3J81Q

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
b'TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j81Q00
1ELOA 1HNXI 2UUBI 4OX9I 4JI0I 2Q2EB 3J80C 2VQEI 4JI2E 4KQVA 4DV2E 4X62I 5LMUI 3PYEA 1MG7A 3J81C 1H7UA 4LF6I 4DV4I 5IT9C 4YHHE 4B3TI 4FWGA 2HFSA 3ZKBA 2UU9E 2BV3A 3GONA 4DR2E 4DV7E 4JI4E 4P7AA 2HK2A 2HHHI 1A6FA 1H73A 1ZM2A 2E1RA 3B82A 4DR5E 2UXCE 4MYTA 2E5LI 1IBKI 4JI1E 2DEJA 2UUCE 2A2CA 4DPWA 1FI4A 3QT7A 4WUDA 3T1HI 3J7AG 2WW4A 4B3ME 3WU4A 2ZM6E 1IBLE 3WU6A 1U2RA 4URLA 4JI3E 4B3SE 4HXZA 1N36E 2HK3A 3K1JA 4X66E 4YHHI 4M1KA 4GKJE 2V8PA 4JI6E 1WUUA 4DR7I 4PRXA 4K0KE 4NXNE 1Z59A 2CZ9A 1Z0CA 4JI8E 4LF8E 4USKA 4I3HA 1ZM4A 1UEKA 4DR2I 2UXDE 2VQFI 4LF9E 1PKPA 4LF5E 4DR6I 1HNWE 3PYGA 4XTJA 5BR8E 4FWHA 4LFCE 1OJ4A 1J5EE 3PYDA 1KVKA 2ZBKB 4DV0E 4B3MI 4X64E 4DV6I 4RPFA 3F0NA 1XMQE 1XMOI 4EMDA 1S4EA 4PU9A 4YY3E 1HR0E 3K17A 1FJGE 3V2UC 1K47A 4DR3I 4JI5E 4JI7E 2V2VA 4LFBE 2BM0A 4LF7E 1PVGA 1XNRI 3QT5A 4LF4E 1KKHA 4JV5E 4JYAE 4DUYI 4LFAI 1XNQI 4B3RE 5IWAE 3D4JA 1N34E 4X65I 1Z0EA 3ZM7A 1DARA 1FWLA 2V2QA 3H4LA 1ZM3A 4DR4E 3ZZ0A 1ZXMA 3B8HA 2F4VI 5LMNI 4DV5I 1EA6A 3Q1QA 3ZZUA 1HNZE 2EFGA 5LL6R 4DU7A 4FW9A 2HKEA 4PRVA 4JI2I 2X7IA 4DV2I 2GS8A 4HY1A 2V2ZA 1N32E 1IBME 1NHJA 2UXBE 4LF7I 5A2QQ 4USMA 5L3JA 1FKAE 3LTOA 5FLXQ 1MX0A 4GKKE 1NHIA 2UU9I 3QT6A 1HNXE 3LPSA 1VISA 4DV7I 4JI4I 2UUBE 4OX9E 4JI0E 3JAMQ 4HACA 2VQEE 1BKNA 4X62E 1H7SA 2UXCI 5LMUE 4DR5I 1ZM9A 4LF6E 4DV4E 1FWKA 4JI1I 2UUCI 4DPUA 4P52A 2UUAE 4B3TE 3V5RA 3T1YE 1NZ0A 2ZM6I 1IBLI 3J7AM 4JI3I 1RR9A 1PIEA 4B3SI 1N36I 4DV3E 1B62A 3OTOE 3ZZTA 4X66I 2UXBI 2HHHE 4GKJI 4DPYA 2BM1A 3PYFA 4Z7CA 2A2DA 3WU3A 4DV1E 4JI6I 2E5LE 1IBKE 4K0KI 4NXNI 4JI8I 4LF8I 3J80Q 1NHHA 2LJPA 3T1HE 2UXDI 4LF9I 4R1FA 3J81Q 1I94E 4LF5I 5IT9Q 3QT8A 1HNWI 5BR8I 4LFCI 2X36A 2NPFA 4WUCA 1J5EI 1H72C 2DEIA 2XEXA 5GMEA 2UUAI 1Z0WA 3T1YI 1Z0GA 1N0UA 1Z0BA 1B63A 4Z7YA 4DV0I 4DR7E 4X64I 1Z0TA 5GMDA 1ZXNA 4DXLA 1N33E 1XMQI 1EI1A 2VQFE 4KHPE 4UTGA 4YY3I 1HR0I 2V34A 1N0VC 4DV3I 4AQYE 1FJGI 3OTOI 4DR1E 4DR6E 4DUZE 1XHKA 3CWVA 2R42A 4DPTA 4NXME 4DV1I 3WU5A 4JI5I 4JI7I 4LFBI 4HACB 1MU5A 3HULA 4FWDA 1QZRA 3M6AA 4LF4I 4DV6E 4JV5I 5A2QC 1I94I 1D6TA 4JYAI 1XMOE 4B3RI 3ZKDA 4ED4A 5IWAI 1N34I 3B78A 4MYUA 5FLXC 2VF3A 1RREA 2HKJA 4DR3E 3LNUA 1KIJA 2OI2A 3JAMC 4DR4I 1H74A 2AJ4A 1N33I 4DU8A 1XNRE 4KHPI 1KTVA 1HNZI 4AQYI 2ZITA 4DR1I 4DUYE 4LFAE 4DUZI 1XNQE 1S16A 4X65E 4DPXA 4NXMI 4UT4A 1Z0VA 1Z5CA 2R3VA 1N32I 4HYMA 4JG4A 1Z5BA 1IBMI 2HFUA 4WUBA 1FNMA 1Z5AA 4FN5A 4ZVIA 2F4VE 2J7KA 5LMNE 4DV5E 4GKKI
chains in the Genus database with same CATH superfamily
4IFDD 1ELOA 1HNXI 4BA2B 2UUBI 4OX9I 2Z5BA 4JI0I 1Y5YA 2Q2EB 5DNXA 3J80C 2C37A 4MU3A 2VQEI 4JI2E 4KQVA 3NZKA 4DV2E 2IOQA 4X62I 5LMUI 3PYEA 1MG7A 3J81C 1H7UA 3PRYA 4LF6I 4DV4I 5IT9C 4YHHE 4LOMA 2IESA 4B3TI 3P3EA 4LCFA 1E3HA 4FWGA 2HFSA 2CGEA 4IZKB 3ZKBA 2UU9E 5K36D 2BV3A 3GONA 5DNLA 1YH8A 4DR2E 4DV7E 4JI4E 4P7AA 2HK2A 3M7ND 2HHHI 2Z5EA 3GLLA 1A6FA 1H73A 1ZM2A 2E1RA 3B82A 4DR5E 2UXCE 4AM3A 1YHCA 3CDIA 3HKMA 4MYTA 2E5LI 1IBKI 4JI1E 2DEJA 4IZKA 2UUCE 2A2CA 2GO3A 3PS2A 4DPWA 1FI4A 3QT7A 4IZJD 4WUDA 5JEAD 3T1HI 3J7AG 1USUA 2WW4A 4B3ME 2C39B 3WU4A 2ZM6E 1IBLE 4QNJA 3WU6A 1U2RA 4URLA 4JI3E 4OZEA 4B3SE 4HXZA 4MDTA 1N36E 2HK3A 3K1JA 5C0XF 5ELWA 4X66E 4YHHI 4M1KA 4GKJE 2V8PA 2JE6B 4ISAA 4JI6E 1WUUA 1UDQA 1VI7A 4FW6A 4DR7I 4PRXA 4K0KE 4NXNE 1Z59A 2CZ9A 1Z0CA 4JI8E 4LF8E 4USKA 4I3HA 1ZM4A 1UEKA 4DR2I 2UXDE 2VQFI 5DRRA 4BA1A 4LF9E 3L7ZA 1PKPA 4OO1C 5C0XC 4LF5E 4DR6I 1HNWE 3PYGA 4XTJA 5BR8E 4FWHA 4LFCE 2Z5BB 1R6MA 1OJ4A 4FW5A 1J5EE 3HJCA 1USVA 3PYDA 4MU1A 1KVKA 2ZBKB 4DV0E 4LCGA 4X64E 4B3MI 4DV6I 4RPFA 5EL9A 4U3BA 3F0NA 1XMQE 4QNKA 1XMOI 4EMDA 1S4EA 2PNMA 4PU9A 4YY3E 4OO1A 5C0XA 1HR0E 4IFDC 5FWKA 2GO4A 2NN6D 1P42A 3K17A 2NN6C 1FJGE 5K36F 3V2UC 2O1VA 1K47A 4DR3I 4IS9A 4JI5E 2JT2A 4JI7E 3B4TA 2V2VA 4LFBE 4AIMA 2PO0B 2BM0A 4LF7E 1PVGA 1XNRI 2J65A 4OKGA 3QT5A 4LF4E 1KKHA 4JV5E 3Q6NA 4JYAE 4DUYI 4LFAI 1XNQI 4B3RE 4FW4A 5IWAE 3D4JA 1N34E 5K36C 4AIDA 1OYPA 4X65I 1Z0EA 3ZM7A 1DARA 3U1KA 2CG9A 1FWLA 2PO0A 2V2QA 3H4LA 1ZM3A 4DR4E 3CDJA 1ZXMA 3ZZ0A 3B8HA 2F4VI 5LMNI 4DV5I 5DRQA 1EA6A 3Q1QA 1Y60A 3ZZUA 1HNZE 2EFGA 3Q6MA 5LL6R 5JEAC 4DU7A 4FW9A 2HKEA 2WP8B 3PS3A 5K36A 4PRVA 4JI2I 2X7IA 1OYSA 4DV2I 2GS8A 4HY1A 4BA1B 3GMEA 3P76A 2V2ZA 3L7ZB 1N32E 4OO1F 2O3ZA 1IBME 1NHJA 4LCHA 2UXBE 4LF7I 5A2QQ 1RHYA 4USMA 5L3JA 2C38B 1FKAE 3LTOA 5FLXQ 2WP8A 3K85A 2BA1D 1MX0A 4IZJA 4GKKE 1NHIA 5JEAA 2UU9I 3QT6A 1HNXE 3LPSA 1VISA 4DV7I 2WNRB 4JI4I 2UUBE 4OX9E 4JI0E 3JAMQ 4HACA 2O1WA 2VQEE 1BKNA 1Y6ZA 3H1CA 4X62E 1H7SA 2UXCI 5LMUE 5DRPA 4DR5I 4IFDF 4OO1B 5C0XB 2NN6F 2C38A 1ZM9A 2IERA 4LF6E 4DV4E 1FWKA 4JI1I 2UUCI 4DPUA 4P52A 2UUAE 2Z5CB 2CVEA 4B3TE 3V5RA 3T1YE 1Y4UA 2O1UA 1NZ0A 2WNRA 2ZM6I 1IBLI 2GQ0A 2F1DA 3J7AM 4JI3I 1UDSA 1RR9A 2BR2A 1PIEA 4B3SI 4OO1E 5C0XE 1OYRA 1N36I 4DV3E 1B62A 2PNZA 3OTOE 3ZZTA 4X66I 2PO2B 2UXBI 2HHHE 4GKJI 4IFDB 2NN6B 4DPYA 2Z5CA 2BM1A 3PYFA 4Z7CA 2A2DA 3WU3A 4DV1E 4JI6I 2E5LE 1IBKE 4K0KI 4NXNI 2BA1G 2PNLA 4JI8I 4LF8I 3J80Q 1NHHA 1R6LA 2LJPA 3T1HE 2UXDI 4FW3A 4LF9I 4R1FA 3J81Q 1I94E 2VESA 4LF5I 2PO2A 5IT9Q 3QT8A 4IFDA 4IFDE 1HNWI 3KRNA 2NN6A 2NN6E 5JEAF 5BR8I 2BA0G 4LFCI 2X36A 1E3PA 2JEAA 2NPFA 1UDOA 4WUCA 5K36B 1J5EI 1H72C 2DEIA 2XEXA 5GMEA 2UUAI 1UDNA 1Z0WA 3T1YI 1Z0GA 1N0UA 1Z0BA 1B63A 3M85G 4Z7YA 4DV0I 4BA2A 4DR7E 4X64I 1Z0TA 5GMDA 1ZXNA 4DXLA 1N33E 1XMQI 1EI1A 2JEBB 2VQFE 4KHPE 4UTGA 4YY3I 1HR0I 2V34A 1N0VC 4DV3I 4AQYE 1FJGI 3OTOI 4DR1E 4IZJB 5K36E 3P3GA 4DR6E 4DUZE 1XHKA 5JEAB 1HK7A 3CWVA 2R42A 4DPTA 2PO1B 4NXME 4DV1I 3WU5A 4JI5I 4JI7I 4LFBI 4HACB 2AE8A 3P3CA 1MU5A 3HULA 4FWDA 5DROA 2JEBA 1QZRA 4MU0A 2IOPA 3M6AA 4LF4I 4J3DA 4DV6E 1XXEA 4JV5I 5A2QC 1I94I 1D6TA 4JYAI 1XMOE 3DD6A 4B3RI 3ZKDA 5JEAE 4FW7A 4ED4A 5IWAI 1N34I 3B78A 4N3OA 4MYUA 5FLXC 2PO1A 2O1TA 2VF3A 1RREA 3UHMA 2HKJA 4NBQA 4GQUA 4MQYA 4DR3E 3LNUA 1KIJA 3PS1A 2OI2A 2BR2B 3JAMC 2BA0D 4DR4I 2PNZB 2C39A 1H74A 2AJ4A 4LPFA 1N33I 4DU8A 1XNRE 4KHPI 1KTVA 1HNZI 3M85D 4AQYI 2ZITA 4DR1I 5C0XD 4DUYE 4OO1D 4LFAE 4DUZI 1XNQE 3M7NG 1S16A 4U3DA 4X65E 4DPXA 2JE6A 1Y4SA 4NXMI 4UT4A 1Z0VA 1Z5CA 3GCMA 3U1YA 3P06A 2C37B 2R3VA 4MU4A 1N32I 4HYMA 4JG4A 1Z5BA 1IBMI 2HFUA 4WUBA 1FNMA 1Z5AA 4FN5A 2JEAB 4ZVIA 2F4VE 2J7KA 5LMNE 4DV5E 4GKKI 5EKWA
chains in the Genus database with same CATH topology
1ELOA 1HNXI 2UUBI 4OX9I 2Z5BA 4JI0I 2Q2EB 3J80C 2VQEI 4JI2E 4KQVA 4DV2E 2IOQA 4X62I 5LMUI 3PYEA 1MG7A 3J81C 1H7UA 3PRYA 4LF6I 4DV4I 5IT9C 4YHHE 4B3TI 4FWGA 2HFSA 2CGEA 4IZKB 3ZKBA 2UU9E 2BV3A 3GONA 4DR2E 4DV7E 4JI4E 4P7AA 2HK2A 2HHHI 2Z5EA 1A6FA 1H73A 1ZM2A 2E1RA 3B82A 4DR5E 2UXCE 4MYTA 2E5LI 1IBKI 4JI1E 2DEJA 4IZKA 2UUCE 2A2CA 4DPWA 1FI4A 3QT7A 4IZJD 4WUDA 3T1HI 3J7AG 1USUA 2WW4A 4B3ME 3WU4A 2ZM6E 1IBLE 3WU6A 1U2RA 4URLA 4JI3E 4B3SE 4HXZA 1N36E 2HK3A 3K1JA 4X66E 4YHHI 4M1KA 4GKJE 2V8PA 4JI6E 1WUUA 4DR7I 4PRXA 4K0KE 4NXNE 1Z59A 2CZ9A 1Z0CA 4JI8E 4LF8E 4USKA 4I3HA 1ZM4A 1UEKA 4DR2I 2UXDE 2VQFI 4LF9E 1PKPA 4LF5E 4DR6I 1HNWE 3PYGA 4XTJA 5BR8E 4FWHA 4LFCE 2Z5BB 1OJ4A 1J5EE 3HJCA 1USVA 3PYDA 1KVKA 2ZBKB 4DV0E 4B3MI 4X64E 4DV6I 4RPFA 3F0NA 1XMQE 1XMOI 4EMDA 1S4EA 2PNMA 4PU9A 4YY3E 1HR0E 5FWKA 3K17A 1FJGE 3V2UC 2O1VA 1K47A 4DR3I 4JI5E 4JI7E 2V2VA 4LFBE 2BM0A 4LF7E 1PVGA 1XNRI 3QT5A 4LF4E 1KKHA 4JV5E 3Q6NA 4JYAE 4DUYI 4LFAI 1XNQI 4B3RE 5IWAE 3D4JA 1N34E 4X65I 1Z0EA 3ZM7A 1DARA 2CG9A 1FWLA 2V2QA 3H4LA 1ZM3A 4DR4E 3ZZ0A 1ZXMA 3B8HA 2F4VI 5LMNI 4DV5I 1EA6A 3Q1QA 3ZZUA 1HNZE 2EFGA 3Q6MA 5LL6R 4DU7A 4FW9A 2HKEA 4PRVA 4JI2I 2X7IA 4DV2I 2GS8A 4HY1A 2V2ZA 1N32E 1IBME 1NHJA 2UXBE 4LF7I 5A2QQ 4USMA 5L3JA 1FKAE 3LTOA 5FLXQ 3K85A 1MX0A 4IZJA 4GKKE 1NHIA 2UU9I 3QT6A 1HNXE 3LPSA 1VISA 4DV7I 4JI4I 2UUBE 4OX9E 4JI0E 3JAMQ 4HACA 2O1WA 2VQEE 1BKNA 1Y6ZA 4X62E 1H7SA 2UXCI 5LMUE 4DR5I 1ZM9A 4LF6E 4DV4E 1FWKA 4JI1I 2UUCI 4DPUA 4P52A 2UUAE 2Z5CB 4B3TE 3V5RA 3T1YE 1Y4UA 2O1UA 1NZ0A 2ZM6I 1IBLI 2GQ0A 3J7AM 4JI3I 1RR9A 1PIEA 4B3SI 1N36I 4DV3E 1B62A 3OTOE 3ZZTA 4X66I 2UXBI 2HHHE 4GKJI 4DPYA 2Z5CA 2BM1A 3PYFA 4Z7CA 2A2DA 3WU3A 4DV1E 4JI6I 2E5LE 1IBKE 4K0KI 4NXNI 2PNLA 4JI8I 4LF8I 3J80Q 1NHHA 2LJPA 3T1HE 2UXDI 4LF9I 4R1FA 3J81Q 1I94E 4LF5I 5IT9Q 3QT8A 1HNWI 5BR8I 4LFCI 2X36A 2NPFA 4WUCA 1J5EI 1H72C 2DEIA 2XEXA 5GMEA 2UUAI 1Z0WA 3T1YI 1Z0GA 1N0UA 1Z0BA 1B63A 4Z7YA 4DV0I 4DR7E 4X64I 1Z0TA 5GMDA 1ZXNA 4DXLA 1N33E 1XMQI 1EI1A 2VQFE 4KHPE 4UTGA 4YY3I 1HR0I 2V34A 1N0VC 4AQYE 4DV3I 1FJGI 3OTOI 4DR1E 4IZJB 4DR6E 4DUZE 1XHKA 1HK7A 3CWVA 2R42A 4DPTA 4NXME 4DV1I 3WU5A 4JI5I 4JI7I 4LFBI 4HACB 1MU5A 3HULA 4FWDA 1QZRA 2IOPA 3M6AA 4LF4I 4DV6E 4JV5I 5A2QC 1I94I 1D6TA 4JYAI 1XMOE 4B3RI 3ZKDA 4ED4A 5IWAI 1N34I 3B78A 4N3OA 4MYUA 5FLXC 2O1TA 2VF3A 1RREA 2HKJA 4DR3E 3LNUA 1KIJA 2OI2A 3JAMC 4DR4I 1H74A 2AJ4A 1N33I 4DU8A 1XNRE 4KHPI 1KTVA 1HNZI 4AQYI 2ZITA 4DR1I 4DUYE 4LFAE 4DUZI 1XNQE 1S16A 4X65E 4DPXA 1Y4SA 4NXMI 4UT4A 1Z0VA 1Z5CA 3P06A 2R3VA 1N32I 4HYMA 4JG4A 1Z5BA 1IBMI 2HFUA 4WUBA 1FNMA 1Z5AA 4FN5A 4ZVIA 2F4VE 2J7KA 5LMNE 4DV5E 4GKKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELO A;  1HNX I;  2UUB I;  4OX9 I;  4JI0 I;  2Q2E B;  3J80 C;  2VQE I;  4JI2 E;  4KQV A;  4DV2 E;  4X62 I;  5LMU I;  3PYE A;  1MG7 A;  3J81 C;  1H7U A;  4LF6 I;  4DV4 I;  5IT9 C;  4YHH E;  4B3T I;  4FWG A;  2HFS A;  3ZKB A;  2UU9 E;  2BV3 A;  3GON A;  4DR2 E;  4DV7 E;  4JI4 E;  4P7A A;  2HK2 A;  2HHH I;  1A6F A;  1H73 A;  1ZM2 A;  2E1R A;  3B82 A;  4DR5 E;  2UXC E;  4MYT A;  2E5L I;  1IBK I;  4JI1 E;  2DEJ A;  2UUC E;  2A2C A;  4DPW A;  1FI4 A;  3QT7 A;  4WUD A;  3T1H I;  3J7A G;  2WW4 A;  4B3M E;  3WU4 A;  2ZM6 E;  1IBL E;  3WU6 A;  1U2R A;  4URL A;  4JI3 E;  4B3S E;  4HXZ A;  1N36 E;  2HK3 A;  3K1J A;  4X66 E;  4YHH I;  4M1K A;  4GKJ E;  2V8P A;  4JI6 E;  1WUU A;  4DR7 I;  4PRX A;  4K0K E;  4NXN E;  1Z59 A;  2CZ9 A;  1Z0C A;  4JI8 E;  4LF8 E;  4USK A;  4I3H A;  1ZM4 A;  1UEK A;  4DR2 I;  2UXD E;  2VQF I;  4LF9 E;  1PKP A;  4LF5 E;  4DR6 I;  1HNW E;  3PYG A;  4XTJ A;  5BR8 E;  4FWH A;  4LFC E;  1OJ4 A;  1J5E E;  3PYD A;  1KVK A;  2ZBK B;  4DV0 E;  4B3M I;  4X64 E;  4DV6 I;  4RPF A;  3F0N A;  1XMQ E;  1XMO I;  4EMD A;  1S4E A;  4PU9 A;  4YY3 E;  1HR0 E;  3K17 A;  1FJG E;  3V2U C;  1K47 A;  4DR3 I;  4JI5 E;  4JI7 E;  2V2V A;  4LFB E;  2BM0 A;  4LF7 E;  1PVG A;  1XNR I;  3QT5 A;  4LF4 E;  1KKH A;  4JV5 E;  4JYA E;  4DUY I;  4LFA I;  1XNQ I;  4B3R E;  5IWA E;  3D4J A;  1N34 E;  4X65 I;  1Z0E A;  3ZM7 A;  1DAR A;  1FWL A;  2V2Q A;  3H4L A;  1ZM3 A;  4DR4 E;  3ZZ0 A;  1ZXM A;  3B8H A;  2F4V I;  5LMN I;  4DV5 I;  1EA6 A;  3Q1Q A;  3ZZU A;  1HNZ E;  2EFG A;  5LL6 R;  4DU7 A;  4FW9 A;  2HKE A;  4PRV A;  4JI2 I;  2X7I A;  4DV2 I;  2GS8 A;  4HY1 A;  2V2Z A;  1N32 E;  1IBM E;  1NHJ A;  2UXB E;  4LF7 I;  5A2Q Q;  4USM A;  5L3J A;  1FKA E;  3LTO A;  5FLX Q;  1MX0 A;  4GKK E;  1NHI A;  2UU9 I;  3QT6 A;  1HNX E;  3LPS A;  1VIS A;  4DV7 I;  4JI4 I;  2UUB E;  4OX9 E;  4JI0 E;  3JAM Q;  4HAC A;  2VQE E;  1BKN A;  4X62 E;  1H7S A;  2UXC I;  5LMU E;  4DR5 I;  1ZM9 A;  4LF6 E;  4DV4 E;  1FWK A;  4JI1 I;  2UUC I;  4DPU A;  4P52 A;  2UUA E;  4B3T E;  3V5R A;  3T1Y E;  1NZ0 A;  2ZM6 I;  1IBL I;  3J7A M;  4JI3 I;  1RR9 A;  1PIE A;  4B3S I;  1N36 I;  4DV3 E;  1B62 A;  3OTO E;  3ZZT A;  4X66 I;  2UXB I;  2HHH E;  4GKJ I;  4DPY A;  2BM1 A;  3PYF A;  4Z7C A;  2A2D A;  3WU3 A;  4DV1 E;  4JI6 I;  2E5L E;  1IBK E;  4K0K I;  4NXN I;  4JI8 I;  4LF8 I;  3J80 Q;  1NHH A;  2LJP A;  3T1H E;  2UXD I;  4LF9 I;  4R1F A;  3J81 Q;  1I94 E;  4LF5 I;  5IT9 Q;  3QT8 A;  1HNW I;  5BR8 I;  4LFC I;  2X36 A;  2NPF A;  4WUC A;  1J5E I;  1H72 C;  2DEI A;  2XEX A;  5GME A;  2UUA I;  1Z0W A;  3T1Y I;  1Z0G A;  1N0U A;  1Z0B A;  1B63 A;  4Z7Y A;  4DV0 I;  4DR7 E;  4X64 I;  1Z0T A;  5GMD A;  1ZXN A;  4DXL A;  1N33 E;  1XMQ I;  1EI1 A;  2VQF E;  4KHP E;  4UTG A;  4YY3 I;  1HR0 I;  2V34 A;  1N0V C;  4DV3 I;  4AQY E;  1FJG I;  3OTO I;  4DR1 E;  4DR6 E;  4DUZ E;  1XHK A;  3CWV A;  2R42 A;  4DPT A;  4NXM E;  4DV1 I;  3WU5 A;  4JI5 I;  4JI7 I;  4LFB I;  4HAC B;  1MU5 A;  3HUL A;  4FWD A;  1QZR A;  3M6A A;  4LF4 I;  4DV6 E;  4JV5 I;  5A2Q C;  1I94 I;  1D6T A;  4JYA I;  1XMO E;  4B3R I;  3ZKD A;  4ED4 A;  5IWA I;  1N34 I;  3B78 A;  4MYU A;  5FLX C;  2VF3 A;  1RRE A;  2HKJ A;  4DR3 E;  3LNU A;  1KIJ A;  2OI2 A;  3JAM C;  4DR4 I;  1H74 A;  2AJ4 A;  1N33 I;  4DU8 A;  1XNR E;  4KHP I;  1KTV A;  1HNZ I;  4AQY I;  2ZIT A;  4DR1 I;  4DUY E;  4LFA E;  4DUZ I;  1XNQ E;  1S16 A;  4X65 E;  4DPX A;  4NXM I;  4UT4 A;  1Z0V A;  1Z5C A;  2R3V A;  1N32 I;  4HYM A;  4JG4 A;  1Z5B A;  1IBM I;  2HFU A;  4WUB A;  1FNM A;  1Z5A A;  4FN5 A;  4ZVI A;  2F4V E;  2J7K A;  5LMN E;  4DV5 E;  4GKK I; 
#chains in the Genus database with same CATH topology
 4IFD D;  1ELO A;  1HNX I;  4BA2 B;  2UUB I;  4OX9 I;  2Z5B A;  4JI0 I;  1Y5Y A;  2Q2E B;  5DNX A;  3J80 C;  2C37 A;  4MU3 A;  2VQE I;  4JI2 E;  4KQV A;  3NZK A;  4DV2 E;  2IOQ A;  4X62 I;  5LMU I;  3PYE A;  1MG7 A;  3J81 C;  1H7U A;  3PRY A;  4LF6 I;  4DV4 I;  5IT9 C;  4YHH E;  4LOM A;  2IES A;  4B3T I;  3P3E A;  4LCF A;  1E3H A;  4FWG A;  2HFS A;  2CGE A;  4IZK B;  3ZKB A;  2UU9 E;  5K36 D;  2BV3 A;  3GON A;  5DNL A;  1YH8 A;  4DR2 E;  4DV7 E;  4JI4 E;  4P7A A;  2HK2 A;  3M7N D;  2HHH I;  2Z5E A;  3GLL A;  1A6F A;  1H73 A;  1ZM2 A;  2E1R A;  3B82 A;  4DR5 E;  2UXC E;  4AM3 A;  1YHC A;  3CDI A;  3HKM A;  4MYT A;  2E5L I;  1IBK I;  4JI1 E;  2DEJ A;  4IZK A;  2UUC E;  2A2C A;  2GO3 A;  3PS2 A;  4DPW A;  1FI4 A;  3QT7 A;  4IZJ D;  4WUD A;  5JEA D;  3T1H I;  3J7A G;  1USU A;  2WW4 A;  4B3M E;  2C39 B;  3WU4 A;  2ZM6 E;  1IBL E;  4QNJ A;  3WU6 A;  1U2R A;  4URL A;  4JI3 E;  4OZE A;  4B3S E;  4HXZ A;  4MDT A;  1N36 E;  2HK3 A;  3K1J A;  5C0X F;  5ELW A;  4X66 E;  4YHH I;  4M1K A;  4GKJ E;  2V8P A;  2JE6 B;  4ISA A;  4JI6 E;  1WUU A;  1UDQ A;  1VI7 A;  4FW6 A;  4DR7 I;  4PRX A;  4K0K E;  4NXN E;  1Z59 A;  2CZ9 A;  1Z0C A;  4JI8 E;  4LF8 E;  4USK A;  4I3H A;  1ZM4 A;  1UEK A;  4DR2 I;  2UXD E;  2VQF I;  5DRR A;  4BA1 A;  4LF9 E;  3L7Z A;  1PKP A;  4OO1 C;  5C0X C;  4LF5 E;  4DR6 I;  1HNW E;  3PYG A;  4XTJ A;  5BR8 E;  4FWH A;  4LFC E;  2Z5B B;  1R6M A;  1OJ4 A;  4FW5 A;  1J5E E;  3HJC A;  1USV A;  3PYD A;  4MU1 A;  1KVK A;  2ZBK B;  4DV0 E;  4LCG A;  4X64 E;  4B3M I;  4DV6 I;  4RPF A;  5EL9 A;  4U3B A;  3F0N A;  1XMQ E;  4QNK A;  1XMO I;  4EMD A;  1S4E A;  2PNM A;  4PU9 A;  4YY3 E;  4OO1 A;  5C0X A;  1HR0 E;  4IFD C;  5FWK A;  2GO4 A;  2NN6 D;  1P42 A;  3K17 A;  2NN6 C;  1FJG E;  5K36 F;  3V2U C;  2O1V A;  1K47 A;  4DR3 I;  4IS9 A;  4JI5 E;  2JT2 A;  4JI7 E;  3B4T A;  2V2V A;  4LFB E;  4AIM A;  2PO0 B;  2BM0 A;  4LF7 E;  1PVG A;  1XNR I;  2J65 A;  4OKG A;  3QT5 A;  4LF4 E;  1KKH A;  4JV5 E;  3Q6N A;  4JYA E;  4DUY I;  4LFA I;  1XNQ I;  4B3R E;  4FW4 A;  5IWA E;  3D4J A;  1N34 E;  5K36 C;  4AID A;  1OYP A;  4X65 I;  1Z0E A;  3ZM7 A;  1DAR A;  3U1K A;  2CG9 A;  1FWL A;  2PO0 A;  2V2Q A;  3H4L A;  1ZM3 A;  4DR4 E;  3CDJ A;  1ZXM A;  3ZZ0 A;  3B8H A;  2F4V I;  5LMN I;  4DV5 I;  5DRQ A;  1EA6 A;  3Q1Q A;  1Y60 A;  3ZZU A;  1HNZ E;  2EFG A;  3Q6M A;  5LL6 R;  5JEA C;  4DU7 A;  4FW9 A;  2HKE A;  2WP8 B;  3PS3 A;  5K36 A;  4PRV A;  4JI2 I;  2X7I A;  1OYS A;  4DV2 I;  2GS8 A;  4HY1 A;  4BA1 B;  3GME A;  3P76 A;  2V2Z A;  3L7Z B;  1N32 E;  4OO1 F;  2O3Z A;  1IBM E;  1NHJ A;  4LCH A;  2UXB E;  4LF7 I;  5A2Q Q;  1RHY A;  4USM A;  5L3J A;  2C38 B;  1FKA E;  3LTO A;  5FLX Q;  2WP8 A;  3K85 A;  2BA1 D;  1MX0 A;  4IZJ A;  4GKK E;  1NHI A;  5JEA A;  2UU9 I;  3QT6 A;  1HNX E;  3LPS A;  1VIS A;  4DV7 I;  2WNR B;  4JI4 I;  2UUB E;  4OX9 E;  4JI0 E;  3JAM Q;  4HAC A;  2O1W A;  2VQE E;  1BKN A;  1Y6Z A;  3H1C A;  4X62 E;  1H7S A;  2UXC I;  5LMU E;  5DRP A;  4DR5 I;  4IFD F;  4OO1 B;  5C0X B;  2NN6 F;  2C38 A;  1ZM9 A;  2IER A;  4LF6 E;  4DV4 E;  1FWK A;  4JI1 I;  2UUC I;  4DPU A;  4P52 A;  2UUA E;  2Z5C B;  2CVE A;  4B3T E;  3V5R A;  3T1Y E;  1Y4U A;  2O1U A;  1NZ0 A;  2WNR A;  2ZM6 I;  1IBL I;  2GQ0 A;  2F1D A;  3J7A M;  4JI3 I;  1UDS A;  1RR9 A;  2BR2 A;  1PIE A;  4B3S I;  4OO1 E;  5C0X E;  1OYR A;  1N36 I;  4DV3 E;  1B62 A;  2PNZ A;  3OTO E;  3ZZT A;  4X66 I;  2PO2 B;  2UXB I;  2HHH E;  4GKJ I;  4IFD B;  2NN6 B;  4DPY A;  2Z5C A;  2BM1 A;  3PYF A;  4Z7C A;  2A2D A;  3WU3 A;  4DV1 E;  4JI6 I;  2E5L E;  1IBK E;  4K0K I;  4NXN I;  2BA1 G;  2PNL A;  4JI8 I;  4LF8 I;  3J80 Q;  1NHH A;  1R6L A;  2LJP A;  3T1H E;  2UXD I;  4FW3 A;  4LF9 I;  4R1F A;  3J81 Q;  1I94 E;  2VES A;  4LF5 I;  2PO2 A;  5IT9 Q;  3QT8 A;  4IFD A;  4IFD E;  1HNW I;  3KRN A;  2NN6 A;  2NN6 E;  5JEA F;  5BR8 I;  2BA0 G;  4LFC I;  2X36 A;  1E3P A;  2JEA A;  2NPF A;  1UDO A;  4WUC A;  5K36 B;  1J5E I;  1H72 C;  2DEI A;  2XEX A;  5GME A;  2UUA I;  1UDN A;  1Z0W A;  3T1Y I;  1Z0G A;  1N0U A;  1Z0B A;  1B63 A;  3M85 G;  4Z7Y A;  4DV0 I;  4BA2 A;  4DR7 E;  4X64 I;  1Z0T A;  5GMD A;  1ZXN A;  4DXL A;  1N33 E;  1XMQ I;  1EI1 A;  2JEB B;  2VQF E;  4KHP E;  4UTG A;  4YY3 I;  1HR0 I;  2V34 A;  1N0V C;  4DV3 I;  4AQY E;  1FJG I;  3OTO I;  4DR1 E;  4IZJ B;  5K36 E;  3P3G A;  4DR6 E;  4DUZ E;  1XHK A;  5JEA B;  1HK7 A;  3CWV A;  2R42 A;  4DPT A;  2PO1 B;  4NXM E;  4DV1 I;  3WU5 A;  4JI5 I;  4JI7 I;  4LFB I;  4HAC B;  2AE8 A;  3P3C A;  1MU5 A;  3HUL A;  4FWD A;  5DRO A;  2JEB A;  1QZR A;  4MU0 A;  2IOP A;  3M6A A;  4LF4 I;  4J3D A;  4DV6 E;  1XXE A;  4JV5 I;  5A2Q C;  1I94 I;  1D6T A;  4JYA I;  1XMO E;  3DD6 A;  4B3R I;  3ZKD A;  5JEA E;  4FW7 A;  4ED4 A;  5IWA I;  1N34 I;  3B78 A;  4N3O A;  4MYU A;  5FLX C;  2PO1 A;  2O1T A;  2VF3 A;  1RRE A;  3UHM A;  2HKJ A;  4NBQ A;  4GQU A;  4MQY A;  4DR3 E;  3LNU A;  1KIJ A;  3PS1 A;  2OI2 A;  2BR2 B;  3JAM C;  2BA0 D;  4DR4 I;  2PNZ B;  2C39 A;  1H74 A;  2AJ4 A;  4LPF A;  1N33 I;  4DU8 A;  1XNR E;  4KHP I;  1KTV A;  1HNZ I;  3M85 D;  4AQY I;  2ZIT A;  4DR1 I;  5C0X D;  4DUY E;  4OO1 D;  4LFA E;  4DUZ I;  1XNQ E;  3M7N G;  1S16 A;  4U3D A;  4X65 E;  4DPX A;  2JE6 A;  1Y4S A;  4NXM I;  4UT4 A;  1Z0V A;  1Z5C A;  3GCM A;  3U1Y A;  3P06 A;  2C37 B;  2R3V A;  4MU4 A;  1N32 I;  4HYM A;  4JG4 A;  1Z5B A;  1IBM I;  2HFU A;  4WUB A;  1FNM A;  1Z5A A;  4FN5 A;  2JEA B;  4ZVI A;  2F4V E;  2J7K A;  5LMN E;  4DV5 E;  4GKK I;  5EKW A; 
#chains in the Genus database with same CATH homology
 1ELO A;  1HNX I;  2UUB I;  4OX9 I;  2Z5B A;  4JI0 I;  2Q2E B;  3J80 C;  2VQE I;  4JI2 E;  4KQV A;  4DV2 E;  2IOQ A;  4X62 I;  5LMU I;  3PYE A;  1MG7 A;  3J81 C;  1H7U A;  3PRY A;  4LF6 I;  4DV4 I;  5IT9 C;  4YHH E;  4B3T I;  4FWG A;  2HFS A;  2CGE A;  4IZK B;  3ZKB A;  2UU9 E;  2BV3 A;  3GON A;  4DR2 E;  4DV7 E;  4JI4 E;  4P7A A;  2HK2 A;  2HHH I;  2Z5E A;  1A6F A;  1H73 A;  1ZM2 A;  2E1R A;  3B82 A;  4DR5 E;  2UXC E;  4MYT A;  2E5L I;  1IBK I;  4JI1 E;  2DEJ A;  4IZK A;  2UUC E;  2A2C A;  4DPW A;  1FI4 A;  3QT7 A;  4IZJ D;  4WUD A;  3T1H I;  3J7A G;  1USU A;  2WW4 A;  4B3M E;  3WU4 A;  2ZM6 E;  1IBL E;  3WU6 A;  1U2R A;  4URL A;  4JI3 E;  4B3S E;  4HXZ A;  1N36 E;  2HK3 A;  3K1J A;  4X66 E;  4YHH I;  4M1K A;  4GKJ E;  2V8P A;  4JI6 E;  1WUU A;  4DR7 I;  4PRX A;  4K0K E;  4NXN E;  1Z59 A;  2CZ9 A;  1Z0C A;  4JI8 E;  4LF8 E;  4USK A;  4I3H A;  1ZM4 A;  1UEK A;  4DR2 I;  2UXD E;  2VQF I;  4LF9 E;  1PKP A;  4LF5 E;  4DR6 I;  1HNW E;  3PYG A;  4XTJ A;  5BR8 E;  4FWH A;  4LFC E;  2Z5B B;  1OJ4 A;  1J5E E;  3HJC A;  1USV A;  3PYD A;  1KVK A;  2ZBK B;  4DV0 E;  4B3M I;  4X64 E;  4DV6 I;  4RPF A;  3F0N A;  1XMQ E;  1XMO I;  4EMD A;  1S4E A;  2PNM A;  4PU9 A;  4YY3 E;  1HR0 E;  5FWK A;  3K17 A;  1FJG E;  3V2U C;  2O1V A;  1K47 A;  4DR3 I;  4JI5 E;  4JI7 E;  2V2V A;  4LFB E;  2BM0 A;  4LF7 E;  1PVG A;  1XNR I;  3QT5 A;  4LF4 E;  1KKH A;  4JV5 E;  3Q6N A;  4JYA E;  4DUY I;  4LFA I;  1XNQ I;  4B3R E;  5IWA E;  3D4J A;  1N34 E;  4X65 I;  1Z0E A;  3ZM7 A;  1DAR A;  2CG9 A;  1FWL A;  2V2Q A;  3H4L A;  1ZM3 A;  4DR4 E;  3ZZ0 A;  1ZXM A;  3B8H A;  2F4V I;  5LMN I;  4DV5 I;  1EA6 A;  3Q1Q A;  3ZZU A;  1HNZ E;  2EFG A;  3Q6M A;  5LL6 R;  4DU7 A;  4FW9 A;  2HKE A;  4PRV A;  4JI2 I;  2X7I A;  4DV2 I;  2GS8 A;  4HY1 A;  2V2Z A;  1N32 E;  1IBM E;  1NHJ A;  2UXB E;  4LF7 I;  5A2Q Q;  4USM A;  5L3J A;  1FKA E;  3LTO A;  5FLX Q;  3K85 A;  1MX0 A;  4IZJ A;  4GKK E;  1NHI A;  2UU9 I;  3QT6 A;  1HNX E;  3LPS A;  1VIS A;  4DV7 I;  4JI4 I;  2UUB E;  4OX9 E;  4JI0 E;  3JAM Q;  4HAC A;  2O1W A;  2VQE E;  1BKN A;  1Y6Z A;  4X62 E;  1H7S A;  2UXC I;  5LMU E;  4DR5 I;  1ZM9 A;  4LF6 E;  4DV4 E;  1FWK A;  4JI1 I;  2UUC I;  4DPU A;  4P52 A;  2UUA E;  2Z5C B;  4B3T E;  3V5R A;  3T1Y E;  1Y4U A;  2O1U A;  1NZ0 A;  2ZM6 I;  1IBL I;  2GQ0 A;  3J7A M;  4JI3 I;  1RR9 A;  1PIE A;  4B3S I;  1N36 I;  4DV3 E;  1B62 A;  3OTO E;  3ZZT A;  4X66 I;  2UXB I;  2HHH E;  4GKJ I;  4DPY A;  2Z5C A;  2BM1 A;  3PYF A;  4Z7C A;  2A2D A;  3WU3 A;  4DV1 E;  4JI6 I;  2E5L E;  1IBK E;  4K0K I;  4NXN I;  2PNL A;  4JI8 I;  4LF8 I;  3J80 Q;  1NHH A;  2LJP A;  3T1H E;  2UXD I;  4LF9 I;  4R1F A;  3J81 Q;  1I94 E;  4LF5 I;  5IT9 Q;  3QT8 A;  1HNW I;  5BR8 I;  4LFC I;  2X36 A;  2NPF A;  4WUC A;  1J5E I;  1H72 C;  2DEI A;  2XEX A;  5GME A;  2UUA I;  1Z0W A;  3T1Y I;  1Z0G A;  1N0U A;  1Z0B A;  1B63 A;  4Z7Y A;  4DV0 I;  4DR7 E;  4X64 I;  1Z0T A;  5GMD A;  1ZXN A;  4DXL A;  1N33 E;  1XMQ I;  1EI1 A;  2VQF E;  4KHP E;  4UTG A;  4YY3 I;  1HR0 I;  2V34 A;  1N0V C;  4AQY E;  4DV3 I;  1FJG I;  3OTO I;  4DR1 E;  4IZJ B;  4DR6 E;  4DUZ E;  1XHK A;  1HK7 A;  3CWV A;  2R42 A;  4DPT A;  4NXM E;  4DV1 I;  3WU5 A;  4JI5 I;  4JI7 I;  4LFB I;  4HAC B;  1MU5 A;  3HUL A;  4FWD A;  1QZR A;  2IOP A;  3M6A A;  4LF4 I;  4DV6 E;  4JV5 I;  5A2Q C;  1I94 I;  1D6T A;  4JYA I;  1XMO E;  4B3R I;  3ZKD A;  4ED4 A;  5IWA I;  1N34 I;  3B78 A;  4N3O A;  4MYU A;  5FLX C;  2O1T A;  2VF3 A;  1RRE A;  2HKJ A;  4DR3 E;  3LNU A;  1KIJ A;  2OI2 A;  3JAM C;  4DR4 I;  1H74 A;  2AJ4 A;  1N33 I;  4DU8 A;  1XNR E;  4KHP I;  1KTV A;  1HNZ I;  4AQY I;  2ZIT A;  4DR1 I;  4DUY E;  4LFA E;  4DUZ I;  1XNQ E;  1S16 A;  4X65 E;  4DPX A;  1Y4S A;  4NXM I;  4UT4 A;  1Z0V A;  1Z5C A;  3P06 A;  2R3V A;  1N32 I;  4HYM A;  4JG4 A;  1Z5B A;  1IBM I;  2HFU A;  4WUB A;  1FNM A;  1Z5A A;  4FN5 A;  4ZVI A;  2F4V E;  2J7K A;  5LMN E;  4DV5 E;  4GKK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...