4DR2E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr2E02
2VQEE 1RR9A 4DR1E 3ADGA 3PYEA 1RQ0A 4MYTA 1H73A 2UXCE 4LFAE 4DPTA 4GKJE 1ZBTA 3J7AM 3K17A 1I94E 1IBME 4M1KA 3GONA 4YY3I 3K1JA 3B78A 5GMEA 4JV5I 3V2UC 1YYWA 5IWAI 1X47A 4DV3I 1ZM9A 1PVGA 1T4NA 3QT8A 2LUPB 1BKNA 2DIXA 1HNXE 4HYMA 4AQYI 4USMA 2UXDI 2KHXA 2NUFA 3P1XA 4YY3E 2E1RA 4R1FA 1S16A 1X48A 5IWAE 2CPNA 1FWKA 4LFCI 1N33I 4DV3E 4JI6E 2A2DA 1XNQI 4AQYE 1N36E 4DUYI 2UXDE 3ZZ0A 1HNZI 2NUEA 4LF4I 4DR3I 4DV4I 3WU3A 4LFCE 1N33E 1MG7A 1FJGE 2LTRA 1XNQE 1XMOI 1HNZE 1Z0GA 4DR3E 4JYAI 4DV4E 2R3VA 2L2MA 4DU7A 1NHJA 2L2NA 2AJ4A 2UUBI 2UUAE 2DEIA 2BV3A 3HTXA 2BM0A 4MYUA 1YYKA 2F4VI 4B3RE 4B3MI 4HY1A 1STUA 1XMOE 2XEXA 2J7KA 4JI2I 3F0NA 4FW9A 2HHHI 4HACA 4JYAE 1OJ4A 3LTOA 1HR0I 1O0WA 3ZKDA 4XTJA 2ZM6I 2HKEA 1QZRA 3ADLA 2ZBKB 4DR2E 2UUBE 1MU5A 5FLXQ 2F4VE 3PYDA 4PRXA 4B3ME 4ED4A 1QU6A 3LLHA 4DR5I 4DV2I 2L3JA 1H7UA 5FLXC 4FN5A 4DKKA 1J26A 1N32I 3LNUA 2DEJA 4DV1I 2ZM6E 4OOGC 4LFAI 1J5EE 4NXME 3Q1QA 4GKJI 1FI4A 4Z7YA 1I94I 1ZM3A 3ADIA 1Z0VA 4DR5E 4PRVA 4DV2E 4FWGA 3VYYA 1N32E 2V2VA 4DV1E 4DR7I 2YT4A 4DPXA 4KHPI 1Z0EA 5L3JA 4LF6I 5LL6R 4LFBI 1HNXI 1NHIA 2VQFI 4FWDA 2R42A 3T1HI 4KQVA 4JI7I 4M2ZA 4PU9A 1B63A 3ZZUA 4DR7E 4KHPE 4JI6I 5LMUE 4LF6E 4OX9I 4LFBE 2V8PA 2VQFE 1ZXMA 4WUDA 1N36I 3T1HE 2NA2A 1MX0A 5CFFE 4DPWA 4X62I 4JI7E 4USKA 1T4LB 4DV0E 2EFGA 1Z0BA 5A2QQ 3J80Q 1FJGI 1A6FA 4WUBA 4LF7E 2L2KB 4OX9E 4DV7I 1KTVA 1UHZA 3WU4A 5A2QC 3J80C 2UXBI 1D6TA 2JY9A 1N34I 1N0UA 2UUCI 4X62E 3ZKBA 1YZ9A 2N3GA 2RSMA 1KVKA 1XMQI 2V34A 2UUAI 2HKJA 2X7IA 3C4BA 2LRSA 4JI4I 4B3RI 4DV7E 1Z59A 2N3HA 4P7AA 2RS7A 2HFUA 2UXBE 4WYQB 1N34E 4JI0I 4X64E 3ZZTA 4DR4I 2DB2A 1RC7A 2UUCE 1ZM4A 1XMQE 4DR2I 1U2RA 1H74A 4NXNI 4DV5I 4JI4E 3PYGA 3OTOE 1UEKA 1XNRI 3VYXA 1NZ0A 2LJPA 4JI0E 4RPFA 1H72C 4DR4E 1FNMA 1EA6A 1J5EI 4NXNE 3D4JA 3QT6A 4DV5E 4NXMI 2VF3A 3JAMQ 1XNRE 3J7AG 2GS8A 4URLA 4JI5E 3B8HA 4LF8I 4LF9E 2OI2A 4X65I 2DMYA 4FWHA 4EMDA 3J7Yp 2B3TB 4P52A 1ELOA 2EZ6A 4LF5E 1K47A 2HK2A 2V2QA 4DU8A 4Z7CA 4JI1E 1WUUA 2UU9I 2LUQA 4LF8E 4HACB 3T1YI 4X65E 3J81Q 1PKPA 4X66I 1Z5AA 2E5LI 5LMUI 4X8WA 1IBKE 1Z5CA 4WUCA 3J81C 1XHKA 2UU9E 1B62A 2LBSB 4I3HA 3HULA 1EKZA 1DI2A 3T1YE 4M30A 2LJHA 4DV0I 2L3CA 1FKAE 4DPUA 4X66E 2E5LE 3PYFA 4LF7I 1IBLI 1NHHA 3B82A 1UILA 1PIEA 4B3SI 4JG4A 2JVAA 1WHNA 1H7SA 1RREA 1X49A 3LPSA 2LTSA 1IBLE 2Q2EB 1EI1A 4JI8I 2A2CA 3M6AA 4DR6I 3C4TA 2L33A 4B3SE 2B7TA 1Z0TA 4X64I 1Z0WA 2IHR1 4GKKI 4JV5E 2NUGA 1ZM2A 3OTOI 2CZ9A 5GMDA 4JI8E 3QT5A 2B7VA 1DARA 4DPYA 4DV6I 5IT9Q 4DR6E 4YHHI 1KKHA 4JI3I 4GKKE 1ZXNA 2V2ZA 4DXLA 5IT9C 1YYOA 2WW4A 3ZM7A 2HFSA 4UTGA 5LMNI 1Z0CA 4DV6E 1VISA 4DUYE 4DUZI 4YHHE 4LF4E 4JI3E 4JI5I 4LF9I 2ZITA 4ZVIA 1HNWI 2RS6A 2BM1A 1GQEA 4LF5I 5LMNE 4JI1I 4K0KI 4DUZE 3H4LA 3WU6A 3JAMC 3CWVA 1N0VC 5BR8I 1HNWE 2X36A 4UT4A 2NPFA 1IBKI 1S4EA 4K0KE 3QT7A 2MDRA 4HXZA 3ADJA 4B3TI 4JI2E 2HHHE 2VQEI 4DR1I 1FWLA 1T4OA 5BR8E 2RTXA 1HR0E 1Z5BA 1KIJA 2UXCI 2HK3A 1WHQA 3V5RA 3WU5A 4WFTA 4B3TE 1IBMI
chains in the Genus database with same CATH superfamily
1HK7A 2VQEE 2BA1G 1RR9A 3IWBA 4DR1E 3ADGA 1UDNA 4GQUA 2EM2A 1L4SA 3PYEA 2JEBA 2V85A 1RQ0A 2YTFA 4MYTA 2EMLA 1H73A 2UXCE 4IS9A 5C0XF 4LFAE 4MDTA 2EPUA 2EM4A 4DPTA 2HC5A 2LCEA 2YTJA 4GKJE 4R2RA 1ZBTA 3IWCA 1YH8A 3J7AM 3K17A 2EL5A 2YU5A 1I94E 5C0XE 1IBME 1JK1A 3GONA 4M1KA 4DMIA 4YY3I 2EOJA 3K1JA 3B78A 4MQYA 5GMEA 4AIDA 2I13A 1IQOA 4JV5I 3V2UC 1YYWA 3M7NG 5IWAI 3GLLA 2CTDA 3HXLA 2EM8A 4F6NA 1X47A 4DV3I 1ZM9A 1PVGA 5F3WA 1T4NA 3QT8A 1OYSA 2LUPB 1G2DC 1BKNA 2DIXA 1HNXE 4HYMA 2Z5BA 4MU4A 4AQYI 4USMA 2EQ3A 2UXDI 2JT2A 5A6BA 4Q28A 1GZ6A 2KHXA 2VRDA 2NUFA 3P1XA 4YY3E 2CG9A 5K36A 2ENCA 2LT7A 2E1RA 4R1FA 1S16A 1X48A 2VESA 2EMIA 5IWAE 4LTYA 3EPKA 2LE2A 1MEYC 2CPNA 2EN8A 4L8NA 5KL2A 1FWKA 4LFCI 4DV3E 4JI6E 2A2DA 1N33I 2EOFA 4N3OA 3PRYA 4X9JA 1XNQI 4ZYDA 3NZKA 4AQYE 1A1GA 4IZKA 1N36E 4DUYI 2V88A 3PS1A 2EPNA 2JOXA 2EPPA 2KONA 1T39A 1A1HA 2UXDE 2PNZB 2LMZA 2NUEA 4FW5A 3ZZ0A 4R2CA 4LF4I 4DR3I 1A1JA 4DV4I 1A1FA 2O3ZA 2VE7C 1YUJA 2IOPA 1RMDA 2YTGA 4OO1C 2PO0A 5JEAB 4MU3A 3WU3A 4OX9I 5A6KA 4LFCE 1N33E 1MG7A 1SR9A 2EPXA 1FJGE 1EH6A 2LTRA 5KL3A 1XNQE 2CVEA 1NCSA 3HKMA 2O1VA 3Q6MA 1XMOI 1UN6B 2BB8A 1E3PA 1HNZE 1Z0GA 2EM5A 4N4RB 5C0XA 4FK5C 4DR3E 2C37A 4JYAI 2VF1A 4DV4E 2R3VA 3MHSC 2L2MA 2YTOA 1NHJA 3K85A 4DU7A 5DRQA 3C6KA 2L2NA 2AJ4A 2UUBI 2UUAE 2DEIA 5A6BD 2Z5CA 2H36X 2C38B 2NN6C 2BV3A 2DLQA 2FTXB 3HTXA 1BB8A 2BM0A 4MYUA 1YYKA 2F4VI 2ELYA 4B3RE 2DSYA 1LLMC 4B3MI 4LFBI 1STUA 1XMOE 4HY1A 1Y60A 2JWOA 4NBQA 2XEXA 3UHMA 2J7KA 2PO2B 1ZAAC 3F0NA 4FW9A 2HHHI 4JI2I 1X6EA 2EMAA 4HACA 4JYAE 1ZU1A 3ECRA 1Z1BA 1OJ4A 2EMXA 3LTOA 1HR0I 1TF3A 1YPNA 1O0WA 2YTPA 5IV8B 4XTJA 2BR2B 3P3EA 3ZKDA 2HKEA 2ZM6I 2NABA 1QZRA 3ADLA 4R2SA 2ELZA 3DJWA 4MLQA 4DR2E 1A1KA 2UUBE 2ZBKB 4IZJB 4GEQB 4LCGA 5DNYA 1E3HA 1MU5A 5FLXQ 2F4VE 2EPLX 3PYDA 4PRXA 4B3ME 4F9CB 2YTNA 4ED4A 2EOEA 1QU6A 3LLHA 3HPZA 4Q35B 2DGCA 4R2PA 3H1CA 2FV4B 5EKWA 4DV2I 4WXCA 5T6JA 2V83A 5FLXC 2L3JA 1H7UA 2EMFA 4DKKA 4TUGA 1J26A 3Q6NA 2D9HA 4FN5A 4FW3A 1N32I 3LNUA 1X6FA 2CGEA 2DEJA 2PNLA 2ZM6E 4OOGC 4DV1I 4LFAI 1J5EE 3B4TA 2V87A 2ODRC 3F6GA 4NXME 3Q1QA 4P78A 1UDSA 2PO1B 4GKJI 2V8QB 5KL6A 1FI4A 3EPLA 2YWQA 5K36C 2EMKA 4FW7A 4Z7YA 1I94I 1IQSA 1ZM3A 3ADIA 1Z0VA 4DR5E 3M99B 2FGGA 1ZBQA 3MSWA 4DV2E 4PRVA 2N8XA 2EPZA 4AM3A 3UK3C 4FWGA 3VYYA 1N32E 2V2VA 1EH8A 2GQ0A 4DV1E 2BA1D 2YRKA 2YT4A 4DR7I 4DPXA 4KHPI 1Z0EA 4RH8A 1X6HA 2LO3A 2WBUA 1YUIA 5L3JA 5LL6R 4LF6I 2WP8B 2ENAA 4J3DA 2JR1A 4WSGA 1HNXI 4IFDC 1NHIA 2VQFI 1Y4UA 4OO1B 2Q8UA 4F2JC 2EM3A 1N3GA 4IS1C 2IESA 4FWDA 1UDOA 2IOQA 4LCFA 2EOYA 2R42A 4BA1A 3T1HI 3HPSA 3CDJA 2EN6A 4KQVA 2JPAA 4JI7I 4O4KA 1VI7A 4M2ZA 4PU9A 1B63A 3ZZUA 2DLKA 3AUZA 2YTEA 4DR7E 4KHPE 4JI6I 2EMBA 1IMUA 2PNMA 5LMUE 4LF6E 2YRMA 1YSAC 4LFBE 2DMIA 2WNRB 2V8PA 3C6MA 4KWYA 4AIMA 2VQFE 1ZXMA 4WUDA 5C0XC 1N36I 2O1TA 3T1HE 2NA2A 2NN6B 2EMHA 1MX0A 5CFFE 4DPWA 4MU1A 4X62I 4U3BA 4JI7E 2CT1A 1R6MA 2WCC3 4ISAA 4USKA 1T4LB 5AASA 4DV0E 2EFGA 1Z0BA 5A2QQ 3KZYA 3J80Q 1FJGI 2GO4A 2LJUA 4GZNC 2EN2A 1A6FA 3VHTB 4LF7E 2L2KB 4OX9E 2IERA 4WUBA 4DV7I 1BBOA 1KTVA 1Y6ZA 2R1FA 2EPRA 2EMZA 1TN9A 1UHZA 3WU4A 5A2QC 3J80C 2UXBI 1D6TA 2JY9A 1N34I 4WPYA 1N0UA 2UUCI 4X62E 3ZKBA 4WX9A 1PDAA 2EPKX 2WZOA 1YZ9A 3KRNA 2N3GA 2RSMA 2EPCA 2PRTA 2F1DA 1KVKA 1XMQI 2V34A 2UUAI 4BCAA 2HKJA 5KL5A 2X7IA 3C4BA 2LRSA 2C38A 2GO3A 4JI4I 4QNJA 4B3RI 4DV7E 1Z59A 2N3HA 2EMWA 4P7AA 2RS7A 3THNA 2HFUA 4LOMA 2UXBE 2PO2A 4WYQB 2GHFA 3EPHA 2MC5A 4P7DA 1N34E 4JI0I 4X64E 4R2AA 3ZZTA 2EP3A 4DR4I 2DB2A 4BC7A 1RC7A 2UUCE 5K36B 2EM7A 1JK2A 2BR2A 1ZM4A 2EL4A 1XMQE 2YSOA 1U2RA 4FW6A 4BC9A 1H74A 4IZJA 4NXNI 4DR2I 4DV5I 3BIDA 4JI4E 3PYGA 3OTOE 1UEKA 2EM9A 1XNRI 2JEAB 5AC4A 3VYXA 3HJCA 5ELWA 1DGCA 1NZ0A 3P76A 4O43A 3M85D 1TF6A 2EN3A 3CDIA 2EN1A 2YTQA 4BHBA 2L92A 2L6MA 2LJPA 4JI0E 5JEAD 4RPFA 4TUIA 4M0VA 1H72C 4IFDB 4DR4E 3BGHA 4OZEA 5DRPA 4QNKA 2EORA 5TSEA 3DD6A 4J8ZA 4BA2B 1WJPA 1FNMA 1EA6A 1J5EI 4NXNE 3D4JA 3QT6A 2EOSA 4DV5E 2O1UA 4U3DA 2VF3A 3VK6A 4NXMI 2J7JA 1YFHA 2ADRA 2MKDA 1XNRE 2BA0D 3JAMQ 2PO1A 4BBYA 4DPUA 3J7AG 5JEAF 4WSPA 1DQ3A 2EOZA 1Y5YA 2YPNA 2GS8A 4URLA 5AC5A 5DROA 5C0XB 1A1IA 4L5NC 4JI5E 3B8HA 4LF9E 2OI2A 4LF8I 5A6JA 4X65I 2YTDA 5JEAE 2DMYA 4R03A 4FWHA 4EMDA 4BS9A 3J7Yp 2B3TB 4P52A 2WP8A 1ELOA 1A1LA 2EZ6A 4LF5E 1K47A 2HK2A 2V2QA 4OO1A 4DU8A 4Z7CA 4ZYGA 4JI1E 1WUUA 2UU9I 4R2QA 5FWKA 2EL6A 2LUQA 2K4VA 4BHCA 1PJQA 1P42A 4IZJD 4LF8E 4HACB 3U1KA 3T1YI 2EJ4A 4OKGA 4X65E 3PS2A 3J81Q 3P3GA 1PKPA 2JE6B 2YZTA 4X66I 4FW4A 1MGTA 2ENHA 1Z5AA 2E5LI 5LMUI 4X8WA 2KOUA 1IBKE 2WNRA 4F9BB 5DRRA 1Z5CA 3EPJA 2EMCA 4WUCA 3J81C 1XHKA 3GCMA 2M4IA 4M9VC 3BF2A 2Z5EA 2UU9E 4HEIA 2C39B 2NN6A 1B62A 5LLQA 2LBSB 3HULA 3KZZA 4F54A 1EKZA 4I3HA 1XXEA 1DI2A 4LCHA 3T1YE 2RPCA 4M30A 1BBGA 2EOQA 2EPOA 2LJHA 1ZR9A 2EM6A 2EPMX 4I8OA 4RHBB 2DRPA 4DV0I 2EMGA 2LV2A 3JU0A 2EM0A 5KL4A 2I9IA 5ADZA 4X66E 2L3CA 1FKAE 2E5LE 2L8TA 3PYFA 4LF7I 1IBLI 1NHHA 2EN4A 3L7ZB 1UILA 3B82A 2PNZA 3MHHC 1PIEA 5DNLA 4B3SI 4NHRA 3P3CA 3KWRA 2JOBA 1SFEA 2M9AA 4JG4A 4OO1D 1GTKA 2JVAA 5DNXA 1EH7A 2JEBB 5JEAA 1WHNA 1G2FC 1H7SA 1RREA 2LTSA 1X49A 2JP9A 3LPSA 1UBDC 3F6HA 4BMJA 1IBLE 2Q2EB 1EI1A 4JI8I 2A2CA 2EQ1A 3M6AA 2B9DA 2EPAA 2RQLA 4LU9A 2RSIA 1P47A 3C4TA 4DR6I 2L33A 1AH5A 2J65A 2E1MA 4B3SE 2B7TA 2YSPA 2WBSA 1Z0TA 4X64I 1Z0WA 2O1WA 4BA1B 2LVHA 3ZOQB 2IHR1 1USUA 4OO1F 2EOIA 1RHYA 4GKKI 4HTGA 2EWLA 3LMLA 2R76A 4JV5E 2NUGA 1ZM2A 1WRJA 4F6MA 3OTOI 2NN6D 2V86A 2CZ9A 5GMDA 2JEAA 1T38A 4F9AB 4OO1E 4JI8E 3QT5A 2B7VA 1DARA 4DPYA 4DV6I 2Z5BB 5IT9Q 4DR6E 4YHHI 5IXMB 2MKNA 1KKHA 1PJTA 4IFDA 2G7HA 3QG5C 5EL9A 4JI3I 2CSHA 2EMYA 3RMPA 2EOHA 4GKKE 4NZVA 1ZXNA 2V2ZA 4DXLA 5IT9C 4BA2A 3H09A 2NN6F 5AE3A 2A25A 4IJDA 3U1YA 1YYOA 2WW4A 3HQ1A 3ZM7A 4MLVA 2HJJA 2HFSA 4UTGA 5LMNI 3JTZA 2HGHA 1Z0CA 4R8OA 4DV6E 1VISA 3THOB 4WXDA 3PS3A 4IZKB 2NN6E 2YU8A 2EOMA 2BBGA 4YHHE 4DUYE 4DUZI 4R2DA 4DR5I 5AE2A 4LF4E 3FIGA 4JI3E 1Y4SA 1UDQA 2K7IA 4LPFA 4JI5I 1PJSA 2M1SA 4LF9I 2ZITA 2M7QA 5A6AA 4ZVIA 1HNWI 2AE8A 4KZSA 2RS6A 2BM1A 1QNTA 2MC6A 2JXPA 2PO0B 2ODRD 3M85G 1GQEA 1F2IG 2YTIA 4LF5I 4MU0A 5LMNE 1WXRA 4JI1I 5K36D 5A69A 4K0KI 2YRHA 1X5WA 4DUZE 3H4LA 3WU6A 1KYQA 3L00A 3BBGA 3JAMC 2C37B 3CWVA 3OMLA 1NEIA 2EQ0A 2JYAA 2WBTA 1N0VC 5BR8I 1HNWE 2X36A 2BA0G 2JE6A 2NPFA 4UT4A 3M7ND 1AAYA 4O24A 3DF6A 4ZYEA 1IBKI 1X3CA 1S4EA 3TQMA 2Z5CB 5K36F 4IFDD 5KL7A 1HNZI 1KJKA 2E72A 1USVA 2EN7A 3IWDA 4K0KE 1OYRA 2MDRA 2C39A 3QT7A 4HXZA 3ADJA 4B3TI 4JI2E 1OYPA 2HHHE 5JEAC 2VQEI 5K36E 4DR1I 2EOXA 1R6LA 3K6QA 1FWLA 3P06A 4ZYHA 1T4OA 2F8BA 5BR8E 2RTXA 1HR0E 1Z5BA 1KIJA 3AV0A 3EQ1A 2GLIA 4IFDF 2UXCI 2HK3A 2V89A 1B69A 5AE1A 3GMEA 1YHCA 2EOOA 2GPIA 4R2EA 5C0XD 1WHQA 2EE8A 4O5GA 3L7ZA 3V5RA 4WFTA 3WU5A 2MDGA 4B3TE 4IFDE 1IBMI
chains in the Genus database with same CATH topology
1HK7A 2VQEE 1RR9A 3IWBA 4DR1E 3ADGA 3PYEA 2V85A 1RQ0A 4MYTA 1H73A 2UXCE 4LFAE 4DPTA 4GKJE 1ZBTA 3IWCA 3J7AM 3K17A 1I94E 1IBME 4M1KA 3GONA 4YY3I 4DMIA 3K1JA 3B78A 5GMEA 4JV5I 3V2UC 1YYWA 5IWAI 3HXLA 1X47A 4DV3I 1ZM9A 1PVGA 5F3WA 1T4NA 3QT8A 2LUPB 1BKNA 2DIXA 1HNXE 4HYMA 2Z5BA 4AQYI 4USMA 2UXDI 4Q28A 1GZ6A 2KHXA 2NUFA 3P1XA 4YY3E 2CG9A 2E1RA 4R1FA 1S16A 1X48A 5IWAE 4LTYA 2LE2A 2CPNA 1FWKA 4L8NA 4LFCI 1N33I 4DV3E 4JI6E 2A2DA 4N3OA 3PRYA 1XNQI 4AQYE 4IZKA 1N36E 4DUYI 2V88A 2JOXA 2KONA 2UXDE 3ZZ0A 1HNZI 2LMZA 2NUEA 4LF4I 4DR3I 4DV4I 2VE7C 2IOPA 3WU3A 4LFCE 1N33E 1MG7A 1SR9A 1FJGE 2LTRA 1XNQE 2O1VA 3Q6MA 1XMOI 1HNZE 1Z0GA 4DR3E 4JYAI 2VF1A 4DV4E 2R3VA 2L2MA 3K85A 4DU7A 1NHJA 2L2NA 2AJ4A 2UUBI 2UUAE 2DEIA 2Z5CA 2H36X 2BV3A 2FTXB 3HTXA 2BM0A 4MYUA 1YYKA 2F4VI 4B3RE 2DSYA 4B3MI 1STUA 1XMOE 4HY1A 2JWOA 2XEXA 2J7KA 4JI2I 3F0NA 4FW9A 2HHHI 4HACA 4JYAE 1OJ4A 3LTOA 1HR0I 1O0WA 3ZKDA 4XTJA 2ZM6I 2HKEA 1QZRA 3ADLA 2ZBKB 4DR2E 2UUBE 3DJWA 4IZJB 4GEQB 5DNYA 1MU5A 5FLXQ 2F4VE 3PYDA 4PRXA 4B3ME 4F9CB 4ED4A 1QU6A 3LLHA 3HPZA 4DR5I 2FV4B 4DV2I 5T6JA 5FLXC 2V83A 2L3JA 1H7UA 4FN5A 4DKKA 1J26A 4TUGA 3Q6NA 1N32I 3LNUA 2DEJA 2CGEA 2PNLA 4DV1I 2ZM6E 4OOGC 4LFAI 1J5EE 2V87A 2ODRC 3F6GA 4NXME 3Q1QA 4P78A 4GKJI 2V8QB 1FI4A 4Z7YA 1I94I 1ZM3A 3ADIA 1Z0VA 4DR5E 4PRVA 2FGGA 1ZBQA 3MSWA 4DV2E 4FWGA 3VYYA 1N32E 2V2VA 2GQ0A 4DV1E 4DR7I 2YT4A 4DPXA 4KHPI 1Z0EA 5L3JA 4LF6I 5LL6R 4LFBI 1HNXI 2JR1A 1NHIA 2VQFI 1Y4UA 4FWDA 2IOQA 2R42A 3T1HI 3HPSA 4KQVA 4JI7I 4M2ZA 4PU9A 1B63A 3ZZUA 3AUZA 4DR7E 4KHPE 4JI6I 2PNMA 5LMUE 4LF6E 4OX9I 4LFBE 2V8PA 2VQFE 1ZXMA 4WUDA 1N36I 2O1TA 3T1HE 2NA2A 1MX0A 5CFFE 4DPWA 4X62I 4JI7E 4USKA 1T4LB 5AASA 4DV0E 2EFGA 1Z0BA 5A2QQ 3J80Q 1FJGI 1A6FA 4WUBA 4LF7E 2L2KB 4OX9E 4DV7I 1KTVA 1Y6ZA 1UHZA 3WU4A 5A2QC 3J80C 2UXBI 1D6TA 2JY9A 1N34I 4WPYA 1N0UA 2UUCI 4X62E 3ZKBA 2WZOA 1YZ9A 2N3GA 2RSMA 1KVKA 1XMQI 2V34A 2UUAI 4BCAA 2HKJA 2X7IA 3C4BA 2LRSA 4JI4I 4B3RI 4DV7E 1Z59A 2N3HA 4P7AA 2RS7A 2HFUA 2UXBE 4WYQB 1N34E 2MC5A 4P7DA 4JI0I 4X64E 3ZZTA 4DR4I 2DB2A 4BC7A 1RC7A 2UUCE 1ZM4A 1XMQE 4DR2I 1U2RA 4IZJA 4BC9A 1H74A 4NXNI 4DV5I 4JI4E 3PYGA 3OTOE 1UEKA 1XNRI 3VYXA 3HJCA 1NZ0A 2L92A 2L6MA 2LJPA 4JI0E 4RPFA 4TUIA 4M0VA 1H72C 4DR4E 4J8ZA 1FNMA 1EA6A 1J5EI 4NXNE 3D4JA 3QT6A 4DV5E 2O1UA 4NXMI 2VF3A 3VK6A 3JAMQ 1XNRE 4BBYA 3J7AG 4WSPA 1DQ3A 2GS8A 4URLA 4L5NC 4JI5E 3B8HA 4LF9E 2OI2A 4LF8I 4X65I 2DMYA 4R03A 4FWHA 4EMDA 4BS9A 3J7Yp 2B3TB 4P52A 1ELOA 2EZ6A 4LF5E 1K47A 2HK2A 2V2QA 4DU8A 4Z7CA 4JI1E 1WUUA 2UU9I 5FWKA 2LUQA 2K4VA 4IZJD 4LF8E 4HACB 3T1YI 4X65E 3J81Q 1PKPA 2YZTA 4X66I 1Z5AA 2E5LI 5LMUI 4X8WA 2KOUA 1IBKE 4F9BB 1Z5CA 4WUCA 3J81C 1XHKA 2M4IA 2Z5EA 2UU9E 1B62A 2LBSB 4I3HA 3HULA 4F54A 1EKZA 1DI2A 3T1YE 4M30A 2LJHA 4DV0I 4I8OA 2L3CA 3JU0A 1FKAE 4DPUA 4X66E 5ADZA 2E5LE 2L8TA 3PYFA 4LF7I 1IBLI 1NHHA 1UILA 3B82A 1PIEA 4B3SI 3KWRA 2JOBA 4JG4A 2JVAA 1WHNA 1H7SA 1RREA 1X49A 2LTSA 3LPSA 3F6HA 4BMJA 1IBLE 2Q2EB 1EI1A 4JI8I 2A2CA 3M6AA 2B9DA 4DR6I 4LU9A 3C4TA 2L33A 2E1MA 4B3SE 2B7TA 1Z0TA 4X64I 1Z0WA 2O1WA 3ZOQB 2IHR1 1USUA 4GKKI 2EWLA 3LMLA 4JV5E 2NUGA 1ZM2A 3OTOI 2V86A 2CZ9A 5GMDA 4F9AB 4JI8E 3QT5A 2B7VA 1DARA 4DPYA 4DV6I 2Z5BB 5IT9Q 4DR6E 4YHHI 1KKHA 2G7HA 4JI3I 3RMPA 4GKKE 1ZXNA 2V2ZA 4DXLA 5IT9C 3H09A 5AE3A 1YYOA 2WW4A 3HQ1A 3ZM7A 2HFSA 4UTGA 5LMNI 3JTZA 1Z0CA 4R8OA 4DV6E 1VISA 4IZKB 4DUYE 4DUZI 4YHHE 5AE2A 4LF4E 3FIGA 4JI3E 1Y4SA 4JI5I 4LF9I 2M1SA 2ZITA 2M7QA 4ZVIA 1HNWI 4KZSA 2RS6A 2BM1A 2MC6A 2ODRD 1GQEA 4LF5I 5LMNE 1WXRA 4JI1I 4K0KI 4DUZE 3H4LA 3WU6A 3JAMC 3CWVA 3OMLA 1N0VC 5BR8I 1HNWE 2X36A 4UT4A 2NPFA 3DF6A 1IBKI 1S4EA 2Z5CB 1USVA 4K0KE 3IWDA 3QT7A 2MDRA 4HXZA 3ADJA 4B3TI 4JI2E 2HHHE 2VQEI 4DR1I 3P06A 3K6QA 1FWLA 1T4OA 2F8BA 5BR8E 2RTXA 1HR0E 1Z5BA 1KIJA 3AV0A 2UXCI 2HK3A 2V89A 5AE1A 1WHQA 3V5RA 3WU5A 4WFTA 4B3TE 1IBMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE E;  1RR9 A;  4DR1 E;  3ADG A;  3PYE A;  1RQ0 A;  4MYT A;  1H73 A;  2UXC E;  4LFA E;  4DPT A;  4GKJ E;  1ZBT A;  3J7A M;  3K17 A;  1I94 E;  1IBM E;  4M1K A;  3GON A;  4YY3 I;  3K1J A;  3B78 A;  5GME A;  4JV5 I;  3V2U C;  1YYW A;  5IWA I;  1X47 A;  4DV3 I;  1ZM9 A;  1PVG A;  1T4N A;  3QT8 A;  2LUP B;  1BKN A;  2DIX A;  1HNX E;  4HYM A;  4AQY I;  4USM A;  2UXD I;  2KHX A;  2NUF A;  3P1X A;  4YY3 E;  2E1R A;  4R1F A;  1S16 A;  1X48 A;  5IWA E;  2CPN A;  1FWK A;  4LFC I;  1N33 I;  4DV3 E;  4JI6 E;  2A2D A;  1XNQ I;  4AQY E;  1N36 E;  4DUY I;  2UXD E;  3ZZ0 A;  1HNZ I;  2NUE A;  4LF4 I;  4DR3 I;  4DV4 I;  3WU3 A;  4LFC E;  1N33 E;  1MG7 A;  1FJG E;  2LTR A;  1XNQ E;  1XMO I;  1HNZ E;  1Z0G A;  4DR3 E;  4JYA I;  4DV4 E;  2R3V A;  2L2M A;  4DU7 A;  1NHJ A;  2L2N A;  2AJ4 A;  2UUB I;  2UUA E;  2DEI A;  2BV3 A;  3HTX A;  2BM0 A;  4MYU A;  1YYK A;  2F4V I;  4B3R E;  4B3M I;  4HY1 A;  1STU A;  1XMO E;  2XEX A;  2J7K A;  4JI2 I;  3F0N A;  4FW9 A;  2HHH I;  4HAC A;  4JYA E;  1OJ4 A;  3LTO A;  1HR0 I;  1O0W A;  3ZKD A;  4XTJ A;  2ZM6 I;  2HKE A;  1QZR A;  3ADL A;  2ZBK B;  4DR2 E;  2UUB E;  1MU5 A;  5FLX Q;  2F4V E;  3PYD A;  4PRX A;  4B3M E;  4ED4 A;  1QU6 A;  3LLH A;  4DR5 I;  4DV2 I;  2L3J A;  1H7U A;  5FLX C;  4FN5 A;  4DKK A;  1J26 A;  1N32 I;  3LNU A;  2DEJ A;  4DV1 I;  2ZM6 E;  4OOG C;  4LFA I;  1J5E E;  4NXM E;  3Q1Q A;  4GKJ I;  1FI4 A;  4Z7Y A;  1I94 I;  1ZM3 A;  3ADI A;  1Z0V A;  4DR5 E;  4PRV A;  4DV2 E;  4FWG A;  3VYY A;  1N32 E;  2V2V A;  4DV1 E;  4DR7 I;  2YT4 A;  4DPX A;  4KHP I;  1Z0E A;  5L3J A;  4LF6 I;  5LL6 R;  4LFB I;  1HNX I;  1NHI A;  2VQF I;  4FWD A;  2R42 A;  3T1H I;  4KQV A;  4JI7 I;  4M2Z A;  4PU9 A;  1B63 A;  3ZZU A;  4DR7 E;  4KHP E;  4JI6 I;  5LMU E;  4LF6 E;  4OX9 I;  4LFB E;  2V8P A;  2VQF E;  1ZXM A;  4WUD A;  1N36 I;  3T1H E;  2NA2 A;  1MX0 A;  5CFF E;  4DPW A;  4X62 I;  4JI7 E;  4USK A;  1T4L B;  4DV0 E;  2EFG A;  1Z0B A;  5A2Q Q;  3J80 Q;  1FJG I;  1A6F A;  4WUB A;  4LF7 E;  2L2K B;  4OX9 E;  4DV7 I;  1KTV A;  1UHZ A;  3WU4 A;  5A2Q C;  3J80 C;  2UXB I;  1D6T A;  2JY9 A;  1N34 I;  1N0U A;  2UUC I;  4X62 E;  3ZKB A;  1YZ9 A;  2N3G A;  2RSM A;  1KVK A;  1XMQ I;  2V34 A;  2UUA I;  2HKJ A;  2X7I A;  3C4B A;  2LRS A;  4JI4 I;  4B3R I;  4DV7 E;  1Z59 A;  2N3H A;  4P7A A;  2RS7 A;  2HFU A;  2UXB E;  4WYQ B;  1N34 E;  4JI0 I;  4X64 E;  3ZZT A;  4DR4 I;  2DB2 A;  1RC7 A;  2UUC E;  1ZM4 A;  1XMQ E;  4DR2 I;  1U2R A;  1H74 A;  4NXN I;  4DV5 I;  4JI4 E;  3PYG A;  3OTO E;  1UEK A;  1XNR I;  3VYX A;  1NZ0 A;  2LJP A;  4JI0 E;  4RPF A;  1H72 C;  4DR4 E;  1FNM A;  1EA6 A;  1J5E I;  4NXN E;  3D4J A;  3QT6 A;  4DV5 E;  4NXM I;  2VF3 A;  3JAM Q;  1XNR E;  3J7A G;  2GS8 A;  4URL A;  4JI5 E;  3B8H A;  4LF8 I;  4LF9 E;  2OI2 A;  4X65 I;  2DMY A;  4FWH A;  4EMD A;  3J7Y p;  2B3T B;  4P52 A;  1ELO A;  2EZ6 A;  4LF5 E;  1K47 A;  2HK2 A;  2V2Q A;  4DU8 A;  4Z7C A;  4JI1 E;  1WUU A;  2UU9 I;  2LUQ A;  4LF8 E;  4HAC B;  3T1Y I;  4X65 E;  3J81 Q;  1PKP A;  4X66 I;  1Z5A A;  2E5L I;  5LMU I;  4X8W A;  1IBK E;  1Z5C A;  4WUC A;  3J81 C;  1XHK A;  2UU9 E;  1B62 A;  2LBS B;  4I3H A;  3HUL A;  1EKZ A;  1DI2 A;  3T1Y E;  4M30 A;  2LJH A;  4DV0 I;  2L3C A;  1FKA E;  4DPU A;  4X66 E;  2E5L E;  3PYF A;  4LF7 I;  1IBL I;  1NHH A;  3B82 A;  1UIL A;  1PIE A;  4B3S I;  4JG4 A;  2JVA A;  1WHN A;  1H7S A;  1RRE A;  1X49 A;  3LPS A;  2LTS A;  1IBL E;  2Q2E B;  1EI1 A;  4JI8 I;  2A2C A;  3M6A A;  4DR6 I;  3C4T A;  2L33 A;  4B3S E;  2B7T A;  1Z0T A;  4X64 I;  1Z0W A;  2IHR 1;  4GKK I;  4JV5 E;  2NUG A;  1ZM2 A;  3OTO I;  2CZ9 A;  5GMD A;  4JI8 E;  3QT5 A;  2B7V A;  1DAR A;  4DPY A;  4DV6 I;  5IT9 Q;  4DR6 E;  4YHH I;  1KKH A;  4JI3 I;  4GKK E;  1ZXN A;  2V2Z A;  4DXL A;  5IT9 C;  1YYO A;  2WW4 A;  3ZM7 A;  2HFS A;  4UTG A;  5LMN I;  1Z0C A;  4DV6 E;  1VIS A;  4DUY E;  4DUZ I;  4YHH E;  4LF4 E;  4JI3 E;  4JI5 I;  4LF9 I;  2ZIT A;  4ZVI A;  1HNW I;  2RS6 A;  2BM1 A;  1GQE A;  4LF5 I;  5LMN E;  4JI1 I;  4K0K I;  4DUZ E;  3H4L A;  3WU6 A;  3JAM C;  3CWV A;  1N0V C;  5BR8 I;  1HNW E;  2X36 A;  4UT4 A;  2NPF A;  1IBK I;  1S4E A;  4K0K E;  3QT7 A;  2MDR A;  4HXZ A;  3ADJ A;  4B3T I;  4JI2 E;  2HHH E;  2VQE I;  4DR1 I;  1FWL A;  1T4O A;  5BR8 E;  2RTX A;  1HR0 E;  1Z5B A;  1KIJ A;  2UXC I;  2HK3 A;  1WHQ A;  3V5R A;  3WU5 A;  4WFT A;  4B3T E;  1IBM I; 
#chains in the Genus database with same CATH topology
 1HK7 A;  2VQE E;  2BA1 G;  1RR9 A;  3IWB A;  4DR1 E;  3ADG A;  1UDN A;  4GQU A;  2EM2 A;  1L4S A;  3PYE A;  2JEB A;  2V85 A;  1RQ0 A;  2YTF A;  4MYT A;  2EML A;  1H73 A;  2UXC E;  4IS9 A;  5C0X F;  4LFA E;  4MDT A;  2EPU A;  2EM4 A;  4DPT A;  2HC5 A;  2LCE A;  2YTJ A;  4GKJ E;  4R2R A;  1ZBT A;  3IWC A;  1YH8 A;  3J7A M;  3K17 A;  2EL5 A;  2YU5 A;  1I94 E;  5C0X E;  1IBM E;  1JK1 A;  3GON A;  4M1K A;  4DMI A;  4YY3 I;  2EOJ A;  3K1J A;  3B78 A;  4MQY A;  5GME A;  4AID A;  2I13 A;  1IQO A;  4JV5 I;  3V2U C;  1YYW A;  3M7N G;  5IWA I;  3GLL A;  2CTD A;  3HXL A;  2EM8 A;  4F6N A;  1X47 A;  4DV3 I;  1ZM9 A;  1PVG A;  5F3W A;  1T4N A;  3QT8 A;  1OYS A;  2LUP B;  1G2D C;  1BKN A;  2DIX A;  1HNX E;  4HYM A;  2Z5B A;  4MU4 A;  4AQY I;  4USM A;  2EQ3 A;  2UXD I;  2JT2 A;  5A6B A;  4Q28 A;  1GZ6 A;  2KHX A;  2VRD A;  2NUF A;  3P1X A;  4YY3 E;  2CG9 A;  5K36 A;  2ENC A;  2LT7 A;  2E1R A;  4R1F A;  1S16 A;  1X48 A;  2VES A;  2EMI A;  5IWA E;  4LTY A;  3EPK A;  2LE2 A;  1MEY C;  2CPN A;  2EN8 A;  4L8N A;  5KL2 A;  1FWK A;  4LFC I;  4DV3 E;  4JI6 E;  2A2D A;  1N33 I;  2EOF A;  4N3O A;  3PRY A;  4X9J A;  1XNQ I;  4ZYD A;  3NZK A;  4AQY E;  1A1G A;  4IZK A;  1N36 E;  4DUY I;  2V88 A;  3PS1 A;  2EPN A;  2JOX A;  2EPP A;  2KON A;  1T39 A;  1A1H A;  2UXD E;  2PNZ B;  2LMZ A;  2NUE A;  4FW5 A;  3ZZ0 A;  4R2C A;  4LF4 I;  4DR3 I;  1A1J A;  4DV4 I;  1A1F A;  2O3Z A;  2VE7 C;  1YUJ A;  2IOP A;  1RMD A;  2YTG A;  4OO1 C;  2PO0 A;  5JEA B;  4MU3 A;  3WU3 A;  4OX9 I;  5A6K A;  4LFC E;  1N33 E;  1MG7 A;  1SR9 A;  2EPX A;  1FJG E;  1EH6 A;  2LTR A;  5KL3 A;  1XNQ E;  2CVE A;  1NCS A;  3HKM A;  2O1V A;  3Q6M A;  1XMO I;  1UN6 B;  2BB8 A;  1E3P A;  1HNZ E;  1Z0G A;  2EM5 A;  4N4R B;  5C0X A;  4FK5 C;  4DR3 E;  2C37 A;  4JYA I;  2VF1 A;  4DV4 E;  2R3V A;  3MHS C;  2L2M A;  2YTO A;  1NHJ A;  3K85 A;  4DU7 A;  5DRQ A;  3C6K A;  2L2N A;  2AJ4 A;  2UUB I;  2UUA E;  2DEI A;  5A6B D;  2Z5C A;  2H36 X;  2C38 B;  2NN6 C;  2BV3 A;  2DLQ A;  2FTX B;  3HTX A;  1BB8 A;  2BM0 A;  4MYU A;  1YYK A;  2F4V I;  2ELY A;  4B3R E;  2DSY A;  1LLM C;  4B3M I;  4LFB I;  1STU A;  1XMO E;  4HY1 A;  1Y60 A;  2JWO A;  4NBQ A;  2XEX A;  3UHM A;  2J7K A;  2PO2 B;  1ZAA C;  3F0N A;  4FW9 A;  2HHH I;  4JI2 I;  1X6E A;  2EMA A;  4HAC A;  4JYA E;  1ZU1 A;  3ECR A;  1Z1B A;  1OJ4 A;  2EMX A;  3LTO A;  1HR0 I;  1TF3 A;  1YPN A;  1O0W A;  2YTP A;  5IV8 B;  4XTJ A;  2BR2 B;  3P3E A;  3ZKD A;  2HKE A;  2ZM6 I;  2NAB A;  1QZR A;  3ADL A;  4R2S A;  2ELZ A;  3DJW A;  4MLQ A;  4DR2 E;  1A1K A;  2UUB E;  2ZBK B;  4IZJ B;  4GEQ B;  4LCG A;  5DNY A;  1E3H A;  1MU5 A;  5FLX Q;  2F4V E;  2EPL X;  3PYD A;  4PRX A;  4B3M E;  4F9C B;  2YTN A;  4ED4 A;  2EOE A;  1QU6 A;  3LLH A;  3HPZ A;  4Q35 B;  2DGC A;  4R2P A;  3H1C A;  2FV4 B;  5EKW A;  4DV2 I;  4WXC A;  5T6J A;  2V83 A;  5FLX C;  2L3J A;  1H7U A;  2EMF A;  4DKK A;  4TUG A;  1J26 A;  3Q6N A;  2D9H A;  4FN5 A;  4FW3 A;  1N32 I;  3LNU A;  1X6F A;  2CGE A;  2DEJ A;  2PNL A;  2ZM6 E;  4OOG C;  4DV1 I;  4LFA I;  1J5E E;  3B4T A;  2V87 A;  2ODR C;  3F6G A;  4NXM E;  3Q1Q A;  4P78 A;  1UDS A;  2PO1 B;  4GKJ I;  2V8Q B;  5KL6 A;  1FI4 A;  3EPL A;  2YWQ A;  5K36 C;  2EMK A;  4FW7 A;  4Z7Y A;  1I94 I;  1IQS A;  1ZM3 A;  3ADI A;  1Z0V A;  4DR5 E;  3M99 B;  2FGG A;  1ZBQ A;  3MSW A;  4DV2 E;  4PRV A;  2N8X A;  2EPZ A;  4AM3 A;  3UK3 C;  4FWG A;  3VYY A;  1N32 E;  2V2V A;  1EH8 A;  2GQ0 A;  4DV1 E;  2BA1 D;  2YRK A;  2YT4 A;  4DR7 I;  4DPX A;  4KHP I;  1Z0E A;  4RH8 A;  1X6H A;  2LO3 A;  2WBU A;  1YUI A;  5L3J A;  5LL6 R;  4LF6 I;  2WP8 B;  2ENA A;  4J3D A;  2JR1 A;  4WSG A;  1HNX I;  4IFD C;  1NHI A;  2VQF I;  1Y4U A;  4OO1 B;  2Q8U A;  4F2J C;  2EM3 A;  1N3G A;  4IS1 C;  2IES A;  4FWD A;  1UDO A;  2IOQ A;  4LCF A;  2EOY A;  2R42 A;  4BA1 A;  3T1H I;  3HPS A;  3CDJ A;  2EN6 A;  4KQV A;  2JPA A;  4JI7 I;  4O4K A;  1VI7 A;  4M2Z A;  4PU9 A;  1B63 A;  3ZZU A;  2DLK A;  3AUZ A;  2YTE A;  4DR7 E;  4KHP E;  4JI6 I;  2EMB A;  1IMU A;  2PNM A;  5LMU E;  4LF6 E;  2YRM A;  1YSA C;  4LFB E;  2DMI A;  2WNR B;  2V8P A;  3C6M A;  4KWY A;  4AIM A;  2VQF E;  1ZXM A;  4WUD A;  5C0X C;  1N36 I;  2O1T A;  3T1H E;  2NA2 A;  2NN6 B;  2EMH A;  1MX0 A;  5CFF E;  4DPW A;  4MU1 A;  4X62 I;  4U3B A;  4JI7 E;  2CT1 A;  1R6M A;  2WCC 3;  4ISA A;  4USK A;  1T4L B;  5AAS A;  4DV0 E;  2EFG A;  1Z0B A;  5A2Q Q;  3KZY A;  3J80 Q;  1FJG I;  2GO4 A;  2LJU A;  4GZN C;  2EN2 A;  1A6F A;  3VHT B;  4LF7 E;  2L2K B;  4OX9 E;  2IER A;  4WUB A;  4DV7 I;  1BBO A;  1KTV A;  1Y6Z A;  2R1F A;  2EPR A;  2EMZ A;  1TN9 A;  1UHZ A;  3WU4 A;  5A2Q C;  3J80 C;  2UXB I;  1D6T A;  2JY9 A;  1N34 I;  4WPY A;  1N0U A;  2UUC I;  4X62 E;  3ZKB A;  4WX9 A;  1PDA A;  2EPK X;  2WZO A;  1YZ9 A;  3KRN A;  2N3G A;  2RSM A;  2EPC A;  2PRT A;  2F1D A;  1KVK A;  1XMQ I;  2V34 A;  2UUA I;  4BCA A;  2HKJ A;  5KL5 A;  2X7I A;  3C4B A;  2LRS A;  2C38 A;  2GO3 A;  4JI4 I;  4QNJ A;  4B3R I;  4DV7 E;  1Z59 A;  2N3H A;  2EMW A;  4P7A A;  2RS7 A;  3THN A;  2HFU A;  4LOM A;  2UXB E;  2PO2 A;  4WYQ B;  2GHF A;  3EPH A;  2MC5 A;  4P7D A;  1N34 E;  4JI0 I;  4X64 E;  4R2A A;  3ZZT A;  2EP3 A;  4DR4 I;  2DB2 A;  4BC7 A;  1RC7 A;  2UUC E;  5K36 B;  2EM7 A;  1JK2 A;  2BR2 A;  1ZM4 A;  2EL4 A;  1XMQ E;  2YSO A;  1U2R A;  4FW6 A;  4BC9 A;  1H74 A;  4IZJ A;  4NXN I;  4DR2 I;  4DV5 I;  3BID A;  4JI4 E;  3PYG A;  3OTO E;  1UEK A;  2EM9 A;  1XNR I;  2JEA B;  5AC4 A;  3VYX A;  3HJC A;  5ELW A;  1DGC A;  1NZ0 A;  3P76 A;  4O43 A;  3M85 D;  1TF6 A;  2EN3 A;  3CDI A;  2EN1 A;  2YTQ A;  4BHB A;  2L92 A;  2L6M A;  2LJP A;  4JI0 E;  5JEA D;  4RPF A;  4TUI A;  4M0V A;  1H72 C;  4IFD B;  4DR4 E;  3BGH A;  4OZE A;  5DRP A;  4QNK A;  2EOR A;  5TSE A;  3DD6 A;  4J8Z A;  4BA2 B;  1WJP A;  1FNM A;  1EA6 A;  1J5E I;  4NXN E;  3D4J A;  3QT6 A;  2EOS A;  4DV5 E;  2O1U A;  4U3D A;  2VF3 A;  3VK6 A;  4NXM I;  2J7J A;  1YFH A;  2ADR A;  2MKD A;  1XNR E;  2BA0 D;  3JAM Q;  2PO1 A;  4BBY A;  4DPU A;  3J7A G;  5JEA F;  4WSP A;  1DQ3 A;  2EOZ A;  1Y5Y A;  2YPN A;  2GS8 A;  4URL A;  5AC5 A;  5DRO A;  5C0X B;  1A1I A;  4L5N C;  4JI5 E;  3B8H A;  4LF9 E;  2OI2 A;  4LF8 I;  5A6J A;  4X65 I;  2YTD A;  5JEA E;  2DMY A;  4R03 A;  4FWH A;  4EMD A;  4BS9 A;  3J7Y p;  2B3T B;  4P52 A;  2WP8 A;  1ELO A;  1A1L A;  2EZ6 A;  4LF5 E;  1K47 A;  2HK2 A;  2V2Q A;  4OO1 A;  4DU8 A;  4Z7C A;  4ZYG A;  4JI1 E;  1WUU A;  2UU9 I;  4R2Q A;  5FWK A;  2EL6 A;  2LUQ A;  2K4V A;  4BHC A;  1PJQ A;  1P42 A;  4IZJ D;  4LF8 E;  4HAC B;  3U1K A;  3T1Y I;  2EJ4 A;  4OKG A;  4X65 E;  3PS2 A;  3J81 Q;  3P3G A;  1PKP A;  2JE6 B;  2YZT A;  4X66 I;  4FW4 A;  1MGT A;  2ENH A;  1Z5A A;  2E5L I;  5LMU I;  4X8W A;  2KOU A;  1IBK E;  2WNR A;  4F9B B;  5DRR A;  1Z5C A;  3EPJ A;  2EMC A;  4WUC A;  3J81 C;  1XHK A;  3GCM A;  2M4I A;  4M9V C;  3BF2 A;  2Z5E A;  2UU9 E;  4HEI A;  2C39 B;  2NN6 A;  1B62 A;  5LLQ A;  2LBS B;  3HUL A;  3KZZ A;  4F54 A;  1EKZ A;  4I3H A;  1XXE A;  1DI2 A;  4LCH A;  3T1Y E;  2RPC A;  4M30 A;  1BBG A;  2EOQ A;  2EPO A;  2LJH A;  1ZR9 A;  2EM6 A;  2EPM X;  4I8O A;  4RHB B;  2DRP A;  4DV0 I;  2EMG A;  2LV2 A;  3JU0 A;  2EM0 A;  5KL4 A;  2I9I A;  5ADZ A;  4X66 E;  2L3C A;  1FKA E;  2E5L E;  2L8T A;  3PYF A;  4LF7 I;  1IBL I;  1NHH A;  2EN4 A;  3L7Z B;  1UIL A;  3B82 A;  2PNZ A;  3MHH C;  1PIE A;  5DNL A;  4B3S I;  4NHR A;  3P3C A;  3KWR A;  2JOB A;  1SFE A;  2M9A A;  4JG4 A;  4OO1 D;  1GTK A;  2JVA A;  5DNX A;  1EH7 A;  2JEB B;  5JEA A;  1WHN A;  1G2F C;  1H7S A;  1RRE A;  2LTS A;  1X49 A;  2JP9 A;  3LPS A;  1UBD C;  3F6H A;  4BMJ A;  1IBL E;  2Q2E B;  1EI1 A;  4JI8 I;  2A2C A;  2EQ1 A;  3M6A A;  2B9D A;  2EPA A;  2RQL A;  4LU9 A;  2RSI A;  1P47 A;  3C4T A;  4DR6 I;  2L33 A;  1AH5 A;  2J65 A;  2E1M A;  4B3S E;  2B7T A;  2YSP A;  2WBS A;  1Z0T A;  4X64 I;  1Z0W A;  2O1W A;  4BA1 B;  2LVH A;  3ZOQ B;  2IHR 1;  1USU A;  4OO1 F;  2EOI A;  1RHY A;  4GKK I;  4HTG A;  2EWL A;  3LML A;  2R76 A;  4JV5 E;  2NUG A;  1ZM2 A;  1WRJ A;  4F6M A;  3OTO I;  2NN6 D;  2V86 A;  2CZ9 A;  5GMD A;  2JEA A;  1T38 A;  4F9A B;  4OO1 E;  4JI8 E;  3QT5 A;  2B7V A;  1DAR A;  4DPY A;  4DV6 I;  2Z5B B;  5IT9 Q;  4DR6 E;  4YHH I;  5IXM B;  2MKN A;  1KKH A;  1PJT A;  4IFD A;  2G7H A;  3QG5 C;  5EL9 A;  4JI3 I;  2CSH A;  2EMY A;  3RMP A;  2EOH A;  4GKK E;  4NZV A;  1ZXN A;  2V2Z A;  4DXL A;  5IT9 C;  4BA2 A;  3H09 A;  2NN6 F;  5AE3 A;  2A25 A;  4IJD A;  3U1Y A;  1YYO A;  2WW4 A;  3HQ1 A;  3ZM7 A;  4MLV A;  2HJJ A;  2HFS A;  4UTG A;  5LMN I;  3JTZ A;  2HGH A;  1Z0C A;  4R8O A;  4DV6 E;  1VIS A;  3THO B;  4WXD A;  3PS3 A;  4IZK B;  2NN6 E;  2YU8 A;  2EOM A;  2BBG A;  4YHH E;  4DUY E;  4DUZ I;  4R2D A;  4DR5 I;  5AE2 A;  4LF4 E;  3FIG A;  4JI3 E;  1Y4S A;  1UDQ A;  2K7I A;  4LPF A;  4JI5 I;  1PJS A;  2M1S A;  4LF9 I;  2ZIT A;  2M7Q A;  5A6A A;  4ZVI A;  1HNW I;  2AE8 A;  4KZS A;  2RS6 A;  2BM1 A;  1QNT A;  2MC6 A;  2JXP A;  2PO0 B;  2ODR D;  3M85 G;  1GQE A;  1F2I G;  2YTI A;  4LF5 I;  4MU0 A;  5LMN E;  1WXR A;  4JI1 I;  5K36 D;  5A69 A;  4K0K I;  2YRH A;  1X5W A;  4DUZ E;  3H4L A;  3WU6 A;  1KYQ A;  3L00 A;  3BBG A;  3JAM C;  2C37 B;  3CWV A;  3OML A;  1NEI A;  2EQ0 A;  2JYA A;  2WBT A;  1N0V C;  5BR8 I;  1HNW E;  2X36 A;  2BA0 G;  2JE6 A;  2NPF A;  4UT4 A;  3M7N D;  1AAY A;  4O24 A;  3DF6 A;  4ZYE A;  1IBK I;  1X3C A;  1S4E A;  3TQM A;  2Z5C B;  5K36 F;  4IFD D;  5KL7 A;  1HNZ I;  1KJK A;  2E72 A;  1USV A;  2EN7 A;  3IWD A;  4K0K E;  1OYR A;  2MDR A;  2C39 A;  3QT7 A;  4HXZ A;  3ADJ A;  4B3T I;  4JI2 E;  1OYP A;  2HHH E;  5JEA C;  2VQE I;  5K36 E;  4DR1 I;  2EOX A;  1R6L A;  3K6Q A;  1FWL A;  3P06 A;  4ZYH A;  1T4O A;  2F8B A;  5BR8 E;  2RTX A;  1HR0 E;  1Z5B A;  1KIJ A;  3AV0 A;  3EQ1 A;  2GLI A;  4IFD F;  2UXC I;  2HK3 A;  2V89 A;  1B69 A;  5AE1 A;  3GME A;  1YHC A;  2EOO A;  2GPI A;  4R2E A;  5C0X D;  1WHQ A;  2EE8 A;  4O5G A;  3L7Z A;  3V5R A;  4WFT A;  3WU5 A;  2MDG A;  4B3T E;  4IFD E;  1IBM I; 
#chains in the Genus database with same CATH homology
 1HK7 A;  2VQE E;  1RR9 A;  3IWB A;  4DR1 E;  3ADG A;  3PYE A;  2V85 A;  1RQ0 A;  4MYT A;  1H73 A;  2UXC E;  4LFA E;  4DPT A;  4GKJ E;  1ZBT A;  3IWC A;  3J7A M;  3K17 A;  1I94 E;  1IBM E;  4M1K A;  3GON A;  4YY3 I;  4DMI A;  3K1J A;  3B78 A;  5GME A;  4JV5 I;  3V2U C;  1YYW A;  5IWA I;  3HXL A;  1X47 A;  4DV3 I;  1ZM9 A;  1PVG A;  5F3W A;  1T4N A;  3QT8 A;  2LUP B;  1BKN A;  2DIX A;  1HNX E;  4HYM A;  2Z5B A;  4AQY I;  4USM A;  2UXD I;  4Q28 A;  1GZ6 A;  2KHX A;  2NUF A;  3P1X A;  4YY3 E;  2CG9 A;  2E1R A;  4R1F A;  1S16 A;  1X48 A;  5IWA E;  4LTY A;  2LE2 A;  2CPN A;  1FWK A;  4L8N A;  4LFC I;  1N33 I;  4DV3 E;  4JI6 E;  2A2D A;  4N3O A;  3PRY A;  1XNQ I;  4AQY E;  4IZK A;  1N36 E;  4DUY I;  2V88 A;  2JOX A;  2KON A;  2UXD E;  3ZZ0 A;  1HNZ I;  2LMZ A;  2NUE A;  4LF4 I;  4DR3 I;  4DV4 I;  2VE7 C;  2IOP A;  3WU3 A;  4LFC E;  1N33 E;  1MG7 A;  1SR9 A;  1FJG E;  2LTR A;  1XNQ E;  2O1V A;  3Q6M A;  1XMO I;  1HNZ E;  1Z0G A;  4DR3 E;  4JYA I;  2VF1 A;  4DV4 E;  2R3V A;  2L2M A;  3K85 A;  4DU7 A;  1NHJ A;  2L2N A;  2AJ4 A;  2UUB I;  2UUA E;  2DEI A;  2Z5C A;  2H36 X;  2BV3 A;  2FTX B;  3HTX A;  2BM0 A;  4MYU A;  1YYK A;  2F4V I;  4B3R E;  2DSY A;  4B3M I;  1STU A;  1XMO E;  4HY1 A;  2JWO A;  2XEX A;  2J7K A;  4JI2 I;  3F0N A;  4FW9 A;  2HHH I;  4HAC A;  4JYA E;  1OJ4 A;  3LTO A;  1HR0 I;  1O0W A;  3ZKD A;  4XTJ A;  2ZM6 I;  2HKE A;  1QZR A;  3ADL A;  2ZBK B;  4DR2 E;  2UUB E;  3DJW A;  4IZJ B;  4GEQ B;  5DNY A;  1MU5 A;  5FLX Q;  2F4V E;  3PYD A;  4PRX A;  4B3M E;  4F9C B;  4ED4 A;  1QU6 A;  3LLH A;  3HPZ A;  4DR5 I;  2FV4 B;  4DV2 I;  5T6J A;  5FLX C;  2V83 A;  2L3J A;  1H7U A;  4FN5 A;  4DKK A;  1J26 A;  4TUG A;  3Q6N A;  1N32 I;  3LNU A;  2DEJ A;  2CGE A;  2PNL A;  4DV1 I;  2ZM6 E;  4OOG C;  4LFA I;  1J5E E;  2V87 A;  2ODR C;  3F6G A;  4NXM E;  3Q1Q A;  4P78 A;  4GKJ I;  2V8Q B;  1FI4 A;  4Z7Y A;  1I94 I;  1ZM3 A;  3ADI A;  1Z0V A;  4DR5 E;  4PRV A;  2FGG A;  1ZBQ A;  3MSW A;  4DV2 E;  4FWG A;  3VYY A;  1N32 E;  2V2V A;  2GQ0 A;  4DV1 E;  4DR7 I;  2YT4 A;  4DPX A;  4KHP I;  1Z0E A;  5L3J A;  4LF6 I;  5LL6 R;  4LFB I;  1HNX I;  2JR1 A;  1NHI A;  2VQF I;  1Y4U A;  4FWD A;  2IOQ A;  2R42 A;  3T1H I;  3HPS A;  4KQV A;  4JI7 I;  4M2Z A;  4PU9 A;  1B63 A;  3ZZU A;  3AUZ A;  4DR7 E;  4KHP E;  4JI6 I;  2PNM A;  5LMU E;  4LF6 E;  4OX9 I;  4LFB E;  2V8P A;  2VQF E;  1ZXM A;  4WUD A;  1N36 I;  2O1T A;  3T1H E;  2NA2 A;  1MX0 A;  5CFF E;  4DPW A;  4X62 I;  4JI7 E;  4USK A;  1T4L B;  5AAS A;  4DV0 E;  2EFG A;  1Z0B A;  5A2Q Q;  3J80 Q;  1FJG I;  1A6F A;  4WUB A;  4LF7 E;  2L2K B;  4OX9 E;  4DV7 I;  1KTV A;  1Y6Z A;  1UHZ A;  3WU4 A;  5A2Q C;  3J80 C;  2UXB I;  1D6T A;  2JY9 A;  1N34 I;  4WPY A;  1N0U A;  2UUC I;  4X62 E;  3ZKB A;  2WZO A;  1YZ9 A;  2N3G A;  2RSM A;  1KVK A;  1XMQ I;  2V34 A;  2UUA I;  4BCA A;  2HKJ A;  2X7I A;  3C4B A;  2LRS A;  4JI4 I;  4B3R I;  4DV7 E;  1Z59 A;  2N3H A;  4P7A A;  2RS7 A;  2HFU A;  2UXB E;  4WYQ B;  1N34 E;  2MC5 A;  4P7D A;  4JI0 I;  4X64 E;  3ZZT A;  4DR4 I;  2DB2 A;  4BC7 A;  1RC7 A;  2UUC E;  1ZM4 A;  1XMQ E;  4DR2 I;  1U2R A;  4IZJ A;  4BC9 A;  1H74 A;  4NXN I;  4DV5 I;  4JI4 E;  3PYG A;  3OTO E;  1UEK A;  1XNR I;  3VYX A;  3HJC A;  1NZ0 A;  2L92 A;  2L6M A;  2LJP A;  4JI0 E;  4RPF A;  4TUI A;  4M0V A;  1H72 C;  4DR4 E;  4J8Z A;  1FNM A;  1EA6 A;  1J5E I;  4NXN E;  3D4J A;  3QT6 A;  4DV5 E;  2O1U A;  4NXM I;  2VF3 A;  3VK6 A;  3JAM Q;  1XNR E;  4BBY A;  3J7A G;  4WSP A;  1DQ3 A;  2GS8 A;  4URL A;  4L5N C;  4JI5 E;  3B8H A;  4LF9 E;  2OI2 A;  4LF8 I;  4X65 I;  2DMY A;  4R03 A;  4FWH A;  4EMD A;  4BS9 A;  3J7Y p;  2B3T B;  4P52 A;  1ELO A;  2EZ6 A;  4LF5 E;  1K47 A;  2HK2 A;  2V2Q A;  4DU8 A;  4Z7C A;  4JI1 E;  1WUU A;  2UU9 I;  5FWK A;  2LUQ A;  2K4V A;  4IZJ D;  4LF8 E;  4HAC B;  3T1Y I;  4X65 E;  3J81 Q;  1PKP A;  2YZT A;  4X66 I;  1Z5A A;  2E5L I;  5LMU I;  4X8W A;  2KOU A;  1IBK E;  4F9B B;  1Z5C A;  4WUC A;  3J81 C;  1XHK A;  2M4I A;  2Z5E A;  2UU9 E;  1B62 A;  2LBS B;  4I3H A;  3HUL A;  4F54 A;  1EKZ A;  1DI2 A;  3T1Y E;  4M30 A;  2LJH A;  4DV0 I;  4I8O A;  2L3C A;  3JU0 A;  1FKA E;  4DPU A;  4X66 E;  5ADZ A;  2E5L E;  2L8T A;  3PYF A;  4LF7 I;  1IBL I;  1NHH A;  1UIL A;  3B82 A;  1PIE A;  4B3S I;  3KWR A;  2JOB A;  4JG4 A;  2JVA A;  1WHN A;  1H7S A;  1RRE A;  1X49 A;  2LTS A;  3LPS A;  3F6H A;  4BMJ A;  1IBL E;  2Q2E B;  1EI1 A;  4JI8 I;  2A2C A;  3M6A A;  2B9D A;  4DR6 I;  4LU9 A;  3C4T A;  2L33 A;  2E1M A;  4B3S E;  2B7T A;  1Z0T A;  4X64 I;  1Z0W A;  2O1W A;  3ZOQ B;  2IHR 1;  1USU A;  4GKK I;  2EWL A;  3LML A;  4JV5 E;  2NUG A;  1ZM2 A;  3OTO I;  2V86 A;  2CZ9 A;  5GMD A;  4F9A B;  4JI8 E;  3QT5 A;  2B7V A;  1DAR A;  4DPY A;  4DV6 I;  2Z5B B;  5IT9 Q;  4DR6 E;  4YHH I;  1KKH A;  2G7H A;  4JI3 I;  3RMP A;  4GKK E;  1ZXN A;  2V2Z A;  4DXL A;  5IT9 C;  3H09 A;  5AE3 A;  1YYO A;  2WW4 A;  3HQ1 A;  3ZM7 A;  2HFS A;  4UTG A;  5LMN I;  3JTZ A;  1Z0C A;  4R8O A;  4DV6 E;  1VIS A;  4IZK B;  4DUY E;  4DUZ I;  4YHH E;  5AE2 A;  4LF4 E;  3FIG A;  4JI3 E;  1Y4S A;  4JI5 I;  4LF9 I;  2M1S A;  2ZIT A;  2M7Q A;  4ZVI A;  1HNW I;  4KZS A;  2RS6 A;  2BM1 A;  2MC6 A;  2ODR D;  1GQE A;  4LF5 I;  5LMN E;  1WXR A;  4JI1 I;  4K0K I;  4DUZ E;  3H4L A;  3WU6 A;  3JAM C;  3CWV A;  3OML A;  1N0V C;  5BR8 I;  1HNW E;  2X36 A;  4UT4 A;  2NPF A;  3DF6 A;  1IBK I;  1S4E A;  2Z5C B;  1USV A;  4K0K E;  3IWD A;  3QT7 A;  2MDR A;  4HXZ A;  3ADJ A;  4B3T I;  4JI2 E;  2HHH E;  2VQE I;  4DR1 I;  3P06 A;  3K6Q A;  1FWL A;  1T4O A;  2F8B A;  5BR8 E;  2RTX A;  1HR0 E;  1Z5B A;  1KIJ A;  3AV0 A;  2UXC I;  2HK3 A;  2V89 A;  5AE1 A;  1WHQ A;  3V5R A;  3WU5 A;  4WFT A;  4B3T E;  1IBM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...