4DR2E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr2E02
4DV4E 2UUBI 4UT4A 1KKHA 1J26A 1RC7A 3Q1QA 4DR7I 2XEXA 3T1HE 4JG4A 4LFCI 1D6TA 3ZM7A 2RSMA 1QZRA 4YHHI 4DV3I 4JI7E 2OI2A 3JAMQ 4DPYA 1N32E 5LMNI 2UXCE 2IHR1 2L33A 2HK2A 2NA2A 3LTOA 2UU9I 4LF8I 4GKJE 4PRVA 2UUCI 1FWLA 1STUA 2E5LI 1HNXI 1O0WA 4LF4E 1S4EA 1HNZI 4JI6E 1XMQE 5FLXC 1ZM3A 4DKKA 1DI2A 4DXLA 3WU5A 5GMDA 2B7VA 5IWAI 4JV5E 1Z5BA 1OJ4A 3B78A 4DR5I 4LF7I 4WUBA 2MDRA 1K47A 1IBKE 4JI0E 4GKKE 2YT4A 3K1JA 1U2RA 4LF5I 4UTGA 1WHNA 4DV2I 1H72C 1ZM9A 2LRSA 1EKZA 4AQYI 4LFAI 3GONA 1Z0GA 3B82A 3VYYA 3WU6A 2UXDI 1KTVA 3QT6A 4X65I 5BR8I 2HKEA 4DR4E 1Z0EA 1ELOA 4FWHA 4X62E 4M30A 4DUZE 1FI4A 1MU5A 2N3HA 1MG7A 4WYQB 2EZ6A 5L3JA 1XNRE 3T1HI 2LBSB 3B8HA 1WHQA 2BM1A 1ZXNA 5GMEA 3D4JA 4P52A 1Z0TA 1EA6A 1N32I 2UXCI 1X47A 1N36I 4KQVA 4HY1A 4LFBE 3LNUA 3ADJA 1T4LB 1YYWA 2DIXA 4LF4I 2A2DA 4DPXA 4DR3I 3T1YE 3VYXA 1KVKA 4KHPE 1IBME 4B3SE 2CZ9A 5LMUI 1XMOE 2L2NA 4OOGC 2UUAE 1YZ9A 2VF3A 2JY9A 1UILA 3PYFA 3J7AG 1T4OA 2HFSA 3PYEA 1IBKI 1Z0WA 4GKKI 4YY3E 4I3HA 3LLHA 2AJ4A 2LJPA 1PIEA 2V34A 1HR0E 2V2VA 4NXME 2HHHE 1WUUA 4JI5E 3J81C 4EMDA 4FN5A 4DV1E 4DR6E 2LTRA 1H74A 1N33E 4X62I 3OTOE 1N0UA 4OX9E 4B3RE 3K17A 2F4VE 2VQEE 1ZXMA 2DB2A 2N3GA 4B3TE 1XNRI 4URLA 4DV6E 2A2CA 1ZM4A 4JI1E 4PU9A 3V5RA 3H4LA 5LL6R 4DV7I 4HACA 1YYOA 4JI2E 1DARA 2R42A 4JI4E 3PYDA 1S16A 4FWDA 1FJGE 4DR2I 1B62A 3CWVA 1EI1A 1VISA 3J80C 4LFBI 3QT8A 1IBLI 2LJHA 4LF9E 4JI8I 3HULA 3T1YI 3V2UC 3ADGA 1IBMI 1XMOI 3PYGA 4DV5I 4DV4I 2ZITA 2RS6A 4LFCE 5IT9C 4DPTA 4USKA 4YY3I 1N34E 1A6FA 4DV3E 1HR0I 1H73A 3ZKBA 5LMNE 4NXMI 2HHHI 4JI5I 3HTXA 1ZM2A 4DV0E 4JI7I 4FW9A 4DR6I 4X66E 2NUFA 1HNZE 4JYAE 1H7UA 3QT7A 1N33I 2LUQA 4GKJI 3ADIA 3OTOI 4OX9I 5A2QC 4LF6E 1UEKA 4B3RI 2DEIA 2F4VI 5CFFE 2ZM6E 4NXNE 2VQEI 3C4BA 2V8PA 1XMQI 4JI6I 4B3TI 2VQFE 2BV3A 1B63A 1HNWE 4JV5I 1ZBTA 4FWGA 1RREA 1Z5AA 3WU4A 4ED4A 4JI0I 4Z7CA 2X7IA 3QT5A 4JI4I 2HK3A 1RQ0A 2WW4A 2NUGA 1NHHA 4X64E 1FJGI 4HXZA 1X49A 5BR8E 5FLXQ 1NHIA 4DR1E 4Z7YA 4LF9I 2V2QA 4K0KE 4M2ZA 3J7Yp 4DR4I 4MYTA 1FKAE 4M1KA 2L3JA 4P7AA 1QU6A 1XNQE 1H7SA 3ZZ0A 1I94E 4DUZI 4ZVIA 3J80Q 1FNMA 4DU8A 1N34I 3J7AM 2Q2EB 4B3ME 1MX0A 4WUCA 2GS8A 1N0VC 1N36E 2DMYA 1J5EE 1RR9A 2UXBE 2DEJA 2LTSA 4DV0I 1PVGA 1X48A 3P1XA 2B3TB 4X66I 1GQEA 4JYAI 4DR3E 5IT9Q 2KHXA 4JI3E 4DUYE 1Z0CA 3WU3A 4WFTA 2X36A 5LMUE 2NPFA 3JAMC 4LF6I 1YYKA 2HFUA 2UUBE 2ZM6I 4NXNI 1Z0VA 4HYMA 4KHPI 2VQFI 2BM0A 1NHJA 4B3SI 3F0NA 4DR7E 1HNWI 2RTXA 1T4NA 2UUAI 2E1RA 1Z59A 1FWKA 4YHHE 3ZKDA 2HKJA 5A2QQ 4X64I 2NUEA 2ZBKB 2EFGA 2JVAA 2L2MA 2UU9E 4LF8E 2J7KA 4DV1I 4DR1I 2UUCE 4K0KI 2E5LE 4R1FA 1HNXE 1XHKA 2R3VA 3M6AA 3ZZUA 1NZ0A 1XNQI 4USMA 1I94I 5IWAE 3ADLA 4PRXA 2B7TA 2V2ZA 4X8WA 3J81Q 4DR5E 4LF7E 4DV7E 3ZZTA 4DV6I 4B3MI 4DU7A 4JI1I 2CPNA 4LF5E 4DV2E 2LUPB 4DR2E 1J5EI 4WUDA 2UXBI 4AQYE 4DPUA 2L3CA 4JI2I 2RS7A 4HACB 4LFAE 4MYUA 1IBLE 4RPFA 1KIJA 3C4TA 4JI8E 2UXDE 3LPSA 4JI3I 4X65E 4DUYI 1Z5CA 1Z0BA 1UHZA 1PKPA 4DPWA 1BKNA 4XTJA 4DV5E 2L2KB
chains in the Genus database with same CATH superfamily
2HJJA 4DV4E 3CDJA 4DMIA 1E3HA 2UUBI 4J3DA 4UT4A 4F6MA 4O43A 2GQ0A 1WRJA 2I13A 1KKHA 1J26A 1RC7A 3Q1QA 3HPSA 4BHBA 2C37B 4HTGA 2ENCA 4OO1C 4DR7I 4OO1D 4WSPA 4KWYA 2XEXA 3T1HE 2YTNA 3NZKA 5JEAA 2ADRA 4WSGA 4JG4A 3MHSC 4NZVA 4N4RB 1F2IG 4LFCI 1EH8A 2EM6A 3P76A 1D6TA 3ZM7A 2RSMA 2PO2B 1QZRA 4YHHI 5IXMB 4DV3I 4JI7E 2EMHA 5IV8B 2OI2A 3JAMQ 4DPYA 1N32E 3UHMA 5LMNI 3F6HA 2UXCE 2IHR1 5EL9A 4WPYA 3M85G 2EPZA 2DGCA 4FK5C 5A6JA 2L33A 2HK2A 2NA2A 3LTOA 2EPMX 2UU9I 4LF8I 2BA1G 2V83A 5C0XF 4GKJE 2G7HA 2LE2A 4PRVA 2UUCI 1FWLA 1STUA 2E5LI 4R2QA 2CVEA 1O0WA 4LF4E 1S4EA 4BC7A 1HNXI 1P47A 1HNZI 4WXCA 4JI6E 5FLXC 3VK6A 2LT7A 4R2CA 1XMQE 1ZM3A 4DKKA 2EN3A 1DI2A 3H1CA 4DXLA 3WU5A 2DLQA 1PDAA 2B7VA 5A6KA 5GMDA 4F9AB 5IWAI 4JV5E 2EL4A 5K36F 1Z5BA 1Z1BA 1OJ4A 4IZJD 4L5NC 3B78A 4DR5I 4LF7I 4WUBA 2EPNA 4R03A 2K7IA 2MDRA 3AV0A 1K47A 1JK1A 1IBKE 4JI0E 4GKKE 2EMBA 2YT4A 3K1JA 2BBGA 1U2RA 5AC4A 2WZOA 2AE8A 4OO1A 2B9DA 5EKWA 4LF5I 2R76A 1YSAC 4UTGA 2YTOA 1TF6A 1WHNA 2EL5A 2EPAA 4DV2I 4IFDF 1H72C 2EPLX 3L7ZB 2LCEA 1KJKA 2NN6E 1ZM9A 3P3GA 2LRSA 1EKZA 4AQYI 4BCAA 2GO3A 1UBDC 2D9HA 4IZKB 4LFAI 3GONA 2EMCA 2EOFA 2WP8B 2I9IA 1E3PA 4R8OA 1RHYA 1OYSA 1Z0GA 2YU5A 3B82A 3VYYA 3RMPA 3WU6A 2EM7A 1BB8A 2GLIA 2UXDI 1B69A 4KZSA 1KTVA 2NABA 3MHHC 3QT6A 4X65I 2EMIA 2PNZB 5BR8I 2HKEA 2WNRB 4DR4E 3P06A 4N3OA 3EPJA 5JEAE 1Z0EA 3EPHA 1ELOA 4FWHA 4L8NA 2NN6B 2YWQA 4X62E 1YHCA 3M85D 3HKMA 2EPRA 4I8OA 4M30A 1HK7A 4DUZE 1FI4A 5AE1A 1A1FA 1YUIA 1PJSA 2V89A 3EPKA 1MU5A 4BA1B 2N3HA 2BA1D 1MG7A 4WYQB 2EZ6A 2JOBA 5L3JA 2WBTA 1XNRE 3T1HI 1WJPA 2JEAA 2LBSB 3B8HA 1WHQA 4ZYEA 4GEQB 4IZJA 3BBGA 2BM1A 2DRPA 1ZXNA 5GMEA 3D4JA 4WX9A 4P52A 1RMDA 4M0VA 2YTFA 5C0XB 1IQOA 1Z0TA 2A25A 1EA6A 1N32I 2UXCI 3Q6MA 1X47A 4IJDA 3BGHA 4KQVA 1N36I 1TF3A 2EJ4A 2EOYA 2Z5CA 4HY1A 5KL3A 2EMKA 2EQ3A 4LFBE 5DNLA 2M4IA 3LNUA 3ADJA 1Y60A 1T4LB 1YYWA 2EE8A 4F6NA 2DIXA 2PO1A 2BR2B 4LF4I 2A2DA 4DPXA 4DR3I 2JP9A 2VF1A 3T1YE 3VYXA 2EMAA 2CTDA 5C0XC 3TQMA 1KVKA 4J8ZA 4KHPE 2Z5EA 4MU0A 1IBME 5C0XD 2EMXA 4B3SE 2CZ9A 4NBQA 2YZTA 4LPFA 5LMUI 2JE6A 2EOIA 2L2NA 1XMOE 1DGCA 2V8QB 2YTEA 2EMYA 4OOGC 2UUAE 1YZ9A 2EOHA 2VF3A 2JY9A 1UILA 1G2DC 2Z5BA 3PYFA 3J7AG 1T4OA 2HFSA 1QNTA 3KWRA 3PYEA 1IBKI 1Z0WA 4GQUA 2EMWA 4GKKI 4YY3E 4I3HA 3LLHA 2AJ4A 5K36C 4FW7A 2LJPA 1PIEA 2NN6F 5K36D 2V34A 4BA2B 1EH6A 1HR0E 2GO4A 4R2SA 2V2VA 4MU1A 1Y5YA 2MDGA 4NXME 2HHHE 2C38B 1WUUA 4JI5E 1NCSA 3JTZA 3J81C 1EH7A 4EMDA 2V88A 2JXPA 2EM8A 5A69A 2O1UA 2CT1A 2EPOA 2BA0G 4IFDC 2RPCA 4O5GA 5AE3A 2CG9A 4FN5A 4DV1E 4IFDD 4GZNC 2EOQA 2KONA 1WXRA 2V86A 5JEAF 4DR6E 4MDTA 2GPIA 2LTRA 1A1GA 2EMGA 1H74A 2EM5A 2RQLA 3EQ1A 1UDNA 2V87A 1N33E 4AIDA 1SR9A 4M9VC 2C39A 4X62I 2EPCA 3OTOE 1N0UA 4OX9E 3THNA 2EN4A 4ISAA 1BBGA 4B3RE 3K17A 5KL2A 2YTPA 1YH8A 3KZZA 2VQEE 2F4VE 1ZXMA 2DB2A 5C0XA 4RHBB 2N3GA 4B3TE 1XNRI 4URLA 2EMLA 4DV6E 2V85A 3QG5C 4NHRA 3K6QA 2A2CA 1ZM4A 4JI1E 4PU9A 4BBYA 3IWBA 3V5RA 3HPZA 3H4LA 3M7ND 4MU3A 2L6MA 5LL6R 4DV7I 3B4TA 1AAYA 4HACA 1YYOA 4JI2E 1DARA 4LCFA 2R42A 1P42A 2M7QA 2IOQA 4JI4E 5K36A 4P78A 5ELWA 1G2FC 5DNXA 3L00A 2ENHA 1S16A 5F3WA 4Q35B 3PYDA 2K4VA 1USVA 4FW3A 4FWDA 3LMLA 3U1KA 1FJGE 4DR2I 2EN8A 1B62A 3C6MA 3IWCA 3J80C 1EI1A 1VISA 2EOJA 3CWVA 4R2RA 4LFBI 3QT8A 1A1JA 4O4KA 4QNJA 4TUGA 1IBLI 2LMZA 2PO0A 3AUZA 4IFDA 2LJHA 4LF9E 2JOXA 3KRNA 3HULA 5DRQA 2EOOA 1BBOA 4JI8I 5ADZA 1A1IA 3V2UC 4AIMA 3T1YI 2HC5A 2EOSA 3ADGA 1USUA 2C37A 1UN6B 2BA0D 1L4SA 4BHCA 2JEBB 1IBMI 1PJTA 3C6KA 1X3CA 1X5WA 2EN6A 1XMOI 2EPUA 2H36X 3PYGA 4DV5I 4LU9A 4DV4I 2ZITA 2RS6A 4LFCE 2JPAA 2CGEA 4MLQA 2PO2A 5IT9C 4DPTA 4USKA 4YY3I 1LLMC 2EN7A 1Y4UA 3M99B 5A6BD 1N34E 1A6FA 4DV3E 1HR0I 2BB8A 1H73A 2KOUA 3ZKBA 5JEAB 5LMNE 4NXMI 2E1MA 3MSWA 2YU8A 2HHHI 4JI5I 2O3ZA 2EOZA 4BS9A 3HTXA 2WBUA 1GZ6A 4LTYA 2NN6C 1SFEA 2EORA 3H09A 1ZM2A 2NN6D 1UDSA 4DV0E 4JI7I 2FGGA 3OMLA 4FW9A 2N8XA 1A1HA 4DR6I 4X66E 2NUFA 1HNZE 4JYAE 1H7UA 3QT7A 1IQSA 1MGTA 4IS1C 2F4VI 2YRHA 1N33I 4ZYDA 1Y6ZA 5JEAC 2LUQA 4GKJI 2EPXA 5JEAD 4MQYA 3ADIA 5T6JA 3OTOI 4OX9I 5LLQA 5A2QC 4LF6E 1UEKA 1KYQA 4B3RI 5KL7A 2DEIA 4F9CB 5CFFE 2ZM6E 4NXNE 2DMIA 3C4BA 2V8PA 2VQEI 1XMQI 4JI6I 3P3CA 5K36E 1YPNA 4WXDA 4B3TI 2VQFE 2BV3A 4OO1E 1AH5A 3BIDA 1B63A 4OZEA 5DRRA 1HNWE 2EM2A 4JV5I 1ZBTA 2YSPA 4FWGA 1RREA 2EM0A 4P7DA 1Z5AA 3L7ZA 3WU4A 2M1SA 1ZU1A 2MKNA 2O1VA 4MLVA 4IZKA 2DSYA 4ED4A 2EPKX 4JI0I 4IFDE 5DNYA 4Z7CA 2WP8A 2X7IA 1NEIA 3QT5A 5A6BA 2EN1A 4JI4I 2HK3A 1RQ0A 2IESA 2ELYA 4R2EA 2WW4A 2NUGA 1NHHA 4OO1B 5AC5A 2EOEA 1R6MA 4X64E 5DROA 1FJGI 3K85A 2PNZA 4HXZA 2WNRA 1X49A 3PS3A 5BR8E 5FLXQ 2ENAA 1ZBQA 2J7JA 3GMEA 2NN6A 4F2JC 1NHIA 4DR1E 4OKGA 4Z7YA 2VESA 4LF9I 2V2QA 1X6FA 2LO3A 4K0KE 4M2ZA 4BA1A 3THOB 2WCC3 3PRYA 3J7Yp 1YFHA 3U1YA 4MYTA 1ZR9A 2MC5A 2O1WA 4R2AA 4FW5A 4DR4I 2R1FA 2YPNA 1FKAE 4M1KA 2L3JA 4P7AA 4F9BB 5KL5A 1QU6A 1X6HA 3IWDA 1T39A 1ZAAC 1XNQE 1H7SA 3ZZ0A 1I94E 4DUZI 2YTQA 4MU4A 3PS1A 4ZVIA 1T38A 3BF2A 3J80Q 1FNMA 4DU8A 3HQ1A 2EWLA 2PO0B 1N34I 2YRMA 4FW6A 2JR1A 3J7AM 2Q2EB 4B3ME 1A1KA 1MX0A 4WUCA 2GS8A 4QNKA 2JEAB 2YTIA 1N0VC 4LCGA 4AM3A 1N36E 5A6AA 2Q8UA 4R2PA 2EMZA 2DMYA 4IZJB 3FIGA 4R2DA 1J5EE 1RR9A 2YTJA 2UXBE 2DEJA 3HXLA 4RH8A 2LTSA 4DV0I 1PVGA 4U3DA 1X48A 3P1XA 2JWOA 2B3TB 2BR2A 4X66I 4BC9A 1GQEA 2EOMA 4JYAI 4DR3E 5IT9Q 3DF6A 2KHXA 4JI3E 2Z5CB 4DUYE 2PNLA 2EM4A 4X9JA 1Z0CA 4TUIA 3WU3A 4WFTA 2LJUA 3JAMC 5LMUE 2X36A 2NPFA 2EQ0A 1YYKA 4LF6I 1N3GA 4OO1F 2M9AA 1UDOA 2HFUA 2UUBE 2ZM6I 4NXNI 3EPLA 2PO1B 1Z0VA 4HYMA 4BMJA 4KHPI 2F8BA 2VQFI 2BM0A 1NHJA 2IOPA 4B3SI 3F0NA 4LOMA 4BA2A 2PNMA 4DR7E 1VI7A 3P3EA 4Q28A 1HNWI 2EOXA 2RTXA 2JE6B 1T4NA 5AASA 2EQ1A 2GHFA 1IMUA 2JT2A 2C38A 2E1RA 2UUAI 2VRDA 1UDQA 3VHTB 2Z5BB 1Z59A 4O24A 4YHHE 1FWKA 3GLLA 2HKJA 3ZKDA 2RSIA 3Q6NA 2CSHA 1OYPA 5A2QQ 2E72A 2EM9A 2NUEA 1DQ3A 3GCMA 4X64I 1TN9A 1X6EA 1Y4SA 3DD6A 4FW4A 2EM3A 2EPPA 2EFGA 2ZBKB 2JVAA 2FV4B 2L2MA 2UU9E 4LF8E 1R6LA 2ELZA 2WBSA 2J7KA 4DV1I 4DR1I 3KZYA 2EN2A 2YTGA 2DLKA 1A1LA 2IERA 5DRPA 2L92A 2UUCE 2L8TA 4K0KI 2E5LE 4R1FA 5C0XE 1HNXE 1XHKA 2R3VA 3M6AA 3ZZUA 4HEIA 2MKDA 1NZ0A 3CDIA 2C39B 1PJQA 4ZYGA 3JU0A 5KL6A 1XNQI 2F1DA 4USMA 1I94I 5IWAE 1YUJA 3ADLA 4PRXA 2B7TA 2YTDA 4X8WA 3UK3C 2MC6A 2V2ZA 4DR5E 2LVHA 3DJWA 2FTXB 4LF7E 3PS2A 4LCHA 3J81Q 4DV7E 5FWKA 2YRKA 2EP3A 3ZZTA 4DV6I 4B3MI 4DU7A 4JI1I 2CPNA 1MEYC 2ODRC 3F6GA 4F54A 4LF5E 2VE7C 2YSOA 2PRTA 2ODRD 4IS9A 4DV2E 2LUPB 4DR2E 5AE2A 1J5EI 2EMFA 4WUDA 2UXBI 2LV2A 4AQYE 3ZOQB 4DPUA 2L3CA 2HGHA 2EL6A 4JI2I 2RS7A 3ECRA 4LFAE 1OYRA 4HACB 4MYUA 1IBLE 1XXEA 4ZYHA 2J65A 1JK2A 2O1TA 4RPFA 5K36B 4U3BA 1KIJA 3C4TA 4JI8E 2UXDE 3HJCA 2JEBA 3LPSA 4JI3I 4X65E 3M7NG 4DUYI 1Z5CA 1Z0BA 5KL4A 1UHZA 1PKPA 4DPWA 1GTKA 5TSEA 2JYAA 1BKNA 4XTJA 4DV5E 2L2KB 4IFDB
chains in the Genus database with same CATH topology
4DV4E 2UUBI 4DMIA 4UT4A 2GQ0A 1KKHA 1J26A 1RC7A 3Q1QA 3HPSA 4DR7I 4WSPA 2XEXA 3T1HE 4JG4A 4LFCI 1D6TA 3ZM7A 2RSMA 1QZRA 4YHHI 4DV3I 4JI7E 2OI2A 3JAMQ 4DPYA 1N32E 5LMNI 3F6HA 2UXCE 2IHR1 4WPYA 2L33A 2HK2A 2NA2A 3LTOA 2UU9I 4LF8I 2V83A 4GKJE 2G7HA 2LE2A 4PRVA 2UUCI 1FWLA 1STUA 2E5LI 1HNXI 1O0WA 4LF4E 1S4EA 4BC7A 1HNZI 4JI6E 5FLXC 3VK6A 1XMQE 1ZM3A 4DKKA 1DI2A 4DXLA 3WU5A 5GMDA 2B7VA 4F9AB 5IWAI 4JV5E 1Z5BA 1OJ4A 4IZJD 4L5NC 3B78A 4DR5I 4LF7I 4WUBA 4R03A 2MDRA 3AV0A 1K47A 1IBKE 4JI0E 4GKKE 2YT4A 3K1JA 1U2RA 2WZOA 2B9DA 4LF5I 4UTGA 1WHNA 4DV2I 1H72C 1ZM9A 2LRSA 1EKZA 4AQYI 4BCAA 4IZKB 4LFAI 3GONA 1Z0GA 4R8OA 3B82A 3VYYA 3RMPA 3WU6A 2UXDI 4KZSA 1KTVA 3QT6A 4X65I 5BR8I 2HKEA 3P06A 4DR4E 4N3OA 1Z0EA 1ELOA 4FWHA 4L8NA 4X62E 4I8OA 4M30A 1HK7A 4DUZE 1FI4A 5AE1A 1MU5A 2V89A 2N3HA 1MG7A 4WYQB 2EZ6A 2JOBA 5L3JA 1XNRE 3T1HI 2LBSB 3B8HA 1WHQA 4GEQB 4IZJA 2BM1A 1ZXNA 5GMEA 3D4JA 4P52A 4M0VA 1Z0TA 1EA6A 1N32I 2UXCI 3Q6MA 1X47A 1N36I 4KQVA 2Z5CA 4HY1A 4LFBE 2M4IA 3LNUA 3ADJA 1T4LB 1YYWA 2DIXA 4LF4I 2A2DA 4DPXA 4DR3I 2VF1A 3T1YE 3VYXA 1KVKA 4J8ZA 4KHPE 2Z5EA 1IBME 4B3SE 2CZ9A 2YZTA 5LMUI 1XMOE 2L2NA 2V8QB 4OOGC 2UUAE 1YZ9A 2VF3A 2JY9A 1UILA 2Z5BA 3PYFA 3J7AG 1T4OA 2HFSA 3KWRA 3PYEA 1IBKI 1Z0WA 4GKKI 4YY3E 4I3HA 3LLHA 2AJ4A 2LJPA 1PIEA 2V34A 1HR0E 2V2VA 4NXME 2HHHE 1WUUA 4JI5E 3JTZA 3J81C 4EMDA 2V88A 2O1UA 5AE3A 2CG9A 4FN5A 4DV1E 2KONA 1WXRA 2V86A 4DR6E 2LTRA 1H74A 2V87A 1N33E 1SR9A 4X62I 3OTOE 1N0UA 4OX9E 4B3RE 3K17A 2F4VE 2VQEE 1ZXMA 2DB2A 2N3GA 4B3TE 1XNRI 4URLA 4DV6E 2V85A 3K6QA 2A2CA 1ZM4A 4JI1E 4PU9A 4BBYA 3IWBA 3V5RA 3HPZA 3H4LA 2L6MA 5LL6R 4DV7I 4HACA 1YYOA 4JI2E 1DARA 2R42A 2IOQA 2M7QA 4JI4E 4P78A 3PYDA 1S16A 5F3WA 2K4VA 1USVA 4FWDA 3LMLA 1FJGE 4DR2I 1B62A 3IWCA 3CWVA 3J80C 1EI1A 1VISA 4LFBI 3QT8A 4TUGA 1IBLI 2LMZA 3AUZA 2LJHA 4LF9E 2JOXA 4JI8I 3HULA 3T1YI 5ADZA 3V2UC 3ADGA 1USUA 1IBMI 1XMOI 2H36X 3PYGA 4DV5I 4LU9A 4DV4I 2ZITA 2RS6A 4LFCE 2CGEA 5IT9C 4DPTA 4USKA 4YY3I 1Y4UA 1N34E 1A6FA 4DV3E 1HR0I 1H73A 2KOUA 3ZKBA 5LMNE 4NXMI 2E1MA 3MSWA 2HHHI 4JI5I 4BS9A 3HTXA 1GZ6A 4LTYA 3H09A 1ZM2A 4DV0E 4JI7I 2FGGA 3OMLA 4FW9A 4DR6I 4X66E 2NUFA 1HNZE 4JYAE 1H7UA 3QT7A 1N33I 1Y6ZA 2LUQA 4GKJI 3ADIA 5T6JA 3OTOI 4OX9I 5A2QC 4LF6E 1UEKA 4B3RI 2DEIA 4F9CB 5CFFE 2ZM6E 4NXNE 2VQEI 3C4BA 2V8PA 1XMQI 4JI6I 2F4VI 4B3TI 2VQFE 2BV3A 1B63A 1HNWE 4JV5I 1ZBTA 4FWGA 1RREA 4P7DA 1Z5AA 3WU4A 2M1SA 2O1VA 4IZKA 2DSYA 4ED4A 4JI0I 5DNYA 4Z7CA 2X7IA 3QT5A 4JI4I 2HK3A 1RQ0A 2WW4A 2NUGA 1NHHA 4X64E 1FJGI 3K85A 4HXZA 1X49A 5BR8E 5FLXQ 1ZBQA 1NHIA 4DR1E 4Z7YA 4LF9I 2V2QA 4K0KE 4M2ZA 3PRYA 3J7Yp 4DR4I 4MYTA 2MC5A 2O1WA 1FKAE 4M1KA 2L3JA 4P7AA 4F9BB 1QU6A 3IWDA 1XNQE 1H7SA 3ZZ0A 1I94E 4DUZI 4ZVIA 3J80Q 1FNMA 4DU8A 3HQ1A 2EWLA 1N34I 2JR1A 3J7AM 2Q2EB 4B3ME 1MX0A 4WUCA 2GS8A 1N0VC 1N36E 2DMYA 4IZJB 3FIGA 1J5EE 1RR9A 2UXBE 2DEJA 3HXLA 2LTSA 4DV0I 1PVGA 1X48A 3P1XA 2JWOA 2B3TB 4X66I 4BC9A 1GQEA 4JYAI 4DR3E 5IT9Q 3DF6A 2KHXA 4JI3E 2Z5CB 4DUYE 2PNLA 1Z0CA 4TUIA 3WU3A 4WFTA 2X36A 3JAMC 5LMUE 2NPFA 4LF6I 1YYKA 2HFUA 2UUBE 2ZM6I 4NXNI 1Z0VA 4HYMA 4BMJA 4KHPI 2F8BA 2VQFI 2BM0A 1NHJA 2IOPA 4B3SI 3F0NA 2PNMA 4DR7E 4Q28A 1HNWI 2RTXA 1T4NA 5AASA 2UUAI 2E1RA 2Z5BB 1Z59A 1FWKA 4YHHE 3ZKDA 2HKJA 3Q6NA 5A2QQ 4X64I 2NUEA 1DQ3A 1Y4SA 2ZBKB 2EFGA 2JVAA 2L2MA 2FV4B 2UU9E 4LF8E 2J7KA 4DV1I 4DR1I 2L92A 2UUCE 2L8TA 4K0KI 2E5LE 4R1FA 1HNXE 1XHKA 2R3VA 3M6AA 3ZZUA 1NZ0A 3JU0A 1XNQI 4USMA 1I94I 5IWAE 3ADLA 4PRXA 2B7TA 2V2ZA 4X8WA 2MC6A 3J81Q 4DR5E 4LF7E 3DJWA 2FTXB 4DV7E 5FWKA 3ZZTA 4DV6I 4B3MI 4DU7A 4JI1I 2CPNA 2ODRC 3F6GA 4F54A 4LF5E 2VE7C 2ODRD 4DV2E 2LUPB 4DR2E 5AE2A 1J5EI 4WUDA 2UXBI 4AQYE 3ZOQB 4DPUA 2L3CA 4JI2I 2RS7A 4HACB 4LFAE 4MYUA 1IBLE 2O1TA 4RPFA 1KIJA 3C4TA 4JI8E 2UXDE 3HJCA 3LPSA 4JI3I 4X65E 4DUYI 1Z5CA 1Z0BA 1UHZA 1PKPA 4DPWA 1BKNA 4XTJA 4DV5E 2L2KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 E;  2UUB I;  4UT4 A;  1KKH A;  1J26 A;  1RC7 A;  3Q1Q A;  4DR7 I;  2XEX A;  3T1H E;  4JG4 A;  4LFC I;  1D6T A;  3ZM7 A;  2RSM A;  1QZR A;  4YHH I;  4DV3 I;  4JI7 E;  2OI2 A;  3JAM Q;  4DPY A;  1N32 E;  5LMN I;  2UXC E;  2IHR 1;  2L33 A;  2HK2 A;  2NA2 A;  3LTO A;  2UU9 I;  4LF8 I;  4GKJ E;  4PRV A;  2UUC I;  1FWL A;  1STU A;  2E5L I;  1HNX I;  1O0W A;  4LF4 E;  1S4E A;  1HNZ I;  4JI6 E;  1XMQ E;  5FLX C;  1ZM3 A;  4DKK A;  1DI2 A;  4DXL A;  3WU5 A;  5GMD A;  2B7V A;  5IWA I;  4JV5 E;  1Z5B A;  1OJ4 A;  3B78 A;  4DR5 I;  4LF7 I;  4WUB A;  2MDR A;  1K47 A;  1IBK E;  4JI0 E;  4GKK E;  2YT4 A;  3K1J A;  1U2R A;  4LF5 I;  4UTG A;  1WHN A;  4DV2 I;  1H72 C;  1ZM9 A;  2LRS A;  1EKZ A;  4AQY I;  4LFA I;  3GON A;  1Z0G A;  3B82 A;  3VYY A;  3WU6 A;  2UXD I;  1KTV A;  3QT6 A;  4X65 I;  5BR8 I;  2HKE A;  4DR4 E;  1Z0E A;  1ELO A;  4FWH A;  4X62 E;  4M30 A;  4DUZ E;  1FI4 A;  1MU5 A;  2N3H A;  1MG7 A;  4WYQ B;  2EZ6 A;  5L3J A;  1XNR E;  3T1H I;  2LBS B;  3B8H A;  1WHQ A;  2BM1 A;  1ZXN A;  5GME A;  3D4J A;  4P52 A;  1Z0T A;  1EA6 A;  1N32 I;  2UXC I;  1X47 A;  1N36 I;  4KQV A;  4HY1 A;  4LFB E;  3LNU A;  3ADJ A;  1T4L B;  1YYW A;  2DIX A;  4LF4 I;  2A2D A;  4DPX A;  4DR3 I;  3T1Y E;  3VYX A;  1KVK A;  4KHP E;  1IBM E;  4B3S E;  2CZ9 A;  5LMU I;  1XMO E;  2L2N A;  4OOG C;  2UUA E;  1YZ9 A;  2VF3 A;  2JY9 A;  1UIL A;  3PYF A;  3J7A G;  1T4O A;  2HFS A;  3PYE A;  1IBK I;  1Z0W A;  4GKK I;  4YY3 E;  4I3H A;  3LLH A;  2AJ4 A;  2LJP A;  1PIE A;  2V34 A;  1HR0 E;  2V2V A;  4NXM E;  2HHH E;  1WUU A;  4JI5 E;  3J81 C;  4EMD A;  4FN5 A;  4DV1 E;  4DR6 E;  2LTR A;  1H74 A;  1N33 E;  4X62 I;  3OTO E;  1N0U A;  4OX9 E;  4B3R E;  3K17 A;  2F4V E;  2VQE E;  1ZXM A;  2DB2 A;  2N3G A;  4B3T E;  1XNR I;  4URL A;  4DV6 E;  2A2C A;  1ZM4 A;  4JI1 E;  4PU9 A;  3V5R A;  3H4L A;  5LL6 R;  4DV7 I;  4HAC A;  1YYO A;  4JI2 E;  1DAR A;  2R42 A;  4JI4 E;  3PYD A;  1S16 A;  4FWD A;  1FJG E;  4DR2 I;  1B62 A;  3CWV A;  1EI1 A;  1VIS A;  3J80 C;  4LFB I;  3QT8 A;  1IBL I;  2LJH A;  4LF9 E;  4JI8 I;  3HUL A;  3T1Y I;  3V2U C;  3ADG A;  1IBM I;  1XMO I;  3PYG A;  4DV5 I;  4DV4 I;  2ZIT A;  2RS6 A;  4LFC E;  5IT9 C;  4DPT A;  4USK A;  4YY3 I;  1N34 E;  1A6F A;  4DV3 E;  1HR0 I;  1H73 A;  3ZKB A;  5LMN E;  4NXM I;  2HHH I;  4JI5 I;  3HTX A;  1ZM2 A;  4DV0 E;  4JI7 I;  4FW9 A;  4DR6 I;  4X66 E;  2NUF A;  1HNZ E;  4JYA E;  1H7U A;  3QT7 A;  1N33 I;  2LUQ A;  4GKJ I;  3ADI A;  3OTO I;  4OX9 I;  5A2Q C;  4LF6 E;  1UEK A;  4B3R I;  2DEI A;  2F4V I;  5CFF E;  2ZM6 E;  4NXN E;  2VQE I;  3C4B A;  2V8P A;  1XMQ I;  4JI6 I;  4B3T I;  2VQF E;  2BV3 A;  1B63 A;  1HNW E;  4JV5 I;  1ZBT A;  4FWG A;  1RRE A;  1Z5A A;  3WU4 A;  4ED4 A;  4JI0 I;  4Z7C A;  2X7I A;  3QT5 A;  4JI4 I;  2HK3 A;  1RQ0 A;  2WW4 A;  2NUG A;  1NHH A;  4X64 E;  1FJG I;  4HXZ A;  1X49 A;  5BR8 E;  5FLX Q;  1NHI A;  4DR1 E;  4Z7Y A;  4LF9 I;  2V2Q A;  4K0K E;  4M2Z A;  3J7Y p;  4DR4 I;  4MYT A;  1FKA E;  4M1K A;  2L3J A;  4P7A A;  1QU6 A;  1XNQ E;  1H7S A;  3ZZ0 A;  1I94 E;  4DUZ I;  4ZVI A;  3J80 Q;  1FNM A;  4DU8 A;  1N34 I;  3J7A M;  2Q2E B;  4B3M E;  1MX0 A;  4WUC A;  2GS8 A;  1N0V C;  1N36 E;  2DMY A;  1J5E E;  1RR9 A;  2UXB E;  2DEJ A;  2LTS A;  4DV0 I;  1PVG A;  1X48 A;  3P1X A;  2B3T B;  4X66 I;  1GQE A;  4JYA I;  4DR3 E;  5IT9 Q;  2KHX A;  4JI3 E;  4DUY E;  1Z0C A;  3WU3 A;  4WFT A;  2X36 A;  5LMU E;  2NPF A;  3JAM C;  4LF6 I;  1YYK A;  2HFU A;  2UUB E;  2ZM6 I;  4NXN I;  1Z0V A;  4HYM A;  4KHP I;  2VQF I;  2BM0 A;  1NHJ A;  4B3S I;  3F0N A;  4DR7 E;  1HNW I;  2RTX A;  1T4N A;  2UUA I;  2E1R A;  1Z59 A;  1FWK A;  4YHH E;  3ZKD A;  2HKJ A;  5A2Q Q;  4X64 I;  2NUE A;  2ZBK B;  2EFG A;  2JVA A;  2L2M A;  2UU9 E;  4LF8 E;  2J7K A;  4DV1 I;  4DR1 I;  2UUC E;  4K0K I;  2E5L E;  4R1F A;  1HNX E;  1XHK A;  2R3V A;  3M6A A;  3ZZU A;  1NZ0 A;  1XNQ I;  4USM A;  1I94 I;  5IWA E;  3ADL A;  4PRX A;  2B7T A;  2V2Z A;  4X8W A;  3J81 Q;  4DR5 E;  4LF7 E;  4DV7 E;  3ZZT A;  4DV6 I;  4B3M I;  4DU7 A;  4JI1 I;  2CPN A;  4LF5 E;  4DV2 E;  2LUP B;  4DR2 E;  1J5E I;  4WUD A;  2UXB I;  4AQY E;  4DPU A;  2L3C A;  4JI2 I;  2RS7 A;  4HAC B;  4LFA E;  4MYU A;  1IBL E;  4RPF A;  1KIJ A;  3C4T A;  4JI8 E;  2UXD E;  3LPS A;  4JI3 I;  4X65 E;  4DUY I;  1Z5C A;  1Z0B A;  1UHZ A;  1PKP A;  4DPW A;  1BKN A;  4XTJ A;  4DV5 E;  2L2K B; 
#chains in the Genus database with same CATH topology
 2HJJ A;  4DV4 E;  3CDJ A;  4DMI A;  1E3H A;  2UUB I;  4J3D A;  4UT4 A;  4F6M A;  4O43 A;  2GQ0 A;  1WRJ A;  2I13 A;  1KKH A;  1J26 A;  1RC7 A;  3Q1Q A;  3HPS A;  4BHB A;  2C37 B;  4HTG A;  2ENC A;  4OO1 C;  4DR7 I;  4OO1 D;  4WSP A;  4KWY A;  2XEX A;  3T1H E;  2YTN A;  3NZK A;  5JEA A;  2ADR A;  4WSG A;  4JG4 A;  3MHS C;  4NZV A;  4N4R B;  1F2I G;  4LFC I;  1EH8 A;  2EM6 A;  3P76 A;  1D6T A;  3ZM7 A;  2RSM A;  2PO2 B;  1QZR A;  4YHH I;  5IXM B;  4DV3 I;  4JI7 E;  2EMH A;  5IV8 B;  2OI2 A;  3JAM Q;  4DPY A;  1N32 E;  3UHM A;  5LMN I;  3F6H A;  2UXC E;  2IHR 1;  5EL9 A;  4WPY A;  3M85 G;  2EPZ A;  2DGC A;  4FK5 C;  5A6J A;  2L33 A;  2HK2 A;  2NA2 A;  3LTO A;  2EPM X;  2UU9 I;  4LF8 I;  2BA1 G;  2V83 A;  5C0X F;  4GKJ E;  2G7H A;  2LE2 A;  4PRV A;  2UUC I;  1FWL A;  1STU A;  2E5L I;  4R2Q A;  2CVE A;  1O0W A;  4LF4 E;  1S4E A;  4BC7 A;  1HNX I;  1P47 A;  1HNZ I;  4WXC A;  4JI6 E;  5FLX C;  3VK6 A;  2LT7 A;  4R2C A;  1XMQ E;  1ZM3 A;  4DKK A;  2EN3 A;  1DI2 A;  3H1C A;  4DXL A;  3WU5 A;  2DLQ A;  1PDA A;  2B7V A;  5A6K A;  5GMD A;  4F9A B;  5IWA I;  4JV5 E;  2EL4 A;  5K36 F;  1Z5B A;  1Z1B A;  1OJ4 A;  4IZJ D;  4L5N C;  3B78 A;  4DR5 I;  4LF7 I;  4WUB A;  2EPN A;  4R03 A;  2K7I A;  2MDR A;  3AV0 A;  1K47 A;  1JK1 A;  1IBK E;  4JI0 E;  4GKK E;  2EMB A;  2YT4 A;  3K1J A;  2BBG A;  1U2R A;  5AC4 A;  2WZO A;  2AE8 A;  4OO1 A;  2B9D A;  5EKW A;  4LF5 I;  2R76 A;  1YSA C;  4UTG A;  2YTO A;  1TF6 A;  1WHN A;  2EL5 A;  2EPA A;  4DV2 I;  4IFD F;  1H72 C;  2EPL X;  3L7Z B;  2LCE A;  1KJK A;  2NN6 E;  1ZM9 A;  3P3G A;  2LRS A;  1EKZ A;  4AQY I;  4BCA A;  2GO3 A;  1UBD C;  2D9H A;  4IZK B;  4LFA I;  3GON A;  2EMC A;  2EOF A;  2WP8 B;  2I9I A;  1E3P A;  4R8O A;  1RHY A;  1OYS A;  1Z0G A;  2YU5 A;  3B82 A;  3VYY A;  3RMP A;  3WU6 A;  2EM7 A;  1BB8 A;  2GLI A;  2UXD I;  1B69 A;  4KZS A;  1KTV A;  2NAB A;  3MHH C;  3QT6 A;  4X65 I;  2EMI A;  2PNZ B;  5BR8 I;  2HKE A;  2WNR B;  4DR4 E;  3P06 A;  4N3O A;  3EPJ A;  5JEA E;  1Z0E A;  3EPH A;  1ELO A;  4FWH A;  4L8N A;  2NN6 B;  2YWQ A;  4X62 E;  1YHC A;  3M85 D;  3HKM A;  2EPR A;  4I8O A;  4M30 A;  1HK7 A;  4DUZ E;  1FI4 A;  5AE1 A;  1A1F A;  1YUI A;  1PJS A;  2V89 A;  3EPK A;  1MU5 A;  4BA1 B;  2N3H A;  2BA1 D;  1MG7 A;  4WYQ B;  2EZ6 A;  2JOB A;  5L3J A;  2WBT A;  1XNR E;  3T1H I;  1WJP A;  2JEA A;  2LBS B;  3B8H A;  1WHQ A;  4ZYE A;  4GEQ B;  4IZJ A;  3BBG A;  2BM1 A;  2DRP A;  1ZXN A;  5GME A;  3D4J A;  4WX9 A;  4P52 A;  1RMD A;  4M0V A;  2YTF A;  5C0X B;  1IQO A;  1Z0T A;  2A25 A;  1EA6 A;  1N32 I;  2UXC I;  3Q6M A;  1X47 A;  4IJD A;  3BGH A;  4KQV A;  1N36 I;  1TF3 A;  2EJ4 A;  2EOY A;  2Z5C A;  4HY1 A;  5KL3 A;  2EMK A;  2EQ3 A;  4LFB E;  5DNL A;  2M4I A;  3LNU A;  3ADJ A;  1Y60 A;  1T4L B;  1YYW A;  2EE8 A;  4F6N A;  2DIX A;  2PO1 A;  2BR2 B;  4LF4 I;  2A2D A;  4DPX A;  4DR3 I;  2JP9 A;  2VF1 A;  3T1Y E;  3VYX A;  2EMA A;  2CTD A;  5C0X C;  3TQM A;  1KVK A;  4J8Z A;  4KHP E;  2Z5E A;  4MU0 A;  1IBM E;  5C0X D;  2EMX A;  4B3S E;  2CZ9 A;  4NBQ A;  2YZT A;  4LPF A;  5LMU I;  2JE6 A;  2EOI A;  2L2N A;  1XMO E;  1DGC A;  2V8Q B;  2YTE A;  2EMY A;  4OOG C;  2UUA E;  1YZ9 A;  2EOH A;  2VF3 A;  2JY9 A;  1UIL A;  1G2D C;  2Z5B A;  3PYF A;  3J7A G;  1T4O A;  2HFS A;  1QNT A;  3KWR A;  3PYE A;  1IBK I;  1Z0W A;  4GQU A;  2EMW A;  4GKK I;  4YY3 E;  4I3H A;  3LLH A;  2AJ4 A;  5K36 C;  4FW7 A;  2LJP A;  1PIE A;  2NN6 F;  5K36 D;  2V34 A;  4BA2 B;  1EH6 A;  1HR0 E;  2GO4 A;  4R2S A;  2V2V A;  4MU1 A;  1Y5Y A;  2MDG A;  4NXM E;  2HHH E;  2C38 B;  1WUU A;  4JI5 E;  1NCS A;  3JTZ A;  3J81 C;  1EH7 A;  4EMD A;  2V88 A;  2JXP A;  2EM8 A;  5A69 A;  2O1U A;  2CT1 A;  2EPO A;  2BA0 G;  4IFD C;  2RPC A;  4O5G A;  5AE3 A;  2CG9 A;  4FN5 A;  4DV1 E;  4IFD D;  4GZN C;  2EOQ A;  2KON A;  1WXR A;  2V86 A;  5JEA F;  4DR6 E;  4MDT A;  2GPI A;  2LTR A;  1A1G A;  2EMG A;  1H74 A;  2EM5 A;  2RQL A;  3EQ1 A;  1UDN A;  2V87 A;  1N33 E;  4AID A;  1SR9 A;  4M9V C;  2C39 A;  4X62 I;  2EPC A;  3OTO E;  1N0U A;  4OX9 E;  3THN A;  2EN4 A;  4ISA A;  1BBG A;  4B3R E;  3K17 A;  5KL2 A;  2YTP A;  1YH8 A;  3KZZ A;  2VQE E;  2F4V E;  1ZXM A;  2DB2 A;  5C0X A;  4RHB B;  2N3G A;  4B3T E;  1XNR I;  4URL A;  2EML A;  4DV6 E;  2V85 A;  3QG5 C;  4NHR A;  3K6Q A;  2A2C A;  1ZM4 A;  4JI1 E;  4PU9 A;  4BBY A;  3IWB A;  3V5R A;  3HPZ A;  3H4L A;  3M7N D;  4MU3 A;  2L6M A;  5LL6 R;  4DV7 I;  3B4T A;  1AAY A;  4HAC A;  1YYO A;  4JI2 E;  1DAR A;  4LCF A;  2R42 A;  1P42 A;  2M7Q A;  2IOQ A;  4JI4 E;  5K36 A;  4P78 A;  5ELW A;  1G2F C;  5DNX A;  3L00 A;  2ENH A;  1S16 A;  5F3W A;  4Q35 B;  3PYD A;  2K4V A;  1USV A;  4FW3 A;  4FWD A;  3LML A;  3U1K A;  1FJG E;  4DR2 I;  2EN8 A;  1B62 A;  3C6M A;  3IWC A;  3J80 C;  1EI1 A;  1VIS A;  2EOJ A;  3CWV A;  4R2R A;  4LFB I;  3QT8 A;  1A1J A;  4O4K A;  4QNJ A;  4TUG A;  1IBL I;  2LMZ A;  2PO0 A;  3AUZ A;  4IFD A;  2LJH A;  4LF9 E;  2JOX A;  3KRN A;  3HUL A;  5DRQ A;  2EOO A;  1BBO A;  4JI8 I;  5ADZ A;  1A1I A;  3V2U C;  4AIM A;  3T1Y I;  2HC5 A;  2EOS A;  3ADG A;  1USU A;  2C37 A;  1UN6 B;  2BA0 D;  1L4S A;  4BHC A;  2JEB B;  1IBM I;  1PJT A;  3C6K A;  1X3C A;  1X5W A;  2EN6 A;  1XMO I;  2EPU A;  2H36 X;  3PYG A;  4DV5 I;  4LU9 A;  4DV4 I;  2ZIT A;  2RS6 A;  4LFC E;  2JPA A;  2CGE A;  4MLQ A;  2PO2 A;  5IT9 C;  4DPT A;  4USK A;  4YY3 I;  1LLM C;  2EN7 A;  1Y4U A;  3M99 B;  5A6B D;  1N34 E;  1A6F A;  4DV3 E;  1HR0 I;  2BB8 A;  1H73 A;  2KOU A;  3ZKB A;  5JEA B;  5LMN E;  4NXM I;  2E1M A;  3MSW A;  2YU8 A;  2HHH I;  4JI5 I;  2O3Z A;  2EOZ A;  4BS9 A;  3HTX A;  2WBU A;  1GZ6 A;  4LTY A;  2NN6 C;  1SFE A;  2EOR A;  3H09 A;  1ZM2 A;  2NN6 D;  1UDS A;  4DV0 E;  4JI7 I;  2FGG A;  3OML A;  4FW9 A;  2N8X A;  1A1H A;  4DR6 I;  4X66 E;  2NUF A;  1HNZ E;  4JYA E;  1H7U A;  3QT7 A;  1IQS A;  1MGT A;  4IS1 C;  2F4V I;  2YRH A;  1N33 I;  4ZYD A;  1Y6Z A;  5JEA C;  2LUQ A;  4GKJ I;  2EPX A;  5JEA D;  4MQY A;  3ADI A;  5T6J A;  3OTO I;  4OX9 I;  5LLQ A;  5A2Q C;  4LF6 E;  1UEK A;  1KYQ A;  4B3R I;  5KL7 A;  2DEI A;  4F9C B;  5CFF E;  2ZM6 E;  4NXN E;  2DMI A;  3C4B A;  2V8P A;  2VQE I;  1XMQ I;  4JI6 I;  3P3C A;  5K36 E;  1YPN A;  4WXD A;  4B3T I;  2VQF E;  2BV3 A;  4OO1 E;  1AH5 A;  3BID A;  1B63 A;  4OZE A;  5DRR A;  1HNW E;  2EM2 A;  4JV5 I;  1ZBT A;  2YSP A;  4FWG A;  1RRE A;  2EM0 A;  4P7D A;  1Z5A A;  3L7Z A;  3WU4 A;  2M1S A;  1ZU1 A;  2MKN A;  2O1V A;  4MLV A;  4IZK A;  2DSY A;  4ED4 A;  2EPK X;  4JI0 I;  4IFD E;  5DNY A;  4Z7C A;  2WP8 A;  2X7I A;  1NEI A;  3QT5 A;  5A6B A;  2EN1 A;  4JI4 I;  2HK3 A;  1RQ0 A;  2IES A;  2ELY A;  4R2E A;  2WW4 A;  2NUG A;  1NHH A;  4OO1 B;  5AC5 A;  2EOE A;  1R6M A;  4X64 E;  5DRO A;  1FJG I;  3K85 A;  2PNZ A;  4HXZ A;  2WNR A;  1X49 A;  3PS3 A;  5BR8 E;  5FLX Q;  2ENA A;  1ZBQ A;  2J7J A;  3GME A;  2NN6 A;  4F2J C;  1NHI A;  4DR1 E;  4OKG A;  4Z7Y A;  2VES A;  4LF9 I;  2V2Q A;  1X6F A;  2LO3 A;  4K0K E;  4M2Z A;  4BA1 A;  3THO B;  2WCC 3;  3PRY A;  3J7Y p;  1YFH A;  3U1Y A;  4MYT A;  1ZR9 A;  2MC5 A;  2O1W A;  4R2A A;  4FW5 A;  4DR4 I;  2R1F A;  2YPN A;  1FKA E;  4M1K A;  2L3J A;  4P7A A;  4F9B B;  5KL5 A;  1QU6 A;  1X6H A;  3IWD A;  1T39 A;  1ZAA C;  1XNQ E;  1H7S A;  3ZZ0 A;  1I94 E;  4DUZ I;  2YTQ A;  4MU4 A;  3PS1 A;  4ZVI A;  1T38 A;  3BF2 A;  3J80 Q;  1FNM A;  4DU8 A;  3HQ1 A;  2EWL A;  2PO0 B;  1N34 I;  2YRM A;  4FW6 A;  2JR1 A;  3J7A M;  2Q2E B;  4B3M E;  1A1K A;  1MX0 A;  4WUC A;  2GS8 A;  4QNK A;  2JEA B;  2YTI A;  1N0V C;  4LCG A;  4AM3 A;  1N36 E;  5A6A A;  2Q8U A;  4R2P A;  2EMZ A;  2DMY A;  4IZJ B;  3FIG A;  4R2D A;  1J5E E;  1RR9 A;  2YTJ A;  2UXB E;  2DEJ A;  3HXL A;  4RH8 A;  2LTS A;  4DV0 I;  1PVG A;  4U3D A;  1X48 A;  3P1X A;  2JWO A;  2B3T B;  2BR2 A;  4X66 I;  4BC9 A;  1GQE A;  2EOM A;  4JYA I;  4DR3 E;  5IT9 Q;  3DF6 A;  2KHX A;  4JI3 E;  2Z5C B;  4DUY E;  2PNL A;  2EM4 A;  4X9J A;  1Z0C A;  4TUI A;  3WU3 A;  4WFT A;  2LJU A;  3JAM C;  5LMU E;  2X36 A;  2NPF A;  2EQ0 A;  1YYK A;  4LF6 I;  1N3G A;  4OO1 F;  2M9A A;  1UDO A;  2HFU A;  2UUB E;  2ZM6 I;  4NXN I;  3EPL A;  2PO1 B;  1Z0V A;  4HYM A;  4BMJ A;  4KHP I;  2F8B A;  2VQF I;  2BM0 A;  1NHJ A;  2IOP A;  4B3S I;  3F0N A;  4LOM A;  4BA2 A;  2PNM A;  4DR7 E;  1VI7 A;  3P3E A;  4Q28 A;  1HNW I;  2EOX A;  2RTX A;  2JE6 B;  1T4N A;  5AAS A;  2EQ1 A;  2GHF A;  1IMU A;  2JT2 A;  2C38 A;  2E1R A;  2UUA I;  2VRD A;  1UDQ A;  3VHT B;  2Z5B B;  1Z59 A;  4O24 A;  4YHH E;  1FWK A;  3GLL A;  2HKJ A;  3ZKD A;  2RSI A;  3Q6N A;  2CSH A;  1OYP A;  5A2Q Q;  2E72 A;  2EM9 A;  2NUE A;  1DQ3 A;  3GCM A;  4X64 I;  1TN9 A;  1X6E A;  1Y4S A;  3DD6 A;  4FW4 A;  2EM3 A;  2EPP A;  2EFG A;  2ZBK B;  2JVA A;  2FV4 B;  2L2M A;  2UU9 E;  4LF8 E;  1R6L A;  2ELZ A;  2WBS A;  2J7K A;  4DV1 I;  4DR1 I;  3KZY A;  2EN2 A;  2YTG A;  2DLK A;  1A1L A;  2IER A;  5DRP A;  2L92 A;  2UUC E;  2L8T A;  4K0K I;  2E5L E;  4R1F A;  5C0X E;  1HNX E;  1XHK A;  2R3V A;  3M6A A;  3ZZU A;  4HEI A;  2MKD A;  1NZ0 A;  3CDI A;  2C39 B;  1PJQ A;  4ZYG A;  3JU0 A;  5KL6 A;  1XNQ I;  2F1D A;  4USM A;  1I94 I;  5IWA E;  1YUJ A;  3ADL A;  4PRX A;  2B7T A;  2YTD A;  4X8W A;  3UK3 C;  2MC6 A;  2V2Z A;  4DR5 E;  2LVH A;  3DJW A;  2FTX B;  4LF7 E;  3PS2 A;  4LCH A;  3J81 Q;  4DV7 E;  5FWK A;  2YRK A;  2EP3 A;  3ZZT A;  4DV6 I;  4B3M I;  4DU7 A;  4JI1 I;  2CPN A;  1MEY C;  2ODR C;  3F6G A;  4F54 A;  4LF5 E;  2VE7 C;  2YSO A;  2PRT A;  2ODR D;  4IS9 A;  4DV2 E;  2LUP B;  4DR2 E;  5AE2 A;  1J5E I;  2EMF A;  4WUD A;  2UXB I;  2LV2 A;  4AQY E;  3ZOQ B;  4DPU A;  2L3C A;  2HGH A;  2EL6 A;  4JI2 I;  2RS7 A;  3ECR A;  4LFA E;  1OYR A;  4HAC B;  4MYU A;  1IBL E;  1XXE A;  4ZYH A;  2J65 A;  1JK2 A;  2O1T A;  4RPF A;  5K36 B;  4U3B A;  1KIJ A;  3C4T A;  4JI8 E;  2UXD E;  3HJC A;  2JEB A;  3LPS A;  4JI3 I;  4X65 E;  3M7N G;  4DUY I;  1Z5C A;  1Z0B A;  5KL4 A;  1UHZ A;  1PKP A;  4DPW A;  1GTK A;  5TSE A;  2JYA A;  1BKN A;  4XTJ A;  4DV5 E;  2L2K B;  4IFD B; 
#chains in the Genus database with same CATH homology
 4DV4 E;  2UUB I;  4DMI A;  4UT4 A;  2GQ0 A;  1KKH A;  1J26 A;  1RC7 A;  3Q1Q A;  3HPS A;  4DR7 I;  4WSP A;  2XEX A;  3T1H E;  4JG4 A;  4LFC I;  1D6T A;  3ZM7 A;  2RSM A;  1QZR A;  4YHH I;  4DV3 I;  4JI7 E;  2OI2 A;  3JAM Q;  4DPY A;  1N32 E;  5LMN I;  3F6H A;  2UXC E;  2IHR 1;  4WPY A;  2L33 A;  2HK2 A;  2NA2 A;  3LTO A;  2UU9 I;  4LF8 I;  2V83 A;  4GKJ E;  2G7H A;  2LE2 A;  4PRV A;  2UUC I;  1FWL A;  1STU A;  2E5L I;  1HNX I;  1O0W A;  4LF4 E;  1S4E A;  4BC7 A;  1HNZ I;  4JI6 E;  5FLX C;  3VK6 A;  1XMQ E;  1ZM3 A;  4DKK A;  1DI2 A;  4DXL A;  3WU5 A;  5GMD A;  2B7V A;  4F9A B;  5IWA I;  4JV5 E;  1Z5B A;  1OJ4 A;  4IZJ D;  4L5N C;  3B78 A;  4DR5 I;  4LF7 I;  4WUB A;  4R03 A;  2MDR A;  3AV0 A;  1K47 A;  1IBK E;  4JI0 E;  4GKK E;  2YT4 A;  3K1J A;  1U2R A;  2WZO A;  2B9D A;  4LF5 I;  4UTG A;  1WHN A;  4DV2 I;  1H72 C;  1ZM9 A;  2LRS A;  1EKZ A;  4AQY I;  4BCA A;  4IZK B;  4LFA I;  3GON A;  1Z0G A;  4R8O A;  3B82 A;  3VYY A;  3RMP A;  3WU6 A;  2UXD I;  4KZS A;  1KTV A;  3QT6 A;  4X65 I;  5BR8 I;  2HKE A;  3P06 A;  4DR4 E;  4N3O A;  1Z0E A;  1ELO A;  4FWH A;  4L8N A;  4X62 E;  4I8O A;  4M30 A;  1HK7 A;  4DUZ E;  1FI4 A;  5AE1 A;  1MU5 A;  2V89 A;  2N3H A;  1MG7 A;  4WYQ B;  2EZ6 A;  2JOB A;  5L3J A;  1XNR E;  3T1H I;  2LBS B;  3B8H A;  1WHQ A;  4GEQ B;  4IZJ A;  2BM1 A;  1ZXN A;  5GME A;  3D4J A;  4P52 A;  4M0V A;  1Z0T A;  1EA6 A;  1N32 I;  2UXC I;  3Q6M A;  1X47 A;  1N36 I;  4KQV A;  2Z5C A;  4HY1 A;  4LFB E;  2M4I A;  3LNU A;  3ADJ A;  1T4L B;  1YYW A;  2DIX A;  4LF4 I;  2A2D A;  4DPX A;  4DR3 I;  2VF1 A;  3T1Y E;  3VYX A;  1KVK A;  4J8Z A;  4KHP E;  2Z5E A;  1IBM E;  4B3S E;  2CZ9 A;  2YZT A;  5LMU I;  1XMO E;  2L2N A;  2V8Q B;  4OOG C;  2UUA E;  1YZ9 A;  2VF3 A;  2JY9 A;  1UIL A;  2Z5B A;  3PYF A;  3J7A G;  1T4O A;  2HFS A;  3KWR A;  3PYE A;  1IBK I;  1Z0W A;  4GKK I;  4YY3 E;  4I3H A;  3LLH A;  2AJ4 A;  2LJP A;  1PIE A;  2V34 A;  1HR0 E;  2V2V A;  4NXM E;  2HHH E;  1WUU A;  4JI5 E;  3JTZ A;  3J81 C;  4EMD A;  2V88 A;  2O1U A;  5AE3 A;  2CG9 A;  4FN5 A;  4DV1 E;  2KON A;  1WXR A;  2V86 A;  4DR6 E;  2LTR A;  1H74 A;  2V87 A;  1N33 E;  1SR9 A;  4X62 I;  3OTO E;  1N0U A;  4OX9 E;  4B3R E;  3K17 A;  2F4V E;  2VQE E;  1ZXM A;  2DB2 A;  2N3G A;  4B3T E;  1XNR I;  4URL A;  4DV6 E;  2V85 A;  3K6Q A;  2A2C A;  1ZM4 A;  4JI1 E;  4PU9 A;  4BBY A;  3IWB A;  3V5R A;  3HPZ A;  3H4L A;  2L6M A;  5LL6 R;  4DV7 I;  4HAC A;  1YYO A;  4JI2 E;  1DAR A;  2R42 A;  2IOQ A;  2M7Q A;  4JI4 E;  4P78 A;  3PYD A;  1S16 A;  5F3W A;  2K4V A;  1USV A;  4FWD A;  3LML A;  1FJG E;  4DR2 I;  1B62 A;  3IWC A;  3CWV A;  3J80 C;  1EI1 A;  1VIS A;  4LFB I;  3QT8 A;  4TUG A;  1IBL I;  2LMZ A;  3AUZ A;  2LJH A;  4LF9 E;  2JOX A;  4JI8 I;  3HUL A;  3T1Y I;  5ADZ A;  3V2U C;  3ADG A;  1USU A;  1IBM I;  1XMO I;  2H36 X;  3PYG A;  4DV5 I;  4LU9 A;  4DV4 I;  2ZIT A;  2RS6 A;  4LFC E;  2CGE A;  5IT9 C;  4DPT A;  4USK A;  4YY3 I;  1Y4U A;  1N34 E;  1A6F A;  4DV3 E;  1HR0 I;  1H73 A;  2KOU A;  3ZKB A;  5LMN E;  4NXM I;  2E1M A;  3MSW A;  2HHH I;  4JI5 I;  4BS9 A;  3HTX A;  1GZ6 A;  4LTY A;  3H09 A;  1ZM2 A;  4DV0 E;  4JI7 I;  2FGG A;  3OML A;  4FW9 A;  4DR6 I;  4X66 E;  2NUF A;  1HNZ E;  4JYA E;  1H7U A;  3QT7 A;  1N33 I;  1Y6Z A;  2LUQ A;  4GKJ I;  3ADI A;  5T6J A;  3OTO I;  4OX9 I;  5A2Q C;  4LF6 E;  1UEK A;  4B3R I;  2DEI A;  4F9C B;  5CFF E;  2ZM6 E;  4NXN E;  2VQE I;  3C4B A;  2V8P A;  1XMQ I;  4JI6 I;  2F4V I;  4B3T I;  2VQF E;  2BV3 A;  1B63 A;  1HNW E;  4JV5 I;  1ZBT A;  4FWG A;  1RRE A;  4P7D A;  1Z5A A;  3WU4 A;  2M1S A;  2O1V A;  4IZK A;  2DSY A;  4ED4 A;  4JI0 I;  5DNY A;  4Z7C A;  2X7I A;  3QT5 A;  4JI4 I;  2HK3 A;  1RQ0 A;  2WW4 A;  2NUG A;  1NHH A;  4X64 E;  1FJG I;  3K85 A;  4HXZ A;  1X49 A;  5BR8 E;  5FLX Q;  1ZBQ A;  1NHI A;  4DR1 E;  4Z7Y A;  4LF9 I;  2V2Q A;  4K0K E;  4M2Z A;  3PRY A;  3J7Y p;  4DR4 I;  4MYT A;  2MC5 A;  2O1W A;  1FKA E;  4M1K A;  2L3J A;  4P7A A;  4F9B B;  1QU6 A;  3IWD A;  1XNQ E;  1H7S A;  3ZZ0 A;  1I94 E;  4DUZ I;  4ZVI A;  3J80 Q;  1FNM A;  4DU8 A;  3HQ1 A;  2EWL A;  1N34 I;  2JR1 A;  3J7A M;  2Q2E B;  4B3M E;  1MX0 A;  4WUC A;  2GS8 A;  1N0V C;  1N36 E;  2DMY A;  4IZJ B;  3FIG A;  1J5E E;  1RR9 A;  2UXB E;  2DEJ A;  3HXL A;  2LTS A;  4DV0 I;  1PVG A;  1X48 A;  3P1X A;  2JWO A;  2B3T B;  4X66 I;  4BC9 A;  1GQE A;  4JYA I;  4DR3 E;  5IT9 Q;  3DF6 A;  2KHX A;  4JI3 E;  2Z5C B;  4DUY E;  2PNL A;  1Z0C A;  4TUI A;  3WU3 A;  4WFT A;  2X36 A;  3JAM C;  5LMU E;  2NPF A;  4LF6 I;  1YYK A;  2HFU A;  2UUB E;  2ZM6 I;  4NXN I;  1Z0V A;  4HYM A;  4BMJ A;  4KHP I;  2F8B A;  2VQF I;  2BM0 A;  1NHJ A;  2IOP A;  4B3S I;  3F0N A;  2PNM A;  4DR7 E;  4Q28 A;  1HNW I;  2RTX A;  1T4N A;  5AAS A;  2UUA I;  2E1R A;  2Z5B B;  1Z59 A;  1FWK A;  4YHH E;  3ZKD A;  2HKJ A;  3Q6N A;  5A2Q Q;  4X64 I;  2NUE A;  1DQ3 A;  1Y4S A;  2ZBK B;  2EFG A;  2JVA A;  2L2M A;  2FV4 B;  2UU9 E;  4LF8 E;  2J7K A;  4DV1 I;  4DR1 I;  2L92 A;  2UUC E;  2L8T A;  4K0K I;  2E5L E;  4R1F A;  1HNX E;  1XHK A;  2R3V A;  3M6A A;  3ZZU A;  1NZ0 A;  3JU0 A;  1XNQ I;  4USM A;  1I94 I;  5IWA E;  3ADL A;  4PRX A;  2B7T A;  2V2Z A;  4X8W A;  2MC6 A;  3J81 Q;  4DR5 E;  4LF7 E;  3DJW A;  2FTX B;  4DV7 E;  5FWK A;  3ZZT A;  4DV6 I;  4B3M I;  4DU7 A;  4JI1 I;  2CPN A;  2ODR C;  3F6G A;  4F54 A;  4LF5 E;  2VE7 C;  2ODR D;  4DV2 E;  2LUP B;  4DR2 E;  5AE2 A;  1J5E I;  4WUD A;  2UXB I;  4AQY E;  3ZOQ B;  4DPU A;  2L3C A;  4JI2 I;  2RS7 A;  4HAC B;  4LFA E;  4MYU A;  1IBL E;  2O1T A;  4RPF A;  1KIJ A;  3C4T A;  4JI8 E;  2UXD E;  3HJC A;  3LPS A;  4JI3 I;  4X65 E;  4DUY I;  1Z5C A;  1Z0B A;  1UHZ A;  1PKP A;  4DPW A;  1BKN A;  4XTJ A;  4DV5 E;  2L2K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...