The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
206
|
structure length |
206
|
Chain Sequence |
LMESWLIPAAPVTVVEEIKKSRFITMLAHTDGVEAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALRQLTTQRKTPLTEYTLQCEYHQLTGIEALLGQCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEEE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of YIGZ, a conserved hypothetical protein from Escherichia coli k12 with a novel fold
pubmed doi rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Escherichia coli
|
molecule keywords |
Hypothetical protein yigZ
|
total genus |
46
|
structure length |
206
|
sequence length |
206
|
ec nomenclature | |
pdb deposition date | 2003-12-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01205 | UPF0029 | Uncharacterized protein family UPF0029 |
A | PF09186 | DUF1949 | Domain of unknown function (DUF1949) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
Alpha Beta | 2-Layer Sandwich | Ribosomal Protein S5; domain 2 | Impact, N-terminal domain |