4DR2E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr2E02
1N0UA 4AQYI 2HKEA 4LF8E 4JI6I 4Z7YA 1S16A 3JAMC 1HNZI 1EA6A 4KHPI 4EMDA 2V2QA 1XMQE 2HFUA 4JV5E 1N34I 1YZ9A 1H72C 4HXZA 4FN5A 1RQ0A 4DPYA 4DV1E 2DMYA 4MYTA 4B3TE 1FJGI 4DR5E 1UILA 4YHHE 1FWKA 2XEXA 1WHNA 2L33A 4OX9I 4DV7I 5FLXC 4DR2I 3LNUA 2V2ZA 1FKAE 1XNQI 4WFTA 4DUZE 1T4NA 4X62E 1HNWE 4LF9E 2DB2A 4LF4I 2LBSB 4JI8I 3PYFA 1T4OA 4DR4I 1PIEA 2RS6A 4R1FA 4DV5I 2B7TA 2F4VI 3J7Yp 3J80C 4DR1E 1I94I 4DV4E 5LMNI 3WU3A 4K0KE 1IBLI 4GKKI 4NXME 4AQYE 4X8WA 2UUCE 4FW9A 2L3CA 1H74A 1Z0VA 4LF8I 2CPNA 2DIXA 1YYOA 1ZM2A 1XHKA 4DU8A 1MU5A 1N34E 1KTVA 1XMQI 4JV5I 1J5EE 4X66E 1OJ4A 1NZ0A 4DV1I 1EI1A 4B3TI 3C4TA 2EZ6A 3C4BA 4DR5I 4FWHA 4JI2E 4NXNE 1XNRE 4YHHI 4OOGC 2MDRA 4HY1A 2HHHI 1QZRA 4LFCE 1XNQE 4WUBA 2RS7A 3P1XA 1WHQA 2DEJA 4PU9A 2UXBI 1RR9A 2DEIA 1N33E 1Z5BA 2N3HA 4X62I 1HNWI 1YYKA 2NUGA 4LF9I 2RSMA 4DXLA 1ZXMA 2BM1A 2LJHA 4DPUA 1NHHA 3PYEA 5GMDA 4LFBE 4DR1I 1Z0GA 4DV4I 4LFAE 4M2ZA 4K0KI 3ZKBA 4NXMI 1ELOA 2UUCI 1X47A 3K1JA 4DR6E 4Z7CA 1PKPA 3J80Q 5CFFE 3J81C 1IBMI 2R3VA 1KIJA 3VYYA 3K17A 2L2KB 1Z0WA 4X66I 1J5EI 1YYWA 2A2DA 2VF3A 3J7AG 4JI5E 2V34A 3ZZUA 1HNXI 4JI2I 4NXNI 1XNRI 1D6TA 3LLHA 5IT9C 1A6FA 2HHHE 5A2QC 1Z0BA 3HULA 1ZM3A 1EKZA 4ED4A 2V8PA 1Z0TA 4LFCI 3F0NA 4HACA 2UXBE 1J26A 1ZBTA 1N33I 2UXDE 1Z0EA 1DI2A 1RC7A 4B3SE 1K47A 4WUDA 5LMUE 1KVKA 3ZZTA 1NHIA 1MX0A 4DU7A 4LFBI 5LL6R 4JI3E 4LFAI 3ADIA 1FI4A 2HK2A 3GONA 2JVAA 4YY3I 4DR6I 2VQFE 1N32I 2NUEA 1B62A 4DV2E 3HTXA 4DR7I 1IBME 1UHZA 4DKKA 2YT4A 5GMEA 4JI0I 1X49A 4HACB 4X65E 1MG7A 1Z0CA 2LRSA 1FWLA 4JI5I 3T1YE 4DR3E 1HNXE 4B3ME 3JAMQ 2N3GA 3QT8A 4X64E 3OTOE 2KHXA 2VQEE 4JG4A 4JI1E 4JI7I 1Z59A 4P52A 3QT5A 2BV3A 3QT6A 3WU6A 2UXDI 4B3SI 5FLXQ 5A2QQ 4DV6I 3LTOA 5LMUI 4URLA 2JY9A 2UUBE 3QT7A 4DV0E 1ZM9A 3B78A 2UU9E 3T1HI 4JI3I 2LTRA 1HR0E 4YY3E 4LF6I 4M1KA 2L3JA 3ZKDA 1N32E 4FWGA 2VQFI 1H7UA 4DR7E 5L3JA 4JI0E 4USMA 4LF5E 2ZM6E 4DV2I 2UUAE 2R42A 4X65I 4B3RE 4RPFA 4XTJA 2NUFA 3Q1QA 3D4JA 3WU5A 3T1YI 4DR3I 4B3MI 2GS8A 4X64I 3M6AA 3OTOI 1T4LB 2VQEI 2L2MA 2B7VA 4JI7E 1H73A 4JI1I 4I3HA 2HK3A 1S4EA 4DUYE 2EFGA 3ZZ0A 4FWDA 1STUA 2HFSA 2E5LE 2X36A 2LJPA 4GKJE 1XMOI 3B8HA 2X7IA 1RREA 1KKHA 1NHJA 2A2CA 4DV6E 2NPFA 1Z5AA 4USKA 1Z5CA 1N36E 4JI4E 2UUBI 4JYAI 4DV0I 4WYQB 1WUUA 3T1HE 5BR8I 4DV3E 2UU9I 5IWAE 3ADLA 2CZ9A 1HR0I 4ZVIA 4MYUA 4UTGA 4LF6E 2UXCE 2NA2A 1ZM4A 3WU4A 3ZM7A 4LF5I 2ZM6I 2UUAI 4LF7I 2J7KA 1VISA 2ZITA 1IBKE 4UT4A 4PRXA 4B3RI 2OI2A 3H4LA 2V2VA 4JI6E 4DPWA 2HKJA 4HYMA 1HNZE 3J81Q 2LUPB 4KHPE 2E1RA 1DARA 2B3TB 4DUYI 3VYXA 2L2NA 2RTXA 1BKNA 4PRVA 2WW4A 1FJGE 2Q2EB 4KQVA 2E5LI 4DPTA 2LTSA 3PYGA 1XMOE 4GKJI 1X48A 1O0WA 5IT9Q 2LUQA 4OX9E 4DV7E 4DR2E 1U2RA 2ZBKB 4JYAE 2IHR1 3PYDA 1N36I 4JI4I 5BR8E 4M30A 1N0VC 4DV3I 3B82A 5IWAI 2AJ4A 4DUZI 1UEKA 2BM0A 4WUCA 3V2UC 1ZXNA 2UXCI 1PVGA 4LF4E 3CWVA 4JI8E 4DR4E 1GQEA 3LPSA 4DV5E 4LF7E 2F4VE 3ADGA 1I94E 1B63A 1FNMA 5LMNE 1H7SA 3V5RA 4DPXA 3J7AM 1QU6A 1IBKI 1IBLE 4P7AA 4GKKE 3ADJA
chains in the Genus database with same CATH superfamily
2JWOA 4WXCA 2YRMA 1N0UA 4AQYI 5K36E 4IZKA 2HKEA 2ENCA 4LF8E 2EWLA 2JYAA 2V88A 4IS1C 4JI6I 4Z7YA 1R6LA 4FW6A 1MGTA 1S16A 1Y4SA 2EOJA 3JAMC 1HNZI 2B9DA 3P3CA 4LU9A 2EOHA 1EA6A 2F8BA 5AASA 4EMDA 4KHPI 2V2QA 2LJUA 1XMQE 4M0VA 2HFUA 4JV5E 1N34I 1YZ9A 2EPMX 1H72C 2NN6E 4HXZA 4FN5A 1RQ0A 3LMLA 2JT2A 3HXLA 4DPYA 4DV1E 2DMYA 3HPZA 2V89A 4MYTA 4B3TE 5JEAA 4BA2A 1FJGI 1YH8A 4DR5E 1UILA 4OO1E 2EN6A 1DGCA 2KOUA 3F6GA 2L92A 2R1FA 4YHHE 5LLQA 1FWKA 2XEXA 1WHNA 2L33A 4AIDA 4HEIA 3BBGA 2LT7A 2BA1D 2WCC3 2LCEA 5FLXC 4DV7I 4OX9I 3F6HA 4ZYGA 4DR2I 1BBOA 3LNUA 2V2ZA 1PJSA 2EL4A 2YTFA 1FKAE 1XNQI 5AE2A 5K36A 4WFTA 4IZKB 2R76A 1Y6ZA 2VESA 4BCAA 4DUZE 1T4NA 4F9BB 4X62E 4F6NA 4P7DA 1HNWE 4LF9E 2DB2A 2V83A 2NABA 3L00A 4AM3A 4OO1A 4WPYA 5JEAC 2EM7A 4LF4I 1A1GA 2LBSB 4JI8I 3PYFA 1T4OA 2CTDA 4DR4I 1PIEA 4FW4A 3VHTB 2RS6A 4R1FA 2EM8A 4DV5I 2B7TA 2F4VI 3J7Yp 3J80C 4DR1E 3P3EA 1JK2A 4FW5A 4DV4E 5C0XD 5LMNI 1I94I 2EJ4A 3L7ZA 2MKNA 3UK3C 3P3GA 4K0KE 3WU3A 5JEAB 1IBLI 4BA2B 4GKKI 2EPXA 4LCGA 4M9VC 4NXME 4GQUA 4AQYE 1NEIA 4X8WA 2UUCE 4FW9A 4MU0A 4IFDA 2L3CA 4BMJA 2E1MA 2GPIA 4R2SA 1H74A 1Z0VA 4LF8I 5K36C 2CPNA 2C37B 2AE8A 3P76A 1E3PA 1ZU1A 4LTYA 3U1YA 2Q8UA 2DIXA 1YYOA 4TUIA 1ZM2A 1XHKA 1WJPA 2EPCA 4DU8A 2HC5A 1PJTA 2EM6A 1MU5A 4WXDA 1N34E 3DJWA 2NN6B 1KTVA 3EQ1A 5JEAF 1XMQI 4I8OA 4JV5I 1J5EE 4X66E 2Z5BA 4MU1A 4R2RA 1Z1BA 1OJ4A 5FWKA 1TF6A 1NZ0A 2D9HA 1N3GA 4DV1I 2YRKA 2WNRA 1EI1A 4B3TI 2A25A 3C4TA 2EZ6A 5KL5A 4BA1A 3C4BA 4OO1B 4DR5I 4FWHA 4JI2E 2YU8A 4NXNE 2WBSA 2GHFA 4IJDA 1XNRE 4IFDC 4YHHI 1BBGA 4FW7A 4OOGC 3EPLA 2FTXB 2MDRA 4LCFA 2EMCA 4HY1A 1UN6B 2HHHI 5K36F 2EMBA 1QZRA 4IS9A 4LFCE 2EOYA 3THNA 2PRTA 3EPHA 3PS1A 1XNQE 4WUBA 1A1KA 4R2DA 2RS7A 3P1XA 4ZYHA 1WHQA 2DEJA 4PU9A 2UXBI 2Z5CA 1RR9A 1G2DC 2DEIA 1N33E 1Z5BA 2PNMA 1SR9A 4HTGA 1IQOA 2N3HA 4X62I 2K4VA 4NBQA 5K36D 4NHRA 1HNWI 1YYKA 2NUGA 1TN9A 4O43A 4LF9I 2RSMA 4RH8A 4DXLA 2M4IA 1ZXMA 2BM1A 2PNZA 1TF3A 1R6MA 2LJHA 4DPUA 4WX9A 2RQLA 1NHHA 2ODRC 2VRDA 2Z5BB 4LFBE 3PYEA 5GMDA 1VI7A 2J65A 1L4SA 1Z0GA 1X6HA 2LMZA 2WNRB 4DV4I 4DR1I 4IFDF 4MQYA 2YSPA 4LFAE 2WBTA 5A6BA 1AAYA 4M2ZA 3ZKBA 4BA1B 4K0KI 3HJCA 4WSPA 2EN1A 4U3BA 4NXMI 1ELOA 2UUCI 1X47A 5A6JA 3GLLA 3K1JA 4DR6E 2C39B 4Z7CA 4BHCA 2DGCA 1PKPA 2EMLA 2YTQA 1A1IA 2EMKA 3KZZA 3KWRA 3J80Q 5CFFE 3J81C 5TSEA 1IBMI 2R3VA 3QG5C 2C38A 1KIJA 3ECRA 2EN7A 3AV0A 3KRNA 3VYYA 3K17A 2L2KB 1WRJA 1X6FA 2EPZA 1WXRA 1HK7A 5ADZA 2Z5CB 4DMIA 1F2IG 1Z0WA 2BB8A 4X66I 1J5EI 4J8ZA 2EPOA 2YTIA 3C6MA 1YYWA 4IZJD 2YTJA 2A2DA 5EL9A 3J7AG 2VF3A 5ELWA 4JI5E 2V34A 5A6AA 1UDOA 2EOEA 1OYPA 2EM9A 3ZZUA 1HNXI 4JI2I 4NXNI 2PNZB 1UDNA 1X3CA 1XNRI 3LLHA 1D6TA 1G2FC 4MLVA 2C37A 2EOSA 3M99B 5IT9C 1A6FA 1ZR9A 2ENAA 2PO0A 2HHHE 2EOFA 1T39A 1UDQA 3Q6MA 5A2QC 1Z0BA 3HULA 1ZM3A 1EKZA 4ED4A 4R2AA 2WZOA 1Z0TA 2V8PA 4LFCI 2EOZA 2YTEA 3F0NA 4HACA 3DF6A 2UXBE 1J26A 1SFEA 2NN6A 2O1TA 4QNJA 4DR7I 4R03A 1ZBTA 1B69A 2VF1A 1N33I 2JP9A 2UXDE 1Z0EA 1DI2A 1RC7A 2EE8A 4B3SE 4R8OA 5KL7A 4KWYA 1K47A 2EN4A 1GZ6A 4WUDA 2YRHA 2C38B 5DROA 5LMUE 1KVKA 4U3DA 4Q35B 3ZZTA 2JOBA 3L7ZB 5KL2A 4J3DA 1NHIA 2DLQA 4GEQB 1MX0A 3PRYA 4DU7A 4LFBI 4R2CA 5LL6R 4JI3E 4LFAI 3ADIA 1FI4A 2HK2A 1EH6A 4MU4A 3M85G 2CVEA 2EMFA 3PS2A 3IWDA 3GONA 2IERA 2EOMA 2JVAA 4F2JC 2NN6C 4YY3I 4DR6I 2VQFE 1XXEA 2PO2A 2MDGA 2PO0B 1N32I 2NUEA 2ADRA 3TQMA 1B62A 3OMLA 2RSIA 4DV2E 2I13A 3CDJA 2V86A 2FGGA 3HTXA 3EPKA 1UHZA 1IBME 2DLKA 2YT4A 4DKKA 3MHHC 2YTOA 5GMEA 4JI0I 2EM0A 1P42A 4LCHA 1X49A 4HACB 4OO1C 4X65E 2IOQA 2CT1A 4LPFA 2MKDA 2V8QB 1MG7A 1YHCA 1PJQA 2L8TA 2JXPA 1Z0CA 2JEAA 2LRSA 3IWCA 5T6JA 1FWLA 4JI5I 3T1YE 5AE1A 2EPNA 4DR3E 1HNXE 4B3ME 3JAMQ 2M9AA 2N3GA 3QT8A 4X64E 2EN3A 3BGHA 5JEAD 4Q28A 4L5NC 3OTOE 2C39A 1RMDA 2KHXA 2VQEE 2EMHA 3IWBA 1PDAA 4WSGA 1YUIA 4JG4A 4JI1E 2NN6F 5DRQA 5DNYA 4JI7I 3HPSA 1Z59A 2Z5EA 5DNLA 4P52A 2EPUA 4BC7A 3K6QA 1IQSA 4TUGA 2I9IA 4MDTA 3QT5A 2EM4A 1A1JA 1UBDC 1BB8A 1OYSA 2BV3A 2PO2B 5IV8B 2GO3A 3FIGA 3QT6A 2HGHA 3NZKA 3WU6A 1P47A 2LVHA 2UXDI 2WP8A 5DRRA 3VK6A 1YFHA 5C0XE 4B3SI 2WBUA 5FLXQ 1USUA 5A2QQ 2EOQA 4DV6I 3LTOA 5LMUI 1ZBQA 1T38A 3ZOQB 3HKMA 3K85A 4URLA 2EPPA 2JY9A 2UUBE 2JPAA 1E3HA 4DV0E 1YPNA 3QT7A 3UHMA 1ZM9A 4OO1D 2YU5A 1X5WA 3B78A 2JEAB 4P78A 2BA0G 2UU9E 1RHYA 3T1HI 1Y5YA 1YUJA 4N4RB 4JI3I 2EP3A 2LTRA 5AE3A 1HR0E 2GO4A 2EM3A 4NZVA 3DD6A 4YY3E 4LF6I 4M1KA 1DQ3A 2L3JA 3ZKDA 3P06A 2EPAA 3BIDA 1N32E 4FWGA 2VQFI 4IFDD 1H7UA 1NCSA 2EMAA 5C0XA 4DR7E 5L3JA 4JI0E 2IESA 4LF5E 2ZM6E 2O1WA 4FW3A 4USMA 4DV2I 2UUAE 2GQ0A 4ZYEA 3CDIA 2R42A 4X65I 3M7ND 2BR2A 4B3RE 4N3OA 4RPFA 2E72A 1JK1A 3MHSC 2EM2A 2EMWA 4R2QA 4BS9A 2IOPA 4XTJA 2YTGA 2WP8B 3GCMA 2EORA 2NUFA 3Q1QA 3D4JA 2LE2A 4QNKA 4ZYDA 3WU5A 3T1YI 4DR3I 2EOXA 2GS8A 4B3MI 2PO1A 4X64I 2YPNA 1AH5A 3M6AA 1Y4UA 2F1DA 3Q6NA 2H36X 3OTOI 1T4LB 2VQEI 2BA1G 2DRPA 4F54A 1QNTA 2L2MA 2B7VA 4JI7E 1H73A 5EKWA 4JI1I 4I3HA 4F6MA 2ODRD 2EN8A 2CG9A 2EMGA 1A1HA 4DUYE 1S4EA 2EFGA 2HK3A 2EOIA 4BHBA 2EMYA 4OZEA 2RPCA 2JE6A 5C0XC 3HQ1A 3ZZ0A 2EQ1A 4FWDA 1EH7A 1STUA 2EQ0A 2EMIA 4MLQA 2DSYA 4F9CB 2YTNA 5DRPA 2EM5A 5IXMB 2HFSA 2E5LE 2X36A 2EL6A 4AIMA 3AUZA 4ISAA 2LV2A 1GTKA 2LJPA 2ELYA 4GKJE 5C0XB 1XMOI 3B8HA 2X7IA 1RREA 1KKHA 1NHJA 2A2CA 4DV6E 2NPFA 1Z5AA 4USKA 1Y60A 2BR2B 2O1VA 1Z5CA 1N36E 4JI4E 2UUBI 4JYAI 4DV0I 2YTDA 2JEBB 4WYQB 2ELZA 1WUUA 3T1HE 2EL5A 5BR8I 4IFDE 4DV3E 2UU9I 5IWAE 3ADLA 2CZ9A 2PNLA 1HR0I 4ZVIA 4MYUA 2PO1B 2O3ZA 4UTGA 4LF6E 2YTPA 3BF2A 5C0XF 2MC6A 2VE7C 5A6BD 2CGEA 2UXCE 2EOOA 2NA2A 1ZM4A 5A6KA 5A69A 2EMXA 3WU4A 2J7JA 3ZM7A 4LF5I 2ZM6I 2HJJA 2JE6B 3C6KA 2J7KA 3GMEA 1VISA 2ZITA 4OKGA 2UUAI 4O5GA 4LF7I 2MC5A 1IBKE 4UT4A 3EPJA 4MU3A 4PRXA 2EPKX 4B3RI 3M85D 4X9JA 2OI2A 3H4LA 1LLMC 2V2VA 1EH8A 4LOMA 3MSWA 5F3WA 2ENHA 4JI6E 4DPWA 2YWQA 2HKJA 3JU0A 4HYMA 2YZTA 1HNZE 3J81Q 2DMIA 2LUPB 4O4KA 4KHPE 2YSOA 3JTZA 2E1RA 4IZJA 2FV4B 1DARA 5K36B 2CSHA 2B3TB 2KONA 2M1SA 4F9AB 2O1UA 4DUYI 3VYXA 2L2NA 2RTXA 2EN2A 1BKNA 4O24A 2N8XA 5KL6A 2WW4A 4PRVA 1FJGE 4R2EA 2Q2EB 4R2PA 4KQVA 2E5LI 3RMPA 4DPTA 2BBGA 5DNXA 2LTSA 4BC9A 2NN6D 1IMUA 1XMOE 1A1FA 3PYGA 4GKJI 1X48A 5KL3A 2V87A 1O0WA 2GLIA 2JOXA 5IT9Q 3KZYA 2LUQA 3THOB 4FK5C 4OX9E 4DV7E 5AC4A 1ZAAC 3U1KA 4DR2E 1U2RA 4RHBB 4JYAE 2EPLX 2ZBKB 2IHR1 5KL4A 1KJKA 3PYDA 1N36I 4JI4I 1KYQA 4L8NA 5BR8E 4IFDB 4M30A 1UDSA 1N0VC 4DV3I 3B82A 5IWAI 1MEYC 4OO1F 2AJ4A 2LO3A 4DUZI 1OYRA 1UEKA 2BM0A 2JR1A 2G7HA 4WUCA 3V2UC 1ZXNA 2UXCI 1PVGA 4LF4E 2M7QA 3CWVA 4JI8E 3H09A 3PS3A 4IZJB 4DR4E 1GQEA 3H1CA 5AC5A 2EPRA 3LPSA 1A1LA 4DV5E 1X6EA 4LF7E 2F4VE 1YSAC 3ADGA 1I94E 1B63A 4BBYA 5LMNE 1FNMA 1H7SA 3B4TA 3V5RA 1QU6A 1USVA 4DPXA 3J7AM 1IBKI 2BA0D 4KZSA 1IBLE 3M7NG 2EQ3A 5JEAE 4P7AA 4GKKE 3ADJA 2L6MA 2JEBA 2V85A 2K7IA 4GZNC 2EMZA
chains in the Genus database with same CATH topology
2JWOA 1N0UA 4AQYI 4IZKA 2HKEA 4LF8E 2EWLA 2V88A 4JI6I 4Z7YA 1S16A 1Y4SA 3JAMC 1HNZI 2B9DA 4LU9A 1EA6A 2F8BA 5AASA 4EMDA 4KHPI 2V2QA 1XMQE 4M0VA 2HFUA 4JV5E 1N34I 1YZ9A 1H72C 4HXZA 4FN5A 1RQ0A 3LMLA 3HXLA 4DPYA 4DV1E 2DMYA 3HPZA 2V89A 4MYTA 4B3TE 1FJGI 4DR5E 1UILA 2KOUA 3F6GA 2L92A 4YHHE 1FWKA 2XEXA 1WHNA 2L33A 4OX9I 4DV7I 5FLXC 3F6HA 4DR2I 3LNUA 2V2ZA 1FKAE 1XNQI 5AE2A 4WFTA 4IZKB 1Y6ZA 4BCAA 4DUZE 1T4NA 4F9BB 4X62E 4P7DA 1HNWE 4LF9E 2DB2A 2V83A 4WPYA 4LF4I 2LBSB 4JI8I 3PYFA 1T4OA 4DR4I 1PIEA 2RS6A 4R1FA 4DV5I 2B7TA 2F4VI 3J7Yp 3J80C 4DR1E 1I94I 4DV4E 5LMNI 3WU3A 4K0KE 1IBLI 4GKKI 4NXME 4AQYE 4X8WA 2UUCE 4FW9A 2L3CA 4BMJA 2E1MA 1H74A 1Z0VA 4LF8I 2CPNA 4LTYA 2DIXA 1YYOA 4TUIA 1ZM2A 1XHKA 4DU8A 1MU5A 1N34E 3DJWA 1KTVA 1XMQI 4I8OA 4JV5I 1J5EE 4X66E 2Z5BA 5FWKA 1OJ4A 1NZ0A 4DV1I 1EI1A 4B3TI 3C4TA 2EZ6A 3C4BA 4DR5I 4FWHA 4JI2E 4NXNE 1XNRE 4YHHI 4OOGC 2FTXB 2MDRA 4HY1A 2HHHI 1QZRA 4LFCE 1XNQE 4WUBA 2RS7A 3P1XA 1WHQA 2DEJA 4PU9A 2UXBI 2Z5CA 1RR9A 2DEIA 1N33E 1Z5BA 2PNMA 1SR9A 2N3HA 4X62I 2K4VA 1HNWI 1YYKA 2NUGA 4LF9I 2RSMA 4DXLA 2M4IA 1ZXMA 2BM1A 2LJHA 4DPUA 2Z5BB 1NHHA 2ODRC 3PYEA 5GMDA 4LFBE 4DR1I 1Z0GA 2LMZA 4DV4I 4LFAE 4M2ZA 4K0KI 3ZKBA 3HJCA 4WSPA 4NXMI 1ELOA 2UUCI 1X47A 3K1JA 4DR6E 4Z7CA 1PKPA 3KWRA 3J80Q 5CFFE 3J81C 1IBMI 2R3VA 1KIJA 3AV0A 3VYYA 3K17A 2L2KB 2Z5CB 1WXRA 1HK7A 5ADZA 4DMIA 1Z0WA 4X66I 1J5EI 4J8ZA 1YYWA 4IZJD 2A2DA 3J7AG 2VF3A 4JI5E 2V34A 3ZZUA 1HNXI 4JI2I 4NXNI 1XNRI 1D6TA 3LLHA 5IT9C 1A6FA 2HHHE 3Q6MA 5A2QC 1Z0BA 3HULA 1ZM3A 1EKZA 4ED4A 2V8PA 2WZOA 1Z0TA 4LFCI 3F0NA 4HACA 3DF6A 2UXBE 1J26A 2O1TA 4R03A 1ZBTA 2VF1A 1N33I 2UXDE 1Z0EA 1DI2A 1RC7A 4B3SE 4R8OA 1K47A 1GZ6A 4WUDA 5LMUE 1KVKA 3ZZTA 2JOBA 1NHIA 4GEQB 1MX0A 3PRYA 4DU7A 4LFBI 5LL6R 4JI3E 4LFAI 3ADIA 1FI4A 2HK2A 3IWDA 3GONA 2JVAA 4YY3I 4DR6I 2VQFE 1N32I 2NUEA 1B62A 3OMLA 4DV2E 2V86A 2FGGA 3HTXA 4DR7I 1IBME 1UHZA 4DKKA 2YT4A 5GMEA 4JI0I 1X49A 4HACB 4X65E 2IOQA 2V8QB 1MG7A 2L8TA 1Z0CA 2LRSA 3IWCA 5T6JA 1FWLA 4JI5I 3T1YE 5AE1A 4DR3E 1HNXE 4B3ME 3JAMQ 2N3GA 3QT8A 4X64E 4Q28A 4L5NC 3OTOE 2KHXA 2VQEE 3IWBA 4JG4A 4JI1E 5DNYA 4JI7I 3HPSA 1Z59A 2Z5EA 4P52A 4BC7A 3K6QA 4TUGA 3QT5A 2BV3A 3QT6A 3FIGA 3WU6A 2UXDI 3VK6A 4B3SI 5FLXQ 1USUA 5A2QQ 4DV6I 3LTOA 5LMUI 1ZBQA 3K85A 3ZOQB 4URLA 2JY9A 2UUBE 3QT7A 4DV0E 1ZM9A 3B78A 2UU9E 3T1HI 4JI3I 2LTRA 5AE3A 1HR0E 4YY3E 4LF6I 4M1KA 1DQ3A 2L3JA 3ZKDA 3P06A 1N32E 4FWGA 2VQFI 1H7UA 4DR7E 5L3JA 4JI0E 4USMA 4LF5E 2ZM6E 2O1WA 4DV2I 2UUAE 2GQ0A 2R42A 4X65I 4B3RE 4N3OA 4RPFA 4BS9A 2IOPA 4XTJA 2NUFA 3Q1QA 3D4JA 2LE2A 3WU5A 3T1YI 4DR3I 4B3MI 2GS8A 4X64I 3M6AA 1Y4UA 3Q6NA 2H36X 3OTOI 1T4LB 2VQEI 4F54A 2L2MA 2B7VA 4JI7E 1H73A 4JI1I 4I3HA 2ODRD 2CG9A 2HK3A 1S4EA 4DUYE 2EFGA 3HQ1A 3ZZ0A 4FWDA 1STUA 4F9CB 2DSYA 2HFSA 2E5LE 2X36A 3AUZA 2LJPA 4GKJE 1XMOI 3B8HA 2X7IA 1RREA 1KKHA 1NHJA 2A2CA 4DV6E 2NPFA 1Z5AA 4USKA 2O1VA 1Z5CA 1N36E 4JI4E 2UUBI 4JYAI 4DV0I 4WYQB 1WUUA 3T1HE 5BR8I 4DV3E 2UU9I 5IWAE 3ADLA 2CZ9A 2PNLA 1HR0I 4ZVIA 4MYUA 4UTGA 4LF6E 2MC6A 2VE7C 2CGEA 2UXCE 2NA2A 1ZM4A 3WU4A 3ZM7A 4LF5I 2ZM6I 2UUAI 4LF7I 2J7KA 1VISA 2ZITA 2MC5A 1IBKE 4UT4A 4PRXA 4B3RI 2OI2A 3H4LA 2V2VA 3MSWA 5F3WA 4JI6E 4DPWA 2HKJA 3JU0A 4HYMA 2YZTA 1HNZE 3J81Q 2LUPB 4KHPE 3JTZA 2E1RA 4IZJA 2FV4B 1DARA 2B3TB 2KONA 2M1SA 4F9AB 2O1UA 4DUYI 3VYXA 2L2NA 2RTXA 1BKNA 4PRVA 2WW4A 1FJGE 2Q2EB 4KQVA 2E5LI 3RMPA 4DPTA 2LTSA 4BC9A 3PYGA 1XMOE 4GKJI 1X48A 2V87A 1O0WA 5IT9Q 2JOXA 2LUQA 4OX9E 4DV7E 4DR2E 1U2RA 2ZBKB 4JYAE 2IHR1 3PYDA 1N36I 4JI4I 4L8NA 5BR8E 4M30A 1N0VC 4DV3I 3B82A 5IWAI 2AJ4A 4DUZI 1UEKA 2BM0A 2JR1A 2G7HA 4WUCA 3V2UC 1ZXNA 2UXCI 1PVGA 4LF4E 2M7QA 3CWVA 4JI8E 3H09A 4IZJB 4DR4E 1GQEA 3LPSA 4DV5E 4LF7E 2F4VE 1B63A 1I94E 1FNMA 3ADGA 4BBYA 5LMNE 1H7SA 3V5RA 4DPXA 1QU6A 1USVA 3J7AM 1IBKI 4KZSA 1IBLE 4P7AA 4GKKE 3ADJA 2L6MA 2V85A 4P78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0U A;  4AQY I;  2HKE A;  4LF8 E;  4JI6 I;  4Z7Y A;  1S16 A;  3JAM C;  1HNZ I;  1EA6 A;  4KHP I;  4EMD A;  2V2Q A;  1XMQ E;  2HFU A;  4JV5 E;  1N34 I;  1YZ9 A;  1H72 C;  4HXZ A;  4FN5 A;  1RQ0 A;  4DPY A;  4DV1 E;  2DMY A;  4MYT A;  4B3T E;  1FJG I;  4DR5 E;  1UIL A;  4YHH E;  1FWK A;  2XEX A;  1WHN A;  2L33 A;  4OX9 I;  4DV7 I;  5FLX C;  4DR2 I;  3LNU A;  2V2Z A;  1FKA E;  1XNQ I;  4WFT A;  4DUZ E;  1T4N A;  4X62 E;  1HNW E;  4LF9 E;  2DB2 A;  4LF4 I;  2LBS B;  4JI8 I;  3PYF A;  1T4O A;  4DR4 I;  1PIE A;  2RS6 A;  4R1F A;  4DV5 I;  2B7T A;  2F4V I;  3J7Y p;  3J80 C;  4DR1 E;  1I94 I;  4DV4 E;  5LMN I;  3WU3 A;  4K0K E;  1IBL I;  4GKK I;  4NXM E;  4AQY E;  4X8W A;  2UUC E;  4FW9 A;  2L3C A;  1H74 A;  1Z0V A;  4LF8 I;  2CPN A;  2DIX A;  1YYO A;  1ZM2 A;  1XHK A;  4DU8 A;  1MU5 A;  1N34 E;  1KTV A;  1XMQ I;  4JV5 I;  1J5E E;  4X66 E;  1OJ4 A;  1NZ0 A;  4DV1 I;  1EI1 A;  4B3T I;  3C4T A;  2EZ6 A;  3C4B A;  4DR5 I;  4FWH A;  4JI2 E;  4NXN E;  1XNR E;  4YHH I;  4OOG C;  2MDR A;  4HY1 A;  2HHH I;  1QZR A;  4LFC E;  1XNQ E;  4WUB A;  2RS7 A;  3P1X A;  1WHQ A;  2DEJ A;  4PU9 A;  2UXB I;  1RR9 A;  2DEI A;  1N33 E;  1Z5B A;  2N3H A;  4X62 I;  1HNW I;  1YYK A;  2NUG A;  4LF9 I;  2RSM A;  4DXL A;  1ZXM A;  2BM1 A;  2LJH A;  4DPU A;  1NHH A;  3PYE A;  5GMD A;  4LFB E;  4DR1 I;  1Z0G A;  4DV4 I;  4LFA E;  4M2Z A;  4K0K I;  3ZKB A;  4NXM I;  1ELO A;  2UUC I;  1X47 A;  3K1J A;  4DR6 E;  4Z7C A;  1PKP A;  3J80 Q;  5CFF E;  3J81 C;  1IBM I;  2R3V A;  1KIJ A;  3VYY A;  3K17 A;  2L2K B;  1Z0W A;  4X66 I;  1J5E I;  1YYW A;  2A2D A;  2VF3 A;  3J7A G;  4JI5 E;  2V34 A;  3ZZU A;  1HNX I;  4JI2 I;  4NXN I;  1XNR I;  1D6T A;  3LLH A;  5IT9 C;  1A6F A;  2HHH E;  5A2Q C;  1Z0B A;  3HUL A;  1ZM3 A;  1EKZ A;  4ED4 A;  2V8P A;  1Z0T A;  4LFC I;  3F0N A;  4HAC A;  2UXB E;  1J26 A;  1ZBT A;  1N33 I;  2UXD E;  1Z0E A;  1DI2 A;  1RC7 A;  4B3S E;  1K47 A;  4WUD A;  5LMU E;  1KVK A;  3ZZT A;  1NHI A;  1MX0 A;  4DU7 A;  4LFB I;  5LL6 R;  4JI3 E;  4LFA I;  3ADI A;  1FI4 A;  2HK2 A;  3GON A;  2JVA A;  4YY3 I;  4DR6 I;  2VQF E;  1N32 I;  2NUE A;  1B62 A;  4DV2 E;  3HTX A;  4DR7 I;  1IBM E;  1UHZ A;  4DKK A;  2YT4 A;  5GME A;  4JI0 I;  1X49 A;  4HAC B;  4X65 E;  1MG7 A;  1Z0C A;  2LRS A;  1FWL A;  4JI5 I;  3T1Y E;  4DR3 E;  1HNX E;  4B3M E;  3JAM Q;  2N3G A;  3QT8 A;  4X64 E;  3OTO E;  2KHX A;  2VQE E;  4JG4 A;  4JI1 E;  4JI7 I;  1Z59 A;  4P52 A;  3QT5 A;  2BV3 A;  3QT6 A;  3WU6 A;  2UXD I;  4B3S I;  5FLX Q;  5A2Q Q;  4DV6 I;  3LTO A;  5LMU I;  4URL A;  2JY9 A;  2UUB E;  3QT7 A;  4DV0 E;  1ZM9 A;  3B78 A;  2UU9 E;  3T1H I;  4JI3 I;  2LTR A;  1HR0 E;  4YY3 E;  4LF6 I;  4M1K A;  2L3J A;  3ZKD A;  1N32 E;  4FWG A;  2VQF I;  1H7U A;  4DR7 E;  5L3J A;  4JI0 E;  4USM A;  4LF5 E;  2ZM6 E;  4DV2 I;  2UUA E;  2R42 A;  4X65 I;  4B3R E;  4RPF A;  4XTJ A;  2NUF A;  3Q1Q A;  3D4J A;  3WU5 A;  3T1Y I;  4DR3 I;  4B3M I;  2GS8 A;  4X64 I;  3M6A A;  3OTO I;  1T4L B;  2VQE I;  2L2M A;  2B7V A;  4JI7 E;  1H73 A;  4JI1 I;  4I3H A;  2HK3 A;  1S4E A;  4DUY E;  2EFG A;  3ZZ0 A;  4FWD A;  1STU A;  2HFS A;  2E5L E;  2X36 A;  2LJP A;  4GKJ E;  1XMO I;  3B8H A;  2X7I A;  1RRE A;  1KKH A;  1NHJ A;  2A2C A;  4DV6 E;  2NPF A;  1Z5A A;  4USK A;  1Z5C A;  1N36 E;  4JI4 E;  2UUB I;  4JYA I;  4DV0 I;  4WYQ B;  1WUU A;  3T1H E;  5BR8 I;  4DV3 E;  2UU9 I;  5IWA E;  3ADL A;  2CZ9 A;  1HR0 I;  4ZVI A;  4MYU A;  4UTG A;  4LF6 E;  2UXC E;  2NA2 A;  1ZM4 A;  3WU4 A;  3ZM7 A;  4LF5 I;  2ZM6 I;  2UUA I;  4LF7 I;  2J7K A;  1VIS A;  2ZIT A;  1IBK E;  4UT4 A;  4PRX A;  4B3R I;  2OI2 A;  3H4L A;  2V2V A;  4JI6 E;  4DPW A;  2HKJ A;  4HYM A;  1HNZ E;  3J81 Q;  2LUP B;  4KHP E;  2E1R A;  1DAR A;  2B3T B;  4DUY I;  3VYX A;  2L2N A;  2RTX A;  1BKN A;  4PRV A;  2WW4 A;  1FJG E;  2Q2E B;  4KQV A;  2E5L I;  4DPT A;  2LTS A;  3PYG A;  1XMO E;  4GKJ I;  1X48 A;  1O0W A;  5IT9 Q;  2LUQ A;  4OX9 E;  4DV7 E;  4DR2 E;  1U2R A;  2ZBK B;  4JYA E;  2IHR 1;  3PYD A;  1N36 I;  4JI4 I;  5BR8 E;  4M30 A;  1N0V C;  4DV3 I;  3B82 A;  5IWA I;  2AJ4 A;  4DUZ I;  1UEK A;  2BM0 A;  4WUC A;  3V2U C;  1ZXN A;  2UXC I;  1PVG A;  4LF4 E;  3CWV A;  4JI8 E;  4DR4 E;  1GQE A;  3LPS A;  4DV5 E;  4LF7 E;  2F4V E;  3ADG A;  1I94 E;  1B63 A;  1FNM A;  5LMN E;  1H7S A;  3V5R A;  4DPX A;  3J7A M;  1QU6 A;  1IBK I;  1IBL E;  4P7A A;  4GKK E;  3ADJ A; 
#chains in the Genus database with same CATH topology
 2JWO A;  4WXC A;  2YRM A;  1N0U A;  4AQY I;  5K36 E;  4IZK A;  2HKE A;  2ENC A;  4LF8 E;  2EWL A;  2JYA A;  2V88 A;  4IS1 C;  4JI6 I;  4Z7Y A;  1R6L A;  4FW6 A;  1MGT A;  1S16 A;  1Y4S A;  2EOJ A;  3JAM C;  1HNZ I;  2B9D A;  3P3C A;  4LU9 A;  2EOH A;  1EA6 A;  2F8B A;  5AAS A;  4EMD A;  4KHP I;  2V2Q A;  2LJU A;  1XMQ E;  4M0V A;  2HFU A;  4JV5 E;  1N34 I;  1YZ9 A;  2EPM X;  1H72 C;  2NN6 E;  4HXZ A;  4FN5 A;  1RQ0 A;  3LML A;  2JT2 A;  3HXL A;  4DPY A;  4DV1 E;  2DMY A;  3HPZ A;  2V89 A;  4MYT A;  4B3T E;  5JEA A;  4BA2 A;  1FJG I;  1YH8 A;  4DR5 E;  1UIL A;  4OO1 E;  2EN6 A;  1DGC A;  2KOU A;  3F6G A;  2L92 A;  2R1F A;  4YHH E;  5LLQ A;  1FWK A;  2XEX A;  1WHN A;  2L33 A;  4AID A;  4HEI A;  3BBG A;  2LT7 A;  2BA1 D;  2WCC 3;  2LCE A;  5FLX C;  4DV7 I;  4OX9 I;  3F6H A;  4ZYG A;  4DR2 I;  1BBO A;  3LNU A;  2V2Z A;  1PJS A;  2EL4 A;  2YTF A;  1FKA E;  1XNQ I;  5AE2 A;  5K36 A;  4WFT A;  4IZK B;  2R76 A;  1Y6Z A;  2VES A;  4BCA A;  4DUZ E;  1T4N A;  4F9B B;  4X62 E;  4F6N A;  4P7D A;  1HNW E;  4LF9 E;  2DB2 A;  2V83 A;  2NAB A;  3L00 A;  4AM3 A;  4OO1 A;  4WPY A;  5JEA C;  2EM7 A;  4LF4 I;  1A1G A;  2LBS B;  4JI8 I;  3PYF A;  1T4O A;  2CTD A;  4DR4 I;  1PIE A;  4FW4 A;  3VHT B;  2RS6 A;  4R1F A;  2EM8 A;  4DV5 I;  2B7T A;  2F4V I;  3J7Y p;  3J80 C;  4DR1 E;  3P3E A;  1JK2 A;  4FW5 A;  4DV4 E;  5C0X D;  5LMN I;  1I94 I;  2EJ4 A;  3L7Z A;  2MKN A;  3UK3 C;  3P3G A;  4K0K E;  3WU3 A;  5JEA B;  1IBL I;  4BA2 B;  4GKK I;  2EPX A;  4LCG A;  4M9V C;  4NXM E;  4GQU A;  4AQY E;  1NEI A;  4X8W A;  2UUC E;  4FW9 A;  4MU0 A;  4IFD A;  2L3C A;  4BMJ A;  2E1M A;  2GPI A;  4R2S A;  1H74 A;  1Z0V A;  4LF8 I;  5K36 C;  2CPN A;  2C37 B;  2AE8 A;  3P76 A;  1E3P A;  1ZU1 A;  4LTY A;  3U1Y A;  2Q8U A;  2DIX A;  1YYO A;  4TUI A;  1ZM2 A;  1XHK A;  1WJP A;  2EPC A;  4DU8 A;  2HC5 A;  1PJT A;  2EM6 A;  1MU5 A;  4WXD A;  1N34 E;  3DJW A;  2NN6 B;  1KTV A;  3EQ1 A;  5JEA F;  1XMQ I;  4I8O A;  4JV5 I;  1J5E E;  4X66 E;  2Z5B A;  4MU1 A;  4R2R A;  1Z1B A;  1OJ4 A;  5FWK A;  1TF6 A;  1NZ0 A;  2D9H A;  1N3G A;  4DV1 I;  2YRK A;  2WNR A;  1EI1 A;  4B3T I;  2A25 A;  3C4T A;  2EZ6 A;  5KL5 A;  4BA1 A;  3C4B A;  4OO1 B;  4DR5 I;  4FWH A;  4JI2 E;  2YU8 A;  4NXN E;  2WBS A;  2GHF A;  4IJD A;  1XNR E;  4IFD C;  4YHH I;  1BBG A;  4FW7 A;  4OOG C;  3EPL A;  2FTX B;  2MDR A;  4LCF A;  2EMC A;  4HY1 A;  1UN6 B;  2HHH I;  5K36 F;  2EMB A;  1QZR A;  4IS9 A;  4LFC E;  2EOY A;  3THN A;  2PRT A;  3EPH A;  3PS1 A;  1XNQ E;  4WUB A;  1A1K A;  4R2D A;  2RS7 A;  3P1X A;  4ZYH A;  1WHQ A;  2DEJ A;  4PU9 A;  2UXB I;  2Z5C A;  1RR9 A;  1G2D C;  2DEI A;  1N33 E;  1Z5B A;  2PNM A;  1SR9 A;  4HTG A;  1IQO A;  2N3H A;  4X62 I;  2K4V A;  4NBQ A;  5K36 D;  4NHR A;  1HNW I;  1YYK A;  2NUG A;  1TN9 A;  4O43 A;  4LF9 I;  2RSM A;  4RH8 A;  4DXL A;  2M4I A;  1ZXM A;  2BM1 A;  2PNZ A;  1TF3 A;  1R6M A;  2LJH A;  4DPU A;  4WX9 A;  2RQL A;  1NHH A;  2ODR C;  2VRD A;  2Z5B B;  4LFB E;  3PYE A;  5GMD A;  1VI7 A;  2J65 A;  1L4S A;  1Z0G A;  1X6H A;  2LMZ A;  2WNR B;  4DV4 I;  4DR1 I;  4IFD F;  4MQY A;  2YSP A;  4LFA E;  2WBT A;  5A6B A;  1AAY A;  4M2Z A;  3ZKB A;  4BA1 B;  4K0K I;  3HJC A;  4WSP A;  2EN1 A;  4U3B A;  4NXM I;  1ELO A;  2UUC I;  1X47 A;  5A6J A;  3GLL A;  3K1J A;  4DR6 E;  2C39 B;  4Z7C A;  4BHC A;  2DGC A;  1PKP A;  2EML A;  2YTQ A;  1A1I A;  2EMK A;  3KZZ A;  3KWR A;  3J80 Q;  5CFF E;  3J81 C;  5TSE A;  1IBM I;  2R3V A;  3QG5 C;  2C38 A;  1KIJ A;  3ECR A;  2EN7 A;  3AV0 A;  3KRN A;  3VYY A;  3K17 A;  2L2K B;  1WRJ A;  1X6F A;  2EPZ A;  1WXR A;  1HK7 A;  5ADZ A;  2Z5C B;  4DMI A;  1F2I G;  1Z0W A;  2BB8 A;  4X66 I;  1J5E I;  4J8Z A;  2EPO A;  2YTI A;  3C6M A;  1YYW A;  4IZJ D;  2YTJ A;  2A2D A;  5EL9 A;  3J7A G;  2VF3 A;  5ELW A;  4JI5 E;  2V34 A;  5A6A A;  1UDO A;  2EOE A;  1OYP A;  2EM9 A;  3ZZU A;  1HNX I;  4JI2 I;  4NXN I;  2PNZ B;  1UDN A;  1X3C A;  1XNR I;  3LLH A;  1D6T A;  1G2F C;  4MLV A;  2C37 A;  2EOS A;  3M99 B;  5IT9 C;  1A6F A;  1ZR9 A;  2ENA A;  2PO0 A;  2HHH E;  2EOF A;  1T39 A;  1UDQ A;  3Q6M A;  5A2Q C;  1Z0B A;  3HUL A;  1ZM3 A;  1EKZ A;  4ED4 A;  4R2A A;  2WZO A;  1Z0T A;  2V8P A;  4LFC I;  2EOZ A;  2YTE A;  3F0N A;  4HAC A;  3DF6 A;  2UXB E;  1J26 A;  1SFE A;  2NN6 A;  2O1T A;  4QNJ A;  4DR7 I;  4R03 A;  1ZBT A;  1B69 A;  2VF1 A;  1N33 I;  2JP9 A;  2UXD E;  1Z0E A;  1DI2 A;  1RC7 A;  2EE8 A;  4B3S E;  4R8O A;  5KL7 A;  4KWY A;  1K47 A;  2EN4 A;  1GZ6 A;  4WUD A;  2YRH A;  2C38 B;  5DRO A;  5LMU E;  1KVK A;  4U3D A;  4Q35 B;  3ZZT A;  2JOB A;  3L7Z B;  5KL2 A;  4J3D A;  1NHI A;  2DLQ A;  4GEQ B;  1MX0 A;  3PRY A;  4DU7 A;  4LFB I;  4R2C A;  5LL6 R;  4JI3 E;  4LFA I;  3ADI A;  1FI4 A;  2HK2 A;  1EH6 A;  4MU4 A;  3M85 G;  2CVE A;  2EMF A;  3PS2 A;  3IWD A;  3GON A;  2IER A;  2EOM A;  2JVA A;  4F2J C;  2NN6 C;  4YY3 I;  4DR6 I;  2VQF E;  1XXE A;  2PO2 A;  2MDG A;  2PO0 B;  1N32 I;  2NUE A;  2ADR A;  3TQM A;  1B62 A;  3OML A;  2RSI A;  4DV2 E;  2I13 A;  3CDJ A;  2V86 A;  2FGG A;  3HTX A;  3EPK A;  1UHZ A;  1IBM E;  2DLK A;  2YT4 A;  4DKK A;  3MHH C;  2YTO A;  5GME A;  4JI0 I;  2EM0 A;  1P42 A;  4LCH A;  1X49 A;  4HAC B;  4OO1 C;  4X65 E;  2IOQ A;  2CT1 A;  4LPF A;  2MKD A;  2V8Q B;  1MG7 A;  1YHC A;  1PJQ A;  2L8T A;  2JXP A;  1Z0C A;  2JEA A;  2LRS A;  3IWC A;  5T6J A;  1FWL A;  4JI5 I;  3T1Y E;  5AE1 A;  2EPN A;  4DR3 E;  1HNX E;  4B3M E;  3JAM Q;  2M9A A;  2N3G A;  3QT8 A;  4X64 E;  2EN3 A;  3BGH A;  5JEA D;  4Q28 A;  4L5N C;  3OTO E;  2C39 A;  1RMD A;  2KHX A;  2VQE E;  2EMH A;  3IWB A;  1PDA A;  4WSG A;  1YUI A;  4JG4 A;  4JI1 E;  2NN6 F;  5DRQ A;  5DNY A;  4JI7 I;  3HPS A;  1Z59 A;  2Z5E A;  5DNL A;  4P52 A;  2EPU A;  4BC7 A;  3K6Q A;  1IQS A;  4TUG A;  2I9I A;  4MDT A;  3QT5 A;  2EM4 A;  1A1J A;  1UBD C;  1BB8 A;  1OYS A;  2BV3 A;  2PO2 B;  5IV8 B;  2GO3 A;  3FIG A;  3QT6 A;  2HGH A;  3NZK A;  3WU6 A;  1P47 A;  2LVH A;  2UXD I;  2WP8 A;  5DRR A;  3VK6 A;  1YFH A;  5C0X E;  4B3S I;  2WBU A;  5FLX Q;  1USU A;  5A2Q Q;  2EOQ A;  4DV6 I;  3LTO A;  5LMU I;  1ZBQ A;  1T38 A;  3ZOQ B;  3HKM A;  3K85 A;  4URL A;  2EPP A;  2JY9 A;  2UUB E;  2JPA A;  1E3H A;  4DV0 E;  1YPN A;  3QT7 A;  3UHM A;  1ZM9 A;  4OO1 D;  2YU5 A;  1X5W A;  3B78 A;  2JEA B;  4P78 A;  2BA0 G;  2UU9 E;  1RHY A;  3T1H I;  1Y5Y A;  1YUJ A;  4N4R B;  4JI3 I;  2EP3 A;  2LTR A;  5AE3 A;  1HR0 E;  2GO4 A;  2EM3 A;  4NZV A;  3DD6 A;  4YY3 E;  4LF6 I;  4M1K A;  1DQ3 A;  2L3J A;  3ZKD A;  3P06 A;  2EPA A;  3BID A;  1N32 E;  4FWG A;  2VQF I;  4IFD D;  1H7U A;  1NCS A;  2EMA A;  5C0X A;  4DR7 E;  5L3J A;  4JI0 E;  2IES A;  4LF5 E;  2ZM6 E;  2O1W A;  4FW3 A;  4USM A;  4DV2 I;  2UUA E;  2GQ0 A;  4ZYE A;  3CDI A;  2R42 A;  4X65 I;  3M7N D;  2BR2 A;  4B3R E;  4N3O A;  4RPF A;  2E72 A;  1JK1 A;  3MHS C;  2EM2 A;  2EMW A;  4R2Q A;  4BS9 A;  2IOP A;  4XTJ A;  2YTG A;  2WP8 B;  3GCM A;  2EOR A;  2NUF A;  3Q1Q A;  3D4J A;  2LE2 A;  4QNK A;  4ZYD A;  3WU5 A;  3T1Y I;  4DR3 I;  2EOX A;  2GS8 A;  4B3M I;  2PO1 A;  4X64 I;  2YPN A;  1AH5 A;  3M6A A;  1Y4U A;  2F1D A;  3Q6N A;  2H36 X;  3OTO I;  1T4L B;  2VQE I;  2BA1 G;  2DRP A;  4F54 A;  1QNT A;  2L2M A;  2B7V A;  4JI7 E;  1H73 A;  5EKW A;  4JI1 I;  4I3H A;  4F6M A;  2ODR D;  2EN8 A;  2CG9 A;  2EMG A;  1A1H A;  4DUY E;  1S4E A;  2EFG A;  2HK3 A;  2EOI A;  4BHB A;  2EMY A;  4OZE A;  2RPC A;  2JE6 A;  5C0X C;  3HQ1 A;  3ZZ0 A;  2EQ1 A;  4FWD A;  1EH7 A;  1STU A;  2EQ0 A;  2EMI A;  4MLQ A;  2DSY A;  4F9C B;  2YTN A;  5DRP A;  2EM5 A;  5IXM B;  2HFS A;  2E5L E;  2X36 A;  2EL6 A;  4AIM A;  3AUZ A;  4ISA A;  2LV2 A;  1GTK A;  2LJP A;  2ELY A;  4GKJ E;  5C0X B;  1XMO I;  3B8H A;  2X7I A;  1RRE A;  1KKH A;  1NHJ A;  2A2C A;  4DV6 E;  2NPF A;  1Z5A A;  4USK A;  1Y60 A;  2BR2 B;  2O1V A;  1Z5C A;  1N36 E;  4JI4 E;  2UUB I;  4JYA I;  4DV0 I;  2YTD A;  2JEB B;  4WYQ B;  2ELZ A;  1WUU A;  3T1H E;  2EL5 A;  5BR8 I;  4IFD E;  4DV3 E;  2UU9 I;  5IWA E;  3ADL A;  2CZ9 A;  2PNL A;  1HR0 I;  4ZVI A;  4MYU A;  2PO1 B;  2O3Z A;  4UTG A;  4LF6 E;  2YTP A;  3BF2 A;  5C0X F;  2MC6 A;  2VE7 C;  5A6B D;  2CGE A;  2UXC E;  2EOO A;  2NA2 A;  1ZM4 A;  5A6K A;  5A69 A;  2EMX A;  3WU4 A;  2J7J A;  3ZM7 A;  4LF5 I;  2ZM6 I;  2HJJ A;  2JE6 B;  3C6K A;  2J7K A;  3GME A;  1VIS A;  2ZIT A;  4OKG A;  2UUA I;  4O5G A;  4LF7 I;  2MC5 A;  1IBK E;  4UT4 A;  3EPJ A;  4MU3 A;  4PRX A;  2EPK X;  4B3R I;  3M85 D;  4X9J A;  2OI2 A;  3H4L A;  1LLM C;  2V2V A;  1EH8 A;  4LOM A;  3MSW A;  5F3W A;  2ENH A;  4JI6 E;  4DPW A;  2YWQ A;  2HKJ A;  3JU0 A;  4HYM A;  2YZT A;  1HNZ E;  3J81 Q;  2DMI A;  2LUP B;  4O4K A;  4KHP E;  2YSO A;  3JTZ A;  2E1R A;  4IZJ A;  2FV4 B;  1DAR A;  5K36 B;  2CSH A;  2B3T B;  2KON A;  2M1S A;  4F9A B;  2O1U A;  4DUY I;  3VYX A;  2L2N A;  2RTX A;  2EN2 A;  1BKN A;  4O24 A;  2N8X A;  5KL6 A;  2WW4 A;  4PRV A;  1FJG E;  4R2E A;  2Q2E B;  4R2P A;  4KQV A;  2E5L I;  3RMP A;  4DPT A;  2BBG A;  5DNX A;  2LTS A;  4BC9 A;  2NN6 D;  1IMU A;  1XMO E;  1A1F A;  3PYG A;  4GKJ I;  1X48 A;  5KL3 A;  2V87 A;  1O0W A;  2GLI A;  2JOX A;  5IT9 Q;  3KZY A;  2LUQ A;  3THO B;  4FK5 C;  4OX9 E;  4DV7 E;  5AC4 A;  1ZAA C;  3U1K A;  4DR2 E;  1U2R A;  4RHB B;  4JYA E;  2EPL X;  2ZBK B;  2IHR 1;  5KL4 A;  1KJK A;  3PYD A;  1N36 I;  4JI4 I;  1KYQ A;  4L8N A;  5BR8 E;  4IFD B;  4M30 A;  1UDS A;  1N0V C;  4DV3 I;  3B82 A;  5IWA I;  1MEY C;  4OO1 F;  2AJ4 A;  2LO3 A;  4DUZ I;  1OYR A;  1UEK A;  2BM0 A;  2JR1 A;  2G7H A;  4WUC A;  3V2U C;  1ZXN A;  2UXC I;  1PVG A;  4LF4 E;  2M7Q A;  3CWV A;  4JI8 E;  3H09 A;  3PS3 A;  4IZJ B;  4DR4 E;  1GQE A;  3H1C A;  5AC5 A;  2EPR A;  3LPS A;  1A1L A;  4DV5 E;  1X6E A;  4LF7 E;  2F4V E;  1YSA C;  3ADG A;  1I94 E;  1B63 A;  4BBY A;  5LMN E;  1FNM A;  1H7S A;  3B4T A;  3V5R A;  1QU6 A;  1USV A;  4DPX A;  3J7A M;  1IBK I;  2BA0 D;  4KZS A;  1IBL E;  3M7N G;  2EQ3 A;  5JEA E;  4P7A A;  4GKK E;  3ADJ A;  2L6M A;  2JEB A;  2V85 A;  2K7I A;  4GZN C;  2EMZ A; 
#chains in the Genus database with same CATH homology
 2JWO A;  1N0U A;  4AQY I;  4IZK A;  2HKE A;  4LF8 E;  2EWL A;  2V88 A;  4JI6 I;  4Z7Y A;  1S16 A;  1Y4S A;  3JAM C;  1HNZ I;  2B9D A;  4LU9 A;  1EA6 A;  2F8B A;  5AAS A;  4EMD A;  4KHP I;  2V2Q A;  1XMQ E;  4M0V A;  2HFU A;  4JV5 E;  1N34 I;  1YZ9 A;  1H72 C;  4HXZ A;  4FN5 A;  1RQ0 A;  3LML A;  3HXL A;  4DPY A;  4DV1 E;  2DMY A;  3HPZ A;  2V89 A;  4MYT A;  4B3T E;  1FJG I;  4DR5 E;  1UIL A;  2KOU A;  3F6G A;  2L92 A;  4YHH E;  1FWK A;  2XEX A;  1WHN A;  2L33 A;  4OX9 I;  4DV7 I;  5FLX C;  3F6H A;  4DR2 I;  3LNU A;  2V2Z A;  1FKA E;  1XNQ I;  5AE2 A;  4WFT A;  4IZK B;  1Y6Z A;  4BCA A;  4DUZ E;  1T4N A;  4F9B B;  4X62 E;  4P7D A;  1HNW E;  4LF9 E;  2DB2 A;  2V83 A;  4WPY A;  4LF4 I;  2LBS B;  4JI8 I;  3PYF A;  1T4O A;  4DR4 I;  1PIE A;  2RS6 A;  4R1F A;  4DV5 I;  2B7T A;  2F4V I;  3J7Y p;  3J80 C;  4DR1 E;  1I94 I;  4DV4 E;  5LMN I;  3WU3 A;  4K0K E;  1IBL I;  4GKK I;  4NXM E;  4AQY E;  4X8W A;  2UUC E;  4FW9 A;  2L3C A;  4BMJ A;  2E1M A;  1H74 A;  1Z0V A;  4LF8 I;  2CPN A;  4LTY A;  2DIX A;  1YYO A;  4TUI A;  1ZM2 A;  1XHK A;  4DU8 A;  1MU5 A;  1N34 E;  3DJW A;  1KTV A;  1XMQ I;  4I8O A;  4JV5 I;  1J5E E;  4X66 E;  2Z5B A;  5FWK A;  1OJ4 A;  1NZ0 A;  4DV1 I;  1EI1 A;  4B3T I;  3C4T A;  2EZ6 A;  3C4B A;  4DR5 I;  4FWH A;  4JI2 E;  4NXN E;  1XNR E;  4YHH I;  4OOG C;  2FTX B;  2MDR A;  4HY1 A;  2HHH I;  1QZR A;  4LFC E;  1XNQ E;  4WUB A;  2RS7 A;  3P1X A;  1WHQ A;  2DEJ A;  4PU9 A;  2UXB I;  2Z5C A;  1RR9 A;  2DEI A;  1N33 E;  1Z5B A;  2PNM A;  1SR9 A;  2N3H A;  4X62 I;  2K4V A;  1HNW I;  1YYK A;  2NUG A;  4LF9 I;  2RSM A;  4DXL A;  2M4I A;  1ZXM A;  2BM1 A;  2LJH A;  4DPU A;  2Z5B B;  1NHH A;  2ODR C;  3PYE A;  5GMD A;  4LFB E;  4DR1 I;  1Z0G A;  2LMZ A;  4DV4 I;  4LFA E;  4M2Z A;  4K0K I;  3ZKB A;  3HJC A;  4WSP A;  4NXM I;  1ELO A;  2UUC I;  1X47 A;  3K1J A;  4DR6 E;  4Z7C A;  1PKP A;  3KWR A;  3J80 Q;  5CFF E;  3J81 C;  1IBM I;  2R3V A;  1KIJ A;  3AV0 A;  3VYY A;  3K17 A;  2L2K B;  2Z5C B;  1WXR A;  1HK7 A;  5ADZ A;  4DMI A;  1Z0W A;  4X66 I;  1J5E I;  4J8Z A;  1YYW A;  4IZJ D;  2A2D A;  3J7A G;  2VF3 A;  4JI5 E;  2V34 A;  3ZZU A;  1HNX I;  4JI2 I;  4NXN I;  1XNR I;  1D6T A;  3LLH A;  5IT9 C;  1A6F A;  2HHH E;  3Q6M A;  5A2Q C;  1Z0B A;  3HUL A;  1ZM3 A;  1EKZ A;  4ED4 A;  2V8P A;  2WZO A;  1Z0T A;  4LFC I;  3F0N A;  4HAC A;  3DF6 A;  2UXB E;  1J26 A;  2O1T A;  4R03 A;  1ZBT A;  2VF1 A;  1N33 I;  2UXD E;  1Z0E A;  1DI2 A;  1RC7 A;  4B3S E;  4R8O A;  1K47 A;  1GZ6 A;  4WUD A;  5LMU E;  1KVK A;  3ZZT A;  2JOB A;  1NHI A;  4GEQ B;  1MX0 A;  3PRY A;  4DU7 A;  4LFB I;  5LL6 R;  4JI3 E;  4LFA I;  3ADI A;  1FI4 A;  2HK2 A;  3IWD A;  3GON A;  2JVA A;  4YY3 I;  4DR6 I;  2VQF E;  1N32 I;  2NUE A;  1B62 A;  3OML A;  4DV2 E;  2V86 A;  2FGG A;  3HTX A;  4DR7 I;  1IBM E;  1UHZ A;  4DKK A;  2YT4 A;  5GME A;  4JI0 I;  1X49 A;  4HAC B;  4X65 E;  2IOQ A;  2V8Q B;  1MG7 A;  2L8T A;  1Z0C A;  2LRS A;  3IWC A;  5T6J A;  1FWL A;  4JI5 I;  3T1Y E;  5AE1 A;  4DR3 E;  1HNX E;  4B3M E;  3JAM Q;  2N3G A;  3QT8 A;  4X64 E;  4Q28 A;  4L5N C;  3OTO E;  2KHX A;  2VQE E;  3IWB A;  4JG4 A;  4JI1 E;  5DNY A;  4JI7 I;  3HPS A;  1Z59 A;  2Z5E A;  4P52 A;  4BC7 A;  3K6Q A;  4TUG A;  3QT5 A;  2BV3 A;  3QT6 A;  3FIG A;  3WU6 A;  2UXD I;  3VK6 A;  4B3S I;  5FLX Q;  1USU A;  5A2Q Q;  4DV6 I;  3LTO A;  5LMU I;  1ZBQ A;  3K85 A;  3ZOQ B;  4URL A;  2JY9 A;  2UUB E;  3QT7 A;  4DV0 E;  1ZM9 A;  3B78 A;  2UU9 E;  3T1H I;  4JI3 I;  2LTR A;  5AE3 A;  1HR0 E;  4YY3 E;  4LF6 I;  4M1K A;  1DQ3 A;  2L3J A;  3ZKD A;  3P06 A;  1N32 E;  4FWG A;  2VQF I;  1H7U A;  4DR7 E;  5L3J A;  4JI0 E;  4USM A;  4LF5 E;  2ZM6 E;  2O1W A;  4DV2 I;  2UUA E;  2GQ0 A;  2R42 A;  4X65 I;  4B3R E;  4N3O A;  4RPF A;  4BS9 A;  2IOP A;  4XTJ A;  2NUF A;  3Q1Q A;  3D4J A;  2LE2 A;  3WU5 A;  3T1Y I;  4DR3 I;  4B3M I;  2GS8 A;  4X64 I;  3M6A A;  1Y4U A;  3Q6N A;  2H36 X;  3OTO I;  1T4L B;  2VQE I;  4F54 A;  2L2M A;  2B7V A;  4JI7 E;  1H73 A;  4JI1 I;  4I3H A;  2ODR D;  2CG9 A;  2HK3 A;  1S4E A;  4DUY E;  2EFG A;  3HQ1 A;  3ZZ0 A;  4FWD A;  1STU A;  4F9C B;  2DSY A;  2HFS A;  2E5L E;  2X36 A;  3AUZ A;  2LJP A;  4GKJ E;  1XMO I;  3B8H A;  2X7I A;  1RRE A;  1KKH A;  1NHJ A;  2A2C A;  4DV6 E;  2NPF A;  1Z5A A;  4USK A;  2O1V A;  1Z5C A;  1N36 E;  4JI4 E;  2UUB I;  4JYA I;  4DV0 I;  4WYQ B;  1WUU A;  3T1H E;  5BR8 I;  4DV3 E;  2UU9 I;  5IWA E;  3ADL A;  2CZ9 A;  2PNL A;  1HR0 I;  4ZVI A;  4MYU A;  4UTG A;  4LF6 E;  2MC6 A;  2VE7 C;  2CGE A;  2UXC E;  2NA2 A;  1ZM4 A;  3WU4 A;  3ZM7 A;  4LF5 I;  2ZM6 I;  2UUA I;  4LF7 I;  2J7K A;  1VIS A;  2ZIT A;  2MC5 A;  1IBK E;  4UT4 A;  4PRX A;  4B3R I;  2OI2 A;  3H4L A;  2V2V A;  3MSW A;  5F3W A;  4JI6 E;  4DPW A;  2HKJ A;  3JU0 A;  4HYM A;  2YZT A;  1HNZ E;  3J81 Q;  2LUP B;  4KHP E;  3JTZ A;  2E1R A;  4IZJ A;  2FV4 B;  1DAR A;  2B3T B;  2KON A;  2M1S A;  4F9A B;  2O1U A;  4DUY I;  3VYX A;  2L2N A;  2RTX A;  1BKN A;  4PRV A;  2WW4 A;  1FJG E;  2Q2E B;  4KQV A;  2E5L I;  3RMP A;  4DPT A;  2LTS A;  4BC9 A;  3PYG A;  1XMO E;  4GKJ I;  1X48 A;  2V87 A;  1O0W A;  5IT9 Q;  2JOX A;  2LUQ A;  4OX9 E;  4DV7 E;  4DR2 E;  1U2R A;  2ZBK B;  4JYA E;  2IHR 1;  3PYD A;  1N36 I;  4JI4 I;  4L8N A;  5BR8 E;  4M30 A;  1N0V C;  4DV3 I;  3B82 A;  5IWA I;  2AJ4 A;  4DUZ I;  1UEK A;  2BM0 A;  2JR1 A;  2G7H A;  4WUC A;  3V2U C;  1ZXN A;  2UXC I;  1PVG A;  4LF4 E;  2M7Q A;  3CWV A;  4JI8 E;  3H09 A;  4IZJ B;  4DR4 E;  1GQE A;  3LPS A;  4DV5 E;  4LF7 E;  2F4V E;  1B63 A;  1I94 E;  1FNM A;  3ADG A;  4BBY A;  5LMN E;  1H7S A;  3V5R A;  4DPX A;  1QU6 A;  1USV A;  3J7A M;  1IBK I;  4KZS A;  1IBL E;  4P7A A;  4GKK E;  3ADJ A;  2L6M A;  2V85 A;  4P78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...