2VQEI

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqeI00
3PYDA 2UU9I 2VQEE 4KHPE 4GKJI 5BR8I 4NXNE 1I94I 5LMUE 2F4VE 4LFBE 2E1RA 2UUCE 5IT9Q 1ZM9A 4DPXA 4DV3E 3OTOI 3WU3A 3ZZ0A 4DU7A 2UU9E 3QT6A 1XMOE 1H7SA 4GKJE 5BR8E 4DV6I 4NXMI 1KKHA 2HFSA 4B3SI 1I94E 3PYGA 2UXBI 4HXZA 4KQVA 2DEJA 1Z0EA 2VF3A 3OTOE 1PKPA 2V2QA 4DV6E 3WU4A 4RPFA 1NHIA 2WW4A 4NXME 4B3SE 1PIEA 2HHHI 4DV4I 2UXBE 4JI8I 1FWKA 1UEKA 1ZXMA 4MYTA 3T1YI 2BM0A 5L3JA 3D4JA 4JG4A 4JI0I 4HACA 4WUBA 4PU9A 1NHHA 4JI5E 2A2CA 2J7KA 4P7AA 1Z5AA 3QT5A 4DV7I 2HHHE 2BV3A 4DV4E 4HACB 4JI8E 4PRXA 2ZM6E 1MX0A 5LMNE 3T1YE 4LF6I 4DV5I 4X65E 2E5LI 4XTJA 4MYUA 4DV2I 2A2DA 4DPTA 2VQEI 4LFAI 1N0VC 3B8HA 1K47A 4NXNI 2GS8A 5LMUI 1ELOA 3JAMC 2NPFA 4WUDA 1S16A 4DR2I 1FNMA 2EFGA 1N34I 4USKA 4DR4I 4LF6E 4USMA 1Z0CA 2E5LE 4B3RI 1U2RA 4LF9I 4DR5I 1HNWE 5LL6R 4X66I 4DV2E 1FWLA 1Z0TA 1XMOI 4ED4A 4LFAE 1DARA 4FWGA 1MG7A 4Z7YA 4DR2E 1IBLI 4UT4A 1FJGI 2HK2A 1N34E 4LF7I 4DR4E 3M6AA 3ZZTA 3V2UC 4JI7I 4B3RE 4LF9E 4DR5E 4DXLA 2HFUA 4X66E 4R1FA 1N36I 2R3VA 1HR0I 4M1KA 2UUAI 3LNUA 2AJ4A 4DPYA 5FLXC 1KVKA 1RR9A 4JI2I 2ZBKB 1A6FA 1BKNA 4AQYI 1IBLE 1FJGE 3ZZUA 4LF7E 4K0KI 1H72C 1PVGA 4DUZI 4B3MI 1Z0BA 4JI7E 4DUYI 4DR6I 3B78A 1N36E 2HKJA 4EMDA 4JI5I 1HR0E 2UUAE 4I3HA 1XNRE 4DR3I 2X36A 1NZ0A 3ZM7A 1HNZI 4B3TI 4JI2E 1N33I 1NHJA 4DU8A 1FI4A 1EI1A 4AQYE 2LJPA 4LF8I 2V2VA 1B62A 2ZM6I 4K0KE 5LMNI 4DUZE 4B3ME 2ZITA 4PRVA 4DUYE 4JYAI 1Z0WA 4DR6E 4DV0I 4X65I 2UXDI 1J5EI 4X64E 4HY1A 3JAMQ 4DR3E 1HNZE 4B3TE 4X62I 1N33E 3J81C 3Q1QA 4LF8E 2BM1A 5IWAI 2XEXA 4YHHI 1ZXNA 4JYAE 4DV0E 2UXDE 1J5EE 4URLA 2VQFI 4Z7CA 3F0NA 2CZ9A 3CWVA 1HNWI 2HKEA 4P52A 4X62E 4LF4I 4JI4E 4LF5I 4JI6I 1H73A 4ZVIA 3J7AG 3T1HE 5IWAE 4YHHE 5FLXQ 4DR1I 2VQFE 1N32E 4LF4E 4FWDA 4FWHA 2UXCI 1RREA 4LF5E 4JI6E 1Z0GA 3J80C 2R42A 4HYMA 3J7AM 3H4LA 4YY3I 4DR1E 1XNQE 1Z0VA 2UUBI 3QT7A 2Q2EB 2V2ZA 2UXCE 3K17A 1XNRI 4LFCI 1Z5BA 4YY3E 4DPWA 3J81Q 3QT8A 2UUBE 2HK3A 1KTVA 1ZM3A 5A2QC 4X64I 1WUUA 4JI3I 4DR7I 4JI1I 1H7UA 4OX9I 5GMDA 4LFCE 1Z5CA 2V34A 1IBMI 4DV1I 2DEIA 3PYEA 1QZRA 3HULA 1IBKI 1D6TA 1EA6A 1HNXI 1Z59A 3ZKDA 5IT9C 1KIJA 4JI3E 4DR7E 4JI1E 4FN5A 4OX9E 3ZKBA 3LPSA 5GMEA 4JI4I 1MU5A 3WU6A 4WUCA 3PYFA 1IBME 4DV1E 3T1HI 1OJ4A 1S4EA 4FW9A 1IBKE 1HNXE 2V8PA 1H74A 1N0UA 3K1JA 3J80Q 1N32I 2OI2A 1VISA 3V5RA 1XHKA 3B82A 4JI0E 4GKKI 1XMQI 3WU5A 4JV5I 1XNQI 1FKAE 4DPUA 4KHPI 4DV7E 3GONA 3LTOA 1B63A 2F4VI 2X7IA 4LFBI 4UTGA 2UUCI 4GKKE 5A2QQ 1ZM4A 4DV3I 4DV5E 1XMQE 1ZM2A 4JV5E
chains in the Genus database with same CATH superfamily
2NN6B 3PYDA 3K85A 2UU9I 5EKWA 2VQEE 4KHPE 4IZJB 4GKJI 5BR8I 2O3ZA 3U1KA 1Y6ZA 2VESA 4NXNE 1I94I 5K36F 5LMUE 2F4VE 3GMEA 4LFBE 5K36A 2E1RA 2UUCE 5IT9Q 1ZM9A 4FW3A 4DPXA 4DV3E 3OTOI 3WU3A 1Y4UA 3ZZ0A 4OO1B 4DU7A 2UU9E 3QT6A 1XMOE 1H7SA 3M85D 4GKJE 2IOQA 5BR8E 4DV6I 3M85G 4NXMI 1KKHA 2HFSA 4B3SI 1I94E 2JEAA 3PYGA 1YH8A 4OZEA 2UXBI 4HXZA 4KQVA 2DEJA 1Z0EA 2VF3A 3OTOE 3B4TA 1PKPA 2PO2B 4ISAA 2V2QA 4LOMA 2WP8A 3CDIA 3PS1A 3WU4A 4DV6E 4RPFA 1NHIA 2WW4A 4NXME 4B3SE 1PIEA 2HHHI 4MU3A 4DV4I 2UXBE 4JI8I 1FWKA 1UEKA 1ZXMA 4MYTA 5C0XF 5DNXA 2BM0A 2BR2A 3T1YI 5L3JA 3D4JA 4JG4A 4MU1A 4OKGA 4JI0I 5C0XA 2PNZA 4HACA 2C38B 4WUBA 3H1CA 4PU9A 4IZKA 1NHHA 4JI5E 5DRQA 2A2CA 1E3PA 2J7KA 4P7AA 1Z5AA 2BR2B 3QT5A 4DV7I 2HHHE 1UDSA 1UDOA 5C0XB 2BV3A 2PNZB 4DV4E 4HACB 4JI8E 4MDTA 1USVA 4PRXA 2ZM6E 1MX0A 5LMNE 4IZKB 3T1YE 2O1TA 4LCHA 4IFDF 4MQYA 4LF6I 4DV5I 4X65E 2E5LI 4XTJA 5JEAD 4IFDA 4MYUA 4DV2I 2A2DA 4DPTA 2VQEI 2F1DA 2NN6F 4LFAI 1N0VC 3B8HA 2IESA 1K47A 3DD6A 4NXNI 2GS8A 5LMUI 1ELOA 2O1UA 3JAMC 5DRRA 2NPFA 4WUDA 1S16A 4DR2I 1FNMA 2EFGA 1N34I 4USKA 4DR4I 4LF6E 4USMA 1Z0CA 2JE6A 2E5LE 4B3RI 1U2RA 4LF9I 4AIDA 4DR5I 1HNWE 5LL6R 4X66I 1Y5YA 4DV2E 1FWLA 1Z0TA 1XMOI 4ED4A 4LFAE 4OO1F 1DARA 2C37A 4FWGA 4OO1A 1MG7A 3NZKA 4Z7YA 2JE6B 4DR2E 1IBLI 4UT4A 1FJGI 2HK2A 1N34E 4LF7I 4DR4E 1E3HA 3M6AA 2Z5EA 3ZZTA 3V2UC 4JI7I 4B3RE 4LF9E 4DR5E 4DXLA 2C37B 1OYPA 2HFUA 5JEAE 4X66E 4R1FA 1N36I 2R3VA 5K36D 1HR0I 4M1KA 2UUAI 3LNUA 2AJ4A 2C39A 2PO2A 4DPYA 5FLXC 1KVKA 1RR9A 4JI2I 2ZBKB 4AIMA 1A6FA 1BKNA 1XXEA 4LPFA 4AQYI 1IBLE 1FJGE 2CG9A 3ZZUA 4LF7E 4K0KI 1H72C 1PVGA 4DUZI 4B3MI 1Z0BA 4JI7E 4DUYI 2C39B 4DR6I 3B78A 1N36E 4IS9A 2HKJA 4EMDA 4JI5I 1HR0E 2UUAE 1HK7A 4I3HA 3KRNA 1XNRE 4DR3I 2X36A 1NZ0A 2C38A 3ZM7A 1HNZI 4B3TI 4JI2E 1N33I 4FW6A 1NHJA 4DU8A 1FI4A 1EI1A 4AQYE 2LJPA 1Y60A 3L7ZB 4LF8I 5JEAC 2V2VA 1B62A 2ZM6I 4K0KE 2PNMA 5LMNI 4DUZE 2Z5CA 4B3ME 2ZITA 4PRVA 1VI7A 4DUYE 5DNLA 4JYAI 1Z0WA 4DR6E 4DV0I 4X65I 2UXDI 1J5EI 4X64E 4HY1A 3JAMQ 2WNRA 5K36E 2Z5BA 4DR3E 1HNZE 1OYRA 4B3TE 4X62I 1N33E 2Z5CB 3J81C 3Q1QA 1RHYA 4J3DA 4LF8E 2NN6C 2BM1A 5IWAI 2XEXA 4YHHI 1ZXNA 2WNRB 4N3OA 4JYAE 2Z5BB 4NBQA 2GQ0A 4DV0E 2UXDE 1J5EE 4URLA 2VQFI 4Z7CA 3F0NA 3PS3A 2CZ9A 2GO3A 3CWVA 1HNWI 2HKEA 4P52A 3PRYA 5FWKA 4X62E 1R6LA 4LF4I 4JI4E 4LF5I 4JI6I 1H73A 4ZVIA 3J7AG 3T1HE 4IFDD 4BA1A 4QNKA 5IWAE 4YHHE 5K36C 5FLXQ 4DR1I 2VQFE 2JEBA 2NN6D 1N32E 3P3CA 4IZJD 5DRPA 2BA0D 4LF4E 4FWDA 4BA1B 4FWHA 2BA0G 2UXCI 2J65A 1RREA 4LF5E 4JI6E 3Q6MA 4BA2A 1Z0GA 5C0XE 3J80C 2PO1A 2JEBB 2R42A 4HYMA 3J7AM 1P42A 3H4LA 2PO0A 2IERA 4YY3I 4DR1E 1XNQE 4OO1D 1Z0VA 1UDNA 2UUBI 4BA2B 1OYSA 3QT7A 2PNLA 2Q2EB 2PO1B 2V2ZA 2UXCE 3K17A 4MU4A 2PO0B 1XNRI 4LFCI 3GLLA 4IFDE 1Z5BA 4AM3A 4YY3E 3GCMA 4DPWA 5EL9A 2JT2A 3J81Q 3L7ZA 3QT8A 2NN6E 2UUBE 2HK3A 5C0XC 1KTVA 1ZM3A 5K36B 5A2QC 4X64I 4FW5A 4FW7A 1WUUA 4JI3I 4DR7I 4JI1I 3HJCA 1H7UA 4LCFA 2CVEA 2O1VA 4OX9I 5GMDA 4LFCE 1Z5CA 2V34A 1IBMI 4FW4A 4DV1I 1YHCA 3P3EA 2DEIA 3PYEA 1QZRA 3HULA 1IBKI 1Y4SA 1D6TA 2JEAB 3HKMA 1EA6A 1HNXI 4OO1E 1Z59A 3ZKDA 5IT9C 2IOPA 1KIJA 4JI3E 4IFDC 4DR7E 5DROA 4JI1E 4FN5A 1R6MA 4OX9E 3ZKBA 3LPSA 5GMEA 4GQUA 3P76A 4JI4I 1MU5A 3WU6A 5C0XD 4WUCA 3PYFA 1IBME 4DV1E 2WP8B 3T1HI 1OJ4A 4QNJA 1USUA 1S4EA 4FW9A 5ELWA 4MU0A 1IBKE 3CDJA 3U1YA 1HNXE 2V8PA 1H74A 1N0UA 3K1JA 3J80Q 1N32I 1UDQA 5JEAF 2OI2A 1VISA 3V5RA 2O1WA 5JEAA 4LCGA 3M7ND 2GO4A 1XHKA 3M7NG 2AE8A 3P06A 4OO1C 3B82A 4JI0E 4GKKI 1XMQI 3WU5A 4JV5I 2CGEA 5JEAB 2BA1D 1XNQI 1FKAE 2BA1G 4DPUA 4KHPI 2NN6A 4DV7E 3GONA 3LTOA 1B63A 3Q6NA 4IZJA 2F4VI 3PS2A 3P3GA 4U3DA 2X7IA 4IFDB 4LFBI 4UTGA 2UUCI 4U3BA 4GKKE 5A2QQ 1ZM4A 4DV3I 4DV5E 1XMQE 1ZM2A 3UHMA 4JV5E
chains in the Genus database with same CATH topology
3PYDA 3K85A 2UU9I 2VQEE 4KHPE 4IZJB 4GKJI 5BR8I 1Y6ZA 4NXNE 1I94I 5LMUE 2F4VE 4LFBE 2E1RA 2UUCE 5IT9Q 1ZM9A 4DPXA 4DV3E 3OTOI 3WU3A 1Y4UA 3ZZ0A 4DU7A 2UU9E 3QT6A 1XMOE 1H7SA 4GKJE 2IOQA 5BR8E 4DV6I 4NXMI 1KKHA 2HFSA 4B3SI 1I94E 3PYGA 2UXBI 4HXZA 4KQVA 2DEJA 1Z0EA 2VF3A 3OTOE 1PKPA 2V2QA 4DV6E 3WU4A 4RPFA 1NHIA 2WW4A 4NXME 4B3SE 1PIEA 2HHHI 4DV4I 2UXBE 4JI8I 1FWKA 1UEKA 1ZXMA 4MYTA 3T1YI 2BM0A 5L3JA 3D4JA 4JG4A 4JI0I 4HACA 4WUBA 4PU9A 4IZKA 1NHHA 4JI5E 2A2CA 2J7KA 4P7AA 1Z5AA 3QT5A 4DV7I 2HHHE 2BV3A 4DV4E 4HACB 4JI8E 1USVA 4PRXA 2ZM6E 1MX0A 5LMNE 4IZKB 3T1YE 2O1TA 4LF6I 4DV5I 4X65E 2E5LI 4XTJA 4MYUA 4DV2I 2A2DA 4DPTA 2VQEI 4LFAI 1N0VC 3B8HA 1K47A 4NXNI 2GS8A 5LMUI 1ELOA 2O1UA 3JAMC 2NPFA 4WUDA 1S16A 4DR2I 1FNMA 2EFGA 1N34I 4USKA 4DR4I 4LF6E 4USMA 1Z0CA 2E5LE 4B3RI 1U2RA 4LF9I 4DR5I 1HNWE 5LL6R 4X66I 4DV2E 1FWLA 1Z0TA 1XMOI 4ED4A 4LFAE 1DARA 4FWGA 1MG7A 4Z7YA 4DR2E 1IBLI 4UT4A 1FJGI 2HK2A 1N34E 4LF7I 4DR4E 3M6AA 2Z5EA 3ZZTA 3V2UC 4JI7I 4B3RE 4LF9E 4DR5E 4DXLA 2HFUA 4X66E 4R1FA 1N36I 2R3VA 1HR0I 4M1KA 2UUAI 3LNUA 2AJ4A 4DPYA 5FLXC 1KVKA 1RR9A 4JI2I 2ZBKB 1A6FA 1BKNA 4AQYI 1IBLE 1FJGE 2CG9A 3ZZUA 4LF7E 4K0KI 1H72C 1PVGA 4DUZI 4B3MI 1Z0BA 4JI7E 4DUYI 4DR6I 3B78A 1N36E 2HKJA 4EMDA 4JI5I 1HR0E 2UUAE 1HK7A 4I3HA 1XNRE 4DR3I 2X36A 1NZ0A 3ZM7A 1HNZI 4B3TI 4JI2E 1N33I 1NHJA 4DU8A 1FI4A 1EI1A 4AQYE 2LJPA 4LF8I 2V2VA 1B62A 2ZM6I 4K0KE 2PNMA 5LMNI 4DUZE 2Z5CA 4B3ME 2ZITA 4PRVA 4DUYE 4JYAI 1Z0WA 4DR6E 4DV0I 4X65I 2UXDI 1J5EI 4X64E 4HY1A 3JAMQ 2Z5BA 4DR3E 1HNZE 4B3TE 4X62I 1N33E 2Z5CB 3J81C 3Q1QA 4LF8E 2BM1A 5IWAI 2XEXA 4YHHI 1ZXNA 4N3OA 4JYAE 2Z5BB 2GQ0A 4DV0E 2UXDE 1J5EE 4URLA 2VQFI 4Z7CA 3F0NA 2CZ9A 3CWVA 1HNWI 2HKEA 4P52A 3PRYA 5FWKA 4X62E 4LF4I 4JI4E 4LF5I 4JI6I 1H73A 4ZVIA 3J7AG 3T1HE 5IWAE 4YHHE 5FLXQ 4DR1I 2VQFE 1N32E 4IZJD 4LF4E 4FWDA 4FWHA 2UXCI 1RREA 4LF5E 4JI6E 3Q6MA 1Z0GA 3J80C 2R42A 4HYMA 3J7AM 3H4LA 4YY3I 4DR1E 1XNQE 1Z0VA 2UUBI 3QT7A 2PNLA 2Q2EB 2V2ZA 2UXCE 3K17A 1XNRI 4LFCI 1Z5BA 4YY3E 4DPWA 3J81Q 3QT8A 2UUBE 2HK3A 1KTVA 1ZM3A 5A2QC 4X64I 1WUUA 4JI3I 4DR7I 4JI1I 3HJCA 1H7UA 4OX9I 2O1VA 5GMDA 4LFCE 1Z5CA 2V34A 1IBMI 4DV1I 2DEIA 3PYEA 1QZRA 3HULA 1IBKI 1Y4SA 1D6TA 1EA6A 1HNXI 1Z59A 3ZKDA 5IT9C 2IOPA 1KIJA 4JI3E 4DR7E 4JI1E 4FN5A 4OX9E 3ZKBA 3LPSA 5GMEA 4JI4I 1MU5A 3WU6A 4WUCA 3PYFA 1IBME 4DV1E 3T1HI 1OJ4A 1USUA 1S4EA 4FW9A 1IBKE 1HNXE 2V8PA 1H74A 1N0UA 3K1JA 3J80Q 1N32I 2OI2A 1VISA 3V5RA 2O1WA 1XHKA 3P06A 3B82A 4JI0E 4GKKI 1XMQI 3WU5A 4JV5I 2CGEA 1XNQI 1FKAE 4DPUA 4KHPI 4DV7E 3GONA 3LTOA 1B63A 3Q6NA 4IZJA 2F4VI 2X7IA 4LFBI 4UTGA 2UUCI 4GKKE 5A2QQ 1ZM4A 4DV3I 4DV5E 1XMQE 1ZM2A 4JV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYD A;  2UU9 I;  2VQE E;  4KHP E;  4GKJ I;  5BR8 I;  4NXN E;  1I94 I;  5LMU E;  2F4V E;  4LFB E;  2E1R A;  2UUC E;  5IT9 Q;  1ZM9 A;  4DPX A;  4DV3 E;  3OTO I;  3WU3 A;  3ZZ0 A;  4DU7 A;  2UU9 E;  3QT6 A;  1XMO E;  1H7S A;  4GKJ E;  5BR8 E;  4DV6 I;  4NXM I;  1KKH A;  2HFS A;  4B3S I;  1I94 E;  3PYG A;  2UXB I;  4HXZ A;  4KQV A;  2DEJ A;  1Z0E A;  2VF3 A;  3OTO E;  1PKP A;  2V2Q A;  4DV6 E;  3WU4 A;  4RPF A;  1NHI A;  2WW4 A;  4NXM E;  4B3S E;  1PIE A;  2HHH I;  4DV4 I;  2UXB E;  4JI8 I;  1FWK A;  1UEK A;  1ZXM A;  4MYT A;  3T1Y I;  2BM0 A;  5L3J A;  3D4J A;  4JG4 A;  4JI0 I;  4HAC A;  4WUB A;  4PU9 A;  1NHH A;  4JI5 E;  2A2C A;  2J7K A;  4P7A A;  1Z5A A;  3QT5 A;  4DV7 I;  2HHH E;  2BV3 A;  4DV4 E;  4HAC B;  4JI8 E;  4PRX A;  2ZM6 E;  1MX0 A;  5LMN E;  3T1Y E;  4LF6 I;  4DV5 I;  4X65 E;  2E5L I;  4XTJ A;  4MYU A;  4DV2 I;  2A2D A;  4DPT A;  2VQE I;  4LFA I;  1N0V C;  3B8H A;  1K47 A;  4NXN I;  2GS8 A;  5LMU I;  1ELO A;  3JAM C;  2NPF A;  4WUD A;  1S16 A;  4DR2 I;  1FNM A;  2EFG A;  1N34 I;  4USK A;  4DR4 I;  4LF6 E;  4USM A;  1Z0C A;  2E5L E;  4B3R I;  1U2R A;  4LF9 I;  4DR5 I;  1HNW E;  5LL6 R;  4X66 I;  4DV2 E;  1FWL A;  1Z0T A;  1XMO I;  4ED4 A;  4LFA E;  1DAR A;  4FWG A;  1MG7 A;  4Z7Y A;  4DR2 E;  1IBL I;  4UT4 A;  1FJG I;  2HK2 A;  1N34 E;  4LF7 I;  4DR4 E;  3M6A A;  3ZZT A;  3V2U C;  4JI7 I;  4B3R E;  4LF9 E;  4DR5 E;  4DXL A;  2HFU A;  4X66 E;  4R1F A;  1N36 I;  2R3V A;  1HR0 I;  4M1K A;  2UUA I;  3LNU A;  2AJ4 A;  4DPY A;  5FLX C;  1KVK A;  1RR9 A;  4JI2 I;  2ZBK B;  1A6F A;  1BKN A;  4AQY I;  1IBL E;  1FJG E;  3ZZU A;  4LF7 E;  4K0K I;  1H72 C;  1PVG A;  4DUZ I;  4B3M I;  1Z0B A;  4JI7 E;  4DUY I;  4DR6 I;  3B78 A;  1N36 E;  2HKJ A;  4EMD A;  4JI5 I;  1HR0 E;  2UUA E;  4I3H A;  1XNR E;  4DR3 I;  2X36 A;  1NZ0 A;  3ZM7 A;  1HNZ I;  4B3T I;  4JI2 E;  1N33 I;  1NHJ A;  4DU8 A;  1FI4 A;  1EI1 A;  4AQY E;  2LJP A;  4LF8 I;  2V2V A;  1B62 A;  2ZM6 I;  4K0K E;  5LMN I;  4DUZ E;  4B3M E;  2ZIT A;  4PRV A;  4DUY E;  4JYA I;  1Z0W A;  4DR6 E;  4DV0 I;  4X65 I;  2UXD I;  1J5E I;  4X64 E;  4HY1 A;  3JAM Q;  4DR3 E;  1HNZ E;  4B3T E;  4X62 I;  1N33 E;  3J81 C;  3Q1Q A;  4LF8 E;  2BM1 A;  5IWA I;  2XEX A;  4YHH I;  1ZXN A;  4JYA E;  4DV0 E;  2UXD E;  1J5E E;  4URL A;  2VQF I;  4Z7C A;  3F0N A;  2CZ9 A;  3CWV A;  1HNW I;  2HKE A;  4P52 A;  4X62 E;  4LF4 I;  4JI4 E;  4LF5 I;  4JI6 I;  1H73 A;  4ZVI A;  3J7A G;  3T1H E;  5IWA E;  4YHH E;  5FLX Q;  4DR1 I;  2VQF E;  1N32 E;  4LF4 E;  4FWD A;  4FWH A;  2UXC I;  1RRE A;  4LF5 E;  4JI6 E;  1Z0G A;  3J80 C;  2R42 A;  4HYM A;  3J7A M;  3H4L A;  4YY3 I;  4DR1 E;  1XNQ E;  1Z0V A;  2UUB I;  3QT7 A;  2Q2E B;  2V2Z A;  2UXC E;  3K17 A;  1XNR I;  4LFC I;  1Z5B A;  4YY3 E;  4DPW A;  3J81 Q;  3QT8 A;  2UUB E;  2HK3 A;  1KTV A;  1ZM3 A;  5A2Q C;  4X64 I;  1WUU A;  4JI3 I;  4DR7 I;  4JI1 I;  1H7U A;  4OX9 I;  5GMD A;  4LFC E;  1Z5C A;  2V34 A;  1IBM I;  4DV1 I;  2DEI A;  3PYE A;  1QZR A;  3HUL A;  1IBK I;  1D6T A;  1EA6 A;  1HNX I;  1Z59 A;  3ZKD A;  5IT9 C;  1KIJ A;  4JI3 E;  4DR7 E;  4JI1 E;  4FN5 A;  4OX9 E;  3ZKB A;  3LPS A;  5GME A;  4JI4 I;  1MU5 A;  3WU6 A;  4WUC A;  3PYF A;  1IBM E;  4DV1 E;  3T1H I;  1OJ4 A;  1S4E A;  4FW9 A;  1IBK E;  1HNX E;  2V8P A;  1H74 A;  1N0U A;  3K1J A;  3J80 Q;  1N32 I;  2OI2 A;  1VIS A;  3V5R A;  1XHK A;  3B82 A;  4JI0 E;  4GKK I;  1XMQ I;  3WU5 A;  4JV5 I;  1XNQ I;  1FKA E;  4DPU A;  4KHP I;  4DV7 E;  3GON A;  3LTO A;  1B63 A;  2F4V I;  2X7I A;  4LFB I;  4UTG A;  2UUC I;  4GKK E;  5A2Q Q;  1ZM4 A;  4DV3 I;  4DV5 E;  1XMQ E;  1ZM2 A;  4JV5 E; 
#chains in the Genus database with same CATH topology
 2NN6 B;  3PYD A;  3K85 A;  2UU9 I;  5EKW A;  2VQE E;  4KHP E;  4IZJ B;  4GKJ I;  5BR8 I;  2O3Z A;  3U1K A;  1Y6Z A;  2VES A;  4NXN E;  1I94 I;  5K36 F;  5LMU E;  2F4V E;  3GME A;  4LFB E;  5K36 A;  2E1R A;  2UUC E;  5IT9 Q;  1ZM9 A;  4FW3 A;  4DPX A;  4DV3 E;  3OTO I;  3WU3 A;  1Y4U A;  3ZZ0 A;  4OO1 B;  4DU7 A;  2UU9 E;  3QT6 A;  1XMO E;  1H7S A;  3M85 D;  4GKJ E;  2IOQ A;  5BR8 E;  4DV6 I;  3M85 G;  4NXM I;  1KKH A;  2HFS A;  4B3S I;  1I94 E;  2JEA A;  3PYG A;  1YH8 A;  4OZE A;  2UXB I;  4HXZ A;  4KQV A;  2DEJ A;  1Z0E A;  2VF3 A;  3OTO E;  3B4T A;  1PKP A;  2PO2 B;  4ISA A;  2V2Q A;  4LOM A;  2WP8 A;  3CDI A;  3PS1 A;  3WU4 A;  4DV6 E;  4RPF A;  1NHI A;  2WW4 A;  4NXM E;  4B3S E;  1PIE A;  2HHH I;  4MU3 A;  4DV4 I;  2UXB E;  4JI8 I;  1FWK A;  1UEK A;  1ZXM A;  4MYT A;  5C0X F;  5DNX A;  2BM0 A;  2BR2 A;  3T1Y I;  5L3J A;  3D4J A;  4JG4 A;  4MU1 A;  4OKG A;  4JI0 I;  5C0X A;  2PNZ A;  4HAC A;  2C38 B;  4WUB A;  3H1C A;  4PU9 A;  4IZK A;  1NHH A;  4JI5 E;  5DRQ A;  2A2C A;  1E3P A;  2J7K A;  4P7A A;  1Z5A A;  2BR2 B;  3QT5 A;  4DV7 I;  2HHH E;  1UDS A;  1UDO A;  5C0X B;  2BV3 A;  2PNZ B;  4DV4 E;  4HAC B;  4JI8 E;  4MDT A;  1USV A;  4PRX A;  2ZM6 E;  1MX0 A;  5LMN E;  4IZK B;  3T1Y E;  2O1T A;  4LCH A;  4IFD F;  4MQY A;  4LF6 I;  4DV5 I;  4X65 E;  2E5L I;  4XTJ A;  5JEA D;  4IFD A;  4MYU A;  4DV2 I;  2A2D A;  4DPT A;  2VQE I;  2F1D A;  2NN6 F;  4LFA I;  1N0V C;  3B8H A;  2IES A;  1K47 A;  3DD6 A;  4NXN I;  2GS8 A;  5LMU I;  1ELO A;  2O1U A;  3JAM C;  5DRR A;  2NPF A;  4WUD A;  1S16 A;  4DR2 I;  1FNM A;  2EFG A;  1N34 I;  4USK A;  4DR4 I;  4LF6 E;  4USM A;  1Z0C A;  2JE6 A;  2E5L E;  4B3R I;  1U2R A;  4LF9 I;  4AID A;  4DR5 I;  1HNW E;  5LL6 R;  4X66 I;  1Y5Y A;  4DV2 E;  1FWL A;  1Z0T A;  1XMO I;  4ED4 A;  4LFA E;  4OO1 F;  1DAR A;  2C37 A;  4FWG A;  4OO1 A;  1MG7 A;  3NZK A;  4Z7Y A;  2JE6 B;  4DR2 E;  1IBL I;  4UT4 A;  1FJG I;  2HK2 A;  1N34 E;  4LF7 I;  4DR4 E;  1E3H A;  3M6A A;  2Z5E A;  3ZZT A;  3V2U C;  4JI7 I;  4B3R E;  4LF9 E;  4DR5 E;  4DXL A;  2C37 B;  1OYP A;  2HFU A;  5JEA E;  4X66 E;  4R1F A;  1N36 I;  2R3V A;  5K36 D;  1HR0 I;  4M1K A;  2UUA I;  3LNU A;  2AJ4 A;  2C39 A;  2PO2 A;  4DPY A;  5FLX C;  1KVK A;  1RR9 A;  4JI2 I;  2ZBK B;  4AIM A;  1A6F A;  1BKN A;  1XXE A;  4LPF A;  4AQY I;  1IBL E;  1FJG E;  2CG9 A;  3ZZU A;  4LF7 E;  4K0K I;  1H72 C;  1PVG A;  4DUZ I;  4B3M I;  1Z0B A;  4JI7 E;  4DUY I;  2C39 B;  4DR6 I;  3B78 A;  1N36 E;  4IS9 A;  2HKJ A;  4EMD A;  4JI5 I;  1HR0 E;  2UUA E;  1HK7 A;  4I3H A;  3KRN A;  1XNR E;  4DR3 I;  2X36 A;  1NZ0 A;  2C38 A;  3ZM7 A;  1HNZ I;  4B3T I;  4JI2 E;  1N33 I;  4FW6 A;  1NHJ A;  4DU8 A;  1FI4 A;  1EI1 A;  4AQY E;  2LJP A;  1Y60 A;  3L7Z B;  4LF8 I;  5JEA C;  2V2V A;  1B62 A;  2ZM6 I;  4K0K E;  2PNM A;  5LMN I;  4DUZ E;  2Z5C A;  4B3M E;  2ZIT A;  4PRV A;  1VI7 A;  4DUY E;  5DNL A;  4JYA I;  1Z0W A;  4DR6 E;  4DV0 I;  4X65 I;  2UXD I;  1J5E I;  4X64 E;  4HY1 A;  3JAM Q;  2WNR A;  5K36 E;  2Z5B A;  4DR3 E;  1HNZ E;  1OYR A;  4B3T E;  4X62 I;  1N33 E;  2Z5C B;  3J81 C;  3Q1Q A;  1RHY A;  4J3D A;  4LF8 E;  2NN6 C;  2BM1 A;  5IWA I;  2XEX A;  4YHH I;  1ZXN A;  2WNR B;  4N3O A;  4JYA E;  2Z5B B;  4NBQ A;  2GQ0 A;  4DV0 E;  2UXD E;  1J5E E;  4URL A;  2VQF I;  4Z7C A;  3F0N A;  3PS3 A;  2CZ9 A;  2GO3 A;  3CWV A;  1HNW I;  2HKE A;  4P52 A;  3PRY A;  5FWK A;  4X62 E;  1R6L A;  4LF4 I;  4JI4 E;  4LF5 I;  4JI6 I;  1H73 A;  4ZVI A;  3J7A G;  3T1H E;  4IFD D;  4BA1 A;  4QNK A;  5IWA E;  4YHH E;  5K36 C;  5FLX Q;  4DR1 I;  2VQF E;  2JEB A;  2NN6 D;  1N32 E;  3P3C A;  4IZJ D;  5DRP A;  2BA0 D;  4LF4 E;  4FWD A;  4BA1 B;  4FWH A;  2BA0 G;  2UXC I;  2J65 A;  1RRE A;  4LF5 E;  4JI6 E;  3Q6M A;  4BA2 A;  1Z0G A;  5C0X E;  3J80 C;  2PO1 A;  2JEB B;  2R42 A;  4HYM A;  3J7A M;  1P42 A;  3H4L A;  2PO0 A;  2IER A;  4YY3 I;  4DR1 E;  1XNQ E;  4OO1 D;  1Z0V A;  1UDN A;  2UUB I;  4BA2 B;  1OYS A;  3QT7 A;  2PNL A;  2Q2E B;  2PO1 B;  2V2Z A;  2UXC E;  3K17 A;  4MU4 A;  2PO0 B;  1XNR I;  4LFC I;  3GLL A;  4IFD E;  1Z5B A;  4AM3 A;  4YY3 E;  3GCM A;  4DPW A;  5EL9 A;  2JT2 A;  3J81 Q;  3L7Z A;  3QT8 A;  2NN6 E;  2UUB E;  2HK3 A;  5C0X C;  1KTV A;  1ZM3 A;  5K36 B;  5A2Q C;  4X64 I;  4FW5 A;  4FW7 A;  1WUU A;  4JI3 I;  4DR7 I;  4JI1 I;  3HJC A;  1H7U A;  4LCF A;  2CVE A;  2O1V A;  4OX9 I;  5GMD A;  4LFC E;  1Z5C A;  2V34 A;  1IBM I;  4FW4 A;  4DV1 I;  1YHC A;  3P3E A;  2DEI A;  3PYE A;  1QZR A;  3HUL A;  1IBK I;  1Y4S A;  1D6T A;  2JEA B;  3HKM A;  1EA6 A;  1HNX I;  4OO1 E;  1Z59 A;  3ZKD A;  5IT9 C;  2IOP A;  1KIJ A;  4JI3 E;  4IFD C;  4DR7 E;  5DRO A;  4JI1 E;  4FN5 A;  1R6M A;  4OX9 E;  3ZKB A;  3LPS A;  5GME A;  4GQU A;  3P76 A;  4JI4 I;  1MU5 A;  3WU6 A;  5C0X D;  4WUC A;  3PYF A;  1IBM E;  4DV1 E;  2WP8 B;  3T1H I;  1OJ4 A;  4QNJ A;  1USU A;  1S4E A;  4FW9 A;  5ELW A;  4MU0 A;  1IBK E;  3CDJ A;  3U1Y A;  1HNX E;  2V8P A;  1H74 A;  1N0U A;  3K1J A;  3J80 Q;  1N32 I;  1UDQ A;  5JEA F;  2OI2 A;  1VIS A;  3V5R A;  2O1W A;  5JEA A;  4LCG A;  3M7N D;  2GO4 A;  1XHK A;  3M7N G;  2AE8 A;  3P06 A;  4OO1 C;  3B82 A;  4JI0 E;  4GKK I;  1XMQ I;  3WU5 A;  4JV5 I;  2CGE A;  5JEA B;  2BA1 D;  1XNQ I;  1FKA E;  2BA1 G;  4DPU A;  4KHP I;  2NN6 A;  4DV7 E;  3GON A;  3LTO A;  1B63 A;  3Q6N A;  4IZJ A;  2F4V I;  3PS2 A;  3P3G A;  4U3D A;  2X7I A;  4IFD B;  4LFB I;  4UTG A;  2UUC I;  4U3B A;  4GKK E;  5A2Q Q;  1ZM4 A;  4DV3 I;  4DV5 E;  1XMQ E;  1ZM2 A;  3UHM A;  4JV5 E; 
#chains in the Genus database with same CATH homology
 3PYD A;  3K85 A;  2UU9 I;  2VQE E;  4KHP E;  4IZJ B;  4GKJ I;  5BR8 I;  1Y6Z A;  4NXN E;  1I94 I;  5LMU E;  2F4V E;  4LFB E;  2E1R A;  2UUC E;  5IT9 Q;  1ZM9 A;  4DPX A;  4DV3 E;  3OTO I;  3WU3 A;  1Y4U A;  3ZZ0 A;  4DU7 A;  2UU9 E;  3QT6 A;  1XMO E;  1H7S A;  4GKJ E;  2IOQ A;  5BR8 E;  4DV6 I;  4NXM I;  1KKH A;  2HFS A;  4B3S I;  1I94 E;  3PYG A;  2UXB I;  4HXZ A;  4KQV A;  2DEJ A;  1Z0E A;  2VF3 A;  3OTO E;  1PKP A;  2V2Q A;  4DV6 E;  3WU4 A;  4RPF A;  1NHI A;  2WW4 A;  4NXM E;  4B3S E;  1PIE A;  2HHH I;  4DV4 I;  2UXB E;  4JI8 I;  1FWK A;  1UEK A;  1ZXM A;  4MYT A;  3T1Y I;  2BM0 A;  5L3J A;  3D4J A;  4JG4 A;  4JI0 I;  4HAC A;  4WUB A;  4PU9 A;  4IZK A;  1NHH A;  4JI5 E;  2A2C A;  2J7K A;  4P7A A;  1Z5A A;  3QT5 A;  4DV7 I;  2HHH E;  2BV3 A;  4DV4 E;  4HAC B;  4JI8 E;  1USV A;  4PRX A;  2ZM6 E;  1MX0 A;  5LMN E;  4IZK B;  3T1Y E;  2O1T A;  4LF6 I;  4DV5 I;  4X65 E;  2E5L I;  4XTJ A;  4MYU A;  4DV2 I;  2A2D A;  4DPT A;  2VQE I;  4LFA I;  1N0V C;  3B8H A;  1K47 A;  4NXN I;  2GS8 A;  5LMU I;  1ELO A;  2O1U A;  3JAM C;  2NPF A;  4WUD A;  1S16 A;  4DR2 I;  1FNM A;  2EFG A;  1N34 I;  4USK A;  4DR4 I;  4LF6 E;  4USM A;  1Z0C A;  2E5L E;  4B3R I;  1U2R A;  4LF9 I;  4DR5 I;  1HNW E;  5LL6 R;  4X66 I;  4DV2 E;  1FWL A;  1Z0T A;  1XMO I;  4ED4 A;  4LFA E;  1DAR A;  4FWG A;  1MG7 A;  4Z7Y A;  4DR2 E;  1IBL I;  4UT4 A;  1FJG I;  2HK2 A;  1N34 E;  4LF7 I;  4DR4 E;  3M6A A;  2Z5E A;  3ZZT A;  3V2U C;  4JI7 I;  4B3R E;  4LF9 E;  4DR5 E;  4DXL A;  2HFU A;  4X66 E;  4R1F A;  1N36 I;  2R3V A;  1HR0 I;  4M1K A;  2UUA I;  3LNU A;  2AJ4 A;  4DPY A;  5FLX C;  1KVK A;  1RR9 A;  4JI2 I;  2ZBK B;  1A6F A;  1BKN A;  4AQY I;  1IBL E;  1FJG E;  2CG9 A;  3ZZU A;  4LF7 E;  4K0K I;  1H72 C;  1PVG A;  4DUZ I;  4B3M I;  1Z0B A;  4JI7 E;  4DUY I;  4DR6 I;  3B78 A;  1N36 E;  2HKJ A;  4EMD A;  4JI5 I;  1HR0 E;  2UUA E;  1HK7 A;  4I3H A;  1XNR E;  4DR3 I;  2X36 A;  1NZ0 A;  3ZM7 A;  1HNZ I;  4B3T I;  4JI2 E;  1N33 I;  1NHJ A;  4DU8 A;  1FI4 A;  1EI1 A;  4AQY E;  2LJP A;  4LF8 I;  2V2V A;  1B62 A;  2ZM6 I;  4K0K E;  2PNM A;  5LMN I;  4DUZ E;  2Z5C A;  4B3M E;  2ZIT A;  4PRV A;  4DUY E;  4JYA I;  1Z0W A;  4DR6 E;  4DV0 I;  4X65 I;  2UXD I;  1J5E I;  4X64 E;  4HY1 A;  3JAM Q;  2Z5B A;  4DR3 E;  1HNZ E;  4B3T E;  4X62 I;  1N33 E;  2Z5C B;  3J81 C;  3Q1Q A;  4LF8 E;  2BM1 A;  5IWA I;  2XEX A;  4YHH I;  1ZXN A;  4N3O A;  4JYA E;  2Z5B B;  2GQ0 A;  4DV0 E;  2UXD E;  1J5E E;  4URL A;  2VQF I;  4Z7C A;  3F0N A;  2CZ9 A;  3CWV A;  1HNW I;  2HKE A;  4P52 A;  3PRY A;  5FWK A;  4X62 E;  4LF4 I;  4JI4 E;  4LF5 I;  4JI6 I;  1H73 A;  4ZVI A;  3J7A G;  3T1H E;  5IWA E;  4YHH E;  5FLX Q;  4DR1 I;  2VQF E;  1N32 E;  4IZJ D;  4LF4 E;  4FWD A;  4FWH A;  2UXC I;  1RRE A;  4LF5 E;  4JI6 E;  3Q6M A;  1Z0G A;  3J80 C;  2R42 A;  4HYM A;  3J7A M;  3H4L A;  4YY3 I;  4DR1 E;  1XNQ E;  1Z0V A;  2UUB I;  3QT7 A;  2PNL A;  2Q2E B;  2V2Z A;  2UXC E;  3K17 A;  1XNR I;  4LFC I;  1Z5B A;  4YY3 E;  4DPW A;  3J81 Q;  3QT8 A;  2UUB E;  2HK3 A;  1KTV A;  1ZM3 A;  5A2Q C;  4X64 I;  1WUU A;  4JI3 I;  4DR7 I;  4JI1 I;  3HJC A;  1H7U A;  4OX9 I;  2O1V A;  5GMD A;  4LFC E;  1Z5C A;  2V34 A;  1IBM I;  4DV1 I;  2DEI A;  3PYE A;  1QZR A;  3HUL A;  1IBK I;  1Y4S A;  1D6T A;  1EA6 A;  1HNX I;  1Z59 A;  3ZKD A;  5IT9 C;  2IOP A;  1KIJ A;  4JI3 E;  4DR7 E;  4JI1 E;  4FN5 A;  4OX9 E;  3ZKB A;  3LPS A;  5GME A;  4JI4 I;  1MU5 A;  3WU6 A;  4WUC A;  3PYF A;  1IBM E;  4DV1 E;  3T1H I;  1OJ4 A;  1USU A;  1S4E A;  4FW9 A;  1IBK E;  1HNX E;  2V8P A;  1H74 A;  1N0U A;  3K1J A;  3J80 Q;  1N32 I;  2OI2 A;  1VIS A;  3V5R A;  2O1W A;  1XHK A;  3P06 A;  3B82 A;  4JI0 E;  4GKK I;  1XMQ I;  3WU5 A;  4JV5 I;  2CGE A;  1XNQ I;  1FKA E;  4DPU A;  4KHP I;  4DV7 E;  3GON A;  3LTO A;  1B63 A;  3Q6N A;  4IZJ A;  2F4V I;  2X7I A;  4LFB I;  4UTG A;  2UUC I;  4GKK E;  5A2Q Q;  1ZM4 A;  4DV3 I;  4DV5 E;  1XMQ E;  1ZM2 A;  4JV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...