2VQEI

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqeI00
4WUCA 2OI2A 1ZM2A 1Z5BA 3PYGA 2LJPA 2HK2A 3J81C 4DPYA 4YHHE 4KQVA 3ZM7A 2VQEI 1HR0E 2VQFI 1S16A 4LF6E 3J81Q 4B3SE 4JI6E 5IWAE 1Z0CA 4X66E 4HY1A 4Z7YA 4JI8I 4MYTA 4DUZI 2VQEE 1HR0I 2ZITA 5A2QQ 4DR3E 2UUAI 4JI5E 1ZM9A 1VISA 4JYAI 4K0KE 1BKNA 4JI4E 2UXCE 2UXBE 1K47A 1ZM3A 2UU9E 1EA6A 4DV2I 2V2VA 2UUAE 4X62E 1IBKI 4MYUA 4LFCI 2Q2EB 1Z5CA 1XNRE 2UUBE 4JI5I 1A6FA 1ZXMA 2X7IA 4LF9E 4JI1E 4DV7E 2A2CA 2BV3A 3LNUA 4M1KA 4DR2E 4GKKI 2VF3A 1IBKE 1WUUA 5LMNI 1N32E 3H4LA 4X62I 5LMUE 4LFBE 4USKA 2V34A 3B78A 1XHKA 2V2QA 4DXLA 1FNMA 4AQYI 5GMEA 1MX0A 4DV5I 4JI6I 4DR1E 2F4VE 2UXDI 4B3TI 3T1YE 4JI3E 4HACB 4R1FA 4DR6E 4DUYI 4WUDA 1HNXE 3WU5A 3QT5A 1N33E 3K1JA 1OJ4A 4RPFA 1I94I 2UXDE 5BR8I 4JI0E 4LF8I 3CWVA 4I3HA 4PRXA 4DV2E 1XMOI 4DR6I 2XEXA 3B8HA 4Z7CA 4OX9I 4DPTA 3T1HI 1NHIA 4LF8E 1FJGI 4LF7I 1Z0TA 4DR5I 1H72C 4HYMA 3ZZTA 4JYAE 4YHHI 1D6TA 3QT8A 4OX9E 1IBLE 1FI4A 4XTJA 5FLXC 3F0NA 4DV0E 4DV6E 1N0UA 1N34E 3OTOI 2CZ9A 3WU6A 4DU8A 4DR5E 1KKHA 1FJGE 4AQYE 2E1RA 4DPWA 4DR1I 4UT4A 4DV0I 4DV6I 1MU5A 4JI1I 1KIJA 2HHHI 1IBME 1N0VC 4DR3I 4YY3I 3J80Q 2VQFE 4LF6I 5LMNE 2R42A 1XMQE 2BM1A 2NPFA 4X66I 4LFBI 4DUZE 2HK3A 1IBMI 4X64E 4FWDA 3J7AG 2ZM6I 4DR7I 4KHPE 1Z0VA 3HULA 4LFCE 1Z0BA 2UUCE 1HNWI 4JI7I 1KTVA 2X36A 4PRVA 4X64I 4DUYE 2AJ4A 1B63A 2R3VA 2ZBKB 4JI8E 4NXNI 2HFSA 1HNXI 1RR9A 4LFAI 1Z59A 4JI7E 4NXME 4GKJE 1NZ0A 4JI0I 4LF9I 1ELOA 1Z0GA 3QT6A 2V8PA 4DR2I 4GKKE 2GS8A 1PVGA 1PKPA 1FWLA 4UTGA 4DV1I 2E5LI 3ZKDA 4URLA 4GKJI 2UXBI 2UXCI 4K0KI 5IT9Q 3M6AA 3K17A 1RREA 1B62A 5GMDA 3WU3A 4X65I 1Z0EA 1DARA 1XNQE 1H7SA 4P7AA 2HKJA 4B3ME 3GONA 2F4VI 3ZKBA 3V5RA 2E5LE 3T1YI 2A2DA 3JAMQ 4LF5I 4B3SI 2ZM6E 4DR7E 1HNZI 4DR4I 4ZVIA 4X65E 4JV5E 3PYFA 1Z5AA 1XNQI 1N33I 1I94E 4FN5A 4DV4E 1Z0WA 1H74A 4JI2I 4LF4I 4LF7E 5FLXQ 1XMQI 4DU7A 4YY3E 2HFUA 4USMA 1XMOE 1HNZE 5A2QC 4DR4E 3D4JA 3J7AM 4DPXA 4FWHA 4ED4A 3LTOA 3WU4A 4KHPI 1N32I 5IWAI 4PU9A 5L3JA 1IBLI 2UUCI 1ZXNA 1HNWE 1PIEA 1S4EA 3J80C 4DV3E 5BR8E 3OTOE 1UEKA 2DEJA 4FW9A 4NXNE 3PYDA 4HACA 1N36E 2WW4A 1MG7A 1J5EI 1NHJA 1NHHA 3T1HE 4DPUA 4NXMI 4DV3I 3ZZUA 3PYEA 2HKEA 4B3RI 3Q1QA 3V2UC 4HXZA 4JG4A 2UUBI 1J5EE 1N36I 1XNRI 4DV7I 1N34I 1KVKA 4P52A 2EFGA 1FWKA 2V2ZA 5IT9C 4EMDA 4WUBA 4JI2E 4LF4E 3ZZ0A 1QZRA 1FKAE 2DEIA 4B3RE 5LMUI 1ZM4A 2BM0A 4JI4I 5LL6R 1U2RA 4B3MI 2HHHE 4LF5E 2UU9I 3JAMC 1EI1A 2J7KA 4DV5E 3QT7A 4FWGA 4JV5I 1H73A 1H7UA 3B82A 4B3TE 4DV1E 4LFAE 3LPSA 4DV4I 4JI3I
chains in the Genus database with same CATH superfamily
2C38A 4WUCA 2BR2A 4LOMA 2OI2A 1ZM2A 1Z5BA 3PYGA 2LJPA 2HK2A 3J81C 5DRPA 4OO1E 2Z5CA 4DPYA 1UDNA 5JEAA 4IZKA 2PO1B 4YHHE 4KQVA 3ZM7A 2VQEI 1HR0E 1R6LA 2F1DA 2VQFI 1S16A 4LF6E 3J81Q 4B3SE 5JEAB 3L7ZB 4JI6E 3GLLA 5DROA 5IWAE 1Z0CA 4AIMA 4X66E 2JEAA 4HY1A 4Z7YA 4JI8I 4MYTA 4DUZI 1E3PA 2GO3A 2GQ0A 3PRYA 4MU3A 2VQEE 1HR0I 4OO1B 5DNLA 2ZITA 5A2QQ 4DR3E 4U3BA 3U1KA 2IERA 2WP8B 4IZJD 2UUAI 4IFDC 4JI5E 4LCFA 1ZM9A 1VISA 4JYAI 4QNKA 4FW4A 4K0KE 1BKNA 4JI4E 4AIDA 2UXCE 2UXBE 1K47A 1ZM3A 2UU9E 1EA6A 4DV2I 2V2VA 2CG9A 2UUAE 4X62E 5DNXA 1IBKI 4MYUA 4LFCI 2Q2EB 1Z5CA 1XNRE 2UUBE 4JI5I 1A6FA 1ZXMA 2X7IA 4LF9E 1P42A 4DV7E 4JI1E 2A2CA 2BV3A 3LNUA 4M1KA 4DR2E 4GKKI 4LCHA 2VF3A 1IBKE 1WUUA 5LMNI 1N32E 4N3OA 3H4LA 4X62I 5LMUE 4LFBE 4U3DA 4USKA 2NN6E 2V34A 3B78A 1XHKA 2V2QA 4DXLA 4IFDF 3Q6NA 1FNMA 3H1CA 5C0XA 4AQYI 5GMEA 1MX0A 3L7ZA 1OYRA 4DV5I 4JI6I 4DR1E 2O1VA 2F4VE 2UXDI 4ISAA 4B3TI 3T1YE 1HK7A 4JI3E 4HACB 2C37B 4R1FA 5C0XC 2BR2B 4DR6E 3PS1A 4DUYI 4WUDA 2PO1A 1HNXE 3WU5A 1Y5YA 3QT5A 2C39B 1N33E 3K1JA 1OJ4A 4RPFA 1I94I 2JE6A 2JEBA 2UXDE 5BR8I 4OO1C 4JI0E 3CDIA 4LF8I 3CWVA 4I3HA 5EKWA 2NN6F 2C39A 4PRXA 4IFDA 4DV2E 1XMOI 4DR6I 1R6MA 2XEXA 5ELWA 3B8HA 3UHMA 4Z7CA 1YHCA 4OX9I 4DPTA 3T1HI 1NHIA 4LF8E 4OO1A 3M85G 1RHYA 2PNZA 1FJGI 4LF7I 1Z0TA 5K36B 4DR5I 2PO2A 1H72C 4MU4A 4HYMA 3ZZTA 4JYAE 4YHHI 1D6TA 3QT8A 4OX9E 1IBLE 1FI4A 4XTJA 5FLXC 3F0NA 4DV0E 4DV6E 4BA1A 3P76A 1N0UA 5C0XF 1N34E 2WNRB 2CZ9A 3OTOI 3WU6A 4DU8A 2IESA 4DR5E 3GCMA 4IZJB 1KKHA 1FJGE 4AQYE 2O1WA 2PNLA 2E1RA 4DPWA 4DR1I 4UT4A 4DV0I 4DV6I 1VI7A 4OO1F 4IZKB 1MU5A 4JI1I 1KIJA 2HHHI 5C0XD 2BA0D 4IZJA 1IBME 1N0VC 4DR3I 4YY3I 2C37A 3J80Q 2VQFE 3M85D 4LF6I 5LMNE 2R42A 1XMQE 2BM1A 2NPFA 2PNMA 5JEAC 4X66I 4LFBI 4DUZE 4AM3A 2HK3A 2JE6B 1IBMI 4X64E 4FWDA 3J7AG 2ZM6I 4DR7I 4KHPE 1Z0VA 3CDJA 3HULA 2Z5BB 4FW3A 3M7NG 4LFCE 3P06A 3HJCA 1Z0BA 2UUCE 1HNWI 4JI7I 1KTVA 5C0XE 2X36A 3PS2A 3B4TA 2Z5BA 4PRVA 4X64I 4DUYE 2AJ4A 1B63A 2R3VA 2ZBKB 5JEAD 4JI8E 4NXNI 2HFSA 1HNXI 1RR9A 4LFAI 1Z59A 5DRQA 4JI7E 2JEAB 4NXME 4IFDD 4GKJE 1NZ0A 2PO0A 3K85A 4JI0I 4BA1B 1ELOA 2Z5CB 4LF9I 4FW7A 4IFDB 1Z0GA 3QT6A 4FW6A 2V8PA 5JEAF 1UDSA 3P3CA 4LPFA 3PS3A 4DR2I 4GKKE 2GS8A 1PVGA 3M7ND 1PKPA 1FWLA 5FWKA 2O1TA 4UTGA 4DV1I 4IFDE 2E5LI 3ZKDA 4URLA 1Y4SA 4MDTA 4GKJI 2UXBI 2UXCI 4K0KI 5IT9Q 3M6AA 3K17A 4MU0A 1RREA 1B62A 1Y60A 5GMDA 4LCGA 3WU3A 4X65I 1Z0EA 1DARA 1XNQE 1H7SA 4P7AA 2HKJA 2WP8A 4GQUA 3P3GA 4B3ME 3GONA 2F4VI 2AE8A 3ZKBA 3V5RA 2E5LE 3T1YI 2A2DA 2NN6B 3JAMQ 1UDQA 4LF5I 4B3SI 2ZM6E 4DR7E 1HNZI 4DR4I 4ZVIA 5K36C 2NN6C 4X65E 4BA2B 4JV5E 3PYFA 1Z5AA 1XNQI 1N33I 4J3DA 2PO2B 5EL9A 1I94E 4FN5A 4DV4E 1Z0WA 1H74A 4JI2I 4OZEA 4LF4I 2JT2A 4LF7E 5FLXQ 4BA2A 2C38B 1XMQI 4DU7A 4QNJA 2HFUA 4MQYA 4USMA 4YY3E 3Q6MA 2WNRA 1XMOE 1HNZE 5A2QC 4DR4E 2NN6D 1OYSA 3D4JA 3HKMA 3KRNA 3J7AM 2GO4A 4DPXA 5JEAE 4FWHA 4ED4A 4OKGA 2O3ZA 3LTOA 3WU4A 2IOPA 2BA1D 4KHPI 1UDOA 1Y4UA 2BA1G 1N32I 5IWAI 1OYPA 4PU9A 5L3JA 1IBLI 2UUCI 1ZXNA 1HNWE 1PIEA 1S4EA 2VESA 5K36A 2CVEA 3J80C 2JEBB 2BA0G 5BR8E 4DV3E 3OTOE 1UEKA 1USVA 3GMEA 2DEJA 5K36F 4FW9A 4NXNE 3U1YA 3PYDA 4HACA 1N36E 4NBQA 2WW4A 1MG7A 4IS9A 1J5EI 1NHJA 1NHHA 3T1HE 4DPUA 2CGEA 4NXMI 2PNZB 4DV3I 2PO0B 4OO1D 3ZZUA 2Z5EA 5K36D 3PYEA 1XXEA 3NZKA 2HKEA 2J65A 4B3RI 3Q1QA 4MU1A 3V2UC 4HXZA 4JG4A 2UUBI 1J5EE 1N36I 1XNRI 4DV7I 1N34I 1KVKA 2O1UA 4P52A 2EFGA 4FW5A 1FWKA 2V2ZA 5IT9C 4EMDA 4WUBA 5DRRA 4JI2E 4LF4E 3ZZ0A 1QZRA 1FKAE 3P3EA 2DEIA 4B3RE 5LMUI 1ZM4A 2BM0A 1Y6ZA 4JI4I 5LL6R 1U2RA 4B3MI 1E3HA 2HHHE 5C0XB 4LF5E 5K36E 2UU9I 3JAMC 1EI1A 2J7KA 4DV5E 1YH8A 3QT7A 2NN6A 4FWGA 4JV5I 3DD6A 1H73A 1H7UA 3B82A 4B3TE 4DV1E 4LFAE 3LPSA 4DV4I 1USUA 4JI3I 2IOQA
chains in the Genus database with same CATH topology
4WUCA 2OI2A 1ZM2A 1Z5BA 3PYGA 2LJPA 2HK2A 3J81C 2Z5CA 4DPYA 4IZKA 4YHHE 4KQVA 3ZM7A 2VQEI 1HR0E 2VQFI 1S16A 4LF6E 3J81Q 4B3SE 4JI6E 5IWAE 1Z0CA 4X66E 4HY1A 4Z7YA 4JI8I 4MYTA 4DUZI 2GQ0A 3PRYA 2VQEE 1HR0I 2ZITA 5A2QQ 4DR3E 4IZJD 2UUAI 4JI5E 1ZM9A 1VISA 4JYAI 4K0KE 1BKNA 4JI4E 2UXCE 2UXBE 1K47A 1ZM3A 2UU9E 1EA6A 4DV2I 2V2VA 2CG9A 2UUAE 4X62E 1IBKI 4MYUA 4LFCI 2Q2EB 1Z5CA 1XNRE 2UUBE 4JI5I 1A6FA 1ZXMA 2X7IA 4LF9E 4JI1E 4DV7E 2A2CA 2BV3A 3LNUA 4M1KA 4DR2E 4GKKI 2VF3A 1IBKE 1WUUA 5LMNI 1N32E 4N3OA 3H4LA 4X62I 5LMUE 4LFBE 4USKA 2V34A 3B78A 1XHKA 2V2QA 4DXLA 3Q6NA 1FNMA 4AQYI 5GMEA 1MX0A 4DV5I 4JI6I 4DR1E 2O1VA 2F4VE 2UXDI 4B3TI 3T1YE 1HK7A 4JI3E 4HACB 4R1FA 4DR6E 4DUYI 4WUDA 1HNXE 3WU5A 3QT5A 1N33E 3K1JA 1OJ4A 4RPFA 1I94I 2UXDE 5BR8I 4JI0E 4LF8I 3CWVA 4I3HA 4PRXA 4DV2E 1XMOI 4DR6I 2XEXA 3B8HA 4Z7CA 4OX9I 4DPTA 3T1HI 1NHIA 4LF8E 1FJGI 4LF7I 1Z0TA 4DR5I 1H72C 4HYMA 3ZZTA 4JYAE 4YHHI 1D6TA 3QT8A 4OX9E 1IBLE 1FI4A 4XTJA 5FLXC 3F0NA 4DV0E 4DV6E 1N0UA 1N34E 3OTOI 2CZ9A 3WU6A 4DU8A 4DR5E 4IZJB 1KKHA 1FJGE 4AQYE 2O1WA 2PNLA 2E1RA 4DPWA 4DR1I 4UT4A 4DV0I 4DV6I 4IZKB 1MU5A 4JI1I 1KIJA 2HHHI 4IZJA 1IBME 1N0VC 4DR3I 4YY3I 3J80Q 2VQFE 4LF6I 5LMNE 2R42A 1XMQE 2BM1A 2NPFA 2PNMA 4X66I 4LFBI 4DUZE 2HK3A 1IBMI 4X64E 4FWDA 3J7AG 2ZM6I 4DR7I 4KHPE 1Z0VA 3HULA 2Z5BB 4LFCE 3P06A 3HJCA 1Z0BA 2UUCE 1HNWI 4JI7I 1KTVA 2X36A 2Z5BA 4PRVA 4X64I 4DUYE 2AJ4A 1B63A 2R3VA 2ZBKB 4JI8E 4NXNI 2HFSA 1HNXI 1RR9A 4LFAI 1Z59A 4JI7E 4NXME 4GKJE 1NZ0A 3K85A 4JI0I 4LF9I 1ELOA 2Z5CB 1Z0GA 3QT6A 2V8PA 4DR2I 4GKKE 2GS8A 1PVGA 1PKPA 1FWLA 5FWKA 2O1TA 4UTGA 4DV1I 2E5LI 3ZKDA 4URLA 1Y4SA 4GKJI 2UXBI 2UXCI 4K0KI 5IT9Q 3M6AA 3K17A 1RREA 1B62A 5GMDA 3WU3A 4X65I 1Z0EA 1DARA 1XNQE 1H7SA 4P7AA 2HKJA 4B3ME 3GONA 2F4VI 3ZKBA 3V5RA 2E5LE 3T1YI 2A2DA 3JAMQ 4LF5I 4B3SI 2ZM6E 4DR7E 1HNZI 4DR4I 4ZVIA 4X65E 4JV5E 3PYFA 1Z5AA 1XNQI 1N33I 1I94E 4FN5A 4DV4E 1Z0WA 1H74A 4JI2I 4LF4I 4LF7E 5FLXQ 1XMQI 4DU7A 4YY3E 2HFUA 4USMA 3Q6MA 1XMOE 1HNZE 5A2QC 4DR4E 3D4JA 3J7AM 4DPXA 4FWHA 4ED4A 3LTOA 3WU4A 2IOPA 4KHPI 1N32I 1Y4UA 5IWAI 4PU9A 5L3JA 1IBLI 2UUCI 1ZXNA 1HNWE 1PIEA 1S4EA 3J80C 4DV3E 5BR8E 3OTOE 1UEKA 1USVA 2DEJA 4FW9A 4NXNE 3PYDA 4HACA 1N36E 2WW4A 1MG7A 1J5EI 1NHJA 1NHHA 3T1HE 4DPUA 2CGEA 4NXMI 4DV3I 3ZZUA 2Z5EA 3PYEA 2HKEA 4B3RI 3Q1QA 3V2UC 4HXZA 4JG4A 2UUBI 1J5EE 1N36I 1XNRI 4DV7I 1N34I 1KVKA 2O1UA 4P52A 2EFGA 1FWKA 2V2ZA 5IT9C 4EMDA 4WUBA 4JI2E 4LF4E 3ZZ0A 1QZRA 1FKAE 2DEIA 4B3RE 5LMUI 1ZM4A 2BM0A 1Y6ZA 4JI4I 5LL6R 1U2RA 4B3MI 2HHHE 4LF5E 2UU9I 3JAMC 1EI1A 2J7KA 4DV5E 3QT7A 4FWGA 4JV5I 1H73A 1H7UA 3B82A 4B3TE 4DV1E 4LFAE 3LPSA 4DV4I 1USUA 4JI3I 2IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUC A;  2OI2 A;  1ZM2 A;  1Z5B A;  3PYG A;  2LJP A;  2HK2 A;  3J81 C;  4DPY A;  4YHH E;  4KQV A;  3ZM7 A;  2VQE I;  1HR0 E;  2VQF I;  1S16 A;  4LF6 E;  3J81 Q;  4B3S E;  4JI6 E;  5IWA E;  1Z0C A;  4X66 E;  4HY1 A;  4Z7Y A;  4JI8 I;  4MYT A;  4DUZ I;  2VQE E;  1HR0 I;  2ZIT A;  5A2Q Q;  4DR3 E;  2UUA I;  4JI5 E;  1ZM9 A;  1VIS A;  4JYA I;  4K0K E;  1BKN A;  4JI4 E;  2UXC E;  2UXB E;  1K47 A;  1ZM3 A;  2UU9 E;  1EA6 A;  4DV2 I;  2V2V A;  2UUA E;  4X62 E;  1IBK I;  4MYU A;  4LFC I;  2Q2E B;  1Z5C A;  1XNR E;  2UUB E;  4JI5 I;  1A6F A;  1ZXM A;  2X7I A;  4LF9 E;  4JI1 E;  4DV7 E;  2A2C A;  2BV3 A;  3LNU A;  4M1K A;  4DR2 E;  4GKK I;  2VF3 A;  1IBK E;  1WUU A;  5LMN I;  1N32 E;  3H4L A;  4X62 I;  5LMU E;  4LFB E;  4USK A;  2V34 A;  3B78 A;  1XHK A;  2V2Q A;  4DXL A;  1FNM A;  4AQY I;  5GME A;  1MX0 A;  4DV5 I;  4JI6 I;  4DR1 E;  2F4V E;  2UXD I;  4B3T I;  3T1Y E;  4JI3 E;  4HAC B;  4R1F A;  4DR6 E;  4DUY I;  4WUD A;  1HNX E;  3WU5 A;  3QT5 A;  1N33 E;  3K1J A;  1OJ4 A;  4RPF A;  1I94 I;  2UXD E;  5BR8 I;  4JI0 E;  4LF8 I;  3CWV A;  4I3H A;  4PRX A;  4DV2 E;  1XMO I;  4DR6 I;  2XEX A;  3B8H A;  4Z7C A;  4OX9 I;  4DPT A;  3T1H I;  1NHI A;  4LF8 E;  1FJG I;  4LF7 I;  1Z0T A;  4DR5 I;  1H72 C;  4HYM A;  3ZZT A;  4JYA E;  4YHH I;  1D6T A;  3QT8 A;  4OX9 E;  1IBL E;  1FI4 A;  4XTJ A;  5FLX C;  3F0N A;  4DV0 E;  4DV6 E;  1N0U A;  1N34 E;  3OTO I;  2CZ9 A;  3WU6 A;  4DU8 A;  4DR5 E;  1KKH A;  1FJG E;  4AQY E;  2E1R A;  4DPW A;  4DR1 I;  4UT4 A;  4DV0 I;  4DV6 I;  1MU5 A;  4JI1 I;  1KIJ A;  2HHH I;  1IBM E;  1N0V C;  4DR3 I;  4YY3 I;  3J80 Q;  2VQF E;  4LF6 I;  5LMN E;  2R42 A;  1XMQ E;  2BM1 A;  2NPF A;  4X66 I;  4LFB I;  4DUZ E;  2HK3 A;  1IBM I;  4X64 E;  4FWD A;  3J7A G;  2ZM6 I;  4DR7 I;  4KHP E;  1Z0V A;  3HUL A;  4LFC E;  1Z0B A;  2UUC E;  1HNW I;  4JI7 I;  1KTV A;  2X36 A;  4PRV A;  4X64 I;  4DUY E;  2AJ4 A;  1B63 A;  2R3V A;  2ZBK B;  4JI8 E;  4NXN I;  2HFS A;  1HNX I;  1RR9 A;  4LFA I;  1Z59 A;  4JI7 E;  4NXM E;  4GKJ E;  1NZ0 A;  4JI0 I;  4LF9 I;  1ELO A;  1Z0G A;  3QT6 A;  2V8P A;  4DR2 I;  4GKK E;  2GS8 A;  1PVG A;  1PKP A;  1FWL A;  4UTG A;  4DV1 I;  2E5L I;  3ZKD A;  4URL A;  4GKJ I;  2UXB I;  2UXC I;  4K0K I;  5IT9 Q;  3M6A A;  3K17 A;  1RRE A;  1B62 A;  5GMD A;  3WU3 A;  4X65 I;  1Z0E A;  1DAR A;  1XNQ E;  1H7S A;  4P7A A;  2HKJ A;  4B3M E;  3GON A;  2F4V I;  3ZKB A;  3V5R A;  2E5L E;  3T1Y I;  2A2D A;  3JAM Q;  4LF5 I;  4B3S I;  2ZM6 E;  4DR7 E;  1HNZ I;  4DR4 I;  4ZVI A;  4X65 E;  4JV5 E;  3PYF A;  1Z5A A;  1XNQ I;  1N33 I;  1I94 E;  4FN5 A;  4DV4 E;  1Z0W A;  1H74 A;  4JI2 I;  4LF4 I;  4LF7 E;  5FLX Q;  1XMQ I;  4DU7 A;  4YY3 E;  2HFU A;  4USM A;  1XMO E;  1HNZ E;  5A2Q C;  4DR4 E;  3D4J A;  3J7A M;  4DPX A;  4FWH A;  4ED4 A;  3LTO A;  3WU4 A;  4KHP I;  1N32 I;  5IWA I;  4PU9 A;  5L3J A;  1IBL I;  2UUC I;  1ZXN A;  1HNW E;  1PIE A;  1S4E A;  3J80 C;  4DV3 E;  5BR8 E;  3OTO E;  1UEK A;  2DEJ A;  4FW9 A;  4NXN E;  3PYD A;  4HAC A;  1N36 E;  2WW4 A;  1MG7 A;  1J5E I;  1NHJ A;  1NHH A;  3T1H E;  4DPU A;  4NXM I;  4DV3 I;  3ZZU A;  3PYE A;  2HKE A;  4B3R I;  3Q1Q A;  3V2U C;  4HXZ A;  4JG4 A;  2UUB I;  1J5E E;  1N36 I;  1XNR I;  4DV7 I;  1N34 I;  1KVK A;  4P52 A;  2EFG A;  1FWK A;  2V2Z A;  5IT9 C;  4EMD A;  4WUB A;  4JI2 E;  4LF4 E;  3ZZ0 A;  1QZR A;  1FKA E;  2DEI A;  4B3R E;  5LMU I;  1ZM4 A;  2BM0 A;  4JI4 I;  5LL6 R;  1U2R A;  4B3M I;  2HHH E;  4LF5 E;  2UU9 I;  3JAM C;  1EI1 A;  2J7K A;  4DV5 E;  3QT7 A;  4FWG A;  4JV5 I;  1H73 A;  1H7U A;  3B82 A;  4B3T E;  4DV1 E;  4LFA E;  3LPS A;  4DV4 I;  4JI3 I; 
#chains in the Genus database with same CATH topology
 2C38 A;  4WUC A;  2BR2 A;  4LOM A;  2OI2 A;  1ZM2 A;  1Z5B A;  3PYG A;  2LJP A;  2HK2 A;  3J81 C;  5DRP A;  4OO1 E;  2Z5C A;  4DPY A;  1UDN A;  5JEA A;  4IZK A;  2PO1 B;  4YHH E;  4KQV A;  3ZM7 A;  2VQE I;  1HR0 E;  1R6L A;  2F1D A;  2VQF I;  1S16 A;  4LF6 E;  3J81 Q;  4B3S E;  5JEA B;  3L7Z B;  4JI6 E;  3GLL A;  5DRO A;  5IWA E;  1Z0C A;  4AIM A;  4X66 E;  2JEA A;  4HY1 A;  4Z7Y A;  4JI8 I;  4MYT A;  4DUZ I;  1E3P A;  2GO3 A;  2GQ0 A;  3PRY A;  4MU3 A;  2VQE E;  1HR0 I;  4OO1 B;  5DNL A;  2ZIT A;  5A2Q Q;  4DR3 E;  4U3B A;  3U1K A;  2IER A;  2WP8 B;  4IZJ D;  2UUA I;  4IFD C;  4JI5 E;  4LCF A;  1ZM9 A;  1VIS A;  4JYA I;  4QNK A;  4FW4 A;  4K0K E;  1BKN A;  4JI4 E;  4AID A;  2UXC E;  2UXB E;  1K47 A;  1ZM3 A;  2UU9 E;  1EA6 A;  4DV2 I;  2V2V A;  2CG9 A;  2UUA E;  4X62 E;  5DNX A;  1IBK I;  4MYU A;  4LFC I;  2Q2E B;  1Z5C A;  1XNR E;  2UUB E;  4JI5 I;  1A6F A;  1ZXM A;  2X7I A;  4LF9 E;  1P42 A;  4DV7 E;  4JI1 E;  2A2C A;  2BV3 A;  3LNU A;  4M1K A;  4DR2 E;  4GKK I;  4LCH A;  2VF3 A;  1IBK E;  1WUU A;  5LMN I;  1N32 E;  4N3O A;  3H4L A;  4X62 I;  5LMU E;  4LFB E;  4U3D A;  4USK A;  2NN6 E;  2V34 A;  3B78 A;  1XHK A;  2V2Q A;  4DXL A;  4IFD F;  3Q6N A;  1FNM A;  3H1C A;  5C0X A;  4AQY I;  5GME A;  1MX0 A;  3L7Z A;  1OYR A;  4DV5 I;  4JI6 I;  4DR1 E;  2O1V A;  2F4V E;  2UXD I;  4ISA A;  4B3T I;  3T1Y E;  1HK7 A;  4JI3 E;  4HAC B;  2C37 B;  4R1F A;  5C0X C;  2BR2 B;  4DR6 E;  3PS1 A;  4DUY I;  4WUD A;  2PO1 A;  1HNX E;  3WU5 A;  1Y5Y A;  3QT5 A;  2C39 B;  1N33 E;  3K1J A;  1OJ4 A;  4RPF A;  1I94 I;  2JE6 A;  2JEB A;  2UXD E;  5BR8 I;  4OO1 C;  4JI0 E;  3CDI A;  4LF8 I;  3CWV A;  4I3H A;  5EKW A;  2NN6 F;  2C39 A;  4PRX A;  4IFD A;  4DV2 E;  1XMO I;  4DR6 I;  1R6M A;  2XEX A;  5ELW A;  3B8H A;  3UHM A;  4Z7C A;  1YHC A;  4OX9 I;  4DPT A;  3T1H I;  1NHI A;  4LF8 E;  4OO1 A;  3M85 G;  1RHY A;  2PNZ A;  1FJG I;  4LF7 I;  1Z0T A;  5K36 B;  4DR5 I;  2PO2 A;  1H72 C;  4MU4 A;  4HYM A;  3ZZT A;  4JYA E;  4YHH I;  1D6T A;  3QT8 A;  4OX9 E;  1IBL E;  1FI4 A;  4XTJ A;  5FLX C;  3F0N A;  4DV0 E;  4DV6 E;  4BA1 A;  3P76 A;  1N0U A;  5C0X F;  1N34 E;  2WNR B;  2CZ9 A;  3OTO I;  3WU6 A;  4DU8 A;  2IES A;  4DR5 E;  3GCM A;  4IZJ B;  1KKH A;  1FJG E;  4AQY E;  2O1W A;  2PNL A;  2E1R A;  4DPW A;  4DR1 I;  4UT4 A;  4DV0 I;  4DV6 I;  1VI7 A;  4OO1 F;  4IZK B;  1MU5 A;  4JI1 I;  1KIJ A;  2HHH I;  5C0X D;  2BA0 D;  4IZJ A;  1IBM E;  1N0V C;  4DR3 I;  4YY3 I;  2C37 A;  3J80 Q;  2VQF E;  3M85 D;  4LF6 I;  5LMN E;  2R42 A;  1XMQ E;  2BM1 A;  2NPF A;  2PNM A;  5JEA C;  4X66 I;  4LFB I;  4DUZ E;  4AM3 A;  2HK3 A;  2JE6 B;  1IBM I;  4X64 E;  4FWD A;  3J7A G;  2ZM6 I;  4DR7 I;  4KHP E;  1Z0V A;  3CDJ A;  3HUL A;  2Z5B B;  4FW3 A;  3M7N G;  4LFC E;  3P06 A;  3HJC A;  1Z0B A;  2UUC E;  1HNW I;  4JI7 I;  1KTV A;  5C0X E;  2X36 A;  3PS2 A;  3B4T A;  2Z5B A;  4PRV A;  4X64 I;  4DUY E;  2AJ4 A;  1B63 A;  2R3V A;  2ZBK B;  5JEA D;  4JI8 E;  4NXN I;  2HFS A;  1HNX I;  1RR9 A;  4LFA I;  1Z59 A;  5DRQ A;  4JI7 E;  2JEA B;  4NXM E;  4IFD D;  4GKJ E;  1NZ0 A;  2PO0 A;  3K85 A;  4JI0 I;  4BA1 B;  1ELO A;  2Z5C B;  4LF9 I;  4FW7 A;  4IFD B;  1Z0G A;  3QT6 A;  4FW6 A;  2V8P A;  5JEA F;  1UDS A;  3P3C A;  4LPF A;  3PS3 A;  4DR2 I;  4GKK E;  2GS8 A;  1PVG A;  3M7N D;  1PKP A;  1FWL A;  5FWK A;  2O1T A;  4UTG A;  4DV1 I;  4IFD E;  2E5L I;  3ZKD A;  4URL A;  1Y4S A;  4MDT A;  4GKJ I;  2UXB I;  2UXC I;  4K0K I;  5IT9 Q;  3M6A A;  3K17 A;  4MU0 A;  1RRE A;  1B62 A;  1Y60 A;  5GMD A;  4LCG A;  3WU3 A;  4X65 I;  1Z0E A;  1DAR A;  1XNQ E;  1H7S A;  4P7A A;  2HKJ A;  2WP8 A;  4GQU A;  3P3G A;  4B3M E;  3GON A;  2F4V I;  2AE8 A;  3ZKB A;  3V5R A;  2E5L E;  3T1Y I;  2A2D A;  2NN6 B;  3JAM Q;  1UDQ A;  4LF5 I;  4B3S I;  2ZM6 E;  4DR7 E;  1HNZ I;  4DR4 I;  4ZVI A;  5K36 C;  2NN6 C;  4X65 E;  4BA2 B;  4JV5 E;  3PYF A;  1Z5A A;  1XNQ I;  1N33 I;  4J3D A;  2PO2 B;  5EL9 A;  1I94 E;  4FN5 A;  4DV4 E;  1Z0W A;  1H74 A;  4JI2 I;  4OZE A;  4LF4 I;  2JT2 A;  4LF7 E;  5FLX Q;  4BA2 A;  2C38 B;  1XMQ I;  4DU7 A;  4QNJ A;  2HFU A;  4MQY A;  4USM A;  4YY3 E;  3Q6M A;  2WNR A;  1XMO E;  1HNZ E;  5A2Q C;  4DR4 E;  2NN6 D;  1OYS A;  3D4J A;  3HKM A;  3KRN A;  3J7A M;  2GO4 A;  4DPX A;  5JEA E;  4FWH A;  4ED4 A;  4OKG A;  2O3Z A;  3LTO A;  3WU4 A;  2IOP A;  2BA1 D;  4KHP I;  1UDO A;  1Y4U A;  2BA1 G;  1N32 I;  5IWA I;  1OYP A;  4PU9 A;  5L3J A;  1IBL I;  2UUC I;  1ZXN A;  1HNW E;  1PIE A;  1S4E A;  2VES A;  5K36 A;  2CVE A;  3J80 C;  2JEB B;  2BA0 G;  5BR8 E;  4DV3 E;  3OTO E;  1UEK A;  1USV A;  3GME A;  2DEJ A;  5K36 F;  4FW9 A;  4NXN E;  3U1Y A;  3PYD A;  4HAC A;  1N36 E;  4NBQ A;  2WW4 A;  1MG7 A;  4IS9 A;  1J5E I;  1NHJ A;  1NHH A;  3T1H E;  4DPU A;  2CGE A;  4NXM I;  2PNZ B;  4DV3 I;  2PO0 B;  4OO1 D;  3ZZU A;  2Z5E A;  5K36 D;  3PYE A;  1XXE A;  3NZK A;  2HKE A;  2J65 A;  4B3R I;  3Q1Q A;  4MU1 A;  3V2U C;  4HXZ A;  4JG4 A;  2UUB I;  1J5E E;  1N36 I;  1XNR I;  4DV7 I;  1N34 I;  1KVK A;  2O1U A;  4P52 A;  2EFG A;  4FW5 A;  1FWK A;  2V2Z A;  5IT9 C;  4EMD A;  4WUB A;  5DRR A;  4JI2 E;  4LF4 E;  3ZZ0 A;  1QZR A;  1FKA E;  3P3E A;  2DEI A;  4B3R E;  5LMU I;  1ZM4 A;  2BM0 A;  1Y6Z A;  4JI4 I;  5LL6 R;  1U2R A;  4B3M I;  1E3H A;  2HHH E;  5C0X B;  4LF5 E;  5K36 E;  2UU9 I;  3JAM C;  1EI1 A;  2J7K A;  4DV5 E;  1YH8 A;  3QT7 A;  2NN6 A;  4FWG A;  4JV5 I;  3DD6 A;  1H73 A;  1H7U A;  3B82 A;  4B3T E;  4DV1 E;  4LFA E;  3LPS A;  4DV4 I;  1USU A;  4JI3 I;  2IOQ A; 
#chains in the Genus database with same CATH homology
 4WUC A;  2OI2 A;  1ZM2 A;  1Z5B A;  3PYG A;  2LJP A;  2HK2 A;  3J81 C;  2Z5C A;  4DPY A;  4IZK A;  4YHH E;  4KQV A;  3ZM7 A;  2VQE I;  1HR0 E;  2VQF I;  1S16 A;  4LF6 E;  3J81 Q;  4B3S E;  4JI6 E;  5IWA E;  1Z0C A;  4X66 E;  4HY1 A;  4Z7Y A;  4JI8 I;  4MYT A;  4DUZ I;  2GQ0 A;  3PRY A;  2VQE E;  1HR0 I;  2ZIT A;  5A2Q Q;  4DR3 E;  4IZJ D;  2UUA I;  4JI5 E;  1ZM9 A;  1VIS A;  4JYA I;  4K0K E;  1BKN A;  4JI4 E;  2UXC E;  2UXB E;  1K47 A;  1ZM3 A;  2UU9 E;  1EA6 A;  4DV2 I;  2V2V A;  2CG9 A;  2UUA E;  4X62 E;  1IBK I;  4MYU A;  4LFC I;  2Q2E B;  1Z5C A;  1XNR E;  2UUB E;  4JI5 I;  1A6F A;  1ZXM A;  2X7I A;  4LF9 E;  4JI1 E;  4DV7 E;  2A2C A;  2BV3 A;  3LNU A;  4M1K A;  4DR2 E;  4GKK I;  2VF3 A;  1IBK E;  1WUU A;  5LMN I;  1N32 E;  4N3O A;  3H4L A;  4X62 I;  5LMU E;  4LFB E;  4USK A;  2V34 A;  3B78 A;  1XHK A;  2V2Q A;  4DXL A;  3Q6N A;  1FNM A;  4AQY I;  5GME A;  1MX0 A;  4DV5 I;  4JI6 I;  4DR1 E;  2O1V A;  2F4V E;  2UXD I;  4B3T I;  3T1Y E;  1HK7 A;  4JI3 E;  4HAC B;  4R1F A;  4DR6 E;  4DUY I;  4WUD A;  1HNX E;  3WU5 A;  3QT5 A;  1N33 E;  3K1J A;  1OJ4 A;  4RPF A;  1I94 I;  2UXD E;  5BR8 I;  4JI0 E;  4LF8 I;  3CWV A;  4I3H A;  4PRX A;  4DV2 E;  1XMO I;  4DR6 I;  2XEX A;  3B8H A;  4Z7C A;  4OX9 I;  4DPT A;  3T1H I;  1NHI A;  4LF8 E;  1FJG I;  4LF7 I;  1Z0T A;  4DR5 I;  1H72 C;  4HYM A;  3ZZT A;  4JYA E;  4YHH I;  1D6T A;  3QT8 A;  4OX9 E;  1IBL E;  1FI4 A;  4XTJ A;  5FLX C;  3F0N A;  4DV0 E;  4DV6 E;  1N0U A;  1N34 E;  3OTO I;  2CZ9 A;  3WU6 A;  4DU8 A;  4DR5 E;  4IZJ B;  1KKH A;  1FJG E;  4AQY E;  2O1W A;  2PNL A;  2E1R A;  4DPW A;  4DR1 I;  4UT4 A;  4DV0 I;  4DV6 I;  4IZK B;  1MU5 A;  4JI1 I;  1KIJ A;  2HHH I;  4IZJ A;  1IBM E;  1N0V C;  4DR3 I;  4YY3 I;  3J80 Q;  2VQF E;  4LF6 I;  5LMN E;  2R42 A;  1XMQ E;  2BM1 A;  2NPF A;  2PNM A;  4X66 I;  4LFB I;  4DUZ E;  2HK3 A;  1IBM I;  4X64 E;  4FWD A;  3J7A G;  2ZM6 I;  4DR7 I;  4KHP E;  1Z0V A;  3HUL A;  2Z5B B;  4LFC E;  3P06 A;  3HJC A;  1Z0B A;  2UUC E;  1HNW I;  4JI7 I;  1KTV A;  2X36 A;  2Z5B A;  4PRV A;  4X64 I;  4DUY E;  2AJ4 A;  1B63 A;  2R3V A;  2ZBK B;  4JI8 E;  4NXN I;  2HFS A;  1HNX I;  1RR9 A;  4LFA I;  1Z59 A;  4JI7 E;  4NXM E;  4GKJ E;  1NZ0 A;  3K85 A;  4JI0 I;  4LF9 I;  1ELO A;  2Z5C B;  1Z0G A;  3QT6 A;  2V8P A;  4DR2 I;  4GKK E;  2GS8 A;  1PVG A;  1PKP A;  1FWL A;  5FWK A;  2O1T A;  4UTG A;  4DV1 I;  2E5L I;  3ZKD A;  4URL A;  1Y4S A;  4GKJ I;  2UXB I;  2UXC I;  4K0K I;  5IT9 Q;  3M6A A;  3K17 A;  1RRE A;  1B62 A;  5GMD A;  3WU3 A;  4X65 I;  1Z0E A;  1DAR A;  1XNQ E;  1H7S A;  4P7A A;  2HKJ A;  4B3M E;  3GON A;  2F4V I;  3ZKB A;  3V5R A;  2E5L E;  3T1Y I;  2A2D A;  3JAM Q;  4LF5 I;  4B3S I;  2ZM6 E;  4DR7 E;  1HNZ I;  4DR4 I;  4ZVI A;  4X65 E;  4JV5 E;  3PYF A;  1Z5A A;  1XNQ I;  1N33 I;  1I94 E;  4FN5 A;  4DV4 E;  1Z0W A;  1H74 A;  4JI2 I;  4LF4 I;  4LF7 E;  5FLX Q;  1XMQ I;  4DU7 A;  4YY3 E;  2HFU A;  4USM A;  3Q6M A;  1XMO E;  1HNZ E;  5A2Q C;  4DR4 E;  3D4J A;  3J7A M;  4DPX A;  4FWH A;  4ED4 A;  3LTO A;  3WU4 A;  2IOP A;  4KHP I;  1N32 I;  1Y4U A;  5IWA I;  4PU9 A;  5L3J A;  1IBL I;  2UUC I;  1ZXN A;  1HNW E;  1PIE A;  1S4E A;  3J80 C;  4DV3 E;  5BR8 E;  3OTO E;  1UEK A;  1USV A;  2DEJ A;  4FW9 A;  4NXN E;  3PYD A;  4HAC A;  1N36 E;  2WW4 A;  1MG7 A;  1J5E I;  1NHJ A;  1NHH A;  3T1H E;  4DPU A;  2CGE A;  4NXM I;  4DV3 I;  3ZZU A;  2Z5E A;  3PYE A;  2HKE A;  4B3R I;  3Q1Q A;  3V2U C;  4HXZ A;  4JG4 A;  2UUB I;  1J5E E;  1N36 I;  1XNR I;  4DV7 I;  1N34 I;  1KVK A;  2O1U A;  4P52 A;  2EFG A;  1FWK A;  2V2Z A;  5IT9 C;  4EMD A;  4WUB A;  4JI2 E;  4LF4 E;  3ZZ0 A;  1QZR A;  1FKA E;  2DEI A;  4B3R E;  5LMU I;  1ZM4 A;  2BM0 A;  1Y6Z A;  4JI4 I;  5LL6 R;  1U2R A;  4B3M I;  2HHH E;  4LF5 E;  2UU9 I;  3JAM C;  1EI1 A;  2J7K A;  4DV5 E;  3QT7 A;  4FWG A;  4JV5 I;  1H73 A;  1H7U A;  3B82 A;  4B3T E;  4DV1 E;  4LFA E;  3LPS A;  4DV4 I;  1USU A;  4JI3 I;  2IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...