K1JA 3ZZUA 2OI2A 3GONA 4LF5I 4LF9E 5IWAI 1HR0I 4DR7E 3B78A 2DEIA 1H7UA 4OO1D 2BA1G 5K36B 4DV7I 4X65E 5ELWA 4LF9I 3Q1QA 4DR7I 2Z5CA 1A6FA 4FWGA 4DU7A 4LFBE 4OO1E 4B3SE 5LMNE 5A2QC 4X65I 1ZM3A 4JV5I 2JT2A 2PNZB 4DR2E 4IFDB 4BA2A 5K36C 1N32I 2O1UA 3JAMQ 4JI5E 5EL9A 1B62A 5DROA 4M1KA 2WP8A 3M7ND 4FW3A 2PNLA 1HNWE 4OX9E 1RREA 2PO2B 1UDQA 4B3SI 5LMNI 2GO4A 3P06A 4DV4E 4MQYA 2V2QA 2V8PA 4DPXA 4NXNE 4JI5I 4IFDC 3GLLA 2PO1B 4QNKA 2NN6F 3QT5A 4X62I 4YHHE 4MU0A 3GMEA 4DR5E 4LFCE 1HNWI 4DUYE 4OX9I 3M7NG 4IFDD 4B3RE 1PVGA 4DV4I 1PIEA 2Z5EA 2C39B 4JI8E 4NXNI 4HYMA 1OJ4A 2UXDE 4DV6E 3K85A 1XNRE 4YHHI 4OKGA 4DR5I 3P3EA 4LFCI 1HNXE 1H7SA 4DUYI 1I94I 2WNRA 1IBLE 4XTJA 4B3RI 4HXZA 1H74A 2XEXA 1KKHA 1R6MA 4JI8I 4MU3A 1EI1A 2HKEA 4PRXA 1HNZE 1XNRI 1Z0CA 1ZM9A 2IESA 4IZJA 1HNXI 2VQEE 4IZKA 4X66E 5GMDA 1IBLI 3WU6A 5DNXA 2UUBE 4JI1E 1Z5AA 1N0VC 3U1YA 5L3JA 4WUDA 3J7AM 2VQEI 4JG4A 1RHYA 1OYSA 3OTOE 3P3CA 2JE6A 4LPFA 2UUBI 4JI1I 4U3DA 4OO1A 4NBQA 3D4JA 3NZKA 5C0XD 4FW6A 3H4LA 2AE8A 5FLXQ 1MG7A 5IT9Q 1Z0WA 1Y4SA 2O1VA 3F0NA 4OO1F 3OTOI 1N36E 4USKA 4J3DA 1NHHA 3LNUA 1FJGE 3J81C 2ZBKB 2A2DA 5C0XE 3PS2A 2WNRB 4IS9A 2CVEA 2Z5BB 1ZXNA 1IBME 1Z5CA 2CZ9A 4DR1E 3B82A 1U2RA 2ZITA 3H1CA 4DPWA 1N36I 5JEAD 2C39A 4U3BA 2HKJA 1FJGI 1USVA 4IZJB 4MU1A 5LMUI 4IZKB 4I3HA 4JI0E 3QT8A 3PYGA 3PYDA 1IBMI 2C38A 1KIJA 4YY3E 1Z0BA 4DR1I 3LTOA 3U1KA 5JEAE 5DRPA 2VF3A 2EFGA 4JI0I 1OYPA 1USUA 5FLXC 4WUCA 2E5LE 2JE6B 1N34E 4YY3I 4JI3E 3KRNA 4OO1B 2HFUA 4R1FA 3UHMA 2UU9E 4LFBI 4DV5E 2E5LI 4AIMA 3M6AA 1J5EE 4DR2I 1N34I 4JI3I 2DEJA 4DV3E 3WU4A 2O1TA 2UU9I 3WU5A 4OO1C 2Q2EB 3GCMA 5DNLA 4DV5I 4JI2E 4ISAA 4DV2E 2F4VE 4BA1A 4ED4A 3PYEA 2A2CA 3J80Q 1J5EI 3HKMA 2VESA 4DV3I 4AQYE 4LCHA 3ZZ0A 1S16A 4JYAE 3B8HA 1EA6A 1NZ0A 4JI2I 1H73A 2C38B 2O3ZA 2F4VI 4LF7E 2GO3A 3L7ZB 2Z5BA 1IBKE 3JAMC 5C0XA 4AQYI 1Y6ZA 4DV1E 1P42A 4NXME 4JI7E 2UXDI 4DV6I 4JYAI 1Y5YA 4DXLA 1N0UA 4MDTA 1N33E 5C0XF 4PU9A 4LF7I 4URLA 1KVKA 3P76A 1XHKA 1IBKI 2HK3A 3B4TA 4LFAE 1NHIA 4DV1I 4NXMI 3CWVA 4JI7I 1XMOE 1DARA 1HNZI 2J65A 4MYTA 4N3OA 2NN6D 1R6LA 1FWKA 3HULA 4X66I 3J80C 1BKNA 5JEAA 4FN5A 4FW4A 4GKKE 3J7AG 4LFAI 4HACA 5JEAF 4DR4E 1XMOI 4LCGA 4BA1B 5BR8E 1ZM4A 2HFSA 5LL6R 2HHHE 4DR3E 2PO0A 3V2UC 3K17A 2V2ZA 3DD6A 4DR4I 1Z0TA 2NPFA 4GKJE 4LF8E 5BR8I 3LPSA 2CG9A 1XNQE 1Z0GA 5C0XB 2F1DA 4X64E 4FW5A 3ZM7A 5A2QQ 1XMQE 4JI4E 2HHHI 4DR3I 3ZKBA 4K0KE 1HR0E 4LOMA 1FKAE 5K36D 2JEAA 3CDJA 4GKJI 4LF8I 4DPYA 3HJCA 1XNQI 3L7ZA 4OZEA 5DRRA 4X64I 1XMQI 4FW7A 4JI4I 2UUCE 1XXEA 5C0XC 4K0KI 4PRVA 4JI6E 3Q6NA 5K36E 1E3HA 4EMDA 3CDIA 4KQVA 5IT9C 5JEAB
chains in the Genus database with same CATH topology
4GQUA 4MU3A 4LOMA 5DNXA 2F1DA 4MU0A 4LPFA 5ELWA 5EL9A 4MU4A 5DNLA 2AE8A 5EKWA 1RHYA 4QNJA 4MU1A 4QNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GQU A;  4MU3 A;  4LOM A;  5DNX A;  2F1D A;  4MU0 A;  4LPF A;  5ELW A;  5EL9 A;  4MU4 A;  5DNL A;  2AE8 A;  5EKW A;  1RHY A;  4QNJ A;  4MU1 A;  4QNK A; 
#chains in the Genus database with same CATH topology
 2BA0 D;  1B63 A;  2X36 A;  2IOQ A;  4HAC B;  4UTG A;  4GQU A;  2V34 A;  4JV5 E;  3PYF A;  4FW9 A;  2UUC I;  4UT4 A;  3PS3 A;  1N32 E;  2BM0 A;  1HK7 A;  3M85 D;  4JI6 I;  3Q6M A;  4FWH A;  4LCF A;  1MU5 A;  4IFD E;  1UDO A;  4AM3 A;  1ELO A;  2BA0 G;  1H72 C;  4QNJ A;  2PO0 B;  5JEA C;  2ZM6 E;  1VI7 A;  2VQF E;  2UUA E;  2J7K A;  5EKW A;  2BV3 A;  2PNM A;  3M85 G;  4X62 E;  2C37 A;  4B3M E;  2V2V A;  2ZM6 I;  2VQF I;  2IER A;  2UUA I;  4P52 A;  2NN6 A;  2JEA B;  1NHJ A;  5GME A;  5FWK A;  1UEK A;  1FI4 A;  1K47 A;  4MU4 A;  4DV2 I;  2R3V A;  1PKP A;  4DR6 E;  2HK2 A;  1I94 E;  2BR2 A;  4B3M I;  1VIS A;  4USM A;  2X7I A;  2R42 A;  2LJP A;  4DV0 E;  3P3G A;  1QZR A;  1UDS A;  1FNM A;  4AID A;  4DPU A;  4DR6 I;  1D6T A;  1Y60 A;  2JEB A;  4KHP E;  4B3T E;  4HY1 A;  2Z5C B;  4P7A A;  4DV0 I;  1E3P A;  4LF6 E;  1N33 I;  3WU3 A;  3T1H E;  2UXC E;  3J81 Q;  2BM1 A;  3QT6 A;  3PS1 A;  4BA2 B;  3ZKD A;  5K36 A;  4WUB A;  4DU8 A;  4KHP I;  4B3T I;  1Z59 A;  1KTV A;  4LF4 E;  3QT7 A;  4DPT A;  1ZXM A;  2C37 B;  2E1R A;  2NN6 E;  2WP8 B;  4Z7Y A;  4LF6 I;  5K36 F;  4FWD A;  1YHC A;  3T1H I;  4RPF A;  1FWL A;  2UXC I;  1RR9 A;  1MX0 A;  2NN6 B;  2GS8 A;  4GKK I;  1ZM2 A;  2PNZ A;  1Y4U A;  4IFD A;  4DUZ E;  4LF4 I;  2O1W A;  1UDN A;  3PRY A;  2UXB E;  4Z7C A;  4IFD F;  3T1Y E;  1Z5B A;  2BR2 B;  3V5R A;  1YH8 A;  3ZZT A;  2GQ0 A;  1OYR A;  4LF5 E;  2PO2 A;  4IZJ D;  5IWA E;  5DRQ A;  1S4E A;  2CGE A;  2NN6 C;  4ZVI A;  2IOP A;  2AJ4 A;  4DUZ I;  1WUU A;  2PO1 A;  2UXB I;  1Z0E A;  2BA1 D;  2WW4 A;  5LMU E;  4MYU A;  2JEB B;  1Z0V A;  3T1Y I;  4DV7 E;  3K1J A;  3ZZU A;  2OI2 A;  3GON A;  4LF5 I;  4LF9 E;  5IWA I;  1HR0 I;  4DR7 E;  3B78 A;  2DEI A;  1H7U A;  4OO1 D;  2BA1 G;  5K36 B;  4DV7 I;  4X65 E;  5ELW A;  4LF9 I;  3Q1Q A;  4DR7 I;  2Z5C A;  1A6F A;  4FWG A;  4DU7 A;  4LFB E;  4OO1 E;  4B3S E;  5LMN E;  5A2Q C;  4X65 I;  1ZM3 A;  4JV5 I;  2JT2 A;  2PNZ B;  4DR2 E;  4IFD B;  4BA2 A;  5K36 C;  1N32 I;  2O1U A;  3JAM Q;  4JI5 E;  5EL9 A;  1B62 A;  5DRO A;  4M1K A;  2WP8 A;  3M7N D;  4FW3 A;  2PNL A;  1HNW E;  4OX9 E;  1RRE A;  2PO2 B;  1UDQ A;  4B3S I;  5LMN I;  2GO4 A;  3P06 A;  4DV4 E;  4MQY A;  2V2Q A;  2V8P A;  4DPX A;  4NXN E;  4JI5 I;  4IFD C;  3GLL A;  2PO1 B;  4QNK A;  2NN6 F;  3QT5 A;  4X62 I;  4YHH E;  4MU0 A;  3GME A;  4DR5 E;  4LFC E;  1HNW I;  4DUY E;  4OX9 I;  3M7N G;  4IFD D;  4B3R E;  1PVG A;  4DV4 I;  1PIE A;  2Z5E A;  2C39 B;  4JI8 E;  4NXN I;  4HYM A;  1OJ4 A;  2UXD E;  4DV6 E;  3K85 A;  1XNR E;  4YHH I;  4OKG A;  4DR5 I;  3P3E A;  4LFC I;  1HNX E;  1H7S A;  4DUY I;  1I94 I;  2WNR A;  1IBL E;  4XTJ A;  4B3R I;  4HXZ A;  1H74 A;  2XEX A;  1KKH A;  1R6M A;  4JI8 I;  4MU3 A;  1EI1 A;  2HKE A;  4PRX A;  1HNZ E;  1XNR I;  1Z0C A;  1ZM9 A;  2IES A;  4IZJ A;  1HNX I;  2VQE E;  4IZK A;  4X66 E;  5GMD A;  1IBL I;  3WU6 A;  5DNX A;  2UUB E;  4JI1 E;  1Z5A A;  1N0V C;  3U1Y A;  5L3J A;  4WUD A;  3J7A M;  2VQE I;  4JG4 A;  1RHY A;  1OYS A;  3OTO E;  3P3C A;  2JE6 A;  4LPF A;  2UUB I;  4JI1 I;  4U3D A;  4OO1 A;  4NBQ A;  3D4J A;  3NZK A;  5C0X D;  4FW6 A;  3H4L A;  2AE8 A;  5FLX Q;  1MG7 A;  5IT9 Q;  1Z0W A;  1Y4S A;  2O1V A;  3F0N A;  4OO1 F;  3OTO I;  1N36 E;  4USK A;  4J3D A;  1NHH A;  3LNU A;  1FJG E;  3J81 C;  2ZBK B;  2A2D A;  5C0X E;  3PS2 A;  2WNR B;  4IS9 A;  2CVE A;  2Z5B B;  1ZXN A;  1IBM E;  1Z5C A;  2CZ9 A;  4DR1 E;  3B82 A;  1U2R A;  2ZIT A;  3H1C A;  4DPW A;  1N36 I;  5JEA D;  2C39 A;  4U3B A;  2HKJ A;  1FJG I;  1USV A;  4IZJ B;  4MU1 A;  5LMU I;  4IZK B;  4I3H A;  4JI0 E;  3QT8 A;  3PYG A;  3PYD A;  1IBM I;  2C38 A;  1KIJ A;  4YY3 E;  1Z0B A;  4DR1 I;  3LTO A;  3U1K A;  5JEA E;  5DRP A;  2VF3 A;  2EFG A;  4JI0 I;  1OYP A;  1USU A;  5FLX C;  4WUC A;  2E5L E;  2JE6 B;  1N34 E;  4YY3 I;  4JI3 E;  3KRN A;  4OO1 B;  2HFU A;  4R1F A;  3UHM A;  2UU9 E;  4LFB I;  4DV5 E;  2E5L I;  4AIM A;  3M6A A;  1J5E E;  4DR2 I;  1N34 I;  4JI3 I;  2DEJ A;  4DV3 E;  3WU4 A;  2O1T A;  2UU9 I;  3WU5 A;  4OO1 C;  2Q2E B;  3GCM A;  5DNL A;  4DV5 I;  4JI2 E;  4ISA A;  4DV2 E;  2F4V E;  4BA1 A;  4ED4 A;  3PYE A;  2A2C A;  3J80 Q;  1J5E I;  3HKM A;  2VES A;  4DV3 I;  4AQY E;  4LCH A;  3ZZ0 A;  1S16 A;  4JYA E;  3B8H A;  1EA6 A;  1NZ0 A;  4JI2 I;  1H73 A;  2C38 B;  2O3Z A;  2F4V I;  4LF7 E;  2GO3 A;  3L7Z B;  2Z5B A;  1IBK E;  3JAM C;  5C0X A;  4AQY I;  1Y6Z A;  4DV1 E;  1P42 A;  4NXM E;  4JI7 E;  2UXD I;  4DV6 I;  4JYA I;  1Y5Y A;  4DXL A;  1N0U A;  4MDT A;  1N33 E;  5C0X F;  4PU9 A;  4LF7 I;  4URL A;  1KVK A;  3P76 A;  1XHK A;  1IBK I;  2HK3 A;  3B4T A;  4LFA E;  1NHI A;  4DV1 I;  4NXM I;  3CWV A;  4JI7 I;  1XMO E;  1DAR A;  1HNZ I;  2J65 A;  4MYT A;  4N3O A;  2NN6 D;  1R6L A;  1FWK A;  3HUL A;  4X66 I;  3J80 C;  1BKN A;  5JEA A;  4FN5 A;  4FW4 A;  4GKK E;  3J7A G;  4LFA I;  4HAC A;  5JEA F;  4DR4 E;  1XMO I;  4LCG A;  4BA1 B;  5BR8 E;  1ZM4 A;  2HFS A;  5LL6 R;  2HHH E;  4DR3 E;  2PO0 A;  3V2U C;  3K17 A;  2V2Z A;  3DD6 A;  4DR4 I;  1Z0T A;  2NPF A;  4GKJ E;  4LF8 E;  5BR8 I;  3LPS A;  2CG9 A;  1XNQ E;  1Z0G A;  5C0X B;  2F1D A;  4X64 E;  4FW5 A;  3ZM7 A;  5A2Q Q;  1XMQ E;  4JI4 E;  2HHH I;  4DR3 I;  3ZKB A;  4K0K E;  1HR0 E;  4LOM A;  1FKA E;  5K36 D;  2JEA A;  3CDJ A;  4GKJ I;  4LF8 I;  4DPY A;  3HJC A;  1XNQ I;  3L7Z A;  4OZE A;  5DRR A;  4X64 I;  1XMQ I;  4FW7 A;  4JI4 I;  2UUC E;  1XXE A;  5C0X C;  4K0K I;  4PRV A;  4JI6 E;  3Q6N A;  5K36 E;  1E3H A;  4EMD A;  3CDI A;  4KQV A;  5IT9 C;  5JEA B; 
#chains in the Genus database with same CATH homology
 4GQU A;  4MU3 A;  4LOM A;  5DNX A;  2F1D A;  4MU0 A;  4LPF A;  5ELW A;  5EL9 A;  4MU4 A;  5DNL A;  2AE8 A;  5EKW A;  1RHY A;  4QNJ A;  4MU1 A;  4QNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...