2VQEI

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqeI00
1FI4A 2UU9E 4UTGA 4LF7E 1XNRI 1Z0TA 4FWHA 5FLXC 1XNRE 4DPYA 2A2CA 4DV2E 1U2RA 1KVKA 4M1KA 2VF3A 3B78A 1N36I 1MU5A 1N33I 1N36E 4DV5I 1WUUA 5IWAI 1N34I 4LFBI 4DPXA 5IWAE 4MYUA 1N34E 4LFBE 1KIJA 2OI2A 4UT4A 2AJ4A 2UXDI 4LF6I 1H72C 4URLA 2WW4A 1HNWI 4USMA 1HNWE 3QT8A 2X7IA 5LL6R 4LF8E 4DR2I 4HY1A 4ZVIA 4DR4I 4DR2E 4DV7I 1XMQI 4NXNI 4DR6I 3CWVA 5LMUE 2VQFE 1XMQE 4NXNE 2HKJA 5BR8I 1KKHA 4DPTA 2V2VA 4PRXA 4DV4E 3J81C 4DR3I 1FKAE 4JI0E 4DR3E 4KHPE 1S4EA 2HFUA 4DV6I 4JI2I 4P52A 1HR0E 4JI2E 2F4VE 3T1YI 2BM1A 4DV0I 1XNQI 4LF9I 1NHIA 4DV0E 4LF9E 1B63A 4DR1I 3OTOE 1HNXE 3WU3A 3WU6A 1NHHA 5FLXQ 3J7AG 1Z0CA 1EA6A 1IBLI 1RR9A 1IBLE 1K47A 4JV5E 1DARA 1Z0BA 3V2UC 4X64I 2V2QA 4X64E 2HKEA 1UEKA 4X66E 2R42A 1H73A 4OX9E 1NHJA 1MX0A 4LF5I 1VISA 4LF5E 4KQVA 4YHHI 4HYMA 3HULA 2Q2EB 1QZRA 1XMOI 2VQEI 1XMOE 1HNZI 2UUAI 1MG7A 2UUAE 1PIEA 2V8PA 3PYEA 4B3SI 4X62I 1N33E 3Q1QA 1ZXNA 4DV5E 1FWKA 4DV3I 4DPWA 3J81Q 2UXDE 4DV3E 2HFSA 4LF6E 1B62A 4YY3I 3V5RA 4DR5I 4YY3E 3PYDA 1ZM9A 2DEIA 3JAMC 3LNUA 5GMEA 1N32I 1Z0WA 1I94I 4DU7A 3LTOA 1IBKI 2J7KA 4X65I 3J80C 1N32E 3ZKBA 4AQYI 4ED4A 3LPSA 4X65E 4JI6I 4DR4E 4JI3I 2HK2A 4DV7E 5GMDA 4HXZA 4DR6E 1Z0GA 5IT9C 5L3JA 5BR8E 1D6TA 4MYTA 5A2QQ 4B3MI 2HHHI 2HHHE 4WUCA 2A2DA 1EI1A 4DV6E 1N0UA 4WUBA 3F0NA 3ZZTA 4JI8I 4JI8E 3K1JA 3T1YE 1NZ0A 1XNQE 3H4LA 4JG4A 3B8HA 4DUZI 3D4JA 4DR1E 3QT5A 5LMNI 4JI7I 1Z5CA 4GKJI 4JI7E 2EFGA 2BM0A 4JYAI 4JYAE 5A2QC 4Z7YA 3WU4A 2LJPA 1Z59A 2UUCI 4NXMI 2UUCE 3ZZUA 4Z7CA 4JI1I 1A6FA 4JI1E 1S16A 4DU8A 4GKKI 2GS8A 4LFAI 1Z5AA 4RPFA 4LFAE 1H7UA 1KTVA 4B3TI 4B3TE 4FWGA 4EMDA 3JAMQ 2ZBKB 4YHHE 2DEJA 4HACA 4JI5I 4LFCI 4P7AA 4DPUA 3J80Q 4JI5E 1ELOA 2VQEE 2UU9I 1HNZE 4LF7I 2CZ9A 5IT9Q 4B3SE 1XHKA 4DUYI 4X62E 2ZM6I 4DUYE 2ZM6E 3M6AA 2NPFA 4DV2I 1PVGA 4I3HA 3WU5A 1Z0EA 4USKA 3QT7A 2X36A 1H7SA 4DR5E 1ZM3A 2V2ZA 2HK3A 1IBMI 1IBME 4K0KI 1I94E 4K0KE 1IBKE 4AQYE 4JI6E 3QT6A 4JI3E 4JI4I 4JI4E 2UXCI 1Z5BA 4B3ME 2UXCE 4FN5A 4LF8I 4WUDA 3ZKDA 1FJGI 3GONA 1FJGE 5LMUI 2VQFI 2UXBI 1RREA 2UXBE 3T1HI 3T1HE 3K17A 4DV4I 1J5EI 1BKNA 4JI0I 1ZM2A 1J5EE 4DUZE 4KHPI 1H74A 3PYGA 4XTJA 4B3RI 5LMNE 4B3RE 1HR0I 2F4VI 4GKJE 4DXLA 1Z0VA 4DV1I 4DV1E 2R3VA 1N0VC 4NXME 3OTOI 1HNXI 2XEXA 2E5LI 4PRVA 2E5LE 1ZXMA 2UUBI 3ZM7A 4LF4I 2UUBE 2E1RA 4FWDA 4LF4E 4FW9A 4GKKE 3J7AM 1FNMA 4R1FA 2ZITA 4JV5I 1PKPA 4PU9A 4X66I 1ZM4A 1FWLA 3B82A 3ZZ0A 4OX9I 4HACB 3PYFA 2BV3A 2V34A 4LFCE 4DR7I 4DR7E 1OJ4A
chains in the Genus database with same CATH superfamily
1FI4A 2UU9E 3M7NG 1OYPA 4UTGA 3U1KA 4LF7E 1XNRI 1Z0TA 3NZKA 4FWHA 5FLXC 1XNRE 4DPYA 2A2CA 2NN6F 4DV2E 1U2RA 1KVKA 2JE6B 4IZJB 4M1KA 1USVA 2VF3A 3B78A 1N36I 1MU5A 1N33I 1N36E 2O1TA 4OO1F 4DV5I 1HK7A 1WUUA 2VESA 5IWAI 1N34I 4LFBI 4DPXA 5IWAE 2F1DA 4MYUA 1N34E 4LFBE 1KIJA 2OI2A 4UT4A 2AJ4A 2UXDI 4LF6I 1H72C 5JEAD 4URLA 2WW4A 3U1YA 1HNWI 4USMA 1HNWE 4IFDD 4LPFA 3QT8A 4U3BA 2J65A 2CGEA 2X7IA 3M85D 5LL6R 1Y6ZA 2PNZA 4LF8E 2BA1G 3PS3A 4DR2I 4BA2B 4HY1A 3Q6NA 4ZVIA 4DR4I 4DR2E 4DV7I 1XMQI 4NXNI 4DR6I 3CWVA 4IS9A 2VQFE 5LMUE 1XMQE 4NXNE 3L7ZB 2PO1A 2HKJA 5BR8I 4FW7A 1KKHA 4DPTA 2V2VA 4PRXA 5K36B 1XXEA 1E3PA 3J81C 4DV4E 4DR3I 1FKAE 4JI0E 4DR3E 4KHPE 1S4EA 2Z5CA 2HFUA 4DV6I 4N3OA 1USUA 5JEAF 4JI2I 2CG9A 4P52A 1HR0E 4JI2E 2F4VE 3T1YI 2BM1A 4NBQA 2Z5EA 4DV0I 4LF9I 1XNQI 1NHIA 4DV0E 2IERA 4LF9E 4IFDF 5C0XB 1Y60A 1B63A 1UDQA 4DR1I 2C37A 3OTOE 1HNXE 3WU3A 3WU6A 2CVEA 1NHHA 5FLXQ 3J7AG 2Z5BB 3K85A 1Z0CA 4FW3A 2O3ZA 1EA6A 1IBLI 1RR9A 2JEBB 1IBLE 5C0XF 1K47A 4JV5E 1DARA 1Z0BA 3V2UC 2C39B 4X64I 2V2QA 4X64E 2PO0B 3KRNA 2HKEA 1UEKA 4X66E 2R42A 1H73A 4OX9E 1RHYA 1R6LA 1NHJA 2BR2B 2IESA 5DRRA 1MX0A 4LF5I 1VISA 5K36C 4LOMA 2GQ0A 4LF5E 3P3EA 2WNRB 2WP8A 1E3HA 4KQVA 4YHHI 4OO1B 4HYMA 3P76A 2PO2B 5K36E 3HULA 2Q2EB 4QNKA 1QZRA 1XMOI 2VQEI 1XMOE 4GQUA 2NN6A 1HNZI 2GO4A 5EL9A 2IOQA 2UUAI 2O1WA 1MG7A 2UUAE 1PIEA 2V8PA 4MQYA 3PYEA 4B3SI 4X62I 1N33E 4MU3A 3Q1QA 1ZXNA 5DNLA 4DV5E 4LCHA 2JEAB 1FWKA 4DV3I 4DPWA 3J81Q 2UXDE 4DV3E 2HFSA 4LF6E 1Y5YA 1B62A 2PNMA 3UHMA 2JE6A 4YY3I 3P06A 4IZJA 3V5RA 4DR5I 3Q6MA 4YY3E 3PYDA 1ZM9A 2DEIA 4AIDA 3JAMC 3CDJA 3LNUA 1YHCA 5GMEA 1UDOA 3HKMA 1N32I 1Z0WA 1I94I 4IZKB 4DU7A 3LTOA 2J7KA 3J80C 4X65I 1IBKI 1N32E 2AE8A 3ZKBA 4AQYI 4QNJA 1UDSA 3LPSA 4ED4A 4X65E 2NN6C 3M85G 4JI6I 4DR4E 4JI3I 2HK2A 4DV7E 5GMDA 4HXZA 4DR6E 1Z0GA 5IT9C 5JEAB 2IOPA 5L3JA 5BR8E 1R6MA 1OYRA 1D6TA 4MYTA 5A2QQ 4B3MI 2HHHI 2NN6E 2HHHE 2BA0D 4OKGA 4WUCA 4AIMA 4IFDB 2A2DA 1EI1A 2C38B 3GLLA 4DV6E 4BA2A 1N0UA 4WUBA 3F0NA 3ZZTA 4JI8I 3L7ZA 4JI8E 3K1JA 3T1YE 1NZ0A 1XNQE 3H4LA 5K36A 4JG4A 3B8HA 4DUZI 3D4JA 4DR1E 2O1UA 3QT5A 5LMNI 4JI7I 5EKWA 1Z5CA 4GKJI 4JI7E 2EFGA 2BM0A 2PNLA 4JYAI 4U3DA 4OZEA 5DRPA 4JYAE 5A2QC 4Z7YA 3WU4A 2LJPA 1Z59A 2UUCI 4NXMI 2UUCE 3ZZUA 5C0XA 1VI7A 4MU4A 4Z7CA 4JI1I 4BA1B 4MU1A 1A6FA 3CDIA 2NN6D 4JI1E 1S16A 4DU8A 2Z5BA 4GKKI 1Y4UA 2GS8A 5JEAC 4LFAI 1Z5AA 4RPFA 5FWKA 4LFAE 1H7UA 1KTVA 1P42A 4B3TI 2C39A 4B3TE 4FWGA 2PO0A 4EMDA 3JAMQ 4IZJD 2GO3A 2ZBKB 4YHHE 2DEJA 4HACA 4JI5I 4LFCI 1Y4SA 4P7AA 4DPUA 3J80Q 3M7ND 4JI5E 3DD6A 3PS1A 1ELOA 2BR2A 2VQEE 2UU9I 1HNZE 4FW5A 5C0XC 4LF7I 2CZ9A 3P3GA 5IT9Q 1XHKA 4B3SE 4DUYI 4X62E 2ZM6I 4DUYE 2ZM6E 3M6AA 2WNRA 2NPFA 4DV2I 4OO1A 1PVGA 4J3DA 4I3HA 5C0XE 2PO2A 3WU5A 1Z0EA 4USKA 3QT7A 2X36A 1H7SA 4DR5E 1ZM3A 2V2ZA 4MDTA 2HK3A 1IBMI 1IBME 2PNZB 2JEAA 4K0KI 3PS2A 1I94E 4K0KE 1IBKE 4AQYE 5DROA 4JI6E 5K36D 2PO1B 3QT6A 4JI3E 4ISAA 4JI4I 4LCGA 4JI4E 2BA1D 1UDNA 2UXCI 1Z5BA 4B3ME 2UXCE 4FN5A 4OO1C 4LF8I 2Z5CB 4WUDA 3ZKDA 4IZKA 1FJGI 2BA0G 3GONA 3GCMA 3HJCA 1FJGE 5LMUI 2VQFI 2UXBI 1RREA 3PRYA 5ELWA 5C0XD 2UXBE 4OO1E 3GMEA 5JEAA 3T1HI 3T1HE 3K17A 4DV4I 4FW4A 2C37B 1J5EI 1BKNA 4JI0I 3P3CA 1ZM2A 1J5EE 4DUZE 4KHPI 1H74A 4IFDA 1YH8A 3PYGA 4XTJA 2C38A 5LMNE 4B3RI 4B3RE 1HR0I 3B4TA 2F4VI 3H1CA 4GKJE 4DXLA 1Z0VA 5K36F 4DV1I 4DV1E 2R3VA 1N0VC 4NXME 3OTOI 1HNXI 5DNXA 2XEXA 2E5LI 4PRVA 2E5LE 1ZXMA 2UUBI 3ZM7A 4LF4I 2UUBE 2JT2A 2E1RA 4FWDA 4LF4E 4FW9A 4GKKE 3J7AM 1FNMA 4R1FA 2ZITA 4JV5I 4LCFA 2JEBA 1PKPA 4OO1D 5DRQA 4PU9A 4X66I 2WP8B 4IFDC 1ZM4A 5JEAE 4BA1A 2O1VA 1FWLA 3B82A 4FW6A 3ZZ0A 4HACB 4OX9I 3PYFA 2BV3A 2V34A 1OYSA 4LFCE 4AM3A 4DR7I 2NN6B 4IFDE 4DR7E 4MU0A 1OJ4A
chains in the Genus database with same CATH topology
1FI4A 2UU9E 4UTGA 4LF7E 1XNRI 1Z0TA 4FWHA 5FLXC 1XNRE 4DPYA 2A2CA 4DV2E 1U2RA 1KVKA 4IZJB 4M1KA 1USVA 2VF3A 3B78A 1N36I 1MU5A 1N33I 1N36E 2O1TA 4DV5I 1HK7A 1WUUA 5IWAI 1N34I 4LFBI 4DPXA 5IWAE 4MYUA 1N34E 4LFBE 1KIJA 2OI2A 4UT4A 2AJ4A 2UXDI 4LF6I 1H72C 4URLA 2WW4A 1HNWI 4USMA 1HNWE 3QT8A 2CGEA 2X7IA 5LL6R 1Y6ZA 4LF8E 4DR2I 4HY1A 3Q6NA 4ZVIA 4DR4I 4DR2E 4DV7I 1XMQI 4NXNI 4DR6I 3CWVA 5LMUE 2VQFE 1XMQE 4NXNE 2HKJA 5BR8I 1KKHA 4DPTA 2V2VA 4PRXA 4DV4E 3J81C 4DR3I 1FKAE 4JI0E 4DR3E 4KHPE 1S4EA 2Z5CA 2HFUA 4DV6I 4N3OA 1USUA 4JI2I 2CG9A 4P52A 1HR0E 4JI2E 2F4VE 3T1YI 2BM1A 4DV0I 2Z5EA 1XNQI 4LF9I 1NHIA 4DV0E 4LF9E 1B63A 4DR1I 3OTOE 1HNXE 3WU3A 3WU6A 1NHHA 5FLXQ 3J7AG 2Z5BB 3K85A 1Z0CA 1EA6A 1IBLI 1RR9A 1IBLE 1K47A 4JV5E 1DARA 1Z0BA 3V2UC 4X64I 2V2QA 4X64E 2HKEA 1UEKA 4X66E 2R42A 1H73A 4OX9E 1NHJA 1MX0A 4LF5I 1VISA 2GQ0A 4LF5E 4KQVA 4YHHI 4HYMA 3HULA 2Q2EB 1QZRA 1XMOI 2VQEI 1XMOE 1HNZI 2IOQA 2UUAI 2O1WA 1MG7A 2UUAE 1PIEA 2V8PA 3PYEA 4B3SI 4X62I 1N33E 3Q1QA 1ZXNA 4DV5E 1FWKA 4DV3I 4DPWA 3J81Q 2UXDE 4DV3E 2HFSA 4LF6E 1B62A 2PNMA 4YY3I 3P06A 4DR5I 4IZJA 3V5RA 3Q6MA 4YY3E 3PYDA 1ZM9A 2DEIA 3JAMC 3LNUA 5GMEA 1N32I 1Z0WA 1I94I 4IZKB 4DU7A 3LTOA 2J7KA 3J80C 4X65I 1IBKI 1N32E 3ZKBA 4AQYI 4ED4A 3LPSA 4X65E 4JI6I 4DR4E 4JI3I 2HK2A 4DV7E 5GMDA 4HXZA 4DR6E 1Z0GA 5IT9C 2IOPA 5L3JA 5BR8E 1D6TA 4MYTA 5A2QQ 4B3MI 2HHHI 2HHHE 4WUCA 2A2DA 1EI1A 4DV6E 1N0UA 4WUBA 3F0NA 3ZZTA 4JI8I 4JI8E 3K1JA 3T1YE 1NZ0A 1XNQE 3H4LA 4JG4A 3B8HA 4DUZI 3D4JA 4DR1E 2O1UA 3QT5A 5LMNI 4JI7I 1Z5CA 4GKJI 4JI7E 2EFGA 2BM0A 2PNLA 4JYAI 4JYAE 5A2QC 4Z7YA 3WU4A 2LJPA 1Z59A 2UUCI 4NXMI 2UUCE 3ZZUA 4Z7CA 4JI1I 1A6FA 4JI1E 1S16A 4DU8A 2Z5BA 4GKKI 1Y4UA 2GS8A 4LFAI 1Z5AA 4RPFA 5FWKA 4LFAE 1H7UA 1KTVA 4B3TI 4B3TE 4FWGA 4EMDA 3JAMQ 4IZJD 2ZBKB 4YHHE 2DEJA 4HACA 4JI5I 4LFCI 1Y4SA 4P7AA 4DPUA 3J80Q 4JI5E 1ELOA 2VQEE 2UU9I 1HNZE 4LF7I 2CZ9A 5IT9Q 1XHKA 4B3SE 4DUYI 4X62E 2ZM6I 4DUYE 2ZM6E 3M6AA 2NPFA 4DV2I 1PVGA 4I3HA 3WU5A 1Z0EA 4USKA 3QT7A 2X36A 1H7SA 4DR5E 1ZM3A 2V2ZA 2HK3A 1IBMI 1IBME 4K0KI 1I94E 4K0KE 1IBKE 4AQYE 4JI6E 3QT6A 4JI3E 4JI4I 4JI4E 2UXCI 1Z5BA 4B3ME 2UXCE 4FN5A 4LF8I 2Z5CB 4WUDA 3ZKDA 4IZKA 1FJGI 3GONA 3HJCA 1FJGE 5LMUI 2VQFI 2UXBI 1RREA 3PRYA 2UXBE 3T1HI 3T1HE 3K17A 4DV4I 1J5EI 1BKNA 4JI0I 1ZM2A 1J5EE 4DUZE 4KHPI 1H74A 3PYGA 4XTJA 4B3RI 5LMNE 4B3RE 1HR0I 2F4VI 4GKJE 4DXLA 1Z0VA 4DV1I 4DV1E 2R3VA 1N0VC 4NXME 3OTOI 1HNXI 2XEXA 2E5LI 4PRVA 2E5LE 1ZXMA 2UUBI 3ZM7A 4LF4I 2UUBE 2E1RA 4FWDA 4LF4E 4FW9A 4GKKE 3J7AM 1FNMA 4R1FA 2ZITA 4JV5I 1PKPA 4PU9A 4X66I 1ZM4A 2O1VA 1FWLA 3B82A 3ZZ0A 4OX9I 4HACB 3PYFA 2BV3A 2V34A 4LFCE 4DR7I 4DR7E 1OJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FI4 A;  2UU9 E;  4UTG A;  4LF7 E;  1XNR I;  1Z0T A;  4FWH A;  5FLX C;  1XNR E;  4DPY A;  2A2C A;  4DV2 E;  1U2R A;  1KVK A;  4M1K A;  2VF3 A;  3B78 A;  1N36 I;  1MU5 A;  1N33 I;  1N36 E;  4DV5 I;  1WUU A;  5IWA I;  1N34 I;  4LFB I;  4DPX A;  5IWA E;  4MYU A;  1N34 E;  4LFB E;  1KIJ A;  2OI2 A;  4UT4 A;  2AJ4 A;  2UXD I;  4LF6 I;  1H72 C;  4URL A;  2WW4 A;  1HNW I;  4USM A;  1HNW E;  3QT8 A;  2X7I A;  5LL6 R;  4LF8 E;  4DR2 I;  4HY1 A;  4ZVI A;  4DR4 I;  4DR2 E;  4DV7 I;  1XMQ I;  4NXN I;  4DR6 I;  3CWV A;  5LMU E;  2VQF E;  1XMQ E;  4NXN E;  2HKJ A;  5BR8 I;  1KKH A;  4DPT A;  2V2V A;  4PRX A;  4DV4 E;  3J81 C;  4DR3 I;  1FKA E;  4JI0 E;  4DR3 E;  4KHP E;  1S4E A;  2HFU A;  4DV6 I;  4JI2 I;  4P52 A;  1HR0 E;  4JI2 E;  2F4V E;  3T1Y I;  2BM1 A;  4DV0 I;  1XNQ I;  4LF9 I;  1NHI A;  4DV0 E;  4LF9 E;  1B63 A;  4DR1 I;  3OTO E;  1HNX E;  3WU3 A;  3WU6 A;  1NHH A;  5FLX Q;  3J7A G;  1Z0C A;  1EA6 A;  1IBL I;  1RR9 A;  1IBL E;  1K47 A;  4JV5 E;  1DAR A;  1Z0B A;  3V2U C;  4X64 I;  2V2Q A;  4X64 E;  2HKE A;  1UEK A;  4X66 E;  2R42 A;  1H73 A;  4OX9 E;  1NHJ A;  1MX0 A;  4LF5 I;  1VIS A;  4LF5 E;  4KQV A;  4YHH I;  4HYM A;  3HUL A;  2Q2E B;  1QZR A;  1XMO I;  2VQE I;  1XMO E;  1HNZ I;  2UUA I;  1MG7 A;  2UUA E;  1PIE A;  2V8P A;  3PYE A;  4B3S I;  4X62 I;  1N33 E;  3Q1Q A;  1ZXN A;  4DV5 E;  1FWK A;  4DV3 I;  4DPW A;  3J81 Q;  2UXD E;  4DV3 E;  2HFS A;  4LF6 E;  1B62 A;  4YY3 I;  3V5R A;  4DR5 I;  4YY3 E;  3PYD A;  1ZM9 A;  2DEI A;  3JAM C;  3LNU A;  5GME A;  1N32 I;  1Z0W A;  1I94 I;  4DU7 A;  3LTO A;  1IBK I;  2J7K A;  4X65 I;  3J80 C;  1N32 E;  3ZKB A;  4AQY I;  4ED4 A;  3LPS A;  4X65 E;  4JI6 I;  4DR4 E;  4JI3 I;  2HK2 A;  4DV7 E;  5GMD A;  4HXZ A;  4DR6 E;  1Z0G A;  5IT9 C;  5L3J A;  5BR8 E;  1D6T A;  4MYT A;  5A2Q Q;  4B3M I;  2HHH I;  2HHH E;  4WUC A;  2A2D A;  1EI1 A;  4DV6 E;  1N0U A;  4WUB A;  3F0N A;  3ZZT A;  4JI8 I;  4JI8 E;  3K1J A;  3T1Y E;  1NZ0 A;  1XNQ E;  3H4L A;  4JG4 A;  3B8H A;  4DUZ I;  3D4J A;  4DR1 E;  3QT5 A;  5LMN I;  4JI7 I;  1Z5C A;  4GKJ I;  4JI7 E;  2EFG A;  2BM0 A;  4JYA I;  4JYA E;  5A2Q C;  4Z7Y A;  3WU4 A;  2LJP A;  1Z59 A;  2UUC I;  4NXM I;  2UUC E;  3ZZU A;  4Z7C A;  4JI1 I;  1A6F A;  4JI1 E;  1S16 A;  4DU8 A;  4GKK I;  2GS8 A;  4LFA I;  1Z5A A;  4RPF A;  4LFA E;  1H7U A;  1KTV A;  4B3T I;  4B3T E;  4FWG A;  4EMD A;  3JAM Q;  2ZBK B;  4YHH E;  2DEJ A;  4HAC A;  4JI5 I;  4LFC I;  4P7A A;  4DPU A;  3J80 Q;  4JI5 E;  1ELO A;  2VQE E;  2UU9 I;  1HNZ E;  4LF7 I;  2CZ9 A;  5IT9 Q;  4B3S E;  1XHK A;  4DUY I;  4X62 E;  2ZM6 I;  4DUY E;  2ZM6 E;  3M6A A;  2NPF A;  4DV2 I;  1PVG A;  4I3H A;  3WU5 A;  1Z0E A;  4USK A;  3QT7 A;  2X36 A;  1H7S A;  4DR5 E;  1ZM3 A;  2V2Z A;  2HK3 A;  1IBM I;  1IBM E;  4K0K I;  1I94 E;  4K0K E;  1IBK E;  4AQY E;  4JI6 E;  3QT6 A;  4JI3 E;  4JI4 I;  4JI4 E;  2UXC I;  1Z5B A;  4B3M E;  2UXC E;  4FN5 A;  4LF8 I;  4WUD A;  3ZKD A;  1FJG I;  3GON A;  1FJG E;  5LMU I;  2VQF I;  2UXB I;  1RRE A;  2UXB E;  3T1H I;  3T1H E;  3K17 A;  4DV4 I;  1J5E I;  1BKN A;  4JI0 I;  1ZM2 A;  1J5E E;  4DUZ E;  4KHP I;  1H74 A;  3PYG A;  4XTJ A;  4B3R I;  5LMN E;  4B3R E;  1HR0 I;  2F4V I;  4GKJ E;  4DXL A;  1Z0V A;  4DV1 I;  4DV1 E;  2R3V A;  1N0V C;  4NXM E;  3OTO I;  1HNX I;  2XEX A;  2E5L I;  4PRV A;  2E5L E;  1ZXM A;  2UUB I;  3ZM7 A;  4LF4 I;  2UUB E;  2E1R A;  4FWD A;  4LF4 E;  4FW9 A;  4GKK E;  3J7A M;  1FNM A;  4R1F A;  2ZIT A;  4JV5 I;  1PKP A;  4PU9 A;  4X66 I;  1ZM4 A;  1FWL A;  3B82 A;  3ZZ0 A;  4OX9 I;  4HAC B;  3PYF A;  2BV3 A;  2V34 A;  4LFC E;  4DR7 I;  4DR7 E;  1OJ4 A; 
#chains in the Genus database with same CATH topology
 1FI4 A;  2UU9 E;  3M7N G;  1OYP A;  4UTG A;  3U1K A;  4LF7 E;  1XNR I;  1Z0T A;  3NZK A;  4FWH A;  5FLX C;  1XNR E;  4DPY A;  2A2C A;  2NN6 F;  4DV2 E;  1U2R A;  1KVK A;  2JE6 B;  4IZJ B;  4M1K A;  1USV A;  2VF3 A;  3B78 A;  1N36 I;  1MU5 A;  1N33 I;  1N36 E;  2O1T A;  4OO1 F;  4DV5 I;  1HK7 A;  1WUU A;  2VES A;  5IWA I;  1N34 I;  4LFB I;  4DPX A;  5IWA E;  2F1D A;  4MYU A;  1N34 E;  4LFB E;  1KIJ A;  2OI2 A;  4UT4 A;  2AJ4 A;  2UXD I;  4LF6 I;  1H72 C;  5JEA D;  4URL A;  2WW4 A;  3U1Y A;  1HNW I;  4USM A;  1HNW E;  4IFD D;  4LPF A;  3QT8 A;  4U3B A;  2J65 A;  2CGE A;  2X7I A;  3M85 D;  5LL6 R;  1Y6Z A;  2PNZ A;  4LF8 E;  2BA1 G;  3PS3 A;  4DR2 I;  4BA2 B;  4HY1 A;  3Q6N A;  4ZVI A;  4DR4 I;  4DR2 E;  4DV7 I;  1XMQ I;  4NXN I;  4DR6 I;  3CWV A;  4IS9 A;  2VQF E;  5LMU E;  1XMQ E;  4NXN E;  3L7Z B;  2PO1 A;  2HKJ A;  5BR8 I;  4FW7 A;  1KKH A;  4DPT A;  2V2V A;  4PRX A;  5K36 B;  1XXE A;  1E3P A;  3J81 C;  4DV4 E;  4DR3 I;  1FKA E;  4JI0 E;  4DR3 E;  4KHP E;  1S4E A;  2Z5C A;  2HFU A;  4DV6 I;  4N3O A;  1USU A;  5JEA F;  4JI2 I;  2CG9 A;  4P52 A;  1HR0 E;  4JI2 E;  2F4V E;  3T1Y I;  2BM1 A;  4NBQ A;  2Z5E A;  4DV0 I;  4LF9 I;  1XNQ I;  1NHI A;  4DV0 E;  2IER A;  4LF9 E;  4IFD F;  5C0X B;  1Y60 A;  1B63 A;  1UDQ A;  4DR1 I;  2C37 A;  3OTO E;  1HNX E;  3WU3 A;  3WU6 A;  2CVE A;  1NHH A;  5FLX Q;  3J7A G;  2Z5B B;  3K85 A;  1Z0C A;  4FW3 A;  2O3Z A;  1EA6 A;  1IBL I;  1RR9 A;  2JEB B;  1IBL E;  5C0X F;  1K47 A;  4JV5 E;  1DAR A;  1Z0B A;  3V2U C;  2C39 B;  4X64 I;  2V2Q A;  4X64 E;  2PO0 B;  3KRN A;  2HKE A;  1UEK A;  4X66 E;  2R42 A;  1H73 A;  4OX9 E;  1RHY A;  1R6L A;  1NHJ A;  2BR2 B;  2IES A;  5DRR A;  1MX0 A;  4LF5 I;  1VIS A;  5K36 C;  4LOM A;  2GQ0 A;  4LF5 E;  3P3E A;  2WNR B;  2WP8 A;  1E3H A;  4KQV A;  4YHH I;  4OO1 B;  4HYM A;  3P76 A;  2PO2 B;  5K36 E;  3HUL A;  2Q2E B;  4QNK A;  1QZR A;  1XMO I;  2VQE I;  1XMO E;  4GQU A;  2NN6 A;  1HNZ I;  2GO4 A;  5EL9 A;  2IOQ A;  2UUA I;  2O1W A;  1MG7 A;  2UUA E;  1PIE A;  2V8P A;  4MQY A;  3PYE A;  4B3S I;  4X62 I;  1N33 E;  4MU3 A;  3Q1Q A;  1ZXN A;  5DNL A;  4DV5 E;  4LCH A;  2JEA B;  1FWK A;  4DV3 I;  4DPW A;  3J81 Q;  2UXD E;  4DV3 E;  2HFS A;  4LF6 E;  1Y5Y A;  1B62 A;  2PNM A;  3UHM A;  2JE6 A;  4YY3 I;  3P06 A;  4IZJ A;  3V5R A;  4DR5 I;  3Q6M A;  4YY3 E;  3PYD A;  1ZM9 A;  2DEI A;  4AID A;  3JAM C;  3CDJ A;  3LNU A;  1YHC A;  5GME A;  1UDO A;  3HKM A;  1N32 I;  1Z0W A;  1I94 I;  4IZK B;  4DU7 A;  3LTO A;  2J7K A;  3J80 C;  4X65 I;  1IBK I;  1N32 E;  2AE8 A;  3ZKB A;  4AQY I;  4QNJ A;  1UDS A;  3LPS A;  4ED4 A;  4X65 E;  2NN6 C;  3M85 G;  4JI6 I;  4DR4 E;  4JI3 I;  2HK2 A;  4DV7 E;  5GMD A;  4HXZ A;  4DR6 E;  1Z0G A;  5IT9 C;  5JEA B;  2IOP A;  5L3J A;  5BR8 E;  1R6M A;  1OYR A;  1D6T A;  4MYT A;  5A2Q Q;  4B3M I;  2HHH I;  2NN6 E;  2HHH E;  2BA0 D;  4OKG A;  4WUC A;  4AIM A;  4IFD B;  2A2D A;  1EI1 A;  2C38 B;  3GLL A;  4DV6 E;  4BA2 A;  1N0U A;  4WUB A;  3F0N A;  3ZZT A;  4JI8 I;  3L7Z A;  4JI8 E;  3K1J A;  3T1Y E;  1NZ0 A;  1XNQ E;  3H4L A;  5K36 A;  4JG4 A;  3B8H A;  4DUZ I;  3D4J A;  4DR1 E;  2O1U A;  3QT5 A;  5LMN I;  4JI7 I;  5EKW A;  1Z5C A;  4GKJ I;  4JI7 E;  2EFG A;  2BM0 A;  2PNL A;  4JYA I;  4U3D A;  4OZE A;  5DRP A;  4JYA E;  5A2Q C;  4Z7Y A;  3WU4 A;  2LJP A;  1Z59 A;  2UUC I;  4NXM I;  2UUC E;  3ZZU A;  5C0X A;  1VI7 A;  4MU4 A;  4Z7C A;  4JI1 I;  4BA1 B;  4MU1 A;  1A6F A;  3CDI A;  2NN6 D;  4JI1 E;  1S16 A;  4DU8 A;  2Z5B A;  4GKK I;  1Y4U A;  2GS8 A;  5JEA C;  4LFA I;  1Z5A A;  4RPF A;  5FWK A;  4LFA E;  1H7U A;  1KTV A;  1P42 A;  4B3T I;  2C39 A;  4B3T E;  4FWG A;  2PO0 A;  4EMD A;  3JAM Q;  4IZJ D;  2GO3 A;  2ZBK B;  4YHH E;  2DEJ A;  4HAC A;  4JI5 I;  4LFC I;  1Y4S A;  4P7A A;  4DPU A;  3J80 Q;  3M7N D;  4JI5 E;  3DD6 A;  3PS1 A;  1ELO A;  2BR2 A;  2VQE E;  2UU9 I;  1HNZ E;  4FW5 A;  5C0X C;  4LF7 I;  2CZ9 A;  3P3G A;  5IT9 Q;  1XHK A;  4B3S E;  4DUY I;  4X62 E;  2ZM6 I;  4DUY E;  2ZM6 E;  3M6A A;  2WNR A;  2NPF A;  4DV2 I;  4OO1 A;  1PVG A;  4J3D A;  4I3H A;  5C0X E;  2PO2 A;  3WU5 A;  1Z0E A;  4USK A;  3QT7 A;  2X36 A;  1H7S A;  4DR5 E;  1ZM3 A;  2V2Z A;  4MDT A;  2HK3 A;  1IBM I;  1IBM E;  2PNZ B;  2JEA A;  4K0K I;  3PS2 A;  1I94 E;  4K0K E;  1IBK E;  4AQY E;  5DRO A;  4JI6 E;  5K36 D;  2PO1 B;  3QT6 A;  4JI3 E;  4ISA A;  4JI4 I;  4LCG A;  4JI4 E;  2BA1 D;  1UDN A;  2UXC I;  1Z5B A;  4B3M E;  2UXC E;  4FN5 A;  4OO1 C;  4LF8 I;  2Z5C B;  4WUD A;  3ZKD A;  4IZK A;  1FJG I;  2BA0 G;  3GON A;  3GCM A;  3HJC A;  1FJG E;  5LMU I;  2VQF I;  2UXB I;  1RRE A;  3PRY A;  5ELW A;  5C0X D;  2UXB E;  4OO1 E;  3GME A;  5JEA A;  3T1H I;  3T1H E;  3K17 A;  4DV4 I;  4FW4 A;  2C37 B;  1J5E I;  1BKN A;  4JI0 I;  3P3C A;  1ZM2 A;  1J5E E;  4DUZ E;  4KHP I;  1H74 A;  4IFD A;  1YH8 A;  3PYG A;  4XTJ A;  2C38 A;  5LMN E;  4B3R I;  4B3R E;  1HR0 I;  3B4T A;  2F4V I;  3H1C A;  4GKJ E;  4DXL A;  1Z0V A;  5K36 F;  4DV1 I;  4DV1 E;  2R3V A;  1N0V C;  4NXM E;  3OTO I;  1HNX I;  5DNX A;  2XEX A;  2E5L I;  4PRV A;  2E5L E;  1ZXM A;  2UUB I;  3ZM7 A;  4LF4 I;  2UUB E;  2JT2 A;  2E1R A;  4FWD A;  4LF4 E;  4FW9 A;  4GKK E;  3J7A M;  1FNM A;  4R1F A;  2ZIT A;  4JV5 I;  4LCF A;  2JEB A;  1PKP A;  4OO1 D;  5DRQ A;  4PU9 A;  4X66 I;  2WP8 B;  4IFD C;  1ZM4 A;  5JEA E;  4BA1 A;  2O1V A;  1FWL A;  3B82 A;  4FW6 A;  3ZZ0 A;  4HAC B;  4OX9 I;  3PYF A;  2BV3 A;  2V34 A;  1OYS A;  4LFC E;  4AM3 A;  4DR7 I;  2NN6 B;  4IFD E;  4DR7 E;  4MU0 A;  1OJ4 A; 
#chains in the Genus database with same CATH homology
 1FI4 A;  2UU9 E;  4UTG A;  4LF7 E;  1XNR I;  1Z0T A;  4FWH A;  5FLX C;  1XNR E;  4DPY A;  2A2C A;  4DV2 E;  1U2R A;  1KVK A;  4IZJ B;  4M1K A;  1USV A;  2VF3 A;  3B78 A;  1N36 I;  1MU5 A;  1N33 I;  1N36 E;  2O1T A;  4DV5 I;  1HK7 A;  1WUU A;  5IWA I;  1N34 I;  4LFB I;  4DPX A;  5IWA E;  4MYU A;  1N34 E;  4LFB E;  1KIJ A;  2OI2 A;  4UT4 A;  2AJ4 A;  2UXD I;  4LF6 I;  1H72 C;  4URL A;  2WW4 A;  1HNW I;  4USM A;  1HNW E;  3QT8 A;  2CGE A;  2X7I A;  5LL6 R;  1Y6Z A;  4LF8 E;  4DR2 I;  4HY1 A;  3Q6N A;  4ZVI A;  4DR4 I;  4DR2 E;  4DV7 I;  1XMQ I;  4NXN I;  4DR6 I;  3CWV A;  5LMU E;  2VQF E;  1XMQ E;  4NXN E;  2HKJ A;  5BR8 I;  1KKH A;  4DPT A;  2V2V A;  4PRX A;  4DV4 E;  3J81 C;  4DR3 I;  1FKA E;  4JI0 E;  4DR3 E;  4KHP E;  1S4E A;  2Z5C A;  2HFU A;  4DV6 I;  4N3O A;  1USU A;  4JI2 I;  2CG9 A;  4P52 A;  1HR0 E;  4JI2 E;  2F4V E;  3T1Y I;  2BM1 A;  4DV0 I;  2Z5E A;  1XNQ I;  4LF9 I;  1NHI A;  4DV0 E;  4LF9 E;  1B63 A;  4DR1 I;  3OTO E;  1HNX E;  3WU3 A;  3WU6 A;  1NHH A;  5FLX Q;  3J7A G;  2Z5B B;  3K85 A;  1Z0C A;  1EA6 A;  1IBL I;  1RR9 A;  1IBL E;  1K47 A;  4JV5 E;  1DAR A;  1Z0B A;  3V2U C;  4X64 I;  2V2Q A;  4X64 E;  2HKE A;  1UEK A;  4X66 E;  2R42 A;  1H73 A;  4OX9 E;  1NHJ A;  1MX0 A;  4LF5 I;  1VIS A;  2GQ0 A;  4LF5 E;  4KQV A;  4YHH I;  4HYM A;  3HUL A;  2Q2E B;  1QZR A;  1XMO I;  2VQE I;  1XMO E;  1HNZ I;  2IOQ A;  2UUA I;  2O1W A;  1MG7 A;  2UUA E;  1PIE A;  2V8P A;  3PYE A;  4B3S I;  4X62 I;  1N33 E;  3Q1Q A;  1ZXN A;  4DV5 E;  1FWK A;  4DV3 I;  4DPW A;  3J81 Q;  2UXD E;  4DV3 E;  2HFS A;  4LF6 E;  1B62 A;  2PNM A;  4YY3 I;  3P06 A;  4DR5 I;  4IZJ A;  3V5R A;  3Q6M A;  4YY3 E;  3PYD A;  1ZM9 A;  2DEI A;  3JAM C;  3LNU A;  5GME A;  1N32 I;  1Z0W A;  1I94 I;  4IZK B;  4DU7 A;  3LTO A;  2J7K A;  3J80 C;  4X65 I;  1IBK I;  1N32 E;  3ZKB A;  4AQY I;  4ED4 A;  3LPS A;  4X65 E;  4JI6 I;  4DR4 E;  4JI3 I;  2HK2 A;  4DV7 E;  5GMD A;  4HXZ A;  4DR6 E;  1Z0G A;  5IT9 C;  2IOP A;  5L3J A;  5BR8 E;  1D6T A;  4MYT A;  5A2Q Q;  4B3M I;  2HHH I;  2HHH E;  4WUC A;  2A2D A;  1EI1 A;  4DV6 E;  1N0U A;  4WUB A;  3F0N A;  3ZZT A;  4JI8 I;  4JI8 E;  3K1J A;  3T1Y E;  1NZ0 A;  1XNQ E;  3H4L A;  4JG4 A;  3B8H A;  4DUZ I;  3D4J A;  4DR1 E;  2O1U A;  3QT5 A;  5LMN I;  4JI7 I;  1Z5C A;  4GKJ I;  4JI7 E;  2EFG A;  2BM0 A;  2PNL A;  4JYA I;  4JYA E;  5A2Q C;  4Z7Y A;  3WU4 A;  2LJP A;  1Z59 A;  2UUC I;  4NXM I;  2UUC E;  3ZZU A;  4Z7C A;  4JI1 I;  1A6F A;  4JI1 E;  1S16 A;  4DU8 A;  2Z5B A;  4GKK I;  1Y4U A;  2GS8 A;  4LFA I;  1Z5A A;  4RPF A;  5FWK A;  4LFA E;  1H7U A;  1KTV A;  4B3T I;  4B3T E;  4FWG A;  4EMD A;  3JAM Q;  4IZJ D;  2ZBK B;  4YHH E;  2DEJ A;  4HAC A;  4JI5 I;  4LFC I;  1Y4S A;  4P7A A;  4DPU A;  3J80 Q;  4JI5 E;  1ELO A;  2VQE E;  2UU9 I;  1HNZ E;  4LF7 I;  2CZ9 A;  5IT9 Q;  1XHK A;  4B3S E;  4DUY I;  4X62 E;  2ZM6 I;  4DUY E;  2ZM6 E;  3M6A A;  2NPF A;  4DV2 I;  1PVG A;  4I3H A;  3WU5 A;  1Z0E A;  4USK A;  3QT7 A;  2X36 A;  1H7S A;  4DR5 E;  1ZM3 A;  2V2Z A;  2HK3 A;  1IBM I;  1IBM E;  4K0K I;  1I94 E;  4K0K E;  1IBK E;  4AQY E;  4JI6 E;  3QT6 A;  4JI3 E;  4JI4 I;  4JI4 E;  2UXC I;  1Z5B A;  4B3M E;  2UXC E;  4FN5 A;  4LF8 I;  2Z5C B;  4WUD A;  3ZKD A;  4IZK A;  1FJG I;  3GON A;  3HJC A;  1FJG E;  5LMU I;  2VQF I;  2UXB I;  1RRE A;  3PRY A;  2UXB E;  3T1H I;  3T1H E;  3K17 A;  4DV4 I;  1J5E I;  1BKN A;  4JI0 I;  1ZM2 A;  1J5E E;  4DUZ E;  4KHP I;  1H74 A;  3PYG A;  4XTJ A;  4B3R I;  5LMN E;  4B3R E;  1HR0 I;  2F4V I;  4GKJ E;  4DXL A;  1Z0V A;  4DV1 I;  4DV1 E;  2R3V A;  1N0V C;  4NXM E;  3OTO I;  1HNX I;  2XEX A;  2E5L I;  4PRV A;  2E5L E;  1ZXM A;  2UUB I;  3ZM7 A;  4LF4 I;  2UUB E;  2E1R A;  4FWD A;  4LF4 E;  4FW9 A;  4GKK E;  3J7A M;  1FNM A;  4R1F A;  2ZIT A;  4JV5 I;  1PKP A;  4PU9 A;  4X66 I;  1ZM4 A;  2O1V A;  1FWL A;  3B82 A;  3ZZ0 A;  4OX9 I;  4HAC B;  3PYF A;  2BV3 A;  2V34 A;  4LFC E;  4DR7 I;  4DR7 E;  1OJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...