1VI7A

Crystal structure of an hypothetical protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
LMESWLIPAAPVTVVEEIKKSRFITMLAHTDGVEAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALRQLTTQRKTPLTEYTLQCEYHQLTGIEALLGQCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yigZ
publication title Crystal structure of YIGZ, a conserved hypothetical protein from Escherichia coli k12 with a novel fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01205 UPF0029 Uncharacterized protein family UPF0029
A PF09186 DUF1949 Domain of unknown function (DUF1949)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vi7A02
3.30.230.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Impact, N-terminal domain 1vi7A01
1U2RA 1ZPWX 1ZM9A 3B8HA 4ES2A 3LH2S 1KTVA 4ZCKA 1DARA 1N0VC 4ZCMA 3ZZ0A 5G4DA 3UI3A 2XEXA 2NPFA 4ZCIA 3E3XA 1ZM2A 2IVYA 1VI7A 2BM0A 2I0XA 1ELOA 4ZCLA 4M1KA 4FN5A 2BV3A 4MAKA 3ZZUA 2ZITA 2CVEA 4QR2A 1T95A 2KDOA 3B78A 4MYTA 2WBMA 4QR0A 2J7KA 2L9NA 1ZM3A 3B82A 4ES1A 3EXCX 2EFGA 2E1RA 3ZZTA 1FNMA 4QR1A 4TNOA 3OQ2A 1P9QC 1ZM4A 2BM1A 1N0UA 2I8EA 4MYUA 4ES3A
chains in the Genus database with same CATH superfamily
1NJWA 4DUYJ 4A8SA 3GV7B 3QT7A 3SZ2A 5GAHU 2JT2A 1PGZA 3BKTA 4MDTA 2KKHA 5DG8A 2QLWA 2PIIA 1OMSA 3VGTA 3FFIA 3OTCA 5KOWA 1TKXA 1U0HB 2COLA 1ZETA 2DHGA 2FTRA 3V6HA 4F3QA 3H40A 2MEWA 4B9VA 1UDNA 3UN2A 2DHAA 2LU1A 2KG1A 2RKIA 4FF1A 2AD9A 5RUBA 2J9DA 1NKCA 1R8CA 3KWMA 4A8YA 4F50A 4J5OA 4M8LA 1Q81T 2HHUA 4ZLJA 4JI4I 2F1FA 2V6AA 4Q8EA 3N01A 3J81Y 4R1FA 4UUXA 2FLOA 5J2NB 3ZNUA 3T1HJ 1FRKA 1WC0A 4OYXA 1X4BA 4ETXA 5HVGA 1P8GA 1SIZA 3MCSA 3MMAB 2DIUA 1XN9A 3MFHA 5IWAJ 3CDJA 1OQ3A 1WC1A 4CH7A 2EFVA 4IZKB 2UUCF 1KLMA 5EL9A 5BXIA 3NOCA 5B0CA 2R7XA 5LSRA 2NPIA 1RWMB 4TLQA 3QAEA 2EVZA 2VQFJ 2ZM6I 1F0XA 4E8UA 3U7JA 1RA7A 4CLSA 1U02A 4I2PB 1CJKB 4X4NA 3DOKA 3GWCA 3H20A 3DRPB 3OFGA 3PW0A 3OXFA 4LF5J 1SL2A 4W4MA 1G2EA 2PO2B 1BWEA 4B3MI 2YQ0A 2QL5B 2OKQA 1U26A 1VQSA 1VHIA 2IFXA 1UWBB 1H7UA 5DRRA 2CPXA 4ILMA 3WBZA 2D3ZA 4DQRA 4AIMA 3NWGA 3TARA 1SH0A 4S0MA 4IZJB 4LVNP 5EWFA 1Y00A 2VD3A 4EUVA 5BYQA 4IO1A 4DV5F 3KLIB 5JVHQ 4TN2A 1FDNA 2FHOB 3HF5A 5C0XB 1QAXA 3QSIA 2GA7A 1KQFB 5KFYA 3MR5A 2IA6A 2XZWA 5FLXU 2DH9A 2DK2A 4NLVA 2DCUB 2IVYA 5HMXA 2V68A 3Q8SB 4IFDC 1WHYA 2GHPA 1DQ9A 3CT9A 4CZCA 2QT7A 2CG4A 3NS7B 2MSSA 5HN0A 2MQ8A 4F04B 3G8QA 3MCOA 2QLBB 2DR9A 1U8SA 1VQNS 1NPPA 1JLBB 5ETKA 4JI5F 5C25B 3LGMA 4G1QA 4OJ3A 2X1GA 1N32J 1CS4A 1RTJA 4LRCA 1T0TV 2EK1A 4KIAA 2OH2A 2BA1D 3RR7A 4AUKA 3M8QB 4U7UK 3ZZPA 1XQIA 5LMUE 2FZKB 4AQYE 2OLWA 2FVCA 5FLXY 3UCGA 1OJ4A 1RP5A 2PD1A 2MKYA 4X62F 2PI4A 2VKRA 4ZHRB 3T41A 4PWUA 2K1RA 4I7FB 2IESA 4XDDA 2W7OA 3W5XA 2W9BA 3T1YI 1IKXA 4QYZJ 2X1BA 3C46A 1XJWB 2AX1A 3G6ES 2VHGA 2BDPA 3VV2B 1S1UA 4Y2IA 1VI7A 3PRVA 4ECTA 4JI7I 5KTQA 3A8EA 4F4AA 2F3JA 1L3SA 3D9BA 2HHHF 3CW2C 1S6QB 2GJFA 3CC2S 2HAFA 5CABA 2ZH1A 4ELTA 4DV3I 3ISND 4LPFA 2XMUA 1TV6B 2RHSB 3HM9A 4ZVEA 4OKGA 3FK4A 3B4DA 3P5TL 4OZNA 4DV0J 3MM9A 1YK9A 2Z56B 1HNIB 1F1BB 2RSQA 1WOOA 3MXHP 4LF4E 2Y0SD 2F8HA 2ZOFA 4RW8B 3J81C 1S72S 2A1BA 1FDBA 4XK8C 4HDHA 1EI1A 1HQEA 2MZRA 3TP2A 2XSJB 3UW1A 2J7KA 5KFLA 2GNKA 3HX9A 1KDNA 2FQQB 1VLYA 3QT5A 1VQ6S 3TA2A 2I5JA 1S1VA 1EETB 2MTLA 2ZZTA 3R5CA 2UUBI 4JV2A 4USHA 1GXLA 5ADZA 2UUAE 3EWGA 1ZM3A 2ZHOA 3GG0A 4QNKA 1KNZA 1TVRA 2BOPA 4JYAI 1IR0A 4PYDA 2G2YA 1YH8A 2OELA 2VFUA 3UNYA 2R7VA 4Y2AA 4EFAC 1N52B 2CQ1A 2V5HG 2PO0A 5KT3A 4UY8T 1FO1A 1OY8A 4U3BA 3PX6A 3FZBA 4XPCA 2KT5A 3BH7B 4Q43A 1HK7A 3SBMA 1X4AA 4B3SE 3M2UA 1YQHA 4NXMF 4OZ1A 3T9ZA 1HQ2A 2HFZA 1ZZNA 1A7GE 1HPZA 2YQ1A 2E1AA 1SL1A 2YTCA 3JTPA 3CCLS 1M5HA 2N4CA 5CXTA 4I2QB 3CO0P 4UZBA 1XMQJ 2F4VF 3P5BP 4CLPA 4YDDB 3KG0A 1Z5AA 2OPRA 4FZVA 2HVHA 1X4HA 4MT1A 1NDKA 1C1CA 3TAPA 1S4FA 2WW8A 4JI4E 1SKRA 2RMLA 2L9NA 3HKZD 4DV2I 4I64A 4DR2I 1FJEB 4DUZF 2GQ0A 3D28A 1HHTP 2HBRB 5DDOC 3OJSA 4FW3A 3TVZA 4DR7I 1C0UB 2RNEA 4ZN3A 1KHWA 1NZAA 1NK9A 3O44A 4WYLA 2MKIA 2VBYA 5KFAA 3OPKA 1HNVA 4WFBQ 2E1CA 1RT1B 3HT3A 3DDIA 2H54B 2WSFC 2BA0D 1USVA 4WFYA 4H4OA 4KH0B 2ZM6E 1KEKA 4TXSA 4TLRA 2P6TA 2AIRB 2JLGA 3D1QA 3CJQA 3NL0A 4IFDB 4GC6A 2RDIA 3H5YA 3ZXWA 1WEYA 1YZ6A 4PEOA 4B3ME 4MFBB 3KNAA 1JJHA 1V5IB 2E66A 3ULHA 2MHEA 1VJQA 3NCPA 3QJLA 1GK8A 2D69A 5JEAD 3I87A 4HDGA 1X4CA 3W2VA 1BQMB 4H4MA 1TK5A 2R2SA 2B51A 2R2TA 2ZBIA 1GH8A 2DR7A 3VVTA 3UCUP 1D09B 2VJUA 1GMWA 1F6TA 3BQ1A 4DLGA 5KFDA 1LXNA 1K1SA 4C11B 1R0AA 2F4FA 3J7AN 4B9LA 2ZUGA 1UVLA 3H2VE 1T7PA 3EYZA 1HI1A 3M85D 2DO0A 1XNQJ 4GKJJ 3FCHA 4DV5E 1K0TA 2OSQA 4RW4A 2NYIA 4Q0BA 2WSCC 3IAM9 2YY3A 4I3HA 1AA1B 4BA2A 5AJ3J 4OZ2A 5CYMA 3KLHA 3KLGA 3BREA 5HAOA 1S48A 5AE3A 2CVIA 4A8MP 2CWKA 2IDLA 2V0NA 4RNNA 4O0NA 2DEJA 1S0MA 3JSMB 1JJCB 4F0HA 5HMZA 4DZDA 2YX7A 3NLCA 4LFCJ 1BWVA 2BUNA 4Y3CA 3AY0A 3IS9A 1SUQB 4LR7A 2ZHAA 2I38A 1NKBA 3BGOP 4GMKA 5JEAA 3BSNA 2IRXA 2EFPA 5GAEU 1FXRA 5IFMA 3QRQA 1HWKA 1N36J 1R8BA 4M5KA 1J5OB 5M2RA 1XNRI 2E5LI 2PC6A 4KGKA 3GMEA 4IO9Q 3N0VA 2YPYA 1TKZA 4NXNF 1JXEA 2W4DA 5KFUA 3IXQA 2C2NA 5A8WA 4DCOB 5K14B 5J1NA 4UZCA 4XO0A 4DV6I 4LF8J 3TOQA 3ADAC 3JQJA 3B78A 2GX8A 3HHNB 1JLGB 1U1QA 3NP5A 3SCLE 3JQMA 4LSLA 3OL6A 3SSQA 3NOGA 4B3RJ 3MPUB 1HW8A 4LF6J 2ERRA 1RT3A 2B3TB 2QTWA 1WHWA 2HFVA 3RTVA 2HMIB 1JX4A 1DZ5A 3RW6A 2BABA 1OSDA 2M3DA 5IV3A 1VC6A 1UEKA 4OI0A 2ZVIA 3UNGC 1X0FA 1AZSA 1HBUA 4TU8A 2C22A 4OZLA 4CLZA 1WSRA 3CCVS 5E3QA 1OYDA 4OLOA 1VRTB 2MKKA 1HBMA 1YBTA 1DTTB 1U48A 4ES1A 3OFFA 1QY7A 4QIVA 3R5DA 3KNGA 1A6FA 2AYMA 3MEEB 3T5HA 4DL6A 4JYAE 5BR8F 3UD5A 2J9CA 2BANB 4NCGB 3V4IA 2VASA 3HO1A 3R6GB 4NLPA 3K58A 5GAHI 4JI0I 3TUPA 3E3XA 2NYHA 2JEIA 2C2OB 3NXZA 2BKNA 1S57A 2J7WA 2DGOA 2BE9B 2GFFA 3SEOA 4DV7J 4DX7A 2HHPA 4KE5A 4DR1F 4YHHF 4IG3B 3E51A 4ZLLA 4PXBA 1U1LA 3LQVA 4DV4F 2IHR1 4KJIA 1LW0B 3C15B 2CJYB 4ANEA 3MR2A 1GQEA 2B6AA 4W92B 2XLJA 4QIEA 2VIHA 2AKWB 1CULB 2V9KA 2Y1IA 4URLA 4J9SA 2ZH5A 2D7SA 4USVA 4LFAE 4XPEA 3J7Z5 1XMOE 1HKAA 2FLLA 3MGJA 3TAQA 2DEIA 4MIAA 2SXLA 2XI2A 3KK1B 4MU4A 1U1NA 2LYVA 2ZUAA 2CNLB 4ED6A 4H54A 1MWZA 3M8WA 3MCMA 4B02A 3AD9C 4WCEQ 3CDBA 2XYHB 2H9ZA 4L75A 3UHMA 4RZRA 1PBAA 1FX2A 3TA0A 3EUNA 2XO6A 4LFBI 1UEUA 2E1PA 3G82B 4FWDA 3H98A 2F8MA 5ITHA 2XCPA 4M1KA 4QW9A 4QR0A 3HT0A 1S79A 4DMZA 4HT5A 4FNHA 1KVIA 1N6QB 4E98A 4ECQA 2L3MA 2Z58B 4NBQA 4KQVA 4JI2F 1MW7A 1HBNA 2QYCA 4JV0A 3OL8A 3W9JA 3KLEA 2DGUA 1F3VA 2PI5A 3ZZTA 2X7IA 3MPWA 3CULA 4FYWB 1TKTB 4OYIA 1FKOB 2FB0A 4J37A 2Q43A 4CTAB 1WD6A 3PO4A 4P10A 1RU1A 1SJ4P 2DNYA 4LF7F 1T9XA 3GJQB 1NAQA 4CIOA 1RAFB 3BGRA 2OEJA 2EFNA 1FFGB 3H0PA 1TZ0A 4X66J 5K20B 3ET6A 3FBEA 3CE8A 2N7YA 1RCXB 2EG1A 1HNZE 3NGTA 2NXCA 3EM1A 1Y5YA 5DG7A 1SH2A 2O66A 2MHNA 1RKIA 4C8NA 4WKRA 1WKJA 4CNZA 1RWKB 1S6PA 2V34A 3C8YA 1RLDA 2RDJA 3DGPB 1WOSA 1FWPA 1HD1A 1W25A 1TTHB 4PRFA 1J5EI 1NKEA 2RE1A 3FUYA 2W1BA 1BKNA 3IP0A 3TUIC 4FW5A 2FHKA 4OZ0A 2MLXA 2D74B 1NBEB 2D1CA 2B5JA 2P8IA 2XS5A 1YG0A 1Y0HA 2F5GA 2Q66A 4J3DA 1RT4A 3OR2B 5EX0A 1VQ9S 5HANA 2VJVA 2O01C 3S01A 1UFKA 2C3PA 4OZJA 4NA1A 4ZN1A 3TNVA 1NHHA 3M9MB 3J7YI 1ZM4A 3OUYA 2WCXA 1Y4UA 2LECA 4YFUA 3EE3A 3M6VA 4R0EA 2N4DA 4X4RA 3BSOA 3UN3A 2RT3A 5F3ZA 2GIFA 1H38A 4U3DA 1VIXA 2DBBA 4J90A 3M2VB 5LMUJ 2MQPA 2DNNA 4FW9A 4JI8I 2E5LE 2M70A 2PO1A 3AD8C 4O3NA 1S1XB 1FJGF 4X65E 1MU2A 3CVKA 1DLOA 1B64A 2W01A 2JDJA 4Q7AA 4F0MA 2HWIA 2B8PA 2UUCI 1HQUB 4EBEA 2NUHA 1WEZA 2XYPB 3WU6A 3D6FB 3W63A 3QMQA 4P6QA 5KT2A 4JUZA 1RBAA 2KXFA 2B9WA 3RB4A 2Y1JA 1RHMB 5C0XD 3MMAA 3DLHA 2VF3A 3GLLA 1TL7B 3W3SA 4F2SA 3X1LB 3MM8A 2YWHA 4IZKA 2XB2D 2HURA 4PG8A 3DU5A 2QZ8A 2EBGA 4HH1A 2LU2A 2CVEA 1IKVB 1B3TA 4P2FA 3MM7A 3GIRA 1FCAA 5KFTA 5HLFA 3PFOA 3UI3A 5EWEA 4PR6A 3MFIA 4OQJA 3G6XA 1HR0I 2R7UA 3A3PB 3OFHA 3J81j 2XMAA 2Z57B 4OX9J 3KDNA 4Y0FA 4ZVQB 2MYFA 1Q8KA 3JSYA 1U6ZA 2OEKA 2MQLA 3HDSA 3PJ9A 5KFCA 1U0SA 4I6WA 5L1LA 2BQUA 4F2RA 4C9DA 4LF4J 4PG4A 1KKHA 4P74A 1UDSA 2X3GA 3LPSA 4URGA 1RABB 4ZPWR 3LP1A 1ZAWA 2Y1RI 3Q22A 2GC8A 1WG5A 4HEA9 3CCRS 4EYHB 2VFSA 3UCZP 1RWWB 1KQSR 1HBOA 2HNZA 3D1HA 1S12A 4KB7A 3RB6A 2CJBA 5C0XA 3FBBA 4WJBA 3LP2B 3LH2S 3THPA 3TEHB 1AFIA 3M8PA 3OVAA 2UUAJ 1RJJA 3AJ2A 2VG6A 3TYTA 1IQZA 1H7SA 2CQCA 4WXWA 4RU2A 2DNMA 1MWYA 4JI5I 3W61A 4JI0E 2RH3A 4LVOP 3JXOA 4ED1A 2M0GB 2H3EB 5L9XA 3WU3A 4IR1A 2AHOB 3VCDA 5BR8E 3CJ2A 3W62A 1YBUA 4DQPA 3A3OB 3ITHA 1QM9A 1R0BG 3H2LA 3GP9A 3V5RA 2AT1B 3PVXA 3I4PA 5HQ8A 3PW4A 4B3SJ 4DUYF 1U2RA 1E3PA 1TL3B 3SQGB 2IBOA 5LOQA 4DR1E 2C2RA 2FC9A 2XS7A 1LWCA 3TANA 1SQGA 3MMCB 2V69A 2NXUA 3G71S 2V4QA 3VAIA 1MN9A 3SV3A 3L7ZA 2R8JA 4QIGA 1I94I 1AXQA 2J0QD 3CD5A 1OWXA 5D3GA 5DNLA 3ILOA 4ERDA 2LCWA 3TUZC 2X1FA 5D78A 3FCVA 4OYAA 4DFMA 2HFNA 1RTIA 2DY1A 4C8YA 1Q95G 4EO8A 1NHIA 2HHHI 2P5VA 2V67A 3CSKA 5LM7E 1U6BA 4N76A 4JI4J 4ETZA 4EI2A 3T1HF 2B9XA 5I3QA 1UVJA 3GILA 2CQ2A 1X0PA 2GMJA 5IQQA 1U1RA 5IWAF 2VESA 1FFSB 2YNGA 2G2ZA 3QGHA 5K36E 3G96A 2XZTB 4JI2E 2O1UA 2R4FA 2IJFA 4M5DA 1PKPA 2ZM6J 4ELUA 1HL6A 1CJUB 4K0KI 4OJ1A 4ZKAA 1WTFA 2J0WA 3MI7X 4LF5F 2PSZA 4QR2A 1SC6A 3MEKA 4PYAA 4IFVA 2P9EA 2BW2A 2RQKA 2C39B 1C4CA 2L41A 4B3MJ 1F9EB 1EKRA 1J2VA 2WONB 5D6GA 2J6SA 1YITS 1NZ8A 1YSJA 3NG8A 3IM9A 3I56S 3OT9A 3DOLA 4K7QA 1N5TA 3BQ0A 3EJMA 4NLYA 3BV8A 1UKUA 1TL1A 1Z59A 4FS2A 5L8RC 3PDNA 4HHHA 4X64I 1FRLA 4TY8A 2C1EB 1YJ9S 4RL1A 1KN6A 4HACA 1E6YB 1J5EE 2W7PA 2CQPA 2E1MC 4FKYA 2VFVA 2RILA 3M8YA 3DOMB 3HPOA 4EBCA 2C2EA 3I55S 2GQCA 4ZP6A 2UVUA 3D1OA 5C42B 2FY1A 1Z0WA 3UPFA 3DRYA 3KLFB 3LF0A 3PYGA 4WP9A 1TL4A 1FE0A 1YX2A 3LAKA 4B3TI 1YHQS 5GAEI 1WC4A 1FXDA 5K36C 4E0DA 4IFDD 1WWHA 1N32F 5U47A 4DPXA 3PHTA 1ITPA 4OI1A 1P9QC 1N34E 4C8LA 2V2ZA 4USIA 2W9AA 1SV5B 1HNXI 3T3FA 2L48A 3O3LA 1D8YA 3IG1A 1X5TA 3DRRB 2VC0A 2IC3B 3I5AA 4DV1I 4I2QA 3FGVA 1RBOB 3MR7A 3VGUA 2HNYA 4USUA 4JI8E 2RS8A 3DD6A 3FVYA 4KO0A 2UXDF 2AGOA 1LQ9A 3PG9A 3I31A 3VQTA 3DRXA 3B6BA 2RS2A 5EX3A 3FFIB 2NN6E 2XMWA 1TKXB 4LMZA 2GVDA 2W4PA 1U6FA 3PRDA 2KYZA 2XSFA 3LA0A 2V8DA 3T1YJ 4MMOA 1ZXMA 1FJGE 1DTQA 1V5VA 1P6TA 2RKIB 4NLTA 5D4LA 2EWHA 1CC7A 4J9RA 4KGZB 1C0UA 1HWIA 2E7WA 1F5BA 3PIOQ 1RHKB 1EP4A 1CSJA 4F4XA 2MSTA 1VHFA 2EPIA 4IYQA 1YDLA 3LANA 2E9TA 1NJZA 1X4GA 4DV3J 2FJAB 4O44A 3U1MA 2PFDA 2QMXA 4O3OA 2QL7B 4Z2XA 1HR0E 2H4WB 3EICA 1KLMB 2YQ3A 4UUWA 4QYZK 1XEZA 1SH3A 4FXWA 3CUNA 2L9DA 1JLEA 3RUBL 3TZWA 4X4SA 4FN5A 1APSA 4FF4A 3KJVA 3QT6A 3BJYA 2JVRA 2AYGA 2MKHA 3HSGA 4ZVHA 3BYRA 2WZ1A 2UXBI 4DOZA 4ZJLA 4LOMA 1SL0A 4HVZA 3DXBA 4ZVRB 1P1LA 3D54A 5CCMA 5L1IA 3EGVA 1MLAA 1NEEA 5HJYA 2NR0A 1LWXA 2UUBJ 2AWZA 2Z2YB 2NN6C 3ZZZA 4I6YA 3H4DA 1N48A 2HHXA 2PDAA 5HL7Q 4JYAJ 3GTYX 1Y5NB 3DLKA 5E3CA 2KRBA 2CJQA 3VALA 1NH7A 3D3CJ 3N79A 3IGVA 4PXEA 1XBWA 1H6KX 3JSMA 2ZE2B 2LEPA 3O2IA 4B17A 1MU5A 4AT1B 2ZJQQ 4DR4I 1S99A 5KT4A 3BM7A 1PCAA 1HHQA 4FXDA 1FTCA 2JOQA 2XG8A 2WB1D 2OIHA 3RW7A 4C2MA 1XMQF 1I94E 4DUYE 1UW9A 1KR4A 5GMKa 2D3OR 3G87A 4YB5A 1CS4B 1RTJB 3GFZA 1ACMB 1J5OA 4LFAJ 1XMOJ 2DNPA 3WIUA 1WOPA 4TY9A 4JV1A 1FKAF 2ZITA 2R42A 4LIWA 3OR1A 2PMZD 1U8WA 4DV2J 4IH6A 5J2QA 1UJ5A 2K1RB 2CIMA 4DR2J 1QSSA 2XMTA 1Z2ZA 1SJRA 3ZZUA 5DRKA 1FD2A 2W9BB 1QE1A 2OI2A 4DR7J 3T1HE 1RKJA 3KMSA 2J0XA 2IJNA 1TU0B 1XC9A 1GX6A 1T03B 1S1UB 5IWAE 2DXDA 3A1YG 4QIFA 1S7IA 5J2MB 2YWWA 4NLWA 2WVEA 4K0KE 3EGNA 3N5FA 3VTIA 2FHJD 4KV8A 2VQFE 3DYAA 4WK1A 1N33F 2LJPA 4ZLPA 2XULA 2FGOA 4PG6A 1TL5A 4DPTA 1UP1A 3HVTB 2VICA 1RTHA 4FKXA 4LF5E 2XLIA 1YWXA 3MM9B 4DSJA 3B8HA 1W2IA 1IBMI 2P9CA 4RW9B 2YKOA 5DROA 3GIIA 1RAIB 3RBDA 4U67Q 6FD1A 1FEHA 2A6OA 3HHDA 3GV5B 1GXUA 3IR5B 4X64E 3T6BA 1Z1ZA 3CNQP 1M5KC 5F8JA 4DPOA 4HY1A 1RCOB 2DYAA 4F4ZA 4RBVA 2GHWA 2HWTA 2OP5A 5ETNA 2XEXA 4J9MA 1HQEB 3IRXA 1RISA 2YBVA 1NK0A 3PKYA 4GKJF 4C48A 3RAQA 2EFOA 2KG0A 3BGUA 4PUOA 4YHHI 2ZH7A 2RU3A 4JB8B 1CQNA 1JLFA 1S0NA 5A6WA 1S1VB 4M5IA 5F8IA 4C0HA 2O3DA 5AJ3F 2CYYA 2GW8A 3MECA 2VZ9A 4Q2LA 1R3NA 5AE1A 2V2QA 3ZM7A 4KRWA 1FHTA 2C3YA 2M5YA 1FDDA 2YKMB 1KQGB 4KYZA 4B3TE 2FHJA 4NEZA 4U95A 2VQEF 2PO0B 4LFCF 5IT9Q 4OX8A 3KHGA 2WAQD 3MWBA 1LW2A 4N77A 4M5NA 1PSDA 1RAJA 4PQAA 2JC1A 4PWDA 2UV8G 4DWIA 4I67A 4DV1E 2BEFA 5KG0A 5BYSA 1IWGA 3PYFA 2L9WA 4Z7CA 3VAMA 3M2UB 4FWGA 1N32E 1WJ9A 3I5BA 4ANDA 3M05A 4C3LA 2IRUA 1HPZB 1N36F 3AH6A 1W26A 1S4EA 2VFTA 1X5OA 1XNRJ 2E5LJ 3TW0A 4ZVTB 2QLXA 1UVKA 3BYPA 4B9NA 4USJC 2CNOB 3ENVA 3S8SA 2OPRB 3BBBA 2LKZA 1M1HA 2KN4A 1C1CB 3RBXA 1B7YB 2ASLA 2KFYA 2MZTA 1N6QA 1S6OA 3MM6A 2KI2A 3T5LA 5KFOA 4H4KC 4PG5A 3T5JA 2WW4A 1TAUA 5D0EA 4NRUA 4LF8F 2NS1B 1QDUB 4UY85 4LRFA 1F5CA 3FRZA 1S0VA 2QFIA 5CHCB 2AGQA 4X84A 2GHVC 3MMJA 4ZCLA 4UOGA 4IFYA 4B3RF 3M6XA 4PQUB 1HNVB 2GIRA 4AL7A 4ZVOB 4CTAA 2V8VA 4LF6F 4H4OB 4NE9C 4LUBA 3GYXB 2YKPA 4K59A 1EIYB 4DV0E 4DL2A 3AA9A 2Q2EB 4WF9Q 4ZOSA 4JOUA 3MEDA 1VQ5S 2UXBE 4U7UD 2K3IA 3P3EA 1XR7A 3RU0A 3EZOA 3KK3B 4OX7A 2O1PA 2RUSA 3BR9A 5F9LA 4YY3I 1BQNA 4P52A 3R7NB 2LA4A 4RNMA 3HXMA 4IQMA 2R7QA 2M4MA 4WE1A 4Y2CA 2P2CB 1NNDA 2E5HA 2HRYA 1EARA 2CQIA 4LSNA 2ZHBA 3W2VB 4H4MB 4OI6A 4UOHA 1PJ6A 2D3O1 3GIKA 2C2KB 1R0AB 3DLEA 2RHQB 4ZPTR 4HI1A 4B08A 2ZC4A 2MDAA 4O3QA 4JI0J 1UDOA 1Q86T 3FDSA 4DV7F 1UVNA 1MMLA 4NA3A 4WU3A 5T41A 5GADU 3B4TA 2B7BB 4RW4B 1N88A 4Q0BB 2QMWA 4DR4E 1FXLA 1EZZB 2Q6CA 4BA2B 2W2PP 2XBPA 5CYMB 3KLGB 4EEYA 4QWCA 3DDNA 3JSRA 1LOUA 4U6PA 2ZDPA 4WIQA 3DMJA 1FF2A 4JV5I 1XXEA 1R8AA 2OUGA 2G1HA 3AD7C 1DRZA 4ZK7M 3P3GA 5KFBA 2WNRA 2ROGA 3G86A 2EBEA 2G0CA 1OO0B 1JIHA 2RQ4A 4BBYA 3IS9B 3D0HE 4ZMMA 1IR2A 1S1XA 3RAXA 1XERA 4MKYA 2KT2A 2APOA 3NKYA 1RHUB 1ULRA 1F2HA 2HWHA 2Q3PA 1WF0A 3PHEA 4I56A 4A8WA 3TVKA 4LFBJ 1NB7A 3HSZA 2HZCA 3B54A 1KWMA 1W2BR 5L39A 4HYMA 4RUAA 3PRYA 3DRSA 4NOHA 3CWJA 4DL0C 4Y2MA 3K2YA 2GIQA 3EVOA 1TKZB 2AYEA 4PPDA 2PEHA 3NCQA 3GSDA 2HQFA 1NHUA 3PS3A 2HQCA 4ZVPB 1Y7PA 3OSPA 2ZC3A 4WIIA 3ZFVA 3OVBA 4NASA 4B3OA 2CG8A 5DRPA 5ETSA 4AXIA 4OV1A 3EZ5A 3PX0A 1R6LA 2IOPA 1NXIA 1FNOA 2DY9A 3H8YA 1G3OA 2KO1A 3F44A 2MY7A 4X66F 4O3SA 1IBKI 3D67A 2YWFA 3OXLA 1C0TA 1L3KA 1RT3B 2PNMA 1SKSA 1M5VC 3EGZA 1SVDA 1CJTA 4KHPI 4O23A 2IBKA 2EC0A 1S5ZA 4ILLA 4P2MA 1AZSB 1HBUB 3UR3C 4CI0B 4USTA 2VFRA 1B63A 2VU5A 3FBFA 1TFYA 1VQMS 2HQDA 3HZEA 1J5EJ 2BJEA 1HBMB 2C42A 3A3NB 3H25A 3VAHA 3AOBA 5D0GA 3M32A 1T95A 1D9FA 4WK3A 4UF4A 4D3GA 1AFJA 4BHQA 3QT8A 1XNQE 3N9UC 1RAHB 4DFPA 5C5JA 2HQGA 3UR0A 1Q7LB 1Q7YT 1WNEA 2D3UA 1MNEA 4C8MA 4DQQA 2EEYA 1LK5A 3IA0A 1T9YA 2DGWA 5DETA 3HHEA 2PA8D 1RU2A 2D41A 4HH0A 2PNZA 4WPAA 1URNA 2ZH4A 4B9UA 4JI3I 1GTEA 5THWA 5F8LA 1O51A 2CJKA 1H73A 3MF5A 3RRKA 1YJ7A 2WSEC 4W98A 1OQ6A 2DXFA 1TFWA 5ETVA 3M6WA 4RJVA 2BKPA 2ZH9A 5LT5A 4NRTA 3WX8A 5LMUF 3R3TA 4JI8J 3NNCA 3NZKA 4AIDA 3GPAA 2VPWB 1T94A 1M5SA 5DM6Q 2E29A 1MX0A 4NZ0A 4QWDA 1NH8A 3CWVA 1HNWE 3K85A 2HQIA 1QJHA 5LSLA 1BMQB 1FT8A 1Y4SA 3MUVP 3R9LA 2HNDB 5CYQA 1RGVA 4J9NA 5KFEA 3HJCA 1AYEA 2ZWPA 1B0PA 3AB2B 1V3SA 3CIZA 3O1LA 4OHYA 1D9DA 3KUHA 2WVBA 3KDOA 2KHDA 2XLKA 2BRLA 1Y11A 3Q8VA 4LF8E 1VQPS 4DR5I 3R5GA 4ED5A 4J9KA 1HBNB 2HS0A 5K5MA 1CJUA 3KLEB 3AB4B 2DVIA 1HR0J 4DN9A 5KG4A 4OLPA 4JI6E 3U02A 2QE5A 4B3RE 3FCWA 1UCNA 1ZS6A 2G0JA 4C8ZA 5E3RA 3OL9A 2ALZA 5G4DA 1WORA 3N6LA 4LF4F 3D68A 3ZZRA 4MH8A 4YY3E 2ZD1A 4MK8A 5B0DA 2BQRA 4GQUA 3MAQA 3HVRA 3Q8QB 1S1TA 3E8OA 3NAHA 3Q8PB 3EPGA 1BY9A 3ET6B 4LSZB 1D6TA 4U96A 2H48B 4MKAA 4TU7A 5E0OA 1AROP 2W9CA 1ZA2B 4I68A 3T9NA 1UDQA 2V63A 4I1TA 2UUAF 4XDCA 4K4ZA 3CCES 2AEJA 5L38A 2FJWA 1S6PB 3HLUA 3POTA 2VDHA 2ZKTA 3O6QA 1F2GA 3PY8A 4JI5J 3P96A 2QA2A 2XYGB 4NYOA 3UDLA 3MEGA 3FEXB 3OHAA 3CJRA 2HBQB 1MMDA 1VK8A 3QPIA 4E2FB 3R2CJ 4M5MA 4CLWA 4N8OA 1VLOA 2B5JB 4W90B 3IWXA 1YGYA 4ZDNA 4N5SA 2UXDI 1N54B 4LR9A 1RT4B 4XTTA 2RVJA 4B3SF 5J2PB 2DISA 4G1PA 2RJZA 4JV5E 4USWA 4ZLNA 3QBCA 2B0GA 2D9OA 4NMLA 2IC3A 3MUTP 4L3NA 4FS1A 1S9FA 3CMAS 4X4VA 5KFVA 4IG0A 3OUYB 3MR6A 2DKOB 1I94J 3IBWA 3SCJE 4DSEA 1GEHA 2VUGA 2YNHA 3ISNC 4CT8A 4OYOA 4DR3E 4OL8A 1SC3B 2PMHA 3M4XA 5KG3A 2IAJA 4NPOA 1B0VA 3TJ8A 3CCQS 2GAHC 4JI4F 3MPDA 3OXGA 4KPYA 4LT6A 4WBFA 2PO1B 4PCQA 4PZVA 4ZVGA 1NJXA 1MU2B 1X9SA 2R7WA 1DLOB 2G13A 4ZVIA 3LWMA 2HHWA 2CDQA 2ZOMA 1T9WA 2IRYA 4V19X 2GMHA 4ZP8A 4LRAA 2JJ4D 1GFWB 2LA6A 2CJXB 2Z5BB 2EFGA 2ZM6F 1RQ0A 1KFDA 1NSKL 1K47A 3Q6NA 4DJBA 3MM8B 5A8KA 2ROPA 5JMNA 3W9HA 5FDLA 4UQTA 1PIEA 1SB6A 4RUBA 2V2VA 3ETMA 2IVFB 3M8SA 4K0KJ 1CEZA 2FVPA 3PR4A 4P2SA 1IKWB 3MM7B 4OX6A 2NXNA 3RYLA 5HLFB 4B3MF 1IBKE 1FE4A 1RSCA 1VGYA 4KC5A 4I0WA 4DX5A 5KG2A 2DB1A 4X66E 5E5NA 3S1TA 4Y28C 4OO1E 4ZCMA 3G6VA 2BR2B 4X64J 5HJXA 2UV8A 1JLQA 1AB8A 1MG7A 3I4HX 2JRSA 1N8RT 3LP1B 2ZH2A 4MJKA 7AT1B 2DNHA 5IQ6A 4RUCA 2I6WA 1S49A 3G6YA 1SIWB 1U09A 4L3KA 1FRXA 1HBOB 1NSQA 2HNZB 5AXNA 3NGSA 3QYYA 1OYEA 1U2FA 2ZWOA 3KXDA 3CJTA 3QO9A 1IXKA 2YWKA 3TZYA 1VQYA 5H9FJ 1YJNS 1KTQA 3CJ0A 3Q8YA 3M8PB 3VWSA 4CO0A 4RU9A 2VG6B 2AV5A 3VGSA 3DKDA 3RAMA 1T05A 2ZE2A 4B3TJ 3VQSA 1PJ5A 2H1YA 4ZS6A 1Q82T 2QV6A 4FYYB 3CJ3A 4JI3E 3AOCA 4DU8A 1LWEA 3ILJA 1N5SA 2QFJA 5D8HB 3HULA 3ZTQA 3OTOI 1K44A 2QA4S 1CPZA 1FJ7A 3ITHB 4KPCA 1HNXJ 2KT3A 4RNFA 2PNLA 4NX9A 4DV1J 1IBLI 2VB6A 7FD1A 2LQ9A 3TO8A 1RAAB 1OIAA 5B0FA 1RZMA 1H98A 2R2RA 5KFWA 2B9EA 4RR5A 2MJUA 2OPSA 5EUHA 3PX4A 2CPIA 2HFSA 1LWCB 1REVB 3H2UB 1LNQA 3D6MB 3TAMA 3FMBA 4J91A 3L7ZB 2IMOA 3AXMA 5D3GB 1V9OA 2EG2A 3OTEA 3N4WA 3OD2A 3I0SA 1FRJA 1Z0VA 1RTIB 1FRHA 4ATNA 1CVJA 3IWLA 1UEVA 1VQKS 4OO1C 2BXJA 4LF9E 2YX4A 4MIBA 2NQPA 2VPZB 1T03A 4ECUA 3TQ1A 2HBYB 4DR5E 4O4GA 3BO4A 2CZ9A 4NCBA 1N33I 2XNRA 1NK4A 3KOAA 4P9SA 4CYUA 3FEYB 1CJVA 5J2MA 1G4CA 3DDKA 5E7OB 2QRRA 4TNOA 1QUPA 2I8EA 2YNGB 4HYKA 3KG4A 4NYPA 3H4LA 3C6TB 3ZZ0A 4M5DB 5K36A 2ZZMA 3HVTA 1XR5A 4OX9E 5CH7B 1PC5A 1VMBA 1D1UA 3LOUA 2DITA 5LL6R 4OI3A 2UXBJ 4RW9A 2BQ3A 1T9UA 3AQOA 3GIJA 1AT1B 4IFVB 5E33A 4NI2A 1Z0GA 5F9NA 1VQOS 1RR9A 5C24A 5KT5A 1TELA 5JVGQ 2UUBF 1R7IA 3IO1A 4Y6IA 3OJUA 3DOLB 2BE2B 2DHXA 4NLSA 1TL1B 4AD6A 4LCHA 4P71A 1S76D 2J6UA 2O3ZA 1S1WB 2VQEI 4TY8B 4JYAF 4HACB 2IMWP 4BS2A 5HP1A 5DRQA 5HO4A 2N7CA 2BKOA 2ABYA 1FJCA 1NHKL 3NGRA 1QTNB 2MKJA 2YKMA 3QFWA 2QGFB 4L74A 1H7WA 2MQOA 2ASDA 4ES2A 2AEMA 3OL7A 4N7TA 2C38B 5DDQC 4K5RA 4ECXA 1G6BA 4JI1I 4DR4J 1C1BA 5DO2A 3NAIA 2MXYA 1R6YA 4MU1A 2AJ4A 3J80Q 2VH7A 5IXUA 5DS7A 3RBZA 1TKDA 2RAQA 3HCXA 1NK5A 3GFXA 2NPFA 5A76A 1U1PA 1XWLA 3R8YA 2ZH8A 5LMNI 4F25A 3D0GE 5BYRA 2VBXA 3WU5A 4LFAF 1XMOF 4DR6I 5KFZA 1SQFA 3GCMA 3IG1B 5C7PA 3J7AG 4A46A 1HA1A 3CCUS 2CPHA 2HNYB 2HVZA 4KO0B 2O1VA 2LDYA 3E2EA 1HHSA 4GVLA 3W5YA 5F41A 1KD1T 1S97A 4FP9A 4DV2F 4XAKA 1RLCL 2HS3A 3K17A 1PBUA 3ONQA 1SKUB 2QIFA 2GVDB 4DR7F 3GMGA 1GMWD 1RWOB 1NPRA 1U47A 1DTQB 3G8SA 5CD4A 2NN6A 8ATCB 2FJXA 4OYMA 2DGSA 5KFGA 4C3MA 1T11A 3RRGA 2QO3A 1EP4B 4PQUA 4PABA 3EXYA 4IDKA 3MCNA 5HQMA 1IKYA 2E9RX 1Q5VA 4O44B 4CH0S 2J7UA 4P7AA 2XCAA 1KBRA 2A6MA 4PRVA 1RTZA 4X4TA 3D6HB 4IH7A 1MROA 3KK3A 2JEAB 2MZSA 1JLEB 3MMBB 1IBMJ 1NM2A 3KJVB 1VK3A 1NRKA 1HNZF 2FVSA 1QD1A 5T14A 3H5UA 3ILIA 4OZEA 2UU9I 3D2WA 3GFHA 2VA3A 2HYIB 2KYXA 2HW3A 1H3DA 3DLJA 4AFFA 2DHSA 3UWTA 3MR3A 1SXLA 3FSYA 2PE8A 4C8OA 2Z2LA 4MU3A 4YHHJ 3QAUA 1KSPA 1S77D 2J5AA 1P9YA 2QSWA 2CPFA 4ZPDA 3BSCA 4M5HA 1YRUA 3W8PA 4OO1B 3OTDA 4FBTA 2E5JA 4K4SA 4RLEA 2JFKA 5B0EA 4OMFG 2RIJA 1EQ0A 3IR6B 4ISAA 1SCJB 5I3UA 2PN6A 3DLKB 2R7SA 2BBEA 4RW7A 2QA4G 4ECVA 3OTOE 4ECYA 5B7WA 1D0EA 5HBMA 1EX8A 1JLCA 2W2NP 2FJDB 3KYLA 1IBLE 3D66A 3DCAA 5LJ3Y 3BSAA 2KTQA 3CCTA 2OPQA 3ZTSA 2UUTA 3JAMC 1R0CB 1EJ7L 4FVCA 3U1YA 4DG1A 1VC0A 2M52A 1FVSA 1XNRF 4FW6A 5I42A 2E5LF 3I96A 3CDEA 4CLLA 6FDRA 3M6UA 2ACMA 4DCJB 2GGPA 5CAAA 4X65F 1ZM2A 3HHLA 3N28A 4IOCQ 1I1GA 1HNWJ 3IBFB 1YI2S 1VQ4S 1WI8A 2FYXA 3K5NA 3T1YE 2HPUA 1WG4A 4DSIA 3OR1B 2JNJA 4CNYA 4RO0A 1WHXA 4J7CA 2MQMA 1A6LA 3HSDA 1WF1A 5D4PA 5J2QB 2AX0A 2CJAA 4JI7E 3R1HA 3GZ7A 1KIJA 4FF2A 4CLFA 2QN6B 3ZZOA 3D0IE 1QE1B 4NLOA 4WTOB 5GAGI 3TA1A 3N6NA 4DV3E 4F8RA 1VS3A 1Y3KA 4QQBA 3K5MA 3C66A 2X1AA 4U8VA 4PG7A 2JE6A 4MTPA 2JEGA 1Z0CA 4JI6J 3CCMS 1NLKL 3WU4A 4KV8B 2Z5CA 1QLNA 3DYAB 5FWKA 2Q6BA 3BZQA 2CNKB 1Q78A 2VV5A 4YY3J 2FVQA 1OYSA 1UWAA 2KJVA 1H0HB 1WC6A 4CO2A 4F4WA 1RTHB 3FMWA 4FDFA 2CWXA 1K73T 2KJWA 2CKWA 4ALZA 4DPUA 4PPZA 3KLVA 2XM3A 1X8DA 1M1GA 1L3TA 2L08A 5HROB 3D4JA 1VQLS 1PYOB 2UUBE 4FF3A 3CB4A 2IM0A 5IZHA 2MGZA 3IRXB 3MOJB 4H4KA 2ZJPQ 4JI0F 4KGMA 4ELVA 4PAAA 2KH9A 1H2VZ 3TVYA 4PUOB 3MM5A 4CDIA 3V6DB 1EA6A 2Z30B 1JLFB 5ETQA 1TK0A 2GMLA 2YKAA 4EWTA 3MECB 3PEJA 1OPIA 2RB7A 2BA0G 4AQYI 3V6KA 2LQ8A 4QIWD 3B82A 1XIQA 3CDWA 4JV5J 4OIXA 4JP8A 5LMNE 3PS1A 1UMJA 3GU0A 5F3TA 3SYZA 3CD0A 1U1KA 1HLWA 3CTRA 1LW2B 4LBPA 4DR6E 1IR1A 1OPZA 4PWDB 3V6JA 3CCSS 2RRBA 3Q8UA 4KQZA 4K2JA 4ZJQA 1SPBP 1N5YA 1BLUA 2F9DA 4DI6A 2Z0GA 2HK3A 4DR3J 3N5BA 1UZDA 1E6VA 2IDEA 3TUJC 4LFBF 5J1EA 2ZBRA 2ZFHA 3PW7A 3CJ4A 4BC9A 2FZCB 3PYEA 1WHVA 4ZP7A 2KZMA 2HNDA 1HD0A 4PRXA 2JFDA 2OFGX 4F02A 4DV2E 3BR8A 3ZTRA 3HFZB 3MAAB 3GE9A 2I9SA 3L3CA 4DR2E 3HVAA 1HMVA 1NDLA 5K36F 4DR7E 3W9IA 4HTJA 2K7KA 3MM6B 4A8KA 3JYTA 2CG9A 4WUDA 2NREA 3LALA 1YHCA 1RT2A 2A0FB 1WACA 2X51A 3CC4S 3PW5A 2J9EA 5T7LA 3H5SA 3DLBA 5CA5A 2ZNZA 1RTDA 1CG2A 1JLAA 1S7HA 5EGYA 4ZJOA 4IKAA 1JJ4A 2CNNB 5IS2A 4IFYB 3CDIA 4KGXB 4GKKI 1YRTA 2JEBA 3LGHA 1IBKJ 4QU6A 4RPFA 2AGPA 2NSCA 1RDRA 2GAGC 2VG5A 4JG4A 4G3IA 1ZAVA 2Y3YA 1SJ1A 4UOCA 4KHPJ 3PNIA 2UU9E 1R6VA 2CZVC 3EVMA 3MEDB 4HKQA 5KFQA 2H4YB 5FJ4A 3BEGB 5ETMA 3QGGA 1VBYA 1VYAA 1BQNB 5A2QC 1WTBA 2PO4A 4U8YA 4WUBA 1LXJA 3JAMQ 2KL8A 1J5EF 3M30A 5E3AA 3RZAA 1RWNB 4WE1B 2WOMA 1NHJA 3QQCD 1Q16B 3PCOB 3CIMA 4LSNB 2FJEB 4M95A 3GJRB 2CAJA 1U49A 4LCFA 4USKA 4Q8FA 1RHRB 5M2UA 1PO6A 4KBIA 1HWUA 4K5SA 3NCRA 2XMJA 4HT7A 4C6AA 5H9EK 4ZIWA 2I0XA 4HLBA 3W60A 2KB2A 5KFMA 4FYDA 1H7XA 2UXCI 1X4EA 3DLEB 3K8WA 1Y3JA 2B9YA 1UFLA 1YKWA 3PJWA 2GO3A 3AHPA 1S10A 3LGNA 3LP0A 4BDPA 4WFNQ 2AYBA 5J2PA 2FJVA 4P7TA 4JI3J 1N34F 1UW4A 3NGDA 2KRRA 1NK8A 5KFFA 3RR8A 4DU7A 1SJQA 4HHJA 2DIVA 4Q5VA 2ZJRQ 1N5VA 3KK2A 2WRMA 4IFDE 4JI8F 1S9GA 3SQOP 4QCLA 2HRTA 1L3VA 3DMJB 3GFYA 2E7XA 1DURA 1T8EA 1KHVA 3V4MA 2NXEA 4LRDA 5F8MA 5DG9A 2AF6A 5F8NA 1Q1KA 2WNRB 4MYUA 2NN6F 1XNRE 3GIMA 2GVZA 3P45B 3MUMP 1E3HA 1P42A 1IJFB 4AE5A 2MQNA 3K7RA 1PAEX 1NPKA 3AOAA 4IRDA 1HARA 1Q79A 2JVOA 3IC1A 3Q2TC 1DAXA 2DJWA 4DX6A 4QU7A 2V94A 1ZTWA 4LF9J 2DCLA 4K4VA 1TUVA 5HSPA 2Z5BA 3DRSB 4DV6E 1BC6A 4DR5J 4QWBA 4Y2KA 1QVFR 1NUEA 1DY3A 4EO6A 4ZCIA 2V4JB 4K4YA 4KAIA 1HR0F 2JX2A 2ATCB 3GYGA 1IKWA 2VC1A 1FD8A 4M94A 2UVRA 4F7VA 3HVWA 5ETRA 2N82B 3EMTA 2J65A 4RUHA 1S0OA 2K7JA 2YNFA 4B3OB 2CXEA 1VCTA 2AU0A 4GO5X 2IY5B 4OYWA 2JHEA 4R5PA 2BR0A 1G1XA 3A13A 5HMYA 2Y9HA 2M9KA 2PGCA 3OHBA 2B4UA 2U2FA 1FA0A 2DT9A 4DV5I 3CCZA 3BPDA 2BR2A 1C0TB 3VR1A 5KFNA 4CWBA 2R9LA 4MK9A 4RW6A 2C3OA 2ZDOA 1CJTB 5IT9U 8AT1B 2HGNA 3K57A 1K9MT 1UAWA 1QAYA 3PM9A 2MZQA 2YXLA 2FUG9 2A10A 5EWGA 2W7AA 5K8NA 4K4TA 1HFEL 3M32B 4ZITA 1IVZA 1UA1A 2CDRB 2AP6A 2EW9A 4ZVFA 3UVJA 4CO4A 3UN5A 4HTIA 4LIRA 3BF4A 2UXDJ 3Q8RB 4GO7X 2JC0A 3J7YU 5DGBA 4LBHA 2DRBA 4N3OA 3DHXA 1UPPA 5IT9Y 5DQIA 2YPZA 3CMQA 1HYSA 5L3JA 2WVCA 3EDRB 4ID5A 3GQCA 3K0JA 1TP7A 2AJ1A 2PNZB 1RAOA 3L9ZA 1I94F 4X62I 5B0GA 4QZVB 2CZ4A 1R31A 4X4UA 1OY6A 3FBCA 1REVA 5DNXA 4C3KA 2F8EX 8RUCA 3THTA 5AXKA 3QZ7A 4RWXA 5IM0A 5HATA 1YJTA 1F5AA 4OJGA 4FYXB 3ISZA 1RA6A 4F4KA 1LK7A 3OW2R 1BHNA 2PFFB 4QPXA 3NBPA 5KFJA 1HI0P 1NB2A 2C37B 2WBMA 4LFBE 3MHYA 2M2BA 2ATLA 1V6HA 1JNZB 4AYBD 1NJYA 4GRSA 3DI6A 3JSBA 1AUSL 1U24A 2R8IA 3RJMB 4ER8A 5DQGA 3T5KA 1RADB 5CYQB 5A2QQ 2AQ4A 2FC8A 5LSOA 3FQLA 1JMTA 3KHLA 4HL9A 2IERA 3VZHA 5IT4A 2ILYA 3IWNC 1JKHB 3C6TA 4K0KF 2F63A 2R8HA 2VQFF 1J27A 3TX0A 1TMJA 4WFAQ 4FYVB 4GKKE 5ETPA 4DF8A 4R8UB 3UFCX 4M5JA 2AZ1A 3M6AA 1LV5A 3TWZA 5E3PA 2P9GA 1FWLA 3NS5A 3J7A1 2DPJA 3I5CA 3BGLA 3CJKA 3V81A 3GCWP 2CJ9A 2GJ2A 3PYDA 5EHHA 2IM2A 1EKSA 2P6SA 4X64F 2ZD1B 1WDTA 1WUUA 2QMUB 3RG6A 3BBFA 2FD2A 1UA0A 1GNKA 3Q6MA 4TKTA 4RX6A 1S1TB 2BE2A 2M88A 1REGX 3W2WA 4MIWA 1RAGB 1QZRA 1F3FA 1S1WA 2BOAA 4IQXA 2HK2A 1TQLA 3AJDA 1U4BA 2V2KA 5KFHA 5GMDA 2W9CB 2NZCA 1VRQC 2DR5A 5DM7Q 3T6JA 2KZZA 2UXCE 3TJAA 3KKFA 2WTFA 3K1JA 4ECRA 1T3NA 1IN0A 4B3TF 3POTB 4NXMI 5KT6A 5A8RB 1PVGA 4ID8A 5JJBA 5IT0A 3OLBA 2C38A 4Q2MA 4RKUC 4EMDA 1RWUA 3G2XA 2DH8A 2VONA 3K5OA 4LFAI 1XMOI 3MEGB 1H74A 4OHWA 1RT6B 3OTOJ 2F4VI 1HNXF 1FTRA 1Y5IB 1HWLA 2H5JB 1Q8LA 4DV1F 2GO8A 4DS5A 1IBLJ 2W8LA 2XY6A 3LPEA 4OJHA 2F65A 1FX4A 3I6PA 3FNNA 5A0YB 1D8ZA 4MQYA 4OHVA 5H9FK 2R8GA 3C3LA 2AZ3A 1UJ6A 2CPZA 2V50A 1OY9A 4NMXA 4N47A 2NXJA 4IG0B 3M7NG 4F36A 4DUZI 4WU2A 2YNHB 2LVWA 4D3HA 2NUUG 3A4TA 2IM1A 4ZPCA 2LQ5A 3Q86A 2R2UA 2UUCE 2YX1A 2IAJB 2LXUA 3OFEA 2XQCA 3MPVA 3KHHA 4WUCA 5FLXC 3OQ2A 1WF2A 2RF2A 2Z2ZA 2CQ4A 1YJUA 3L7OA 4L76A 1M90T 1N33J 4JI7J 4OO1D 4NA2A 5C2GA 5IT9C 1FESA 3NNHA 5F0WA 1XR6A 1CBKA 1VJWA 4QJVA 1KVJA 3C19A 4YDXA 2DRAA 4DL4A 1HNZI 1YTYA 4O4RA 4KGVB 3NGUA 5A8KB 3UD4P 5EDWA 3I9V9 2BVZA 4DV0F 5FDLB 3CCJS 5LXYA 1X5PA 4X4OA 2JEAA 5G0RB 2B43A 2UXBF 3MMBA 2YNIA 2YKNA 2G2OA 1XTZA 3NMAA 5L1KA 3G8TA 3WX4A 3C16B 2CQBA 3D3BJ 4DHVA 2VPXB 3PFEA 2VG7A 1IWAA 3R6LB 2O1TA 3BO2A 1BD6A 2Z5EA 4FW4A 1S6UA 5SUHA 4B9TA 1WI6A 2IYGA 1JQGA 2DGVA 3AQPA 2ZKUA 1LFPA 1WC5A 5GVQA 5F0UA 1O5JA 1FK9A 2VQEJ 2OHDA 1JLQB 1ZOTA 5HQLA 1U7LA 1A9NB 4OO1A 2Z8QA 4C98A 3BS9A 5B0AA 4JI5E 4V1Ak 1Z4UA 4QPTA 1LWFA 1QSYA 1IJEB 2CADA 1WDDA 3QO9B 4DR4F 4EZ9A 4JI1J 4YMEA 2OMLA 3K8VA 3UO0A 1O8BA 3IM8A 3W1YC 3M1VA 1T05B 2VDIA 4X65I 3U27A 4WZQA 3I82A 3QIPA 2V8PA 4X62E 1LEOA 2EKNA 1EAYC 5C2CA 5LMNJ 1LWEB 1ZXNA 3AA8A 5CCLA 3J81Q 4DR6J 2HGLA 3P6YC 3QFHA 1ZBTA 2B4PA 1ZZFA 1O6XA 1FVQA 2W24A 4NXNI 3MOZA 4OYBA 2OPSB 1YJVA 3NGKA 2HHHE 3ICLA 1VFJA 4KH1B 3C6UB 2HEKA 3TAMB 1IUJA 1RXOB 1P27B 4ICLA 1EHWA 5L46A 2JZ5A 3ZKDA 3W8GA 1ZYQA 3DXSX 3WZ0A 2MY8A 2CFXA 3GSIA 3I0SB 1G7CB 1UL3A 4ES3A 2H65B 1FERA 4KFBA 5HVFA 2HHVA 1R27B 2ZZNA 3NRBA 2Y8WA 3R7BB 3KRNA 1BXNA 2BJ3A 4ILRA 1M0SA 1RB0A 3E01A 2LDIA 4O4GB 5DGAA 1K0VA 2XC9A 5AT1B 2BJ1A 2LEAA 4CYUB 1FFWB 1H2UX 4UW2A 3SV4A 1CJVB 1JXVA 1LKZA 1F9FA 2QA1A 2LFVA 4KTQA 1IBMF 1Z0TA 2BX6A 3GV8B 2VODA 3DHWC 5K36B 1Z0EA 5MAOA 3ENAA 4LF2A 3I0RB 1VBXA 2UU9J 3ENWA 1YRXA 2WB4A 3HHLC 1RI7A 3T19A 1NU4A 1PYTA 1T9TA 2KHCA 1Q0NA 4QWAA 2OPPA 2OD4A 4NI2B 5BR8I 1FRIA 5HROA 1NSAA 3CJSA 2PEBA 4QR1A 4DLEA 5GMEA 3UDVA 2HLUA 5C24B 3CD6S 2IJRA 5KFRA 2HG4A 4NLQA 5IC4B 3L7UA 2YH1A 1XNQF 1UZHA 3KJNB 3R5JB 2KVQE 1I6JA 4NXME 4DR1I 2UZAA 3G9CA 2PT0A 3V6DA 2E7VA 4DV4I 2F40A 4ECSA 4QYRA 4CH1A 2C3UA 3KHRA 5HP1B 2HHSA 2KVIA 1RYSA 1R8HA 1H72C 5FLXQ 2F4VE 1VRUA 2K06A 3PW2A 2BJ7A 3CGIA 5HVHA 5D0RA 4WYWA 1DQ8A 3AAWB 3X3UA 3TZZA 3BDEA 1C1BB 1HNXE 5D15A 3UQSA 3H5XA 4P7VA 5D4OA 4URSA 4X2BA 4ED4A 3ILLA 4DDFA 2IIHA 3P3CA 3W5ZA 4UOFA 1MN7A 4DUZE 1EQMA 1HNWF 2CPYA 4MKBA 1NK6A 2CGEA 2XS2A 4IOAQ 2UVWA 3LAMA 3Q1QA 4X4QA 2FZGB 4HI2A 3QWPA 4JI2I 4FVMA 2AJFE 3MAAA 4OYPA 4YB6A 4NWBA 3M9NB 4N56A 3FC9A 3HJFA 1S9EA 3AJ1A 2BRKA 3P3DA 1T02A 4KY3A 2EK6A 3M2RA 4EZ6A 2Z4PA 4DV6J 1HWJA 3PTWA 4GVBA 4XTJA 4LR8A 1O0PA 1Z5BA 2NN6B 2DHHA 2J8AA 1U2CA 2ROEA 5KFKA 4M5LA 4LF7I 1X4FA 2RRNA 4QWEA 1A0OB 4JI6F 2BZ2A 1WG1A 4G1IA 2ZVSA 4Y34A 4IDKB 2B4VA 4Z7YA 3D5MA 1WC3A 1IKYB 2DNOA 2VOPA 4WXOA 3K59A 3QLHA 1FKPA 4KHMA 3C14B 4YY3F 3KFWX 2Q1LA 3SFUA 1RT7A 3HI9A 2BYCA 2WVDA 2R7TA 5CZVA 1OYRA 4PWWA 3U1KA 4Q44A 2MZ1A 3RB3A 1VDHA 1MROB 3CF5Q 2M8DB 1TR0A 2WP8B 3KUEA 4K4XA 4ED8A 3NNAA 5K8PA 3N6MA 2ASJA 1KQKA 4CO1A 2CQ3A 2XI3A 1VIOA 1JNRB 3VF0B 4Y65A 4RNHA 2DPIA 3W66A 4NLGA 2M7SA 4CLUA 2IVMA 5F8GA 3S6EA 4Z37A 1N34I 3SSSA 1F60B 1U0HA 5AXLA 2J9DE 5B08A 2N3LA 4AQYJ 2ADCA 2W2OP 5CD4H 4FWHA 3H1CA 2KM8C 1UVMA 3M7VA 4JV5F 4ZPBA 4K50A 2DNQA 4IZJD 5I3UB 1T9VA 3P8BB 2FPHX 4RW7B 1X4DA 3MTKA 3RGIA 5J2NA 4I4BA 1FJGI 5HBMB 3GB0A 1JLCB 4MYTA 2DNLA 3OLAA 2BJDA 1D9AA 1NJIT 2E9ZA 4NXNE 1ZPWX 4DR3F 2MZJA 1NDPA 2FY8A 2OPQB 1RAEB 4RWWA 1N4LA 4IOBA 4DG1B 2VKZG 1KVKA 2XMVA 2CPDA 3TZXA 5I42B 5F8HA 3OSNA 2GGPB 1RYRA 2GS8A 3FJ2A 3SFGA 3HHLB 4N41A 4I2PA 2VBZA 1CJKA 1X7VA 3RBEA 2BW7A 1QAJA 1RT5B 3DRPA 5KFPA 3OBIA 3HHKA 2PO2A 1CLFA 2LQBA 3HFKA 2FJBB 4WZMA 1Y6ZA 4F26A 3IN5A 1UWBA 1K1QA 3CCWA 1NK7A 1K8AT 2V4JA 4OI4A 1EB0A 5D0HA 3BBCA 3M7ND 4YP3A 2EKYA 4IZJA 1PG5B 1R89A 3L4BC 2J76E 3QRRA 1KS2A 2YH0A 1PKUA 4TYBA 1OYPA 5SZTA 2FHMA 3BB5A 3KLIA 1IBKF 5DDRC 5AE2A 4GKKJ 1SKWA 3A12A 2HIYA 3BN4A 4LCGA 3M8RA 2MKSA 2JE6B 1DARA 1JB0C 1TK8A 3VVUA 4KHPF 4DL3A 3FSIA 4BA1B 1B99A 2Z5CB 1IBME 1VR6A 4JBCA 4M63A 1NZ0A 3R2DJ 4OO1F 4C7QA 5E41A 2MMYA 2W25A 1H2TZ 3KUGA 3NEKA 5JEAF 4LF1A 2JSXA 2BA9A 2HKJA 3J80U 5KG5A 1GTHA 1N5QA 1JLBA 1GMUA 1U1OA 4LREA 5C25A 1YJWS 3BH6B 4QBUA 2POKA 3FQKA 2DXEA 4YHHE 3M8QA 1Q8BA 1VQ7S 3B4MA 4DV4E 2G4BA 5DLGA 1FDAA 2RQCA 2UXCJ 2XZDB 2ALYB 3VZIA 2RUGA 2XWYA 1SC4B 3WHIA 3TR5A 3Q24A 3GJTB 2JL9A 3A8IA 3I9ZA 2MGZB 4DUYI 4C0OC 4AL5A 4ECZA 2DNRA 3Q89A 4JI3F 3HFVA 4ZHRA 2OO4A 3JTNA 4IR9A 3LO3A 4I7FA 3MM5B 4YUDA 2QG9B 2QLJB 4AXJA 3J80Y 1B4SA 2XY5A 1OS5A 2QLFB 1YZ7A 1UETA 3US5A 1Q8IA 1S16A 5DDPC 4CRJA 4X4PA 2DNZA 5ETTA 4USMA 3LWLA 3H7HB 4A8XA 4YR3A 1S6QA 2FLNA 4KKOB 5I4MA 3T1HI 1IM6A 1TUWA 3EVWA 2FVRA 1Y10A 1YJRA 2ZBQA 2GCFA 1KFSA 1TV6A 1WKLA 4A8QA 1N5YB 4DSLA 2C37A 2AE8A 5IWAI 3W65A 3BQ2A 1X60A 2YVSA 5IC6B 1E6VB 2UUCJ 5J1EB 4LF9F 2W8KA 1HNIA 3IRWP 3PV8A 2VQFI 1BGXT 3OVSA 2ZNYA 4EU0A 3BO3A 4J9PA 2QL9B 2CQ0A 4FW7A 2JLEA 4DR5F 2WVFA 2WBRA 2MKCA 1JKHA 3CMES 4RW8A 4LF5I 1HMVB 4LF7E 2FLPA 3GR1A 1F9HA 3IBCB 1GXTA 2XSJA 3NS6A 3EDQB 3JYTB 1RT2B 1FRMA 3QGPA 1MSWD 5IOLA 5ETOA 4R8UA 5DJBA 5T7LB 2H51B 1RTDB 3ZTPA 1EETA 1JLAB 2KM8B 2OGUA 4OX9F 2JH3A 2KFZA 5DZ6A 4J9LA 1Y9OA 2OEMA 4K2XA 4CLKA 2CPJA 4A4JA 3VAKA 2NCKL 3VGVA 2JEBB 2AW0A 1Z0BA 3NMRA 4DV5J 4OHXA 2YWGA 2OTLS 5D4NA 2VL1A 1RREA 1RHYA 3WC0A 3DM2B 2VG5B 5H1SV 3SDEB 3BKUA 2RDDA 3TRGA 1UVIA 2AMCB 4F67A 3SCKE 4LBIA 4ED7A 2OD6A 4NLUA 3R5BA 1VQ8S 2IYIA 3BN7A 3U1LA 2W2QP 1PAUB 2QYGA 3M30B 1BQXA 4CCHA 2WOMB 4OZ5A 3BKFA 3P49B 1ICEB 5A8RA 5K8MA 4CO3A 1N32I 4URQU 3A8JA 3DLGB 3GCXP 3QNWB 2JLFA 2H5IB 3C2PA 2GO9A 2HFOA 1RT6A 5A6PA 1Y5LB 3LPYA 4QOTA 2MLYA 3CPWR 5FIIA 2DH7A 3UDEA 2BJ9A 3LP0B 2AJ2A 4DEZA 2ZOGA 1ZPVA 1JWWA 5A0YA 4X62J 5I3PA 3Q83A 4YEAA 2OJ3A 1RHQB 4ED0A 2KXNB 1X9WA 4V19J 3QJJA 2C28A 2YWEA 1GAOA 3KK2B 1RT1A 2GO4A 1Z2LA 1S9GB 1SBRA 2F1DA 1YBAA 5LJ5Y 3DLLQ 5K9FA 2ASYA 2HHHJ 2DGTA 4IFDA 2MPUA 4L72B 3KMQA 3QRPA 2GVZB 3R1LA 2I1RA 2WHOA 4MFBA 3TQEA 2UVVA 4PXCA 1KP6A 5KG7A 1HW9A 3G4SS 4DV0I 2XGQA 4G6VB 4U9RA 3J80C 3DOKB 1C2PA 2HLTA 4I69A 3GYNA 1DHMA 1MMNA 2QJ3A 9RUBA 1BQMA 2VOOA 1VC5A 4K4UA 4NZ7A 2RRAA 3HD1A 4KR0B 5CYJA 6AT1B 4C11A 2LXIA 3V2UC 2HHTA 5G0RA 2QC3A 4IUFA 3H59A 3A8KA 2HAIA 2PA3A 3UE2A 3C16A 3R27A 1ZM9A 4NYZA 2YNFB 3F56A 1Z5CA 4K4WA 2C2DA 2AJ0A 4KHPE 3VAFA 2V9WA 4R5PB 2LMIA 5HI7A 2RD5C 4HHUA 5AXMA 4BLGA 3PEHA 4C8KA 2J0SD 5EKWA 2OSRA 2GQQA 5KFSA 5JEAE 4WKYA 4ENOA 1VBZA 4RW6B 4DF4A 1SUQA 1CQMA 5KOXA 5KG1A 4F0KA 2R8KA 1ZA1B 4TU9A 3FEZA 4CLTA 3HMJG 4FBUA 1UFWA 4NXMJ 4G1QB 3GG1A 2RU9A 2J8SA 9ATCB 4P75A 2HRUA 2DRDA 3PR5B 3MZIA 3H42A 1FWKA 1PJ7A 1YIJS 1N0VC 3OTOF 1QUVA 1XMQI 1YLXA 3UVJB 1AUDA 2F4VJ 1R8PA 4KSEB 1IBLF 1V3RA 2Y8YA 4P2XA 4A48A 1XK8A 4CP5A 1URRA 5K14A 1SJFA 2MLZA 2IPOB 1HYSB 1IKXB 4ID5B 5K36D 3FKBA 2X3DA 3CDAA 4DZ6A 4IS9A 4QW8A 4RBTA 1I3OB 1JLGA 4P72A 3RRHA 4DUZJ 2KU7A 1ZTTA 4WFZA 3DN9A 1PYSB 1T3OA 3C6UA 2ACYA 2KFNA 2BJ8A 4M5GA 2B7CB 1L3UA 4EYIB 5IM0B 3T1YF 2VA2A 4OI2A 3W64A 2QSFA 4KHRA 3QZ8A 5KAKA 3WIVA 3NBPB 2EI5A 4IRCA 2HMIA 5KFIA 3IR7B 3HK2A 2FGCA 4MAKA 4BCAA 4J9VA 4JI7F 2OFHX 4CO5A 1R43A 4NLDA 3DI6B 4RNOA 2MB0B 5C0XF 2C2MB 5JXSA 5JEAC 4RBUA 1P1TA 4LJMA 2B8QA 1QSLA 4DV3F 3UDCA 1Q5YA 1VRTA 2E5GA 3RB0A 2VBWA 1FNXH 4YS2A 2RQMA 1HNZJ 1DTTA 4UT4A 3P4UB 3JAMU 2H5EA 3FZ2A 1PC4A 2EFQA 3J7ZT 2HHQA 2FIUA 4DFKA 4MKVA 2HGMA 4CM2A 2C3MA 1RWXB 3MEEA 3PO5A 2F7VA 2GV1A 4A8OA 2FDNA 2G1DA 1DFDA 4DSFA 3I0RA 2BANA 4NCGA 2I5JB 4MU0A 3HSJA 1DBDA 2B56A 2HVEA 2GJIA 1HIYA 4EBDA 1XNQI 4GKJI 3ZO7A 3L7PA 3OTBA 4GC7A 1TVRB 3TX8A 3CJKB 2DO4A 3V81B 2UP1A 3VAJA 4IG3A 4WWSA 4Y00A 3JAMY 2DGQA 1U45A 1LW0A 2OAUA 5GADI 3C15A 3CJ8A 2O1WA 5L1JA 3ENQA 2ZBKB 2LXFA 2W2MP 5ELWA 2HZVA 3EGWB 1CULA 2IM3A 1RE1B 3TEGA 1TAQA 3P06A 2IOQA 1SI9A 3W2WB 1ROFA 4LFCI 3QATA 1M5PC 1R6MA 2HKEA 3R97A 3KK1A 4PU9A 5D77A 4JI1F 2W4CA 2ADBA 2NN6D 2JWNA 3SSRA 5B09A 4ED3A 2UXDE 1KTVA 3GR0A 3KG1A 3CC7S 4X65J 3JS9A 3G82A 3PS2A 1N36I 1HNWI 5DLFA 5LMNF 3R7SB 4K8RA 4WP3A 4ZVSB 1WSVA 1ZAXA 5LXRA 2MQQA 4ED2A 4J9UE 4DR6F 2AEFA 3UD3P 1WEXA 3P76A 3HP6A 2DTJA 3OV7A 2E44A 1QVGR 5B0BA 1RACB 4NXNJ 4CQ1A 3IAS9 3PZPA 1N0UA 4ZIVA 4BWJA 5J1PA 1DJ0A 7FDRA 3CXCR 1D3WA 4LF8I 1TKTA 4ANCA 1FKOA 5KT7A 1RK8A 3LW5C 2HFUA 2MJNA 4FNIA 1RWPB 3IFEA 3JTOA 4DR2F 4WTYA 2DNKA 2DNGA 4NCAA 1GMVA 1RBLA 4Q45A 4JI6I 2WK4A 3R5AA 4B3RI 2V8HA 3M8ZA 4DUTA 1Y4ZB 4LF6I 2RF2B 3CJ5A 2BM1A 4XIUA 4ITSA 3MD1A 4A8FA 4YB7A 1OSCA 4OFZA 2M8HA 3ZC4A 3EZUA 4OHZA 2B4OA 4FPRA 2Z2MA 5DQHA 5HK4A 3EX7B 5IV4A 4DXLA 3GONA 3PACA 4NLXA 4F4YA 3DGPA 4YN3B 1ZH5A 2HIQA 1JJ2R 2KXHA 3K5LA 3C14A 2HBZB 1Q53A 2HVIA 4U7CA 3O5TB 5KFXA 1SJ3P 4TVAB 3O8WA 2V4RA 3JB9k 3PJXA 1B62A 3L95X 3F73A 3HJVA 4O3RA 3CO9A 4NL5A 3DNCA 2UU9F 2WP8A 2CQHA 3FRYA 2IA0A 3OR2A 2HVDA 1SQEA 2YNIB 2BA1G 3PRBA 2YKNB 3LNUA 3QWUA 4LQ3A 3Q2SC 2A3JA 1IM4A 3DU6A 3D6TB 5BR8J 2E1RA 1WKKA 1B0TA 4MK7A 2NZ4A 2VG7B 2Y0BB 3MAHA 2Q79A 3HHLD 3KLHB 2ZBCA 4ZA1A 1BE4A 4DV7I 4F3OA 2QX0A 2Y1LB 2HSEB 2LP4A 3QGIA 2XO7A 2XMMA 2ILZA 3IMQJ 2V8GA 4DR1J 3KJFB 3ETOA 4EGLA 1FK9B 3MDFA 1VISA 2K3KA 4DV4J 3M2VA 4O0IA 4C97A 4C0BA 3GLJA 1NHVA 3QIDA 1M5OC 1XMQE 2K2PA 2ZEJA 3K5PA 2I2YA 3CD7A 4CM0A 5BJRA 2OMOA 2J6TA 1KOHA 4DR3I 5JEAB 1IQTA 1NO8A 1LWFB 2DGXA 4ZPAA 1HQUA 3ZNJ1 3TJ9A 2BM0A 4R25A 4P73A 3SIPB 4KT0C 3F41A 3HZGA 3FSXA 1FKAE 4IFDF 3M1VB 4ZP9A 4DPWA 4ZCKA 4DN0A 3QIPB 1TL7A 2A18A 4FPIA 1UJ4A 5A2QU 5K8OA 5E2QA 1KRPA 3SI8A 4I6AA 3MTJA 4HR2A 2HZAA 4DL5A 1IKVA 2D9PA 3LUYA 5A8WB 1LFWA 1Q4RA 2O5DA 3AFGA 4A47A 3HKWA 2R7RA 3WQPA 2GQ2A 1I5OB 4JI2J 3ELHA 2CQDA 1GT8A 1N56A 4UQGA 2LEBA 1TUGB 1RT5A 3BPSP 2LQJA 5MLCV 1UPMB 1NDCA 4LSLB 3MURP 4ICLB 2CA9A 4DV6F 2XY7A 2GZOA 4OV6A 4DX8H 4DSKA 1N33E 4AM3A 5A2QY 4N8NA 5CQGA 4KFBB 2PMWA 3DFEA 2NSBA 4NEYA 3NY0A 5H9EJ 4LF7J 2EC2A 5C0XE 4UTGA 2OTJS 4X66I 3BDPA 5M2PA 4BC7A 3E01B 1FNMA 4LQ9A 1S59A 3BGFA 2CQGA 3MD3A 3LP2A 3CDUA 1W7WA 2X36A 3I32A 2BMBA 2EXUA 3PIPQ 4BA1A 1KC8T 1HI8A 1M1KT 4GKJE 4AL6A 1RWVB 4QNJA 4PXDA 2JEFA 3D7SB 1QTMA 1CC8A 3JQKA 4CLYA 3F0NA 1U25A 1KOOA 3LTOA 3V4IB 5ETLA 5DZ7A 5LL6d 3AXKA 1JK9B 3PKMA 2F9JA 2E5IA 2OPPB 1TL3A 3SQGA 3ZZYA 2CPEA 2DR8A 2VQEE 2K8GA 3MMCA 4LFCE 1N34J 2QEXS 3TI0A 2A2DA 1RUSA 4G65A 2JEJA 4TYAA 1Y60A 3U1NA 2BE7D 4ZVUB 2CRLA 4AQYF 2G9OA 2B6AB 4OYZA 4DCPB 4C4WA 2UUWA 1N36E 5LMUI 4JI1E 4DS4A 2HQ3A 4YR2A 2XHCA 4TQSA 2NLWA 1X5SA 2XWXA 1C4AA 3NWRA 4DQSA 1VRUB 4ZPVR 1FJGJ 4LRBA 4OZ3A 1GX5A 5C0XC 3KJQB 1KLNA 4DPYA 1YVFA 2CUYA 1B70B 4KKOA 4J9OA 1IBCB 4LF9I 2XGPA 2BACA 4J9QA 2KDOA 3M9OB 2VPYB 4YR0A 3EXCX 3J7AM 3H90A 2G0IA 1TMMA 1RHJB 4YB1P 1DQAA 3IGNA 3THVA 2R3VA 5CZXA 4EK2A 4BWMA 3GJSB 1L5UA 3DC2A 2U1AA 1FEEA 2BV3A 1VOMA 2XHWA 1KONA 2DD8S 4DQIA 1BUXA 4DBQA 3QJPA 3CEDA 1X9MA 4YOEA 3QSYB 5FD1A 1MWQA 1USUA 5JUMA 2HS4A 4FXVA 2C39A 4LF6E 1NMEB 1XHKA 3L09A 4IRKA 1X31C 5KG6A 2WONA 2DR6A 1ELOA 2C2ZB 4B9SA 4L73A 4OX9I 3VAGA 5GAGU 3HD2A 3ZKBA 4DL7A 1SC1B 3M85G 3Q0AA 1S9EB 4HXZA 3ZTOA 4L6V3 3DGVA 5HMWA 3BGRB 3M2RB 3SXLA 4R0JA 1WELA 4LF4I 4TQRA 3EPIA 5EN1A 1VBKA 4GVBB 3T1AA 1V3ZA 1QAIA 1E6YA 4GKKF 1JXLA 1UTAA 2ZH6A 4WFXA 2O67A 3SMZA 4NZ6A 3DOMA 2LLZA 3SCIE 1NCLA 2ZH3A 4WP8A 4O3PA 3AT1B 3KTQA 2YKQA 3W7BA 3VHQA 3QLHB 1FKPB 5C42A 1AW0A 4ECWA 3DM2A 1FI4A 2UUAI 3KLFA 3SDEA 1RT7B 1PILA 2N3OA 3H4BA 4B9MA 3PXGa 4YQWA 2XMKA 4DV7E 2AJQA 4DFJA 4IH5A 1NSPA 1SV5A 4F3MA 3HKMA 4NLRA 3WDOA 1I51B 3DRRA 4PKDB 3Q23A 1XMBA 3S7RA 2XNQA 2UXCF 5L9NA 3K89A 3J81U 2A2CA 3AODA 3WC2A 1U1MA 2ZBPA 2XTJP 2R7OA 4B3SI 3MPYA 1B7FA 3DLGA 4CT9A
chains in the Genus database with same CATH topology
1NJWA 1IKYA 4A8SA 3GV7B 1P6TA 2RKIB 3SZ2A 4NLTA 5D4LA 2E9RX 5GAHU 4K4XA 4ED8A 1PGZA 3NNAA 2EWHA 1CC7A 4J9RA 4O44B 5K8PA 2KKHA 5DG8A 3N6MA 2QLWA 4CH0S 2PIIA 2ASJA 2J7UA 1KQKA 3FFIA 4CO1A 1C0UA 1HWIA 2XCAA 3OTCA 2E7WA 5KOWA 2CQ3A 2XI3A 1F5BA 1TKXA 2COLA 3PIOQ 1ZETA 1EP4A 4X4TA 1VIOA 2DHGA 2FTRA 1JNRB 3V6HA 1CSJA 4F3QA 3VF0B 4Y65A 4F4XA 2MSTA 4IH7A 1MROA 1VHFA 3H40A 4B9VA 3KK3A 2EPIA 4IYQA 4RNHA 2DPIA 2MZSA 2DHAA 1JLEB 3LANA 2LU1A 2E9TA 2KG1A 3MMBB 4NLGA 2RKIA 1NJZA 2M7SA 2IVMA 1X4GA 5F8GA 2FJAB 3S6EA 4FF1A 3KJVB 1VK3A 4O44A 1NRKA 3U1MA 4Z37A 2AD9A 2J9DA 1NKCA 1HNZF 1R8CA 2QMXA 4O3OA 3SSSA 2FVSA 3KWMA 4Z2XA 4A8YA 5T14A 4F50A 3H5UA 4J5OA 4M8LA 1F60B 1Q81T 2HHUA 1KLMB 2YQ3A 2F1FA 3D2WA 4UUWA 5AXLA 4Q8EA 2J9DE 5B08A 2N3LA 3GFHA 3N01A 1XEZA 2VA3A 3J81Y 2HYIB 2KYXA 1SH3A 2HW3A 4UUXA 2FLOA 4FXWA 3CUNA 5J2NB 1H3DA 2L9DA 1JLEA 2ADCA 3DLJA 1FRKA 4AFFA 2DHSA 4X4SA 4FN5A 5CD4H 1APSA 4ETXA 1X4BA 2KM8C 1UVMA 1P8GA 1SIZA 3MCSA 4FF4A 3KJVA 3BJYA 3MMAB 2JVRA 2DIUA 1XN9A 3UWTA 2AYGA 4JV5F 3MR3A 2MKHA 1SXLA 3FSYA 3MFHA 4ZPBA 4K50A 2PE8A 4ZVHA 4C8OA 2Z2LA 2DNQA 1OQ3A 4CH7A 2EFVA 5I3UB 2UUCF 1KLMA 3QAUA 5B0CA 1KSPA 1S77D 2J5AA 2R7XA 5LSRA 2FPHX 4RW7B 2QSWA 1X4DA 3MTKA 2CPFA 2NPIA 4ZPDA 4DOZA 5J2NA 3BSCA 4I4BA 1YRUA 4TLQA 5HBMB 3GB0A 3QAEA 2EVZA 1JLCB 4MYTA 3OTDA 4FBTA 2E5JA 1F0XA 4E8UA 1SL0A 4RLEA 4K4SA 2DNLA 2JFKA 4HVZA 3U7JA 5B0EA 3DXBA 4OMFG 3OLAA 2BJDA 1P1LA 3D54A 1D9AA 2RIJA 1RA7A 1NJIT 2E9ZA 5CCMA 5L1IA 1ZPWX 4DR3F 4I2PB 2MZJA 3IR6B 5I3UA 4X4NA 2OPQB 2PN6A 3DOKA 3DLKB 4RWWA 1N4LA 2R7SA 1NEEA 4IOBA 2BBEA 3GWCA 4RW7A 2QA4G 3H20A 4DG1B 3DRPB 2VKZG 3OFGA 4ECVA 3PW0A 3OXFA 2NR0A 4ECYA 1SL2A 5B7WA 2XMVA 2CPDA 5HBMA 1D0EA 2AWZA 5I42B 1JLCA 1G2EA 5F8HA 2FJDB 1BWEA 3OSNA 2GGPB 3KYLA 1RYRA 2OKQA 3ZZZA 1U26A 4I6YA 3H4DA 1VQSA 3FJ2A 1N48A 2IFXA 3SFGA 3DCAA 1UWBB 3HHLB 2PDAA 5LJ3Y 2HHXA 5HL7Q 4N41A 3BSAA 4I2PA 2KTQA 2CPXA 4ILMA 2VBZA 1X7VA 3CCTA 3WBZA 3RBEA 2OPQA 1Y5NB 3DLKA 2UUTA 5E3CA 2KRBA 2CJQA 3VALA 1QAJA 4FVCA 2D3ZA 1RT5B 4DG1A 1VC0A 3DRPA 1NH7A 2M52A 5KFPA 3N79A 3HHKA 3OBIA 4DQRA 3NWGA 3TARA 1FVSA 1XNRF 1SH0A 5I42A 2E5LF 3I96A 3IGVA 3CDEA 6FDRA 3M6UA 4PXEA 1CLFA 1XBWA 2LQBA 2GGPA 1H6KX 3HFKA 3JSMA 2FJBB 4WZMA 2ZE2B 4LVNP 4F26A 2LEPA 4X65F 5EWFA 3IN5A 1Y00A 2VD3A 4EUVA 1ZM2A 1UWBA 1K1QA 3CCWA 3HHLA 3O2IA 4B17A 5BYQA 4IO1A 1NK7A 1K8AT 3N28A 4DV5F 2V4JA 4IOCQ 3KLIB 5JVHQ 4TN2A 1FDNA 2FHOB 1I1GA 4OI4A 2ZJQQ 1S99A 3HF5A 5KT4A 3BM7A 1QAXA 4YP3A 1YI2S 2GA7A 1KQFB 1VQ4S 1WI8A 2EKYA 3K5NA 4FXDA 1FTCA 5KFYA 2JOQA 2XG8A 2WB1D 1R89A 3MR5A 3RW7A 2OIHA 2IA6A 2XZWA 2DH9A 2HPUA 2J76E 2DK2A 4NLVA 4C2MA 1KS2A 1XMQF 1WG4A 2DCUB 2IVYA 5HMXA 4DSIA 3OR1B 2YH0A 1KR4A 4TYBA 5GMKa 5SZTA 4CNYA 2D3OR 1WHXA 4YB5A 2MQMA 2FHMA 3BB5A 3Q8SB 1A6LA 1WHYA 1DQ9A 2GHPA 3CT9A 3KLIA 1IBKF 4CZCA 2QT7A 5DDRC 5AE2A 1SKWA 1RTJB 2CG4A 3GFZA 1WF1A 5D4PA 5J2QB 2AX0A 1J5OA 2MSSA 5HN0A 2CJAA 3R1HA 2DNPA 3GZ7A 3G8QA 4FF2A 3BN4A 3M8RA 2MKSA 1DARA 1JB0C 1TK8A 2DR9A 3ZZOA 3D0IE 1U8SA 1VQNS 4KHPF 4TY9A 1QE1B 4NLOA 4DL3A 5GAGI 4JV1A 1FKAF 2ZITA 1JLBB 4LIWA 3FSIA 3OR1A 3TA1A 4JBCA 4JI5F 4M63A 5C25B 3LGMA 3N6NA 4G1QA 2PMZD 4OJ3A 4F8RA 2X1GA 4C7QA 1VS3A 1Y3KA 5E41A 1RTJA 4IH6A 4QQBA 2EK1A 2MMYA 4KIAA 3K5MA 5J2QA 3C66A 2W25A 2OH2A 2X1AA 1UJ5A 2K1RB 2CIMA 3RR7A 1H2TZ 4AUKA 3M8QB 4U7UK 1QSSA 3ZZPA 4PG7A 2XMTA 1Z2ZA 2JSXA 1SJRA 4MTPA 2JEGA 2BA9A 3ZZUA 5DRKA 1FD2A 2W9BB 3CCMS 1QE1A 5KG5A 1GTHA 1RKJA 2OLWA 3KMSA 1N5QA 2FVCA 2IJNA 2J0XA 1JLBA 4KV8B 5FLXY 1QLNA 3DYAB 1XC9A 1U1OA 5C25A 3UCGA 1GX6A 1RP5A 2Q6BA 2PD1A 1T03B 1YJWS 4X62F 3BZQA 4QBUA 1Q78A 1S1UB 2POKA 2PI4A 2VV5A 2VKRA 3A1YG 3FQKA 4ZHRB 2FVQA 4PWUA 2K1RA 4QIFA 3M8QA 1Q8BA 1VQ7S 4I7FB 4XDDA 2W7OA 2KJVA 3B4MA 1H0HB 5J2MB 2G4BA 4CO2A 5DLGA 4F4WA 1FDAA 1RTHB 3FMWA 4NLWA 2RQCA 2W9BA 1IKXA 3EGNA 3VZIA 2RUGA 2XWYA 3N5FA 3VTIA 4QYZJ 3TR5A 3Q24A 2FHJD 2JL9A 1K73T 4KV8A 2KJWA 3I9ZA 2MGZB 2CKWA 4ALZA 4PPZA 3DYAA 4C0OC 2X1BA 3C46A 4AL5A 4ECZA 3KLVA 2AX1A 3G6ES 4WK1A 2DNRA 1X8DA 2BDPA 1S1UA 4Y2IA 1VI7A 4JI3F 1L3TA 4ZHRA 4ECTA 2OO4A 3JTNA 1N33F 4IR9A 2L08A 5KTQA 3A8EA 3LO3A 4I7FA 3MM5B 4YUDA 5HROB 2F3JA 4ZLPA 1L3SA 2XULA 2FGOA 4PG6A 1TL5A 1VQLS 2HHHF 1UP1A 3HVTB 1RTHA 1S6QB 3CC2S 4FF3A 4AXJA 2XLIA 3J80Y 1YWXA 3MM9B 4DSJA 3CB4A 2IM0A 5IZHA 2ZH1A 3B8HA 2MGZA 2XY5A 1OS5A 1W2IA 3IRXB 3MOJB 2P9CA 4ELTA 4H4KA 4RW9B 3ISND 2ZJPQ 2YKOA 4JI0F 4KGMA 3GIIA 2XMUA 1UETA 3RBDA 1TV6B 3US5A 4U67Q 1Q8IA 4ELVA 2KH9A 6FD1A 5DDPC 4X4PA 2DNZA 1FEHA 3HHDA 1H2VZ 3GV5B 3TVYA 4PUOB 3MM5A 1GXUA 3IR5B 3T6BA 3LWLA 3V6DB 1Z1ZA 3HM9A 4ZVEA 1JLFB 1M5KC 4DPOA 4A8XA 4YR3A 1S6QA 2FLNA 4KKOB 5F8JA 3B4DA 3P5TL 4OZNA 2GMLA 4F4ZA 1TK0A 2YKAA 4EWTA 3MM9A 2GHWA 2HWTA 4RBVA 5I4MA 3MECB 3PEJA 2OP5A 1OPIA 2RB7A 1HNIB 2XEXA 4J9MA 2FVRA 1HQEB 3IRXA 1RISA 1YJRA 1NK0A 2RSQA 2GCFA 3V6KA 1KFSA 3PKYA 1TV6A 4QIWD 4GKJF 4A8QA 1N5YB 3B82A 4DSLA 3CDWA 3RAQA 2EFOA 3MXHP 2Y0SD 4OIXA 3BQ2A 2KG0A 4LF9F 3BGUA 4PUOA 2F8HA 2ZH7A 2YVSA 2RU3A 1UMJA 2ZOFA 1CQNA 1E6VB 3CD0A 5F3TA 3SYZA 1JLFA 1U1KA 1S0NA 5A6WA 1S1VB 5J1EB 3CTRA 4RW8B 5F8IA 4C0HA 2O3DA 1LW2B 2A1BA 5AJ3F 1FDBA 1S72S 2CYYA 2GW8A 3MECA 2VZ9A 4Q2LA 2W8KA 1OPZA 4XK8C 1HNIA 4HDHA 3IRWP 4PWDB 3PV8A 1R3NA 3V6JA 1HQEA 5AE1A 3CCSS 2MZRA 1BGXT 3TP2A 2RRBA