1VI7A

Crystal structure of an hypothetical protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
206
structure length
206
Chain Sequence
LMESWLIPAAPVTVVEEIKKSRFITMLAHTDGVEAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALRQLTTQRKTPLTEYTLQCEYHQLTGIEALLGQCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YIGZ, a conserved hypothetical protein from Escherichia coli k12 with a novel fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yigZ
total genus 46
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01205 UPF0029 Uncharacterized protein family UPF0029
A PF09186 DUF1949 Domain of unknown function (DUF1949)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vi7A02
3.30.230.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Impact, N-terminal domain 1vi7A01
2KDOA 2NPFA 1P9QC 2L9NA 3EXCX 4QR1A 4FN5A 1DARA 1ZM4A 2BM0A 3ZZUA 2ZITA 1N0UA 3E3XA 3B8HA 4QR0A 1ELOA 1N0VC 2I0XA 5G4DA 1VI7A 2J7KA 3LH2S 1ZM2A 1T95A 2BV3A 4TNOA 4M1KA 4ZCMA 4ZCKA 1KTVA 4MAKA 2BM1A 1U2RA 2CVEA 2I8EA 2IVYA 3B82A 1ZM9A 2XEXA 4MYTA 3UI3A 1ZM3A 4ES1A 4QR2A 4ZCIA 4MYUA 1ZPWX 1FNMA 2WBMA 3B78A 3ZZ0A 3OQ2A 4ES2A 4ES3A 4ZCLA 3ZZTA 2E1RA 2EFGA
chains in the Genus database with same CATH superfamily
2VL1A 4X66F 2NPFA 5KAKA 2F4FA 4TYAA 5KG3A 2IYGA 1CG2A 4AT1B 2QL5B 2AGPA 2DGSA 2B7CB 3QO9A 1NSKL 3N5FA 2ZJQQ 2HHVA 4GKKE 2QEXS 1IR2A 4OO1A 1IR0A 1SH0A 2FYXA 2Q3PA 1H74A 4NLQA 2FVQA 1Q79A 1N36J 1A0OB 4IFDF 2MLYA 2AT1B 4X4VA 2UXDF 2QN6B 4UQTA 4CLPA 1E3PA 3PW5A 2AIRB 2HQFA 1R6LA 2KJWA 4U8VA 3VGVA 4MU4A 2UUCI 3RBXA 1ZM9A 3BF4A 2EBEA 3A4TA 3NS7B 1HARA 4USJC 1RTIB 3IR7B 4CLFA 5EDWA 3OXGA 2V2ZA 5M2PA 3FRYA 3ENQA 2HZAA 3N01A 4NI2A 5KFEA 3IRWP 2FJVA 2XLKA 4E98A 2GHWA 3EXCX 4N5SA 1GNKA 1TP7A 3TI0A 1HI0P 4JI1F 2VOPA 1GXLA 2EFVA 3KJNB 1TR0A 4DX6A 4L3KA 3E3XA 4EBEA 3MEDB 2JVOA 1S72S 1VQ8S 3H2UB 3D6TB 2VA2A 2CQPA 2DO4A 3CDWA 1OYDA 3MM5B 3M9MB 1VQPS 4FXDA 3F0NA 3OTEA 2HNZB 2HVIA 2JH3A 3A8IA 3I0SB 2W9AA 4EGLA 2GQ2A 2QE5A 3BS9A 5KFFA 1QAIA 4WBFA 2R7OA 5E2QA 5C25A 2A6MA 1UKUA 1TVRB 1YRTA 5FDLA 3OR2B 2AX0A 4OI1A 1KOHA 3IGNA 5KFIA 5AXNA 4EBDA 1U26A 2B51A 4M5IA 4PRXA 3OR2A 4GQUA 2OPSA 5D3GA 4OZ1A 5A2QC 2IAJB 1YRXA 4M5NA 4NCBA 4GO7X 5KFAA 1T05B 3DOLB 2MSTA 1SH2A 1NHUA 1KLNA 1RHQB 2EFOA 3FEYB 5AT1B 5C0XF 2VIHA 1HIYA 8AT1B 5CA5A 1UCNA 4ED2A 2UXBI 4FF1A 3H59A 4I68A 5F3ZA 3H1CA 4OLOA 2X36A 1Z0BA 1SJQA 2UZAA 5KFXA 1HWKA 2QRRA 3HDSA 3ZKBA 1ZOTA 3AOBA 3RW7A 3RB6A 5G0RA 4F8RA 4I6WA 3E8OA 4Y0FA 4DV5F 3U1NA 2R9LA 4EEYA 4NE9C 1KFDA 5GAHI 3FBFA 3K7RA 1BQMB 3FSYA 2HNYB 1U6BA 5A2QY 4KFBA 3BV8A 2NQPA 1GXUA 4ILLA 4UTGA 1J27A 2BKPA 5CZXA 1IKVA 5H1SV 2XHWA 1C1CA 3IAM9 2K2PA 3K8WA 2OFHX 4IDKB 5D8HB 4ISAA 1S0MA 2W9CB 4IDKA 1JQGA 4DL0C 4F4KA 1SQGA 1REGX 1BWEA 3MCNA 2Y3YA 1T02A 4RKUC 1TV6B 1PVGA 1X5TA 2ZM6J 2WNRA 3K2YA 3V6DB 4DF8A 1RR9A 1NDLA 3SXLA 2OJ3A 1X7VA 2Z2ZA 4QJVA 5AE1A 3VZHA 5ADZA 3N28A 3EDRB 2V4RA 1P27B 4PXBA 1HPZA 1BC6A 4DCOB 1MU5A 4FNIA 2XNQA 4M5LA 2HHHE 1RWOB 2C3MA 1N48A 2NN6E 4ENOA 3UDVA 1PIEA 5F8IA 3JYTB 4MU1A 2MKIA 1QAJA 1UEKA 4Q8EA 1RT4B 2F3JA 3QAEA 4BLGA 2DBBA 3SDEA 2FHKA 2XEXA 1YLXA 4LVOP 3WZ0A 4USUA 2WSFC 5KFQA 2Y0BB 5LMUI 4DV2F 3M7NG 4DS4A 3M2VA 1FNMA 3BKFA 4LJMA 2MQNA 5MAOA 2AU0A 4EBCA 3OFEA 4OI2A 3DM2A 5D0GA 3M8WA 3PJWA 4UUWA 4MH8A 1FHTA 4R1FA 4BA2A 2CDQA 4XAKA 4DR1J 1XJWB 5KTQA 2CXEA 2XLJA 4P7AA 1H2TZ 1JLBB 3IR6B 3QO9B 5EX3A 4ECZA 1VQOS 4DV1J 4PUOA 2BA0D 1UP1A 2LECA 3M30B 4M5DA 4OLPA 4AFFA 1B3TA 3T3FA 3H5XA 3JSMA 5F41A 2HBZB 4ZVRB 1UVNA 1VQ5S 3I9ZA 4DR4E 4NXNF 4CI0B 2CQCA 4RPFA 1U2FA 3W64A 3RTVA 4LFCF 4O3SA 1YIJS 1CBKA 1NMEB 1ZM2A 5HP1A 1N36E 3MFHA 1HNWF 4B3OB 4J9PA 3IMQJ 5H9FJ 3R5DA 4DV2I 3GG0A 1EKRA 1CJUA 3T5LA 3BGOP 2VJUA 5J1EB 1U1KA 3AB4B 2BW2A 3UNGC 4DXLA 5A6PA 2R7RA 3T1HJ 1F9HA 4HLBA 4LF2A 1TKZB 4ANEA 1VQMS 1N6QA 4RW9B 3MCSA 3OUYA 2M7SA 4FYWB 2BKOA 1URNA 2XY6A 4XTJA 4JI2I 2AYGA 1VLYA 3ZTPA 2E66A 3R6GB 2RU9A 1NCLA 1Q16B 2DXEA 1RWXB 2NLWA 4ITSA 4OYPA 3ZTRA 3G87A 3ISNC 3KLHA 2OLWA 2QO3A 3HVRA 1K1SA 1U8WA 3I96A 1UFWA 3AJ2A 3TP2A 2L9WA 3G82B 2V8GA 3PO4A 1DQ9A 1MWQA 4JI0F 1RTJA 1VQ4S 2V8PA 5B0CA 2KT5A 2OIHA 3W9HA 4XDDA 3PHEA 1QAYA 1KTQA 2UVWA 2XMWA 1OQ6A 2BM1A 2C2OB 2FJEB 3FQKA 4BC7A 2NN6C 3UR0A 1S6OA 2ZDPA 3DOLA 3D0IE 1LFPA 3H8YA 2IAJA 3GIKA 3BSNA 5KFOA 4DV3J 4EYIB 2CG8A 1TAQA 2AZ3A 3TO8A 4ZN1A 3M2UA 4TY8A 4K4SA 4DR2F 3MOJB 2DHGA 2JC1A 3R97A 3D6HB 3MPVA 3I31A 1IBCB 2C2DA 1YJRA 3J7Z5 3Q2TC 4JYAF 4RNNA 3VAKA 7FDRA 2MY8A 4YY3E 2X1BA 1W7WA 2HFOA 1HD0A 4J7CA 3TAMB 4BDPA 2HLUA 5C0XC 2FLLA 3GV8B 2DNRA 2XMKA 2JE6A 2PIIA 5KFRA 3Q24A 2GJIA 4YUDA 3G9CA 1XR5A 4DR6F 4OI3A 3UDLA 3DYAA 3R5BA 4DSLA 1NZ0A 4LF7I 2HFSA 4C8NA 4OYOA 3TQ1A 1KSPA 3TEGA 1N36F 1IBLI 4MTPA 5IC4B 4FW5A 4QQBA 1X0FA 2UXDJ 3RBZA 4WP9A 3SFUA 2OPQB 1ZM3A 3NLCA 1HQEA 1C1CB 3KLIA 4DFKA 4KPYA 3TANA 4OYBA 3PJ9A 1ZA2B 4ZHRB 2W8LA 4NLRA 4P2XA 2D9OA 2JHEA 3G71S 4TKTA 3T5JA 1V3ZA 2MZRA 2NXCA 4X4UA 1NPPA 3W5YA 4X66J 2ZM6E 4O4RA 1ITPA 5LJ3Y 1WEXA 4FW3A 1RKIA 2PEBA 1N0VC 4J90A 2IBKA 4IUFA 4MK8A 2VPZB 2O1WA 1N36I 5B09A 1E6VA 1YSJA 2BRKA 2JEAA 5CHCB 2DHHA 2HHHJ 4ZPAA 4C8LA 4OI6A 2PO4A 4ZVEA 3DU5A 3QAUA 1HBNA 1HBOA 3N6MA 2VH7A 4U67Q 4DSJA 1OWXA 3AHPA 3M2VB 3US5A 4QWCA 1A9NB 4JV5F 1ZYQA 3OFGA 4YQWA 2Q1LA 4Y2AA 2A0FB 4OJGA 3MTJA 2OPRB 3KK3A 2W7OA 4ECVA 1ZA1B 2FJAB 4Q44A 1VQ9S 1RHJB 4N77A 4P7TA 4JI1I 3FMBA 5HBMB 1F2GA 1XMOE 1XMQE 3CD7A 4JV1A 2C2KB 4X62F 2HS3A 4DR6J 1U1PA 1X4FA 4A8MP 4EFAC 4KGMA 1VQ7S 5GMEA 3VF0B 4DUZF 4O3RA 1YBTA 2HRYA 3A8KA 2JL9A 2HVZA 2LXFA 4EI2A 1RAAB 4Y3CA 1LKZA 4BHQA 4KIAA 2KXFA 3W9IA 4YHHE 1EETA 4RUCA 2RHSB 3QMQA 3L09A 2BJ7A 1NK4A 4MIAA 4PQAA 3R8YA 1RAHB 2M52A 3R6LB 2R7WA 4ELTA 3NZKA 2YKMA 2DHXA 1FJEB 1T3NA 3TUIC 4DL6A 3EGWB 2VD3A 3MI7X 3THVA 4K0KF 3EGNA 2ROEA 4KFBB 2R3VA 4DU7A 4ECRA 2FJBB 4AL6A 4HXZA 1YH8A 1IKVB 2EK6A 4KBIA 5HROA 1RAJA 4O4GB 4ANCA 3RB4A 2IESA 2HGMA 5F0WA 4KGXB 3G96A 3IP0A 1KD1T 2NXEA 3ITHB 4O4GA 4A8YA 2L08A 4A8KA 2PO2A 4UT4A 5AXLA 3QIDA 2UVRA 3DRSB 2PA8D 4C8YA 3GMEA 2MKSA 1C1BB 2CYYA 2D3UA 2N4DA 3AD8C 4H54A 4QWEA 2DVIA 3QRQA 4AQYI 4JI6E 4DV0F 4JI7F 1U2CA 4J5OA 4J3DA 4WUBA 1Z0WA 3HPOA 2B8QA 5DNLA 1FDNA 5KOXA 5A8RA 2AF6A 1WKKA 3T1HF 2ZBCA 3PRBA 4DL4A 4DU8A 4MAKA 4PQUB 5A0YA 4DV3E 1E6VB 5IOLA 5CQGA 1YJWS 2W2OP 4I67A 2LQJA 2ZDOA 4IG0B 1QD1A 5M2RA 4KHMA 2NUUG 2DR8A 3DN9A 4FZVA 4MYUA 5ETLA 2UUCF 2LQ9A 4JI4F 2UXDE 3I87A 5K36B 3G2XA 5IWAI 4L73A 4ZS6A 2XLIA 4BA2B 3TAMA 3EGVA 3DDKA 3AA9A 1VS3A 4AL7A 4DDFA 1M5VC 1N33J 3GYNA 2KT2A 3C15A 4KB7A 2WTFA 3B8HA 1YI2S 1HWUA 4QR0A 4WWSA 4KHRA 4AQYE 4F50A 5BR8I 1UZDA 2C38A 4PXCA 4QOTA 1MLAA 5EN1A 2LA6A 3CCJS 1LW0B 2OO4A 3HHLC 2RQ4A 3QGGA 4MK7A 5KFGA 2O3DA 4ZCMA 1T7PA 3DFEA 4LF5I 1U4BA 1TQLA 4F67A 1S1TB 1T9TA 1WG5A 1TELA 2N7YA 3MM9B 4IO1A 3W9JA 4RW9A 3OUYB 1FT8A 1M5OC 1FKAF 1IJEB 2GS8A 2QC3A 1JJHA 3FSXA 3SFGA 1EA6A 5T14A 3FBEA 1Y00A 2HFZA 3P5BP 2CPDA 4FS2A 4IH5A 1HWJA 2D74B 1OYRA 1JLEB 1S5ZA 3OBIA 5EGYA 4DV0J 2HNZA 3CJ2A 4ZPCA 1FX4A 2ZOMA 3VAGA 2P9GA 1SVDA 2ZNYA 4AUKA 1EX8A 2JZ5A 2C3YA 2MY7A 3DRPA 4I69A 3V81B 2W2MP 1IBMF 2QX0A 3DLLQ 1XMOI 3N5BA 4IZJA 4DV6J 1XMQI 5KFWA 1P1LA 4ZP8A 5D4LA 4USVA 2J6SA 3UDCA 3MM8A 4CH7A 4NLDA 2UV8G 5AJ3F 2IM2A 5LMNE 1WHWA 4FW6A 1FKAE 4GKKI 3DKDA 1FDDA 1PAEX 4FYVB 3GU0A 2PMWA 4YEAA 1EQMA 2DH8A 3VAFA 3M9OB 3QLHB 1MMNA 3UN2A 1TL4A 2XB2D 4B3ME 1IQZA 1JXVA 4PKDB 2D3OR 2YX7A 5KG7A 3JSYA 4F0HA 4RUAA 1P8GA 4PPDA 3PW0A 1L3SA 5D0HA 1W25A 4DLEA 4B9SA 2ZUGA 4QIVA 1YBUA 1V5IB 2VBYA 3H5UA 3WC0A 4EU0A 1ZZFA 2MQQA 4R5PA 1N5YA 1F9EB 2CZVC 2DT9A 2IFXA 2V4JA 3EJMA 5G0RB 5JEAA 1G6BA 5A76A 1N4LA 2DRBA 1RU2A 2V4JB 1FRMA 1HL6A 2CQGA 2DRAA 3T19A 1NK7A 2DK2A 3HKMA 2G2ZA 3RBDA 2RHQB 3DMJB 3OPKA 4IO9Q 1NB7A 1N56A 2JEIA 2GZOA 4YMEA 2M70A 2SXLA 4QW9A 1G1XA 2DISA 2AGOA 2R7SA 4USIA 5B0EA 2D69A 4MKYA 1FESA 4OHXA 1XQIA 2BANA 3AY0A 4Z7CA 1FXDA 3K5LA 4QNKA 1B64A 2XWYA 3T1YJ 3EVOA 4MIBA 3NGUA 4U95A 1NHJA 3R7BB 2LJPA 3HHLA 1Y11A 2XSJB 1SL0A 1IBLE 4IFDC 1RHKB 1HQUA 1TL1A 2DYAA 2EG2A 4K4WA 3N6NA 2YQ1A 4LREA 5HROB 4Q5VA 1BD6A 2HKJA 2XZTB 4NEZA 4RBTA 1PJ7A 2QA1A 5DLGA 2PO2B 2YNGB 3BSCA 1NDCA 4L75A 2MDAA 2W2PP 4GVLA 4OX6A 1RI7A 4M8LA 4FVMA 5HANA 2MZSA 5MLCV 3G6YA 4GC7A 5B0GA 1RE1B 4HH1A 3WX4A 3ZZUA 4OO1B 1SB6A 3NXZA 3WIVA 3D2WA 4JI6J 1A6FA 3GJSB 1U8SA 2BQ3A 4LF6J 1XR7A 1V6HA 1VK8A 3P4UB 3UPFA 4OX8A 3RR8A 1TTHB 3AB2B 1XNQI 5KFDA 3TR5A 4JI3F 4NZ6A 1NAQA 1X4HA 3CO9A 3U27A 1EI1A 3A13A 4NRUA 1UW4A 4NYZA 1IBLJ 4JI7J 1R0CB 4IG0A 2CJYB 5LMNF 1R0AB 2YH0A 1HNWI 4E2FB 4FPRA 2Z5EA 1EQ0A 3AOAA 2KN4A 2IJNA 1NLKL 3K58A 1Y6ZA 2ILZA 5K8OA 3ZZ0A 4DV5E 1F6TA 4KHPE 4R0JA 1N34J 4Z7YA 5KG1A 3MUTP 5IM0A 4EK2A 8RUCA 4OX9F 3QWUA 1RYRA 1ZS6A 5FIIA 3UHMA 2KU7A 5GADI 3W1YC 3CJRA 3BM7A 3FZBA 4I7FA 4CYUB 5F9NA 3T6JA 2F7VA 2RD5C 4NLTA 5B08A 1KNZA 2E5JA 4LT6A 2GO9A 1WTBA 4FNHA 1S1TA 3GR0A 4LF4J 4RNHA 3W2VB 1I94I 3SIPB 1Z0EA 2CWKA 2ZUAA 1X9MA 1J5EJ 4C8ZA 4FW4A 3ETMA 1L3KA 2E44A 3DGVA 5GMKa 4DF4A 4N3OA 3M7ND 1HNXF 4WFZA 5F0UA 1RTDB 3PFOA 4DV4J 1WC4A 2C42A 3M8QA 2E5LJ 3BSAA 2J9DE 2VKRA 3R27A 3MDFA 1RT6A 2V50A 3GIMA 4TN2A 2J0SD 1KR4A 4NCGA 3KLHB 3LO3A 4LRDA 4LSZB 4Q2MA 4DR4I 4DG1B 4WCEQ 1C1BA 2XI3A 4DUYJ 4ZN3A 2WCXA 1VRQC 1N0UA 2E7XA 2J6TA 2CQBA 5HVHA 1EP4A 5EWGA 4DV5I 3KJVB 4OJ3A 5FDLB 4CWBA 5A8KB 4I3HA 1PBUA 4W92B 2RJZA 3CDUA 3PFEA 3R3TA 2L9DA 4ICLB 4MJKA 4WFNQ 3J80Y 3HK2A 2KTQA 1J5EI 2HQCA 2QV6A 5GVQA 4PEOA 3QLHA 3X3UA 5FWKA 1HNXJ 1E6YA 5A8RB 1R8AA 1S0VA 4DV4I 3QT8A 1CC8A 4QWAA 1IWAA 1YJUA 3PIPQ 4DFMA 2IDEA 3HFKA 1IBKE 1WKLA 1IVZA 1ZZNA 2UUAJ 2FZKB 5F8LA 1F0XA 2OMOA 2YKOA 4ZVOB 1SKRA 2C39A 4CNYA 3Q6MA 1AB8A 2ZC3A 2AEFA 2XULA 4NYPA 2POKA 2VG5B 1N5YB 4YB6A 2V2QA 3NMRA 2AP6A 4EZ6A 4J91A 3UDEA 4LFBE 1VHFA 2DNKA 9ATCB 1KVIA 2DTJA 4I4BA 2JX2A 3Q8PB 1VQNS 5DROA 2HAIA 3FBCA 3I9V9 1YK9A 3ZZRA 2XZWA 2MGZA 4TLRA 2WSEC 4JYAE 2RQKA 3VGUA 3OHAA 1W2BR 3SSQA 4OO1C 2ASDA 1T95A 2QJ3A 3JQKA 1QUVA 5L1IA 1XNQJ 1FRLA 5HP1B 4DX7A 1FKPB 1RLCL 2ZHBA 1HNIB 2IVYA 2R8KA 1RBAA 1HNVB 4OHWA 5HQMA 3VAJA 3SZ2A 3ZNUA 2HHHF 4LF7E 4OJ1A 1LK7A 2VPWB 5D77A 2F40A 1KONA 3PX6A 1XMOJ 4YB5A 1XMQJ 4GKKF 4NI2B 3BGLA 3CDJA 4OYXA 2C3OA 5KFKA 4H4KC 4L6V3 1KVKA 4NA1A 2I5JA 4RJVA 3ZTSA 4XIUA 3MUMP 2IM3A 4CO5A 5K8MA 2G4BA 4CO3A 2BJ3A 4ED0A 1U02A 2BQRA 1KN6A 3CW2C 5BYQA 4JYAJ 2BXJA 5L8RC 4UOGA 5BR8F 3R1HA 4B3RI 2OTJS 5HAOA 4A8QA 4J9MA 5FJ4A 2AMCB 2DGUA 2VBWA 3GV7B 1NB2A 3IG1A 3N9UC 3RRHA 3GSIA 3TAQA 1HBNB 3HSGA 2YX1A 3SDEB 1VC5A 1D6TA 1RTJB 2UUBJ 2HVDA 3MF5A 3R5CA 3PVXA 1KQSR 1QSLA 3S1TA 4F0KA 2NN6A 4PWUA 4PR6A 1EKSA 1U09A 3GB0A 3ULHA 1LXJA 1IBME 3PX0A 4WP8A 2HQGA 4ZPVR 2WW8A 2NSBA 3Q2SC 4DHVA 2Q43A 2V69A 1JLQA 2ZH9A 1AUDA 3PACA 4TU7A 4PUOB 3M32A 1JLAA 4J9RA 4DR3J 4C48A 5JEAB 1P9QC 1EB0A 4ZVHA 1UA1A 5DZ6A 4I7FB 4CYUA 2UP1A 2PMZD 1UAWA 3W3SA 2NXNA 4D3HA 2JSXA 1RU1A 2W4DA 2XWXA 5IT9Q 5KFBA 3RG6A 4B02A 3DMJA 4AD6A 2I1RA 3BQ0A 1B70B 5C0XB 4DMZA 3CJ5A 4DUYE 3M6VA 4BWJA 3UCGA 2UUBI 2HVEA 3D1OA 4AQYJ 3Q8VA 5D4PA 2AEJA 3VHQA 2H9ZA 2RRBA 2QSWA 2V8HA 2HWTA 3FK4A 4LMZA 4HY1A 5J2MA 2XMTA 2VFRA 4KAIA 3M7VA 2YNHB 5LJ5Y 1WEZA 5HLFB 4WK3A 4XDCA 5E3PA 1RTDA 2HRTA 3DLHA 1GT8A 2PSZA 2YNHA 3HSZA 1ULRA 3L7PA 4B3RJ 4JI3I 1X4AA 4F25A 1S49A 4L72B 1SKUB 4HHHA 2OH2A 5GADU 2W9CA 3G8TA 1NUEA 2KB2A 1HNIA 4MU0A 1NJYA 2KJVA 1RWWB 1SQFA 3V5RA 4ECQA 2KYZA 5JMNA 1S16A 1REVA 1CJTB 1TKTA 3Q22A 1YJTA 3UO0A 2PMHA 2Q66A 4LFBF 2KT3A 4AXJA 4RWXA 5HK4A 2OPPA 2DNGA 3CJ8A 1YJ7A 2HURA 3QZ8A 1RSCA 2F4VF 3RB3A 1NK5A 1MX0A 3HI9A 1PG5B 2PFFB 1WC5A 3P96A 4NZ7A 4LRBA 1XN9A 3QSYB 4DR1I 3GJTB 2DCUB 4DPYA 1NH7A 3FGVA 5LT5A 1D1UA 2XY7A 4KV8B 1SJFA 3CJTA 1YX2A 1B0VA 3DDNA 3BBCA 3SCIE 3LGHA 2M8DB 4O23A 4B9VA 2C39B 3UWTA 3PXGa 3HJCA 4P2SA 2LLZA 1IBKJ 1HW9A 4WTYA 4RLEA 2KZMA 5JEAC 3TZYA 3SBMA 3G86A 4HDGA 5IC6B 3VTIA 1ZTTA 4GMKA 3V6KA 1NO8A 4EO6A 1ZXNA 2F5GA 3HJVA 2R8JA 4LFBJ 1JK9B 1NHVA 2W7PA 5LSLA 1ZAWA 3HFVA 3ZKDA 2VC1A 2Z2LA 3P6YC 1SIZA 3BZQA 4NCAA 2RUGA 4FKXA 2BBEA 2EC0A 1F5CA 2IC3A 2X1GA 4DR1F 4B3SE 1N33F 2MTLA 3EXYA 3TUPA 1Q5VA 1WF2A 1SKSA 1NBEB 2HEKA 1O8BA 2H1YA 4K8RA 5HSPA 5JEAF 4PYDA 2EI5A 2O01C 2YPZA 3FCHA 2XGQA 2VQFI 1S7HA 2E5IA 3D6FB 4TLQA 4WU2A 3MHYA 3H0PA 3GONA 4ED6A 2OI2A 3POTB 4AIMA 1M5SA 2QSFA 1YZ7A 3KJFB 4FXWA 1AA1B 4CLKA 2P6TA 3QWPA 3LOUA 3FRZA 1K73T 4HTIA 1NSPA 4K4ZA 1YHCA 5LSOA 1LFWA 1RWMB 3NGTA 5CCMA 5CXTA 2CQ1A 3NOCA 4Q8FA 1IBKI 3RAXA 5HQ8A 3P3CA 1I3OB 2VJVA 5EL9A 1UZHA 2Z8QA 4P9SA 1K8AT 1Q7LB 4NZ0A 1B7FA 3ZFVA 2FLPA 2JEGA 3GSDA 2EFNA 1NH8A 2IOPA 5K36E 1TL5A 4DSKA 1X5PA 5JVHQ 2DNOA 3TJ8A 4DG1A 3KJVA 3TAPA 1WACA 3IWNC 1SC1B 3AQOA 1XR6A 4F4WA 4JV5J 3ZZPA 4LF6E 5HMYA 5LOQA 1RZMA 1NJXA 5DGAA 1S9FA 4ZIWA 4R8UB 4X4PA 3NNAA 3PRYA 2Q6BA 2IRUA 2IRXA 3M2UB 1YQHA 2VPYB 3P8BB 4TY8B 1RT5A 4X4RA 3K57A 2ZH4A 1PCAA 1RT1A 3BQ2A 1IBMJ 1UVLA 2DIVA 5B0BA 5A0YB 3O1LA 3ZTQA 1RBOB 5CD4H 2V94A 4AQYF 5LMUJ 4NXNE 4U7UK 2MSSA 3BGRB 2J8AA 2GAGC 2VG5A 2ABYA 3GYXB 3PNIA 4RUHA 4K4VA 1WTFA 4ATNA 3NWGA 4I2PA 3ZXWA 1BMQB 1WOPA 3O44A 1GXTA 1VOMA 4KHPJ 2VQEI 1J2VA 5L1JA 5IZHA 1EETB 3V2UC 2XNRA 2FGOA 4ZP6A 4GC6A 4KGZB 4QIGA 2KM8C 2A6OA 2WONB 3Q0AA 4CO1A 4Q43A 2R8HA 3WC2A 2M5YA 4NLGA 1GMWA 1Y3KA 1F5BA 1RHYA 4OV1A 2AJ0A 4BCAA 1S1XB 1OIAA 2F8EX 1HQEB 3KG0A 3HULA 2CAJA 1SV5A 2E5GA 1HQUB 1TL1B 1VJQA 4C0HA 2W9BA 2DR7A 1JMTA 1DTTB 2VFTA 4ZLPA 1AZSB 2VOOA 3HHLB 5H9FK 2V2VA 1R8BA 1JB0C 1XNQF 1Z5CA 2UXBE 3MMAB 1HYSA 1Y3JA 2CQ2A 3LGNA 4LQ9A 2BJ9A 4ZVQB 3W63A 1REVB 1RT7A 2DCLA 1NK6A 2QYCA 3SCKE 4YHHF 3AH6A 4ZJLA 3CDEA 1JLCA 2E1PA 3N79A 5ETMA 7AT1B 3VAHA 5DM7Q 4B3MJ 4Y2CA 4DR2I 2B9XA 1TKXA 2M8HA 2WVFA 5CYMA 2V9KA 2ZHOA 3WX8A 1PILA 4C6AA 4B9NA 3CGIA 2J0QD 3R7NB 3EGZA 3VGTA 4URLA 1UWBB 3TX0A 5ETQA 2F65A 3J7AN 4RX6A 1N5QA 2HBYB 1Y4SA 2DNQA 4DR2E 4I56A 4LF9J 1YZ6A 5CAAA 3M1VA 2PE8A 2ZH3A 2PI5A 3ILLA 5DQIA 3S01A 2AWZA 4M95A 2QG9B 3TVKA 2GW8A 3O2IA 2Y1IA 1D0EA 4C3KA 4ECTA 1LNQA 3BR9A 1VGYA 1I94F 5J2NB 2ADBA 3QRPA 3HSJA 2KVQE 1JX4A 2ATLA 2UVVA 1LWXA 4QCLA 1HKAA 1M1HA 4ECUA 1D8ZA 2OPRA 3UFCX 2MQPA 2ERRA 1GMWD 3DRXA 4EO8A 4NYOA 4IQMA 3I82A 4UQGA 3KLGB 3VVTA 4ZPWR 3JTPA 3MGJA 3M30A 4M5DB 3NGDA 1D3WA 3MMJA 2WB1D 3MR3A 1CULB 3JTNA 2IOQA 4J9LA 2V6AA 3ISND 2BE9B 2W25A 3CJQA 2EKYA 2P8IA 2BUNA 2DIUA 1N32F 2R8GA 4KHPF 1BHNA 2DJWA 2LXUA 3QGPA 4F3MA 2BR2A 4C8KA 3W66A 4OX9E 1A7GE 5G4DA 2ALYB 3MPUB 4C7QA 4DV6I 3NGKA 2W2QP 3KHRA 1D9AA 1WI8A 2VA3A 1ICEB 1YJVA 1I94E 4ELVA 2JC0A 1PSDA 2NCKL 2F9DA 1RT6B 1SIWB 4KGKA 5IQQA 2BYCA 4PG8A 2H4WB 3N6LA 3I5BA 2R42A 3B4MA 3DDIA 3UD3P 2XGPA 1HHTP 4QR2A 1PYOB 1W26A 3BGFA 3FUYA 1TU0B 2CJAA 2K1RA 3NCRA 3KHHA 1AZSA 4UUXA 4HVZA 4IFVB 2B0GA 1GK8A 5KOWA 2IPOB 3Q8RB 3CDIA 1TV6A 2PN6A 4C8MA 3IA0A 4KHPI 3SQOP 1KS2A 2YNFB 1T3OA 3GCWP 4IZJB 3C46A 2GO3A 4OX9J 2YWWA 1OS5A 3CF5Q 1GAOA 2M9KA 3DRRA 3IFEA 1N34F 4LIRA 3FDSA 3THTA 4LF7F 4URQU 3R2DJ 1E6YB 4F4AA 2LQBA 4G1IA 4FVCA 1D8YA 1KFSA 1I94J 3NL0A 3D1QA 4B17A 4HYKA 1Y60A 4JB8B 5K5MA 2K7JA 3CJ0A 3U1KA 3JYTA 2C2MB 2HMIB 4FWDA 3J7AM 1XTZA 3LGMA 1KVJA 1VIXA 4OI4A 3EDQB 1X31C 4RW4B 1BE4A 4ZVFA 3F44A 1RGVA 4LF6F 3MPDA 4ED5A 4PPZA 1URRA 5SUHA 1GX6A 2FVSA 4MKVA 3TJAA 1RHMB 3K59A 3RR7A 4DWIA 3DD6A 5T7LB 2GGPA 2WBMA 4OZ0A 4DQIA 1CEZA 2HHPA 2B5JB 3NAHA 4YB7A 4Q7AA 1U1NA 3K5NA 2UU9E 1FWPA 4N7TA 4JI2F 2RKIB 2RILA 1NDKA 3OV7A 2F63A 3LP0B 4B3TJ 1N5TA 2CPHA 5KFYA 2OMLA 2UXBJ 2RKIA 4GKJF 2C38B 2JOQA 2IERA 1TL3B 5GAHU 1IKWB 3S8SA 3BSOA 3RB0A 2DGWA 1S7IA 2IMWP 1USUA 3PTWA 1FERA 1XWLA 4USKA 1DTTA 3WU5A 3M85D 5E0OA 1FK9A 4DSIA 3SYZA 2BJDA 2C2EA 3MXHP 3MMAA 2V2KA 4DPWA 1HYSB 3IN5A 4LRCA 4DR7I 3KLIB 5M2UA 1Q78A 2Y8WA 1OY9A 2QMUB 2D1CA 3AXKA 3D9BA 3PG9A 1BQXA 3EE3A 2EC2A 3FEXB 5D4NA 4A48A 1NNDA 4F4XA 3P3GA 1TKXB 4CNZA 1RB0A 2ZBKB 3G6VA 2J9CA 5D0EA 2RVJA 4IOAQ 1Y5LB 4WIQA 4P75A 4DUZE 5HJXA 3W5ZA 3ZZZA 1L5UA 4NLOA 2JLEA 2G2OA 4X65I 4QR1A 1N33I 1E3HA 2VASA 4IZKB 1FJ7A 2JEAB 3CCQS 4DR3F 2E9ZA 4YR0A 3DRPB 3V81A 1L3TA 2O67A 2JLGA 1BKNA 3LALA 1ELOA 2PO0B 2H4YB 2KL8A 3NMAA 4IFDE 3CNQP 1XNRF 5IS2A 4CLZA 2HS4A 1KOOA 3RUBL 3JAMQ 2WOMA 5D3GB 3X1LB 1RT5B 2G0IA 4F3QA 5C2CA 1NEEA 3MMBA 2FHMA 3DU6A 3EUNA 4R8UA 4A46A 1LOUA 2FC9A 4F7VA 2ZKUA 3CCUS 2OKQA 3OL9A 3A8EA 5HN0A 2FHOB 4PXDA 4J9KA 2KRRA 3M8SA 3R5JB 1VQKS 4OI0A 1FJGF 2XYHB 4RL1A 4RW8A 4KSEB 4H4OA 5DZ7A 3UR3C 1D9DA 4B9TA 2IY5B 3BGUA 3W7BA 1OYPA 3Q1QA 2EEYA 3BGRA 3MD1A 1NSAA 4F26A 1N52B 1S1WB 4C3MA 3ILOA 3KK2A 4CLTA 3U7JA 5EWFA 1HK7A 1S1WA 3DCAA 1B7YB 4U9RA 1GMUA 2RH3A 2OD4A 2V68A 3MEEA 3W2VA 2QA4G 1WNEA 3KMQA 4JI8I 2EFQA 3T5KA 3CWJA 4Y34A 4Z2XA 5HLFA 3CJ3A 4PG7A 3QJPA 4EZ9A 4CO4A 1M90T 1NXIA 3ETOA 3BN4A 3JQJA 2JDJA 2KG1A 2B4VA 2K3KA 3GLLA 1U24A 3IRXB 2AEMA 1R8HA 3CDBA 2LU2A 4G6VB 4DX8H 2YNGA 1LEOA 3AA8A 1TUGB 3IRXA 3H4BA 1M1KT 4IRDA 4ZP9A 4ERDA 2B4PA 4J9NA 3EPIA 1RHRB 1T9WA 2HNDB 5K14A 2H3EB 5KFSA 3KLEA 2K06A 4IOBA 4DFPA 1FRKA 2HWHA 3R5GA 4U3BA 5CYMB 5L1LA 3W60A 5AE3A 2G13A 2MKHA 2RT3A 1S1UA 1U0SA 3ZM7A 4AIDA 2ASJA 3KNGA 2PDAA 1U1OA 4ZLLA 3GWCA 2GX8A 4H4MA 5HJYA 4LRAA 2LYVA 2X3DA 4O3QA 1SC3B 3J81j 3D3BJ 4KE5A 3ZO7A 5K36F 4DV3I 2MZQA 3KDNA 4KV8A 4F36A 2CQDA 1F3FA 1FO1A 4A8OA 3CD6S 2VDIA 4BWMA 3QZ7A 4CP5A 3JQMA 1LWFA 3D54A 2O3ZA 3M6AA 1WEYA 1SJ1A 4LSNB 2GGPB 4OHZA 2XMAA 1VQ6S 2BA1G 3SCJE 3TX8A 4DZDA 2CJ9A 5CYJA 3SV4A 3M4XA 1R27B 4Q2LA 4JI8J 3D3CJ 3JSBA 4MKBA 2DB1A 2LP4A 2H5JB 2GVDA 1S4EA 2FGCA 3IBFB 5KFJA 3NGSA 3SCLE 1H98A 2P2CB 3SI8A 2C2NA 5CD4A 1RT3B 2G1HA 5KT7A 2VQFJ 3MM7B 2IVMA 3HLUA 4NLWA 3OSNA 3V6JA 4Z37A 4O44A 2UU9J 1RAFB 1XK8A 2NREA 4F4YA 2RS2A 8ATCB 4KGVB 2BKNA 3U1YA 2DY1A 2GHPA 4JI2J 3CCRS 3KYLA 3AFGA 3RAMA 4FWGA 2B4UA 1TMJA 3Q83A 5LL6d 4W90B 3TA0A 4ZK7M 3CCSS 2E9TA 2XCPA 4LF4E 4WP3A 1RTHA 2EFPA 1UFLA 2IA0A 1MU2B 1MROA 4WKYA 5AE2A 2FQQB 1HHQA 3J7A1 1XBWA 2PC6A 1S77D 1WKJA 1K47A 3QT7A 3DLBA 2DHSA 2BE2B 3LANA 1R43A 4OZNA 2CPYA 3T9ZA 4FBUA 1L3VA 1FX2A 2I9SA 2RQMA 3CXCR 1NJZA 3W62A 1HNZF 2FJXA 3JSRA 4DV4E 3ISZA 5FLXU 1T11A 4K50A 4K59A 1PJ5A 4OHVA 1SUQB 3Q8UA 4UOFA 2IBOA 1NKBA 1JJ4A 4LCHA 5FLXY 3DRSA 4JI1E 4JI0J 2KH9A 3LA0A 2F8HA 4ICLA 4URGA 1HA1A 3PZPA 1XXEA 2JE6B 1K1QA 4LF8E 4DPXA 1VCTA 5A8KA 2WB4A 3BKUA 3TWZA 2IDLA 1PC5A 3AJ1A 1Y5NB 2JRSA 3OT9A 1S1UB 5L9NA 1T0TV 3V6HA 1EARA 1DURA 3PIOQ 1AT1B 1WOSA 1WSRA 2BV3A 2FUG9 3ENAA 3GPAA 3VQTA 4C97A 1YG0A 4RW4A 4WFXA 2V8VA 2M4MA 4RW8B 4WK1A 1MWZA 3Q8QB 4WUCA 2CIMA 4WTOB 2E5LF 5KT5A 5DO2A 2AHOB 5C2GA 4LSLA 4RWWA 5K8PA 4JI3J 4YOEA 2L41A 2KKHA 2NSCA 4J9SA 5K36A 3HHDA 2B6AB 4PXEA 3Q6NA 3CIMA 4U6PA 4JI1J 1HLWA 2ZKTA 5HMWA 4X4TA 4CT9A 3BJYA 3PO5A 4QYZK 1VIOA 4JI6F 2GIQA 1WOOA 3BPSP 5THWA 2FJWA 4DR6E 5SZTA 2UUWA 4UOCA 1S10A 3MEEB 4ZLNA 2NR0A 3M9NB 2U2FA 3BBFA 5I3QA 2ZITA 2ZH6A 1WC0A 5I3UA 4DZ6A 2ZVSA 3L4BC 4M5GA 4BA1B 1SV5B 5J2MB 5GAGI 3UD4P 2NPIA 2C28A 2RUSA 3CCTA 2RE1A 1FD2A 3BYRA 2F1FA 3LAMA 4OYMA 3AXMA 3M6UA 4C0OC 1LWEA 2ASLA 4X64F 2CJBA 1SL2A 4B3MI 1MWYA 2NYIA 4QBUA 3MR2A 1JKHA 2YVSA 3GJQB 1FKPA 2RB7A 4QIEA 1IXKA 4UOHA 2RRAA 4JV5E 4RU9A 2LMIA 3T1YI 2VDHA 4DCJB 4DV2J 1NJIT 4KRWA 4KJIA 4HACB 2LFVA 1RISA 2AYMA 2RAQA 3EX7B 3MPWA 2DITA 3TA2A 3ILJA 3HXMA 1T8EA 3Q8YA 2KFNA 1VR6A 3KUHA 1R89A 5D0RA 4P7VA 2YKNB 3NAIA 3CTRA 2N4CA 2I38A 4QPXA 1HWLA 2EFGA 3OQ2A 4Y6IA 5HMZA 1VRTA 4DQQA 2HYIB 2UXCI 1IKYA 4ZVGA 2R2TA 5C24B 2CJKA 1HBUA 1N54B 5I42A 4DR5E 2HHQA 1PKUA 4L74A 5LXYA 5D6GA 1QAXA 2WP8A 1VK3A 5JEAD 3FNNA 2EW9A 1SUQA 3HHEA 1TFYA 1Y10A 2HBRB 4DFJA 4X2BA 1Z0TA 1QY7A 4RUBA 3J7AG 1PYTA 3KTQA 1FNOA 4A4JA 1T03A 1UFKA 2GIFA 3K85A 3T1YE 5HL7Q 1WDDA 1RWVB 3PEHA 1F9FA 4HL9A 3PV8A 3P76A 2XMVA 2ACYA 3W61A 3A3OB 1T05A 1OYEA 2IRYA 3MM7A 2RDDA 5HBMA 4RW7B 2KG0A 1FNXH 4J9QA 1CJVA 3CD0A 1D9FA 2PO1A 3HHLD 4J9UE 3L3CA 3CPWR 4F2RA 4NLVA 1EHWA 1CJVB 4YS2A 1FWKA 4TU8A 1IQTA 3C6TB 4JI5I 1AROP 2DGQA 1Y4UA 1JJCB 3GZ7A 4PG4A 3C16A 5JUMA 2XMMA 2XO7A 2BJ8A 1FE4A 4JI0I 1R3NA 4DN0A 1VDHA 2VQEE 2GAHC 1G2EA 4JI2E 2ASYA 1UJ4A 2MJNA 3CD5A 3HT0A 2NS1B 2WVCA 5IV3A 1RKJA 5ELWA 1RXOB 2C1EB 2QL9B 2V0NA 5ETPA 4DV3F 5DDRC 2C37B 2CFXA 5U47A 3RU0A 1TL7A 1S1XA 1BUXA 2CNKB 2N3LA 2G9OA 3C19A 4NLPA 4ZDNA 3WIUA 4LFCJ 3MR7A 2NN6F 4LPFA 5K20B 1N8RT 3AJDA 4EYHB 1X4CA 2CNNB 4U8YA 4PAAA 2HNDA 5K14B 2EXUA 1RLDA 2OSQA 2MQ8A 2YNIA 3HFZB 3EZOA 5AJ3J 4LF6I 2YWFA 2F8MA 1DAXA 3DI6B 5T41A 2Y1JA 5A2QU 4CLUA 2F1DA 4IFDA 1J5OB 4RU2A 2JEBB 4DV0E 1YGYA 4DBQA 3DRRB 4O0IA 2VFUA 3CJKA 2H51B 1S4FA 4X66I 3T1YF 2G2YA 1RA7A 1SQEA 4LFAF 4LR9A 1NHHA 4OHYA 1F60B 1LK5A 1VRTB 3MWBA 4DV1E 2GFFA 3E01B 3HVWA 2DGXA 5C5JA 2XQCA 1HBUB 1WUUA 2BW7A 2EVZA 3OHBA 1EZZB 4A8SA 4A47A 1IBLF 2V63A 3SQGB 2UVUA 4OYZA 4FYYB 1LWFB 2HHHI 1USVA 3KHLA 3CC2S 2CQ0A 2DO0A 3H2VE 5K36D 2LCWA 2DNHA 5J2NA 2FJDB 4G1QB 3I4PA 2J6UA 1XERA 2CPJA 2D41A 1Q82T 4ILMA 1NU4A 4JYAI 1TL3A 3H20A 4RNFA 5HMXA 4LF5E 4JI3E 3P49B 2QLJB 4ES2A 4ES3A 2LEBA 2MB0B 4ES1A 2PNLA 3CC4S 1HNZI 2AKWB 3TVZA 2PGCA 3MECA 4RBUA 4FN5A 1LWEB 2ZWPA 2IC3B 4URSA 3UE2A 4HT5A 2HGNA 3T5HA 2XC9A 3FZ2A 3SMZA 1C0UA 2ZVIA 5B0AA 1H72C 4ZKAA 5E7OB 3E2EA 5IT9Y 3LNUA 2VODA 1S1VA 3UCUP 3U1MA 1P6TA 5F8MA 4NXME 1HNVA 1HNXE 4LF9I 3MMCB 5J1PA 2ZC4A 4PWDA 5ITHA 4KY3A 5IWAE 4TYBA 1NRKA 2ZD1B 3IXQA 2ZHAA 1YJ9S 4HACA 1WD6A 1WORA 3CIZA 1NPRA 2WZ1A 1B63A 5CYQA 2LQ8A 1Q81T 2LKZA 3D6MB 5FLXQ 1S57A 3LPEA 4DR1E 1NZ8A 3ZZYA 2RSQA 5DG9A 1X4EA 1FRXA 4G3IA 1IM6A 2W7AA 3DOMB 3KMSA 3HT3A 4DOZA 1M0SA 2IM0A 2HFVA 5L1KA 1WI6A 3A1YG 1FWLA 4WE1A 1RCOB 3HKZD 2PO0A 4JI6I 1N32I 3BPDA 5IT9C 2CRLA 1QSYA 4XPEA 4NXMJ 2AJ1A 4U3DA 1TK5A 1YKWA 3V4MA 1YRUA 3I0RA 1QUPA 1VI7A 3MURP 3VVUA 1O51A 2WBRA 4NWBA 1BY9A 1Q4RA 2CG4A 2KYXA 3GV5B 3WU4A 4J37A 3C3LA 5DETA 4ZCKA 4DSFA 5LL6R 4K7QA 5EHHA 1WG1A 1AFIA 4LFCI 2JT2A 4NLXA 5L3JA 3GFXA 2BOAA 2CNOB 2QLFB 4AYBD 3J7YI 4V19X 4M5MA 1HR0I 3OTOE 3CVKA 5BR8J 4JI8E 4DUTA 3QT5A 2A18A 4ZCLA 1UVJA 1SJRA 1PGZA 1KHVA 3DOKA 5JEAE 1X8DA 1WHVA 2E1CA 2E5HA 1ZPVA 2QIFA 3GIJA 4YHHI 5C0XD 1KLMA 1S6PB 2K7KA 3DYAB 4OYWA 4OQJA 3H98A 4Y2MA 3HD2A 4EWTA 4NL5A 2COLA 4WFYA 3FVYA 4DUZJ 3ET6B 4DV1I 1V3RA 1CPZA 1IWGA 3OL6A 5C0XE 1P9YA 3QIPA 2AX1A 4X66E 2MZJA 3OR1B 1CC7A 1JKHB 2LDYA 2OAUA 2VUGA 2LDIA 3LH2S 2UU9F 1RAGB 1YWXA 1Y7PA 2ZOGA 1QDUB 4PRFA 5HATA 1UL3A 2K1RB 1RUSA 4X64J 4UY8T 1S79A 2IIHA 4X4OA 5J2QB 2KFZA 3KLEB 4JUZA 1WC1A 2J76E 2MQLA 3BR8A 3GFYA 1GMVA 2IMOA 1NHKL 2CPXA 2YKNA 3BYPA 3PM9A 1SCJB 3OVBA 3JTOA 5GAEI 5IXUA 1VMBA 2Z2YB 1J5OA 2JEBA 4IRCA 1SPBP 2UXBF 3KWMA 3QYYA 1FJGI 4YY3F 4FYDA 1N33E 3JAMY 4FW9A 4DUZI 1R8CA 1RDRA 5CABA 4RO0A 2W8KA 2ADCA 1XC9A 2OEMA 4ZPTR 3ZZOA 3KLVA 1AUSL 1BQNB 2B7BB 2HWIA 5C7PA 3TZZA 5ETNA 3DHXA 4RNMA 3OJUA 3LWLA 4B3MF 2XMJA 5J2PA 5DRQA 2IJFA 5DRPA 2LQ5A 2UUAI 1WHXA 1EJ7L 1S6QA 1B99A 2JNJA 1R0AA 4S0MA 1HFEL 1ZAXA 1NK8A 2ZH2A 2RMLA 2WSCC 4DI6A 4E0DA 2R4FA 1SXLA 3RJMB 2NN6B 1HNXI 4LF9E 1HI1A 3KLGA 2P6SA 1UVKA 5K8NA 3MM5A 2CQ4A 4YHHJ 2XMUA 4USWA 3MEKA 3LPYA 2AQ4A 2KRBA 4ED4A 3OLBA 4P2FA 1Z4UA 3GE9A 3C6TA 2FIUA 4RNOA 3PR5B 3J81C 3CCLS 2VU5A 2GVZA 2ZE2B 4DJBA 5CCLA 2DGOA 3CWVA 1DTQB 3O3LA 2DD8S 2E1RA 2PFDA 2QMWA 2RS8A 3D1HA 4DUYF 4DL2A 4JV0A 2R7XA 2VG6A 3QT6A 1FD8A 1Y5IB 2BX6A 2C2ZB 2M3DA 1MU2A 3KUEA 2KHDA 5A8WA 2VONA 1Z0VA 4L3NA 4N8OA 1TK8A 1FFSB 1B0TA 3CB4A 1FTCA 2XS5A 1FRHA 1MROB 3N0VA 2MQMA 3PRDA 1WSVA 3NGRA 1DRZA 1VC6A 2CVIA 4TNOA 4Y2IA 3W5XA 4OMFG 2QFJA 1UEVA 2PD1A 1U1LA 5LMUF 4N76A 1PKPA 1DZ5A 3T1HE 3DXSX 2FY8A 2Q2EB 2DRDA 3D5MA 4MIWA 1RYSA 5EKWA 2QLBB 5C42B 5IWAF 5LXRA 2MZ1A 3ITHA 4P10A 1UWAA 4ZITA 3B78A 2Q6CA 5J2QA 2MMYA 2YNIB 1UMJA 1KHWA 3I56S 4JV5I 1FKOA 1OSDA 4B3SJ 4DSEA 1OQ3A 2OPPB 1IJFB 3UCZP 1U47A 2Z57B 2JEFA 3PKYA 1XEZA 4HT7A 4DR5J 1X5SA 4LR8A 3K89A 5BR8E 2HFNA 2RDJA 4KTQA 2Z58B 2HQ3A 2LEPA 4ZJOA 1UDNA 2N3OA 1U0HB 3EM1A 2ZBIA 3CMES 4P6QA 3GIIA 3AD9C 2LXIA 1UETA 1Y4ZB 2HFUA 4DLGA 1SJ3P 3MPYA 1RT2A 4LF9F 5J2PB 4X64I 1Z0CA 2XSFA 2B5JA 3W2WA 4MQYA 3UI3A 1RCXB 1VC0A 2HBQB 1FDBA 5HVFA 3ELHA 5T7LA 3K5MA 1I6JA 1EIYB 1MN9A 1HNWJ 4X64E 1V9OA 2J0WA 4LF4F 1B0PA 1JLFB 2MYFA 3C8YA 4KO0B 4DQRA 5E3QA 2CGEA 4J9VA 2K8GA 1JLFA 2HIQA 3ET6A 5E3AA 1X9WA 1WWHA 1MSWD 1BGXT 3IO1A 3TUJC 2WONA 2MJUA 3PRVA 4CLYA 5KFPA 4BS2A 2YWKA 1S99A 2NXUA 3BH7B 2HSEB 3PR4A 2D7SA 3CMQA 2B43A 2Z2MA 2Z56B 2YY3A 3QATA 4P52A 4EMDA 1KDNA 5A6WA 5F3TA 4IOCQ 1S97A 1N6QB 4Q45A 4YDXA 2I0XA 2J7KA 4JP8A 4OZEA 2FD2A 1S1VB 3K0JA 1N5SA 2YH1A 2HPUA 1MMDA 1RA6A 2BJ1A 1RT7B 2UV8A 3IGVA 4ID8A 5KFLA 4USMA 4F3OA 2PNZA 1HNWE 2WAQD 1QVFR 2IYIA 1T94A 5H9EJ 4FBTA 1CJKB 3DLJA 2CZ9A 3UW1A 5KG5A 4ZA1A 5LMUE 2IM1A 5D78A 3T1HI 4DV5J 1AFJA 1JLEA 1FRIA 3BBBA 3GLJA 1HMVB 4QYRA 2HS0A 2E5LI 3NOGA 5KFHA 5DDPC 2M2BA 3VAMA 4HKQA 4PU9A 3IWLA 2WK4A 3NP5A 4CCHA 1RTIA 4IH7A 2GA7A 3CSKA 6FD1A 3QFHA 2F4VJ 2YWHA 5K36C 4MU3A 5C42A 4WE1B 3OXLA 3IS9A 2XZDB 4KH0B 1X4GA 6AT1B 1IUJA 3VCDA 4H4KA 4NA2A 2KFYA 3MMBB 4CTAA 2BOPA 1K0VA 4Y28C 2QT7A 1SC6A 5KT6A 1H0HB 2B9YA 2WOMB 1MG7A 3FCVA 3KKFA 3QFWA 5RUBA 3J7ZT 1CSJA 1MW7A 1VBZA 1B62A 2AYEA 2QYGA 3OTDA 1HHSA 2PO1B 1F1BB 4CQ1A 4K0KI 2Y0SD 1KTVA 1S48A 3KG4A 1KEKA 2L48A 2P9EA 2YPYA 2OP5A 1HQ2A 2C3UA 4P2MA 2XG8A 2APOA 1FF2A 4MMOA 4XTTA 3DOKB 3Q8SB 3C16B 3N4WA 2B6AA 1TMMA 2FZGB 4USTA 4I1TA 4U7CA 4F2SA 2Z0GA 3OD2A 2HZCA 2IA6A 4I2QA 1BLUA 1ZM4A 3MTKA 4KO0A 3FCWA 1RTHB 2YTCA 2DHAA 2Q79A 3NS5A 3UNYA 4ZPBA 4OO1E 1Q8LA 1FVSA 4X62E 4BA1A 2FVRA 4KPCA 1RQ0A 2C37A 1FJGE 2LEAA 2DNPA 4B3TI 1EAYC 3A8JA 3GJRB 4M5JA 3OR1A 1MMLA 3T41A 1LWCA 1V5VA 4CZCA 2XYPB 2AJ4A 2X7IA 3DI6A 2OFGX 5E33A 3LTOA 2I6WA 3D28A 4B9LA 2A1BA 4LF8I 1CQNA 3F56A 2OSRA 1VJWA 2O66A 2YNFA 1RWKB 2N7CA 3V4IA 2XO6A 2PNZB 3H90A 3M2RA 3TJ9A 3MM6B 2D9PA 3TEHB 4Q0BB 1RK8A 1IKXB 3MUVP 4JBCA 1FXLA 1VISA 2OPQA 5IFMA 1R6VA 2ZNZA 1Y0HA 5B0DA 3LWMA 1UWBA 3D7SB 3K5OA 4ID5A 2BJEA 2QGFB 3L7OA 4JI4J 2KXHA 4HI2A 5BYSA 5ETOA 3QQCD 1AW0A 2DGTA 3CUNA 4LSNA 4ELUA 2BR0A 1U0HA 3GFHA 2D3O1 3MAAA 4NLYA 2FTRA 2BZ2A 2PI4A 1QM9A 3HSDA 3EVWA 5F9LA 1QTNB 1VBYA 1RABB 2YKPA 4B08A 3HMJG 1NK0A 4C0BA 1RHUB 3IC1A 3C2PA 1N5VA 2IHR1 4JG4A 2GC8A 3ADAC 3OFHA 4IRKA 2W4PA 3C66A 4W98A 5KFUA 3C14A 3UN5A 4LFCE 2GO8A 2ZH7A 4NOHA 1U7LA 1RWNB 4NASA 2OUGA 2Y1RI 1M5KC 4B3SF 3GTYX 2XYGB 3Q86A 3HVTA 1I1GA 2HIYA 2ZE2A 2HHTA 1WG4A 1IBMI 1Z5AA 2YKAA 4ALZA 4ED3A 3BREA 3LP2A 4XK8C 3Q23A 4MKAA 4LVNP 5DJBA 2W2NP 2RF2A 2X1FA 4JI7I 4F0MA 3KFWX 3QGIA 5JVGQ 2B9EA 2JFKA 2ZD1A 3NEKA 4CRJA 4LCFA 1S9EB 2GO4A 4B3RF 1X4DA 3HCXA 1CJKA 3MMCA 1FFGB 2BE7D 4IR1A 3OW2R 1HBMB 2YQ3A 2BE2A 2EKNA 2ZBRA 2R2SA 2J0XA 4X65E 2MHNA 3PCOB 1HMVA 4QWDA 3P45B 6FDRA 2A2DA 4DR2J 5F8HA 1H38A 2O1VA 3RBEA 2CADA 3H5YA 2VG7B 3EPGA 1R6YA 3CCES 1Q86T 4OZ3A 2B9WA 1UDOA 4JI4I 3HHNB 3TNVA 1FE0A 1H3DA 4F04B 2YKQA 3GG1A 3I6PA 3JB9k 2BVZA 4R0EA 4U96A 1VQSA 2OEKA 4IFYB 4ED1A 4LOMA 3IS9B 2M88A 3NG8A 4TXSA 2GJFA 2M0GB 3DNCA 1UA0A 3I0RB 4LF5J 4OL8A 4DV7I 3RYLA 4C11B 5KFNA 1FKOB 2FHJD 2BRLA 3OVSA 4Q0BA 2GMJA 4FXVA 2FY1A 1JJ2R 2F4VE 2E1MC 3L9ZA 5EUHA 2AE8A 3G6XA 3FC9A 2W24A 1SC4B 4LF5F 1HNZE 3O5TB 3F41A 2KO1A 1VLOA 4HHUA 4GRSA 2YWEA 3GILA 3ENWA 1N88A 5LMNJ 3B6BA 2EBGA 1BXNA 1V3SA 4DL5A 2XY5A 3PY8A 2UU9I 2LVWA 2DEJA 1Q95G 4CH1A 1R31A 4BC9A 4IYQA 1U25A 2P5VA 3MR5A 2L3MA 1DY3A 2O1PA 3KHGA 4KYZA 1DFDA 3GFZA 2HHXA 2P9CA 2R2UA 3HP6A 1U48A 4KQZA 5DRRA 1XNRE 3G4SS 2CDRB 4QIFA 2MLXA 4DV7J 4I6YA 4WF9Q 1HR0E 1JXEA 3NNCA 4A8XA 2MGZB 1Q0NA 2V9WA 4C4WA 2O1TA 2BACA 5E5NA 2MLZA 2DH7A 3RW6A 1X4BA 1XMOF 1XMQF 4GKKJ 2X1AA 3DM2B 2V5HG 2O1UA 1HD1A 1U49A 1FK9B 1TL7B 3R2CJ 2W9BB 5DNXA 1OO0B 3TZXA 1MNEA 4OO1D 1O0PA 2BABA 2C3PA 2RF2B 5HQLA 2XS2A 2F4VI 1OSCA 2OTLS 3EZUA 4WFAQ 2FHJA 4WUDA 1WC6A 2BA9A 4PWDB 2ZEJA 4OIXA 2VC0A 4RBVA 1IBKF 3EWGA 1JLCB 2BQUA 2VBXA 1PJ6A 2CG9A 9RUBA 3H2LA 4Y00A 1H7WA 2GV1A 3R9LA 4IS9A 4X62I 1T9XA 3KLFB 2DR9A 1BQNA 2VG7A 3EICA 1JXLA 3ZZTA 2OEJA 3M6WA 3DGPB 4OZ5A 2YWGA 5C24A 2VICA 3WU3A 2HVHA 3DOMA 3E01A 2ZM6I 2AJ2A 1OY6A 2ILYA 2Y1LB 3AT1B 3J80U 2PEHA 1FEHA 4ZVUB 4OX9I 2H65B 2EPIA 4N47A 4YY3J 3OTOF 3MAAB 2C22A 2DPIA 3ZNJ1 4WKRA 4GKJI 3DLGA 5ETRA 2MKKA 3IBCB 3CO0P 2VF3A 4KH1B 2YBVA 3TA1A 3UVJA 3M8PA 3EYZA 1PAUB 4DR7E 2RDIA 2V8DA 3G82A 3P5TL 4IFDD 1RJJA 3IBWA 1QZRA 3VV2B 1R6MA 1JLAB 4DPTA 3HVTB 4CO2A 2X51A 1CULA 1G3OA 3DXBA 3GYGA 4MFBA 3UQSA 2CPEA 4LUBA 4AXIA 5B7WA 4OYIA 4ZCIA 2H5EA 3B54A 3HZEA 5F8GA 3M8YA 4WFBQ 1ZPWX 2AW0A 5A8WB 2UUTA 3IM9A 5ETTA 1UDSA 4LFBI 3RRGA 2VG6B 1ROFA 1K0TA 2OPSB 2ACMA 3TW0A 3TUZC 1N34E 4P73A 5KG4A 2VQEJ 1O6XA 1ZBTA 3R1LA 3KRNA 4YY3I 4NPOA 4F4ZA 1D09B 4K4YA 2XBPA 4DR5I 2VFSA 2QA2A 3AQPA 2JJ4D 4B9MA 2UXCE 1LXNA 4P72A 4C2MA 4N56A 2MHEA 4HTJA 4LFAI 3W8PA 4FS1A 4UY85 1Q53A 1NM2A 1S9GB 1T9YA 2CPIA 1IR1A 4NMLA 5LM7E 2Y9HA 3D68A 5KFVA 3CCWA 2JVRA 4TY9A 5KG6A 1H6KX 1UJ6A 3DRYA 4CLSA 2NN6D 1VHIA 1J5EE 4PG5A 2YQ0A 5L38A 3PS2A 4WZMA 2WVBA 1LQ9A 1CJTA 1Q8IA 1TKTB 2BANB 4PG6A 4CM0A 3CJKB 4ER8A 2AD9A 3QJLA 4TQRA 4IFDB 1RTZA 2VB6A 2O5DA 3I5AA 3J7YU 4OFZA 3J80Q 1XNRJ 2XI2A 3GP9A 2K3IA 3PYDA 2GNKA 4ECYA 4OZLA 4ZHRA 4AL5A 2R7UA 2BA0G 4ID5B 5A2QQ 3SQGA 3NBPB 3MFIA 1IN0A 1SJ4P 4PRVA 1T9UA 1WJ9A 3OSPA 1LW2B 1T9VA 3NBPA 4AE5A 3H7HB 1X9SA 1KKHA 2G1DA 1ZH5A 2B56A 4HEA9 1S59A 1RT2B 4BBYA 4DV6E 4AM3A 3MCMA 2A10A 2E9RX 1JNRB 3THPA 2WW4A 4JV2A 3LUYA 5KT2A 3TVYA 4G1QA 1X0PA 2WVDA 3NRBA 3OXFA 3QGHA 3P3DA 1DQ8A 2QL7B 4R25A 1ZAVA 1Q8KA 2IJRA 3W8GA 3LP0A 3S6EA 1KP6A 4N41A 2OD6A 3H4LA 3JAMU 3RAQA 1FJCA 4HHJA 3PW4A 4V19J 3QJJA 2B3TB 2V4QA 1FVQA 4LFAJ 1TKDA 1S0OA 1VRUA 3F73A 2N82B 2CQ3A 2GQCA 3BN7A 3S7RA 4KR0B 2BM0A 4XO0A 4QU7A 1C0UB 1R7IA 1YDLA 2CPZA 2GQQA 1HWIA 1QJHA 2YX4A 3MAQA 2DNLA 3H5SA 4FF3A 4O0NA 1QLNA 2WVEA 4FYXB 4QNJA 3TARA 3POTA 4YR2A 4ETZA 5LSRA 4KC5A 4GKJJ 4LRFA 4A8FA 1UW9A 3IM8A 4G1PA 2KM8B 4CT8A 2Z30B 5IWAJ 1NJWA 3T6BA 1IM4A 1SH3A 1P42A 3KNAA 1XNQE 5KFCA 4YR3A 4QW8A 4LQ3A 1R8PA 3VAIA 4DQSA 3BKTA 5KT3A 1C4AA 3OL8A 1L3UA 1IKYB 4I0WA 4FWHA 4B3OA 1FCAA 4PZVA 1ZETA 2VQEF 5CZVA 3DGPA 4C9DA 1GEHA 2VHGA 4LF7J 3DHWC 2CZ4A 5DS7A 4MK9A 4LF4I 1N32J 1MN7A 5DQGA 2J5AA 2VQFE 3VALA 4CIOA 1M5HA 2B4OA 1OJ4A 4K4TA 3M8PB 2EK1A 2HK2A 3AODA 3PYGA 4PYAA 5DRKA 5KG0A 4QYZJ 3DLGB 4ZOSA 4WPAA 2AZ1A 1Z5BA 2QTWA 4NCGB 3H25A 1RAIB 1U6FA 3MEGA 3I0SA 1XIQA 1SKWA 3KK1A 4ILRA 4M63A 3C6UA 3CCZA 3QPIA 3AOCA 2CJQA 4M94A 5L39A 1YVFA 3G6ES 4DV6F 2Z5CB 4OV6A 3H42A 5DG8A 2G0JA 2MZTA 4I6AA 3B82A 4MYTA 3HD1A 2VPXB 1C2PA 3O6QA 1G7CB 4I2PB 3W2WB 4WU3A 2XS7A 3AD7C 3QNWB 2R7TA 1RT1B 2DR5A 2ZZMA 4QIWD 3QIPB 1XMBA 4ZP7A 1KQFB 1JLGB 5H9EK 4DR3E 3QRRA 3L95X 3IAS9 4LCGA 3PJXA 3FMWA 4PABA 4OZ2A 1KQKA 2FVCA 4D3GA 4U7UD 2MKJA 4WXOA 4DS5A 2KZZA 3KG1A 3UN3A 2DXFA 3K8VA 4LF8J 3R7SB 4CDIA 3J81Q 1P1TA 4GO5X 3NNHA 2HKEA 5FD1A 4DPUA 1UJ5A 4K2XA 2FZCB 3G8QA 3WDOA 4ED7A 5LMNI 1BQMA 2NYHA 3CDAA 3V4IB 3BEGB 4X65J 5J1NA 3OFFA 4B9UA 1UDQA 1OY8A 2CVEA 2HNYA 4UZBA 3CULA 2YXLA 3MM6A 3TYTA 1K9MT 1DBDA 4LF1A 7FD1A 2GHVC 1B4SA 1ACMB 4OZJA 4CLLA 5DQHA 1DJ0A 5BJRA 2HRUA 4DX5A 2Y8YA 1TUWA 2H5IB 1PYSB 2G0CA 4K5SA 4PCQA 1CQMA 4C98A 3HM9A 2HK3A 3DLEB 4MT1A 1YJNS 1SI9A 3MM9A 4X4QA 2DPJA 3DLEA 5I42B 4X84A 3VZIA 2A3JA 3BB5A 2CA9A 4YP3A 4JI5F 4KKOB 5JJBA 3L7ZA 2WP8B 5HO4A 2BA1D 4X4SA 5AXKA 1U6ZA 1NZAA 4NEYA 2H54B 4DPOA 2ZJPQ 4DUYI 2I5JB 1S6QB 1UPPA 2BDPA 4JI5J 2ZBPA 2ROGA 1RWUA 1FRJA 1FTRA 2J9EA 2ATCB 4ZMMA 3OLAA 1S6UA 3LP1B 4NLSA 2MKCA 2DGVA 3MAHA 1TAUA 2E7VA 4QPTA 5E41A 4RW7A 4O3OA 1DTQA 1PBAA 4HYMA 1TVRA 3KK1B 4UZCA 3CT9A 2JEJA 1M1GA 2GVZB 4O44B 3HO1A 3MM8B 3PYFA 4K4UA 2LA4A 1QTMA 3LW5C 1KWMA 3JS9A 4ZLJA 1HR0J 4DV7E 4LF8F 1HBOB 2FC8A 3CJSA 3A12A 4NXMF 2V67A 4LFAE 1JLBA 2DEIA 4ETXA 2MEWA 3FFIA 2J65A 2KI2A 1FDAA 3FFIB 1HBMA 3JSMB 2QLXA 3T9NA 3UD5A 2Z5BA 3PHTA 2CQIA 1Q7YT 1S12A 3EVMA 4USHA 3VQSA 2FVPA 4JI4E 1S9GA 4ECXA 1G4CA 2EWHA 2NUHA 3D4JA 2CWXA 3GMGA 1K44A 4WIIA 5CYQB 5EX0A 4ECSA 4DV4F 4DR3I 1QVGR 2UUAF 2DXDA 1AYEA 2DNZA 3O8WA 2E5LE 4WYLA 1TK0A 1U2RA 2LU1A 5KG2A 2WRMA 4A8WA 4FF4A 2AJQA 2J7UA 2MKYA 4XPCA 1Q1KA 2X3GA 2ZZNA 4NXMI 4JI7E 4ZVSB 4NBQA 3OTOI 1RAEB 4ZJQA 5IQ6A 5DLFA 1WHYA 1NKCA 2YKMB 1FI4A 3WHIA 1VYAA 2JFDA 2ZFHA 3M2RB 4CTAB 4DV1F 1U1QA 1Y9OA 4DR4J 2HHSA 1N32E 1CS4A 3I5CA 2DNNA 3NCPA 4GVBA 1WF0A 4NLUA 2MPUA 4DCPB 3E51A 5IT4A 4HI1A 3U02A 3MEGB 4M5HA 5DDOC 1Z1ZA 4L76A 3V6DA 3HF5A 1FA0A 2DH9A 3A3PB 3DC2A 2VQFF 3B4DA 3NS6A 2DNMA 3KJQB 3C6UB 1C0TB 4EUVA 1TUVA 4LSLB 4JI8F 2W1BA 3HHKA 3ILIA 4O3PA 4IQXA 1GFWB 3HJFA 3ENVA 3WQPA 1ZXMA 4ZVIA 2UUBE 1DQAA 3L7UA 3K1JA 1KRPA 1XHKA 1S76D 1DHMA 3D0GE 1HPZB 4WYWA 5D4OA 2V34A 4ANDA 2CUYA 4V1Ak 3PS3A 4LIWA 3U1LA 1W2IA 3NCQA 4YB1P 4I2QB 4K5RA 1ZTWA 4PQUA 3DLKB 3C14B 2RQCA 2OELA 3FKBA 3RZAA 5I3UB 1IKWA 3I32A 5DGBA 4NXNJ 2HQDA 3MECB 2CKWA 3VWSA 5BXIA 3SSRA 1J5EF 1QSSA 2HHUA 2L9NA 3R5AA 2RRNA 3M6XA 4RZRA 1DARA 3BDEA 5GAEU 3GQCA 2ZH5A 2ZJRQ 1QE1A 4DV0I 3FQLA 3LP2B 1OMSA 2J8SA 3MR6A 3RRKA 4UW2A 1QE1B 3PEJA 1C4CA 5IM0B 3TOQA 3NY0A 1DLOA 1LV5A 2ZOFA 4Y2KA 3BQ1A 3M05A 4IKAA 2UXCJ 4FKYA 1A6LA 3OJSA 5JXSA 2VKZG 4DEZA 4JOUA 3WU6A 4MDTA 3BDPA 1Y5YA 4B3TE 1JNZB 3HZGA 2BEFA 4E8UA 4X4NA 1X5OA 3CMAS 1FEEA 2W01A 5HVGA 4B3RE 4TU9A 3H4DA 3LQVA 1RP5A 4RW6A 4G65A 3CEDA 3D66A 1OPIA 1TKZA 4IZKA 5D15A 2CQHA 4F02A 4C8OA 4W4MA 4LBIA 5J1EA 2JLFA 1RAOA 3GIRA 5GAGU 3B4TA 2OGUA 3CCMS 2CNLB 2GJ2A 2KVIA 2A2CA 4JI0E 2FLOA 3M8QB 3MZIA 3MEDA 4RR5A 1OYSA 4FDFA 4WZQA 2AV5A 3D0HE 4LBHA 4CM2A 3G8SA 2QA4S 1NPKA 2E29A 3KXDA 3FEZA 4DL7A 3SEOA 2UUCE 4JI5E 1I51B 1R0BG 4IG3B 2PNMA 5ETVA 1CVJA 4P71A 4IG3A 4K0KE 5C25B 4M1KA 2Z5CA 4KT0C 4IZJD 1EP4B 1RREA 4H4OB 2I8EA 3OVAA 2R8IA 3ONQA 1C0TA 4DR7F 3TQEA 5FLXC 1RACB 4FPIA 3KK3B 2ZH1A 4I64A 4ZVTB 1H7SA 3FSIA 1YITS 4LR7A 2VFVA 2GMHA 2W4CA 2E7WA 4CH0S 2HHWA 4K2JA 1VQYA 4WJBA 1U45A 4QZVB 1JLQB 5E3CA 3M32B 3Q89A 2KDOA 3D67A 1BWVA 2HQIA 4WXWA 4QWBA 4IR9A 1UPMB 1VFJA 4LBPA 2QFIA 3TRGA 2VV5A 1HI8A 3CJ4A 2KXNB 3HVAA 2R2RA 3SV3A 1H2VZ 2Z5BB 4R5PB 3P06A 2HW3A 2GCFA 1Z2LA 4ZPDA 2DKOB 1WC3A 2BMBA 4YDDB 5DM6Q 4DL3A 5KFZA 4K4XA 3GR1A 3NKYA 3KK2B 3PW7A 3K17A 4X62J 1WELA 3VGSA 2FLNA 4C3LA 1LWCB 2J7WA 1UVMA 3M8ZA 5DDQC 1N34I 1Q8BA 1JIHA 4TQSA 1FJGJ 3IR5B 3OTCA 1O5JA 2QZ8A 2ZWOA 4QU6A 1F5AA 1SBRA 1Z0GA 4DR7J 3PDNA 2H48B 2QLWA 4CO0A 1UEUA 2XHCA 2HZVA 1IKXA 3PW2A 1KC8T 5KFTA 4YN3B 2DY9A 2KHCA 3GCMA 4OO1F 2R7QA 4GVBB 4HDHA 2B8PA 3CE8A 4H4MB 1CLFA 3J81U 2VESA 1NDPA 3PX4A 2DNYA 2RIJA 3JAMC 2GIRA 3VR1A 5IT0A 3OTOJ 2R7VA 4KKOA 3L7ZB 2PA3A 2PT0A 3PYEA 4DN9A 2HGLA 5ETSA 5KT4A 1YHQS 3BO2A 3W65A 3J81Y 4GKJE 4DR6I 1KQGB 3BH6B 5K9FA 1NSQA 2WNRB 3K5PA 5AXMA 1YBAA 2RNEA 2F9JA 3NWRA 4IH6A 2XM3A 2JWNA 4ED8A 5F8NA 3EMTA 4NX9A 3HKWA 2Z4PA 4DV2E 3UVJB 2NZ4A 4NXNI 3AAWB 1VBKA 1OPZA 2GVDB 2XTJP 3DLKA 2HLTA 3HX9A 3IG1B 5EWEA 4B3TF 1H2UX 3LP1A 2XCAA 2MQOA 1RWPB 1WF1A 4NA3A 2I2YA 4YFUA 5DG7A 1S0NA 4ZVPB 3M1VB 1NHIA 5IV4A 2NZCA 1TFWA 1PO6A 4MFBB 1UVIA 1F2HA 1Q5YA 3M8RA 2UXCF 1NK9A 3PS1A 3OL7A 2ZM6F 1VRUB 4O3NA 3QBCA 4OJHA 4X65F 2ZH8A 4DR4F 4Y65A 3LPSA 2MXYA 1KIJA 3WBZA 5L46A 3MCOA 5I3PA 1FXRA 1DLOB 3RGIA 2QMXA 3C15B 3KOAA 3CCVS 2ZBQA 1NKEA 1F3VA 1RADB 1YTYA 1RT3A 1S9EA 2EG1A 2FDNA 4DV7F 1FFWB 2ROPA 2AYBA 3FBBA 3M85G 1T03B 1TZ0A 2ZZTA 4ZIVA 3MD3A 1LW0A 2GMLA 4FP9A 1X60A 2AJFE 4UF4A 2UUCJ 2CJXB 1I5OB 4RW6B 3TZWA 4J9OA 1XNRI 2HAFA 2CPFA 3JXOA 4HR2A 5C0XA 2E1AA 3A3NB 3IWXA 3KUGA 5BYRA 3KLFA 2D3ZA 1WDTA 1CJUB 2FB0A 1SL1A 1GTHA 1GH8A 4C11A 3LAKA 3OTBA 4OKGA 4IFYA 4N8NA 1U1MA 2U1AA 2VBZA 3SSSA 4CLWA 3CC7S 3PKMA 1H7UA 4M5KA 4OX7A 2C2RA 4TVAB 4FW7A 2XSJA 2WHOA 3KDOA 4DR5F 4ECWA 1HR0F 1HW8A 3ZC4A 3H40A 4B3SI 1GX5A 2OHDA 1JWWA 2AGQA 1H73A 2FPHX 4P74A 1M5PC 4IFVA 1CS4B 4DQPA 4NMXA 2IVFB 1GQEA 1UTAA 3ICLA 5CH7B 3GCXP 5L9XA 3EZ5A 1VBXA 3LF0A 4KQVA 1U1RA 1AXQA 1H7XA 2HG4A 3QSIA 1LW2A 5ETKA 3ZTOA 1HNZJ 4FF2A 3P3EA 5GMDA 2RU3A 4K0KJ 2DR6A 1RBLA 4PWWA 2UUBF 5IT9U 3J80C 1APSA 1KBRA 5B0FA 1Z2ZA 1GTEA 1PC4A 3FJ2A 3I4HX 5HI7A 5KFMA 2GQ0A 2NXJA 3MOZA 1VQLS 5I4MA 2UUAE 2UXDI 1JLGA 2BR2B 2HMIA 2ALZA 1KLMB 1S6PA 4NRTA 3T1AA 3BO3A 2VZ9A 2J9DA 4HH0A 5F8JA 4OYAA 3BO4A 1RT4A 1Z59A 5E3RA 3I55S
chains in the Genus database with same CATH topology
2VL1A 4X66F 2NPFA 5KAKA 4TYAA 5KG3A 2IYGA 1CG2A 2AGPA 2DGSA 2B7CB 3QO9A 3N5FA 2ZJQQ 2HHVA 2QEXS 1IR0A 1SH0A 2Q3PA 4NLQA 2FVQA 1Q79A 4X4VA 2UXDF 4UQTA 3PW5A 2KJWA 1ZM9A 3BF4A 2EBEA 1HARA 4USJC 1RTIB 3IR7B 5EDWA 3OXGA 5M2PA 3FRYA 3ENQA 3IRWP 3N01A 5KFEA 2FJVA 2XLKA 4E98A 2GHWA 3EXCX 4N5SA 1GNKA 1TP7A 3TI0A 1HI0P 4JI1F 2VOPA 1GXLA 2EFVA 2ZZMA 1TR0A 4EBEA 1S72S 3E3XA 1VQ8S 3MEDB 2JVOA 3H2UB 2VA2A 2CQPA 2DO4A 3CDWA 3MM5B 3M9MB 1VQPS 4FXDA 3OTEA 2HNZB 2HVIA 2JH3A 3I0SB 2W9AA 4EGLA 2GQ2A 2QE5A 3BS9A 5KFFA 1QAIA 2R7OA 5E2QA 5C25A 5FDLA 1UKUA 1TVRB 1YRTA 4FF1A 3OR2B 2AX0A 4OI1A 1KOHA 3IGNA 5KFIA 5AXNA 4EBDA 1U26A 2B51A 3OR2A 2OPSA 5D3GA 4OZ1A 2IAJB 1YRXA 4NCBA 4GO7X 5KFAA 1T05B 3DOLB 2MSTA 1SH2A 1NHUA 1KLNA 2EFOA 3FEYB 5CA5A 4ED2A 3H59A 4I68A 5F3ZA 4OLOA 1SJQA 2UZAA 5KFXA 1HWKA 2QRRA 3HDSA 1ZOTA 3RW7A 3RB6A 5G0RA 4F8RA 4I6WA 3E8OA 4Y0FA 4DV5F 3U1NA 2R9LA 4EEYA 1KFDA 5GAHI 3K7RA 1BQMB 3FSYA 2HNYB 1U6BA 5A2QY 4KFBA 2NQPA 1GXUA 4ILLA 5CZXA 1IKVA 5H1SV 2XHWA 1C1CA 3IAM9 2K2PA 3K8WA 2OFHX 4IDKB 5D8HB 1S0MA 2W9CB 4IDKA 4DL0C 4F4KA 1BWEA 1T02A 1TV6B 1X5TA 3K2YA 3V6DB 4DF8A 3SXLA 2OJ3A 1X7VA 4QJVA 5AE1A 3VZHA 5ADZA 3N28A 1BC6A 2V4RA 1P27B 4PXBA 1HPZA 4FNIA 2XNQA 2C3MA 1N48A 5F8IA 3JYTB 2MKIA 1QAJA 4Q8EA 2EC0A 1RT4B 2F3JA 3QAEA 1KNZA 2DBBA 3SDEA 2FHKA 2XEXA 4LVOP 3WZ0A 2WSFC 5KFQA 4DV2F 4DS4A 3M2VA 1FNMA 2AU0A 4LJMA 2MQNA 5MAOA 1VBYA 4EBCA 3OFEA 4OI2A 3DM2A 4W92B 1FHTA 3PJWA 4UUWA 4MH8A 2CDQA 4XAKA 2XLJA 5KTQA 1H2TZ 1JLBB 3IR6B 3QO9B 5EX3A 4ECZA 1VQOS 4PUOA 1UP1A 2LECA 3M30B 4M5DA 4OLPA 4AFFA 3H5XA 3T3FA 3JSMA 5F41A 1UVNA 1VQ5S 3I9ZA 4NXNF 4CI0B 2CQCA 1U2FA 3RTVA 4LFCF 4O3SA 1YIJS 1ZM2A 5HP1A 3MFHA 1HNWF 4B3OB 4J9PA 5H9FJ 3R5DA 3GG0A 3T5LA 1U1KA 5J1EB 3AB4B 2BW2A 3UNGC 5A6PA 2R7RA 1VQMS 1D0EA 4HLBA 1TKZB 4RW9B 3MCSA 3OUYA 2M7SA 1URNA 2XY6A 2AYGA 1VLYA 2E66A 2RU9A 1Q16B 4ITSA 2NLWA 3ISNC 3KLHA 2OLWA 2QO3A 3HVRA 1K1SA 3I96A 1UFWA 3AJ2A 3TP2A 2L9WA 2V8GA 3PO4A 1DQ9A 4JI0F 1RTJA 1VQ4S 5B0CA 2KT5A 2OIHA 4XDDA 3PHEA 1QAYA 1KTQA 2UVWA 2XMWA 1OQ6A 2BM1A 2FJEB 3FQKA 4BC7A 3UR0A 1S6OA 2ZDPA 3DOLA 3D0IE 1LFPA 3H8YA 2IAJA 3GIKA 3BSNA 5KFOA 4EYIB 1TAQA 3TO8A 4K4SA 3M2UA 4TY8A 4DR2F 3MOJB 2DHGA 2JC1A 3MPVA 3I31A 2C2DA 1YJRA 3J7Z5 3Q2TC 4JYAF 4RNNA 3VAKA 7FDRA 2MY8A 2X1BA 2HFOA 1HD0A 3TAMB 4BDPA 2HLUA 2FLLA 3GV8B 2DNRA 2XMKA 2PIIA 5KFRA 3Q24A 2GJIA 4YUDA 3G9CA 1XR5A 4DR6F 4OI3A 3UDLA 3DYAA 3R5BA 4DSLA 4C8NA 1KSPA 3TQ1A 1N36F 4MTPA 4QQBA 1X0FA 3SFUA 2OPQB 1ZM3A 3NLCA 1HQEA 1C1CB 3KLIA 4DFKA 4KPYA 3TANA 4ZHRB 2W8LA 4NLRA 2D9OA 2JHEA 3G71S 4TKTA 3T5JA 1V3ZA 2MZRA 4X4UA 4O4RA 5LJ3Y 1WEXA 1RKIA 1N0VC 2IBKA 4IUFA 4MK8A 2VPZB 5B09A 1E6VA 1YSJA 2BRKA 5CHCB 4ZPAA 4C8LA 4OI6A 2PO4A 4ZVEA 3DU5A 3QAUA 1HBNA 1HBOA 3N6MA 2VH7A 4U67Q 4DSJA 1OWXA 3AHPA 3M2VB 3US5A 4QWCA 1A9NB 4JV5F 1ZYQA 3OFGA 4YQWA 2Q1LA 4Y2AA 3KK3A 4OJGA 3MTJA 2OPRB 2W7OA 4ECVA 1VQ9S 2FJAB 4Q44A 4N77A 4P7TA 3FMBA 5HBMB 3CD7A 4JV1A 4X62F 2HS3A 1X4FA 4A8MP 4EFAC 4KGMA 1VQ7S 3VF0B 4DUZF 4O3RA 2HRYA 2JL9A 2HVZA 2LXFA 4Y3CA 1LKZA 4BHQA 4KIAA 2KXFA 1EETA 4RUCA 3QMQA 3L09A 1NK4A 4MIAA 4PQAA 2R7WA 4ELTA 2M52A 2YKMA 2DHXA 1FJEB 1T3NA 3TUIC 4DL6A 3EGWB 2VD3A 3MI7X 3THVA 4K0KF 3EGNA 2ROEA 4KFBB 4ECRA 2FJBB 4AL6A 1IKVB 2EK6A 4KBIA 5HROA 1RAJA 4O4GB 3RB4A 2HGMA 5F0WA 3G96A 1KD1T 3ITHB 4O4GA 4A8YA 4A8KA 2L08A 5AXLA 3QIDA 2UVRA 3DRSB 2PA8D 4C8YA 2MKSA 1C1BB 2CYYA 2D3UA 2N4DA 4H54A 4QWEA 2DVIA 4DV0F 4JI7F 4J5OA 3HPOA 1FDNA 5KOXA 5A8RA 2AF6A 3T1HF 2ZBCA 3PRBA 4DL4A 4PQUB 4MAKA 5A0YA 1E6VB 5CQGA 1YJWS 4I67A 2LQJA 2ZDOA 4IG0B 5M2RA 2DR8A 4KHMA 2NUUG 2UUCF 3DN9A 4FZVA 4MYUA 2LQ9A 4JI4F 3I87A 4ZS6A 2XLIA 3TAMA 3DDKA 3AA9A 1VS3A 4AL7A 4DDFA 1M5VC 3GYNA 2KT2A 4KB7A 2WTFA 3B8HA 1YI2S 1HWUA 4QR0A 4KHRA 4F50A 4PXCA 4QOTA 5EN1A 2LA6A 3CCJS 1LW0B 2OO4A 3HHLC 2RQ4A 3QGGA 4MK7A 5KFGA 2O3DA 4ZCMA 1T7PA 3DFEA 1U4BA 1TQLA 4F67A 1S1TB 1WG5A 1M5OC 2N7YA 3MM9B 4IO1A 4RW9A 3OUYB 1FT8A 1FKAF 1IJEB 1JJHA 3FSXA 3SFGA 5T14A 1Y00A 2HFZA 2CPDA 4FS2A 4IH5A 1HWJA 2D74B 1JLEB 3OBIA 5EGYA 2HNZA 3CJ2A 4ZPCA 2ZOMA 3VAGA 2P9GA 2ZNYA 4AUKA 2JZ5A 2C3YA 2MY7A 3DRPA 4I69A 3V81B 3DLLQ 1IBMF 3N5BA 5KFWA 1P1LA 4ZP8A 5D4LA 2J6SA 3UDCA 3MM8A 4CH7A 4NLDA 2UV8G 5AJ3F 2IM2A 1WHWA 1FDDA 4YEAA 2DH8A 3VAFA 3M9OB 3QLHB 1MMNA 1TL4A 2XB2D 1IQZA 2J6UA 4PKDB 2D3OR 2YX7A 5KG7A 3JSYA 4RUAA 3PW0A 1P8GA 4PPDA 1L3SA 1W25A 4DLEA 4B9SA 2ZUGA 4QIVA 3H5UA 2MQQA 2VBYA 3WC0A 4EU0A 1ZZFA 4R5PA 1N5YA 2CZVC 2DT9A 2IFXA 2V4JA 5G0RB 1G6BA 2DRBA 1N4LA 2V4JB 1FRMA 1HL6A 2CQGA 2DRAA 3T19A 1NK7A 2DK2A 3RBDA 3DMJB 3OPKA 4IO9Q 1NB7A 1N56A 2JEIA 4YMEA 2M70A 2SXLA 4QW9A 1G1XA 2DISA 2AGOA 4USIA 5B0EA 4MKYA 1FESA 4OHXA 2BANA 3AY0A 3K5LA 1FXDA 1B64A 2XWYA 4MIBA 3HHLA 1SL0A 2XSJB 1HQUA 1TL1A 4K4WA 2EG2A 3N6NA 5HROB 4Q5VA 1BD6A 4RBTA 2QA1A 5DLGA 2YNGB 3BSCA 4OX6A 2MDAA 4GC7A 1RI7A 4M8LA 4FVMA 5MLCV 2MZSA 3G6YA 5B0GA 4HH1A 3WX4A 3ZZUA 1SB6A 3D2WA 1U8SA 2BQ3A 1XR7A 1V6HA 1VK8A 3UPFA 4OX8A 3RR8A 3AB2B 5KFDA 3TR5A 4JI3F 4NZ6A 1NAQA 1X4HA 3CO9A 3U27A 4NRUA 1UW4A 4NYZA 4IG0A 5LMNF 1R0AB 2YH0A 4FPRA 2KN4A 2IJNA 2ILZA 5K8OA 3ZZ0A 4R0JA 3MUTP 5KG1A 5IM0A 4OX9F 3QWUA 1RYRA 5FIIA 2KU7A 5GADI 3FZBA 3BM7A 4I7FA 5F9NA 3T6JA 2F7VA 2RD5C 4NLTA 5B08A 2E5JA 4LT6A 2GO9A 4FNHA 1S1TA 3GR0A 4RNHA 3W2VB