1VI7A

Crystal structure of an hypothetical protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
LMESWLIPAAPVTVVEEIKKSRFITMLAHTDGVEAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALRQLTTQRKTPLTEYTLQCEYHQLTGIEALLGQCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yigZ
publication title Crystal structure of YIGZ, a conserved hypothetical protein from Escherichia coli k12 with a novel fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01205 UPF0029 Uncharacterized protein family UPF0029
A PF09186 DUF1949 Domain of unknown function (DUF1949)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vi7A02
3.30.230.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Impact, N-terminal domain 1vi7A01
1KTVA 4ES1A 3B8HA 4QR1A 4MYUA 4QR2A 4ES3A 1ZM2A 2XEXA 1P9QC 3ZZ0A 2BM1A 2J7KA 2BM0A 1N0VC 3B82A 1DARA 1T95A 3ZZTA 1VI7A 4ZCIA 3E3XA 1ELOA 3LH2S 4ES2A 5G4DA 1FNMA 4ZCKA 2EFGA 2I8EA 2KDOA 2BV3A 4MYTA 3OQ2A 4FN5A 3UI3A 1U2RA 4MAKA 2E1RA 4QR0A 1ZM4A 1ZPWX 4TNOA 4ZCLA 3EXCX 1N0UA 4ZCMA 3ZZUA 3B78A 2IVYA 2WBMA 2CVEA 2L9NA 4M1KA 2NPFA 2I0XA 1ZM9A 2ZITA 1ZM3A
chains in the Genus database with same CATH superfamily
4PXEA 3BGUA 3T1HI 3A13A 2YNIB 4KH1B 5JXSA 1S1TA 2IM1A 3N9UC 5JMNA 2ROPA 2AZ3A 5EUHA 3VQSA 2F63A 1E3HA 2G2OA 5I3QA 3S8SA 4B9VA 2BRKA 2RHQB 1CBKA 5BYQA 3ZZYA 1KN6A 4OMFG 5JEAF 3DLEA 4PQAA 3MMBB 1S1XA 3GV8B 1SCJB 2CG4A 2KRRA 1N34F 4PRVA 5F0UA 3H20A 4MJKA 3N6MA 1S0VA 2DRDA 2DXDA 2N7YA 3LNUA 4DV0I 3JQMA 1JLCA 4KKOB 4DOZA 1KWMA 4ALZA 1JWWA 2C3UA 2ZH8A 3ONQA 5GMEA 4FBUA 2V94A 4OJ1A 4ZJOA 2FDNA 3LO3A 3SSRA 4NMXA 5IWAJ 3GIJA 4X66I 3I31A 5F3TA 2PMZD 1FRKA 4YS2A 2GO9A 2XHWA 2YTCA 2DPIA 4I3HA 1LWFA 4DPOA 3VAJA 5A6WA 2W9CA 3CJ4A 4CLUA 4EU0A 3CB4A 2ZHBA 1HNWE 3R2CJ 4LF5J 2C2OB 3SEOA 3M8PA 1XMBA 4OV1A 2ZUGA 4RNFA 2PMWA 4WUCA 2XSFA 1N34I 5KFFA 2CPEA 2DPJA 1MX0A 1GAOA 2XYPB 5EKWA 1KLMB 4I0WA 4BA2B 2A10A 1XR5A 4DFPA 3HHLB 2NXNA 1OQ3A 2GJFA 3FCWA 4DUYF 3KK2B 2OTJS 5D0EA 4K4XA 3IA0A 3OTBA 1N33F 3JSMB 4KHMA 4YR2A 2GJ2A 2BXJA 5GADI 4ZVIA 1FJGJ 1RK8A 3Q89A 3GV5B 2MQPA 1HBOB 2F8MA 2NYIA 3CJKB 3HLUA 4ZDNA 5K8NA 1EQMA 3MEGA 8ATCB 1UDNA 4U9RA 3IRXB 5IT9Q 4RJVA 5KFPA 5KFBA 2W2QP 5A8KB 2XULA 3QMQA 2BKNA 2KDOA 3MHYA 2HURA 2CUYA 2O01C 2CFXA 1HD1A 5KFEA 4EBDA 1N6QB 2HQGA 2DNKA 1P27B 1LXNA 1OSCA 2IRXA 5CYQB 3PX0A 2Z2ZA 2JH3A 2RRNA 4NXMJ 4ECVA 1KLNA 4Q5VA 2PDAA 1WG5A 4DUYI 1B63A 2HNZB 1NKBA 4LF4J 2IVFB 2KRBA 2KG1A 1PYSB 3GR1A 1OSDA 5D3GA 1X9WA 4IQMA 4NL5A 3MR6A 5I3PA 3US5A 3IG1A 2KG0A 4ENOA 3PM9A 1JLAB 4FXDA 4ZCLA 4NZ0A 3H7HB 1K47A 1ZM9A 4C7QA 3BREA 2F7VA 4J91A 4F02A 3OL8A 4FPIA 1RT7B 5DZ7A 1DJ0A 4GVBA 1T11A 4B3MF 3FBFA 2DR9A 4F36A 3EXCX 1WD6A 4LPFA 1Y4SA 3UDLA 4DX5A 4NA2A 2IJNA 4LF7F 3IR5B 3P8BB 1NK5A 1VQ8S 1S1VB 2APOA 3VAMA 3J80U 1YTYA 2W7AA 5F9LA 4X4NA 1JJCB 5IWAI 2HS3A 4OX9E 4QR2A 1CEZA 2LFVA 2GIRA 2O67A 3AJ1A 2VBXA 4ZP9A 1KVIA 5LSOA 2UUCJ 1UVNA 3RRGA 2XLKA 3RAMA 4DR3J 3NWGA 9RUBA 1BWEA 1SQGA 1HD0A 1FWPA 2E1PA 4LMZA 2WSEC 3OXFA 3T1YI 1BHNA 4UY8T 3OR1A 2CPDA 4F4ZA 5HLFB 4X2BA 2OEKA 4B17A 3C66A 1FKPA 2PN6A 1SVDA 3ZTPA 1NK7A 2RB7A 4UOHA 1NK0A 2OPSB 2NYHA 1FXLA 3Q8VA 3SCIE 5AT1B 4LF7I 1B0PA 1IBLF 2XC9A 3E8OA 3G8TA 2XS5A 5FJ4A 4I2QB 2YKNA 3T9ZA 4WP3A 3GCMA 5I4MA 1RQ0A 2G4BA 4R25A 2XLIA 2IERA 1FJGI 4DV7F 1EETB 2LVWA 4FF2A 1C0UB 2IBKA 3NGKA 2LJPA 4K59A 3B4TA 3B4MA 2L08A 4U3BA 2E44A 2YNGB 3EDQB 4MK9A 4P2FA 4NLYA 3HULA 3MD3A 3UDVA 3TVKA 4LRCA 4PG8A 4F3MA 3PTWA 3R27A 2ZH3A 2DHXA 1HI0P 3MFHA 2YQ0A 3GJQB 4DR2F 5GMDA 1X4BA 4DR4I 4RL1A 3OVSA 4I6WA 4HKQA 2DNPA 1ZYQA 4OYPA 3GYGA 3B6BA 1FVQA 2BM1A 2V0NA 3MM7B 3VVTA 3U27A 2UXCF 5J2MA 3ETOA 1M1HA 1D0EA 4PWDA 1HMVA 4B3RE 2WOMB 3GLJA 4IRDA 1YG0A 4NI2A 2YWFA 3TW0A 2JVOA 1OY8A 4JI1J 3G96A 3DOLA 1RWUA 3DRPB 3Q8UA 4DV7I 5GMKa 2MXYA 1YQHA 1MWYA 2J76E 4IZKB 4PG6A 4DV6F 4JI7E 4UZCA 4CWBA 3CDWA 4AQYI 2V68A 3M7ND 3NMAA 1U45A 4BWMA 3OL9A 5BR8F 4GC7A 5HMXA 1W7WA 4LF6E 3BGRA 3G82B 3M2VA 4CRJA 2VJVA 5HROA 4NPOA 4J9NA 2QMWA 1T9VA 4G1QB 3OVAA 2BKPA 2HHUA 1FKOB 1RE1B 4AL7A 4HACA 2BV3A 4FN5A 4RNHA 2CGEA 1HNIB 1RWXB 1KC8T 1S9GA 2RF2A 2V34A 3U1KA 2Y1JA 2YWEA 1FK9B 3IWLA 3M4XA 3RJMB 4AIDA 4ZVUB 3BYPA 1IKXA 3DRSB 3FEZA 3O44A 2CQ1A 2UZAA 2RS8A 1Q81T 4XPCA 1IKWA 3NRBA 3JAMQ 1I3OB 3TVZA 1Y3KA 1XMOF 2JEJA 4RLEA 2V50A 1NZAA 1GMVA 1RLDA 4KGXB 2YNHA 5BJRA 1TP7A 4FKXA 2AE8A 1U6ZA 5I3UA 2G0JA 5EX0A 3HHDA 2UXDE 5CYMA 1OIAA 3NG8A 4LBIA 4LUBA 1IXKA 3BDPA 2OMOA 3IC1A 2CQPA 2Y1LB 1CJVA 5LXYA 2D3ZA 1VIXA 2J65A 1S0OA 3MR5A 4P7VA 3P3CA 4ZHRB 1FWKA 4DU8A 1HBNB 4USJC 5JUMA 2XHCA 2IESA 2KYXA 3MM9B 1S1XB 4X62E 4ZLPA 1N32E 1RHQB 2QFIA 3CW2C 4MK7A 3JQKA 2ZVIA 4LFBE 2QMXA 4ED7A 5A2QU 2EFPA 3I55S 1WF0A 1Z0VA 4EBCA 1T9YA 3D6MB 1RREA 1JLGA 3KJQB 2HBYB 2P9EA 1U2FA 1DARA 4C8MA 1XHKA 1XMOI 2VA3A 3W2VA 2VBYA 3CNQP 3CJ8A 5LMNE 3QFWA 1Q16B 1L5UA 2N4DA 1RT5A 5K36A 4Y2CA 2J7WA 2IC3B 4JI2F 3ZM7A 1OYRA 3DXBA 4PR6A 4FYDA 1IQTA 5DG7A 1K0VA 1DTQB 5L8RC 4NLGA 2Q66A 1RAOA 1G7CB 4FYWB 1AXQA 2V8GA 3K17A 4LF9F 4C8OA 1VS3A 5B0CA 3HFKA 4ELUA 1B7YB 4QIFA 3HK2A 3UHMA 4KSEB 3M8PB 1F2HA 5CCLA 1LK5A 3KXDA 2IRUA 4KYZA 4NLWA 2V4JA 1S1UB 2R8HA 1QAJA 2CQ0A 4ZVQB 3PW4A 2MSTA 3JB9k 2B56A 4OZ3A 4Y2IA 4Q45A 3JSRA 5A6PA 1BD6A 2KM8C 4A46A 4ZPCA 1SUQB 2R8JA 2OGUA 2DH8A 5C25A 3KTQA 3OQ2A 2DNGA 2KT2A 3J81Q 4MK8A 4OI0A 2ZH1A 5C24B 3TZYA 1RHRB 1FE4A 1VRUA 5E7OB 2VUGA 2HHHJ 1V3ZA 1Y0HA 3CDJA 4Y3CA 2AMCB 3C6UB 3FBBA 4JI2I 2Z57B 2HZCA 3AFGA 3D0HE 1NLKL 1GXUA 3GONA 4O3RA 1R7IA 4LSLB 1PGZA 4CH1A 2VD3A 4JI3J 3KJVA 2NN6F 3HD1A 2AHOB 2DNNA 4QOTA 2IA0A 3QIDA 2IDLA 4LF9I 1HHQA 2ZH7A 2BOAA 3LPEA 2R2UA 3PS2A 3OTOE 1RXOB 2EKYA 2F9JA 3OR2A 2AJ0A 2BR0A 2CNKB 1FX4A 3DM2A 4ZCKA 3CC4S 4IG3A 5M2PA 2J8SA 4ANCA 3V4IB 4BS2A 3TI0A 4C3LA 1SC3B 4P2XA 3IM9A 1WG4A 4DR6E 5GVQA 2B6AA 5KOXA 1IBCB 1X5SA 4ZIVA 4M5GA 1K9MT 3R97A 4GQUA 2GQQA 3O3LA 4OX9J 1LV5A 5L1KA 3M05A 3W5ZA 3EXYA 3NGRA 1SH0A 3KDNA 4DR7F 2XBPA 4P73A 3ELHA 2K7KA 2LLZA 3R3TA 1EIYB 1GH8A 4F2SA 4IG0B 1VIOA 3H40A 2OPRB 1Z0EA 3VAHA 3CIZA 2AZ1A 1IKYA 4DN9A 2KO1A 3AOAA 4URLA 1HNWI 2U1AA 3JTPA 4GVBB 3TP2A 1S0MA 4KE5A 4I68A 4TU7A 5JEAA 4QWAA 2E5IA 2MKJA 2F4FA 2V4QA 1KQGB 2XMKA 2NREA 4B3SE 1S4EA 4FWDA 3M8YA 3GYNA 3OSPA 3PX6A 5KT6A 4N5SA 2QSFA 3P5BP 2DD8S 3CC2S 3F41A 4UQTA 3NCQA 4LFCJ 5KFMA 3BN7A 1GMWA 3UFCX 5KFGA 5EDWA 2FHJD 2KKHA 3BR8A 1SV5A 4YB1P 3MEDA 5ADZA 1N36J 2HWHA 2EFNA 1QJHA 1GNKA 3BH6B 1JK9B 1Y4ZB 3PFEA 3OR1B 3CMAS 3GQCA 5IT9U 3NAHA 4IQXA 5C7PA 1FKPB 1CPZA 3HFVA 3BBCA 2HKEA 4C0OC 1R89A 1JX4A 1VRTA 1WACA 1VQLS 3MCNA 4Z2XA 1HNXJ 1KFDA 1J5EF 1M5SA 3OXGA 2MQQA 1UVMA 2BA1D 5HVGA 3FJ2A 3QAUA 1K0TA 5FDLA 2JEBB 2ZKUA 1Y10A 3NGUA 3CEDA 1HNZF 3FC9A 1BKNA 4NCAA 4A8KA 1NKEA 3TA1A 1B99A 3KG0A 5H1SV 3SFUA 2C37B 4DV5F 2HFOA 4I4BA 4HHUA 1APSA 4U8VA 3A4TA 4ZVPB 1V3RA 4ZVEA 3PRVA 1XR6A 2FGOA 3G8QA 5A8WA 2WSCC 4DPTA 2W2PP 1P9QC 2HVZA 3KNGA 2QL9B 2DGQA 1P6TA 3HHEA 4DR5J 1R8HA 4EYIB 3BH7B 3QGHA 4JI7J 1XMQF 2ALYB 3ZXWA 1RB0A 4WE1B 3R6LB 3F73A 2L9NA 4HVZA 1WORA 1VGYA 1U4BA 4CO3A 4DS5A 5EGYA 3QT5A 1X9SA 1M5KC 1DTTA 1EB0A 3VALA 1T05B 1TV6A 1N5SA 2JLEA 4USKA 3HZEA 4LF6J 1MROB 2WVFA 2EVZA 4DI6A 3HO1A 1NPKA 4GKJF 3CD5A 2G13A 5J2MB 3V6DA 4PWDB 3IS9A 4BC7A 1RAHB 2BACA 2C28A 1SH3A 2XO6A 4PPZA 4X4RA 5E3AA 1HPZA 1KKHA 4YR0A 3OFGA 3MEKA 4PYDA 4TQSA 4U7UK 2DR8A 1RAIB 4NLRA 3QLHB 2VESA 2Y0SD 1SB6A 4DHVA 1EAYC 3IO1A 4L6V3 2DGOA 3V2UC 3U1LA 5KG5A 2RVJA 1A7GE 8AT1B 2B5JB 3M2VB 5G4DA 2P2CB 5HROB 3O5TB 3O2IA 2IM0A 2E66A 2NZCA 3KMSA 1FA0A 4ZK7M 2CVEA 3DDNA 2B4PA 4KT0C 4RU9A 2G9OA 3VGSA 2J6TA 3D67A 4YHHE 1T8EA 2YNFA 2CJKA 2QV6A 3IMQJ 5IC6B 2UUTA 2OO4A 4JV1A 2I38A 3MEEA 5T14A 3TO8A 4QIGA 4X84A 1NK4A 3WU6A 2GAGC 3R1HA 1N32J 2L41A 2V4RA 1FDAA 4UY85 2IAJB 5EX3A 4FF4A 1FNOA 3DD6A 2YNHB 4ZVTB 1D09B 4DSFA 3QSIA 2YH0A 2HPUA 5I3UB 2PGCA 1HYSB 3NOCA 4J9KA 2RIJA 1X31C 2AP6A 2MZRA 4TY8B 2RDIA 2KH9A 5CH7B 1N54B 2CPZA 4FW4A 5LMNJ 2CQ3A 5ETLA 2NSBA 1C4AA 2E5LF 2QN6B 3NY0A 3D0IE 3OJSA 1QM9A 2GCFA 1K1SA 3GP9A 3E3XA 4TU8A 1QSLA 2HLTA 1RP5A 2BJDA 5CA5A 4PG7A 1S49A 2GV1A 4OJ3A 2OLWA 3OFHA 2RQCA 1RWPB 4I7FA 2QX0A 1AFJA 5L38A 5CXTA 2RKIA 1WJ9A 2M8DB 3EGZA 1AA1B 4B3RI 3MZIA 2D3O1 4MU4A 2NS1B 1NXIA 3EGVA 4NX9A 3BGOP 4I69A 2HVIA 3ETMA 1LWEA 4JI5J 4JI4F 3R5BA 2OH2A 2WB4A 4NLVA 5KFTA 1PJ7A 1WSRA 1ZM4A 3H4BA 4RUHA 2JSXA 1DQ9A 3EX7B 3MECB 4M94A 2CJXB 3J7YI 4RO0A 3QQCD 4LFAJ 3MM6B 4Y0FA 4NXNJ 1U7LA 1VHIA 2ZWPA 1KONA 4LF5F 1TL3A 2RAQA 4O3QA 3UCGA 1XNQF 2JE6B 2UXBJ 3LP2A 1H7WA 2NUUG 5KG2A 2E7XA 1SJ1A 1T02A 4FW5A 4A8OA 3QRRA 2XWYA 1HK7A 1Y7PA 3BKTA 3RRHA 2FVRA 3E01B 5E3PA 4IKAA 5DS7A 2RUGA 2LQJA 2SXLA 5GAEU 1T9UA 1S6UA 3R2DJ 1IBKF 5GAGI 5B09A 4IZJB 3OTOJ 4JI4I 2QJ3A 4ID5A 2BA0G 4P9SA 4USWA 2IYGA 4MMOA 4DUTA 2WNRA 1Y6ZA 4K0KF 1FESA 1VRUB 1ZOTA 2I8EA 5E2QA 3HVTA 2UXDI 3OHBA 3FQLA 1XNRJ 4MU3A 5C0XB 1WKLA 2VQEE 1U48A 1JQGA 1RR9A 5DRRA 2X1AA 3PYEA 4YDXA 4CLTA 1YJVA 1TKTA 1XNQI 4WWSA 4FNHA 3H59A 2LEAA 4ES3A 1U0SA 1LWXA 1MN9A 2J6SA 2FVPA 4X62I 1WKJA 2QL5B 1UMJA 3D6TB 4L75A 4NXMF 3QO9B 3M8ZA 3OR2B 2FJEB 3DI6A 4LF4F 3FSXA 4W98A 3DM2B 3OBIA 4IG3B 4LFBI 1VCTA 3GCWP 2DKOB 5F0WA 3ZFVA 4B3SJ 1N52B 3MMAA 1JNZB 1U25A 5C2GA 3R7BB 4I6AA 2CZ9A 3UPFA 2MZQA 5HQ8A 2CYYA 1FEHA 2C2NA 4K0KI 2B6AB 4I56A 5LMNI 2VOPA 2MZSA 2ZEJA 4IRCA 4PCQA 1VI7A 4YY3E 2MJUA 3OTCA 3Q1QA 1VBXA 5RUBA 2IFXA 4GC6A 2HZAA 2R8IA 2CQDA 4OYZA 2ZDOA 3JYTB 3GILA 1VQ6S 4CZCA 4QCLA 1HW9A 2C42A 1IKYB 1CJTA 1VLYA 2MY7A 3VWSA 4BCAA 2VFRA 2HGNA 2W4DA 4KV8A 3RU0A 1V3SA 2XI3A 1URNA 1FJEB 1FI4A 5L39A 1OYEA 3IXQA 4Q0BA 3H5YA 2FHOB 4E2FB 1QE1B 4ECTA 2CJYB 3FK4A 4USMA 3I9V9 5DM6Q 1RWVB 3FBCA 4KGKA 1RT4A 3MPUB 3VR1A 2E5GA 2RT3A 3KK1A 2R7TA 4FYVB 3J81U 3KLIB 4DR3F 2V2KA 1QAYA 2QLXA 3N5FA 4OI2A 3MOZA 4ZLLA 3KLEB 1HQEA 1F3FA 3TJ8A 3R1LA 3FRYA 4TY9A 1PG5B 4MU1A 4OQJA 3WX8A 4QYZK 2W8LA 1YJ7A 2PA3A 4DCPB 2O1UA 2JLFA 3MEDB 3SZ2A 3UN2A 4K4UA 2HFSA 5D6GA 1RLCL 4IFDA 3BKUA 4F2RA 3EUNA 4FS2A 4N56A 1TTHB 1EKSA 1PAUB 2GX8A 2KFNA 1UA1A 1BE4A 1D9DA 2BQRA 1H7SA 1TUWA 2KHDA 1A0OB 5IS2A 3FBEA 5KFSA 5LL6d 4OI6A 1N5YA 3MR3A 1F2GA 4U7CA 2OPPB 1E6VB 5FDLB 5A0YA 2DK2A 3UNGC 3C6TB 4I1TA 4ZPVR 1W2BR 5DJBA 2OTLS 5F8NA 5B0DA 3EVMA 3M6VA 4XPEA 2DR5A 4DR6I 1J5OA 2V2ZA 4B9NA 3AOCA 4LJMA 3MDFA 4OI1A 4ANDA 1HNVA 2XCPA 1O6XA 1YKWA 2W1BA 1TL4A 5KFDA 1TKZA 3H2LA 2Y8YA 1R8CA 3LPSA 3JSBA 2GVDB 2PIIA 3ZC4A 1IBMF 5D4PA 4ZJQA 2NN6A 3KLHB 2ACMA 2UUAI 2HHWA 4K4SA 1HR0E 3WQPA 4RW7B 2J6UA 4GKKE 5K36C 1EA6A 2J9CA 3LGHA 3ISNC 4OZ1A 1EARA 1MG7A 2V2QA 4KHPE 2EEYA 4JI1F 5J2NA 1IN0A 3DOMA 2ZNZA 4ILRA 1Z2LA 3MM8B 1EP4A 5LOQA 3IS9B 2C39B 3P3GA 1HQUB 5KG3A 1TFWA 1HI1A 1Q53A 3R5AA 2RDDA 2W9BB 1YJNS 1D8YA 3SFGA 2E29A 4Q43A 1HPZB 1YHCA 4GRSA 4HDHA 4ERDA 1LWCB 2AW0A 4ISAA 2VASA 1I94I 1K73T 1SIWB 2XEXA 3HSZA 3CULA 4DV4F 2RD5C 2I9SA 1H7XA 4BHQA 1S99A 3WHIA 5F8HA 1IBMI 3M85G 1H2UX 4DPUA 3LWMA 1H2TZ 4LRFA 2VZ9A 2BANA 3C16A 4ICLA 2VODA 1V6HA 2MDAA 3AQPA 3OPKA 2Q6BA 4MFBA 4C0HA 4DV1E 1X4DA 4FW6A 2D9OA 2DGUA 3KK3B 3LGMA 1S9EA 4DV3I 2ZBQA 4WU2A 3MAAB 2YNFB 3UR3C 3DRRA 1NHHA 4DSJA 2KVQE 2KI2A 1X5PA 5K36E 4UOCA 3I87A 2DHGA 1BQXA 3KHGA 3U1MA 3PEJA 4P72A 4U95A 2CPIA 2L9WA 2MLZA 4CO1A 3KRNA 2LECA 2MHEA 2BW2A 3ISZA 2RHSB 1NHKL 2AEJA 1WUUA 1SH2A 3U1NA 4AUKA 3I9ZA 1U1MA 4DV4I 4LRBA 4W90B 3MAQA 2R8GA 5ETQA 2LP4A 1G6BA 3W64A 1UWAA 4LT6A 4J9QA 1M1GA 1R6YA 3OHAA 2CJAA 3PJXA 3DOKA 4OJGA 2DEJA 3MAHA 2DISA 4KPYA 1V5VA 2ACYA 3VGVA 4LBHA 1WC5A 1SIZA 2YQ1A 2ABYA 2DY1A 4I7FB 1WHVA 2RKIB 2DO0A 4G1IA 3TRGA 3RZAA 4MAKA 4ATNA 4CNZA 3FFIA 1HI8A 5C0XE 4ZKAA 1LWEB 1F5AA 3SCLE 2AYEA 5JEAC 1WWHA 2ZHOA 2NPIA 1UKUA 1RAAB 4NCBA 1NJYA 4BA1B 3SYZA 4IS9A 2KN4A 2VFSA 5LJ3Y 1I51B 3NGTA 1ZAVA 5HAOA 3RBXA 2JNJA 4G1PA 1SC1B 2AGQA 2ZZTA 3R8YA 3BQ0A 1TKXA 5LMUE 2DY9A 3BO3A 2X1BA 2IHR1 3N01A 3QWPA 2IIHA 5DZ6A 3EZ5A 3PV8A 4JP8A 4R0EA 3DN9A 1Q82T 4OZEA 4M5KA 2YKMA 3BB5A 4MU0A 2DTJA 1T94A 1WF1A 4CLZA 2DNOA 4KRWA 1KBRA 4JI6F 5MLCV 2MSSA 2UU9F 4YHHI 3OFEA 3PYGA 4DV2J 4PG4A 5EL9A 3KLFA 2B9EA 2WHOA 1QTNB 4X66E 5KG0A 5CABA 3WIUA 3L9ZA 4HDGA 3RB3A 2PO1B 2HHHF 2HSEB 3NZKA 4DUZJ 2A3JA 2JFKA 4WYWA 4OX7A 1UDOA 2W2OP 5FLXY 2AGOA 1U0HB 3TWZA 2K7JA 3ZZUA 4X4TA 1QTMA 3RG6A 1G2EA 3AAWB 2M7SA 3W2WB 3PACA 1YH8A 4WUDA 4JI3F 3TUPA 3M8QA 1REVA 3M30A 4QWDA 2YKOA 3GSIA 5JEAE 3W65A 4DL2A 3LA0A 5ETPA 1N34E 5LT5A 3TARA 4YY3J 1BXNA 2ZBCA 1X8DA 1YK9A 4NCGA 3H8YA 3KDOA 5ITHA 1GX6A 4Z7CA 2MZJA 4G65A 2PNLA 2VKZG 3PRBA 1RTZA 3GIRA 4O3OA 4G6VB 3CUNA 3HJFA 5DRPA 7FD1A 3H5XA 1R8PA 2W4CA 3B82A 4C4WA 2B9WA 2WVBA 4F3QA 5ETNA 3DI6B 2KFYA 1VBKA 1RTHB 2OKQA 4NBQA 5KOWA 2HMIB 4C8YA 3LUYA 4IO1A 4O3SA 3MPWA 3G86A 3QZ7A 1K44A 1VFJA 4EO6A 4P2MA 2J9EA 2PD1A 3IWXA 5F8LA 2W25A 3MI7X 1PKPA 2R4FA 4UT4A 3DCAA 2PI4A 1WC3A 2YX7A 2KJVA 2HNYA 1B0VA 4JYAJ 1ZZNA 3MXHP 2AU0A 1I5OB 3MR7A 2HHTA 4TYBA 5KFLA 3QT7A 2QZ8A 5DDPC 3PKMA 1LW2B 3DYAB 1MU5A 2UUBF 1HWIA 4W4MA 1CJTB 1HHTP 3TZZA 4K4VA 4B02A 4KV8B 2FQQB 3E2EA 1ZAXA 2XB2D 1Y11A 1OY9A 1M5PC 4Q0BB 4DUYE 4LFCF 2A1BA 4XAKA 1N33E 3PXGa 1RSCA 1P1TA 5B0GA 1YSJA 2BYCA 2CZVC 4NLTA 4B9TA 4H4OA 1S6PA 3N5BA 1MWQA 3HPOA 1N36F 2E1MC 4NMLA 1F5CA 1LOUA 3VAFA 2AX1A 2WBMA 1Z0BA 4M1KA 4F04B 3HCXA 4B3OA 4ITSA 2VQEI 2FLPA 5HP1A 1SI9A 3UI3A 3IRWP 2WONB 1U1OA 3PS1A 2J7UA 2Y9HA 1TL7A 4RR5A 1QY7A 1HNXF 4C0BA 1C0TA 3PW5A 1UVLA 1NMEB 1B0TA 1SC4B 2O3ZA 1TUGB 1PVGA 1VC5A 1QVFR 2MPUA 2XMWA 3OV7A 3M8WA 4URGA 1Q95G 1BQNB 5K36D 1MMLA 3G87A 2WP8A 2O1TA 1OY6A 3PNIA 1B62A 3SQGA 3ISND 4GKKJ 4ZA1A 3TEHB 1RT6A 4U3DA 3T1YE 2FZCB 2OHDA 1R6MA 1NHVA 4LOMA 4KH0B 1D8ZA 4J7CA 3WDOA 2BQUA 3ZNUA 7FDRA 1J5OB 3LALA 1U1KA 4J9MA 1R43A 4DR5F 1HW8A 4MIAA 4TYAA 5J2QA 4E8UA 3OFFA 5DETA 3BZQA 1FKAF 2C2RA 3WU4A 4B3ME 1T9WA 2WVDA 2LU1A 1AZSB 2VJUA 1FFSB 2QA1A 2BJ9A 4LF7E 2QL7B 1NUEA 4ECYA 2MTLA 1Z0CA 1Y5YA 2GVZA 4LF6F 3K5PA 4K4WA 5DQIA 4HH1A 1IVZA 2M5YA 4B3TJ 1DHMA 4OX6A 3J80C 5C0XD 4IFVB 4DQPA 2GJIA 2N7CA 1B7FA 1HARA 3P5TL 2AJFE 4LVNP 5KFWA 1TKDA 3D3CJ 4K2XA 5K8PA 2QYCA 1TR0A 1CJUA 2YXLA 4KTQA 1VQ5S 1VISA 3R5JB 2VIHA 2BR2B 1NHUA 3AJ2A 4DR4E 3BBBA 1XR7A 5F9NA 2F8EX 2ZD1A 2C38A 1FE0A 2GO4A 5EHHA 2M88A 3WX4A 2W24A 3GZ7A 1F9HA 1IBLE 2DXFA 5HBMB 5HSPA 4WIQA 1JLEA 2XNQA 4KR0B 5ETKA 5AXMA 2BANB 3C16B 1UPPA 2F4VF 1RHMB 1VDHA 1Y00A 4DFMA 1Q0NA 1CJKA 3TNVA 5DROA 4DV7E 4KFBA 3QGIA 4NEYA 3I0SA 3MCOA 1BQMB 4ECQA 4HXZA 3HZGA 1N32F 3UVJB 3ILLA 1BLUA 5C42A 4L3NA 2EI5A 3DRRB 4AQYE 1N56A 2JZ5A 4WTOB 1ZH5A 2WK4A 4P6QA 4IR9A 2OSQA 3ZZTA 5JEAD 1RT2B 4ZP6A 3C14A 2CA9A 1BWVA 1RTDA 2KTQA 4DR2E 2VG6A 2FC9A 1TL1A 2QIFA 2IOQA 3FRZA 1AB8A 1HHSA 5JVGQ 5B0EA 3A8KA 2UXCE 4ANEA 2XNRA 1HR0I 2JJ4D 5L1JA 3GFZA 4PKDB 1ZPWX 2FGCA 3S6EA 3CT9A 4OYXA 2XLJA 3VZIA 5KFCA 4CQ1A 5KFRA 1L3UA 3DOKB 1FTRA 4MH8A 1DLOB 3H90A 4JI5F 1NBEB 1R27B 4KHPI 1KVJA 4DV0J 1OMSA 1SQFA 3W9JA 1SJ4P 2GMHA 3CCWA 4M5NA 2M4MA 1RABB 3CCSS 3MMCB 3R7SB 3SXLA 2ZH6A 2OP5A 2CQ4A 3D28A 4DG1A 2QA2A 5BR8E 3MUTP 3IM8A 3HI9A 4LFAF 4C3MA 4X66J 1RJJA 4AFFA 4NXNF 3KHHA 3ILOA 4KIAA 4O3PA 1KD1T 4QQBA 2UVWA 1XIQA 2HWIA 3GU0A 2UXBF 3JS9A 2IDEA 4KQVA 4YN3B 3HJCA 1FNMA 2O5DA 1XN9A 1FXDA 4X4QA 1CULB 4WFNQ 2LQBA 5KG7A 2YKQA 1VK3A 2QFJA 3AD7C 4MTPA 3CE8A 3I56S 1NK6A 3D2WA 2VPXB 2CJ9A 2HNDA 3AJDA 4DV1I 1R8AA 3V4MA 2YKMB 4IRKA 1N34J 4R8UB 1JLFA 4WYLA 2HQIA 1XMOE 2RNEA 1Z0GA 2ZVSA 4IFDC 1H6KX 2E9ZA 2H9ZA 4ELTA 2CG8A 1S57A 3KLFB 3V81A 1U2RA 5MAOA 1WEZA 3K5OA 1FFWB 5DLFA 1VYAA 3VVUA 1XNRF 3WC2A 4CH0S 4X64F 1NPRA 2OEJA 2FJAB 2FC8A 1F0XA 3LOUA 2ATCB 2XGQA 3K5NA 2B0GA 2GO3A 3BKFA 3SIPB 3M8QB 4FWGA 2B9XA 1R6VA 2R42A 2X3GA 3GG1A 4OZNA 4OZ2A 3PS3A 4TNOA 1ACMB 3L95X 1E6YA 2ZM6F 2LMIA 5KFJA 3EVOA 3LP1A 3DLKA 1FRHA 2H65B 1PC5A 2CPFA 5A2QC 1R3NA 3PDNA 2H5EA 4YB6A 2K06A 2NN6C 2VHGA 3M6UA 2R7RA 3TAMA 4U6PA 1KS2A 4HH0A 5F3ZA 4DUYJ 4JI2E 4FBTA 3K0JA 3O8WA 4A47A 5FIIA 4R5PB 1YGYA 2HEKA 4B08A 2Q79A 3QWUA 3LWLA 1NDCA 1RTIA 3C15B 4F50A 3SMZA 1ZM2A 4M5DA 4YP3A 3NCRA 4ER8A 4LF9E 2HAFA 1SBRA 5LMUI 5L9XA 4OO1F 2C3OA 3TX8A 1FERA 3WIVA 2JC1A 2DR7A 1REGX 3VQTA 4O4GA 2OIHA 3WU3A 5ETTA 1RAEB 2HIQA 2Z5CB 4K8RA 1KTVA 5T7LB 3S7RA 3KNAA 2E9RX 3LF0A 2AYBA 2MQ8A 3TYTA 4WF9Q 1QLNA 4ZN1A 2BMBA 2KU7A 4I67A 1EX8A 5H9EJ 1IM6A 1TVRB 1T03B 3RUBL 2FJDB 4LRAA 1WNEA 2HYIB 1JKHA 1SKSA 2BM0A 1GX5A 3SCJE 3I32A 2ZH9A 2VQFF 4ECUA 4H4OB 1F5BA 2ILYA 2RS2A 4KJIA 1IR2A 3DLGA 4LSZB 4PAAA 2DIUA 4UUXA 2XMVA 3R5GA 2XWXA 2BJ3A 2Z8QA 1CS4B 3T1YJ 2DGWA 3A12A 4WKRA 2WZ1A 2UV8G 1DZ5A 1NHJA 2FHKA 2EG1A 5GAHU 4RWWA 1RYRA 4Z37A 4GO5X 5KG1A 3CJTA 3W8PA 2DNQA 1A6LA 5HANA 3SCKE 1EI1A 5H9FK 1XJWB 4LF7J 3A8IA 2P6SA 4ED3A 2PEBA 2E5JA 4ZPWR 3J80Y 4YB5A 3HKMA 2PT0A 2B7CB 4QJVA 1C1CB 3EGWB 2PNZA 1QSSA 3VV2B 1RT1B 4PABA 4A8YA 2WVEA 1R0AB 2RRAA 2VQFI 3GB0A 5AJ3J 3VAKA 1JLQA 1RT6B 3IP0A 4RW8B 2W2MP 3HM9A 2V69A 2R2SA 1RU1A 1N0UA 1WEXA 5IV4A 4TKTA 2GIFA 2V63A 4AE5A 4PUOB 4DR1F 1USVA 3P49B 3UCZP 3LP0A 4C11A 3H25A 1VQOS 4L72B 2POKA 3D1HA 4ED2A 1VC0A 1NRKA 4N41A 4USHA 4IFYB 5H9EK 1NPPA 4MYUA 4RZRA 2H4WB 4XDDA 4WK1A 4DR4J 4NRUA 2AYMA 2VG7A 2BKOA 4MIWA 4WPAA 1SKWA 1Z0TA 1KQSR 1MSWD 1IBLJ 2OAUA 3M32A 3FEYB 2DXEA 2DB1A 2B51A 3LQVA 5DLGA 2VFTA 5L3JA 2KXHA 1WDTA 4WXOA 1QDUB 3GYXB 1N33I 4RW6A 1KOOA 3FUYA 4NA1A 1W2IA 3CDBA 2HBRB 3CO9A 1SL0A 1EKRA 4EO8A 5E0OA 2P9GA 4O44B 4DV7J 1CJUB 4ED8A 1NJZA 1HBMA 4U8YA 2VG5B 3NNHA 2BUNA 2X7IA 3QIPA 2BE2A 4AQYJ 3MCMA 2JT2A 5KFXA 1CC7A 2V9WA 4EBEA 4WFZA 2QLBB 2QO3A 4K50A 1ZTTA 2MMYA 5IT9C 2ZE2B 3EPIA 2J0SD 5FD1A 2C38B 2C3YA 1J5EE 4CM0A 2BE9B 1MMDA 1H38A 4YEAA 4LQ9A 5K8OA 2JOQA 4DEZA 2GMLA 1S4FA 4X4PA 3ITHA 1S9FA 1NZ0A 4IDKB 4Q44A 2XZDB 4DV5E 4CT9A 1VRQC 4FS1A 1P42A 3MM5A 4ECRA 3D54A 1S79A 3CCQS 2C22A 3KJNB 4O0IA 3PRDA 2HZVA 5C42B 3Q6MA 5E5NA 4F25A 3UE2A 2DBBA 1TU0B 3DHWC 5J1NA 2ZNYA 2RQMA 1IR1A 1X4GA 4KGVB 1NSPA 4LSNB 3OUYA 5AXKA 1XMQE 3TUZC 2KM8B 4M8LA 1T3NA 1HWUA 4B3MI 3K57A 1RTDB 1D9FA 4I2PA 1WF2A 3QT8A 3KOAA 5BR8J 2XMTA 2KZZA 3AQOA 1C1BA 1TL1B 1UWBA 2XGPA 2R7OA 2MLXA 4C2MA 2Q6CA 5K14A 1JLBA 1WTBA 3RAXA 2ROGA 2HK2A 3QJPA 3A8EA 5KT4A 4GKJE 4WBFA 3GJTB 3VAIA 2ZWOA 3GJSB 2WTFA 3QGPA 1VR6A 2HQFA 3PVXA 3GMEA 3CJ3A 1Y5NB 1YX2A 2L9DA 3N6LA 3IWNC 1UFKA 2DNZA 3OSNA 2ERRA 3TA2A 4ZITA 3CJSA 3PHEA 4F4YA 1OYDA 1Q8IA 3DKDA 1K8AT 5IOLA 4IFDD 2AX0A 2XS7A 3G4SS 4ZOSA 3CCRS 3AA8A 1XMOJ 2WSFC 3HFZB 2JLGA 4XTTA 1M1KT 3T6JA 4B9MA 4DG1B 2YX1A 3ZZOA 4OHZA 4ZCIA 1OPZA 1JXEA 2LEPA 3KLGB 3OJUA 2XCAA 1GTHA 2KXFA 4CYUA 4DZ6A 2ADBA 3L4BC 3K59A 2DHHA 1U1LA 2ZOFA 3T5KA 2BDPA 3BJYA 3JTNA 4YFUA 1IBLI 2HK3A 2RQ4A 3MMBA 2NXCA 4WFYA 1S7HA 4J37A 4C8NA 3D0GE 2Q2EB 4W92B 5DM7Q 4DV2F 5BYSA 5CD4A 4KKOA 3D7SB 1N48A 4MT1A 1Q86T 2JEGA 4IH5A 2HKJA 5A2QY 4N76A 5T41A 3K5MA 3DMJB 4DUZF 4DX6A 4QWCA 3W60A 4UOFA 2QG9B 1R8BA 3ET6A 5B7WA 2BJEA 4PRFA 3K8WA 2A2CA 1YJ9S 6FDRA 3V81B 2I0XA 1RA7A 2UP1A 4CM2A 5IQ6A 3PR5B 2NN6D 1SL2A 3TVYA 2R7WA 1UETA 3IBFB 2ZHAA 2VDIA 5DRKA 3THVA 1RCXB 2QMUB 4DR2I 1NSKL 2GZOA 2B43A 3I0RB 4QR1A 4JI2J 2E5LE 2FB0A 4WFAQ 1VK8A 3BQ2A 2OD4A 3U7JA 1X4CA 2YBVA 4A48A 4FNIA 1HL6A 3LAKA 3MPDA 1JJHA 3GIMA 1HWJA 2UXCI 3KFWX 3QFHA 3RTVA 4LF9J 1Z59A 3TA0A 4BA2A 2R2RA 3VCDA 4DL7A 4FDFA 3HHLA 3ZTSA 2YKAA 4FVCA 3KG4A 1VQ9S 1IKVB 4ZJLA 4JI4E 3Q6NA 3QNWB 1F60B 3LP1B 1EQ0A 3RB0A 2IMWP 4JV0A 3KK2A 3CD0A 1A6FA 3JSMA 2AIRB 4DV6I 2YPZA 3FQKA 4F4WA 3HVWA 2CPJA 3TUIC 3K58A 1HBOA 2FYXA 2GAHC 1WOSA 1X7VA 1S1TB 5BR8I 1AUDA 2WBRA 4LF5E 4JYAF 3W3SA 2MHNA 3EDRB 1X4EA 4LCGA 2ASJA 1XNQE 5HVHA 2EK6A 3IRXA 3H4DA 4M5DB 4EFAC 1NK8A 2IJRA 5A8KA 4ES1A 3DLEB 1VQSA 2H51B 4IOCQ 1YBTA 3BEGB 2NR0A 4RW4A 2V6AA 3QSYB 3W8GA 5HQMA 1F3VA 1OWXA 4O4GB 1HNWJ 1N6QA 4FW9A 1OQ6A 3OTEA 1BGXT 5CYQA 5HL7Q 1JLCB 1IBKE 3ZZRA 2HNZA 2U2FA 4CT8A 1N5QA 5KFZA 4F67A 4K0KE 4K4ZA 2GW8A 3L09A 4JG4A 5J1EA 4RNMA 1UEKA 3R5CA 1NO8A 4IFDF 2DNLA 1D9AA 2ILZA 4MYTA 4OZ5A 4CLKA 1UW9A 1HIYA 1LWFB 4URQU 2W9CB 2AWZA 2N3OA 4FW3A 1RT7A 3KLVA 4QU7A 3LANA 2AT1B 3K85A 2MQNA 3GCXP 4LRDA 4X65F 4CP5A 2R3VA 4JV5F 1M0SA 2PSZA 4NA3A 3CDEA 5IQQA 4PQUA 2PC6A 2VB6A 8RUCA 1WHXA 4J3DA 1DRZA 4NXME 4QIEA 1S1VA 4LF4E 3KJFB 2XMAA 3FSYA 1NAQA 1TQLA 2CPHA 4JI0F 3BYRA 1UDQA 1MLAA 2ZOGA 2ZBIA 2HGLA 2V8DA 3R7NB 1PSDA 1RTJA 2EKNA 4QNKA 3Q8PB 2HVHA 4ECSA 4FF1A 2E7VA 2QT7A 2ADCA 3G9CA 1YITS 3GSDA 4KB7A 4DQQA 1T0TV 2QSWA 4N8OA 1H74A 3ZKDA 3T41A 1U2CA 5HLFA 4Y28C 2CNOB 3MEGB 2XMJA 4J9PA 2AQ4A 2MJNA 3MFIA 4V19J 3OW2R 1QD1A 1WG1A 5IT9Y 1S12A 2V8VA 5AXLA 1DY3A 4DSLA 1S5ZA 4X65I 2OPSA 3D6FB 3CDIA 1S59A 3LP0B 2Z5BA 4DMZA 3DDKA 4B9UA 3SI8A 4B3TF 4CLLA 2BBEA 3QYYA 4I2QA 3ZTOA 1WOPA 2N82B 4DR3E 3KYLA 2VG7B 3MTJA 3CDAA 2KJWA 1Z5AA 1KNZA 1YRTA 5M2UA 1NSAA 2VA2A 2GA7A 5KFKA 1EETA 3SSQA 5J1PA 4NZ6A 3UW1A 1N8RT 1C0UA 1ULRA 1Y5IB 2M3DA 3PCOB 2RU3A 4LCFA 4F3OA 5D3GB 2EW9A 4C9DA 1JB0C 1OO0B 5ETMA 4IOBA 2FTRA 1FCAA 2YNGA 3IG1B 4LF8F 2Z58B 3E51A 1NJXA 4NLOA 1NDLA 3UDCA 3CCZA 1Y5LB 3J81j 3PYFA 4Y2AA 5I42A 2J0XA 2UUAE 2BE2B 1EHWA 3Q83A 3VTIA 1FD2A 3SV3A 5KFAA 4OO1A 3RR7A 3T1AA 3F44A 4ZN3A 3Q24A 1XMQJ 3PKYA 3CCUS 1AT1B 3MM7A 3AOBA 3MOJB 5C2CA 4CH7A 3PY8A 3LW5C 4OHVA 5KFQA 1NZ8A 4NRTA 2V5HG 5IV3A 1O8BA 4PRXA 4JI8F 3BM7A 3SDEA 1Q8LA 2WOMA 1RWKB 4OHXA 1NB2A 1WOOA 2DHSA 2C3PA 3CSKA 2ZKTA 4BWJA 3DRPA 4KC5A 5DGBA 1GXLA 2MQMA 4CLFA 3DRYA 1RUSA 4PG5A 4E98A 4IZKA 2FD2A 3UD5A 3MM5B 4IR1A 4ED1A 2CDRB 3MURP 2I6WA 4LF8I 4DR7I 5D77A 2IYIA 4A8MP 3T1HF 3OT9A 1RISA 1M5OC 1I94E 1MNEA 1YJWS 3AD8C 4WK3A 3HX9A 2LEBA 3GPAA 4DFJA 2G1DA 4OI4A 3V5RA 2DNYA 3QGGA 1IBME 4AXIA 1WC4A 1Y4UA 3NXZA 4OZ0A 4MKBA 4G1QA 2O1VA 4LVOP 3QT6A 1FKOA 4ZMMA 3HT3A 2IRYA 1KP6A 1N5VA 1C1BB 2AJ4A 4CO5A 2CDQA 3AHPA 1HNIA 1WC6A 5K14B 5IZHA 1JLBB 5GADU 1CC8A 4XK8C 3NAIA 4DV3E 2ZH2A 2GHPA 4JI1E 1FK9A 3GIKA 2YKNB 1BUXA 2PO0A 1FFGB 5KT5A 3DRSA 4DV0F 2NPFA 1X4FA 4F4XA 4CLSA 4J5OA 2OUGA 3CJ5A 1N4LA 3ZTQA 2R8KA 2MB0B 4B3RJ 6FD1A 4PXCA 2HHVA 2OEMA 3GTYX 2R7QA 4LREA 2DT9A 1S6QA 2LKZA 3I4HX 1OYSA 4DV4E 2LA6A 1GEHA 5L9NA 1X60A 4DL6A 2JX2A 1TAQA 5DG9A 1RBLA 3VF0B 3CF5Q 2XZTB 2QE5A 4H4KA 4OLPA 3DU5A 4CYUB 4ZHRA 2Y1RI 1HBNA 4Q8EA 1J5EI 1UZDA 1GK8A 2D9PA 5B08A 1V9OA 3HD2A 3MM9A 4FKYA 5E33A 4ZVGA 4ZVRB 2E5LJ 2LDYA 5IXUA 1IM4A 3UR0A 3RR8A 1HNZI 1HMVB 3NS6A 1RHKB 4NI2B 2DGSA 1BC6A 3G6ES 4C6AA 2K8GA 4AD6A 3DOLB 3M2UA 4DV5I 4CLPA 4LF1A 1P9YA 5CAAA 3PYDA 3ET6B 1VQKS 1JIHA 1Y3JA 4JI4J 3SBMA 1NK9A 4H4MA 2IC3A 1SC6A 3M7VA 4C98A 4PXDA 2BJ8A 2UVVA 1DTQA 5C5JA 5DG8A 3Q8YA 2UVRA 1XMQI 5D4NA 1YBAA 3MPYA 2R9LA 3BGRB 2UXDJ 3BSAA 4PU9A 4OYIA 5E41A 2HIYA 2IOPA 2HRUA 4HACB 5ETRA 2H3EB 4PXBA 1XNQJ 1YDLA 4M5JA 1S1UA 5KT2A 3T3FA 2RE1A 2QA4S 4GKJI 1S9GB 2RF2B 4EYHB 2X51A 1UDSA 3MCSA 1GTEA 1AROP 2YWWA 1IKXB 1HBUA 2W9AA 1S1WA 1SUQA 3JAMY 4DFKA 1IKWB 4X62J 1NJWA 4YMEA 3RRKA 3D1OA 5D15A 1T95A 5JVHQ 5C24A 1PYTA 4J9OA 1VQNS 4LFBJ 1D1UA 2CQGA 4F4AA 2VFUA 1VQ7S 1IBKJ 3C6UA 2BOPA 5CYMB 1YWXA 4LR8A 3T5HA 4K0KJ 2J8AA 1CJVB 3RW7A 4LSLA 4TLQA 4J9RA 3GFXA 3L7PA 2FZGB 5EWEA 3W5XA 5B0FA 3TX0A 2XMUA 4UOGA 4Y6IA 2VPYB 3V6KA 4V1Ak 4M95A 4EZ6A 3TOQA 4JI6E 4RW4B 2UU9E 4QW9A 2NSCA 2FJVA 2QLFB 3M8SA 2ZH4A 4D3GA 4CDIA 4WKYA 2F1DA 5IWAF 2HHHE 2AV5A 3V4IA 4L73A 1JLGB 3BR9A 1KSPA 2RJZA 2ZJPQ 3W2VB 1SPBP 2NLWA 2XYGB 2Q43A 5K9FA 3CCES 1QSYA 4OZLA 1RT5B 5K36B 4HYKA 5J1EB 3NLCA 1FEEA 2G2YA 3T1YF 4JI3E 4L3KA 3NKYA 2F3JA 3T5LA 4IG0A 4QZVB 2OPRA 4QYRA 3AXMA 1W25A 4WTYA 2E5LI 3PZPA 4DSEA 3D68A 2W4PA 2HW3A 3HVRA 3BGFA 1U09A 1TUVA 4K2JA 2AGPA 1ZM3A 2MKKA 3G6YA 4UQGA 3P76A 4J9VA 2B3TB 2GC8A 4PQUB 4M63A 1J27A 2V4JB 5L1LA 4KO0A 2EG2A 4CLWA 3JAMU 3JTOA 4CI0B 1X5TA 3CJ0A 2E1RA 3IN5A 4RW9A 4N77A 3C3LA 2Z2YB 4QBUA 3AD9C 2XZWA 3J81Y 5C25B 4IO9Q 4P75A 2HBZB 5AJ3F 1FJGF 3R5DA 1QZRA 4WFBQ 1RTJB 2CNNB 2Z4PA 1RCOB 2L48A 2QRRA 2Y8WA 5AE1A 5SUHA 2ZJQQ 3I5AA 2OD6A 4K5RA 4DR6J 3FGVA 2YPYA 3ZZZA 2IA6A 1IWAA 3K89A 4LF5I 3TZWA 2VICA 2CVIA 2QLWA 1R0CB 4XDCA 3CCMS 3ZKBA 1UPMB 2UUBE 2VPWB 3KJVB 3NNCA 3I5BA 1CVJA 2JC0A 4HEA9 1YJUA 5DQGA 4DR4F 1SJ3P 2YWHA 4A8WA 2Z5BB 2UUAJ 4KHRA 4USTA 3L7UA 2J0WA 4LFCE 5HATA 3CJ2A 1KR4A 2JEBA 3KUHA 4M5LA 4U67Q 1PC4A 1IBKI 2ASYA 4DWIA 4OV6A 2CIMA 4ZVFA 1NNDA 2I1RA 1JXVA 5KT7A 1ZTWA 3EZOA 2C37A 2M9KA 1N36E 1XTZA 5FLXC 2M70A 2VKRA 1VOMA 3HHKA 2HWTA 2ZC3A 3ZTRA 4WP9A 2JWNA 4AQYF 2QGFB 3MMJA 4B9LA 4QNJA 2ZZNA 2GIQA 4WCEQ 4KGZB 2GGPA 5I42B 1HNXE 3CJRA 3DLBA 2DEIA 4WE1A 2MKCA 2Z0GA 1I94J 4HLBA 4GMKA 5ELWA 5JEAB 5HK4A 4QWBA 4OLOA 1T05A 2CKWA 4OO1B 2NZ4A 1IBMJ 3OXLA 1MROA 3L7OA 2YQ3A 4NXMI 3R9LA 5LL6R 3PO4A 3HKWA 4WU3A 4LF4I 2UUCF 2H5IB 1VQMS 4FZVA 5F8MA 3SDEB 2H4YB 3HSGA 1ZXNA 1WI6A 3RYLA 4DV3J 2OFGX 3W9IA 4DR5E 2HBQB 1SV5B 2QTWA 3MGJA 3GFHA 1HQ2A 2HVEA 2DCLA 1FKAE 1OS5A 2Q1LA 2R2TA 3UO0A 4P2SA 2EWHA 3UDEA 3QLHA 3HHLC 5GAEI 5KG6A 3D5MA 1XBWA 2MKSA 4OHYA 3BO2A 4JV2A 4YUDA 4C8KA 2QC3A 3S01A 1R31A 2B5JA 4RUCA 3AODA 3KKFA 4ZVSB 3FZ2A 2LA4A 4WXWA 1VRTB 3B54A 3PG9A 4DV4J 2Z2LA 2Y3YA 3C19A 4M5IA 2R7VA 3ZO7A 5EWFA 1NSQA 2I5JA 2GFFA 2IM2A 2UUCI 4DR3I 4ZP8A 2PO0B 3K7RA 2P9CA 2DNHA 2P8IA 2CQBA 2BW7A 2BJ1A 4EK2A 3PX4A 2IAJA 1W26A 2CRLA 2C2KB 3MWBA 3SQOP 5A8WB 2V8PA 2Z56B 2W7PA 3BQ1A 1HYSA 3M6AA 1S6QB 2D74B 3PW7A 4TY8A 1HWKA 3FKBA 2OPQA 5LXRA 4OJHA 5FWKA 1QUPA 1PJ5A 3HSDA 4I64A 5E3CA 4ECXA 1USUA 3K2YA 2F8HA 1K1QA 2F4VE 1DTTB 2O1WA 1TV6B 2W2NP 2HHPA 4Y2KA 3M1VA 5ETVA 5LM7E 4PPDA 1Q4RA 3QZ8A 4P74A 1V5IB 2LQ8A 4TU9A 3DNCA 4QW8A 4CO2A 3Q22A 3V6DB 3N0VA 4YOEA 2CWKA 3NP5A 2VONA 4DPYA 3OLBA 1Z2ZA 4YHHJ 2WRMA 1YZ7A 1YI2S 4DQRA 4RBUA 2EC2A 2IMOA 3M2UB 3BBFA 3MECA 2M0GB 2N4CA 2VH7A 3Q8RB 4H4MB 3MM6A 2G2ZA 2MLYA 1VC6A 4DQIA 1UL3A 4ZIWA 3ULHA 1N5TA 4O4RA 3KUEA 1IJFB 1GXTA 5A76A 3H0PA 2JE6A 3S1TA 3P96A 3GFYA 1VMBA 1WC0A 3AH6A 3THPA 3PR4A 3G6VA 1LK7A 1M5VC 5F8JA 1U1NA 4ZPTR 1MU2A 2BEFA 4JI5E 3E01A 5CQGA 5F8GA 2V2VA 4JI1I 2GQ0A 3H98A 2EFQA 5ETSA 2QYGA 5DGAA 1U1QA 2J7KA 4HT7A 4IZJA 5IM0A 2MZ1A 4DPXA 1HBUB 1S1WB 4JI6J 3MEEB 3PIOQ 1FRJA 2UU9J 3HDSA 2BJ7A 4LFAE 3OD2A 5E3RA 2DCUB 2GQ2A 4NXNE 1KVKA 4CLYA 4ECZA 3AY0A 2JEIA 4NOHA 2UXBE 5C0XA 4K5SA 3EWGA 1F9EB 3BSNA 1VHFA 4RX6A 4JBCA 1XK8A 4PWUA 3OL7A 1HNWF 3KHRA 1YJTA 5E3QA 1S72S 2DIVA 2AF6A 6AT1B 5KFIA 1B3TA 2LDIA 1HWLA 3QO9A 3NBPA 3FDSA 4NZ7A 4QIWD 1QAXA 4I6YA 4N8NA 4OO1C 3BPDA 2CNLB 4U7UD 1UJ5A 3MF5A 1XNRE 1NCLA 4A8QA 4X64E 4EWTA 2HS0A 4DSIA 4FP9A 3KHLA 4DLEA 1SJFA 1S76D 4OI3A 3J7AM 2PA8D 1R0BG 2DNRA 3B78A 4BDPA 1YRUA 3GIIA 3QATA 4AT1B 2MKIA 1U24A 1U47A 2HQ3A 2J5AA 5BXIA 3M8RA 1PIEA 5KFVA 3LPYA 1P8GA 3AA9A 3JYTA 1TL3B 1FWLA 2KZMA 3FSIA 2VQEJ 3LP2B 4O0NA 1UFWA 4RNOA 2JVRA 3BSOA 3UNYA 1OPIA 4ETZA 1Y9OA 3O1LA 2ZM6E 4NWBA 4EEYA 3GR0A 3NWRA 4DCJB 1QE1A 1D3WA 2HFUA 2UUBJ 2EK1A 4J9UE 4KO0B 1U6BA 4YQWA 2HLUA 3KLIA 2R7XA 4RW9B 2GQCA 1FRMA 1YZ6A 1UW4A 3HXMA 3KLEA 2LU2A 4ID5B 2D69A 1FTCA 1RKIA 2C2DA 4YB7A 2WNRB 1GMUA 3HP6A 3HVTB 4WUBA 1FRXA 1BY9A 3NS5A 1B4SA 4WFXA 1TFYA 2NCKL 2Q3PA 1ZZFA 3CVKA 4OO1E 4RBTA 3P45B 2IPOB 1Q8KA 3JQJA 5JJBA 1FD8A 2LCWA 3RBDA 3EICA 1TKTB 3A3NB 1LFWA 5HO4A 1IQZA 3Q8QB 1CQMA 1LQ9A 3THTA 2MQLA 4HL9A 2EBGA 4HYMA 2BVZA 4JI6I 3W7BA 2BQ3A 2XMMA 2JHEA 4PEOA 1GQEA 1Q5VA 2UU9I 2YVSA 1NKCA 2OPPA 1KOHA 5D0HA 1KHVA 1E6VA 3ICLA 2D41A 2NXJA 3C6TA 3W63A 3FCHA 2VQFE 2XM3A 2HHHI 1DFDA 3MMAB 4OX9F 3CPWR 1CG2A 4H4KC 1JXLA 2FLNA 2Z5EA 3CO0P 3N79A 1MMNA 2H54B 3WBZA 1ZA1B 2JEAA 2P5VA 3BV8A 2V8HA 3U1YA 4QIVA 1XQIA 4X4OA 4AYBD 4JI3I 2EXUA 5B0BA 1EJ7L 1OJ4A 2VC1A 2GVDA 2XSJA 2FVSA 3K1JA 4DZDA 3CWJA 4Y2MA 4F0KA 3M9MB 3HHLD 4BLGA 4CTAA 3KLHA 2VBWA 4GVLA 3G71S 2GGPB 2CQIA 2RQKA 1HKAA 3FNNA 4ETXA 3JXOA 3NNAA 4IH6A 2KFZA 3VGUA 2F40A 4RW7A 1RWOB 2DYAA 4UUWA 2BA9A 3J7AN 4WJBA 1H72C 1RT4B 1VQ4S 3J7YU 3KK1B 2FJWA 4KQZA 3MM8A 4TVAB 2YWGA 1KTQA 3IFEA 5AE2A 4OX9I 1Q8BA 2C39A 1WTFA 4NE9C 4ZPDA 4EMDA 1U1RA 1HQUA 3QJJA 3RW6A 1PO6A 4BC9A 1HQEB 2DGXA 3Q2TC 3HHNB 2J9DA 2W9BA 3IBCB 1UTAA 1IJEB 3FZBA 2LXFA 3HSJA 1LWCA 2RSQA 3TAPA 4DR1E 2DNMA 4IFDB 2G0CA 3PW0A 2YY3A 3H5UA 1MW7A 3OVBA 4DL3A 2UUBI 1B70B 2MKHA 3MUMP 4P52A 4ZS6A 5GAGU 1FDNA 3DGPA 1TAUA 4FPRA 1L3KA 2B4UA 3FMWA 3JSYA 1T9TA 4F0HA 4HHHA 1H0HB 1WI8A 4WIIA 3HJVA 3UN5A 1N5YB 4LFCI 1LEOA 4QPTA 4D3HA 1FRLA 3K5LA 4YR3A 1HR0J 3KK3A 1DAXA 4HTIA 3L3CA 2I5JB 3MAAA 5A0YB 5KG4A 2F4VJ 1XC9A 1WDDA 4B3RF 4UZBA 1SJQA 2ATLA 4HHJA 3U02A 1JMTA 4KHPJ 1N36I 3BO4A 4C3KA 3NOGA 4KPCA 2ZUAA 5HVFA 3CCJS 1HNVB 1S6OA 4JI7F 3F0NA 1C4CA 4WZMA 4AXJA 4E0DA 1TKZB 4NYZA 3WZ0A 4JUZA 1FDBA 2DITA 3UQSA 2UVUA 3HMJG 3Q8SB 3OTDA 3P3EA 3F56A 1HNXI 2NN6B 3PFOA 4DX8H 2OPQB 3QRPA 1RWMB 1LNQA 4TXSA 4Y34A 2PMHA 4RUAA 5DDQC 2AJQA 1ICEB 4QU6A 3UN3A 1WKKA 2NQPA 1Z4UA 4XO0A 1Q1KA 2RILA 1RZMA 2EFOA 3LGNA 3M1VB 3MTKA 1DBDA 4USVA 2CADA 5J2NB 3DOMB 4DV1J 1EP4B 4DCOB 1KRPA 1RBAA 2COLA 2VF3A 4F0MA 4J9SA 4DR5I 1S0NA 4UW2A 4BA1A 4Y65A 4JI7I 1F1BB 2CG9A 4DL0C 2UXDF 2D3UA 3QRQA 3IAS9 1KIJA 5AXNA 3NL0A 2PFDA 4LF6I 3HF5A 4P7TA 3ZNJ1 1TMJA 4NYPA 4RBVA 4ICLB 3CCVS 4MFBB 2CQCA 4LR7A 4QWEA 2IVYA 2DH7A 3N28A 2O3DA 2B9YA 2LYVA 1URRA 4X62F 1PBAA 1MU2B 3TEGA 2XS2A 1S9EB 1AUSL 7AT1B 2KT3A 2EC0A 2LXUA 2KYZA 4LFBF 2YX4A 2PO1A 5IM0B 2PNMA 2YKPA 4LIWA 1U0HA 1HFEL 1ZAWA 4DPWA 1YRXA 2P6TA 5FLXQ 4DBQA 4OO1D 1HLWA 1X5OA 5LMNF 2VU5A 1C2PA 1ZA2B 3GMGA 3W2WA 4A4JA 5HMZA 2ZITA 3CCLS 4DX7A 1J2VA 4X64J 1DURA 2MZTA 4AIMA 4QYZJ 2ZOMA 4OYOA 4BBYA 3EE3A 1VJWA 1GMWD 5HMWA 1KHWA 5LMUJ 2F4VI 1DQAA 2CPXA 1U02A 4DV2E 3BF4A 5IC4B 1AW0A 2ZC4A 4KY3A 5KT3A 2JL9A 1WHYA 1TK8A 2EFGA 2HFVA 4R1FA 1ZBTA 3NS7B 4DUZE 3RGIA 1N32I 4DV6E 2ZM6J 1VLOA 3PRYA 3NBPB 1UEVA 3CXCR 3EVWA 4OHWA 3FFIB 1RTHA 1RAGB 2CJBA 4LR9A 2HMIA 3G8SA 1NH7A 1KEKA 4LCHA 3NMRA 5CCMA 4XTJA 2HRTA 2HG4A 1UFLA 1NU4A 3WC0A 2PO2A 2I2YA 4FF3A 3TZXA 1JNRB 1VBYA 1FHTA 4PWWA 3P4UB 1TKXB 4QR0A 2MQOA 2VOOA 1BMQB 4DDFA 5LJ5Y 4ES2A 1LW2A 3DYAA 3P06A 4Q7AA 4MQYA 2PI5A 2QLJB 2O1PA 3BN4A 4USIA 5DQHA 2XTJP 3BDEA 3W66A 3TUJC 1AYEA 1PKUA 3I96A 2AJ1A 4OL8A 3CMQA 1TMMA 4P7AA 2WW4A 1CSJA 2K2PA 2Y1IA 3D1QA 1GT8A 3OTOF 4JI5I 2OFHX 2Z30B 4IH7A 2BABA 1YJRA 2FY1A 3W1YC 2HRYA 1S16A 1YBUA 4CO4A 2FVQA 1Q5YA 1HA1A 2UUWA 1PCAA 4DR6F 4LFAI 2PE8A 3POTA 4JYAE 4NXNI 3RAQA 2VQFJ 2XYHB 3ENQA 1Z5BA 2UXBI 4DF4A 1REVB 3M30B 2HFZA 1Y60A 2C2EA 4GO7X 2WONA 1WSVA 5L1IA 4OYBA 3DHXA 2UUAF 4NCGB 2W01A 2OI2A 4ZPAA 1WELA 3IR6B 3J7ZT 4B3SF 5DNLA 1BQNA 2M8HA 3OTOI 3KUGA 3DDIA 5LSRA 1Q79A 2OJ3A 2BZ2A 3M7NG 3FCVA 4LBPA 4OYWA 1ROFA 3UD3P 2B4OA 2F5GA 4MDTA 2V67A 1RKJA 2C2ZB 2D7SA 1N33J 1XNRI 1RADB 1FXRA 4IFDE 4X64I 2F1FA 2X36A 3GWCA 2FHMA 2CQHA 3NGDA 2JEFA 2JEAB 3A8JA 4X65E 2HNYB 3C8YA 3OLAA 2AEMA 1I94F 4JV5E 1AZSA 2FVCA 2HHXA 1RAFB 3A3OB 2XSJB 1S77D 2CXEA 4CTAB 3D66A 5CZVA 1N0VC 3I82A 4DR1J 2HS4A 4U96A 2ZM6I 3T6BA 2OSRA 5D8HB 4JI0E 5HN0A 4B3SI 2RUSA 2AEFA 4DLGA 2EBEA 1WEYA 2ZH5A 2DVIA 1SL1A 1WC1A 4IFVA 2MKYA 2GMJA 3QBCA 4DV3F 4LQ3A 4F7VA 4HR2A 1O0PA 4TQRA 4K4YA 1RHYA 1H98A 2CWXA 1GFWB 2MGZA 1S6PB 2FIUA 3IBWA 1FF2A 2GNKA 2C2MB 1TL5A 2JDJA 4PYAA 3CDUA 3DU6A 2NN6E 3IR7B 3I4PA 5A8RA 2BR2A 1OYPA 4B3OB 4ZCMA 5HP1B 2DR6A 4RUBA 3G2XA 4F8RA 1TL7B 5HBMA 4B3MJ 4B3TE 1RT3A 1C0TB 3RB6A 1NJIT 1NEEA 3DGPB 1UAWA 4C48A 4F26A 3DFEA 3TQ1A 2ZFHA 3VHQA 3LAMA 5CZXA 3H2UB 3QAEA 2ROEA 3MR2A 4C97A 5C0XC 4ZPBA 2WP8B 1H73A 1BQMA 3SQGB 2UV8A 2MY8A 2RRBA 3UVJA 4RWXA 2IM3A 4LF8E 4DR7E 2HGMA 4Q2LA 2K1RA 3PW2A 3V6JA 3RB4A 1TZ0A 1X4HA 5D4OA 1RT2A 2KB2A 1LKZA 4A8FA 5KFUA 4FYYB 4ILLA 5J2QB 2HFNA 1YLXA 3QJLA 1O5JA 4DQSA 4P10A 1FNXH 1NM2A 3D6HB 3T5JA 1U49A 2Y0BB 2JRSA 1M90T 2IY5B 3EGNA 1KFSA 2GVZB 4NASA 4L74A 1ITPA 4JI8E 4A8SA 2B8PA 2ZDPA 3PJWA 4ZVHA 2A2DA 1DLOA 3DLLQ 2MEWA 1VQPS 1IWGA 2A0FB 4UTGA 4YHHF 4TLRA 2XQCA 1KQKA 2A6MA 5IFMA 1D6TA 1YIJS 4JOUA 3PO5A 4MKAA 4B9SA 4A8XA 3LTOA 3T1HE 3MMCA 3OL6A 4C8LA 4IOAQ 5HJXA 3ZZ0A 2C3MA 4OKGA 2BA0D 1RWNB 1FX2A 4DF8A 3PJ9A 5G0RA 3H42A 3M2RA 2WAQD 2H48B 4DR1I 5K20B 3NGSA 1CLFA 2ZD1B 5ETOA 4ED0A 1CQNA 1CULA 1G4CA 1UVKA 1QVGR 4DR2J 1XEZA 4CNYA 1JLEB 2QA4G 3EPGA 3M9NB 1HNZE 5LSLA 1NH8A 4MKYA 4DV0E 1TELA 1CJKB 4R8UA 2UXCJ 1H2VZ 4KFBB 2F9DA 3I0SB 4RKUC 1JJ4A 5GAHI 2Z2MA 5DNXA 1P1LA 3AB2B 3CGIA 4V19X 2NXEA 2ZJRQ 3ENVA 1FVSA 3L7ZA 4NYOA 4N7TA 1A9NB 2CQ2A 2LQ5A 2RH3A 1L3VA 4DV6J 1Z1ZA 3C14B 4YDDB 5J2PA 3PHTA 1RYSA 2DRBA 2AD9A 5F8IA 3KMQA 1E3PA 2VG6B 1RDRA 5D0GA 2FZKB 1SXLA 3EYZA 1ZXMA 3J7A1 3FVYA 2B8QA 3X3UA 2ALZA 4RNNA 3DLJA 1PAEX 2AKWB 3D4JA 1QAIA 3SV4A 3FEXB 2G0IA 4DXLA 1VJQA 3I6PA 3A1YG 4Q8FA 1LW0A 2W7OA 1Z5CA 5HI7A 3D9BA 2E9TA 3B4DA 4O3NA 2MYFA 3T19A 5KFYA 2XI2A 1T3OA 3N4WA 4MIBA 2FJBB 4IUFA 3TAQA 2OMLA 1F9FA 4Z7YA 3PEHA 3P6YC 1PILA 2VL1A 2YNIA 2GS8A 3H4LA 4ED5A 4EUVA 4R5PA 3P3DA 1I6JA 2FUG9 3DGVA 3C15A 4OZJA 3UD4P 3QPIA 2PO2B 2JFDA 4OYAA 2ASDA 2VQEF 2IJFA 3AXKA 2FHJA 1RGVA 2BA1G 3T9NA 4DSKA 1UEUA 1H7UA 4OIXA 4DL5A 4FXVA 3TQEA 2Z5CA 5T7LA 2N3LA 3DXSX 5D0RA 2HNDB 2DGTA 3GG0A 2DO4A 2WCXA 2DH9A 3TR5A 5DDRC 2XY5A 3GJRB 1X0FA 1TVRA 1T03A 3TANA 3CCTA 1JLFB 4ZLNA 1TK5A 1RHUB 1U8SA 3GV7B 4NLDA 3HKZD 1FT8A 1ZETA 4RU2A 1PYOB 3BSCA 1FRIA 4X4VA 1L3TA 1AFIA 4H54A 4Y00A 5FLXU 5IT0A 3G6XA 2H5JB 2G1HA 2XG8A 2GHWA 5K5MA 1G1XA 3CD7A 2HVDA 3A3PB 3POTB 4JB8B 1CS4A 1NB7A 4YY3F 1NDPA 1SKRA 4AL6A 5B0AA 2VV5A 1RI7A 2EFVA 2RU9A 1U26A 3IGVA 4ILMA 3KWMA 1KLMA 4X65J 3ILIA 4DV2I 4FW7A 1E6YB 2V9KA 4JV5J 5F41A 1NDKA 5CHCB 4FWHA 1PJ6A 5IWAE 1R6LA 2IBOA 3D3BJ 3Q86A 2XY7A 4K4TA 3DLKB 4FYXB 4DJBA 3J80Q 4DUZI 1C1CA 2KXNB 1Q7LB 3AB4B 3WU5A 1RT1A 4UF4A 2DRAA 4NLXA 1IR0A 4JI0J 1R0AA 2J9DE 1G3OA 2X1FA 5SZTA 3LH2S 1S10A 3CC7S 3TAMB 3ZZPA 1X4AA 1KQFB 2ZBKB 4RW8A 2E1AA 3CJKA 2KVIA 4EZ9A 3RBZA 3PIPQ 1RHJB 4L76A 4OYMA 3N6NA 1RACB 2BRLA 1RTIB 4ZVOB 4DS4A 4P71A 4CCHA 1N88A 4YY3I 4CIOA 4PUOA 2O66A 3AT1B 2WVCA 1S97A 4HT5A 4F4KA 1KDNA 4PZVA 2GO8A 1TK0A 4HY1A 4ECWA 3H2VE 4G3IA 2F65A 3M9OB 2B7BB 4TN2A 5D78A 4IFYA 4IZJD 1UVIA 3O6QA 2XY6A 2DGVA 3M85D 2LXIA 2BE7D 4WP8A 3TJ9A 4WZQA 3ENWA 4NLSA 2RDJA 4HI1A 3JAMC 2FJXA 1Z0WA 4C8ZA 5EN1A 1FJGE 1ELOA 1ZPVA 2HQCA 3VGTA 1FDDA 5BYRA 1JKHB 2XO7A 3H1CA 3RBEA 3K8VA 3M6XA 2KHCA 3I5CA 4M5MA 5HMYA 3HVAA 1JLAA 2MGZB 4O44A 1RBOB 2KT5A 3MUVP 3EMTA 2VG5A 5DO2A 2M2BA 2A6OA 4JYAI 5KFHA 3DLGB 5KAKA 4KGMA 2E1CA 3H5SA 1DQ8A 2E5HA 2H1YA 4LF8J 3Q2SC 9ATCB 2FY8A 4DR7J 5DDOC 2K3IA 5KTQA 3Q23A 1LXJA 2R7SA 5A8RB 4XIUA 1XERA 3DRXA 4LIRA 2ZE2A 5D4LA 1L3SA 1H3DA 1I1GA 4S0MA 2CPYA 4M5HA 3W5YA 1Q7YT 3DLHA 2DHAA 5AE3A 2FLLA 4O23A 1HR0F 1RT3B 5CD4H 2C1EB 2VC0A 5THWA 4GKKF 1YHQS 1XWLA 1X0PA 1FJCA 1VQYA 4J90A 3KG1A 4NLUA 3J7AG 1F6TA 4IDKA 4LF2A 2PNZB 3SSSA 4KHPF 1UA0A 4JI8J 2B4VA 4AM3A 4KAIA 3GLLA 1SKUB 1JLQB 1S7IA 4HI2A 1UJ4A 3VAGA 3FMBA 3CTRA 1T7PA 3CD6S 2K1RB 4ELVA 3MPVA 1UP1A 3NCPA 3C46A 5KFNA 2ZBPA 4ZLJA 2D3OR 2VFVA 2PO4A 4LSNA 1WHWA 2EPIA 3ENAA 3UWTA 4ID8A 4DL4A 1U6FA 2PEHA 5M2RA 3BS9A 3T1HJ 1UVJA 4Q2MA 4URSA 4JV5I 4C11B 4X4UA 3IAM9 1X9MA 3CMES 1SQEA 2AYGA 4NEZA 2FPHX 4DN0A 4X4SA 5K8MA 2VDHA 2HHQA 3GE9A 2UUCE 3J7Z5 2YH1A 1RWWB 4HTJA 4JI0I 1J5EJ 5KFOA 4GKKI 2ZZMA 4EI2A 4DV1F 4ED6A 3M32B 5CYJA 3J81C 2DJWA 2VPZB 3CWVA 3R6GB 4RW6B 1HNZJ 3MD1A 3ILJA 2HHSA 2VBZA 1Q78A 2WW8A 5K36F 5EWGA 4AL5A 4FVMA 4DV5J 3DC2A 3EZUA 4OX8A 4QPXA 1MN7A 1ZS6A 1HBMB 1SJRA 4MKVA 3C2PA 3QIPB 2NUHA 1O51A 2CJQA 1LFPA 3CIMA 3W61A 4N47A 3KLGA 5G0RB 2A18A 2ASLA 3M2RB 2L3MA 1UJ6A 4R0JA 4IYQA 3HT0A 2CZ4A 1RA6A 4EGLA 4B3TI 1MWZA 3V6HA 4USUA 2HAIA 2AJ2A 1PBUA 4NLQA 3EJMA 3TJAA 4J9LA 3ITHB 4GKJJ 2LQ9A 3DMJA 3NEKA 5A2QQ 2X3DA 3UCUP 5L46A 1T9XA 3BPSP 5IT4A 4RPFA 4OFZA 1U8WA 2HQDA 3W62A 4K7QA 4ZP7A 2OELA 4CO0A 2R7UA 5C0XF 5U47A 3M6WA 2PFFB 3L7ZB 1RAJA 2K3KA 3B8HA 3OUYB 2WB1D 3G82A 2IVMA 2E7WA 1XXEA 2CAJA 3EM1A 4FXWA 2M52A 1M5HA 5J2PB 3I0RA 3Q0AA 3W9HA 3BGLA 1B64A 1EZZB 4I2PB 1UZHA 1U1PA 1FO1A 1UWBB 5HQLA 5LMUF 4NLPA 3VZHA 2NXUA 1QUVA 3X1LB 4N3OA 3IGNA 1FJ7A 2X1GA 1UCNA 4JI8I 3ADAC 2J0QD 2W8KA 3CJQA 1S48A 2YWKA 4KBIA 1IKVA 4DU7A 2GHVC 1IUJA 2ZBRA 2QEXS 1LW0B 2BX6A 5HJYA 1YVFA 5DRQA 5H9FJ 2KL8A 4ED4A 1JJ2R 1VBZA 1NHIA 2FLOA 4X66F 2RMLA 2D1CA 1RU2A
chains in the Genus database with same CATH topology
1RA7A 2UP1A 5IQ6A 4PXEA 2F40A 2KHDA 3BGUA 4RW7A 3PR5B 1SL2A 3TVYA 5IS2A 4UUWA 2R7WA 5KFSA 2BA9A 2YNIB 5LL6d 4OI6A 1N5YA 5JXSA 1S1TA 1UETA 3MR3A 2ZHAA 2IM1A 3N9UC 2ROPA 1F2GA 4U7CA 4WJBA 5DRKA 3THVA 5EUHA 1RT4B 1VQ4S 3VQSA 2OPPB 3J7YU 1E6VB 5I3QA 5FDLB 3KK1B 3S8SA 2FJWA 2B43A 5A0YA 2DK2A 3UNGC 4B9VA 4KQZA 3I0RB 4QR1A 3MM8A 3C6TB 2FB0A 4I1TA 2BRKA 4WFAQ 4ZPVR 1W2BR 1VK8A 2YWGA 3BQ2A 1KTQA 2OD4A 3IFEA 5DJBA 5BYQA 3U7JA 3ZZYA 5AE2A 2OTLS 1KN6A 1Q8BA 1X4CA 1WTFA 4ZPDA 1U1RA 5F8NA 1HQUA 4A48A 4FNIA 4OMFG 5B0DA 3QJJA 3DLEA 1HL6A 3RW6A 4PQAA 4XPEA 3M6VA 1PO6A 3LAKA 4BC9A 1HQEB 1S1XA 3MMBB 2DR5A 2DGXA 1J5OA 3Q2TC 1JJHA 4B9NA 3GV8B 2CG4A 3GIMA 2KRRA 1N34F 3HHNB 1HWJA 4LJMA 3KFWX 2J9DA 3MDFA 5F0UA 2W9BA 3H20A 4OI1A 1HNVA 2XCPA 4MJKA 3RTVA 3N6MA 1IJEB 1S0VA 3TA0A 3FZBA 2N7YA 2R2RA 2LXFA 3VCDA 1TL4A 5KFDA 1TKZA 4DL7A 3H2LA 1LWCA 3HHLA 2RSQA 1JLCA 2YKAA 3KG4A 4FVCA 4KKOB 1VQ9S 1IKVB 3TAPA 4DOZA 1R8CA 4ALZA 3JSBA 1JWWA 2DNMA 1F60B 2G0CA 2C3UA 3LP1B 3RB0A 2PIIA 3PW0A 4JV0A 2YY3A 3KK2A 2ZH8A 3ONQA 2IMWP 3H5UA 1MW7A 3OVBA 4DL3A 3CD0A 3ZC4A 1IBMF 5D4PA 4FBUA 2V94A 3KLHB 2MKHA 4OJ1A 3JSMA 3MUMP 2FDNA 4ZS6A 5GAGU 3LO3A 4K4SA 2HHWA 1FDNA 3FQKA 3DGPA 1TAUA 3SSRA 4F4WA 4FPRA 3GIJA 1L3KA 3HVWA 2B4UA 2CPJA 3I31A 3FMWA 3JSYA 3TUIC 4RW7B 5F3TA 2J6UA 2PMZD 1FRKA 3K58A 2GO9A 2XHWA 1H0HB 1WI8A 2J9CA 4WIIA 1HBOA 2YTCA 1N5YB 1X7VA 1S1TB 3ISNC 4D3HA 4OZ1A 2WBRA 4QPTA 1FRLA 1AUDA 3K5LA 4YR3A 4JYAF 3W3SA 2DPIA 3KK3A 2MHNA 1DAXA 4HTIA 1X4EA 1LWFA 4DPOA 3L3CA 3VAJA 2ASJA 5A6WA 2W9CA 5J2NA 4JI1F 1IN0A 3DOMA 3CJ4A 2ZNZA 2EK6A 2I5JB 4ILRA 5A0YB 5KG4A 1Z2LA 3MM8B 1EP4A 1XC9A 3IRXA 4EU0A 3CB4A 2ZHBA 4B3RF 3H4DA 4M5DB 3IS9B 4EFAC 1SJQA 1NK8A 5A8KA 3SEOA 2ATLA 1HQUB 4HHJA 3U02A 3M8PA 5KG3A 1XMBA 1JMTA 4ES1A 3DLEB 1VQSA 1TFWA 3BO4A 4IOCQ 4OV1A 4C3KA 2ZUGA 4RNFA 1HI1A 1Q53A 3BEGB 2NR0A 4RW4A 2XSFA 3R5AA 5KFFA 2CPEA 1OWXA 4O4GB 2DPJA 1GAOA 2W9BB 1YJNS 1D8YA 3CCJS 1N6QA 3SFGA 1HNVB 2E29A 1OQ6A 1S6OA 4JI7F 1KLMB 4I0WA 1C4CA 3OTEA 4Q43A 1HPZB 4WZMA 1BGXT 5CYQA 4HDHA 2A10A 4AXJA 4ERDA 1XR5A 4DFPA 1TKZB 4E0DA 1LWCB 3HHLB 4NYZA 3WZ0A 1JLCB 2AW0A 4JUZA 5HL7Q 2VASA 1FDBA 1OQ3A 2DITA 3UQSA 1SIWB 1K73T 2XEXA 3ZZRA 3CULA 2UVUA 4C8ZA 3HMJG 3Q8SB 4DV4F 2RD5C 4DUYF 2I9SA 2HNZA 3KK2B 3OTDA 2U2FA 2OTJS 1H7XA 3F56A 4BHQA 1S99A 4CT8A 1N5QA 5KFZA 5F8HA 4K4XA 4F67A 1H2UX 3IA0A 3OTBA 3PFOA 4DX8H 1H2TZ 2OPQB 3LWMA 1N33F 3JSMB 4K4ZA 4KHMA 2GW8A 3L09A 4YR2A 4TXSA 2VZ9A 4Y34A 2GJ2A 5J1EA 2BANA 4RNMA 4ICLA 2BXJA 2PMHA 4RUAA 5DDQC 5GADI 3R5CA 2VODA 2AJQA 1V6HA 1RK8A 4QU6A 2MDAA 3AQPA 3OPKA 2Q6BA 4MFBA 4C0HA 1NO8A 3GV5B 1X4DA 2MQPA 2NQPA 1HBOB 1Z4UA 2F8MA 2NYIA 3CJKB 4XO0A 1Q1KA 3HLUA 2RILA 2D9OA 2DNLA 4ZDNA 2EFOA 2DGUA 3LGNA 5K8NA 1D9AA 2ILZA 4MYTA 4OZ5A 3M1VB 3KK3B 3LGMA 3MTKA 1DBDA 1S9EA 1LWFB 4URQU 3MEGA 2W9CB 5J2NB 4WU2A 2AWZA 2N3OA 2YNFB 1RT7A 4U9RA 3UR3C 3KLVA 4QU7A 1EP4B 3LANA 3DRRA 3IRXB 2MQNA 4DSJA 2KI2A 5KFPA 5KFBA 4X65F 1X5PA 4UOCA 1KRPA 3I87A 5A8KB 2XULA 4JV5F 2DHGA 1M0SA 1BQXA 2PSZA 3QMQA 4NA3A 3CDEA 5IQQA 3KHGA 2KDOA 3MHYA 3U1MA 4PQUA 2PC6A 2COLA 2VB6A 1WHXA 3PEJA 4J9SA 1DRZA 2CPIA 2O01C 1S0NA 2CFXA 2L9WA 4QIEA 4UW2A 4CO1A 1HD1A 5KFEA 2LECA 4EBDA 1S1VA 2MHEA 1N6QB 4Y65A 2BW2A 2DNKA 1P27B 3FSYA 1LXNA 1NAQA 1OSCA 3ISZA 1TQLA 2IRXA 5CYQB 3PX0A 2CPHA 4DL0C 4JI0F 2UXDF 1SH2A 3U1NA 2JH3A 2D3UA 4AUKA 2RRNA 3I9ZA 4ECVA 3IAS9 1KLNA 4Q5VA 1U1MA 2PDAA 1WG5A 2ZOGA 4W90B 2ZBIA 2HGLA 2HNZB 2V8DA 5AXNA 3MAQA 1NKBA 2IVFB 2KRBA 1PSDA 1RTJA 2R8GA 2KG1A 3NL0A 3Q8PB 2HVHA 3HF5A 4P7TA 4ECSA 1G6BA 3GR1A 4FF1A 1OSDA 5D3GA 1X9WA 4IQMA 2QT7A 4LT6A 4NYPA 2ADCA 4NL5A 4RBVA 3MR6A 5I3PA 4J9QA 3G9CA 1YITS 4ICLB 3US5A 3GSDA 3IG1A 2KG0A 4KB7A 4DQQA 3CCVS 1R6YA 3OHAA 2CJAA 4MFBB 2CQCA 2QSWA 4N8OA 3PM9A 1JLAB 4FXDA 3PJXA 3DOKA 4ZCLA 4QWEA 4NZ0A 4OJGA 2IVYA 3MAHA 2DH7A 2DISA 3N28A 2O3DA 4KPYA 1ZM9A 4C7QA 3BREA 2ACYA 2F7VA 2B9YA 5HLFA 4Y28C 2LYVA 1URRA 4X62F 1MU2B 1SIZA 4F02A 2ABYA 2XS2A 1S9EB 4I7FB 3MEGB 3OL8A 1WHVA 2XMJA 4J9PA 2AQ4A 2KT3A 2MJNA 3MFIA 1RT7B 3OW2R 4V19J 2LXUA 1DJ0A 2RKIB 2EC0A 1WG1A 2DO0A 2KYZA 4G1IA 5IT9Y 3TRGA 3RZAA 4LFBF 4B3MF 2V8VA 4MAKA 5AXLA 2DR9A 2YX4A 4DSLA 4ATNA 2OPSA 4CNZA 3EXCX 3FFIA 1WD6A 1HI8A 3UDLA 4ZKAA 1LWEB 5IM0B 4NA2A 1F5AA 3LP0B 2YKPA 3SCLE 2AYEA 4DMZA 2IJNA 4LF7F 1WWHA 4LIWA 1HFEL 1ZAWA 1YRXA 2ZHOA 2P6TA 3DDKA 4B9UA 3IR5B 1NK5A 1VQ8S 4DBQA 2NPIA 1UKUA 3SI8A 4NCBA 1NJYA 4B3TF 3SYZA 1S1VB 2KN4A 2VFSA 1X5OA 5LMNF 2APOA 3VAMA 2BBEA 5LJ3Y 3QYYA 4I2QA 1C2PA 2N82B 3GMGA 1YTYA 2W7AA 3W2WA 5F9LA 3KYLA 2VG7B 4A4JA 4X4NA 1ZAVA 3MTJA 5HMZA 2HS3A 2ZITA 3CDAA 4G1PA 3CCLS 2KJWA 2AGQA 4QR2A 1CEZA 1J2VA 1KNZA 1YRTA 3BQ0A 2GIRA 2O67A 5M2UA 3AJ1A 1TKXA 2VBXA 4ZP9A 2VA2A 3BO3A 1KVIA 2GA7A 5LSOA 5KFKA 1EETA 2X1BA 1DURA 2MZTA 4NZ6A 3SSQA 3UW1A 5J1PA 1UVNA 3RRGA 2IHR1 4QYZJ 2ZOMA 2XLKA 3N01A 3RAMA 3NWGA 1N8RT 3QWPA 1C0UA 1ULRA 3EZ5A 3PV8A 1Y5IB 4BBYA 2M3DA 2RU3A 1BWEA 4F3OA 5D3GB 3NNAA 2EW9A 4C9DA 1HD0A 1OO0B 1JB0C 1VJWA 4R0EA 3DN9A 4IOBA 5HMWA 2FTRA 1FCAA 1KHWA 2YNGA 3IG1B 1Q82T 1DQAA 2CPXA 2WSEC 3OXFA 4LF8F 2YKMA 3BF4A 3E51A 1NJXA 3BB5A 4NLOA 3UDCA 4UY8T 5EN1A 3CCZA 1AW0A 2ZC4A 2DTJA 1T94A 1WF1A 1Y5LB 3OR1A 2CPDA 5KT3A 2JL9A 2DNOA 4Y2AA 1WHYA 4F4ZA 4KRWA 1TK8A 4JI6F 5HLFB 2EFGA 4X2BA