1VI7A

Crystal structure of an hypothetical protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
LMESWLIPAAPVTVVEEIKKSRFITMLAHTDGVEAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALRQLTTQRKTPLTEYTLQCEYHQLTGIEALLGQCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yigZ
publication title Crystal structure of YIGZ, a conserved hypothetical protein from Escherichia coli k12 with a novel fold
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01205 UPF0029 Uncharacterized protein family UPF0029
A PF09186 DUF1949 Domain of unknown function (DUF1949)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vi7A02
3.30.230.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Impact, N-terminal domain 1vi7A01
3EXCX 4QR1A 2BM0A 2XEXA 2WBMA 4MYTA 2J7KA 1ZM4A 3LH2S 4ES1A 4ZCKA 2BM1A 1P9QC 3B8HA 3UI3A 1ZM3A 4ES3A 2IVYA 3OQ2A 1ELOA 1DARA 4ZCMA 2ZITA 3ZZ0A 3E3XA 4M1KA 1ZM9A 2KDOA 2E1RA 4TNOA 1VI7A 4QR0A 5G4DA 2BV3A 1ZPWX 4QR2A 1T95A 4MYUA 4ES2A 4MAKA 3ZZTA 1U2RA 2L9NA 3B82A 2I8EA 1N0UA 2EFGA 2NPFA 4ZCIA 1KTVA 1N0VC 1FNMA 3B78A 4FN5A 2CVEA 3ZZUA 4ZCLA 1ZM2A 2I0XA
chains in the Genus database with same CATH superfamily
2UUCI 1HBUB 2EXUA 4PWWA 2HWTA 3F41A 3FNNA 4P10A 3LUYA 3U1MA 3HI9A 2R7XA 4JBCA 4Z7CA 2R7RA 3PEJA 2LA6A 4LR8A 3I56S 2WHOA 3W2VA 1S6OA 1ZAXA 3GCWP 2B8QA 3MPWA 3EVOA 2D7SA 3MPVA 4TKTA 4ECUA 1M90T 1FD8A 4K50A 1FEEA 1LWXA 4X4UA 4UUWA 5I3QA 3M8RA 4UZCA 4GVBB 5EKWA 2K06A 2MJNA 3JXOA 4J9QA 2RKIA 1F9FA 3MCSA 4HH1A 3KLHA 2W25A 2FHKA 4K5RA 4LFBE 2KL8A 5E3CA 4OX9E 1USVA 1DQAA 5C0XD 5A6WA 3A3PB 1VQNS 3AJ2A 3KLGB 1NEEA 3NRBA 3KYLA 3CCSS 4HH0A 2MQPA 4LFBF 4RW8B 5CZXA 4X84A 4OX9F 3DXSX 1RWVB 1FERA 1UPMB 2B9EA 1HI1A 4ZVEA 3LQVA 4OV1A 2YY3A 1HFEL 3M30B 3R5GA 2W7PA 3BGFA 4ZCIA 2OPQB 4ZIWA 3OTDA 1QAXA 1T9YA 1AROP 1EETB 4YHHI 3S01A 2O1VA 4MU1A 2JEBB 4KB7A 2MTLA 1YK9A 2RB7A 5LL6R 2V4JA 1S1TA 2QN6B 5EX0A 2GQQA 1OJ4A 3H98A 4K4WA 1L3SA 5L46A 4V19X 1NNDA 2NXJA 2COLA 2K1RB 1TQLA 2MQNA 2L9DA 2OSRA 4DEZA 3CJQA 4EBDA 5ADZA 4DF4A 4DUTA 5AT1B 5DG8A 1RGVA 3Q86A 2PO4A 3FMBA 3VTIA 4PG4A 1HMVB 4JI2I 5K36F 4OLOA 1HNXJ 1Y10A 3WHIA 1RT7B 4GKJE 2BACA 3T5JA 2V4QA 5C25A 3OW2R 3W9JA 4F7VA 1JLBA 4GKJF 4ENOA 4R0EA 5BYQA 4O23A 4DV2I 4YY3E 2BYCA 2CPZA 3LNUA 5CD4H 4PXEA 3CMES 3OL6A 2EK6A 3CDIA 4HI1A 1M5SA 4YY3F 5ETOA 4HACA 2E1AA 3A3OB 3W63A 5AXLA 1VFJA 3DYAB 2C37B 5F8NA 5IT9Q 4OFZA 4AD6A 1RQ0A 3C8YA 3PS1A 2JSXA 3EE3A 1PAEX 1S1VB 3HLUA 2V2ZA 3KRNA 2W24A 2HGLA 1VQLS 2WB1D 3NKYA 3MEGA 4AIMA 2EFNA 3CJTA 1AUSL 1PO6A 3W61A 1EHWA 3HO1A 4YB7A 3IC1A 4K4UA 1AW0A 1FO1A 1XBWA 2C2ZB 2AYBA 1XR6A 4OX7A 2XSFA 3CVKA 2HS0A 2D3ZA 2IRUA 1S0NA 3D68A 2IRXA 1D9AA 3Q22A 3QT6A 1UJ5A 2AP6A 1H3DA 3AQOA 4ID5A 3TWZA 2I6WA 1JLFB 3CO9A 1UZDA 1OQ3A 3GYXB 2VOPA 3EX7B 3J81j 2R2TA 2PEHA 2GFFA 2NXNA 7FDRA 1RB0A 4RUBA 1N52B 5EL9A 2KJWA 3SCKE 3RZAA 2Q2EB 2DNQA 1AT1B 4B3OB 1NCLA 4KIAA 1FDDA 4FYXB 4WP8A 5KFYA 3V6KA 2B43A 3UD4P 3QRQA 3EUNA 4EYHB 3QGHA 2BJEA 1FCAA 1RI7A 3TP2A 3I5BA 4LSNA 2GA7A 4FWDA 2NR0A 2HFVA 3PYEA 1N32E 5DDRC 2PO0B 3FBEA 5E7OB 1XEZA 2JLGA 4LR7A 4IQMA 5L39A 2C3UA 2BE2A 3NEKA 4M5DB 3FCVA 4ZVFA 2XY5A 1B4SA 3M1VB 4BA1A 4V19J 3Q6NA 4B3SJ 5HLFB 3TJ8A 2F4FA 2IRYA 3KMSA 2AEFA 4ZDNA 3AB2B 1CULA 3ZKBA 2QLXA 2VG7A 4WYWA 4OZ2A 4DQPA 2BR2B 5LJ5Y 1T9TA 4USVA 5KFGA 1KC8T 3D6TB 2CJ9A 4NCGA 3FZ2A 4W98A 1Q8BA 4IUFA 1Q5YA 5ELWA 5HATA 2YKPA 2BANB 3AY0A 3ET6B 3GR0A 5KG1A 4ECTA 2DR8A 4Q0BB 4UY8T 2EG2A 3OVBA 3HHLC 4DV6I 1C4CA 4YFUA 3CD6S 3TZWA 2ZE2B 2B4VA 3FFIB 4YHHJ 4DV3I 1RT5B 3L7ZA 1TKDA 2R8JA 1R0BG 4DR3I 4EUVA 3QGGA 3ZNUA 3EYZA 2LECA 4RL1A 5DGAA 2DR7A 1XK8A 1RKJA 3LPEA 2HBYB 2M4MA 4F4KA 2C2OB 1S9EA 3D9BA 2FJWA 3B8HA 1HARA 1N34J 4LJMA 2WSEC 4JI3I 3GWCA 5D0HA 2UUCE 3SYZA 2AW0A 4OI0A 3MUTP 1HBMA 2HVIA 2E1PA 2PFFB 3DRPA 1RP5A 1HHTP 4OI4A 4O0NA 1X9WA 3JSMB 2UUCF 2ZBRA 1RT2A 3ZC4A 1JNZB 4Z37A 5L1JA 2WVBA 1U2CA 2OSQA 4DR2I 4IZJB 3A4TA 1Z5BA 4ISAA 5KFSA 1RACB 4C11A 3U1LA 2ADBA 5JMNA 1RHYA 3OUYB 3PJ9A 4DV2J 2C42A 2CUYA 1UTAA 5LOQA 2KO1A 2XGPA 1SJ3P 4CLWA 1U7LA 4LMZA 4IFDE 1ZA1B 5J2NA 2GO4A 2JE6B 2A3JA 2N3LA 1K0TA 1JNRB 2YTCA 4PRFA 3ZO7A 3RJMB 4B3MF 1TAUA 1LWEB 3SDEB 3HMJG 3ENQA 5ETPA 2ZZMA 4IFDF 3GB0A 1HLWA 1XMOE 1VQ5S 3CULA 4NI2B 2P5VA 3J7ZT 4KO0B 2CG4A 5LL6d 1M5PC 1RWKB 2HHXA 1RE1B 3DOLB 1XMOF 1HQ2A 4NEZA 2HFSA 2MB0B 2W4PA 2M0GB 2M9KA 3WDOA 4X4TA 3R7SB 3AQPA 4G3IA 3R9LA 2JFDA 4ANDA 3NGUA 1S1XA 2RF2B 1ICEB 4U7CA 3HSZA 3C2PA 1TU0B 1F9EB 3EICA 2DR9A 2LXUA 3TARA 2ZHAA 2NN6C 5E33A 2QLBB 4ZP7A 1OIAA 4AYBD 4IFVA 4ZCMA 5K14B 1HR0I 1WOSA 2JEFA 2W7AA 4ZVTB 1O5JA 1RYSA 2I2YA 4JI2E 3W62A 1XMQJ 4G1PA 2XNRA 2BW7A 1Y11A 2CPEA 2CFXA 3KHLA 3T1HI 3GIIA 2MSSA 4TYBA 4OV6A 2EFQA 1UVKA 1WELA 3Q8VA 5CCMA 2GCFA 3LWLA 4JI2F 3TI0A 4ILRA 4O0IA 4LF2A 4WUBA 1W7WA 1HPZA 3TZZA 1SI9A 2G13A 2ZBQA 1UFLA 4FW9A 4NYOA 5DNLA 4NASA 4DR6I 4NLVA 4HHUA 1FWPA 2DNNA 3I96A 2PO2A 3PACA 4ZP9A 1C0TA 3LP2A 1D9DA 4QYZJ 1FJCA 4K4TA 2C1EB 1RBOB 2KHCA 3NNAA 4NMLA 2UXCI 2V69A 1FDBA 3I9ZA 3JB9k 2JEAB 4KRWA 2D1CA 2GX8A 2MHNA 3PS2A 2CG9A 1QSYA 5KFAA 4DPWA 1RTDB 5K36D 2HBRB 4J9RA 3P8BB 4LFCJ 2C28A 3M4XA 3GFYA 2IOQA 2KVQE 4Y2IA 5ITHA 2BKNA 3RGIA 1KTVA 2WW8A 3GV8B 1CJUB 4LCHA 4FF3A 4B3TI 1Q95G 3M8QA 1LKZA 4P73A 2CQGA 4DR5J 2ZJRQ 4DV6J 4MAKA 4P7TA 3CCMS 4JI4I 4K5SA 2EC0A 3NL0A 1DTTB 1SQEA 3MUMP 3GILA 1UETA 4NA1A 1V5VA 4QIWD 4ZVIA 2Z57B 2GAHC 3R6LB 5L1KA 4W4MA 2ZVIA 2BE7D 2H9ZA 2MQQA 2OUGA 4C8YA 5C24B 1FA0A 3C3LA 2CNOB 5IV4A 4QIGA 2G2YA 1NKCA 1B0VA 1KHWA 4ELVA 1UP1A 1UA0A 3IBWA 1IBKF 4BA2A 4DU8A 4A8XA 1NSQA 3QIPB 2LDYA 2VQEI 1RWMB 2LQ9A 5KFXA 1VQPS 2IBKA 1WG5A 3H2LA 4IQXA 2VB6A 1RWPB 1Q53A 2JNJA 4DR2J 2Y0BB 2UP1A 4JI7J 1HNWI 4QBUA 2RILA 2EFVA 3OR2B 4YS2A 2XEXA 4H4OA 1QE1A 1VDHA 4P2MA 1N5YB 3RR7A 1YRTA 1IWGA 3PRDA 1CJTA 3DFEA 1M1HA 1N54B 1XQIA 2HHVA 4RNHA 2KG0A 2F4VI 1B64A 5AE3A 5D78A 1DY3A 3ZZTA 3GU0A 1HNZJ 4YR2A 2Y0SD 1B62A 3VAKA 4OYWA 4CCHA 2MXYA 4WBFA 3S8SA 2HQCA 5D6GA 1ZM3A 4OHWA 4WUCA 2JC0A 4DV3E 1R6YA 1C0UA 1U24A 2V4RA 1UEUA 4DR3E 1UCNA 1YBAA 1TL7A 2F65A 4CTAB 4I2QA 5FLXQ 4DV3F 4IFDA 3QGPA 2EEYA 3CTRA 3BKTA 1KQKA 3H5SA 4IG3A 3WQPA 1IKVB 4CM2A 2ROGA 3F73A 4JI3E 3MMCB 1T03A 1YKWA 2PMHA 2R2UA 2F9DA 5K5MA 1LW0B 4AFFA 3LTOA 3DI6A 3CJKA 2OMOA 3M8YA 4M5LA 3ZTOA 4JI3F 1NJXA 4WE1A 4IH7A 4MH8A 3NLCA 1N56A 3PFEA 2QYGA 4LF8J 3CJ5A 2CQ3A 4N5SA 3KKFA 3Q83A 1RTHB 4DR2E 3CD7A 2VICA 2RU9A 3O2IA 4FNHA 5G0RB 3I31A 2J0SD 1RT1A 3BDEA 3V4IA 1VQSA 1F6TA 5CYMB 1EZZB 1R8BA 4DR6J 2Q66A 4P6QA 3D66A 4PG5A 3Q24A 3ILLA 2PDAA 1NB2A 4ED5A 2VQFJ 2CJXB 4NBQA 2CZ4A 2O3ZA 1S16A 1PKUA 2LLZA 2UVUA 3AD9C 2IVMA 4F3MA 1UZHA 4CLSA 4KBIA 4G65A 1XNRI 3V2UC 3EGWB 1KRPA 4OO1C 2YNIA 3NCRA 1N8RT 1IM6A 3BN7A 4YB1P 2QL9B 3IG1B 2BJDA 3CIZA 3BQ1A 2C2NA 1IJFB 2ZM6J 4X2BA 1NKEA 4B9UA 3BR8A 5DG9A 3IFEA 4IFYB 1N36I 1MWQA 2GS8A 1KSPA 3JTOA 2C2KB 2VASA 1NK0A 1NH7A 2C3MA 3R2CJ 4EI2A 2PT0A 3CCRS 1H2VZ 4EGLA 2W2PP 4WFYA 1S49A 1TKZB 3GLJA 1LXNA 1GT8A 3EZ5A 3OLAA 4F4YA 4USJC 2KN4A 2V9WA 3Q8SB 5LMNI 2E7XA 1SUQB 4FYWB 2HHWA 1HR0E 1VRTA 4U8YA 1IKWB 1FRHA 3QJJA 5THWA 4F26A 5BXIA 3PO4A 1I6JA 4M94A 4OZNA 5E3QA 3MM7B 3T1HE 4TQSA 2ZH6A 1HR0F 3VZIA 4X64I 5E41A 3D6MB 1JK9B 2CQ1A 3KLIB 4X4SA 3CEDA 3T1HF 4QW8A 3GYGA 1CQMA 4LF6F 3GJTB 2OFGX 5HP1B 2R8IA 2HNYA 5F0UA 2KZZA 5ETNA 1Q4RA 3R8YA 3OFGA 4B9MA 4OHVA 1UDQA 3IA0A 1S9GB 1P9QC 2UXCE 5L3JA 1MU2B 4L72B 2K3KA 4GKKF 1SJRA 1JXLA 1QD1A 4LF9J 1K0VA 1J5OA 2UXCF 1RDRA 3T5LA 4KH0B 1LWFB 1RCOB 4PXCA 2EW9A 5F3ZA 1K73T 1CC8A 1XTZA 1HBUA 1FNOA 2K8GA 4FPRA 2DJWA 4IO1A 4DR7F 3H5UA 4F2RA 4U7UK 1GQEA 2ROEA 2F4VJ 3MAAB 2WBRA 1TUGB 4UY85 3C16B 2J6SA 4B3TE 2JWNA 2D74B 2FPHX 4DQIA 3HHDA 3DHWC 4UOCA 4YEAA 5KFOA 4DUZE 2DHSA 1RLDA 3RBDA 1IBCB 4JI4E 2E5HA 4RNNA 1CSJA 2B5JB 1OYDA 2GO8A 4DUZF 1NO8A 1HHQA 5DQHA 4A8OA 1FK9A 2F1FA 4JI4F 4ZIVA 2VOOA 2WSFC 2YWHA 1TUWA 5M2PA 1MX0A 1S5ZA 5J2MA 1GX6A 4UZBA 3CW2C 1PYOB 2YNHA 3I0RB 3OT9A 1PJ7A 4RW8A 1TR0A 5ETSA 1C4AA 4TVAB 4CIOA 1HW8A 3FQLA 6AT1B 3M30A 4CLKA 4ZCKA 3QYYA 3RYLA 4IS9A 2JEJA 1EETA 2E29A 4J9MA 2VQEE 4QIEA 1Z4UA 1U8SA 4RJVA 2GGPB 4AL6A 1LXJA 1JX4A 3H90A 4JUZA 1TK5A 1X8DA 2VQEF 1HNWE 2G2OA 3KDNA 4NMXA 5D4NA 1Q1KA 2QEXS 1BUXA 1U2RA 2G1HA 3CO0P 3OHBA 2D3OR 4ZCLA 1W26A 2OD6A 5K8PA 2R7SA 2F4VE 7AT1B 4M5JA 1PGZA 4QPXA 1T9XA 3EJMA 5BR8J 4FW3A 3J7Z5 3TX8A 2KT3A 5I3UB 2HVDA 3RRKA 2Y1LB 3J80C 3ZZYA 1E6VB 4DN9A 1XNRJ 2IJFA 2ALYB 3E51A 1F9HA 1KS2A 5IT9Y 4DU7A 3EGNA 2E66A 4MQYA 4U9RA 1G4CA 4C7QA 4MFBB 1UVLA 4B3RJ 2PNZB 4ZVOB 3KG0A 9ATCB 2WP8B 5KT2A 3G6XA 2R7TA 4DV0I 1HNXF 2LU1A 5A8RB 5C2GA 3A8JA 1JLGB 3C14B 4WUDA 3HVAA 2ACYA 2IY5B 2PFDA 2VIHA 1QAJA 4EBCA 1YJ7A 4FYYB 3C6TA 2CJAA 2FB0A 3GP9A 5LMNJ 3IAS9 3M32B 3PW7A 4KYZA 5CZVA 3KTQA 3KUHA 3KNGA 3G86A 1VYAA 4IG0B 4IH5A 2W9BA 3MCOA 4DSKA 2GV1A 2DKOB 4JI6I 4KKOA 4QJVA 2GVDB 4X64J 2IAJB 5DQIA 3H4BA 4LF7I 2CZVC 3ITHB 2X1BA 1P1TA 1DJ0A 3W64A 1R7IA 1FRJA 4PPZA 3TRGA 1S99A 1Y5NB 1B99A 2VKZG 1U6ZA 1M5KC 3AAWB 3FRZA 1JLFA 4EMDA 3FSYA 2G2ZA 3PX0A 3ONQA 5JEAC 2MPUA 4RBTA 1NK7A 1XNRE 5KG2A 3DDIA 5KT3A 2QA4S 4W92B 3CDEA 3KLEB 2ZH2A 3NOGA 4LSLB 1J5EI 3LAKA 1N36E 1J2VA 3JSBA 2GMHA 4IYQA 1IR0A 1N33I 4DS5A 2D9OA 3G8SA 1R8HA 1WG4A 1WHXA 4ZITA 1IBLJ 3M6UA 4RWXA 1N36F 2PO0A 4NYPA 5LJ3Y 4QYRA 4M5DA 4AE5A 2C3YA 2KTQA 4GVLA 5AXMA 3G87A 3UVJB 2CQDA 4JYAJ 4JI5J 4OYIA 1VQ7S 2F7VA 2J9DE 5HLFA 4J9VA 1SXLA 5CYQB 4CRJA 4NLGA 2AYMA 2XZWA 2MKJA 1UEVA 4ED7A 2FVSA 2H4YB 3MMJA 3IS9A 4DQSA 3T41A 1TL1B 1A6LA 3Q8YA 4X64E 3N6NA 3G2XA 1WTBA 2F63A 5M2UA 2MYFA 3MXHP 1FVQA 4F2SA 1QUVA 3DOMA 2BANA 2QL5B 3BO2A 5T7LB 1M5VC 2HK2A 4J90A 1Z1ZA 2BX6A 1SBRA 2CQHA 5LMUI 3GIMA 2HRTA 2RQCA 3N9UC 1NBEB 5DRQA 3LP1B 2KI2A 5DM7Q 4DV7I 4F4XA 4A47A 2YH1A 3CCWA 3CCUS 1X0FA 4RW7A 5HJXA 1TKXB 1D6TA 2J6TA 1D1UA 4E2FB 2K3IA 2OELA 3FGVA 5I4MA 3R1LA 3UNYA 3EGVA 1Q7LB 1WF1A 1MROA 3UNGC 4DFMA 2XSJB 2V5HG 3TQ1A 1R27B 5HO4A 2DRBA 2K7KA 2N82B 2AGPA 2VBYA 3DLKA 4QR1A 3T1AA 3I5AA 3UD5A 1VK8A 2ZD1B 3N4WA 1IUJA 4AUKA 2QL7B 2M88A 3MI7X 3NGTA 3JSMA 4RW9B 3LALA 4FW4A 2ILZA 5LSOA 3DLGA 3IWNC 1Q79A 4EK2A 1W2BR 2MKKA 4LBIA 3CB4A 1UW4A 2GJ2A 3RU0A 2EBEA 1TV6A 5B0EA 1YZ7A 2OTLS 1QSLA 1TK0A 1U02A 1FDNA 4PWUA 1R0AA 4UTGA 1FEHA 2B9XA 1SV5B 1XJWB 2KYZA 3RR8A 1Y3JA 2J76E 2HNDB 5B7WA 4Q44A 4OZEA 5A2QU 3JTPA 3JTNA 1SB6A 5D0GA 1KR4A 1CS4B 4USKA 4A8YA 2YVSA 1IR2A 1UWAA 3G96A 4X62I 4FDFA 2BRLA 1HI0P 1HWUA 4RKUC 4KHPJ 5I3PA 5K9FA 1IKXB 5HJYA 4JI8I 1HWJA 3FZBA 4KT0C 5DQGA 4L74A 2PSZA 4JI6J 1R6VA 3MAQA 1NPKA 4U7UD 1RT3B 5LSRA 1VQ6S 2RHSB 1KWMA 2VG6A 2BA1D 1AFIA 1SJ1A 4L75A 2VPYB 1XXEA 1IQZA 3DLEA 5KG7A 1SPBP 5H9FK 3PZPA 2M52A 2UV8G 1WC3A 5MLCV 1S6PB 2LQ8A 1M5OC 4FXVA 2CQBA 1S1WA 1JJ2R 4KPYA 2ZKUA 3MR5A 2B51A 2Q1LA 3T1YF 1S4FA 2W7OA 2XLKA 1HQEA 5KFBA 1QSSA 2RSQA 3I0SA 4IKAA 2W1BA 3K57A 1EKSA 3K5MA 2XMUA 3MM5B 1K8AT 2EC2A 4DL6A 1E6YB 3C6UB 2IOPA 3OFFA 2ZBKB 1C1CB 4PAAA 1S1UA 3OVAA 1S77D 2NPIA 4DV0E 1XMQF 1TAQA 1Q7YT 3VR1A 5EWFA 2ZOMA 5DLGA 1FJGJ 1DLOB 2E7WA 1WHYA 5KG0A 1DAXA 1RHMB 4J9NA 4C8LA 2UU9J 2KXHA 2ZC4A 2GIQA 2HHTA 3EM1A 4IZJD 3MCMA 1U1LA 4DV0F 1KQSR 3AA9A 3VGTA 5E0OA 5F8GA 3MMBB 2FJBB 5FLXU 1QDUB 5FDLB 4LIRA 2NCKL 2V9KA 2HHHI 3W8GA 5A2QY 1KQGB 3PG9A 3HD2A 4Y28C 2IJRA 1JLCA 5CYJA 1NRKA 3E01A 2OTJS 1U1MA 2WNRA 3HM9A 3MD1A 1JMTA 1S6UA 1KBRA 2QMXA 1SC4B 3BO4A 2UXBJ 3J81Q 2LMIA 4I6YA 3CCTA 4LF7E 2BV3A 2P9CA 4A8KA 2B4OA 3MF5A 3CCVS 4LRFA 1S97A 3D4JA 3OR1B 1D09B 1BMQB 1RAEB 2DB1A 4LF7F 5ETVA 1Z0GA 5GAGU 2XGQA 5A6PA 3PR4A 3BEGB 2J9DA 1YGYA 4ELTA 4G1IA 3CJ8A 3M7ND 2IBOA 2MMYA 4IOBA 1N5TA 2CNKB 3SZ2A 2DY9A 2ZKTA 3CSKA 3NBPB 3JQMA 4DV1E 1KD1T 5EWEA 3FVYA 3C15A 1TP7A 3MMAB 1J5EE 3UR0A 3NAHA 1R6MA 4I2PB 3UO0A 1T3NA 3NS6A 2MQ8A 4MMOA 4WZQA 4DV1F 2FVCA 2FC8A 1UW9A 4NXMI 4GMKA 1B7YB 1N33E 1WDDA 4PR6A 3BYRA 1J5EF 4MIWA 1T95A 2LKZA 3TEGA 5CA5A 4CDIA 4L6V3 4CO2A 3GFXA 4ECYA 2GMJA 4ZP6A 4C0BA 4LCGA 4LFAI 1N33F 1MMLA 3V5RA 3OR2A 1UVMA 3BGLA 2N4CA 1WSVA 2UUAI 1G3OA 3ETOA 2Z56B 4OHYA 4OJ1A 4U67Q 3P06A 2MLZA 2WCXA 3BH7B 4FBTA 1ZBTA 4JV0A 5FLXY 2FZGB 2J8AA 2X3DA 2Z0GA 1GXLA 3AD7C 4TY9A 4J9SA 4DMZA 2VD3A 1BGXT 4J9LA 3L09A 5A8WB 4JI7F 2XWXA 4PWDA 1HQUB 2GHWA 1GH8A 4X62J 1NJWA 2JL9A 5LMUE 2RRNA 3VVUA 4OYZA 3IGVA 2DGXA 1R8AA 3OV7A 4DV7E 4Y2KA 2QO3A 5A76A 1MMDA 3H40A 2H54B 4JI8J 4ED6A 3PKMA 2RHQB 4P72A 5LMUF 4NEYA 1RYRA 4JOUA 4BLGA 1RCXB 4DX6A 4DX8H 5C7PA 3SMZA 4DV7F 4HHJA 1SH3A 3SFGA 2V2QA 2R2SA 2M8HA 4ZJQA 2M70A 3DRSA 1VLYA 3PYFA 5ETKA 3MM9B 4LBHA 1FKAE 2GQ2A 2VPWB 2FLLA 1LW0A 2HFNA 3DU6A 2KRBA 4I1TA 3WX4A 1FKAF 4LOMA 5D0RA 2B3TB 3K5PA 1B63A 1RBAA 4O44B 1EP4B 2WK4A 3H59A 1RTHA 3ISZA 1KOHA 4S0MA 4I0WA 5G0RA 3PRBA 2GJIA 1HWLA 1YJ9S 5E3PA 2KH9A 1YBTA 2OIHA 1T05B 5IQ6A 5D77A 2NUUG 4KGVB 2YKMB 3SXLA 3EDQB 2H51B 3L7UA 2DNOA 3ILJA 2QGFB 3HFVA 3NGSA 2IDLA 4DUYE 1MNEA 2YKNB 2Z5BB 4FS2A 1F2HA 4TU9A 3WU4A 4X62E 2AJ2A 4RW4A 3IG1A 5C0XE 4DUYF 2ASJA 2MGZB 4PQUB 1XNQJ 2IJNA 2HLTA 4DSIA 5KFQA 2IVYA 3B6BA 3GONA 4IFYA 3UDVA 4CO3A 3JQKA 2ZDPA 2YX7A 2W2MP 2EKYA 3HFZB 5A8KB 2DR5A 1U26A 2V68A 3ZZUA 5J1EB 4ES1A 3MR6A 3GIRA 1TKZA 2F8MA 4AQYF 2XQCA 1T3OA 3I82A 4LPFA 3W66A 1N6QB 4PUOA 1UWBB 4AM3A 5B0CA 2HWIA 4DSEA 3JYTB 1FE0A 1YJRA 2E7VA 3JQJA 1SUQA 4USMA 5T14A 4OZ0A 2AIRB 3QFHA 2OMLA 1H74A 3DC2A 3J7YI 2PC6A 5IWAE 1APSA 4HDHA 2RDDA 3CGIA 3QBCA 4WCEQ 3RBEA 1WI6A 1KVIA 5GMDA 3OL8A 2LDIA 3IM8A 5IWAF 3MEKA 4OZJA 3W7BA 2VHGA 2CQIA 4K59A 5LT5A 5DO2A 3M8SA 2Z4PA 1CJKB 5HP1A 3WU5A 3G82B 1ROFA 3DGVA 5LXRA 4DL0C 4LFBI 2RD5C 4ZLLA 4CM0A 2BZ2A 2JFKA 2VA2A 4PG8A 2LEPA 2XO7A 5IZHA 1MU2A 4QNJA 2QG9B 1CG2A 2VJUA 1ZXNA 4KGZB 2BE9B 2WAQD 5JEAB 3OFHA 3KK2B 5HBMA 4HHHA 4C3LA 4KSEB 1YITS 3D7SB 1H7XA 1DRZA 1FRXA 5IFMA 1LWFA 1YRXA 3D1OA 2J9CA 2UUAJ 3PO5A 2AX0A 2HHHE 3MM6B 2FDNA 3EMTA 3POTB 1S59A 4DR1J 2ZBIA 1SQFA 3V6DA 2CXEA 4LIWA 2LQBA 2DGOA 2MLXA 1OQ6A 1BQNB 3BBFA 2HHHF 1Y5LB 1QJHA 2PO1B 2OPRB 4ED0A 3KHGA 3KK3B 1TL3A 4LRAA 4TYAA 2XYHB 8RUCA 1RKIA 4ILMA 3RB3A 5IXUA 4USHA 3OXLA 1FWLA 2J0XA 3A8KA 1Z2LA 2B5JA 3TAMB 4IRKA 3H25A 2BVZA 4X65I 2JEGA 3KG1A 1S48A 4K2JA 4LSZB 1DTQB 2FJXA 3QMQA 4X66J 3Q23A 2M7SA 3FUYA 3CF5Q 1U1KA 3I0RA 5KG5A 1HBNB 4FW6A 2OO4A 1UVNA 5D4LA 1WACA 5D3GA 2WRMA 4I7FB 3Q8QB 4RLEA 4NXME 1S79A 2LVWA 5F8JA 4F3QA 3MD3A 4K0KJ 3KLVA 1C1BB 1Z2ZA 4OYAA 4ZPVR 3WIVA 2GZOA 1PC4A 4NXMF 5A0YB 4LFAE 1SKWA 1NLKL 2AX1A 4DV4J 4QU6A 4LF5J 2KZMA 4HR2A 4LREA 4LFAF 3PDNA 1LEOA 3UI3A 3H2UB 3HSGA 1PYSB 4OI2A 2QA4G 1FE4A 5EHHA 4H4MB 4YR3A 2IDEA 2BJ8A 4I4BA 4M63A 5J2PA 3MOJB 4EU0A 4ZKAA 5KFFA 2ZBPA 2IESA 2NXUA 4XDCA 1LWCB 2BJ7A 1MN7A 4DF8A 2FC9A 2DPIA 1ZM2A 1RISA 3GYNA 3MM8B 5GVQA 3U7JA 4X4VA 4JI1J 4MFBA 2PNZA 4QOTA 3JSRA 4CLYA 1RTJB 4G6VB 1QTMA 1AZSB 1IBMI 4NOHA 1PILA 2HLUA 5A8RA 5KFCA 2BQUA 2LXFA 1JLGA 3C14A 1NU4A 4WIIA 4U96A 4MU4A 2ZITA 1F60B 1T0TV 2BEFA 5DNXA 1R43A 4AXJA 4N56A 4ZOSA 2ZZNA 4DFPA 3CDUA 2E1MC 3E8OA 4U6PA 1ELOA 5C0XA 2FY1A 2OEJA 4QW9A 3FBFA 2W2OP 2XO6A 2AEMA 2QFIA 1AUDA 1VRUA 4NRTA 2J7UA 4C3MA 2NQPA 5KFWA 4B08A 1T9WA 1S6QB 5IM0A 1B70B 3GMGA 2UXDI 3OTBA 3PJXA 1NHKL 4FXDA 4DR4E 2HAFA 2OI2A 3HDSA 3MR2A 3ITHA 1Y6ZA 3W2VB 3G6YA 1WF0A 4M5IA 4Q8FA 4LFBJ 5KFMA 2E5IA 4BS2A 4F0KA 4OX9J 3DDKA 4DR4F 3DN9A 3HJCA 1S12A 2M8DB 2IIHA 2RKIB 2L48A 4MK8A 3KLHB 5HVHA 1Q0NA 1I94I 3EPGA 2XMJA 1WDTA 2YWKA 4IFDC 3TR5A 2HWHA 4A8MP 1Z0VA 2PNMA 4B9TA 4OIXA 1WEYA 1F5BA 4WFNQ 4A8WA 4OKGA 1HHSA 3G4SS 3J7YU 3Q1QA 2BA1G 4U3DA 2ATLA 4H4KA 1OO0B 4O3NA 3E3XA 4C0OC 2R42A 3O8WA 4N77A 1YBUA 2DT9A 2MZTA 1LK5A 3FRYA 1SIZA 1DQ9A 2D41A 3CCJS 2B9WA 4DI6A 4ILLA 2ASLA 5KFHA 4EWTA 4OZ5A 1NZ0A 1X4GA 3OSPA 1REVB 1WC0A 2R7UA 4NLXA 4UOGA 4PYDA 1HA1A 4WIQA 3EWGA 4RNMA 4KHMA 2E5GA 3GG0A 4CO4A 4GKJJ 3TUPA 4BHQA 2U1AA 3V81A 4LF4I 1U47A 2ACMA 1TL1A 9RUBA 2C38A 3SSRA 4I68A 4CYUA 4FF1A 2MDAA 4IO9Q 4QNKA 2V2KA 1WC4A 1PSDA 3Q8UA 2H5JB 3VGUA 2OPPB 4B3MI 4YY3J 5DDOC 2FJDB 4CT9A 3NGRA 3IAM9 5D8HB 2HFZA 2VUGA 4EYIB 3LP1A 1OMSA 2AJ0A 3R3TA 4Q8EA 2AV5A 1JLBB 5CABA 4JG4A 3ZTSA 1XMOI 3TZXA 4LVNP 4CO1A 4YP3A 2FVQA 3I87A 1TKXA 3ZZ0A 3K0JA 3VF0B 2H5IB 2ZNYA 2FJEB 4ZLPA 4HACB 2UUBE 1L3VA 4DPUA 1SQGA 2NN6D 2RRBA 4DCOB 1P8GA 3QAUA 5KFPA 2ZD1A 4JI0I 4C48A 2UUBF 2CAJA 3CJ4A 4RW9A 4N8OA 1P42A 4C8NA 3HP6A 3N28A 3UDEA 2RT3A 5K36E 3ENVA 3UN5A 3P3DA 3MEGB 2ZHOA 3SCLE 3M7NG 4LT6A 4DOZA 4UOFA 2GO3A 4ZN1A 3ADAC 2WW4A 2JHEA 3J81U 3EDRB 1SKUB 4X65E 2A6MA 2QMUB 3R27A 2V63A 2BQRA 2AYGA 2HNDA 2YKOA 3AHPA 1L3KA 2IYGA 4ID5B 4X65F 5ETTA 3TVZA 1P27B 1CS4A 2C3PA 3DCAA 3LF0A 2A2CA 5H9EK 2MLYA 3D5MA 4B17A 4OJ3A 3D0IE 3O6QA 1D9FA 4QWEA 4MDTA 2Q6BA 1UFKA 4YMEA 1V5IB 3X3UA 2JOQA 1GFWB 1N32J 3TUZC 1FWKA 3T9ZA 3TAQA 3GSDA 1K9MT 4WK3A 4USWA 2HK3A 2A6OA 4UT4A 1RT3A 3J80U 2N7YA 1O6XA 3QO9B 3VV2B 1WHVA 2IVFB 4LSNB 2Y1RI 2VDIA 5KFLA 3MTKA 2J5AA 4EO8A 4WXWA 3KLFA 2Q79A 3N5FA 3B78A 4RNOA 3FMWA 1GX5A 2BE2B 5KT4A 2KFYA 5G4DA 4XO0A 1NSAA 3LGMA 1WORA 3PTWA 2XLIA 2Z2MA 2Z8QA 3HX9A 1FFSB 2LQJA 4DX5A 3RTVA 3RB6A 3KUEA 2VG7B 1UA1A 5AXKA 1JQGA 2KDOA 1U8WA 4NCGB 4Q2LA 3LPSA 2B56A 1SCJB 2XLJA 3J7A1 2HQDA 2MQMA 5DGBA 2DY1A 1BWEA 3N01A 1RXOB 4F04B 2QTWA 1KLNA 3HXMA 3M9MB 1IBME 2P6TA 2BA0D 5LSLA 4URSA 3EVWA 3TX0A 4WK1A 1QVGR 2X7IA 4WJBA 1IBKI 5B0BA 5U47A 4R5PA 2KM8B 2XHWA 1NDLA 1NK8A 2DISA 1IBMF 3J81Y 2RU3A 3QSYB 2UUCJ 1WNEA 2BR0A 3HVTB 2FTRA 1USUA 2KKHA 1CJVB 5FDLA 2ZOGA 3HKZD 3KNAA 4MIAA 3QZ8A 4P74A 1WKLA 1S9EB 2QFJA 4NZ6A 2X1GA 2ZUGA 3NS7B 3OJUA 5HQMA 3CDAA 1HBMB 2CA9A 2WONA 1QZRA 4PXBA 3UN2A 2V2VA 2BJ3A 2YWFA 3BGRA 2UXDE 3B82A 3BF4A 1VIOA 1ZETA 1RT2B 4B3MJ 4NXNI 4E8UA 4TN2A 1SL0A 3IR6B 1IVZA 1EJ7L 2UXDF 1ZPWX 2CYYA 4ZLJA 1VGYA 4R8UB 2MZJA 1HWKA 1FFGB 2GC8A 3EXCX 4EBEA 3K85A 5GADI 2PE8A 2HNZA 1XMOJ 1I94E 2RUGA 1X9MA 2FZKB 2AF6A 2QYCA 2HQGA 3DOKA 5J2NB 1D0EA 3GIKA 5HN0A 3UHMA 4RWWA 2JEIA 3M85D 4AT1B 5J2QB 2Z5CB 4URQU 2MJUA 2PD1A 2GVZB 2IA6A 2FLNA 1I94F 3QZ7A 3M8PA 2KT5A 4JV5E 1G1XA 4TY8A 2QT7A 4RUHA 4J7CA 3SSQA 4GC6A 5GAEI 4Y00A 2BABA 4JV5F 4HI2A 1U0HA 4WP9A 2BXJA 4WU2A 2CQ4A 2CIMA 2IHR1 4NLTA 3GJSB 3AJ1A 3K89A 3OTOI 3W5YA 3OFEA 1BE4A 4CLPA 3R1HA 2FQQB 1P9YA 1T94A 3L95X 4JI2J 2WVFA 1GXTA 3PKYA 2SXLA 4DLEA 2J65A 4QR0A 5AE2A 4L76A 4LF4E 3H4LA 5DRPA 3GSIA 3N6LA 2VKRA 1Y7PA 4KQZA 5KFNA 3RUBL 1QM9A 4IFVB 4NRUA 2WBMA 1AFJA 5EDWA 4RX6A 2WB4A 5DS7A 4LF4F 4B3ME 2P8IA 5A8WA 3U02A 2YNFB 3PX4A 2NSCA 1U49A 4RUAA 1P6TA 3K7RA 2DVIA 1HYSB 5L9XA 5IOLA 3RAXA 5K36A 2HQIA 4MKAA 3BDPA 3BH6B 2BJ9A 4LUBA 3D54A 2GNKA 1PIEA 1EKRA 3G71S 3HVWA 4F4WA 4J3DA 4IR1A 2KXFA 2EVZA 2PO2B 1ZH5A 3J7AN 4C4WA 4DV5I 3LP2B 3WU3A 4OI1A 2IFXA 5C5JA 2VH7A 2QRRA 1G7CB 5B0GA 3BREA 2YWGA 3LP0A 4DFJA 4ZVHA 2DHGA 2CJQA 1JLAA 2V8HA 3IR5B 2GW8A 4JI0E 4CWBA 3LA0A 3OHAA 5B0FA 3KUGA 4M5MA 3VQSA 1FF2A 3GV5B 4OJGA 2KVIA 4O44A 1EP4A 4JI0F 1Y4UA 3BJYA 5BYRA 2XMMA 5DETA 2H5EA 4EEYA 4RW6A 3M2UA 4CP5A 2D3UA 3ETMA 5ETLA 4F4AA 2XTJP 1VOMA 1X9SA 3TQEA 1TL5A 3JSYA 1T05A 2O1TA 1KP6A 3FCWA 1NHHA 4ERDA 3M8QB 4DX7A 3QIDA 1U2FA 4DQRA 4LF6I 1YJTA 1FJ7A 1AB8A 4J37A 4Z7YA 3CDBA 2RS2A 1RA6A 2XB2D 2W4DA 4GQUA 2VFVA 5AJ3F 2CWXA 4USTA 2CVEA 5IT9C 3PW4A 4DL2A 3OTEA 4OYOA 5IV3A 1RWUA 1Z5CA 2ASDA 4GKKI 2WOMA 4HEA9 4PQUA 4IDKB 3CCES 3MECA 2IMOA 2DRAA 4ZMMA 4Y2MA 4ED4A 1RTIB 5D4OA 3GFZA 2HHPA 3LOUA 2Y1IA 5KOXA 4A46A 2JC1A 3IR7B 2UV8A 2XS5A 3D28A 3NOCA 1H73A 4DR7I 4WFAQ 1ZZFA 4G1QB 2YQ1A 2DXFA 1ZAVA 4FVCA 2QIFA 2W4CA 4I6WA 3FC9A 1N6QA 3BYPA 3KJVA 1UWBA 1DQ8A 3NMAA 2CQCA 3JYTA 5KFRA 1U45A 3EZUA 2MY7A 1TUVA 1IN0A 3B4DA 4H4OB 2DTJA 2HFOA 3GJRB 3GCXP 4JV2A 5F9NA 1VBXA 4DUZI 1H7SA 2DYAA 4DBQA 3SQOP 3R7BB 3DMJA 1ZA2B 4C2MA 1NAQA 2CNLB 2VPZB 5A2QQ 1CJKA 4DV3J 4NLSA 2FHJA 2ZUAA 2HHUA 5IT0A 2BM1A 1U1NA 4OZ1A 4Q7AA 4DR3J 4F50A 1CLFA 3CXCR 2KHDA 2RS8A 1RT4A 3DRRB 3SIPB 1IBKE 1WC1A 5FJ4A 4DCPB 1NK4A 1C0UB 4A8QA 4JI3J 5B0DA 3LGHA 2BJ1A 2IA0A 1RREA 4UQTA 2DNPA 4I2QB 3ZZPA 4IFDB 4DZ6A 1EQ0A 4BWJA 4TU7A 4UF4A 4IG3B 3MM6A 3M05A 5I42B 2VESA 1R89A 3P4UB 3POTA 3KWMA 1JLQB 1FKPA 1T03B 2DNZA 2ZH8A 1QAYA 3JS9A 1RU2A 1HI8A 5GADU 3R6GB 2OPRA 2XG8A 3CJKB 2O1WA 3HFKA 2CDRB 1X7VA 3K5LA 1Y5IB 4NXNE 1WOOA 2C39B 1YWXA 5GMKa 2XBPA 4LRCA 2HZAA 3SBMA 1H0HB 1ZPVA 1RHKB 2ZH1A 4NLUA 1CBKA 4PCQA 4WXOA 3BGOP 4Q45A 4NXNF 4C98A 3FSXA 1GMWA 2MHEA 5EUHA 3O1LA 1HW9A 4HL9A 3V4IB 3ZXWA 1O51A 1TVRA 2DNHA 1H98A 2Z2ZA 5GAEU 2F9JA 2NYHA 2CPXA 3TANA 4HYMA 4Y34A 4DSLA 4ITSA 3HT3A 1HBNA 1HNXI 3KFWX 3KJQB 4NA3A 1LNQA 1VQ8S 1N5VA 3DKDA 3N79A 1AYEA 2ZDOA 2HGMA 3IBCB 3V6HA 4FVMA 2JLEA 2YNIB 4FWHA 2EKNA 3JAMU 4L73A 1H7UA 3DM2A 1MG7A 1PBAA 5M2RA 2OPSB 5A0YA 4TQRA 2V94A 3UFCX 3OTOE 3U1KA 2ZH3A 2VC1A 2FHJD 1RAOA 1HR0J 2E5LF 4CO0A 4D3HA 1TK8A 2RJZA 2J6UA 3OTOF 4C8ZA 2DD8S 3T1HJ 4LF6J 4RNFA 4KAIA 4FW5A 3SCIE 4ECZA 4IZKA 5JEAD 4ZPTR 4BCAA 1JXEA 1VBYA 2MZ1A 1WUUA 1JKHA 2GMLA 1RUSA 3K5NA 3A1YG 1FX4A 4O4RA 4BDPA 3MM8A 5SZTA 4I6AA 2H65B 3HCXA 5KG6A 2UXCJ 1YH8A 3D3CJ 4WF9Q 3LGNA 3WX8A 1RTJA 1DURA 2R4FA 4A8SA 2HNYB 3KG4A 4DV5E 2ZEJA 2J0QD 2FIUA 4DR7J 2UUTA 3KK1B 3A3NB 2EFOA 4LBPA 2XY6A 1TFWA 1X5OA 3RBXA 4DV5F 1T8EA 2LJPA 1OPZA 3THVA 2MKHA 2KB2A 5L1IA 1GMWD 4QIVA 1NHUA 4DG1B 2IM3A 4UUXA 4DZDA 2ROPA 1RZMA 1DFDA 4X4RA 4B3TJ 2DR6A 4KY3A 2D3O1 4J9KA 2CGEA 4DUZJ 1S6QA 3WC0A 3SSSA 1BHNA 1TELA 2GIRA 4JI4J 5CXTA 3AT1B 2RDIA 3JAMY 5L1LA 4K4XA 2DXDA 3CJ0A 2UVRA 2H4WB 5KT7A 1B3TA 4LF6E 2J0WA 4RUCA 1FRMA 4K4VA 5KFIA 1FT8A 2HZVA 4Q5VA 4B3SI 3UDCA 1N0VC 3GLLA 2RIJA 1FX2A 2YH0A 3GJQB 3M6XA 1LK7A 3RBZA 2DNLA 2XMAA 3K2YA 2I5JA 1P1LA 3CJ3A 2NLWA 3NY0A 3UCGA 2YNGB 4OJHA 1FK9B 3MEDA 4GKKE 3IWXA 4ZVQB 5J2MB 3J7AG 2VQEJ 5KFVA 2YNHB 2N7CA 2F1DA 1K1QA 1U1RA 3VZHA 1HNWJ 1EAYC 2DGTA 4DR7E 3PW5A 3UQSA 1SJFA 5GMEA 4P7AA 2P6SA 3BSOA 3OQ2A 5DRKA 5DDQC 1RK8A 1REVA 4USUA 4GRSA 2KG1A 4EZ9A 4CLFA 3ULHA 2AZ3A 4NCBA 2HSEB 4XTTA 3HD1A 4KJIA 1N88A 5A2QC 1V9OA 2KT2A 3M8ZA 4I67A 1RBLA 4F25A 1N34I 1PC5A 4M5HA 2ZBCA 1ZM9A 3D6HB 3S7RA 3N6MA 1SKSA 2X36A 2AHOB 2LYVA 3BM7A 4GVBA 2BQ3A 3THTA 2OPPA 2XMWA 3TVYA 4NPOA 1Y00A 1LW2B 2BA0G 2A1BA 2JRSA 1MMNA 2VDHA 3BBCA 3PHEA 2L9NA 1QVFR 3T5KA 2KXNB 3KLGA 2ABYA 4ETZA 3BQ2A 2XHCA 2IM1A 2D69A 1ITPA 3MTJA 1H72C 1WI8A 3P76A 1UPPA 4MU3A 2W01A 5JXSA 3CJSA 3VVTA 2OPQA 3HHLB 1QLNA 4Q2MA 4Y0FA 3ISND 2P9GA 1A9NB 4P2SA 1W25A 2JEBA 1N5SA 3QGIA 1VR6A 1F0XA 2VF3A 1RADB 3C6TB 3A13A 2GHVC 2O66A 5FD1A 2M5YA 4MTPA 3QFWA 1RAIB 3H42A 1GEHA 2K1RA 5KFEA 4ER8A 3A8EA 1SJQA 1UEKA 2W9BB 4XIUA 3T1YI 1S57A 4KKOB 2QMWA 2ZNZA 2G0CA 1HMVA 4NLYA 4DSJA 1X4FA 2JJ4D 3QNWB 3OPKA 1RT7A 2V6AA 3CMQA 2D9PA 2XMVA 1NJYA 2IC3B 1U09A 3M85G 4ZVSB 1UFWA 5CHCB 4F67A 1RAFB 3BSCA 5FLXC 3MPUB 2P2CB 1ACMB 1JJCB 4MJKA 3NGDA 2VFRA 1SL1A 1ZS6A 3T6JA 1XMQI 1HNXE 4X4NA 1BKNA 4EZ6A 4R1FA 5MAOA 1NHIA 1UJ4A 3O5TB 1N36J 3VQTA 5CD4A 2X1FA 3QRPA 2YWEA 2HS3A 2EFPA 1KNZA 2N4DA 4FP9A 1FRIA 5GAHI 1VHIA 1S9FA 3DYAA 2C37A 3M9OB 1FRKA 3HJFA 4ELUA 2V0NA 2DNKA 3IMQJ 4FF4A 1Q86T 1OYSA 3HPOA 3QO9A 3L3CA 1S0MA 1Q8IA 1S1VA 1WC5A 3KOAA 1RHJB 1X0PA 3M6AA 2C3OA 5KT5A 1MWZA 5F9LA 1VQKS 2CNNB 3M8WA 5HMXA 2YPZA 1TKTB 1WWHA 4QWDA 3J7AM 1JJHA 2HPUA 1JJ4A 1N32F 4LRBA 4KV8B 3MPDA 3Q2SC 4OI6A 1R31A 4FZVA 2IM2A 4HLBA 4M5NA 1UAWA 3IS9B 1T9VA 4LFCI 1NXIA 3UCUP 1KVJA 3ZZRA 2NN6B 3E2EA 3N5BA 3BS9A 4DL7A 4UQGA 4RU2A 2MKCA 2L08A 2BA9A 3DOMB 2WZ1A 4NLWA 4F4ZA 4LQ9A 4DR5I 5KT6A 1XWLA 2XYGB 4DV1I 1RAJA 2J7KA 4B3OA 3L7OA 2VZ9A 2HQFA 4PG7A 5KG4A 1VC0A 1B0PA 2CRLA 5GAGI 3HVTA 1T11A 3Q8PB 4RW7B 2CPHA 5L38A 4ECRA 1CJVA 3TZYA 6FD1A 4DWIA 1MROB 3IN5A 4DPOA 3FCHA 2W9CB 2IMWP 4XPCA 3HHEA 1Z0WA 1VI7A 4OMFG 3T6BA 3D2WA 2AJ1A 3M1VA 3DLKB 5L9NA 3RW7A 3CT9A 1RAHB 2RNEA 3H5XA 1I1GA 5KOWA 1BQXA 2AYEA 1M5HA 2VFUA 5LXYA 1BQMB 1RR9A 4N3OA 3P3GA 2BR2A 2KJVA 4ECQA 4JI7I 3DLGB 2ZH7A 3AFGA 5DRRA 2E9ZA 1XN9A 2HAIA 4QWCA 4B3SE 4R8UA 1SJ4P 4ZPWR 4PXDA 4WWSA 1TV6B 3ET6A 4LCFA 3K5OA 4O4GB 4Q0BA 1WD6A 3KJFB 4B3SF 1R0AB 1I51B 2ZE2A 2O5DA 3FFIA 5J2QA 2Z5CA 2GVZA 4ED3A 1RT5A 4JB8B 1Q5VA 4UOHA 1HNZI 3VAHA 4ZVPB 3WU6A 1D8ZA 2ZFHA 4AL7A 3PJWA 2BMBA 2V8VA 5IQQA 4ES3A 3LO3A 1G2EA 5C0XC 1SKRA 1TTHB 4YHHE 2OGUA 3KDOA 3PYDA 3T19A 4P2FA 1YSJA 1Z0EA 1T7PA 2OEKA 4NWBA 3T1YJ 1RA7A 3LH2S 2MZQA 5H9FJ 2RQMA 1K47A 4OYXA 4YHHF 4OL8A 3QLHB 4P71A 4CNZA 4ZJOA 1NDKA 4RBVA 2VG6B 1CQNA 2NZ4A 2FGCA 1N34E 1N0UA 1OSDA 4NCAA 3R5AA 1S4EA 3RB0A 3DLEB 1VMBA 2R7QA 2Y8WA 2LA4A 4MYTA 3NNCA 3GR1A 1PJ6A 4IZJA 1SH2A 1R6LA 2JLFA 1N34F 1E3PA 4DL3A 3I4HX 2MKSA 3OUYA 1S1WB 3Q2TC 2YNFA 1VJQA 4PQAA 3M2RB 4LF8I 5DDPC 1KFDA 2XWYA 3DNCA 1HYSA 2JE6A 4Y3CA 1DHMA 1HQEB 4BC9A 3I0SB 4DV0J 1LWEA 4NLPA 3SDEA 4KTQA 3AH6A 3PVXA 4DUYI 2PMWA 4DV2E 2DIUA 3SV3A 1QUPA 3W2WB 1FESA 1S76D 4NI2A 2XYPB 3G8QA 1RWXB 2VQFI 4H4KC 1S1UB 1D8YA 2AGQA 4KO0A 4DV2F 3BKFA 3MCNA 5FIIA 1SH0A 4CI0B 1Y3KA 3DOLA 2AJ4A 2QZ8A 5CCLA 4X4PA 4AQYI 5KTQA 3US5A 2V34A 3HF5A 3PYGA 2RF2A 2DCLA 1DZ5A 2I8EA 1YI2S 1FXLA 2ZM6I 1VC5A 4WKRA 4LF7J 3D0GE 3LANA 1M0SA 4ZK7M 2E9RX 2KU7A 3WIUA 1JLCB 2Z2YB 3E01B 1RAAB 2WNRB 1VQOS 3T1YE 3M2VB 4ZLNA 4F3OA 5K14A 5EX3A 2QLFB 4DPYA 5IWAI 1X4DA 4U8VA 2BKOA 4XK8C 5GAHU 3PR5B 2RDJA 4YN3B 4DV1J 4Q43A 1XMQE 5C2CA 3HSJA 4CH0S 1J5EJ 1IQTA 1PG5B 3C19A 4TXSA 2CJYB 3BPSP 2Y9HA 1O0PA 2EFGA 1N33J 4IDKA 2IERA 2B4UA 1RHQB 1XERA 1UVIA 3HT0A 1RTIA 1T02A 1Z0CA 3C15B 5BJRA 1BD6A 4A4JA 2ZH9A 5E2QA 2JEAA 3GG1A 4MKVA 2E44A 1L3TA 2DGUA 3ENAA 4QYZK 1NB7A 2EBGA 4OO1B 1YVFA 4BWMA 4G1QA 3IM9A 1Y4ZB 1YZ6A 3CCZA 1VBKA 3OXGA 1RTDA 2WVCA 2HKJA 3IP0A 1NM2A 3BB5A 1UVJA 4K4ZA 2E5JA 4N47A 3ZZZA 2QSFA 4K2XA 4R0JA 4KGMA 4RBUA 4KFBB 4LF9I 3MFHA 5RUBA 2ZWOA 4HY1A 3I6PA 1CJUA 3P45B 3V6JA 2EG1A 1J27A 2ZWPA 2CQ2A 3H1CA 5HMYA 3NNHA 4LFCE 3QRRA 2CPDA 1VRQC 5LMUJ 2JH3A 1PBUA 2BUNA 5KG3A 3OL9A 4YDDB 2K2PA 2NXEA 4DV7J 2BOAA 1DTTA 1EX8A 5KFZA 4CZCA 4EO6A 2QX0A 4LFCF 1CVJA 3HVRA 3U1YA 4PWDB 2G9OA 3DRRA 4DR5E 4MK9A 3VGSA 1S72S 4DV6E 3LAMA 1GNKA 1FKOB 2KYXA 1LV5A 5C24A 4F0MA 1OY8A 4LF1A 5CQGA 4KPCA 1FXDA 3AJDA 5HQ8A 5DM6Q 3O3LA 4DR5F 4CLTA 1Z0TA 2HIQA 4CNYA 4DV6F 3R2DJ 8AT1B 2R8GA 4IRDA 3J80Q 2AKWB 5KFDA 4YUDA 4N7TA 4MKBA 3QIPA 4FPIA 2RQKA 2W8LA 4DR3F 5I42A 1RHRB 4QCLA 3DRSB 4U95A 2HBQB 1RT6B 5CAAA 1JLQA 2HMIB 3L9ZA 3C66A 3L7PA 3HSDA 4N8NA 1LFWA 5FWKA 3ZTPA 2C2DA 1V3RA 2HBZB 4DJBA 1N5YA 7FD1A 2OP5A 5HVGA 3V4MA 1ZTWA 2XS7A 3Q89A 2C39A 3DDNA 2GHPA 2C22A 2CDQA 2B4PA 2J9EA 3BZQA 3L4BC 1KLMB 3R5JB 5KAKA 4JI7E 2ZJPQ 3ILIA 1VK3A 1YHQS 3B4TA 2ZHBA 2EWHA 5EWGA 2XMKA 1BC6A 4DUYJ 4DR2F 3RW6A 5H1SV 2XY7A 2J8SA 3UD3P 1JWWA 1IWAA 4XDDA 1EI1A 4C8MA 4KC5A 2CJKA 1RWWB 1FNXH 1RABB 3IO1A 3NCQA 1YTYA 3FSIA 4MT1A 3TO8A 5BR8I 2FY8A 5F0WA 5DROA 4F8RA 1HNZE 4AQYJ 2XM3A 2Y3YA 5KFTA 4CTAA 4I69A 3AB4B 1R0CB 4DN0A 4RW4B 1YDLA 3O44A 4BC7A 1SC1B 1IKVA 1HNZF 4KGXB 2OPSA 2NYIA 2RQ4A 4MKYA 2EK1A 3MMCA 4B3RI 2DRDA 2DO4A 3G9CA 3Q6MA 2R7WA 5SUHA 3CWVA 4M8LA 1FXRA 4LQ3A 1JLEB 3CMAS 2AZ1A 3PXGa 4HTJA 2C2RA 4IOAQ 3NMRA 3X1LB 2L41A 1FRLA 2DNRA 5IWAJ 4YR0A 1KN6A 1MSWD 1WSRA 1NHJA 1OY6A 3HHKA 4PUOB 2AE8A 3PIPQ 4ECVA 1H2TZ 1NDCA 4AL5A 2O67A 4B9VA 1GAOA 2CPIA 2ADCA 1G6BA 5EGYA 1U1OA 3IGNA 4RZRA 5CYMA 3KXDA 4KH1B 4DR4I 1VS3A 1YHCA 3G6ES 4LF8E 3ILOA 2XC9A 3SI8A 2E1CA 2LP4A 4ZS6A 4IFDD 4WU3A 1F5CA 4ZPBA 2BBEA 1NK9A 4LF8F 3BN4A 2HYIB 1UKUA 5K8OA 2B6AB 1AA1B 4GO7X 3IRXB 1KOOA 4DR6E 2VODA 4YB5A 3VALA 2PNLA 1WG1A 1WHWA 2VG5B 2XNQA 2VFTA 2VQFE 1NHVA 3FEZA 3PW0A 3UPFA 4DR6F 3KK1A 2IM0A 4LRDA 1ZAWA 4LVOP 1VC6A 4F02A 2HHHJ 2DEJA 4C8KA 1KFSA 4AQYE 2VQFF 1X60A 3BR9A 2LU2A 1YJNS 2WVDA 4OZLA 5HBMB 3TUJC 4DG1A 3FEXB 1ZOTA 4W90B 2ZM6E 2DK2A 2HURA 1RSCA 2NN6E 1HIYA 3CJ2A 5KFUA 2ZM6F 1UDNA 3V6DB 5IT9U 3OBIA 2C2MB 3K17A 3BQ0A 1IBLI 5T41A 1OY9A 1IKWA 2NN6F 2PIIA 2LFVA 3GIJA 3DGPB 1KHVA 4WYLA 3ENWA 1TL3B 3MM7A 3P96A 4JYAI 2ZZTA 4JI5I 5K36C 4FBUA 4OYBA 3KLIA 3K8WA 2NREA 4B3TF 1X4AA 1VQMS 2ZH5A 1U0SA 3ZM7A 2OJ3A 2LEBA 1HD0A 2G0JA 2YNGA 3F56A 1MU5A 4O3PA 1PVGA 4NXMJ 2VBXA 1Q82T 2VV5A 4K8RA 1S9GA 2HVEA 4URGA 3UW1A 5KFJA 3KHRA 4PRVA 1ZXMA 2AMCB 1N4LA 2GQCA 1BY9A 4LFAJ 4NE9C 1X5SA 1NSKL 2QE5A 5D3GB 3P5TL 1VQ4S 4K4YA 3R5CA 1GTEA 3MEEB 3BSAA 4ZP8A 2V8GA 3DU5A 2AJFE 2YKAA 2JVRA 3J81C 4MIBA 2KFNA 4IR9A 2UUBI 2YXLA 3W9IA 3D1QA 3OJSA 2PA8D 5IC4B 2AWZA 1IKYB 2W2NP 1JB0C 3I4PA 2Q6CA 4HVZA 3BSNA 3MAAA 4LF9E 3SCJE 2DNGA 3C16A 3P6YC 1RHUB 1Q78A 4RU9A 3I55S 1S0VA 4FYDA 1HNWF 2F8EX 3AOAA 4LF9F 3HK2A 2F5GA 1OWXA 4MYUA 5C42B 3PHTA 1YIJS 2I9SA 4V1Ak 5ETMA 1LW2A 5J2PB 3RAMA 2PN6A 3A8IA 2IYIA 1UL3A 3FJ2A 4QZVB 2FVPA 2F4VF 3DRXA 1LQ9A 1UDSA 3AOCA 2V8DA 4USIA 4YOEA 3QATA 4YDXA 3BV8A 2VBZA 1VQYA 4ECXA 2R2RA 2XZDB 4OX6A 4IRCA 2HHSA 3R7NB 3NGKA 3W8PA 4DPTA 3HHLA 4WFZA 1R8PA 4NA2A 4Z2XA 3LPYA 3FBCA 2AQ4A 2GGPA 1FTRA 4ANEA 3QT8A 5JUMA 2ASYA 5J1PA 4NZ0A 3SQGB 2AD9A 4KHPI 1WF2A 4CLLA 5C0XB 1AXQA 8ATCB 2HKEA 3DLHA 4DR4J 2ZVSA 4TLRA 2LQ5A 4QIFA 2JVOA 2PGCA 4C97A 1TMMA 1IR1A 1RWOB 2HQ3A 1VRUB 2HS4A 4UW2A 4DLGA 5IS2A 1Q8LA 3G6VA 5IM0B 4FN5A 2FJVA 3AXKA 2R7VA 1Z0BA 5HROB 4NL5A 5B09A 2OH2A 2IC3A 3B54A 1NK6A 3DLLQ 4PU9A 4ID8A 5I3UA 1E6VA 4KQVA 1HBOB 5HVFA 2XI2A 3QPIA 4URLA 3UR3C 2ERRA 3K1JA 3BGUA 3BO3A 5BR8E 3P3EA 2OD4A 2WP8A 2FYXA 4O3RA 5HI7A 4WZMA 2CG8A 2Z58B 1M1GA 4YQWA 1X4HA 5BR8F 2YWWA 4ICLB 2J7WA 5ETRA 1HNVB 3TEHB 2HW3A 1XNRF 4B3RE 3FDSA 3UE2A 3LW5C 3GTYX 3LWMA 4XPEA 2ZH4A 3M32A 1FJGI 3NP5A 4C8OA 4ZHRB 1X5PA 3HZGA 4B3RF 2AGOA 1BWVA 2UU9I 4IG0A 1HNIB 3KHHA 2YKQA 3QJPA 3M7VA 1Q81T 2EPIA 1FI4A 2P9EA 1TZ0A 1ZYQA 4K7QA 3UWTA 1TKTA 3IXQA 2YX1A 3MURP 2GVDA 3EPIA 5LMNE 2IAJA 3DHXA 4BBYA 2W8KA 2RE1A 4KV8A 4DDFA 3AODA 4RR5A 4B9LA 2KFZA 2HG4A 2B7CB 1U6BA 4JP8A 2XCAA 4B02A 3HHLD 3H7HB 1RAGB 1Z59A 5LMNF 3V81B 1ZTTA 2C38B 2NN6A 1NJZA 1H7WA 4CYUB 2OLWA 3QQCD 4WTYA 2EI5A 1XR7A 1X31C 3GMEA 2UXBI 4QU7A 3W65A 4ECWA 1WEZA 2O01C 4OO1E 4X64F 3Q0AA 1V3ZA 2XS2A 1ZM4A 2A18A 3T3FA 4NLOA 3JAMQ 4HTIA 4PKDB 2DGVA 4FKYA 3WBZA 1MLAA 2GQ0A 2UUBJ 4ZN3A 4OO1F 3KLEA 4DL5A 4LSLA 2QLJB 1F3VA 4ZJLA 4JV5I 3H2VE 1Y0HA 4AIDA 2PMZD 2JX2A 4FYVB 3SFUA 3Q8RB 1KQFB 3UDLA 4CO5A 3GFHA 4ES2A 2W9CA 3EGZA 2PI5A 1FFWB 2HZCA 4FKXA 3NWGA 1B7FA 2AT1B 3D3BJ 2I38A 3UVJA 2B8PA 2OKQA 2V4JB 1S1TB 2OHDA 4FS1A 2M2BA 2XI3A 1FDAA 4A48A 2ZOFA 1IBLE 2POKA 1BQMA 5CYQA 3H8YA 4ZVGA 3TA2A 3M6VA 2UVWA 5CH7B 1XC9A 3D6FB 1F1BB 3RG6A 4X65J 6FDRA 2FGOA 1YJVA 4JYAE 2MEWA 3DLBA 4JI5E 1IBLF 1DARA 3VAJA 4DXLA 2V67A 2QA1A 2JZ5A 3K59A 5F8HA 4FW7A 2AJQA 4HKQA 4ZVUB 3CIMA 4J9PA 2R9LA 4WFXA 2DHHA 5T7LA 4JYAF 4JI5F 4PZVA 1U4BA 2WSCC 4O4GA 3TUIC 1I5OB 2CKWA 2APOA 5H9EJ 4IH6A 3EVMA 1CPZA 1WKKA 2YPYA 4N76A 5C25B 3M6WA 2GAGC 1Y60A 3VWSA 4KE5A 2OEMA 3GE9A 1CEZA 5HMWA 1SC3B 4P2XA 1X4EA 2O3DA 1F3FA 3MZIA 3W5XA 5K20B 5JJBA 4D3GA 5DZ6A 3U27A 1NZAA 5AE1A 5HANA 2DIVA 1IM4A 1M1KT 2XSJA 1A6FA 1RWNB 1X5TA 5ETQA 2QA2A 4MK7A 2N3OA 3D67A 3CDWA 4CLUA 2NS1B 2AU0A 3NXZA 4P52A 3QLHA 3QT7A 1ZZNA 1MN9A 3W5ZA 2CADA 1GMVA 2VC0A 2F40A 3FEYB 2X1AA 3ISNC 4RO0A 2MKIA 5F8LA 3F44A 4TNOA 3KLFB 3MDFA 2DNMA 4X4OA 4L3KA 1WEXA 3TVKA 3NS5A 2NZCA 1QTNB 2DHXA 5F3TA 2Q3PA 5LM7E 3MGJA 2B9YA 3M2RA 4Y65A 4XAKA 4H54A 1PAUB 4ZPDA 1SV5A 1IBMJ 3CUNA 4WFBQ 3I32A 1WKJA 3ZNJ1 3PM9A 1VISA 4M1KA 3W2WA 2E1RA 3ZTQA 2NXCA 2DH8A 2F8HA 2PA3A 2YQ3A 4OHXA 3PIOQ 3QT5A 1IKXA 4J9UE 4J5OA 5K8MA 3P49B 1Y5YA 4R5PB 1F2GA 3H5YA 1UJ6A 1RLCL 1U6FA 3P3CA 2Z2LA 1NH8A 1VCTA 1UMJA 1XNQI 2UXDJ 4KHPE 2IPOB 3M9NB 4DFKA 2FUG9 3PS3A 1RU1A 4FWGA 5D0EA 4NLDA 3M2VA 5E3RA 4JI6E 3CD5A 1OYPA 1U48A 4PEOA 2FHMA 1T9UA 4P75A 4KHPF 2HFUA 2WONB 1S6PA 4BA1B 1ULRA 3P5BP 4OHZA 3BGRB 2RRAA 3HZEA 2CZ9A 1X4CA 4JI6F 4YB6A 2HIYA 3HJVA 4F36A 1CULB 1I94J 4I64A 3A12A 2G0IA 4DSFA 2ALZA 4N41A 3FQKA 5DG7A 1WC6A 1V3SA 3MM5A 2K7JA 4Y2CA 4B9NA 3N0VA 4PABA 1E6YA 3C6UA 1VJWA 3MHYA 2DH7A 4QQBA 3R97A 1PKPA 3PFOA 2HNZB 1C1CA 4JV5J 5IC6B 1EB0A 4C6AA 5KFKA 3DOKB 2YX4A 1DLOA 1Q16B 2VL1A 1S0OA 3ZFVA 5AXNA 4PRXA 2FLPA 3KMQA 3L7ZB 3MWBA 1O8BA 3M8PB 1FNMA 1OYRA 4XTJA 4Y2AA 3S6EA 3NAIA 1KONA 5E5NA 4TY8B 3MMBA 3R5DA 4OO1A 1HKAA 3NCPA 2O1UA 1FJGE 2FJAB 1OSCA 3DRYA 1WTFA 2UU9E 1U0HB 3MFIA 3AD8C 4LF4J 3R5BA 3OSNA 4JV1A 1PCAA 1FJGF 3DD6A 2G1DA 4DPXA 4KFBA 3FBBA 4HDGA 4C0HA 2U2FA 1Z5AA 1UDOA 2UU9F 3AOBA 3DRPB 4QR2A 1TFYA 4F0HA 3VCDA 1K44A 1NDPA 4R25A 4WKYA 1GTHA 5JVHQ 4DR1I 1FVSA 2RAQA 3OR1A 2WTFA 3OVSA 3JAMC 3IBFB 4QPTA 5F8MA 4DQQA 4EFAC 4ETXA 3J80Y 3VAMA 3FK4A 2QLWA 3CD0A 2UXBE 5BYSA 4C11B 2O1PA 2I1RA 5JEAE 1QAIA 2XCPA 2VA3A 4OYMA 3H20A 1E3HA 1NUEA 2UXBF 2H1YA 2BDPA 5K36B 3I5CA 1FKOA 3NBPA 5JEAF 4M95A 3OTCA 3ELHA 2RUSA 3QJLA 3MMAA 4DL4A 4WP3A 4I2PA 1LFPA 4NLQA 2R8KA 5E3AA 4JI0J 3PRYA 4X66I 1TL4A 3W3SA 2GIFA 3CC7S 1EIYB 2UZAA 2AEJA 4PG6A 3LP0B 1KDNA 1RT6A 2E5LI 1JLAB 4ZPAA 2HMIA 2Y1JA 3TNVA 3D0HE 1OYEA 2CQPA 4ZVRB 2B0GA 4B9SA 2BW2A 5D4PA 1S1XB 4K0KI 2DGSA 1HD1A 2OAUA 1GXUA 2C2EA 3ICLA 1Q8KA 2VPXB 2F3JA 1SC6A 3OXFA 4HT5A 5AJ3J 4CLZA 1BXNA 1KLMA 2X51A 4OYPA 2E9TA 4A8FA 4DV4I 4RW6B 2ILYA 3M2UB 4LF5I 1VLOA 5DJBA 4CQ1A 2BRKA 4NX9A 1KVKA 1TMJA 3G8TA 2MKYA 1HQUA 2MQOA 1H6KX 1U25A 3TW0A 2DO0A 2FD2A 2BOPA 4OO1D 1IXKA 3CC2S 2UVVA 3VAIA 3VAFA 3TOQA 2HVZA 1NPPA 5DZ7A 3RRHA 1NK5A 2NUHA 3UN3A 1HPZB 2KM8C 1WOPA 3ZKDA 3U1NA 2LCWA 2VU5A 1YRUA 1YJUA 4LR9A 4O3QA 3IWLA 4TLQA 3NZKA 4GO5X 1URNA 1C0TB 2Z30B 1YLXA 3W9HA 1H2UX 2WOMB 2RVJA 2Y8YA 3VAGA 3MECB 2V8PA 4JI1I 4X62F 4JI8E 3MM9A 3TJAA 1HWIA 5C0XF 3QSIA 1S7IA 2ZC3A 3GZ7A 3T9NA 3BKUA 2FVRA 1JLEA 2MZRA 1KTQA 4CT8A 4JI8F 1W2IA 2KRRA 4I3HA 3GV7B 2XMTA 2Q43A 1NKBA 3ZZOA 1KEKA 3KJVB 2NPFA 3PRVA 3TAPA 2MZSA 2XULA 1YQHA 2I0XA 2ZJQQ 3CC4S 3OLBA 3K58A 1FTCA 2L3MA 4KGKA 3AA8A 1JXVA 1YG0A 2VJVA 4ED2A 3GQCA 2QJ3A 1NPRA 1N48A 2RH3A 2DITA 4CH7A 4U3BA 4K4SA 3HKWA 2FZCB 5IT4A 2YQ0A 4ECSA 3MOZA 3CCQS 4ED1A 2YKMA 2CPYA 2B6AA 3DMJB 4DCJB 1IBKJ 2A10A 3IRXA 2YKNA 4ZPCA 2Z5BA 4TU8A 5HSPA 4GC7A 2VG5A 5HAOA 1GK8A 2GO9A 5B08A 4OX9I 1RT4B 2W2QP 3GCMA 2MGZA 3S1TA 3BBBA 1EARA 1XR5A 3ZTRA 1OPIA 2BKPA 4HXZA 1FJEB 5HL7Q 5A8KA 5L8RC 5J1EA 1NJIT 4HYKA 1MW7A 4BA2B 2PEBA 2DGQA 1XNQE 1U1QA 3CCLS 1R8CA 2NSBA 3MR7A 4NXNJ 5F41A 2QSWA 3TA0A 1FHTA 1FKPB 1URRA 4ED8A 3VHQA 1XNQF 1PYTA 1B0TA 3B4MA 1Y4SA 2HRYA 1N5QA 3QWPA 1Y9OA 1QE1B 3DGPA 5J1NA 2HRUA 4J91A 2R8HA 1CJTB 2DBBA 3PX6A 1A7GE 1HL6A 4IOCQ 1HK7A 1S7HA 3HHNB 1KIJA 3TJ9A 3T5HA 2M3DA 4QWBA 1REGX 3RRGA 3G82A 4GKJI 5HMZA 5K8NA 1TVRB 1XMBA 1GMUA 4OQJA 5DLFA 2CPFA 3RAQA 2UUWA 3SEOA 4L3NA 4YY3I 3TA1A 2W9AA 2E5LJ 4O3SA 5JEAA 3KK2A 1V6HA 4RPFA 2DNYA 1TL7B 3OTOJ 3WC2A 3EXYA 1SL2A 3MEEA 5D15A 3QAEA 1VHFA 3MPYA 4NLRA 3PNIA 3DM2B 1IJEB 4WTOB 3KJNB 1IKYA 2CQ0A 4AXIA 2GJFA 1CC7A 1RJJA 1BQNA 2MSTA 3NG8A 4KHRA 2CWKA 2PO1A 2UUAE 1RTZA 3DI6B 2CVIA 3RB4A 5F8IA 4WE1B 3KK3A 4ZA1A 2XZTB 4ANCA 3CNQP 1VIXA 3PW2A 2L9WA 1S10A 4DR1E 4P9SA 3FKBA 1EA6A 2UUAF 1F5AA 3NWRA 1SIWB 4P7VA 5C42A 4OLPA 3TAMA 3W60A 4NZ7A 1RT1B 2V50A 4IZKB 3PCOB 4DR1F 3TYTA 1WJ9A 1VQ9S 1YX2A 1DTQA 2DGWA 2WVEA 4QWAA 2DEIA 1JKHB 3IRWP 3WZ0A 4DV5J 3CWJA 3DLJA 2R3VA 2BM0A 2B7BB 1C2PA 4OX8A 1YJWS 3F0NA 2HVHA 2MY8A 2DH9A 3D1HA 4WPAA 1H38A 2H48B 3PEHA 1K1SA 5JVGQ 2RMLA 1JIHA 3OD2A 3QWUA 4CH1A 4I7FA 4I56A 4OZ3A 1MWYA 4X66E 1VBZA 1X4BA 1BLUA 4NYZA 2R7OA 1C1BA 2E5LE 1XHKA 2LXIA 2VFSA 4X66F 4C9DA 1L5UA 2X3GA 4HT7A 4FXWA 4PPDA 3GPAA 3SQGA 4DHVA 1I3OB 5HQLA 4KR0B 3PV8A 3SV4A 2QC3A 2DPJA 2CJBA 2OFHX 1OS5A 3PY8A 4K0KE 4E0DA 4ALZA 1N32I 3W1YC 3DXBA 1U1PA 2DCUB 2DHAA 1FD2A 4PYAA 2A0FB 4DV4E 1XIQA 2QV6A 2JT2A 1LOUA 3CE8A 4Y6IA 2DXEA 4H4MA 4K0KF 4LF5E 1EQMA 1NZ8A 5HROA 3CPWR 1VRTB 3AXMA 3I9V9 1R3NA 4DV4F 4DS4A 1SVDA 1LWCA 4LF5F 1PJ5A 1HBOA 2VONA 4E98A 4OI3A 4GKKJ 3MR3A 1NSPA 4C3KA 4O3OA 3C46A 1NMEB 3BPDA 5B0AA 4M5GA 2HEKA 3VGVA 1QY7A 2VBWA 2Z5EA 3H4DA 3UCZP 2H3EB 2I5JB 3HKMA 2ATCB 2HGNA 1AZSA 3MUVP 5EN1A 3THPA 4X4QA 4M5KA 2G4BA 1L3UA 4ICLA 3MEDB 2LEAA 2JDJA 4ATNA 5HK4A 1HNVA 2CPJA 2A2DA 2FHOB 1A0OB 4JI1E 3K8VA 2YBVA 3CDJA 4J9OA 3OL7A 2HHQA 2PI4A 3CJRA 3H0PA 4MU0A 3MAHA 1DBDA 3EZOA 4ZHRA 4JI1F 3HULA 1KKHA 4FNIA 1J5OB 2FLOA 4FF2A 1D3WA 1HNIA 2MQLA
chains in the Genus database with same CATH topology
1TKXB 2HQIA 1HBUB 4MKAA 3BDPA 1VS3A 2J6TA 3G6ES 4LUBA 1D1UA 2HWTA 2K3IA 3D54A 3F41A 3FGVA 3FNNA 2GNKA 5I4MA 2XC9A 3LUYA 3U1MA 3SI8A 2E1CA 1Q7LB 1WF1A 3G71S 3HVWA 1MROA 4ZS6A 4F4WA 3HI9A 4WU3A 1F5CA 3UNGC 4DFMA 2XSJB 4IR1A 2R7XA 4JBCA 2V5HG 2KXFA 3TQ1A 1R27B 5HO4A 2DRBA 2EVZA 4ZPBA 3PEJA 2BBEA 2K7KA 2LA6A 2R7RA 1NK9A 2N82B 1ZH5A 4C4WA 3I56S 2AGPA 2WHOA 3W2VA 1S6OA 3BN4A 3LP2B 2HYIB 1UKUA 2VBYA 3DLKA 4QR1A 2B6AB 2IFXA 4OI1A 3T1AA 5K8OA 5C5JA 2VH7A 1ZAXA 3I5AA 2QRRA 3MPWA 4GO7X 2D7SA 1G7CB 3IRXB 1KOOA 3MPVA 4TKTA 5B0GA 3BREA 1VK8A 2ZD1B 4ECUA 2YWGA 2VODA 3N4WA 1FD8A 1M90T 1IUJA 4YB5A 4K50A 1FEEA 3VALA 4AUKA 2M88A 3LP0A 4DFJA 4ZVHA 1WG1A 3MI7X 2DHGA 4X4UA 3JSMA 1WHWA 2CJQA 1JLAA 4RW9B 3LALA 2VG5B 2XNQA 2VFTA 4UUWA 5I3QA 2V8HA 3IR5B 3M8RA 2ILZA 1NHVA 3FEZA 2GW8A 3PW0A 2MJNA 3UPFA 4DR6F 4J9QA 2RKIA 3KK1A 1F9FA 3MCSA 2IM0A 1ZAWA 3OHAA 4HH1A 5B0FA 3KLHA 5LSOA 3DLGA 3IWNC 1Q79A 4LVOP 1VC6A 2W25A 2FHKA 1W2BR 4K5RA 4F02A 2MKKA 3VQSA 4C8KA 1KFSA 1FF2A 3CB4A 5E3CA 2VQFF 1DQAA 3GV5B 3BR9A 4OJGA 2KVIA 2LU2A 4O44A 1EP4A 5A6WA 1YJNS 1UW4A 2GJ2A 3RU0A 4JI0F 3UD4P 2EBEA 1TV6A 1VQNS 4OZLA 3AJ2A 3BJYA 5BYRA 5B0EA 2XMMA 5DETA 5HBMB 3KLGB 2H5EA 1NEEA 3NRBA 3TUJC 3KYLA 2OTLS 4DG1A 3FEXB 1QSLA 3CCSS 1ZOTA 4HH0A 4EEYA 1TK0A 2MQPA 4RW6A 4LFBF 4W90B 3M2UA 2D3UA 1FDNA 4RW8B 4PWUA 5CZXA 4X84A 4OX9F 1R0AA 1FEHA 2DK2A 3DXSX 1VOMA 2B9XA 1X9SA 1SV5B 1TL5A 1FERA 2KYZA 1HI1A 4ZVEA 3JSYA 3RR8A 3LQVA 4OV1A 1Y3JA 2J76E 2YY3A 1HFEL 1T05A 3M30B 2HNDB 5B7WA 4Q44A 2W7PA 3BGFA 4ZCIA 4ERDA 3CJ2A 2OPQB 5KFUA 3OTDA 3M8QB 3JTPA 2ZM6F 1QAXA 3JTNA 3QIDA 1SB6A 3V6DB 1AROP 1U2FA 1EETB 3OBIA 4DQRA 1KR4A 4A8YA 1YJTA 3S01A 2YVSA 1FJ7A 3BQ0A 5T41A 4J37A 3G96A 1IKWA 2PIIA 3GIJA 3CDBA 4KB7A 2RS2A 1RA6A 2XB2D 1KHVA 2W4DA 2RB7A 2VFVA 2BRLA 2V4JA 3ENWA 1TL3B 3MM7A 4WYLA 1S1TA 5AJ3F 5EX0A 2GQQA 1HI0P 1HWUA 4RKUC 3P96A 5I3PA 5K9FA 3H98A 4K4WA 2CVEA 1L3SA 4V19X 1IKXB 1NNDA 4FBUA 3PW4A 2COLA 1HWJA 3FZBA 4DL2A 3OTEA 3KLIA 4KT0C 3K8WA 5DQGA 2K1RB 2NREA 4B3TF 1RWUA 2PSZA 2ASDA 1TQLA 2MQNA 2L9DA 2OSRA 2WOMA 4HEA9 1X4AA 4DEZA 4EBDA 1VQMS 4PQUA 2ZH5A 5ADZA 4IDKB 3CCES 3MAQA 2OJ3A 4DF4A 3MECA 3IGNA 2IMOA 2DRAA 4ZMMA 1RT3B 4Y2MA 5LSRA 2LEBA 1HD0A 1RTIB 1VQ6S 5D4OA 5DG8A 2YNGA 3F56A 2VG6A 3GFZA 1RGVA 2HHPA 3LOUA 4O3PA 2Y1IA 5KOXA 2PO4A 3FMBA 3VTIA 4A46A 1SJ1A 1AFIA 2JC1A 4PG4A 2VPYB 1HMVB 3IR7B 2UV8A 1IQZA 2VBXA 2XS5A 3DLEA 1Q82T 5KG7A 4OLOA 2VV5A 3D28A 1S9GA 1RT7B 4URGA 3UW1A 5KFJA 3PZPA 2BACA 4WFAQ 1ZZFA 2M52A 3T5JA 3KHRA 2UV8G 4G1QB 2V4QA 1ZAVA 5MLCV 1S6PB 2QIFA 2GQCA 2W4CA 4FVCA 1BY9A 4I6WA 5C25A 1N4LA 3OW2R 1N6QA 1M5OC 4FXVA 2CQBA 1S1WA 1JJ2R 3KJVA 1X5SA 1UWBA 4KPYA 1DQ8A 5D3GB 2QE5A 3NMAA 1JLBA 3P5TL 2ZKUA 4K4YA 1VQ4S 4GKJF 3MR5A 2B51A 2CQCA 2Q1LA 4R0EA 3R5CA 1S4FA 3JYTA 3T1YF 1GTEA 3MEEB 3BSAA 4ZP8A 2V8GA 5BYQA 3DU5A 4O23A 2AJFE 2YKAA 5KFRA 1U45A 2JVRA 2MY7A 3EZUA 4MIBA 2W7OA 2KFNA 2BYCA 4IR9A 2XLKA 1HQEA 2CPZA 3D1QA 1TUVA 5KFBA 1IN0A 3OJSA 2RSQA 1QSSA 3I0SA 2PA8D 4IKAA 3B4DA 4H4OB 5CD4H 3K57A 3K5MA 4PXEA 2DTJA 2XMUA 2HFOA 3CMES 3OL6A 2AWZA 3MM5B 2EK6A 1IKYB 4HI1A 1JB0C 1M5SA 3I4PA 2Q6CA 4JV2A 4HVZA 4YY3F 1K8AT 5F9NA 1VBXA 4DL6A 3BSNA 1E6YB 3C6UB 2E1AA 3OFFA 3SCJE 2DNGA 1VFJA 5AXLA 3P6YC 3DYAB 4DBQA 1C1CB 1S1UA 3DMJA 4C2MA 1Q78A 3OVAA 1S77D 1NAQA 2VPZB 2NPIA 5F8NA 4RU9A 3I55S 1XMQF 1S0VA 1TAQA 1Q7YT 4FYDA 3VR1A 5EWFA 2ZOMA 5DLGA 4NLSA 2FHJA 1DLOB 4OFZA 1HNWF 2F8EX 2HHUA 2E7WA 1RQ0A 5IT0A 4LF9F 1WHYA 3C8YA 1DAXA 2BM1A 5KG0A 1U1NA 2JSXA 4OZ1A 4Q7AA 4F50A 1CLFA 3CXCR 4J9NA 3HK2A 4C8LA 2KHDA 2KXHA 1S1VB 2RS8A 1OWXA 2ZC4A 1RT4A 3DRRB 2GIQA 2HHTA 1U1LA 4MYUA 4DV0F 1KQSR 5C42B 3AA9A 5E0OA 5F8GA 3HLUA 2W24A 1YIJS 2HGLA 2I9SA 3MMBB 1VQLS 1LW2A 2WB1D 3NKYA 2FJBB 5J2PB 3RAMA 3MEGA 2PN6A 2EFNA 5FJ4A 2IYIA 1UL3A 3FJ2A 4QZVB 2FVPA 1PO6A 2F4VF 5FDLB 3DRXA 4LIRA 1NK4A 1LQ9A 1C0UB 4A8QA 2V9KA 5B0DA 2IA0A 3HO1A 5A2QY 4UQTA 1KQGB 4USIA 2V8DA 4Y28C 4YB7A 1JLCA 3IC1A 5CYJA 1NRKA 4K4UA 2DNPA 4YOEA 1AW0A 3E01A 2OTJS 4YDXA 4I2QB 1U1MA 3HM9A 3MD1A 1JMTA 1FO1A 1XBWA 3ZZPA 1S6UA 2AYBA 1XR6A 2VBZA 1VQYA 2XSFA 4OX7A 4ECXA 3CVKA 4BWJA 2R2RA 2HS0A 4TU7A 4OX6A 2D3ZA 4IRCA 2HHSA 4IG3B 2QMXA 3MM6A 3M05A 2IRUA 5I42B 1S0NA 3NGKA 3BO4A 2IRXA 1D9AA 3Q22A 2LMIA 1R89A 3CCTA 3POTA 4I6YA 1UJ5A 2AP6A 3KWMA 1JLQB 1H3DA 2BV3A 2P9CA 3AQOA 3HHLA 4ID5A 1FKPA 4A8KA 4WFZA 1T03B 1R8PA 1JLFB 2B4OA 4NA2A 2DNZA 3MF5A 2ZH8A 4Z2XA 3LPYA 3CCVS 1QAYA 3CO9A 1OQ3A 1HI8A 3GYXB 5GADU 1S97A 2VOPA 3OR1B 3EX7B 2AQ4A 2GGPA 2OPRA 2R2TA 2PEHA 2XG8A 1FTRA 3CJKB 2DB1A 4LF7F 2GFFA 3HFKA 1X7VA 3K5LA 7FDRA 1Y5IB 5GAGU 2XGQA 5A6PA 3PR4A 3BEGB 1YWXA 5GMKa 2XBPA 2J9DA 5JUMA 1YGYA 1H0HB 1ZPVA 2ASYA 5J1PA 4ELTA 1N52B 4G1IA 2KJWA 4NZ0A 3SCKE 3SQGB 3RZAA 2AD9A 2DNQA 2ZH1A 4NLUA 2IBOA 4B3OB 2MMYA 4IOBA 4KIAA 1WF2A 4PCQA 4WXOA 1N5TA 1FDDA 1AXQA 3SZ2A 3DLHA 4Q45A 4NXNF 2ZVSA 4TLRA 4C98A 5KFYA 2ZKTA 3FSXA 3CSKA 3V6KA 2LQ5A 2MHEA 2B43A 3O1LA 4QIFA 5EUHA 2JVOA 1HW9A 3NBPB 3EUNA 4HL9A 2PGCA 3V4IB 4EYHB 4C97A 3QGHA 2BJEA 1O51A 2HQ3A 1KD1T 1FCAA 1TVRA 1VRUB 1H98A 2DNHA 2HS4A 3FVYA 1RI7A 5EWEA 4UW2A 5GAEU 4DLGA 3TP2A 5IS2A 1TP7A 2F9JA 3MMAB 3I5BA 2CPXA 4LSNA 3UR0A 1Q8LA 3NAHA 2GA7A 3G6VA 5IM0B 3TANA 4FN5A 4I2PB 2FJVA 2NR0A 1T3NA 4Y34A 5DDRC 4DSLA 3NS6A 2R7VA