1VI7A

Crystal structure of an hypothetical protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
LMESWLIPAAPVTVVEEIKKSRFITMLAHTDGVEAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALRQLTTQRKTPLTEYTLQCEYHQLTGIEALLGQCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YIGZ, a conserved hypothetical protein from Escherichia coli k12 with a novel fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yigZ
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01205 UPF0029 Uncharacterized protein family UPF0029
A PF09186 DUF1949 Domain of unknown function (DUF1949)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vi7A02
3.30.230.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Impact, N-terminal domain 1vi7A01
4ZCMA 4ES2A 2EFGA 2J7KA 4M1KA 3OQ2A 4QR0A 4ES3A 1FNMA 1KTVA 3B82A 3B78A 2ZITA 4MYTA 3EXCX 1U2RA 2NPFA 4ZCIA 5G4DA 1ELOA 4FN5A 3LH2S 2BM0A 2CVEA 3UI3A 4QR1A 4ZCLA 1N0UA 1ZPWX 3E3XA 3B8HA 4ZCKA 2IVYA 1T95A 1ZM9A 3ZZUA 2E1RA 3ZZTA 4MAKA 2L9NA 4ES1A 1ZM3A 2BV3A 4TNOA 1VI7A 1DARA 1ZM2A 3ZZ0A 4QR2A 4MYUA 2I0XA 1P9QC 1N0VC 2WBMA 1ZM4A 2KDOA 2I8EA 2BM1A 2XEXA
chains in the Genus database with same CATH superfamily
4XPEA 3CDIA 3G9CA 2FC8A 5M2UA 1F60B 3PIPQ 4RBVA 5EDWA 4HH0A 4I2PB 2DHAA 4IQMA 4PABA 1FEEA 1XR5A 1RT2B 1OMSA 2JT2A 3H40A 4JI7I 4GO5X 1C1CA 4IYQA 1AB8A 2Y1LB 3A8IA 1Q5VA 1FRKA 4DR5J 1NXIA 4LF1A 2E5LJ 4YB6A 4YHHF 2C3UA 4ZCLA 1SC6A 4Q8FA 3N0VA 2HW3A 4X62E 2GX8A 1ZBTA 3B8HA 3PFEA 2L9DA 1N5SA 1Z5CA 4J9LA 3TVZA 3V4IA 4FW6A 4DG1B 3UN2A 3GILA 3KK3B 1VRTA 1EJ7L 3M6WA 5DG8A 2OFGX 2XQCA 3QWPA 4NEYA 2Q43A 4OYIA 2FJVA 2Y8WA 1N88A 3G8QA 3THTA 1REVA 3PHEA 2WW8A 3TEHB 5LM7E 4JYAF 2I9SA 2DGXA 3MM8B 3PRBA 4X84A 4OYBA 1RWXB 4OHZA 2VBZA 3T1AA 4L75A 3CCWA 3TUZC 3CB4A 2XB2D 1YQHA 5C0XE 1N32I 2RKIA 4X2BA 2DEJA 2AX0A 5FD1A 4DEZA 4HTIA 5L1JA 4B3RF 4P9SA 3GIIA 3LH2S 4HVZA 1Y4ZB 1NJZA 4I64A 1HMVB 4ILLA 5L1LA 4R8UA 4YY3I 4CT8A 4NA1A 2Z56B 1NLKL 4OX9F 2VG6B 2YNHA 5LMUE 2C2MB 3MD1A 3A8JA 3SMZA 2V4RA 3DU6A 4KIAA 1IWAA 3MAAA 4MAKA 2VA3A 1RHUB 2VUGA 2W7PA 1XC9A 1G6BA 2QT7A 4DU7A 5IT9Q 3GSIA 4B3OB 4UT4A 5KG3A 1UP1A 2W25A 4GRSA 5B7WA 3UDCA 1FRXA 3AAWB 5IC4B 4X65I 3MM7A 3KRNA 4L73A 4JI0J 1QTMA 2M52A 2MZSA 3GG1A 1V5VA 2CQPA 4UQGA 2V5HG 4DV4E 4DCOB 4JI6E 1LNQA 1FESA 4NWBA 3TARA 4B3TJ 4ZVFA 2W8KA 4NCAA 4OLPA 5DGBA 3D28A 2G2OA 4RR5A 2BA9A 2RT3A 4ECVA 4DPUA 2ZBIA 4OI3A 1SUQA 4C3MA 2DNQA 1RBAA 4Z2XA 3US5A 1U09A 2FVRA 3TP2A 3DI6B 4FS2A 1KOOA 1X31C 2B9WA 3Q8SB 2V63A 4GKJF 5ETVA 4RU9A 1S1XA 4NLDA 4DV2F 1N34J 4OJGA 4TLQA 4DR7E 1KONA 1FJGE 1VOMA 2OD4A 2VJUA 3IAM9 5M2PA 2ZEJA 2KG0A 2R7TA 5E41A 3LUYA 3VGVA 4DCJB 2WNRA 1I51B 1YRTA 1Z0WA 1IBKI 3CCJS 3CO0P 9ATCB 1T3OA 1NK7A 2CJQA 3ENWA 3QO9A 4EFAC 2GMJA 1WG5A 4EK2A 2XI2A 4YUDA 1K0VA 2OSQA 5IC6B 4JYAE 1LW2B 3ZM7A 2M3DA 4D3HA 1WDTA 2RB7A 5LOQA 3M8RA 2BOPA 5KFYA 2WHOA 4DL0C 4DV5J 2DNLA 3UQSA 3R5AA 1XN9A 2MDAA 1J5EE 1FXDA 1HR0F 2VC0A 3X3UA 4RW7B 1N36F 4JV2A 4ZIVA 2ACYA 2G1DA 2V2VA 3NCRA 3HP6A 4YFUA 3UCUP 2G2ZA 4QR1A 3UD4P 4IFVB 1FJCA 2JDJA 3AY0A 2BEFA 4Y2IA 4BA1A 2HAIA 2BZ2A 1ZZNA 4YHHI 5HMYA 1HPZA 3D0GE 1P8GA 3NS7B 3OD2A 1AUSL 2YWFA 4B9NA 1R43A 3R6LB 1C0UA 1L3SA 3CUNA 1U2CA 3DHWC 5C0XD 1UFLA 4C0HA 1OYDA 2W2MP 4E2FB 3OUYB 4YHHE 2F9JA 2B7BB 3G82A 2HURA 3HKZD 4USJC 4DCPB 1YITS 1WTBA 1S7IA 3A3PB 3QT6A 2HHUA 3T9NA 5D3GB 2EKNA 1CJTA 3W8PA 1NK8A 3I82A 2VBWA 1SI9A 5HVGA 3R6GB 1ICEB 2EG1A 4KQZA 4MIBA 5KG7A 2BXJA 5CYMB 3LGMA 1RWKB 3KG4A 1H6KX 2LEPA 2F1FA 1TZ0A 2ZC3A 3CCTA 4QW8A 5LMUI 1QAIA 4LF7F 3ZTSA 1HBNA 1RTIB 1ZTTA 4U67Q 3M8PA 5KG5A 2K7JA 1MG7A 3H2VE 2W4CA 3J81C 2R42A 4DV5E 4U9RA 2CQ3A 3KK1A 4L72B 1U49A 2VKRA 4DU8A 2D3UA 5MAOA 4QYZK 1ZYQA 3K89A 3CD0A 1R0AA 3OXLA 1P9QC 3I5AA 3W5ZA 2CJXB 1YX2A 4IOBA 2AGPA 4NA3A 2MZ1A 4YR0A 3LF0A 4WPAA 1WC4A 3UWTA 2COLA 3T1YJ 1SC1B 2LDYA 2XHCA 4TY8A 3R1HA 4B3TF 2EFOA 3FFIA 4HT5A 3UD5A 3EXCX 3M6VA 3PJ9A 1KBRA 2X1BA 3N4WA 1H7XA 2V2KA 4OZ5A 4OYXA 5DDQC 4MH8A 1Q8LA 2OPRB 1XNRJ 1WF2A 3EICA 4LQ9A 3GLJA 2YVSA 3QIPB 3OTOJ 1GNKA 1Z2LA 2HFNA 3MFIA 3Q8YA 1NK0A 3SSRA 3CEDA 4RW9A 4IOAQ 3MR6A 1M1HA 1SH2A 2FHMA 4ELVA 1HWIA 4CLZA 2XMAA 2DXEA 1VQ4S 2DISA 2YNHB 3EMTA 2GA7A 2WONA 3P6YC 3ETOA 1U0HA 2M7SA 4NYOA 3TZXA 3RB4A 2EK1A 2RDIA 1CC8A 2FGOA 3KMSA 2JEIA 5BYQA 1BKNA 1TKXB 1HI0P 1U6FA 2MMYA 1BC6A 3G2XA 4CM2A 4TU9A 3DLGB 1CLFA 5C0XF 1LOUA 1FFWB 3SDEB 3M8SA 2BYCA 2Z4PA 2IM1A 3S7RA 1X8DA 1JKHA 1EIYB 1EETA 3KUEA 4Q8EA 3PX0A 2D3OR 1SKWA 1Z0CA 2H65B 4IO1A 1Q86T 1H2UX 3NAIA 2BQRA 4WP3A 2CPFA 4RUBA 1C2PA 1WTFA 1T94A 1PG5B 2MQOA 4USKA 4DN0A 5HMXA 3IN5A 4IR1A 3NNCA 1LWEB 2ROEA 1Q16B 4YB5A 2YKAA 1Q5YA 3WIUA 3OR2B 4DG1A 3T41A 1UJ6A 3T1HJ 4PU9A 4LF6E 1UJ5A 1DTTA 4UOHA 1M5VC 2VBXA 2V2QA 4ZVGA 4DPYA 4P2XA 3KHLA 2VA2A 4JI1F 2IA0A 3BBBA 2XG8A 2WCXA 2AGQA 2FLNA 4DXLA 4RNOA 4ISAA 2YWHA 5GVQA 3JAMU 1XMOF 4LF9J 1S1TA 5ETKA 2E5LF 1X5PA 2HRYA 4OIXA 4GKKJ 1T9UA 3HD1A 3HFKA 2WNRB 1A6LA 2FC9A 2A6OA 3PG9A 3C15A 3KUHA 4DHVA 4K4XA 3CW2C 4JI2J 2DGVA 3T5HA 1NHJA 3E2EA 2I5JA 2K3KA 3ILOA 1WKKA 2Z8QA 4ITSA 5FDLA 3HJFA 3QT5A 4CLSA 5DM7Q 2EXUA 1KP6A 2DR8A 3WC2A 2Z2LA 3H59A 2QA2A 3RYLA 3ZO7A 4O0NA 4JI1J 2IBOA 1L5UA 3T5KA 1CULB 3BH7B 4K50A 4F4XA 4NCBA 3T1HF 4LFBF 4DV7J 2KJVA 3VVTA 4X4SA 4Z7YA 3EDRB 4IFDC 4F0MA 1RU2A 1U25A 4DR4E 4DR1I 4BS2A 3P3DA 5MLCV 4JI7J 4DR2I 4YDDB 3GFZA 1SJQA 4MU0A 2LXUA 2ZNYA 1MN9A 2YNGA 3K17A 5KFVA 1RHKB 2H4WB 3ZXWA 1VIXA 4DFMA 1FI4A 1TV6A 2XS5A 1KR4A 1MN7A 2DJWA 4CH7A 2C39A 2EVZA 1Y00A 3D3CJ 1W7WA 3H2UB 3HX9A 4BC9A 3H4LA 5KFOA 4HACA 1T9TA 5T14A 2AJ1A 3FCWA 5FIIA 4I4BA 4ZP8A 1TUWA 3M2RB 1N5QA 3PNIA 3M1VB 1TL5A 5E3PA 1TKXA 4DX8H 1WKLA 1NNDA 3G6ES 1GAOA 2OEJA 3HF5A 4P72A 3PZPA 1QAJA 2DGTA 5DM6Q 3D7SB 1HWLA 1YJRA 4IH7A 5E3CA 3TAMA 2YPYA 2YWWA 4OYPA 1I94F 1FJEB 3CCVS 1Z0GA 3FGVA 3PV8A 4DR3E 1JJHA 1DQ9A 3BGRB 4RW9B 1KS2A 3O3LA 3D67A 3OTOF 3SFUA 4I6YA 5C25A 3WQPA 3EPGA 3J7ZT 2IAJA 4ETZA 1X7VA 1CJVB 1K47A 1Y10A 3NG8A 4RW6A 4Y2AA 5IV3A 3CJQA 1RREA 5LXYA 1WWHA 2HZVA 2JL9A 4TKTA 4OO1C 1B0TA 1RLDA 4NRTA 2E7WA 5F3TA 3RZAA 2XO6A 3D2WA 3MM5B 3GV5B 1FWKA 2C2ZB 2KB2A 1BE4A 3OQ2A 3UVJA 4LF5F 2KRBA 1Z0BA 2NS1B 4O3PA 3CD7A 2VFSA 3KXDA 3FBEA 4NEZA 4LF4E 3C2PA 1LW0A 2FUG9 3CJRA 4LRAA 2RDDA 5J2NB 4WF9Q 2DITA 1BY9A 1P1LA 3A1YG 1UPPA 1RQ0A 4NXMJ 4FW3A 1FKAE 1S59A 3SCKE 4P6QA 2HMIB 1YJ7A 3BKTA 3M8PB 4LF7J 4ICLB 2J9DA 1F3FA 2C2OB 4PUOB 3UHMA 1NH7A 1RTJB 2Q79A 3VAFA 4AIDA 3QQCD 2PC6A 1FWLA 2CQ4A 3W66A 3PYDA 3SQOP 2WB4A 3GFXA 1WC1A 4HY1A 1JLAB 1MWYA 1NPKA 1OY6A 2LMIA 4ENOA 4KRWA 2JEGA 4IQXA 2QE5A 2XSFA 3I0RB 4KGXB 1HR0E 2PDAA 2WVEA 1H0HB 4DMZA 3KDNA 5JMNA 5DDOC 3CCES 4B3SI 3CCSS 2HHSA 3W61A 1CBKA 4DV1J 2W9CB 2W4PA 4DR7J 3B78A 3DDIA 3G82B 2H5IB 4MIWA 1Z0VA 3M4XA 2ROGA 2NXJA 3R7NB 3RBEA 3N6MA 4WIIA 4CO1A 3NGRA 2J76E 2UUTA 3DMJB 3GB0A 4FNIA 4UOFA 1DY3A 5J1NA 4IDKB 1RTJA 1RA6A 3DLLQ 4IFVA 3ZZTA 4AL7A 3OBIA 1JNZB 4OX6A 4NXNI 3F44A 2BKNA 1I1GA 2NXCA 4XK8C 3U1YA 4G1PA 2H5JB 4DI6A 4A8YA 2CG4A 3A12A 1HR0J 2ZJPQ 4HYMA 2RRAA 2A2DA 4ECZA 3HHDA 2KXHA 3JTPA 4WU2A 1JLQA 4IFDB 1T7PA 1IBMI 3AXMA 1UW9A 3NEKA 3GYNA 1TELA 4I7FA 5H9FK 4ED5A 2WAQD 4AUKA 2O1WA 2VHGA 1NSAA 3KLEB 4J9QA 1U1KA 3N79A 4FVCA 3CJKB 3ULHA 2MKIA 2MQMA 2ZITA 2CPJA 1DQAA 2V8GA 4CH0S 1EQ0A 3IXQA 4ZJOA 3ISNC 4DUZI 2NN6A 1RWOB 2JH3A 4KE5A 2HNYB 4LF2A 2R2RA 1TP7A 2HWTA 1ZA2B 1SCJB 4KGZB 1LWCA 4UY85 3MUMP 2E9ZA 1WOOA 1GTHA 1HNXJ 4PRXA 4W90B 3S8SA 1XMQE 1SJFA 4X64J 2CJAA 5L9XA 1IKWB 2DK2A 3TAMB 4K0KI 1YTYA 4LR9A 1KHVA 5DQHA 3BJYA 1SQEA 1YRUA 2Y0SD 4AL6A 2X1FA 1YG0A 4XDDA 2HQGA 2HGMA 5EWGA 5BR8J 1FXLA 4I68A 3GYXB 1RUSA 4YY3F 4X65E 3KKFA 5A0YA 2W4DA 3WBZA 5LL6d 2J0XA 2CQIA 3C6UB 1F2HA 3OVSA 4IZKB 3D9BA 5ETQA 2XMKA 3K58A 2YKOA 4ED8A 2D69A 1R89A 1TKTA 3GR0A 4U7CA 2WOMB 2JZ5A 2C38B 4WKYA 4MKAA 2ZZMA 3TW0A 4FNHA 4JG4A 4OZJA 4J9OA 4MU1A 1C1BB 1GT8A 1QSLA 4JI5J 4EMDA 2MGZA 1UEKA 4LR7A 2MZTA 1B7FA 3LQVA 3THPA 4I0WA 1PGZA 1B99A 1YBAA 5K8NA 2L9WA 4OX7A 4CZCA 1MWZA 4P71A 1F3VA 3EPIA 4RBTA 2BRLA 2CYYA 4ANEA 1X4CA 1KQSR 5IT9U 2XMWA 4JI1E 1S16A 4DV0F 1CULA 1X4FA 2BJEA 4P75A 4DN9A 4R8UB 1RCOB 3H5UA 3Q83A 4J90A 4JV0A 4KBIA 2GC8A 2YY3A 4C7QA 4YR2A 4ED7A 1SKRA 3HJCA 4DR4I 1OYPA 2FHOB 2ZH9A 2HFSA 1S1UB 1WC5A 2H51B 5HROA 2AYMA 2GHPA 2QGFB 4JI8J 3TANA 4ELUA 2KFNA 3DRRB 4DPWA 3M05A 3RJMB 1S1WB 2P9CA 1YDLA 3KLHB 3PW7A 2H4YB 4WTYA 2IVMA 5ETNA 5A6PA 2R8HA 3J7AM 2UXBI 2K1RA 4A8QA 3Q89A 4MKVA 1U1QA 1TKZA 2HFVA 1RHYA 2E5GA 1GMVA 2JC0A 1WORA 4USTA 3KK3A 2JRSA 4LMZA 2CG9A 1HQ2A 3LAKA 4ZVTB 4NCGA 3QPIA 3PVXA 3DHXA 4KB7A 2WP8A 5KFRA 1RAHB 3GCXP 4JV5I 1FE0A 1SIZA 2IVYA 1IKWA 4YS2A 3UFCX 2QL9B 4ZA1A 1FF2A 1SH3A 1XQIA 3FBBA 3DOMA 5IM0B 3DNCA 5LL6R 3E01B 1HQUB 1RWVB 2VQEI 3TI0A 2PT0A 1LWCB 4DX5A 5L1IA 2GO3A 1P1TA 3KJVB 4LFCE 3MEEA 4WP9A 2AJ0A 4DF4A 1NBEB 1FKAF 3V6DA 1EETB 2DIUA 3GR1A 4DUZE 2VB6A 4KHMA 3MMAA 1UKUA 4HYKA 1K9MT 3OVBA 2WSFC 3MDFA 3M85D 2DO4A 4F2SA 5F9NA 1R0BG 1PC5A 4F4WA 3OHBA 2ZKTA 3M8QA 2VIHA 4CNYA 4BBYA 1I3OB 2RDJA 1HNXF 2GQ2A 1UVIA 4QWCA 2R7SA 5GADU 3T5JA 1HHQA 2V8VA 2Z5BB 4DR7F 3LGHA 3DKDA 4RW6B 1HARA 2BJ1A 2VFUA 2QLBB 4XTTA 1RCXB 5K9FA 4CRJA 1FRLA 3DLHA 1XXEA 3OTOE 3F41A 4Q45A 3UO0A 3MTJA 2KRRA 1WELA 4IDKA 1UFWA 4UW2A 1FVQA 2FLPA 1CJKA 3Q2SC 1VC5A 1EX8A 2RIJA 2QA4S 3JAMC 4A8OA 2O3DA 3GJQB 1E6VB 2VPZB 5AXLA 4CO2A 1ZTWA 2PNZB 1D09B 5I3UA 2XZTB 3L09A 2FLOA 3QAUA 8ATCB 1UVKA 1R8AA 2D3ZA 3AXKA 4NX9A 4ZP6A 3CDEA 3T9ZA 4DDFA 6AT1B 1X4BA 2VG7B 1ZZFA 4FYYB 2V67A 3AODA 1TUGB 4ES3A 3CJTA 2X1AA 2VQFF 4DS5A 5H9EJ 2LJPA 4OZ0A 3J80Q 4B9VA 2DHHA 2ZZTA 2P2CB 2AYBA 2UXCJ 2CZ4A 2NN6F 5IS2A 2YH1A 5C7PA 1IBKF 3LOUA 4FZVA 2QJ3A 3CD5A 2R7UA 1M5SA 4DV0I 2B5JB 1RI7A 1RE1B 2AWZA 2GIRA 2W9AA 5B0CA 3TUPA 2KZMA 2DGWA 5HJXA 2CG8A 1UA0A 3LPSA 2BQ3A 1JXEA 3PYEA 4DV7E 3FQLA 2I6WA 2HNDB 3HPOA 2AJ2A 3W9HA 2B9YA 2L9NA 4X4UA 4X4NA 4DUYE 4R25A 1OJ4A 2P8IA 5ETTA 2Y1IA 3PW4A 2HMIA 2LQ9A 1RAGB 1VQNS 2FJBB 3HVTA 1Q7LB 2FY8A 1Q0NA 3TRGA 3TEGA 3R2CJ 5HI7A 2YKQA 3QLHA 4N76A 5BR8I 2GJIA 5A2QU 2DHGA 1FCAA 4LFAI 1VK3A 4NI2B 2AYGA 3PACA 2UVWA 1H73A 2N7YA 2XNRA 2JEAB 5E3AA 5CAAA 3K7RA 5F41A 1RWUA 4G1QB 2KG1A 3GJRB 2AHOB 3R2DJ 3VWSA 2IPOB 4KY3A 3K5NA 5I3UB 5KFGA 2ATCB 4M5KA 1S97A 2A3JA 2W24A 2F5GA 5KOXA 2ZH2A 1SKSA 4LF6F 1NKEA 3M8WA 3EYZA 3RB3A 2LEAA 3GP9A 1S12A 3FC9A 4I2QB 5DRKA 2MKSA 2B8QA 3KLIB 1OS5A 5EUHA 3VV2B 1JWWA 4FF4A 1E3HA 1NEEA 2RILA 4J9RA 1S77D 2VG5B 4J7CA 4QWDA 1VC0A 2Z5BA 1FT8A 1X0PA 1Z2ZA 3IAS9 4CLKA 3QNWB 5D15A 2ZD1B 4XIUA 3W9IA 1TKDA 5LMNJ 2JLFA 3FSIA 4JBCA 1HHSA 1JLCA 1WJ9A 4UOGA 2ZH1A 2NPIA 2HFOA 1OWXA 3B54A 4PKDB 3HMJG 4TY9A 2OD6A 4ECWA 5HQLA 1QAXA 2Q3PA 4DV6I 4QIVA 1U02A 2ZOGA 2RF2B 4MK7A 1EQMA 3QRRA 2C39B 5I3PA 2X51A 5M2RA 1TL7A 5KG0A 4IOCQ 3HM9A 4NXNF 2RQMA 1Z5AA 1SPBP 1Y0HA 3RB6A 4FWGA 1U0HB 1R7IA 1L3KA 3M7NG 4ZPWR 5IQ6A 3T6BA 3M7VA 1OQ3A 2LLZA 4NZ6A 2KN4A 3EXYA 1RAOA 3VAMA 1S72S 4DR4J 4GKKF 1Z5BA 1TK5A 3J81j 3G4SS 2UU9I 2RQCA 2M5YA 1VQ9S 4TYAA 1LWXA 2K8GA 2XCAA 2UUAJ 4O3NA 4L6V3 3G87A 4PEOA 5FLXU 2ZBKB 3PCOB 3JTNA 3TJ8A 1LEOA 1S6UA 2MZJA 3D1OA 4NLTA 5BYSA 5KG2A 1FRMA 2BDPA 4O3SA 3D1HA 2BJ9A 3FCHA 3CTRA 1AW0A 2KXNB 1VRUA 4WE1A 2IRYA 2DHSA 3NY0A 3Q8UA 4TY8B 2AW0A 2XS7A 1RT1B 3L3CA 5IV4A 2MPUA 3W2WB 3MR2A 4ECRA 1N6QA 3AH6A 1Z59A 4X66I 4KTQA 5KT3A 1KDNA 2CZ9A 2F4VE 4DR1F 4HH1A 3LP0B 3LPYA 2ZM6I 3K1JA 2O1VA 1HBOB 1DLOB 3FKBA 3CIMA 1SQFA 4ETXA 5C42A 5IXUA 2V4QA 2CWXA 5ETLA 3KMQA 4LREA 4M5DB 5AJ3J 4LF7E 2W8LA 1RSCA 2XO7A 3SV4A 2ZM6E 5HLFA 5D77A 2KTQA 3MM6A 1GXUA 3TZWA 1QSYA 1VHFA 1H72C 3BB5A 2Z5CA 4UUWA 3Q6MA 2HQ3A 2VOOA 2IM2A 4M5IA 1GH8A 4X4QA 2ABYA 3QFWA 2LEBA 4F02A 3VTIA 1M0SA 1N0VC 2ADCA 4X64I 1YSJA 1G3OA 1IBCB 4USUA 3PJXA 4Q7AA 4RBUA 2C2NA 3IR7B 5CYMA 4NMLA 1MU2A 4IR9A 1HNXI 1JKHB 5AE2A 3KJFB 2UXDE 2MY7A 2Z2ZA 3C6UA 3HCXA 3MZIA 4EO8A 2R9LA 2CJKA 4J3DA 5KFEA 5E0OA 4BDPA 2XYGB 4PG4A 1NCLA 4DUZJ 1FJ7A 4DV6E 2IMWP 1XHKA 4H4KA 1N52B 1FHTA 5A2QC 4YB7A 3HKWA 3THVA 4YQWA 3R3TA 1H38A 1BQMB 2BQUA 2AKWB 2MSTA 3JSYA 4X62J 4BWJA 1OY8A 3GTYX 4H54A 1HPZB 4DSIA 2BE2B 4GVBB 5CCMA 1TFYA 3GJTB 2UU9F 3HT0A 2BR2A 1Y3JA 1FE4A 2IC3B 5C0XA 1ULRA 1OIAA 3NGDA 3CJ8A 4URQU 1D9AA 4CI0B 2UUBF 3CDWA 1J5EJ 3LP1B 4H4MB 4NMXA 3R5DA 4TYBA 1F5CA 3QJJA 1RT2A 3ZTOA 4A8XA 4DQQA 2ZZNA 1RT4A 1FFSB 2V50A 3A3NB 1SJRA 1VRUB 1RT7B 2IM3A 3B6BA 4PG6A 4DPOA 5IFMA 1N34F 4U7UD 2IYGA 2J0WA 3KK2A 1PCAA 2CAJA 1WEYA 4M5HA 2XHWA 3VR1A 3BO2A 2ZBRA 2XWYA 1NHHA 3T1YE 5JEAE 1CC7A 4K4UA 2B6AB 4IUFA 1VQKS 1YH8A 1R0AB 1E6YA 1S6QB 1RKJA 2UUCJ 1RWMB 5B0DA 3OL8A 4IG3B 3CJ2A 5KG6A 1U1NA 1FA0A 2U1AA 4OMFG 4OYMA 4ZCKA 4V1Ak 4DV2E 2KU7A 3DYAA 3TZZA 3LANA 2ALYB 2IY5B 2NXUA 3QT7A 1RTIA 1S1XB 2HWHA 4URSA 4WZMA 1T3NA 2UUCF 4OO1B 4JI0F 1RWNB 1NK4A 2CPZA 3GLLA 2I2YA 2PE8A 4RNNA 1T03A 1UZHA 2Y1RI 2PN6A 5D0GA 3EGZA 2UV8G 5EHHA 4NYPA 1GK8A 1M5OC 1RWPB 1YBTA 2FHJD 2GIFA 2GGPA 1NB7A 3C19A 1N8RT 1XBWA 1NSKL 4MIAA 1S1VA 1B0VA 2RJZA 3MCOA 1MWQA 2FPHX 5IQQA 2LA4A 2CNOB 4C6AA 2WZ1A 1VQSA 4ZLNA 3T1HE 3MPWA 1V9OA 3FNNA 3OR1A 5C5JA 1T95A 2ZUAA 3MURP 1CQNA 3D6HB 4WFXA 1JLEB 3MMCA 2F9DA 3OPKA 4BA1B 4OX9E 4WUCA 3ETMA 4K0KE 1USVA 1TL3A 2H1YA 4J5OA 4OYOA 1MROA 2CNKB 2XM3A 3EVWA 5L1KA 4JB8B 3C8YA 3WX4A 2XZDB 5KFDA 2ALZA 2ZE2A 2VODA 2PO2A 1Q1KA 2U2FA 3RU0A 5K8OA 1XMQI 2EG2A 3M2VA 3MMJA 3H4DA 4O3RA 3O6QA 1URNA 2BJ7A 2CXEA 2G0IA 3QATA 2CDQA 4C8MA 5KFZA 4DR6E 4NZ7A 1TU0B 4JYAI 1MMDA 5L46A 3SZ2A 2DXFA 1XWLA 3IWXA 3PW0A 1VQLS 2O1TA 3FSYA 2JVRA 3KWMA 4NLVA 4HHUA 3RR8A 1YJWS 1F5AA 2DH8A 2GHWA 1ZAVA 1VRTB 5SZTA 2DNKA 1VBYA 2GCFA 3FUYA 1YIJS 1VC6A 3N5FA 1U1OA 2JE6B 2BMBA 2E1PA 2UU9J 3WU5A 4HR2A 3Q8QB 3EZUA 2XWXA 2BA0G 4YR3A 3SV3A 3DD6A 1WC0A 3G86A 4LRFA 4DR1J 1NK5A 4DL2A 1S1VB 3BPSP 3RBZA 3TX8A 2HHVA 3I87A 1S10A 1FXRA 1RLCL 3M1VA 4DFPA 2ZC4A 2RRNA 2EBEA 3W5YA 4AM3A 4OX9J 1VJWA 5DNLA 1LWFA 4RPFA 2X3GA 2POKA 1U8WA 2FJWA 4KHPF 5HAOA 3GE9A 2M8HA 2R7WA 3ZKBA 1CSJA 4O4GA 4CDIA 1FRJA 4ATNA 3DLKA 3IP0A 4LCFA 2ZHBA 2YNGB 3IMQJ 5H9EK 4DUYF 4GQUA 1H3DA 3BQ2A 5LMNI 4JI0E 6FD1A 3UW1A 2DNYA 4FYVB 3V6HA 2CQDA 2HYIB 5DRRA 4AQYE 3CD6S 1OSCA 2H3EB 4NLOA 4C3KA 1HWUA 3SIPB 2QA4G 4K4WA 4GKKI 2LP4A 4ID8A 4LBHA 3R8YA 2F4FA 3R5GA 5KFWA 2MXYA 1ZAXA 5LMUF 1KQKA 3QGIA 2RNEA 2K7KA 3K5OA 3MWBA 5E3RA 5HVFA 4AXJA 4Y2CA 1S9FA 1RTZA 4I6WA 4CO0A 1UA1A 2BKPA 4YP3A 5A8KA 4DLEA 2C2DA 2AEFA 1IJEB 1EP4A 4YN3B 3VVUA 1FWPA 2QL7B 3W8GA 2DR9A 1J2VA 4N3OA 5JEAB 2RKIB 5KFCA 4RW4B 4U7UK 2GO9A 2GJ2A 2KHCA 4KAIA 3MR3A 4ECYA 3HO1A 2UXBE 3D4JA 3UDLA 1RT4B 2XLIA 2OMLA 2QSWA 4FKYA 1T9WA 2W9BA 1JLCB 4MYTA 1VQPS 1T02A 2Q1LA 3P5BP 2C3PA 4FDFA 1SIWB 5CABA 4KO0B 1X9WA 3HK2A 1HBMA 4OJ3A 3MPYA 4LFAJ 3OVAA 4CLFA 4KT0C 3MCSA 2IERA 4WJBA 1S0MA 3DOMB 2UV8A 4ZVIA 2BE2A 4GVBA 4ZITA 2UUAF 1AFJA 1RDRA 2B4PA 1QD1A 3SSSA 4LF5J 2UUCI 1WHXA 3HT3A 2AGOA 4X62F 4V19X 4IFYB 1IM4A 2LU1A 3V81B 5A8WB 4DR2E 3U1NA 2OFHX 5ETOA 1KVKA 4Y6IA 4N5SA 3C6TA 4M95A 4ZPDA 3KTQA 2I1RA 3PS3A 2EEYA 5J2QA 3TVKA 2YKMB 5U47A 4RUAA 2FLLA 2MHEA 2UVRA 1W2IA 3BGLA 1MLAA 3SDEA 3M2VB 1J5EI 1TL4A 2UXCI 1I94J 4KGMA 3NNAA 1S0OA 2N3LA 4QNKA 2HHWA 1OYSA 3QJLA 3P8BB 1TL3B 3BSCA 4ZPTR 2F3JA 2CFXA 2QYGA 2WONB 5ELWA 5IWAI 1MNEA 3F73A 3I0SB 2EKYA 5EX0A 2HNDA 5G0RB 3TA2A 4M5DA 1HI8A 4ID5A 2ZWPA 4KYZA 5HK4A 3VQTA 2NXNA 5AJ3F 2IRUA 3CCQS 1FTRA 2ASYA 1EARA 1K44A 3LP0A 1B70B 1RABB 4R0EA 2HG4A 3VAHA 1HK7A 3H7HB 1UEVA 2ZBQA 3FJ2A 1RT1A 1WI8A 3G71S 4M94A 2DNOA 2XMUA 5DG9A 2HZCA 1WF0A 2ZH7A 2VQFJ 2CQ1A 3DLBA 5HMWA 1IQTA 5JVGQ 5KFLA 2NPFA 1SXLA 3K5MA 2BW7A 4ZK7M 1SL0A 1PYTA 5KFNA 3KHGA 3Q8PB 5J1PA 1NDLA 2E5HA 3P96A 3TAPA 2J6UA 1ZXMA 1N33F 2FDNA 2B4OA 2W2QP 2RHSB 4FPIA 3GU0A 1X9MA 3J81Q 5THWA 5F8IA 3PKMA 2GJFA 2AV5A 2WVDA 4B02A 1I94E 2OPQA 2R8GA 1IWGA 2HNYA 2D9PA 3VZHA 4JV5J 2QYCA 4EZ6A 2NN6B 1UJ4A 2RF2A 1HIYA 2ZVSA 4Y34A 3PRDA 4W98A 1RT5A 2FHJA 1I94I 2EFGA 1WI6A 2CQGA 3MMAB 2OSRA 2EFPA 4ED1A 2HHXA 1JK9B 1RT7A 1NKCA 2C1EB 1NJIT 3QSIA 4Q2MA 3D66A 4OI6A 3M9MB 3CXCR 1WSRA 1NK9A 2PI5A 4JI7F 2AE8A 3QRPA 4C98A 4H4MA 1WEXA 2OPQB 3Q22A 4LFAF 1VQ6S 4B3MF 2G13A 4LSNA 5DRQA 2V2ZA 2WSCC 5J2PA 4XAKA 4U3DA 4P2FA 4F3QA 3OFFA 1NUEA 1OYRA 1SC4B 3PIOQ 5C0XB 2R8KA 2ADBA 5AE3A 3HZEA 2NZCA 2VD3A 3CJSA 5B0BA 4DFJA 2QA1A 3MGJA 2YKNB 3FEZA 2P6SA 1UAWA 2VQFI 1FKOB 1IBKJ 1BQMA 3DGVA 3N5BA 1XJWB 2E5IA 3AB4B 3CF5Q 4OJ1A 2J8AA 4DV6J 3TQ1A 4N47A 2WTFA 1F1BB 3MCMA 4LVNP 2ROPA 2KFZA 1HW8A 2QFJA 4DL7A 1N34I 2JEAA 5K36B 3IRXB 3UR3C 3W65A 1AT1B 2AEMA 3J7Z5 2D9OA 3BH6B 2IVFB 2DRBA 4DR6F 3QLHB 5KFBA 1YHQS 3D5MA 2XGPA 2CIMA 2MJNA 4NLWA 3JAMY 1WF1A 3QGPA 2VQEF 2DRAA 4W4MA 4PRFA 4M5GA 5CD4A 3DDKA 1DURA 3ZNUA 2CADA 1FNOA 1T05A 2EBGA 3HZGA 4JI0I 5LMNE 4PUOA 2CRLA 1UW4A 4X65J 4ZVSB 2IESA 3NCPA 1HNVB 2DKOB 2QLXA 3OTDA 2WRMA 4IRKA 2F4VJ 2V9KA 3SXLA 3VHQA 1HBOA 4OV1A 1FNXH 1C1BA 4PWDB 4CO4A 5HMZA 2QLWA 4CTAA 4B3ME 1K1QA 1SV5B 2YBVA 4X64E 3EGWB 1N6QB 2V8HA 2DBBA 4IH5A 1FNMA 4YDXA 1P42A 4PWUA 1N54B 4MKYA 4DV3F 2XYHB 5EN1A 4YY3J 2K06A 1RJJA 3MM5A 2MEWA 2YX7A 2FJAB 2LDIA 5IWAJ 3OV7A 2GQ0A 4JP8A 2J6SA 1CJVA 4N8OA 5C24B 2IDEA 2LQ5A 3MAAB 4Z7CA 3MEKA 3MAHA 4MKBA 3UN3A 1B7YB 4RWXA 3W60A 2CVIA 5J2MB 5LJ5Y 3MMBA 4QWAA 1KQFB 3I56S 3Q1QA 5KFMA 2DGSA 1RAEB 2RUGA 3NGTA 4ECTA 4FBTA 1Q82T 2PA3A 2FZKB 3I32A 2DH9A 2AF6A 2BM1A 1VQ5S 3U1MA 4YB1P 3BO3A 2M2BA 1N34E 4JI8F 4ED4A 1JJCB 4PXBA 3N9UC 3GV8B 3PX4A 3PS2A 2H5EA 1NDPA 3GIMA 3UNYA 4LF5I 2RVJA 4WK1A 4G6VB 4F67A 3KJVA 4WIQA 1S0VA 1QVFR 2YTCA 2AYEA 3BGUA 2MLXA 3ZZPA 2DRDA 3DFEA 3MUTP 2NZ4A 5LSOA 5D0RA 2Q2EB 1U26A 1MU5A 3NGUA 1CJUA 2HNZB 2WVCA 2BACA 3CVKA 3LW5C 3VAIA 4DSFA 5IM0A 4OZEA 4QCLA 3JSMB 3KLIA 5ETMA 4MFBA 4I2QA 2MKCA 2LYVA 4MJKA 1X0FA 1ZM3A 4NCGB 5GADI 5GAEU 2EC2A 3I9ZA 4K5SA 2XSJA 3V6JA 2DY1A 1RAFB 2JC1A 2L08A 3A8EA 3PTWA 1TFWA 3CMAS 4OHYA 2VKZG 1JLBB 5HJYA 2YXLA 4CH1A 1WD6A 1TMJA 2A6MA 3C3LA 2DXDA 4G1QA 4OHXA 3RBXA 3C14A 3TZYA 5F8LA 2UUAI 3LP2A 2J7WA 5E7OB 2NREA 4N7TA 1R6VA 5BR8F 4X66J 4P7AA 1GMUA 1R31A 3B82A 3NKYA 2ZDPA 2YKPA 2NUUG 2VDHA 1W26A 2KYXA 3JSRA 4BCAA 4DJBA 5GAHI 2XLJA 2NUHA 4I1TA 2MZQA 3BM7A 2CQBA 2L48A 2VPWB 2B56A 3PJWA 1PAEX 5KFAA 1RAAB 2XSJB 4QPTA 5KG4A 5KFKA 3H4BA 2X36A 4R1FA 4LF9E 1H2VZ 4KFBA 3DOKB 1NSPA 1OY9A 2DIVA 3MCNA 5L38A 1PIEA 2KYZA 1DTTB 3DN9A 4CWBA 2GVZA 1Y4UA 1KQGB 5F8GA 5HL7Q 2FYXA 1NPPA 2CNNB 3SFGA 3SI8A 1D0EA 4LF8E 5K36E 4CT9A 3CCLS 2VC1A 4J91A 1N48A 1RT3A 1HNIB 4NPOA 2FY1A 1YZ6A 1NZ8A 4OX9I 2R8IA 2RAQA 5FLXY 2FQQB 1T8EA 2GO8A 4C8LA 3UCGA 3M32A 4KV8A 4R5PB 1JMTA 1ZM4A 4KHRA 4JI3J 2MY8A 2F4VF 2ZHOA 1S76D 4JI8I 3C16B 2GQCA 4FBUA 1S4EA 2BE7D 2W2OP 4ANCA 5JJBA 4DSEA 1N5YB 4PQUB 1HNZI 4X65F 4TXSA 2PIIA 3P3CA 3RAMA 1VIOA 2CPIA 1RTDA 3UPFA 1S0NA 1KRPA 2ZKUA 2YQ1A 3AHPA 2O5DA 1P6TA 4USVA 1AZSB 1RKIA 2ZJQQ 2GMHA 1U1PA 2DGQA 1VR6A 3D0HE 3EDQB 3MMBB 1AA1B 3MMCB 2R8JA 2IAJB 3AA9A 4UUXA 2QRRA 1UVJA 4ZLPA 1LFPA 2PFDA 3PXGa 3N6NA 3H5SA 5CYQB 4DR2J 1RISA 4JI3F 1FVSA 2H54B 2VPXB 1DRZA 5J2PB 5ADZA 1HL6A 2AD9A 1VS3A 4AFFA 1XMQJ 4AL5A 1G1XA 2Z0GA 3I96A 4OFZA 1V3RA 3BN7A 2D74B 4NLSA 5B0GA 3QZ8A 4S0MA 4P7TA 3KHRA 2EC0A 3PKYA 2G2YA 3LNUA 4HI2A 4O3OA 3K8VA 1IBLF 1N5YA 1Q8BA 2V8PA 2VF3A 1KLNA 4J9NA 1YJUA 4USMA 1BQNB 4DF8A 3EZ5A 2BE9B 2RQ4A 3I4PA 1RACB 3D68A 2CWKA 4IH6A 2CQ2A 5HVHA 2RU9A 4G3IA 3MEEB 4QYZJ 5I3QA 4K7QA 2Q6BA 2GV1A 5I42B 2KM8B 1I6JA 4K0KJ 4UQTA 4IZJA 3MXHP 3GCMA 1AYEA 2W7AA 5A6WA 4LF9I 4K4VA 3E8OA 1IKVB 3AOBA 3E3XA 4K5RA 4QBUA 3P5TL 1U1LA 1TK0A 2KH9A 1R6MA 2BOAA 4DX7A 4NLXA 2G1HA 1FX2A 5L9NA 3OTEA 2ZM6F 1FERA 3IBCB 5DO2A 4K4ZA 4B3RE 2B43A 3K0JA 4MT1A 2YQ0A 2PGCA 4DX6A 4NBQA 3T1HI 1T9VA 3G96A 3H20A 3J81Y 3QGHA 1MSWD 1TKZB 2A1BA 3QIDA 1VGYA 2KZZA 4PYAA 1FDDA 5K14A 3GZ7A 4OI4A 1CJTB 4JYAJ 2AT1B 1A6FA 2EFVA 4NOHA 2HBZB 2XI3A 3M2UA 4OZ3A 1IBMJ 3SSQA 3GYGA 4PCQA 4DPTA 1HNZE 4WYLA 1OPIA 1KTQA 3HVWA 1A7GE 2BANB 4IO9Q 1DTQA 4O4RA 4CO5A 4NXNJ 2HHQA 4B3SE 1FKOA 4QU6A 2KXFA 1F9HA 3I6PA 4Y2KA 4ZDNA 4Q44A 4X4VA 3CJ3A 3LAMA 4PXEA 4RUHA 3ELHA 2JWNA 2KT2A 3H42A 4MFBB 1H7UA 3FBFA 2VU5A 3JSMA 4K2JA 4L74A 2EK6A 3AJDA 2QC3A 3D6TB 4LFBJ 1HNWF 1LK7A 3CO9A 2MYFA 1WHYA 3JS9A 4CM0A 2GZOA 4DR7I 4DSLA 3DGPB 3KJQB 3M30B 2WBMA 3U1LA 1SC3B 1ZXNA 8RUCA 4DQPA 3OW2R 1Z0TA 5GAHU 3CWVA 1TKTB 4X66F 2YKMA 5ETPA 3S1TA 1Q95G 5CQGA 3ADAC 4DQSA 4ZIWA 5DETA 3ITHA 3SBMA 5GAGU 4B3SJ 2RS8A 1SH0A 2MQPA 4ZCIA 3DLGA 3C6TB 3R1LA 3T1YI 2NSBA 2KT3A 2YX1A 3M6UA 3NL0A 5D0EA 3P45B 3MF5A 2OPPA 4RL1A 2GNKA 2IDLA 4Q43A 2OO4A 4X62I 4G65A 5C25B 2UUWA 3Q8VA 2Q6CA 3DOLA 5B09A 4LF7I 4RWWA 4ED6A 4ZHRA 2J9EA 5HO4A 1FJGJ 1NB2A 3LWLA 2C37B 1UFKA 3PEJA 2L3MA 4K2XA 1GQEA 2Y3YA 3QWUA 4UF4A 5T7LA 4Q5VA 3L95X 4LIRA 1M1KT 5AT1B 5HANA 4J37A 3ZFVA 5LMUJ 3JB9k 4IZJD 1SL2A 4PWWA 4JI2F 5AE1A 3W9JA 4ALZA 1RHRB 5AXNA 3T1YF 3C16A 2IBKA 3IG1B 3IR6B 1UMJA 2VL1A 3R5JB 4JI6J 1C4AA 1HQEA 1FTCA 3DRYA 3L7OA 4EUVA 3AD8C 2G0CA 4PWDA 1XNQF 4ZN3A 3AQPA 2PSZA 3HI9A 4H4OB 1WC6A 4WFNQ 2KO1A 4QIEA 4ID5B 2MSSA 5D78A 2ZM6J 3E51A 3AOCA 3BS9A 3FEXB 3PRVA 2ZBPA 5KFFA 1VQ8S 4FW4A 4KFBB 3UDVA 4ZKAA 2OAUA 3DMJA 2CPDA 3C66A 3ILIA 4LUBA 3SYZA 4UZBA 2Z30B 4LSZB 1B4SA 1JNRB 2MKHA 3W5XA 3VAKA 2PEHA 1R6LA 4CLPA 4A8KA 5BJRA 4RZRA 1SB6A 6FDRA 4IRCA 3HHLD 3KG1A 1RYSA 4EYIB 4ZVHA 1KLMB 1TAQA 2N3OA 1Q4RA 3KLGB 3QBCA 3C15B 1YWXA 4N41A 5JEAC 1HNWE 2GAHC 2V4JB 3CULA 5DDPC 1HA1A 2M9KA 3IRXA 4FYWB 1U7LA 1IQZA 4C9DA 3ET6B 3H8YA 2Z2MA 3LA0A 3RB0A 1XMQF 3ZTQA 5A8WA 3G6XA 1N5VA 1Q79A 2RUSA 3MPUB 4N77A 4N8NA 4OV6A 3KLVA 2BR0A 1EKRA 4DV7I 4DL4A 4DV2I 3H2LA 2V9WA 3IA0A 5CZXA 1RB0A 2D1CA 4DR2F 2A10A 1YRXA 2DNHA 1LFWA 2JFDA 4WXWA 4ZLLA 2WVBA 2QLJB 4NLUA 3UN5A 2YX4A 1QUPA 4X66E 4CIOA 2GFFA 2ZWOA 2C28A 1XNRF 4HTJA 4RJVA 2E29A 3MFHA 4IZJB 2ZUGA 1JLFB 4C11B 3JAMQ 3OFGA 2ASJA 5T41A 2FIUA 1FEHA 3PY8A 1IM6A 1N36E 4F0HA 3VCDA 1RZMA 2OLWA 4PXCA 1F9EB 5AXKA 3L7ZB 4NI2A 3PW5A 4DV5I 3SCIE 2UXBF 3NMRA 4F4ZA 2G4BA 2X1GA 1EP4B 2JJ4D 3PW2A 3J7A1 3FCVA 2PO4A 2E1MC 2E9TA 1N32E 2RSQA 3R27A 4QIWD 5EWFA 4OO1F 2HAFA 4ILRA 2EWHA 4YEAA 5HP1B 2HRTA 2NCKL 3CGIA 3RRKA 1IKYA 3U27A 4EBDA 2Y0BB 2QMWA 3POTA 5I4MA 3Q0AA 4DV4J 3JYTA 2OEMA 5KFIA 1HYSA 1VYAA 2AJ4A 1PYOB 1DHMA 3UNGC 2XS2A 2B5JA 1APSA 1KVIA 4DV1E 2IIHA 3DRPA 2ZH8A 4RLEA 2OPRA 4O4GB 1REGX 4KSEB 2ZH6A 2FZCB 3OXGA 1BGXT 4P52A 5DLGA 1K8AT 1KSPA 3TAQA 1UVLA 1N32F 4FWDA 4KHPE 4MMOA 3Q23A 4ER8A 1K0TA 2MTLA 4OHVA 2YH0A 1LWFB 5HATA 5EWEA 4C0OC 2OI2A 2V68A 3VZIA 3NS6A 1PBAA 2VFVA 3FMWA 4RNMA 4X4OA 2VG7A 4URGA 4A4JA 4HDHA 1N32J 1EA6A 2J65A 5DRPA 1C4CA 4EEYA 1HHTP 1BHNA 2XYPB 2B4UA 4DR5E 3M32B 4R5PA 3BR9A 2PNZA 4USHA 2KFYA 3GIRA 3KLFB 2XY6A 4B9UA 2E5LE 1WACA 4B3OA 5E2QA 2QLFB 1XNRE 3H98A 3K85A 2JE6A 4B9LA 1WHVA 3POTB 3DYAB 5H9FJ 3LPEA 4AD6A 1SJ4P 1PO6A 1UEUA 3Q86A 3AJ2A 2OJ3A 3LGNA 4NA2A 4DS4A 2AJQA 1RU1A 2R2SA 1QY7A 2FVCA 3DOKA 1QLNA 1YGYA 4P73A 4G1IA 4C48A 1NK6A 4OKGA 4ZLJA 3OSNA 4NXMI 4DUYI 1FX4A 3KK2B 3EJMA 5DDRC 3IWLA 3RAXA 1VQ7S 4HKQA 2KKHA 2RQKA 2MKYA 1C0TB 2RHQB 2V8DA 4QQBA 2I5JB 5KFUA 5J1EA 2UP1A 2ZJRQ 4RKUC 5BR8E 2YWKA 5J2QB 3V6DB 1H74A 3C14B 3J80U 2NYIA 2XMJA 4LSLB 2DTJA 3K57A 2OTJS 1FK9B 1VISA 1MROB 2IJRA 3MR7A 7AT1B 1C0UB 5D4LA 3RGIA 1I5OB 2J9DE 4TU7A 1HQUA 4MTPA 1J5OA 2MJUA 3MEDB 2DH7A 5KAKA 3GONA 2LU2A 3KNGA 5IT4A 1FO1A 2WP8B 1IXKA 2MLYA 2YNFA 3CCUS 4F8RA 4E98A 2DVIA 3HSDA 1NMEB 3GFYA 3PDNA 4LJMA 3MECA 2UVVA 1KFDA 2OKQA 1O5JA 2JVOA 2RRBA 3ET6A 5CCLA 1R3NA 1UETA 1U47A 2BA1G 1J5EF 3DLJA 2YNIA 2GGPB 2M8DB 3HHEA 4LFAE 3KLHA 2J7KA 4GO7X 2E7XA 3HHLB 1T11A 2W9BB 1HFEL 4CCHA 4AQYJ 3BBFA 2VBYA 5C0XC 4DV0J 2KM8C 3NCQA 1S1UA 3NLCA 2UVUA 1IR2A 1JXVA 2Y9HA 5D8HB 1S57A 4BLGA 2XY5A 3H5XA 4CYUB 5B0AA 2BM0A 3I31A 1FDBA 4FXWA 1YJVA 1VQOS 2HQCA 1X5OA 4M5JA 1RP5A 1QJHA 4WFBQ 2CPYA 4BA2B 1S9GB 2MLZA 2HGNA 3IS9A 1VDHA 4WUBA 1ZPVA 4ZN1A 1TAUA 4ZVEA 1Y3KA 4IG3A 4LBPA 5D4NA 4LF8I 1DLOA 4KPCA 4RW8B 2HKEA 5F9LA 1SUQB 1Y11A 1H98A 3VGUA 4DR1E 3OL6A 2X7IA 3AJ1A 3MEGB 3MPDA 1UVNA 4OHWA 3G8SA 5KFTA 1S79A 2QSFA 3W2WA 2XTJP 2DPIA 3ILJA 4KC5A 3EGNA 3NNHA 1GEHA 2JEBB 1TVRB 3OJUA 5DLFA 4DV3E 3K5PA 4HI1A 4P74A 3CC2S 1QUVA 3BF4A 3P76A 3F0NA 1IN0A 4J9VA 3TJ9A 4HHJA 1M5PC 2WVFA 4EI2A 4H4KC 1QSSA 1EI1A 5GMEA 1XTZA 2HS3A 2K3IA 4M8LA 3R97A 4NXMF 4IG0A 3WX8A 1S7HA 1U24A 3Q24A 4RU2A 3UI3A 1FJGF 4KH0B 2DB1A 3K2YA 5K8MA 5LSLA 1AXQA 4ZVPB 2BR2B 2VESA 3I55S 2QV6A 4BA2A 4OI1A 3OFEA 1LXNA 3EE3A 2IOPA 5LMNF 4DR5F 2UU9E 5DG7A 4B3MI 2MQLA 2HVEA 2VZ9A 1X9SA 3RBDA 2HS4A 1ITPA 3ENAA 1IVZA 1IKXB 2CZVC 4DSJA 3H90A 3MHYA 4OI2A 4B3SF 4B3TI 3RAQA 5FLXQ 4WKRA 1SL1A 2X3DA 1QM9A 2DGOA 3TR5A 3ITHB 2O1PA 3CJKA 4KPYA 4JI6F 1QVGR 1RHJB 1BD6A 1P9YA 1XMBA 1UZDA 2GVDA 4TN2A 2VH7A 3HHLA 2KJWA 5DNXA 1USUA 5KT2A 4I7FB 4DR6J 5D3GA 3WU4A 2LKZA 3IO1A 2CPXA 1HNWJ 1JXLA 3KG0A 4LT6A 4O44A 1TL1A 4CO3A 3A3OB 5JVHQ 3OUYA 4DLGA 4U6PA 1Q81T 2GO4A 2CNLB 4DR3I 1BWEA 4IFDF 4JV5E 1XMOE 1WG1A 4LFCJ 4PQAA 1RGVA 1M90T 3W62A 4WUDA 1EHWA 2D7SA 2F7VA 3DM2B 3DLEA 1Z1ZA 2M88A 3W3SA 2DGUA 3SCLE 4QW9A 2XCPA 4FPRA 5D4PA 1NJWA 2CJ9A 1A9NB 2CUYA 3S01A 3HLUA 2HBQB 4LSNB 2IJFA 1X4AA 3BYPA 1HNZF 1VBZA 2R7VA 3BBCA 2I8EA 4F36A 4TVAB 3N6LA 1HR0I 4NRUA 4XTJA 4KH1B 1XR6A 2EW9A 1U45A 2PO0B 5JEAA 3BKFA 3SEOA 1KLMA 2HBYB 3IGNA 3ZZZA 2R4FA 1RT5B 2IA6A 1ELOA 2ZFHA 1FD8A 4HHHA 2WK4A 4Q0BB 3GG0A 4LIWA 2V0NA 2XBPA 3NWGA 5EL9A 4Y3CA 3QGGA 4ZMMA 1GFWB 5CZVA 4Y2MA 5HQ8A 4WFAQ 1KWMA 3H5YA 1Z4UA 1N0UA 4CLYA 3GWCA 3CMES 3KNAA 2HIQA 1YJNS 3I5BA 4DR5I 2DD8S 1NU4A 1LV5A 4FW9A 2EFQA 3CJ5A 3GPAA 2NQPA 4DV1I 3KLFA 1S9EA 4XPCA 5I42A 4NXNE 1TL7B 1QE1B 3DI6A 4EGLA 5F8HA 3HHLC 2B6AA 5SUHA 4DV3I 3OLAA 2HK2A 1BQNA 5KFSA 4B3TE 4BHQA 2XMMA 1F6TA 2R3VA 3EM1A 1TTHB 4M1KA 4UOCA 1RA7A 1UWBB 5IOLA 4DPXA 2E9RX 4Y65A 3UVJB 3OTCA 1IBMF 3A8KA 4MU4A 3SQGB 1WNEA 5EGYA 2N7CA 4ZS6A 4Y0FA 1EAYC 4ED3A 2AQ4A 4M63A 3GSDA 2IFXA 4QIFA 1YHCA 3MM7B 2JFKA 1OQ6A 5A76A 2HHHF 2FJDB 3QZ7A 2IM0A 3MEGA 4OYWA 3CDAA 2RU3A 1GMWA 2J6TA 1KIJA 3KJNB 2L41A 3Q6NA 1U6ZA 5CYJA 3M9OB 4JI8E 4PAAA 2EI5A 4ECXA 1KEKA 4LF8F 1IKYB 5K36F 1V3SA 3DLEB 2OEKA 2XY7A 1S9GA 3IS9B 4N56A 1Y6ZA 4OO1E 4Q2LA 3TUIC 4A48A 2ZDOA 3BZQA 1AZSA 3S6EA 4CLUA 4ZPBA 2C3YA 4D3GA 5FJ4A 1NHIA 3H1CA 2C42A 1HNXE 3NOGA 3PM9A 4CYUA 2J8SA 4FS1A 3G8TA 5GAGI 1VRQC 3M2RA 4U8VA 3QJPA 4F50A 1DBDA 4A47A 5H1SV 4ES2A 3EZOA 4X4RA 2VDIA 5HBMA 3MUVP 3CCRS 4PQUA 1AFIA 5E33A 2FD2A 3MM8A 2CDRB 3TA0A 2JHEA 4ECQA 2F8EX 1IBLJ 4JI4J 2KVIA 1MU2B 4LF6J 4KV8B 3I9V9 3QFHA 3L7PA 2YNIB 3SCJE 5KFXA 4LFCF 2UUBE 2C3MA 1O0PA 3QAEA 3DDNA 2ZOMA 4U8YA 3W64A 3CNQP 2ZNZA 4LF4I 2PNLA 3MECB 3P3EA 2CQCA 3BO4A 1B64A 2UUBI 2FVSA 3MM6B 3B4DA 2FZGB 4NLQA 4C97A 1HW9A 1TR0A 2MQQA 5RUBA 4OL8A 3R9LA 3H0PA 5KT4A 3T3FA 1S5ZA 3ZKDA 4LOMA 4WYWA 4JI5I 1S6PA 1X60A 3W63A 1MX0A 2E1AA 4IG0B 1DTQB 2MHNA 2F63A 4TQSA 2HKJA 1FK9A 2BBEA 2NSCA 2XNQA 1AROP 2YWEA 4MU3A 3OFHA 5FDLB 4ZCMA 3EX7B 1Z0EA 5AXMA 3KLGA 1PVGA 3ISZA 1D3WA 2PNMA 1SBRA 3CJ0A 3M2UB 4RUCA 3QSYB 4I2PA 1C0TA 2PD1A 2OIHA 2ZH4A 2PMZD 2VONA 2F4VI 1RHQB 1T03B 2K2PA 3HULA 5D6GA 4FXDA 1NZ0A 3ENQA 3ZTRA 2JEBA 4URLA 3D6FB 2GW8A 1VQMS 3D1QA 2ZHAA 4JI7E 2PO1B 3AB2B 5E3QA 3TX0A 4WBFA 2KHDA 2HHTA 4JI1I 1NJYA 1D6TA 3CDBA 1FDNA 3R7SB 4HT7A 1UPMB 3W2VA 1N56A 4LR8A 2UUAE 3MM9A 4ES1A 3VAGA 4OZ1A 4FF2A 1CJUB 1LWEA 1TMMA 2DCLA 4ECUA 4H4OA 4BWMA 3V4MA 1XNQI 1DARA 2A0FB 1X4DA 2PMWA 3NWRA 1NH8A 5CHCB 4WFZA 3D6MB 4Y00A 1R27B 3PFOA 3M8QB 2HHPA 1A0OB 1O8BA 1V6HA 1Y5IB 1DJ0A 3DLKB 2KVQE 3TUJC 5KFHA 3PR4A 2DPJA 3JQKA 2HEKA 2O3ZA 2JX2A 1N36I 2ZVIA 3BR8A 4C4WA 3U1KA 4ZP9A 4DV4F 4JI4E 3CE8A 4KHPJ 1U4BA 4LF4J 2HSEB 1O6XA 5LSRA 2W7OA 2W1BA 3KUGA 4UZCA 4KGVB 5DS7A 3VALA 2ZD1A 2ERRA 4DSKA 1RT6B 3BDEA 4NL5A 1S6PB 1L3UA 2HQIA 4JI4I 1Q8KA 3E01A 5KTQA 1VBKA 2HS0A 2GS8A 5D0HA 3OL7A 2QEXS 2FGCA 3WC0A 2UXBJ 4J9KA 5GMDA 3UE2A 4AQYF 3MOZA 4HXZA 3KDOA 3IFEA 3NZKA 5HQMA 1HD0A 2W2NP 3QIPA 2LQJA 2XMTA 1ZM2A 3MEDA 1B0PA 1GTEA 3O1LA 3V5RA 3PX6A 5LJ3Y 2I0XA 1CS4A 2LFVA 3TO8A 2PA8D 2QX0A 3NBPB 4C0BA 2K1RB 2LECA 3FFIB 1R8PA 4O0IA 1KOHA 3FSXA 3L7UA 2E5JA 2VICA 1TQLA 1ZS6A 1Q78A 2VFTA 2DNRA 3AFGA 3FK4A 2HVHA 2XGQA 4X64F 1SV5A 1M5KC 4R0JA 1HWJA 4QNJA 1F9FA 4OLOA 1WSVA 2HFUA 2QL5B 5GMKa 2F40A 4FF3A 2NR0A 2PO2B 2VQFE 4ED0A 3GJSB 1KNZA 3AT1B 4GC6A 1HNVA 3HSZA 4DL3A 3OTOI 4FW5A 2UXCE 1R0CB 4DV0E 1EKSA 2OP5A 4X4PA 4KQVA 3GFHA 2MZRA 3GCWP 3QMQA 1W25A 3R5BA 1HBNB 1ZETA 4MDTA 4JI5E 1XNRI 1CVJA 3IBWA 2WW4A 4A8MP 1RYRA 1X5TA 2GVZB 2YQ3A 2BV3A 3DU5A 2MGZB 4UY8T 1H2TZ 1VI7A 3CDUA 1S49A 5HN0A 2LCWA 2QFIA 2BANA 5IWAE 4F3OA 1YJTA 1KD1T 2A18A 2JOQA 1XERA 1AUDA 2MQNA 1Y5NB 3V2UC 5A8RB 2APOA 3O44A 4K59A 2W9CA 1BXNA 2R7OA 3CMQA 1BWVA 3A13A 3I4HX 4NZ0A 2OELA 4KR0B 3TVYA 4QU7A 2HIYA 2V4JA 1FKPB 2XZWA 2CQHA 3BQ1A 1NAQA 1T9YA 2BUNA 2DNPA 4ZVQB 3VQSA 2H48B 4ZVOB 3HSGA 5A0YB 5KFPA 1FFGB 3I0RA 5F0WA 5KT5A 1SQGA 2HBRB 4UTGA 3FVYA 5A2QY 4C8ZA 4LPFA 5DROA 4C8NA 3BN4A 2UUBJ 4J9UE 3WHIA 4J9MA 2BX6A 1D9DA 4MQYA 2VFRA 1QTNB 4F25A 4ECSA 2C3OA 3NGKA 2FHKA 5IT0A 1UDOA 1XMOI 1H7WA 2ZH5A 1S9EB 4QYRA 1U1RA 2E1CA 2OGUA 2JEFA 1X4EA 3MR5A 1Y5LB 3KYLA 4DV1F 2RE1A 1URRA 1R8HA 2F8MA 3BGFA 4M5MA 4P10A 4AXIA 4TNOA 2PMHA 4B3RI 2OHDA 4PPZA 4GKJI 1SJ1A 3IWNC 2ACMA 1E6YB 1JLGB 3FMBA 3KOAA 3ONQA 4ZJLA 2RH3A 2ILZA 3HJVA 2CPEA 3PYFA 2GIQA 2C22A 3RR7A 4HL9A 3AD9C 4F4KA 4Q0BA 2DR7A 1HQEB 1CQMA 3GV7B 4QR0A 1B63A 4LFCI 3J7YU 5CXTA 3RUBL 1DFDA 3BYRA 2V6AA 4OYZA 4O23A 4B08A 1BUXA 1HBUB 4YHHJ 1RTHA 1Q53A 4OJHA 2EPIA 1HNWI 4NYZA 2C2EA 1WKJA 3LP1A 1U0SA 1YBUA 3BREA 3CWJA 1M5HA 2V34A 2HLTA 2VQEJ 2UUCE 4LF5E 2GAGC 1IR1A 1Y60A 2F1DA 2IC3A 1YZ7A 3O2IA 3UR0A 1LKZA 3TOQA 4V19J 2Z57B 3DC2A 5J2MA 2C37A 3JSBA 1PKUA 1YLXA 1UCNA 4IKAA 4PYDA 4ZHRB 5CA5A 4QWEA 4KKOB 3AOAA 2ZH3A 2ASDA 1BQXA 2J5AA 2J0SD 4ILMA 4YOEA 3B4TA 1YK9A 3NOCA 3QT8A 3NP5A 3T5LA 3BDPA 4B3MJ 5JEAF 2OPPB 3OJSA 1VLYA 2CPHA 4F3MA 3CDJA 2GQQA 4USWA 1O51A 4MK9A 1X4GA 1FKPA 3ICLA 4DUZF 3AD7C 5IT9Y 4DBQA 2LQ8A 2QTWA 3DRSA 3GQCA 1PYSB 1PAUB 3DRRA 1G2EA 2P9EA 4K4YA 4WP8A 4FN5A 3LO3A 4Z37A 4DFKA 5CH7B 2JEJA 2PEBA 3ZZOA 4J9PA 1QDUB 2N82B 3MOJB 1JIHA 2WBRA 4PXDA 1IKXA 1JJ2R 4DR4F 4GC7A 2OPSB 4USIA 4PR6A 4BC7A 4FYDA 3OXFA 5B0FA 3CC4S 3ZZUA 2YWGA 4E8UA 3LWMA 1DAXA 2NXEA 4DZDA 4F04B 3WU6A 2UXDJ 4P2MA 2VQEE 3T6JA 2DO0A 3X1LB 1BMQB 2KL8A 3HKMA 3JQJA 4C8KA 3ZNJ1 1JX4A 1UL3A 1VLOA 2XC9A 3MAQA 2R7QA 4B9SA 4DUTA 2Y8YA 4HEA9 2AMCB 3IG1A 4NLPA 2B7CB 3DRSB 1OO0B 3FEYB 2NN6E 1F2GA 1LXJA 1REVB 2HGLA 2F8HA 1HWKA 1U2RA 4NLGA 5K36A 3P49B 2NLWA 3GIKA 3EUNA 1ZH5A 3J80C 3V4IB 1CJKB 1G7CB 1NJXA 4AQYI 1M1GA 1RK8A 1RXOB 2HK3A 2FTRA 1OYEA 3OT9A 3PEHA 5T7LB 2ASLA 4TU8A 1E3PA 2YKNA 3Q8RB 1TUVA 4CLWA 5KT7A 4CNZA 1NHVA 2QMXA 4GKJE 3L7ZA 5ETSA 2Y1JA 1IKVA 4LRDA 2Z5EA 3WIVA 5KG1A 1S48A 1KVJA 3BSNA 1SKUB 1C1CB 2HHHE 3BEGB 1XMOJ 2AEJA 2MKKA 2JNJA 1RHMB 4JUZA 4ED2A 1RTHB 2DT9A 2AIRB 2QG9B 2XEXA 4OQJA 3ZZYA 4HACB 4B17A 2D3O1 5K5MA 5JEAD 3MPVA 2H9ZA 1VQYA 2J0QD 2R2TA 1ZA1B 2ILYA 5KT6A 4I3HA 3HSJA 1TV6B 4IFDD 1MMNA 4I56A 9RUBA 3O8WA 4FW7A 4IFDA 2OMOA 1XIQA 3DGPA 3JQMA 3M30A 5KFQA 2JLGA 1JLGA 2P6TA 1IR0A 2ZOFA 3D3BJ 4WWSA 5DZ6A 5JUMA 2VG5A 1N4LA 3O5TB 2E5LI 4LCHA 1NRKA 5FWKA 1MW7A 1YJ9S 2YNFB 4LFBE 2DCUB 4X4TA 2E1RA 5CYQA 3TQEA 4DUYJ 1BLUA 2OUGA 4OO1D 1D8YA 3RG6A 3P06A 1WC3A 5C24A 4NASA 2CJYB 4WU3A 3NAHA 5JXSA 2BJDA 4C2MA 3TA1A 2UXCF 1OSDA 1WDDA 1RADB 1PKPA 1RTDB 4LSLA 3PO5A 4OZ2A 1U8SA 3FRZA 4I6AA 4FVMA 2AX1A 5K36C 3PO4A 5J1EB 4CLTA 4PRVA 5K14B 2C2RA 1K73T 1ACMB 5G4DA 2G9OA 4Y28C 2AZ3A 3ZTPA 2Z58B 4OX8A 3R7BB 1RR9A 3EWGA 3LTOA 1NHUA 4KGKA 3Q2TC 1RT3B 2V69A 3HD2A 1NDKA 4WTOB 1PJ6A 1VJQA 1ZM9A 1L3VA 4ZVRB 2IJNA 4EZ9A 3I0SA 5G0RA 4DZ6A 4AT1B 4DL5A 1UDNA 2R7RA 2W2PP 1VHIA 3OTBA 4HDGA 1NHKL 1S4FA 4W92B 4I69A 1T0TV 4ZPVR 1FDAA 4LF9F 3K8WA 1FRIA 3BV8A 4M5LA 1PJ7A 2SXLA 3NXZA 3ENVA 5B08A 1KC8T 4DV4I 2HHHI 1LW0B 2B8PA 3TJAA 5L3JA 4NXME 3M7ND 2O67A 3FZBA 2XULA 3M8YA 1IBLE 5BYRA 3BGOP 1F5BA 1NM2A 4LRCA 5F8JA 4DQRA 4DQIA 4EBEA 3PYGA 5EKWA 1VK8A 2UXDI 3FDSA 2N4CA 4EWTA 1G4CA 3HDSA 1UWAA 3NBPA 3M8ZA 5HSPA 1N36J 2Q66A 3OHAA 4ERDA 4K0KF 1Y7PA 3BSAA 1E6VA 2GHVC 2HRUA 2HZAA 1NDCA 2V94A 2CJBA 3DRPB 3DXBA 4LBIA 3K5LA 4RNFA 4EBCA 3ILLA 1W2BR 2DNZA 2QN6B 3CSKA 3RRGA 4IRDA 4LRBA 2ATLA 4K8RA 4RNHA 3L9ZA 5B0EA 2HPUA 2HNZA 1N33I 2WB1D 2J9CA 3FZ2A 4RW7A 3TYTA 1HBMB 1HBUA 4QIGA 4QPXA 1X4HA 2KDOA 3EVMA 4ZOSA 3VAJA 4LF4F 2DYAA 3SQGA 4FXVA 4F26A 3KLEA 3M9NB 4KJIA 4DV2J 5IT9C 1XK8A 2JLEA 4C8YA 3CT9A 1N5TA 2BJ8A 2M0GB 4F4YA 3C46A 1F0XA 1ROFA 1WUUA 1JLQB 2D41A 4PG5A 2BRKA 3HFVA 1X5SA 3QO9B 1D9FA 3M6XA 3MD3A 1JLFA 1QE1A 4FP9A 4C11A 5A8KB 5K8PA 3KK1B 3TNVA 3G6YA 4EYHB 3GMEA 2B51A 2DR6A 1HKAA 4L3KA 1PSDA 4RX6A 1HNIA 1PC4A 2G0JA 2W01A 4FF1A 1FD2A 1GXTA 1PJ5A 1J27A 3J7YI 4DV5F 1CG2A 5KOWA 3UD3P 3N01A 2IMOA 2QO3A 2KT5A 2DHXA 1GX5A 2P5VA 1S6OA 2OH2A 2DR5A 4QJVA 4F2RA 3GMGA 2AU0A 5DZ7A 2UZAA 5F3ZA 1IBME 1RAIB 2IYIA 3F56A 3AA8A 3CIZA 3PHTA 3I5CA 1SVDA 5K20B 1SJ3P 1PILA 5BXIA 1S1WA 5C2CA 5EX3A 3EGVA 2WSEC 2IHR1 3CJ4A 2O01C 3LP2B 1NPRA 1KHWA 2AP6A 5A8RA 4AYBD 5F8MA 1UTAA 4GKJJ 4GMKA 4A46A 3OSPA 1IBLI 3WDOA 4B3RJ 5HROB 4JI6I 1V5IB 1JLAA 2UXDF 4K4SA 1JLBA 2MKJA 3TWZA 4J9SA 3VGTA 2XMVA 1NKBA 4ZJQA 2MQ8A 3VF0B 1VMBA 3KFWX 4JI5F 2B3TB 1EB0A 1Y9OA 3EVOA 4FYXB 1Q8IA 2DEIA 1B3TA 3FQKA 3W1YC 3JTOA 3MI7X 1P27B 3DRXA 3BSOA 3OR2A 2OPSA 1HMVA 2VJVA 3ZZ0A 1MMLA 2BW2A 2BA0D 2I38A 1IJFB 1K1SA 3R5CA 4O44B 5C2GA 3P4UB 4WCEQ 4DV6F 4WFYA 1FJGI 2BA1D 2RMLA 3B4MA 2BABA 2WOMA 2C38A 1U2FA 4WK3A 4AIMA 2RD5C 2GVDB 4TLRA 1S99A 3IM8A 4IZKA 1KTVA 4OYAA 1LW2A 1ZOTA 1Y4SA 5L39A 3U02A 3IGVA 3QYYA 1HD1A 3M85G 2M70A 4ANDA 2Z5CB 2QMUB 1NO8A 4WXOA 3U7JA 2EFNA 4PG8A 2DNMA 5LXRA 1GXLA 3J80Y 4DV3J 3RRHA 4XDCA 4KKOA 5HLFB 4B9TA 4XO0A 3UCZP 2FVQA 4IFDE 3FBCA 2CGEA 3OR1B 5C42B 3DOLB 3D0IE 1D1UA 4EU0A 1RT6A 3DXSX 4LVOP 4LFBI 1XEZA 4B9MA 2YPZA 2DNNA 4AE5A 4L76A 2LVWA 4P2SA 5E5NA 3NGSA 1WOPA 2BJ3A 4LCGA 2QZ8A 3MTKA 1WEZA 1TK8A 1J5OB 4NLRA 3V6KA 1QAYA 4WE1B 2R2UA 1UDQA 4CQ1A 1LQ9A 4RW4A 3GIJA 4F4AA 2E44A 1UWBA 4YY3E 4C8OA 1JB0C 1FRHA 2O1UA 2E7VA 5DQIA 2C2KB 2VASA 4CTAB 4F7VA 4EO6A 1UVMA 4PZVA 4FKXA 4RW8A 1YI2S 5CD4H 2FVPA 1Q7YT 4E0DA 1U6BA 2HLUA 2VV5A 2B0GA 5IWAF 2FJEB 4L3NA 3BPDA 2E66A 2GMLA 3H25A 3W2VB 2DNGA 1U1MA 4OO1A 2VG6A 1H7SA 2VOPA 3WZ0A 3OL9A 3RTVA 1Y5YA 1VFJA 3LALA 1T05B 3PS1A 2HVDA 2PO1A 4DOZA 1YKWA 4ZPAA 4U96A 1CEZA 1R8BA 1RBLA 4ZP7A 3CPWR 4KHPI 4JI4F 4DR3J 2M4MA 1NSQA 4QWBA 1B62A 2DY9A 3J7AG 2B4VA 2HVIA 4QZVB 2PO0A 3HVRA 1JJ4A 2HQDA 2RS2A 3G6VA 2Z2YB 4DR6I 4ELTA 3JXOA 4MK8A 1S1TB 2KI2A 1XNQJ 2AZ1A 3J81U 4OZLA 2CA9A 3ZC4A 1R8CA 2LXFA 5IZHA 5F8NA 3NMAA 3IR5B 1DZ5A 2B9EA 4YMEA 4U3BA 2PFFB 1XR7A 1T9XA 1V3ZA 1WHWA 3CCZA 1NZAA 3DM2A 5D4OA 1KFSA 4ICLA 1JQGA 2O66A 2B9XA 3HFZB 3BKUA 4JV5F 4IS9A 1L3TA 4QR2A 4ZVUB 1U48A 3P3GA 3BQ0A 2MB0B 4CLLA 3PRYA 4JI2I 5K36D 4JOUA 7FDRA 1TL1B 2LA6A 5J2NA 3W7BA 5GAEI 2AJFE 2A2CA 3UDEA 8AT1B 1RBOB 3VGSA 5HBMB 1R6YA 3K59A 2IRXA 1N33J 2LXIA 2CQ0A 4M5NA 2P9GA 2ZE2B 2XLKA 3HXMA 3WU3A 3N28A 3HVTB 3T19A 2HVZA 5DQGA 4JI3E 1CS4B 3IBFB 2CVEA 5L8RC 3ZZRA 1HNZJ 4A8WA 4TQRA 3RW6A 3V81A 2R7XA 4A8SA 1JLEA 4IFYA 4PG7A 1ZPWX 2F65A 1HLWA 4DV7F 2OTLS 1CPZA 2PI4A 3BGRA 3HHKA 4LF8J 5A2QQ 4JI3I 3AQOA 4DR3F 5F0UA 5FLXC 1XNQE 3ISND 4NE9C 2N4DA 4HLBA 2HWIA 4A8FA 1HI1A 4F0KA 3L4BC 4LF6I 1PBUA 2FB0A 3D54A 2FJXA 1D8ZA 4DL6A 2HHHJ 4WZQA 2NN6D 4KO0A 3IM9A 2IOQA 4K4TA 1RAJA 4LQ3A 2J7UA 1WOSA 2ZBCA 4DWIA 1EZZB 3NS5A 1IUJA 1HYSB 4GVLA 3KHHA 1DQ8A 2NYHA 3CC7S 3IC1A 4I67A 1VCTA 1LK5A 2VPYB 2JSXA 4NLYA 4O3QA 1TVRA 1RWWB 1WG4A 3FRYA 5LT5A 5HP1A 4JI2E 5DJBA 1ZAWA 4FWHA 5ETRA 3OLBA 1VBXA 3J7AN 3QRQA 1QZRA 1UDSA 2BKOA 1IBKE 4GKKE 2HFZA 2HQFA 3CCMS 2LQBA 3A4TA 4OZNA 3HHNB 3JYTB 3HVAA 1GX6A 4C3LA 4U95A 3MM9B 4ZPCA 4OI0A 2CKWA 2QIFA 7FD1A 3PR5B 1KN6A 3M6AA 2NN6C 1S6QA 1YVFA 3NRBA 4RO0A 3RW7A 3DCAA 1OPZA 5DGAA 4CP5A 1GMWD 1KKHA 4PPDA 2BVZA 4QOTA 4P7VA 3IRWP 5ITHA 5KFJA 4MYUA 1N33E 4JV1A
chains in the Genus database with same CATH topology
4XPEA 3G9CA 2FC8A 5M2UA 1F60B 3PIPQ 4RBVA 5EDWA 4HH0A 4I2PB 2DHAA 4IQMA 1FEEA 1XR5A 1RT2B 3H40A 4GO5X 1C1CA 4IYQA 1FRKA 4YB6A 4YHHF 2C3UA 4ZCLA 1SC6A 4Q8FA 3N0VA 2HW3A 2GX8A 1ZBTA 3B8HA 3PFEA 2L9DA 1N5SA 4J9LA 3TVZA 3V4IA 4DG1B 3GILA 3KK3B 1VRTA 5DG8A 3M6WA 2OFGX 3QWPA 2FJVA 2Q43A 1N88A 3G8QA 3THTA 1REVA 3PHEA 2WW8A 4JYAF 2I9SA 2DGXA 3MM8B 3PRBA 4X84A 4OHZA 3T1AA 2VBZA 3CCWA 3TUZC 3CB4A 2XB2D 1YQHA 2RKIA 4X2BA 5FD1A 2AX0A 4DEZA 4HTIA 5L1JA 4B3RF 1NJZA 3GIIA 3LH2S 4HVZA 1Y4ZB 4I64A 1HMVB 4ILLA 5L1LA 4R8UA 4CT8A 4NA1A 4OX9F 2VG6B 2YNHA 3MD1A 2V4RA 3SMZA 3DU6A 4KIAA 4MAKA 2VA3A 2VUGA 2W7PA 1XC9A 1G6BA 2QT7A 4B3OB 5KG3A 1UP1A 2W25A 5B7WA 3UDCA 1FRXA 3AAWB 3MM7A 1QTMA 2M52A 2MZSA 3GG1A 2CQPA 4UQGA 2V5HG 1FESA 4NWBA 3TARA 4ZVFA 2W8KA 4NCAA 4OLPA 5DGBA 3D28A 2BA9A 2RT3A 4ECVA 2ZBIA 4OI3A 1SUQA 4C3MA 2DNQA 4Z2XA 3US5A 1U09A 2FVRA 3TP2A 3DI6B 4FS2A 1KOOA 2B9WA 3Q8SB 4GKJF 4RU9A 1S1XA 4NLDA 4DV2F 4OJGA 4TLQA 1KONA 1VOMA 2OD4A 3IAM9 5M2PA 2KG0A 2R7TA 5E41A 3LUYA 1YRTA 3CCJS 1T3OA 1NK7A 2CJQA 3ENWA 3QO9A 4EFAC 2GMJA 1WG5A 4YUDA 2XI2A 1Q7YT 1K0VA 2OSQA 1LW2B 2M3DA 4D3HA 2RB7A 3M8RA 2BOPA 5KFYA 2WHOA 4DL0C 2DNLA 3UQSA 3R5AA 1XN9A 2MDAA 1FXDA 1HR0F 2VC0A 3X3UA 4RW7B 1N36F 4JV2A 2ACYA 2G1DA 3NCRA 3HP6A 4YFUA 4QR1A 3UD4P 4IFVB 1FJCA 2JDJA 3AY0A 4Y2IA 2HAIA 2BZ2A 1ZZNA 5HMYA 1HPZA 3D0GE 1P8GA 2YWFA 4B9NA 1R43A 1C0UA 1L3SA 3CUNA 3DHWC 1UFLA 4C0HA 3OUYB 2F9JA 2B7BB 4USJC 3HKZD 1YITS 2HHUA 1WTBA 3T9NA 5D3GB 1NK8A 3I82A 2VBWA 1SI9A 5KG7A 2EG1A 4KQZA 4MIBA 2BXJA 5CYMB 3LGMA 3KG4A 1H6KX 2LEPA 2F1FA 1TZ0A 2ZC3A 3CCTA 4QW8A 1QAIA 4LF7F 1HBNA 1RTIB 1ZTTA 4U67Q 3M8PA 5KG5A 2K7JA 3H2VE 2W4CA 4U9RA 2CQ3A 3KK1A 4L72B 1U49A 2VKRA 2D3UA 5MAOA 1ZYQA 3CD0A 1R0AA 3OXLA 1P9QC 3I5AA 4IOBA 2AGPA 4NA3A 2MZ1A 4YR0A 3LF0A 3UWTA 2COLA 2LDYA 4TY8A 3R1HA 4B3TF 2EFOA 3FFIA 4HT5A 3EXCX 3M6VA 5DDQC 2X1BA 1J5OA 3N4WA 1H7XA 2V2KA 4OZ5A 4MH8A 1Q8LA 2OPRB 1WF2A 4LQ9A 3QIPB 2YVSA 3MFIA 1GNKA 1Z2LA 2HFNA 1NK0A 3SSRA 3CEDA 4RW9A 4IOAQ 3MR6A 1SH2A 2FHMA 4ELVA 1HWIA 1VQ4S 2DISA 2YNHB 2GA7A 2WONA 3P6YC 3ETOA 4NYOA 2M7SA 3RB4A 2JEIA 2EK1A 2RDIA 1CC8A 2FGOA 3KMSA 5BYQA 1TKXB 1HI0P 1U6FA 2MMYA 1BC6A 4TU9A 3DLGB 1CLFA 1LOUA 3SDEB 3M8SA 2BYCA 2Z4PA 2IM1A 3S7RA 1X8DA 1JKHA 1EETA 4Q8EA 3PX0A 2D3OR 1SKWA 4IO1A 1Q86T 1H2UX 3NAIA 2BQRA 2CPFA 1C2PA 1WTFA 1T94A 2MQOA 4DN0A 5HMXA 3IN5A 4IR1A 3NNCA 1LWEB 2ROEA 1Q16B 4YB5A 2YKAA 3OL8A 4DG1A 3OR2B 4X4VA 1UJ6A 1UJ5A 1DTTA 1M5VC 2VBXA 4ZVGA 2VA2A 4JI1F 3KHLA 2IA0A 2AGQA 2XG8A 2WCXA 2FLNA 4RNOA 2YWHA 5GVQA 1XMOF 1S1TA 2E5LF 1X5PA 2HRYA 4OIXA 3HFKA 1A6LA 2FC9A 4DHVA 4K4XA 2DGVA 3T5HA 3E2EA 2I5JA 2K3KA 4ITSA 2Z8QA 5FDLA 3HJFA 5DM7Q 2DR8A 3WC2A 2Z2LA 3H59A 2QA2A 3RYLA 2IBOA 1L5UA 3T5KA 4F4XA 3T1HF 4LFBF 2KJVA 4X4SA 1U25A 4BS2A 3P3DA 5MLCV 4YDDB 3GFZA 1SJQA 2LXUA 2ZNYA 5KFVA 2YNGA 4DFMA 2XS5A 1VIXA 1TV6A 1KR4A 2DJWA 4CH7A 2EVZA 1Y00A 3HX9A 4BC9A 3H2UB 5KFOA 5T14A 2AJ1A 5FIIA 4I4BA 4ZP8A 3M2RB 1N5QA 3PNIA 3M1VB 1TL5A 5E3PA 1TKXA 4DX8H 1NNDA 3G6ES 1GAOA 3HF5A 3PZPA 1QAJA 2DGTA 5DM6Q 4IH7A 1HWLA 1YJRA 5E3CA 1I94F 3TAMA 1FJEB 3CCVS 3FGVA 3PV8A 1JJHA 1DQ9A 3BGRB 4RW9B 1KS2A 3O3LA 3OTOF 3SFUA 4I6YA 5C25A 3EPGA 3J7ZT 2IAJA 4ETZA 1X7VA 3NG8A 4Y2AA 4RW6A 5LXYA 1WWHA 2JL9A 4TKTA 1B0TA 4NRTA 5F3TA 2E7WA 3RZAA 3D2WA 3MM5B 3GV5B 2KB2A 3OQ2A 4LF5F 2KRBA 2NS1B 4O3PA 3CD7A 2VFSA 3C2PA 1LW0A 2FUG9 5J2NB 4WF9Q 2DITA 1BY9A 1P1LA 3A1YG 1RQ0A 3SCKE 4P6QA 2HMIB 3M8PB 4ICLB 2J9DA 4PUOB 1NH7A 1RTJB 2Q79A 3VAFA 2PC6A 2CQ4A 2WB4A 3GFXA 1JLAB 1MWYA 2LMIA 2JEGA 4IQXA 4KRWA 2QE5A 2XSFA 3I0RB 2PDAA 1H0HB 4DMZA 5DDOC 3CCES 3CCSS 2HHSA 2W9CB 2W4PA 3B78A 4MIWA 3M4XA 2ROGA 3N6MA 4WIIA 4CO1A 2J76E 2UUTA 3DMJB 3GB0A 4FNIA 5J1NA 4IDKB 1RTJA 1RA6A 3DLLQ 4IFVA 3ZZTA 4AL7A 3OBIA 1JNZB 4OX6A 3F44A 4XK8C 1I1GA 4G1PA 4A8YA 2CG4A 2ZJPQ 2RRAA 2A2DA 4ECZA 3HHDA 2KXHA 3JTPA 4WU2A 1JLQA 1T7PA 3GYNA 4I7FA 4ED5A 2WAQD 4AUKA 1U1KA 3KLEB 4J9QA 4FBUA 3N79A 4FVCA 3CJKB 3ULHA 2MKIA 2MQMA 2ZITA 2CPJA 1DQAA 2V8GA 4CH0S 3IXQA 3ISNC 2JH3A 4KE5A 2HNYB 2R2RA 1TP7A 2HWTA 1LWCA 4UY85 3MUMP 2E9ZA 1GTHA 4W90B 3S8SA 1SJFA 2CJAA 5L9XA 1IKWB 2DK2A 3TAMB 1YTYA 3BJYA 1KHVA 5DQHA 1SQEA 1YRUA 2Y0SD 4AL6A 2X1FA 1YG0A 4XDDA 2HGMA 5EWGA 1FXLA 4I68A 3GYXB 4YY3F 3KKFA 5A0YA 2W4DA 3WBZA 5LL6d 2J0XA 2CQIA 3C6UB 3OVSA 3K58A 2XMKA 4ED8A 2YKOA 1R89A 1TKTA 3GR0A 4U7CA 2WOMB 2JZ5A 4WKYA 4MKAA 2ZZMA 3TW0A 4FNHA 4OZJA 4J9OA 1C1BB 1GT8A 1QSLA 2MGZA 1B7FA 2MZTA 1JWWA 3LQVA 3THPA 4I0WA 1PGZA 1YBAA 5K8NA 2L9WA 4OX7A 4CZCA 1MWZA 1KQSR 3EPIA 4RBTA 2BRLA 2CYYA 1X4CA 2XMWA 4DV0F 1X4FA 2BJEA 4DN9A 4R8UB 3H5UA 4JV0A 4KBIA 2GC8A 2YY3A 4C7QA 4YR2A 4ED7A 1SKRA 2FHOB 2ZH9A 1S1UB 5HROA 2AYMA 2GHPA 3TANA 4ELUA 2KFNA 3DRRB 3M05A 1S1WB 2P9CA 3KLHB 3PW7A 4WTYA 2IVMA 2R8HA 5A6PA 2K1RA 4A8QA 1U1QA 1TKZA 2E5GA 2JC0A 3KK3A 2JRSA 4LMZA 3LAKA 4NCGA 3QPIA 3PVXA 3DHXA 4KB7A 5KFRA 1FE0A 1SIZA 2IVYA 1IKWA 3UFCX 4ZA1A 1FF2A 1SH3A 5IM0B 3DOMA 3DNCA 3E01B 1HQUB 3TI0A 2PT0A 1LWCB 5L1IA 1P1TA 3KJVB 3MEEA 2AJ0A 4DF4A 1FKAF 3V6DA 1EETB 2DIUA 3GR1A 2VB6A 4KHMA 3MMAA 1UKUA 4HYKA 1K9MT 3OVBA 2WSFC 3MDFA 2DO4A 4F2SA 5F9NA 4F4WA 1PC5A 3OHBA 2ZKTA 3M8QA 1HNXF 4CNYA 4BBYA 1UVIA 2RDJA 2R7SA 2GQ2A 4QWCA 5GADU 3T5JA 2V8VA 4DR7F 4RW6B 1HARA 5K9FA 2VFUA 3DLHA 1FRLA