4DR2E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr2E02
2ZITA 2RSMA 3JAMC 5FLXC 2E1RA 1WHNA 4B3ME 3V2UC 1PIEA 1WHQA 1XMQE 5LMUI 4JG4A 3ADLA 1STUA 4X66E 3J7Yp 1HNWE 1Z5AA 3T1YE 4Z7YA 1B62A 1Z0GA 5FLXQ 1MG7A 4B3MI 4OX9E 2L2MA 1FJGE 4JI7E 3HULA 4NXME 1I94I 1YYWA 1HNZE 1HNWI 3LPSA 3T1YI 1H72C 4DPXA 3VYXA 3K17A 1FJGI 1IBMI 4JI7I 4DV1E 1Z0VA 4NXMI 4DV7I 1ZM9A 4FN5A 3H4LA 2L3JA 4DPWA 4HYMA 2N3GA 3PYDA 2LRSA 5IT9C 1EKZA 1X47A 4DUZI 3ADGA 1XNRI 1YYKA 1X48A 1YYOA 4PRXA 1DI2A 5IT9Q 2LTSA 5CFFE 2HKJA 4DR5I 4GKJI 4DR7E 2HFUA 4LF8E 4Z7CA 3PYEA 2VQEI 4FW9A 2NA2A 4HY1A 1OJ4A 3J80C 3QT5A 2OI2A 1MX0A 2HFSA 3C4TA 3CWVA 1U2RA 2UUBE 1N0UA 2UUCE 3ADIA 1KTVA 3D4JA 2R3VA 1EA6A 1NHIA 3K1JA 1ELOA 4FWDA 4RPFA 2IHR1 1GQEA 4URLA 4MYTA 4WUCA 3J80Q 4JI0E 4ZVIA 3ZM7A 2V2VA 2UUAE 4LFBE 2UUCI 2L3CA 5IWAE 4DR2E 4LFAE 1KVKA 3QT8A 2F4VE 2RTXA 2E5LI 4LF6E 4JI0I 2BM0A 1N36E 4DR4I 2LTRA 3ADJA 4DV0I 4LF4I 2UUAI 4FWHA 4P52A 4DV3I 4LFBI 4UT4A 1N0VC 4LF9E 3T1HI 4LFAI 4FWGA 2F4VI 4DR1I 2JY9A 4LF6I 4LF5I 4YY3E 2HKEA 2B3TB 4LF9I 1QU6A 3WU6A 4DR3E 4AQYE 1Z0EA 4DPTA 2DEJA 1ZM4A 1J5EE 1EI1A 2L2NA 4YY3I 1ZBTA 4DV2E 3JAMQ 4X62E 1D6TA 1IBLE 2BM1A 4AQYI 1XMQI 2X7IA 5GMEA 4X66I 1T4LB 1NZ0A 1HNXE 4ED4A 4JI3E 4JYAE 4JI5E 4JV5E 3WU4A 4X62I 2HHHE 4OX9I 2DEIA 1UEKA 1IBLI 2ZM6E 3J7AG 1QZRA 1WUUA 4WUBA 1XNQE 1HNZI 4HACB 4DKKA 4DUYE 4DV4E 4JI3I 4JYAI 4JV5I 2B7VA 4P7AA 4M2ZA 2ZM6I 4DV1I 2DMYA 4JI4E 3OTOE 1N33E 1XNQI 1FI4A 1XMOE 4B3RE 2BV3A 2NUGA 2UXDE 1PVGA 3WU3A 1BKNA 4USMA 1B63A 4JI4I 3OTOI 4LF7E 4JI6E 1FWLA 3B78A 1N33I 1X49A 1ZM3A 4XTJA 1XMOI 1FKAE 1YZ9A 1XHKA 4DR6E 2DB2A 4I3HA 5A2QC 1N34E 1PKPA 1UILA 4LF7I 2LUQA 3LNUA 5L3JA 3LLHA 3QT7A 3PYFA 4DR7I 4LF8I 2AJ4A 1HR0E 5A2QQ 2DIXA 4NXNE 4EMDA 4WUDA 2UUBI 1Z0CA 5LL6R 1K47A 1MU5A 1S4EA 4LFCE 3QT6A 1Z0BA 3F0NA 4M1KA 4JI8E 2Q2EB 1HR0I 4USKA 4JI2E 4NXNI 1O0WA 2YT4A 5IWAI 4DR2I 3J81C 4B3TE 2VQFE 4GKKE 4JI8I 1Z0WA 2LJHA 1N36I 5GMDA 1RR9A 1VISA 2NPFA 5BR8E 3WU5A 2GS8A 3ZKBA 3J81Q 2MDRA 3ZZTA 1ZXMA 2VQFI 1H74A 3ZZUA 3GONA 5LMUE 1IBKE 1KIJA 1FNMA 4DU7A 4JI1E 5BR8I 1Z5CA 2NUFA 4DR3I 1Z59A 3B82A 2CZ9A 2LBSB 4K0KE 1T4OA 1FWKA 1J5EI 1I94E 2UXBE 1IBKI 4DV2I 1RREA 4JI1I 4KHPE 2V2ZA 4DU8A 1J26A 3Q1QA 2UXCE 2HK3A 4K0KI 1IBME 1HNXI 2UXBI 4DV7E 3J7AM 4JI5I 4DV6E 2UU9E 2HHHI 4KHPI 3M6AA 2VF3A 1ZM2A 4R1FA 2UXCI 2EZ6A 2R42A 4DUYI 1ZXNA 4DV4I 4DV6I 2UU9I 4UTGA 4DUZE 2V8PA 4X64E 1XNRE 3C4BA 2NUEA 2RS7A 1T4NA 3B8HA 4B3RI 2JVAA 4DR5E 4GKJE 2LUPB 1N32E 3ZZ0A 2B7TA 5LMNE 4X64I 2J7KA 2V34A 2UXDI 2VQEE 4JI6I 3V5RA 2RS6A 1Z5BA 4WYQB 2A2DA 2ZBKB 4DPUA 2X36A 4DR6I 4M30A 1N32I 3PYGA 5LMNI 4X8WA 2A2CA 3VYYA 1N34I 2HK2A 2XEXA 3LTOA 1NHHA 4X65E 4PU9A 1RC7A 2WW4A 1H7UA 4DV5E 4B3SE 4OOGC 1H7SA 2E5LE 2LJPA 4DR4E 2L33A 1H73A 4DPYA 1NHJA 3P1XA 4HACA 4X65I 4LF4E 4DV0E 4LFCI 4DV3E 2V2QA 1DARA 4YHHE 4MYUA 2CPNA 1A6FA 2KHXA 3HTXA 3T1HE 4JI2I 2N3HA 4DV5I 4DR1E 4B3SI 1RQ0A 2EFGA 4LF5E 1UHZA 4PRVA 4B3TI 1Z0TA 1S16A 4KQVA 4GKKI 4YHHI 4WFTA 2L2KB 3ZKDA 4HXZA 4DXLA 1KKHA
chains in the Genus database with same CATH superfamily
1EH8A 2ZITA 2RSMA 5C0XB 3PS1A 3JAMC 5FLXC 4NZVA 2E1RA 1WHNA 4B3ME 3V2UC 1PIEA 1WHQA 1XMQE 2YU5A 5LMUI 4JG4A 4FK5C 3ADLA 1NCSA 4LCGA 1STUA 4X66E 3J7Yp 1Z1BA 2M4IA 2EQ3A 2F8BA 1HNWE 5DRRA 5JEAE 1UDOA 1Z5AA 3T1YE 1TF6A 5T6JA 4Z7YA 1B62A 1Z0GA 4KWYA 5AC5A 1XXEA 5FLXQ 1MG7A 2C37A 5JEAC 4B3MI 4OX9E 2L2MA 1FJGE 2RSIA 5K36D 4JI7E 3HULA 4OO1B 4NXME 2PO2B 1I94I 1YYWA 1HNZE 1HNWI 1L4SA 2ODRC 1IQOA 3LPSA 3P06A 3T1YI 1H72C 2EOSA 2YTEA 4DPXA 3FIGA 3EPKA 3VYXA 3KRNA 2LMZA 4MQYA 1WXRA 4BBYA 3K17A 2YTDA 1FJGI 2EM5A 3L00A 1IBMI 1Y4UA 2V87A 4DV1E 2JOXA 1HNZI 2EM9A 4JI7I 4IFDD 1Z0VA 4NXMI 4DV7I 4R2PA 3Q6MA 1ZM9A 1A1HA 4FN5A 2PO1A 2ADRA 4WSGA 2GQ0A 3H4LA 2RPCA 5A69A 2L3JA 2YWQA 3RMPA 1A1GA 4DPWA 4HYMA 4LOMA 2ELYA 2EOIA 2N3GA 2BB8A 3BF2A 2MC6A 2PNZB 3PYDA 3EPJA 2DLQA 2ENHA 2YPNA 4FW3A 5FWKA 1SFEA 2LRSA 3C6MA 3KZZA 5IT9C 4BHBA 3EPHA 3AUZA 2EMWA 1EKZA 1X47A 4DUZI 3ADGA 2JWOA 1XNRI 2JEAB 3THNA 1YYKA 1DGCA 1X48A 1A1FA 5C0XE 3LMLA 4MU1A 4MLVA 1YYOA 4PRXA 3UHMA 4DMIA 1BB8A 4AIDA 1BBOA 1DI2A 5C0XC 2Z5CB 5IT9Q 2LTSA 1UDQA 2FV4B 5CFFE 2EM4A 3NZKA 2HKJA 2EMZA 4DR5I 2DGCA 4GKJI 2EL6A 4DR7E 2HFUA 4LF8E 2BA0G 4MU0A 1LLMC 4Z7CA 3PYEA 2EOMA 2HGHA 2VQEI 1YH8A 4FW9A 2NA2A 4HY1A 1OJ4A 3J80C 3QT5A 2EN8A 2EPOA 2OI2A 1MX0A 2HFSA 3C4TA 4LCFA 4NBQA 3CWVA 4FW5A 4R2RA 3HKMA 4OO1E 1U2RA 4L8NA 1YPNA 1PJSA 2ODRD 2UUBE 1N0UA 2UUCE 2WBTA 3ADIA 1KTVA 1RHYA 3D4JA 2R3VA 2EPZA 1EA6A 5KL4A 1NHIA 4OO1C 3K1JA 3AV0A 1ELOA 2JPAA 4FWDA 2IERA 4RPFA 2IHR1 1GQEA 2EOJA 4MYTA 4URLA 3DF6A 2EM3A 4TUGA 4FW7A 4WUCA 3J80Q 4JI0E 4ZVIA 4DXLA 3ZM7A 2V2VA 3M85D 2UUAE 4LFBE 3KZYA 2YTNA 3P76A 2UUCI 2L3CA 5DNYA 5K36F 2EM6A 5IWAE 4DR2E 3PS2A 2NN6A 5K36A 3TQMA 1G2FC 4LFAE 1KVKA 3QT8A 2F4VE 2LT7A 2V86A 4BCAA 3JTZA 3DJWA 2RTXA 2E5LI 4LF6E 4JI0I 2BM0A 1N36E 5TSEA 4DR4I 2C39A 2EOHA 2LTRA 3ADJA 3JU0A 1Y4SA 4DV0I 4P78A 2UUAI 2YRKA 4FWHA 4P52A 4DV3I 4LFBI 1R6LA 3EQ1A 4IFDF 4WSPA 4UT4A 2WBUA 3ECRA 1N0VC 4LF9E 2C38B 2FTXB 3T1HI 4LFAI 4FWGA 2F4VI 4DR1I 4P7DA 2JY9A 2BA1D 2M7QA 2YTGA 4LF4I 4LTYA 4LF6I 4LF5I 4U3DA 2EM8A 4YY3E 2KONA 5KL5A 2M1SA 3F6HA 2EPPA 2V85A 4IZJB 2V8QB 2HKEA 1X3CA 3PS3A 2F1DA 1YUJA 2B3TB 2EMCA 1IMUA 4LF9I 2EMGA 2L92A 5DNLA 1QU6A 1X6HA 4WPYA 4DR3E 4AQYE 3WU6A 1Z0EA 4ISAA 4DPTA 1ZR9A 3VHTB 4BA2A 4N4RB 2DEJA 1ZM4A 1J5EE 1GTKA 1EI1A 2EN1A 2EMXA 2L2NA 2IESA 1ZBTA 4TUIA 3L7ZB 4YY3I 4O43A 4DV2E 2YTQA 1R6MA 4ZYGA 4N3OA 3JAMQ 2EQ0A 4GEQB 4M9VC 2BR2B 4X62E 4FW4A 4QNJA 5DRQA 3KWRA 2Z5BB 1D6TA 1IBLE 2CVEA 2NN6D 2BM1A 2O1VA 1PJQA 1UDSA 4AQYI 1XMQI 2X7IA 1KYQA 4IZKA 1A1JA 2EWLA 2EMBA 5GMEA 1OYPA 4X66I 1T4LB 1NZ0A 3HJCA 2GHFA 5JEAA 1HNXE 3VK6A 4ED4A 3CDJA 4JI3E 4JYAE 2EMAA 4JI5E 4JV5E 1E3PA 2WP8A 3H1CA 4J3DA 4MDTA 3WU4A 4X62I 2HHHE 4BA1B 4OX9I 2YTFA 2DEIA 1UEKA 1IBLI 2ZM6E 2L6MA 2HJJA 3J7AG 2VE7C 1X6FA 1QZRA 2EPLX 3U1KA 1WUUA 2FGGA 4WUBA 4MLQA 1XNQE 4HACB 3BGHA 2EM0A 2EMLA 4DKKA 4IS9A 2EOFA 4DUYE 5ADZA 1NEIA 5AE3A 1IQSA 2G7HA 1QNTA 1T38A 2JEBA 4DV4E 2PO0A 4JI3I 4JYAI 2GO3A 4JV5I 2B7VA 5A6BA 1F2IG 3M85G 4P7AA 2WZOA 2LV2A 2EN7A 2BBGA 4F2JC 1TF3A 3K6QA 4M2ZA 2ZM6I 4DV1I 2DMYA 3BBGA 2I9IA 3OTOE 4JI4E 1ZU1A 1N33E 4U3BA 2ENCA 1XNQI 2D9HA 3HPZA 1TN9A 1FI4A 2EM7A 1XMOE 3EPLA 4J8ZA 4B3RE 3ZOQB 5DNXA 4IFDB 2BV3A 4BMJA 2GO4A 1B69A 4RHBB 2NUGA 2JE6B 1X6EA 2EOXA 2UXDE 1PVGA 1BKNA 1Y5YA 1B63A 3WU3A 4O4KA 4USMA 4JI4I 3P3GA 2DLKA 4LF7E 4JI6E 1FWLA 3B78A 3OTOI 1N33I 3DD6A 1X49A 4Q28A 1ZM3A 2B9DA 2BA1G 4XTJA 1AH5A 2WNRA 1XMOI 4F6MA 1FKAE 4GZNC 2O1WA 5JEAD 1X5WA 1YZ9A 2PNMA 5C0XA 1XHKA 4O5GA 4DR6E 2DB2A 4I3HA 5A2QC 2CT1A 1N34E 1PKPA 1UILA 3H09A 4ZYHA 5AE1A 2LUQA 3LNUA 1GZ6A 3PRYA 4LF7I 5L3JA 3LLHA 2O1TA 4F54A 3QT7A 3PYFA 2EORA 4DR7I 4LF8I 4HEIA 2AJ4A 2DRPA 2C37B 2EOOA 2YRHA 4LPFA 4LCHA 4BHCA 1A1IA 1P42A 5A6BD 1HR0E 5A2QQ 1OYRA 2DIXA 4NXNE 1OYSA 2MDGA 2MKDA 3CDIA 4EMDA 3BIDA 2EOZA 4OO1A 1MEYC 2EPKX 4WUDA 2YRMA 1Z0CA 5LL6R 1Y60A 1K47A 2NN6F 3MSWA 2PO2A 2UUBI 2VF1A 1BBGA 1MU5A 3U1YA 1S4EA 4LFCE 2CSHA 3QT6A 1Z0BA 2EPNA 1EH7A 3F0NA 2LVHA 4M1KA 4JI8E 1KJKA 2Q2EB 2DSYA 1Y6ZA 1HR0I 4USKA 4JI2E 4NXNI 4X9JA 1O0WA 2YT4A 5AC4A 4DPYA 2A25A 2PO1B 5EL9A 3IWDA 4MU4A 5IWAI 4DR2I 3J81C 4NHRA 4B3TE 2EJ4A 2VRDA 2JR1A 1UBDC 2VQFE 4GKKE 1WRJA 2WBSA 4JI8I 2R1FA 2J65A 1Z0WA 5C0XD 4IZJD 4IFDE 2EPUA 2LJHA 2PNZA 1N36I 2DMIA 2V83A 2ENAA 5GMDA 1T39A 4FW6A 2JT2A 2R76A 4GQUA 4IFDC 1RR9A 1VISA 4F9CB 3QG5C 4F9BB 5KL7A 2EN6A 2NPFA 5BR8E 3WU5A 2RQLA 2GS8A 3ZKBA 3J81Q 2MDRA 3ZZTA 1ZXMA 4O24A 1A1LA 4F9AB 2VQFI 2EN2A 2EPCA 2K4VA 4R2DA 2LE2A 1H74A 4AIMA 3GLLA 3ZZUA 5DROA 3GONA 1USVA 5LMUE 1IBKE 1KIJA 1FNMA 5LLQA 2Z5CA 1N32I 1MGTA 2N8XA 2PRTA 2NABA 3IWCA 4OO1D 4DU7A 4JI1E 4F6NA 2WCC3 1JK1A 5BR8I 1Z5CA 3M7NG 2NUFA 4DR3I 1YFHA 1Z59A 2VESA 3B82A 2EE8A 2LBSB 2EL5A 5F3WA 4K0KE 2CZ9A 3GMEA 5JEAF 1T4OA 2EN4A 1FWKA 1J5EI 2I13A 4WXCA 3Q6NA 1I94E 2UXBE 2CTDA 2JOBA 1N3GA 5A6JA 2YZTA 2L8TA 2YTPA 4DV2I 1IBKI 3HPSA 2EOEA 3F6GA 1RREA 2Z5EA 2EOYA 4JI1I 4KHPE 4BC7A 4R8OA 4WX9A 2YSOA 5IXMB 2V2ZA 2LO3A 4DU8A 4R2SA 1J26A 3Q1QA 4QNKA 2UXCE 2HK3A 4K0KI 2J7JA 1IBME 1YUIA 1HNXI 2UXBI 1SR9A 2E1MA 4DV7E 5IV8B 3J7AM 4R2EA 2GPIA 3GCMA 4DV6E 2EM2A 4R03A 2NN6B 4JI5I 5K36B 2UU9E 2EMHA 2HHHI 4KHPI 2ELZA 3M6AA 5AE2A 2IOQA 2IOPA 2VF3A 2CG9A 2EPMX 4RH8A 1ZM2A 2PNLA 4R1FA 5ELWA 2EZ6A 2UXCI 2C39B 2LJUA 2R42A 4DUYI 1YHCA 4HTGA 3MHHC 4IJDA 1ZXNA 4DV4I 4DV6I 2UU9I 4UTGA 4DUZE 1AAYA 1HK7A 2EN3A 1DQ3A 2YTIA 2GLIA 4X64E 1XNRE 2V8PA 3C4BA 2LCEA 2C38A 4L5NC 5EKWA 3C6KA 3UK3C 2NUEA 4MU3A 3M7ND 2RS7A 1ZBQA 1T4NA 1UN6B 5C0XF 1USUA 5A6AA 2AE8A 3B8HA 3P3CA 4B3RI 5KL6A 4R2QA 2JVAA 4DR5E 4IZJA 4GKJE 2LUPB 2EMFA 1N32E 2B7TA 5LMNE 3ZZ0A 4X64I 2J7KA 2O1UA 2Q8UA 2V34A 2UXDI 4BA2B 2VQEE 4JI6I 2KOUA 5AASA 3V5RA 2RS6A 4BC9A 5KL3A 1Z5BA 4WYQB 2A2DA 3L7ZA 2ZBKB 3M99B 3HXLA 4KZSA 4DPUA 1WJPA 1ZAAC 2EPAA 2X36A 2E72A 4DR6I 1PJTA 2EMIA 4M30A 1YSAC 2BR2A 4X8WA 2A2CA 3VYYA 3PYGA 4IZKB 4LU9A 4OKGA 5LMNI 4OO1F 2Z5BA 1N34I 2HK2A 2JP9A 2XEXA 3LTOA 2JXPA 4ZYDA 1UDNA 1NHHA 5JEAB 2HC5A 4X65E 2V89A 2WP8B 2YTJA 4WXDA 3K85A 4PU9A 3B4TA 2K7IA 1RC7A 2CGEA 2NN6E 5K36E 2EPRA 2WW4A 1H7UA 2EOQA 2M9AA 4BA1A 4DV5E 2NN6C 5K36C 4B3SE 4OOGC 1H7SA 2E5LE 2LJPA 4DR4E 2L33A 1H73A 2JEBB 1NHJA 3P1XA 1PDAA 4HACA 2PO0B 3THOB 5KL2A 3HQ1A 4DV0E 4LF4E 2JYAA 3IWBA 4LFCI 4X65I 4DV3E 2V2QA 4R2CA 4YHHE 2V88A 1DARA 2CPNA 2MKNA 4MYUA 1JK2A 1A6FA 2KHXA 3HTXA 5A6KA 4R2AA 3T1HE 2EL4A 1G2DC 4JI2I 2N3HA 4Q35B 2EQ1A 4DR1E 4DV5I 2EPXA 4OZEA 4B3SI 4ZYEA 1RQ0A 2EFGA 5DRPA 4IS1C 4LF5E 3P3EA 1UHZA 2EMKA 4PRVA 1VI7A 4I8OA 4M0VA 1P47A 2O3ZA 1RMDA 4B3TI 1Z0TA 1S16A 4BS9A 4KQVA 4GKKI 4YHHI 2JEAA 4WFTA 4AM3A 3OMLA 2YTOA 3MHSC 4IFDA 1E3HA 2L2KB 2MC5A 2H36X 2EMYA 2JE6A 2YSPA 3ZKDA 2YU8A 1A1KA 2BA0D 2WNRB 4HXZA 2EP3A 1EH6A 1KKHA
chains in the Genus database with same CATH topology
2ZITA 2RSMA 3JAMC 5FLXC 2E1RA 1WHNA 4B3ME 3V2UC 1PIEA 1WHQA 1XMQE 5LMUI 4JG4A 3ADLA 1STUA 4X66E 3J7Yp 2M4IA 2F8BA 1HNWE 1Z5AA 3T1YE 5T6JA 4Z7YA 1B62A 1Z0GA 5FLXQ 1MG7A 4B3MI 4OX9E 2L2MA 1FJGE 4JI7E 3HULA 4NXME 1I94I 1YYWA 1HNZE 1HNWI 2ODRC 3LPSA 3P06A 3T1YI 1H72C 4DPXA 3FIGA 3VYXA 2LMZA 1WXRA 4BBYA 3K17A 1FJGI 1IBMI 1Y4UA 2V87A 4DV1E 2JOXA 4JI7I 1Z0VA 4NXMI 4DV7I 3Q6MA 1ZM9A 4FN5A 2GQ0A 3H4LA 3RMPA 2L3JA 4DPWA 4HYMA 2N3GA 2MC6A 3PYDA 5FWKA 2LRSA 5IT9C 3AUZA 1EKZA 1X47A 4DUZI 3ADGA 2JWOA 1XNRI 1YYKA 1X48A 3LMLA 1YYOA 4PRXA 4DMIA 1DI2A 2Z5CB 5IT9Q 2LTSA 2FV4B 5CFFE 2HKJA 4DR5I 4GKJI 4DR7E 2HFUA 4LF8E 4Z7CA 3PYEA 2VQEI 4FW9A 2NA2A 4HY1A 1OJ4A 3J80C 3QT5A 2OI2A 1MX0A 2HFSA 3C4TA 3CWVA 1U2RA 4L8NA 2ODRD 2UUBE 1N0UA 2UUCE 3ADIA 1KTVA 3D4JA 2R3VA 1EA6A 1NHIA 3K1JA 3AV0A 1ELOA 4FWDA 4RPFA 2IHR1 1GQEA 4URLA 4MYTA 3DF6A 4TUGA 4WUCA 3J80Q 4JI0E 4ZVIA 3ZM7A 2V2VA 2UUAE 4LFBE 2UUCI 2L3CA 5DNYA 5IWAE 4DR2E 4LFAE 1KVKA 3QT8A 2F4VE 2V86A 4BCAA 3JTZA 3DJWA 2RTXA 2E5LI 4LF6E 4JI0I 2BM0A 1N36E 4DR4I 3JU0A 2LTRA 3ADJA 1Y4SA 4DV0I 4LF4I 4P78A 2UUAI 4FWHA 4P52A 4DV3I 4LFBI 4WSPA 4UT4A 1N0VC 4LF9E 3T1HI 2FTXB 4LFAI 4FWGA 2F4VI 4DR1I 4P7DA 2JY9A 2M7QA 4LTYA 4LF6I 4LF5I 4YY3E 2KONA 2M1SA 3F6HA 2V85A 4IZJB 2V8QB 2HKEA 2B3TB 4LF9I 2L92A 1QU6A 4WPYA 3WU6A 4DR3E 4AQYE 1Z0EA 4DPTA 2DEJA 1ZM4A 1J5EE 1EI1A 2L2NA 4YY3I 1ZBTA 4TUIA 4DV2E 4N3OA 3JAMQ 4GEQB 4X62E 3KWRA 2Z5BB 1D6TA 1IBLE 2BM1A 2O1VA 4AQYI 1XMQI 2X7IA 4IZKA 2EWLA 5GMEA 4X66I 1T4LB 1NZ0A 3HJCA 1HNXE 3VK6A 4ED4A 4JI3E 4JYAE 4JI5E 4JV5E 3WU4A 4X62I 2HHHE 4OX9I 2DEIA 1UEKA 1IBLI 2ZM6E 2L6MA 3J7AG 2VE7C 1QZRA 1WUUA 2FGGA 4WUBA 1XNQE 1HNZI 4HACB 4DKKA 4DUYE 5ADZA 5AE3A 2G7HA 4DV4E 4JI3I 4JYAI 4JV5I 2B7VA 4P7AA 2WZOA 3K6QA 4M2ZA 2ZM6I 4DV1I 2DMYA 4JI4E 3OTOE 1N33E 1XNQI 3HPZA 1FI4A 1XMOE 4J8ZA 4B3RE 3ZOQB 2BV3A 4BMJA 2NUGA 2UXDE 1PVGA 3WU3A 1BKNA 4USMA 1B63A 4JI4I 3OTOI 4LF7E 4JI6E 1FWLA 3B78A 1N33I 1X49A 4Q28A 1ZM3A 2B9DA 4XTJA 1XMOI 1FKAE 2O1WA 1YZ9A 2PNMA 1XHKA 4DR6E 2DB2A 4I3HA 5A2QC 1N34E 1PKPA 1UILA 3H09A 5AE1A 4LF7I 2LUQA 3LNUA 1GZ6A 3PRYA 5L3JA 3LLHA 2O1TA 4F54A 3QT7A 3PYFA 4DR7I 4LF8I 2AJ4A 1HR0E 5A2QQ 2DIXA 4NXNE 4EMDA 4WUDA 2UUBI 1Z0CA 5LL6R 1K47A 3MSWA 2VF1A 1MU5A 1S4EA 4LFCE 3QT6A 1Z0BA 3F0NA 4M1KA 4JI8E 2Q2EB 2DSYA 1Y6ZA 1HR0I 4USKA 4JI2E 4NXNI 1O0WA 2YT4A 5IWAI 3IWDA 4DR2I 3J81C 4B3TE 2JR1A 2VQFE 4GKKE 4JI8I 1Z0WA 4IZJD 2LJHA 1N36I 2V83A 5GMDA 1RR9A 1VISA 4F9CB 4F9BB 2NPFA 5BR8E 3WU5A 2GS8A 3ZKBA 3J81Q 2MDRA 3ZZTA 1ZXMA 4F9AB 2VQFI 2K4VA 2LE2A 1H74A 3ZZUA 3GONA 1USVA 5LMUE 1IBKE 1KIJA 1FNMA 2Z5CA 3IWCA 4DU7A 4JI1E 5BR8I 1Z5CA 2NUFA 4DR3I 1Z59A 3B82A 2LBSB 5F3WA 4K0KE 2CZ9A 1T4OA 1FWKA 1J5EI 3Q6NA 1I94E 2UXBE 1IBKI 2JOBA 4DV2I 2YZTA 2L8TA 3HPSA 3F6GA 1RREA 2Z5EA 4JI1I 4KHPE 4BC7A 4R8OA 2V2ZA 4DU8A 1J26A 3Q1QA 2UXCE 2HK3A 4K0KI 1IBME 1HNXI 2UXBI 1SR9A 2E1MA 4DV7E 3J7AM 4JI5I 4DV6E 4R03A 2UU9E 2HHHI 4KHPI 3M6AA 5AE2A 2IOQA 2IOPA 2VF3A 2CG9A 1ZM2A 2PNLA 4R1FA 2UXCI 2EZ6A 2R42A 4DUYI 1ZXNA 4DV4I 4DV6I 2UU9I 4UTGA 4DUZE 1HK7A 1DQ3A 2V8PA 4X64E 1XNRE 3C4BA 4L5NC 2NUEA 2RS7A 1ZBQA 1T4NA 1USUA 3B8HA 4B3RI 2JVAA 4DR5E 4IZJA 4GKJE 2LUPB 1N32E 3ZZ0A 2B7TA 5LMNE 4X64I 2J7KA 2O1UA 2V34A 2UXDI 2VQEE 4JI6I 2KOUA 5AASA 3V5RA 2RS6A 4BC9A 1Z5BA 4WYQB 2A2DA 2ZBKB 3HXLA 4KZSA 4DPUA 2X36A 4DR6I 4M30A 1N32I 3PYGA 5LMNI 4X8WA 2A2CA 3VYYA 4IZKB 4LU9A 2Z5BA 1N34I 2HK2A 2XEXA 3LTOA 1NHHA 4X65E 2V89A 3K85A 4PU9A 1RC7A 2CGEA 2WW4A 1H7UA 4DV5E 4B3SE 4OOGC 1H7SA 2E5LE 2LJPA 4DR4E 2L33A 1H73A 4DPYA 1NHJA 3P1XA 4HACA 4X65I 4LF4E 3HQ1A 4DV0E 4LFCI 3IWBA 4DV3E 2V2QA 1DARA 4YHHE 2V88A 4MYUA 2CPNA 1A6FA 2KHXA 3HTXA 3T1HE 4JI2I 2N3HA 4DV5I 4DR1E 4B3SI 1RQ0A 2EFGA 4LF5E 1UHZA 4PRVA 4I8OA 4M0VA 4B3TI 1Z0TA 1S16A 4BS9A 4KQVA 4GKKI 4YHHI 4WFTA 3OMLA 2L2KB 2MC5A 2H36X 3ZKDA 4HXZA 4DXLA 1KKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIT A;  2RSM A;  3JAM C;  5FLX C;  2E1R A;  1WHN A;  4B3M E;  3V2U C;  1PIE A;  1WHQ A;  1XMQ E;  5LMU I;  4JG4 A;  3ADL A;  1STU A;  4X66 E;  3J7Y p;  1HNW E;  1Z5A A;  3T1Y E;  4Z7Y A;  1B62 A;  1Z0G A;  5FLX Q;  1MG7 A;  4B3M I;  4OX9 E;  2L2M A;  1FJG E;  4JI7 E;  3HUL A;  4NXM E;  1I94 I;  1YYW A;  1HNZ E;  1HNW I;  3LPS A;  3T1Y I;  1H72 C;  4DPX A;  3VYX A;  3K17 A;  1FJG I;  1IBM I;  4JI7 I;  4DV1 E;  1Z0V A;  4NXM I;  4DV7 I;  1ZM9 A;  4FN5 A;  3H4L A;  2L3J A;  4DPW A;  4HYM A;  2N3G A;  3PYD A;  2LRS A;  5IT9 C;  1EKZ A;  1X47 A;  4DUZ I;  3ADG A;  1XNR I;  1YYK A;  1X48 A;  1YYO A;  4PRX A;  1DI2 A;  5IT9 Q;  2LTS A;  5CFF E;  2HKJ A;  4DR5 I;  4GKJ I;  4DR7 E;  2HFU A;  4LF8 E;  4Z7C A;  3PYE A;  2VQE I;  4FW9 A;  2NA2 A;  4HY1 A;  1OJ4 A;  3J80 C;  3QT5 A;  2OI2 A;  1MX0 A;  2HFS A;  3C4T A;  3CWV A;  1U2R A;  2UUB E;  1N0U A;  2UUC E;  3ADI A;  1KTV A;  3D4J A;  2R3V A;  1EA6 A;  1NHI A;  3K1J A;  1ELO A;  4FWD A;  4RPF A;  2IHR 1;  1GQE A;  4URL A;  4MYT A;  4WUC A;  3J80 Q;  4JI0 E;  4ZVI A;  3ZM7 A;  2V2V A;  2UUA E;  4LFB E;  2UUC I;  2L3C A;  5IWA E;  4DR2 E;  4LFA E;  1KVK A;  3QT8 A;  2F4V E;  2RTX A;  2E5L I;  4LF6 E;  4JI0 I;  2BM0 A;  1N36 E;  4DR4 I;  2LTR A;  3ADJ A;  4DV0 I;  4LF4 I;  2UUA I;  4FWH A;  4P52 A;  4DV3 I;  4LFB I;  4UT4 A;  1N0V C;  4LF9 E;  3T1H I;  4LFA I;  4FWG A;  2F4V I;  4DR1 I;  2JY9 A;  4LF6 I;  4LF5 I;  4YY3 E;  2HKE A;  2B3T B;  4LF9 I;  1QU6 A;  3WU6 A;  4DR3 E;  4AQY E;  1Z0E A;  4DPT A;  2DEJ A;  1ZM4 A;  1J5E E;  1EI1 A;  2L2N A;  4YY3 I;  1ZBT A;  4DV2 E;  3JAM Q;  4X62 E;  1D6T A;  1IBL E;  2BM1 A;  4AQY I;  1XMQ I;  2X7I A;  5GME A;  4X66 I;  1T4L B;  1NZ0 A;  1HNX E;  4ED4 A;  4JI3 E;  4JYA E;  4JI5 E;  4JV5 E;  3WU4 A;  4X62 I;  2HHH E;  4OX9 I;  2DEI A;  1UEK A;  1IBL I;  2ZM6 E;  3J7A G;  1QZR A;  1WUU A;  4WUB A;  1XNQ E;  1HNZ I;  4HAC B;  4DKK A;  4DUY E;  4DV4 E;  4JI3 I;  4JYA I;  4JV5 I;  2B7V A;  4P7A A;  4M2Z A;  2ZM6 I;  4DV1 I;  2DMY A;  4JI4 E;  3OTO E;  1N33 E;  1XNQ I;  1FI4 A;  1XMO E;  4B3R E;  2BV3 A;  2NUG A;  2UXD E;  1PVG A;  3WU3 A;  1BKN A;  4USM A;  1B63 A;  4JI4 I;  3OTO I;  4LF7 E;  4JI6 E;  1FWL A;  3B78 A;  1N33 I;  1X49 A;  1ZM3 A;  4XTJ A;  1XMO I;  1FKA E;  1YZ9 A;  1XHK A;  4DR6 E;  2DB2 A;  4I3H A;  5A2Q C;  1N34 E;  1PKP A;  1UIL A;  4LF7 I;  2LUQ A;  3LNU A;  5L3J A;  3LLH A;  3QT7 A;  3PYF A;  4DR7 I;  4LF8 I;  2AJ4 A;  1HR0 E;  5A2Q Q;  2DIX A;  4NXN E;  4EMD A;  4WUD A;  2UUB I;  1Z0C A;  5LL6 R;  1K47 A;  1MU5 A;  1S4E A;  4LFC E;  3QT6 A;  1Z0B A;  3F0N A;  4M1K A;  4JI8 E;  2Q2E B;  1HR0 I;  4USK A;  4JI2 E;  4NXN I;  1O0W A;  2YT4 A;  5IWA I;  4DR2 I;  3J81 C;  4B3T E;  2VQF E;  4GKK E;  4JI8 I;  1Z0W A;  2LJH A;  1N36 I;  5GMD A;  1RR9 A;  1VIS A;  2NPF A;  5BR8 E;  3WU5 A;  2GS8 A;  3ZKB A;  3J81 Q;  2MDR A;  3ZZT A;  1ZXM A;  2VQF I;  1H74 A;  3ZZU A;  3GON A;  5LMU E;  1IBK E;  1KIJ A;  1FNM A;  4DU7 A;  4JI1 E;  5BR8 I;  1Z5C A;  2NUF A;  4DR3 I;  1Z59 A;  3B82 A;  2CZ9 A;  2LBS B;  4K0K E;  1T4O A;  1FWK A;  1J5E I;  1I94 E;  2UXB E;  1IBK I;  4DV2 I;  1RRE A;  4JI1 I;  4KHP E;  2V2Z A;  4DU8 A;  1J26 A;  3Q1Q A;  2UXC E;  2HK3 A;  4K0K I;  1IBM E;  1HNX I;  2UXB I;  4DV7 E;  3J7A M;  4JI5 I;  4DV6 E;  2UU9 E;  2HHH I;  4KHP I;  3M6A A;  2VF3 A;  1ZM2 A;  4R1F A;  2UXC I;  2EZ6 A;  2R42 A;  4DUY I;  1ZXN A;  4DV4 I;  4DV6 I;  2UU9 I;  4UTG A;  4DUZ E;  2V8P A;  4X64 E;  1XNR E;  3C4B A;  2NUE A;  2RS7 A;  1T4N A;  3B8H A;  4B3R I;  2JVA A;  4DR5 E;  4GKJ E;  2LUP B;  1N32 E;  3ZZ0 A;  2B7T A;  5LMN E;  4X64 I;  2J7K A;  2V34 A;  2UXD I;  2VQE E;  4JI6 I;  3V5R A;  2RS6 A;  1Z5B A;  4WYQ B;  2A2D A;  2ZBK B;  4DPU A;  2X36 A;  4DR6 I;  4M30 A;  1N32 I;  3PYG A;  5LMN I;  4X8W A;  2A2C A;  3VYY A;  1N34 I;  2HK2 A;  2XEX A;  3LTO A;  1NHH A;  4X65 E;  4PU9 A;  1RC7 A;  2WW4 A;  1H7U A;  4DV5 E;  4B3S E;  4OOG C;  1H7S A;  2E5L E;  2LJP A;  4DR4 E;  2L33 A;  1H73 A;  4DPY A;  1NHJ A;  3P1X A;  4HAC A;  4X65 I;  4LF4 E;  4DV0 E;  4LFC I;  4DV3 E;  2V2Q A;  1DAR A;  4YHH E;  4MYU A;  2CPN A;  1A6F A;  2KHX A;  3HTX A;  3T1H E;  4JI2 I;  2N3H A;  4DV5 I;  4DR1 E;  4B3S I;  1RQ0 A;  2EFG A;  4LF5 E;  1UHZ A;  4PRV A;  4B3T I;  1Z0T A;  1S16 A;  4KQV A;  4GKK I;  4YHH I;  4WFT A;  2L2K B;  3ZKD A;  4HXZ A;  4DXL A;  1KKH A; 
#chains in the Genus database with same CATH topology
 1EH8 A;  2ZIT A;  2RSM A;  5C0X B;  3PS1 A;  3JAM C;  5FLX C;  4NZV A;  2E1R A;  1WHN A;  4B3M E;  3V2U C;  1PIE A;  1WHQ A;  1XMQ E;  2YU5 A;  5LMU I;  4JG4 A;  4FK5 C;  3ADL A;  1NCS A;  4LCG A;  1STU A;  4X66 E;  3J7Y p;  1Z1B A;  2M4I A;  2EQ3 A;  2F8B A;  1HNW E;  5DRR A;  5JEA E;  1UDO A;  1Z5A A;  3T1Y E;  1TF6 A;  5T6J A;  4Z7Y A;  1B62 A;  1Z0G A;  4KWY A;  5AC5 A;  1XXE A;  5FLX Q;  1MG7 A;  2C37 A;  5JEA C;  4B3M I;  4OX9 E;  2L2M A;  1FJG E;  2RSI A;  5K36 D;  4JI7 E;  3HUL A;  4OO1 B;  4NXM E;  2PO2 B;  1I94 I;  1YYW A;  1HNZ E;  1HNW I;  1L4S A;  2ODR C;  1IQO A;  3LPS A;  3P06 A;  3T1Y I;  1H72 C;  2EOS A;  2YTE A;  4DPX A;  3FIG A;  3EPK A;  3VYX A;  3KRN A;  2LMZ A;  4MQY A;  1WXR A;  4BBY A;  3K17 A;  2YTD A;  1FJG I;  2EM5 A;  3L00 A;  1IBM I;  1Y4U A;  2V87 A;  4DV1 E;  2JOX A;  1HNZ I;  2EM9 A;  4JI7 I;  4IFD D;  1Z0V A;  4NXM I;  4DV7 I;  4R2P A;  3Q6M A;  1ZM9 A;  1A1H A;  4FN5 A;  2PO1 A;  2ADR A;  4WSG A;  2GQ0 A;  3H4L A;  2RPC A;  5A69 A;  2L3J A;  2YWQ A;  3RMP A;  1A1G A;  4DPW A;  4HYM A;  4LOM A;  2ELY A;  2EOI A;  2N3G A;  2BB8 A;  3BF2 A;  2MC6 A;  2PNZ B;  3PYD A;  3EPJ A;  2DLQ A;  2ENH A;  2YPN A;  4FW3 A;  5FWK A;  1SFE A;  2LRS A;  3C6M A;  3KZZ A;  5IT9 C;  4BHB A;  3EPH A;  3AUZ A;  2EMW A;  1EKZ A;  1X47 A;  4DUZ I;  3ADG A;  2JWO A;  1XNR I;  2JEA B;  3THN A;  1YYK A;  1DGC A;  1X48 A;  1A1F A;  5C0X E;  3LML A;  4MU1 A;  4MLV A;  1YYO A;  4PRX A;  3UHM A;  4DMI A;  1BB8 A;  4AID A;  1BBO A;  1DI2 A;  5C0X C;  2Z5C B;  5IT9 Q;  2LTS A;  1UDQ A;  2FV4 B;  5CFF E;  2EM4 A;  3NZK A;  2HKJ A;  2EMZ A;  4DR5 I;  2DGC A;  4GKJ I;  2EL6 A;  4DR7 E;  2HFU A;  4LF8 E;  2BA0 G;  4MU0 A;  1LLM C;  4Z7C A;  3PYE A;  2EOM A;  2HGH A;  2VQE I;  1YH8 A;  4FW9 A;  2NA2 A;  4HY1 A;  1OJ4 A;  3J80 C;  3QT5 A;  2EN8 A;  2EPO A;  2OI2 A;  1MX0 A;  2HFS A;  3C4T A;  4LCF A;  4NBQ A;  3CWV A;  4FW5 A;  4R2R A;  3HKM A;  4OO1 E;  1U2R A;  4L8N A;  1YPN A;  1PJS A;  2ODR D;  2UUB E;  1N0U A;  2UUC E;  2WBT A;  3ADI A;  1KTV A;  1RHY A;  3D4J A;  2R3V A;  2EPZ A;  1EA6 A;  5KL4 A;  1NHI A;  4OO1 C;  3K1J A;  3AV0 A;  1ELO A;  2JPA A;  4FWD A;  2IER A;  4RPF A;  2IHR 1;  1GQE A;  2EOJ A;  4MYT A;  4URL A;  3DF6 A;  2EM3 A;  4TUG A;  4FW7 A;  4WUC A;  3J80 Q;  4JI0 E;  4ZVI A;  4DXL A;  3ZM7 A;  2V2V A;  3M85 D;  2UUA E;  4LFB E;  3KZY A;  2YTN A;  3P76 A;  2UUC I;  2L3C A;  5DNY A;  5K36 F;  2EM6 A;  5IWA E;  4DR2 E;  3PS2 A;  2NN6 A;  5K36 A;  3TQM A;  1G2F C;  4LFA E;  1KVK A;  3QT8 A;  2F4V E;  2LT7 A;  2V86 A;  4BCA A;  3JTZ A;  3DJW A;  2RTX A;  2E5L I;  4LF6 E;  4JI0 I;  2BM0 A;  1N36 E;  5TSE A;  4DR4 I;  2C39 A;  2EOH A;  2LTR A;  3ADJ A;  3JU0 A;  1Y4S A;  4DV0 I;  4P78 A;  2UUA I;  2YRK A;  4FWH A;  4P52 A;  4DV3 I;  4LFB I;  1R6L A;  3EQ1 A;  4IFD F;  4WSP A;  4UT4 A;  2WBU A;  3ECR A;  1N0V C;  4LF9 E;  2C38 B;  2FTX B;  3T1H I;  4LFA I;  4FWG A;  2F4V I;  4DR1 I;  4P7D A;  2JY9 A;  2BA1 D;  2M7Q A;  2YTG A;  4LF4 I;  4LTY A;  4LF6 I;  4LF5 I;  4U3D A;  2EM8 A;  4YY3 E;  2KON A;  5KL5 A;  2M1S A;  3F6H A;  2EPP A;  2V85 A;  4IZJ B;  2V8Q B;  2HKE A;  1X3C A;  3PS3 A;  2F1D A;  1YUJ A;  2B3T B;  2EMC A;  1IMU A;  4LF9 I;  2EMG A;  2L92 A;  5DNL A;  1QU6 A;  1X6H A;  4WPY A;  4DR3 E;  4AQY E;  3WU6 A;  1Z0E A;  4ISA A;  4DPT A;  1ZR9 A;  3VHT B;  4BA2 A;  4N4R B;  2DEJ A;  1ZM4 A;  1J5E E;  1GTK A;  1EI1 A;  2EN1 A;  2EMX A;  2L2N A;  2IES A;  1ZBT A;  4TUI A;  3L7Z B;  4YY3 I;  4O43 A;  4DV2 E;  2YTQ A;  1R6M A;  4ZYG A;  4N3O A;  3JAM Q;  2EQ0 A;  4GEQ B;  4M9V C;  2BR2 B;  4X62 E;  4FW4 A;  4QNJ A;  5DRQ A;  3KWR A;  2Z5B B;  1D6T A;  1IBL E;  2CVE A;  2NN6 D;  2BM1 A;  2O1V A;  1PJQ A;  1UDS A;  4AQY I;  1XMQ I;  2X7I A;  1KYQ A;  4IZK A;  1A1J A;  2EWL A;  2EMB A;  5GME A;  1OYP A;  4X66 I;  1T4L B;  1NZ0 A;  3HJC A;  2GHF A;  5JEA A;  1HNX E;  3VK6 A;  4ED4 A;  3CDJ A;  4JI3 E;  4JYA E;  2EMA A;  4JI5 E;  4JV5 E;  1E3P A;  2WP8 A;  3H1C A;  4J3D A;  4MDT A;  3WU4 A;  4X62 I;  2HHH E;  4BA1 B;  4OX9 I;  2YTF A;  2DEI A;  1UEK A;  1IBL I;  2ZM6 E;  2L6M A;  2HJJ A;  3J7A G;  2VE7 C;  1X6F A;  1QZR A;  2EPL X;  3U1K A;  1WUU A;  2FGG A;  4WUB A;  4MLQ A;  1XNQ E;  4HAC B;  3BGH A;  2EM0 A;  2EML A;  4DKK A;  4IS9 A;  2EOF A;  4DUY E;  5ADZ A;  1NEI A;  5AE3 A;  1IQS A;  2G7H A;  1QNT A;  1T38 A;  2JEB A;  4DV4 E;  2PO0 A;  4JI3 I;  4JYA I;  2GO3 A;  4JV5 I;  2B7V A;  5A6B A;  1F2I G;  3M85 G;  4P7A A;  2WZO A;  2LV2 A;  2EN7 A;  2BBG A;  4F2J C;  1TF3 A;  3K6Q A;  4M2Z A;  2ZM6 I;  4DV1 I;  2DMY A;  3BBG A;  2I9I A;  3OTO E;  4JI4 E;  1ZU1 A;  1N33 E;  4U3B A;  2ENC A;  1XNQ I;  2D9H A;  3HPZ A;  1TN9 A;  1FI4 A;  2EM7 A;  1XMO E;  3EPL A;  4J8Z A;  4B3R E;  3ZOQ B;  5DNX A;  4IFD B;  2BV3 A;  4BMJ A;  2GO4 A;  1B69 A;  4RHB B;  2NUG A;  2JE6 B;  1X6E A;  2EOX A;  2UXD E;  1PVG A;  1BKN A;  1Y5Y A;  1B63 A;  3WU3 A;  4O4K A;  4USM A;  4JI4 I;  3P3G A;  2DLK A;  4LF7 E;  4JI6 E;  1FWL A;  3B78 A;  3OTO I;  1N33 I;  3DD6 A;  1X49 A;  4Q28 A;  1ZM3 A;  2B9D A;  2BA1 G;  4XTJ A;  1AH5 A;  2WNR A;  1XMO I;  4F6M A;  1FKA E;  4GZN C;  2O1W A;  5JEA D;  1X5W A;  1YZ9 A;  2PNM A;  5C0X A;  1XHK A;  4O5G A;  4DR6 E;  2DB2 A;  4I3H A;  5A2Q C;  2CT1 A;  1N34 E;  1PKP A;  1UIL A;  3H09 A;  4ZYH A;  5AE1 A;  2LUQ A;  3LNU A;  1GZ6 A;  3PRY A;  4LF7 I;  5L3J A;  3LLH A;  2O1T A;  4F54 A;  3QT7 A;  3PYF A;  2EOR A;  4DR7 I;  4LF8 I;  4HEI A;  2AJ4 A;  2DRP A;  2C37 B;  2EOO A;  2YRH A;  4LPF A;  4LCH A;  4BHC A;  1A1I A;  1P42 A;  5A6B D;  1HR0 E;  5A2Q Q;  1OYR A;  2DIX A;  4NXN E;  1OYS A;  2MDG A;  2MKD A;  3CDI A;  4EMD A;  3BID A;  2EOZ A;  4OO1 A;  1MEY C;  2EPK X;  4WUD A;  2YRM A;  1Z0C A;  5LL6 R;  1Y60 A;  1K47 A;  2NN6 F;  3MSW A;  2PO2 A;  2UUB I;  2VF1 A;  1BBG A;  1MU5 A;  3U1Y A;  1S4E A;  4LFC E;  2CSH A;  3QT6 A;  1Z0B A;  2EPN A;  1EH7 A;  3F0N A;  2LVH A;  4M1K A;  4JI8 E;  1KJK A;  2Q2E B;  2DSY A;  1Y6Z A;  1HR0 I;  4USK A;  4JI2 E;  4NXN I;  4X9J A;  1O0W A;  2YT4 A;  5AC4 A;  4DPY A;  2A25 A;  2PO1 B;  5EL9 A;  3IWD A;  4MU4 A;  5IWA I;  4DR2 I;  3J81 C;  4NHR A;  4B3T E;  2EJ4 A;  2VRD A;  2JR1 A;  1UBD C;  2VQF E;  4GKK E;  1WRJ A;  2WBS A;  4JI8 I;  2R1F A;  2J65 A;  1Z0W A;  5C0X D;  4IZJ D;  4IFD E;  2EPU A;  2LJH A;  2PNZ A;  1N36 I;  2DMI A;  2V83 A;  2ENA A;  5GMD A;  1T39 A;  4FW6 A;  2JT2 A;  2R76 A;  4GQU A;  4IFD C;  1RR9 A;  1VIS A;  4F9C B;  3QG5 C;  4F9B B;  5KL7 A;  2EN6 A;  2NPF A;  5BR8 E;  3WU5 A;  2RQL A;  2GS8 A;  3ZKB A;  3J81 Q;  2MDR A;  3ZZT A;  1ZXM A;  4O24 A;  1A1L A;  4F9A B;  2VQF I;  2EN2 A;  2EPC A;  2K4V A;  4R2D A;  2LE2 A;  1H74 A;  4AIM A;  3GLL A;  3ZZU A;  5DRO A;  3GON A;  1USV A;  5LMU E;  1IBK E;  1KIJ A;  1FNM A;  5LLQ A;  2Z5C A;  1N32 I;  1MGT A;  2N8X A;  2PRT A;  2NAB A;  3IWC A;  4OO1 D;  4DU7 A;  4JI1 E;  4F6N A;  2WCC 3;  1JK1 A;  5BR8 I;  1Z5C A;  3M7N G;  2NUF A;  4DR3 I;  1YFH A;  1Z59 A;  2VES A;  3B82 A;  2EE8 A;  2LBS B;  2EL5 A;  5F3W A;  4K0K E;  2CZ9 A;  3GME A;  5JEA F;  1T4O A;  2EN4 A;  1FWK A;  1J5E I;  2I13 A;  4WXC A;  3Q6N A;  1I94 E;  2UXB E;  2CTD A;  2JOB A;  1N3G A;  5A6J A;  2YZT A;  2L8T A;  2YTP A;  4DV2 I;  1IBK I;  3HPS A;  2EOE A;  3F6G A;  1RRE A;  2Z5E A;  2EOY A;  4JI1 I;  4KHP E;  4BC7 A;  4R8O A;  4WX9 A;  2YSO A;  5IXM B;  2V2Z A;  2LO3 A;  4DU8 A;  4R2S A;  1J26 A;  3Q1Q A;  4QNK A;  2UXC E;  2HK3 A;  4K0K I;  2J7J A;  1IBM E;  1YUI A;  1HNX I;  2UXB I;  1SR9 A;  2E1M A;  4DV7 E;  5IV8 B;  3J7A M;  4R2E A;  2GPI A;  3GCM A;  4DV6 E;  2EM2 A;  4R03 A;  2NN6 B;  4JI5 I;  5K36 B;  2UU9 E;  2EMH A;  2HHH I;  4KHP I;  2ELZ A;  3M6A A;  5AE2 A;  2IOQ A;  2IOP A;  2VF3 A;  2CG9 A;  2EPM X;  4RH8 A;  1ZM2 A;  2PNL A;  4R1F A;  5ELW A;  2EZ6 A;  2UXC I;  2C39 B;  2LJU A;  2R42 A;  4DUY I;  1YHC A;  4HTG A;  3MHH C;  4IJD A;  1ZXN A;  4DV4 I;  4DV6 I;  2UU9 I;  4UTG A;  4DUZ E;  1AAY A;  1HK7 A;  2EN3 A;  1DQ3 A;  2YTI A;  2GLI A;  4X64 E;  1XNR E;  2V8P A;  3C4B A;  2LCE A;  2C38 A;  4L5N C;  5EKW A;  3C6K A;  3UK3 C;  2NUE A;  4MU3 A;  3M7N D;  2RS7 A;  1ZBQ A;  1T4N A;  1UN6 B;  5C0X F;  1USU A;  5A6A A;  2AE8 A;  3B8H A;  3P3C A;  4B3R I;  5KL6 A;  4R2Q A;  2JVA A;  4DR5 E;  4IZJ A;  4GKJ E;  2LUP B;  2EMF A;  1N32 E;  2B7T A;  5LMN E;  3ZZ0 A;  4X64 I;  2J7K A;  2O1U A;  2Q8U A;  2V34 A;  2UXD I;  4BA2 B;  2VQE E;  4JI6 I;  2KOU A;  5AAS A;  3V5R A;  2RS6 A;  4BC9 A;  5KL3 A;  1Z5B A;  4WYQ B;  2A2D A;  3L7Z A;  2ZBK B;  3M99 B;  3HXL A;  4KZS A;  4DPU A;  1WJP A;  1ZAA C;  2EPA A;  2X36 A;  2E72 A;  4DR6 I;  1PJT A;  2EMI A;  4M30 A;  1YSA C;  2BR2 A;  4X8W A;  2A2C A;  3VYY A;  3PYG A;  4IZK B;  4LU9 A;  4OKG A;  5LMN I;  4OO1 F;  2Z5B A;  1N34 I;  2HK2 A;  2JP9 A;  2XEX A;  3LTO A;  2JXP A;  4ZYD A;  1UDN A;  1NHH A;  5JEA B;  2HC5 A;  4X65 E;  2V89 A;  2WP8 B;  2YTJ A;  4WXD A;  3K85 A;  4PU9 A;  3B4T A;  2K7I A;  1RC7 A;  2CGE A;  2NN6 E;  5K36 E;  2EPR A;  2WW4 A;  1H7U A;  2EOQ A;  2M9A A;  4BA1 A;  4DV5 E;  2NN6 C;  5K36 C;  4B3S E;  4OOG C;  1H7S A;  2E5L E;  2LJP A;  4DR4 E;  2L33 A;  1H73 A;  2JEB B;  1NHJ A;  3P1X A;  1PDA A;  4HAC A;  2PO0 B;  3THO B;  5KL2 A;  3HQ1 A;  4DV0 E;  4LF4 E;  2JYA A;  3IWB A;  4LFC I;  4X65 I;  4DV3 E;  2V2Q A;  4R2C A;  4YHH E;  2V88 A;  1DAR A;  2CPN A;  2MKN A;  4MYU A;  1JK2 A;  1A6F A;  2KHX A;  3HTX A;  5A6K A;  4R2A A;  3T1H E;  2EL4 A;  1G2D C;  4JI2 I;  2N3H A;  4Q35 B;  2EQ1 A;  4DR1 E;  4DV5 I;  2EPX A;  4OZE A;  4B3S I;  4ZYE A;  1RQ0 A;  2EFG A;  5DRP A;  4IS1 C;  4LF5 E;  3P3E A;  1UHZ A;  2EMK A;  4PRV A;  1VI7 A;  4I8O A;  4M0V A;  1P47 A;  2O3Z A;  1RMD A;  4B3T I;  1Z0T A;  1S16 A;  4BS9 A;  4KQV A;  4GKK I;  4YHH I;  2JEA A;  4WFT A;  4AM3 A;  3OML A;  2YTO A;  3MHS C;  4IFD A;  1E3H A;  2L2K B;  2MC5 A;  2H36 X;  2EMY A;  2JE6 A;  2YSP A;  3ZKD A;  2YU8 A;  1A1K A;  2BA0 D;  2WNR B;  4HXZ A;  2EP3 A;  1EH6 A;  1KKH A; 
#chains in the Genus database with same CATH homology
 2ZIT A;  2RSM A;  3JAM C;  5FLX C;  2E1R A;  1WHN A;  4B3M E;  3V2U C;  1PIE A;  1WHQ A;  1XMQ E;  5LMU I;  4JG4 A;  3ADL A;  1STU A;  4X66 E;  3J7Y p;  2M4I A;  2F8B A;  1HNW E;  1Z5A A;  3T1Y E;  5T6J A;  4Z7Y A;  1B62 A;  1Z0G A;  5FLX Q;  1MG7 A;  4B3M I;  4OX9 E;  2L2M A;  1FJG E;  4JI7 E;  3HUL A;  4NXM E;  1I94 I;  1YYW A;  1HNZ E;  1HNW I;  2ODR C;  3LPS A;  3P06 A;  3T1Y I;  1H72 C;  4DPX A;  3FIG A;  3VYX A;  2LMZ A;  1WXR A;  4BBY A;  3K17 A;  1FJG I;  1IBM I;  1Y4U A;  2V87 A;  4DV1 E;  2JOX A;  4JI7 I;  1Z0V A;  4NXM I;  4DV7 I;  3Q6M A;  1ZM9 A;  4FN5 A;  2GQ0 A;  3H4L A;  3RMP A;  2L3J A;  4DPW A;  4HYM A;  2N3G A;  2MC6 A;  3PYD A;  5FWK A;  2LRS A;  5IT9 C;  3AUZ A;  1EKZ A;  1X47 A;  4DUZ I;  3ADG A;  2JWO A;  1XNR I;  1YYK A;  1X48 A;  3LML A;  1YYO A;  4PRX A;  4DMI A;  1DI2 A;  2Z5C B;  5IT9 Q;  2LTS A;  2FV4 B;  5CFF E;  2HKJ A;  4DR5 I;  4GKJ I;  4DR7 E;  2HFU A;  4LF8 E;  4Z7C A;  3PYE A;  2VQE I;  4FW9 A;  2NA2 A;  4HY1 A;  1OJ4 A;  3J80 C;  3QT5 A;  2OI2 A;  1MX0 A;  2HFS A;  3C4T A;  3CWV A;  1U2R A;  4L8N A;  2ODR D;  2UUB E;  1N0U A;  2UUC E;  3ADI A;  1KTV A;  3D4J A;  2R3V A;  1EA6 A;  1NHI A;  3K1J A;  3AV0 A;  1ELO A;  4FWD A;  4RPF A;  2IHR 1;  1GQE A;  4URL A;  4MYT A;  3DF6 A;  4TUG A;  4WUC A;  3J80 Q;  4JI0 E;  4ZVI A;  3ZM7 A;  2V2V A;  2UUA E;  4LFB E;  2UUC I;  2L3C A;  5DNY A;  5IWA E;  4DR2 E;  4LFA E;  1KVK A;  3QT8 A;  2F4V E;  2V86 A;  4BCA A;  3JTZ A;  3DJW A;  2RTX A;  2E5L I;  4LF6 E;  4JI0 I;  2BM0 A;  1N36 E;  4DR4 I;  3JU0 A;  2LTR A;  3ADJ A;  1Y4S A;  4DV0 I;  4LF4 I;  4P78 A;  2UUA I;  4FWH A;  4P52 A;  4DV3 I;  4LFB I;  4WSP A;  4UT4 A;  1N0V C;  4LF9 E;  3T1H I;  2FTX B;  4LFA I;  4FWG A;  2F4V I;  4DR1 I;  4P7D A;  2JY9 A;  2M7Q A;  4LTY A;  4LF6 I;  4LF5 I;  4YY3 E;  2KON A;  2M1S A;  3F6H A;  2V85 A;  4IZJ B;  2V8Q B;  2HKE A;  2B3T B;  4LF9 I;  2L92 A;  1QU6 A;  4WPY A;  3WU6 A;  4DR3 E;  4AQY E;  1Z0E A;  4DPT A;  2DEJ A;  1ZM4 A;  1J5E E;  1EI1 A;  2L2N A;  4YY3 I;  1ZBT A;  4TUI A;  4DV2 E;  4N3O A;  3JAM Q;  4GEQ B;  4X62 E;  3KWR A;  2Z5B B;  1D6T A;  1IBL E;  2BM1 A;  2O1V A;  4AQY I;  1XMQ I;  2X7I A;  4IZK A;  2EWL A;  5GME A;  4X66 I;  1T4L B;  1NZ0 A;  3HJC A;  1HNX E;  3VK6 A;  4ED4 A;  4JI3 E;  4JYA E;  4JI5 E;  4JV5 E;  3WU4 A;  4X62 I;  2HHH E;  4OX9 I;  2DEI A;  1UEK A;  1IBL I;  2ZM6 E;  2L6M A;  3J7A G;  2VE7 C;  1QZR A;  1WUU A;  2FGG A;  4WUB A;  1XNQ E;  1HNZ I;  4HAC B;  4DKK A;  4DUY E;  5ADZ A;  5AE3 A;  2G7H A;  4DV4 E;  4JI3 I;  4JYA I;  4JV5 I;  2B7V A;  4P7A A;  2WZO A;  3K6Q A;  4M2Z A;  2ZM6 I;  4DV1 I;  2DMY A;  4JI4 E;  3OTO E;  1N33 E;  1XNQ I;  3HPZ A;  1FI4 A;  1XMO E;  4J8Z A;  4B3R E;  3ZOQ B;  2BV3 A;  4BMJ A;  2NUG A;  2UXD E;  1PVG A;  3WU3 A;  1BKN A;  4USM A;  1B63 A;  4JI4 I;  3OTO I;  4LF7 E;  4JI6 E;  1FWL A;  3B78 A;  1N33 I;  1X49 A;  4Q28 A;  1ZM3 A;  2B9D A;  4XTJ A;  1XMO I;  1FKA E;  2O1W A;  1YZ9 A;  2PNM A;  1XHK A;  4DR6 E;  2DB2 A;  4I3H A;  5A2Q C;  1N34 E;  1PKP A;  1UIL A;  3H09 A;  5AE1 A;  4LF7 I;  2LUQ A;  3LNU A;  1GZ6 A;  3PRY A;  5L3J A;  3LLH A;  2O1T A;  4F54 A;  3QT7 A;  3PYF A;  4DR7 I;  4LF8 I;  2AJ4 A;  1HR0 E;  5A2Q Q;  2DIX A;  4NXN E;  4EMD A;  4WUD A;  2UUB I;  1Z0C A;  5LL6 R;  1K47 A;  3MSW A;  2VF1 A;  1MU5 A;  1S4E A;  4LFC E;  3QT6 A;  1Z0B A;  3F0N A;  4M1K A;  4JI8 E;  2Q2E B;  2DSY A;  1Y6Z A;  1HR0 I;  4USK A;  4JI2 E;  4NXN I;  1O0W A;  2YT4 A;  5IWA I;  3IWD A;  4DR2 I;  3J81 C;  4B3T E;  2JR1 A;  2VQF E;  4GKK E;  4JI8 I;  1Z0W A;  4IZJ D;  2LJH A;  1N36 I;  2V83 A;  5GMD A;  1RR9 A;  1VIS A;  4F9C B;  4F9B B;  2NPF A;  5BR8 E;  3WU5 A;  2GS8 A;  3ZKB A;  3J81 Q;  2MDR A;  3ZZT A;  1ZXM A;  4F9A B;  2VQF I;  2K4V A;  2LE2 A;  1H74 A;  3ZZU A;  3GON A;  1USV A;  5LMU E;  1IBK E;  1KIJ A;  1FNM A;  2Z5C A;  3IWC A;  4DU7 A;  4JI1 E;  5BR8 I;  1Z5C A;  2NUF A;  4DR3 I;  1Z59 A;  3B82 A;  2LBS B;  5F3W A;  4K0K E;  2CZ9 A;  1T4O A;  1FWK A;  1J5E I;  3Q6N A;  1I94 E;  2UXB E;  1IBK I;  2JOB A;  4DV2 I;  2YZT A;  2L8T A;  3HPS A;  3F6G A;  1RRE A;  2Z5E A;  4JI1 I;  4KHP E;  4BC7 A;  4R8O A;  2V2Z A;  4DU8 A;  1J26 A;  3Q1Q A;  2UXC E;  2HK3 A;  4K0K I;  1IBM E;  1HNX I;  2UXB I;  1SR9 A;  2E1M A;  4DV7 E;  3J7A M;  4JI5 I;  4DV6 E;  4R03 A;  2UU9 E;  2HHH I;  4KHP I;  3M6A A;  5AE2 A;  2IOQ A;  2IOP A;  2VF3 A;  2CG9 A;  1ZM2 A;  2PNL A;  4R1F A;  2UXC I;  2EZ6 A;  2R42 A;  4DUY I;  1ZXN A;  4DV4 I;  4DV6 I;  2UU9 I;  4UTG A;  4DUZ E;  1HK7 A;  1DQ3 A;  2V8P A;  4X64 E;  1XNR E;  3C4B A;  4L5N C;  2NUE A;  2RS7 A;  1ZBQ A;  1T4N A;  1USU A;  3B8H A;  4B3R I;  2JVA A;  4DR5 E;  4IZJ A;  4GKJ E;  2LUP B;  1N32 E;  3ZZ0 A;  2B7T A;  5LMN E;  4X64 I;  2J7K A;  2O1U A;  2V34 A;  2UXD I;  2VQE E;  4JI6 I;  2KOU A;  5AAS A;  3V5R A;  2RS6 A;  4BC9 A;  1Z5B A;  4WYQ B;  2A2D A;  2ZBK B;  3HXL A;  4KZS A;  4DPU A;  2X36 A;  4DR6 I;  4M30 A;  1N32 I;  3PYG A;  5LMN I;  4X8W A;  2A2C A;  3VYY A;  4IZK B;  4LU9 A;  2Z5B A;  1N34 I;  2HK2 A;  2XEX A;  3LTO A;  1NHH A;  4X65 E;  2V89 A;  3K85 A;  4PU9 A;  1RC7 A;  2CGE A;  2WW4 A;  1H7U A;  4DV5 E;  4B3S E;  4OOG C;  1H7S A;  2E5L E;  2LJP A;  4DR4 E;  2L33 A;  1H73 A;  4DPY A;  1NHJ A;  3P1X A;  4HAC A;  4X65 I;  4LF4 E;  3HQ1 A;  4DV0 E;  4LFC I;  3IWB A;  4DV3 E;  2V2Q A;  1DAR A;  4YHH E;  2V88 A;  4MYU A;  2CPN A;  1A6F A;  2KHX A;  3HTX A;  3T1H E;  4JI2 I;  2N3H A;  4DV5 I;  4DR1 E;  4B3S I;  1RQ0 A;  2EFG A;  4LF5 E;  1UHZ A;  4PRV A;  4I8O A;  4M0V A;  4B3T I;  1Z0T A;  1S16 A;  4BS9 A;  4KQV A;  4GKK I;  4YHH I;  4WFT A;  3OML A;  2L2K B;  2MC5 A;  2H36 X;  3ZKD A;  4HXZ A;  4DXL A;  1KKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...