3J81Q

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
b'TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
molecule tags Ribosome
source organism Saccharomyces cerevisiae
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j81Q00
4DV3E 4DR1E 4JI2I 4X64I 4DV4E 4LF9I 1ELOA 3LPSA 4WUCA 1H73A 1B63A 3J7AG 2AJ4A 4K0KE 1U2RA 4JI0I 3J81C 4LF7E 4DR6I 4B3RE 1XHKA 1HNXI 2F4VI 1IBME 4B3RI 3M6AA 4DV4I 2WW4A 5A2QQ 4DUZI 4WUDA 4USKA 3B78A 4DV5I 2HKEA 4DPUA 1ZM4A 4PRXA 4PRVA 1H74A 2UXBI 2UUAE 3T1YI 4LFCI 2F4VE 4YY3E 2UU9E 1H7UA 1IBLI 4LFCE 2HHHI 2HK3A 2UXDE 1HR0I 5LMNI 4JI5E 3QT6A 2R3VA 2UXDI 4JV5E 1ZM9A 1N33I 1XNRI 3F0NA 3V5RA 1N36I 1Z5BA 3ZM7A 4LFBE 3QT5A 1HNZE 1N36E 2E1RA 4X62E 3JAMC 4YY3I 2NPFA 4YHHI 2HHHE 4NXME 1KKHA 2ZBKB 1RREA 1PVGA 2ZM6I 4DU7A 4B3TE 2ZM6E 1XNRE 4LF6E 4LFAE 2VQEE 4DV6E 4JI4I 1ZXMA 4R1FA 2UXCI 1KIJA 2A2DA 4DR3E 4YHHE 2A2CA 2UUBI 2DEIA 1J5EE 1IBKE 4KHPI 3D4JA 2LJPA 3J80C 4DV2I 1J5EI 1IBKI 5IT9Q 4ED4A 4B3TI 4FN5A 3QT7A 3ZZ0A 2DEJA 2CZ9A 1XNQI 2R42A 4P7AA 3B82A 4DV7E 4LF4E 1N34I 4MYUA 4B3SI 3ZZTA 4DV7I 2HFUA 1Z0WA 1Z0BA 5BR8I 1BKNA 2HK2A 4JI1E 2OI2A 4LF8I 2BM1A 2VQFI 4LF8E 4JI6E 1S16A 4AQYI 1QZRA 3K17A 4X65E 1S4EA 4FWGA 1XMOI 1K47A 1N32I 2V2QA 3ZKDA 1NHJA 1FI4A 1WUUA 3K1JA 4Z7YA 4NXNE 1Z59A 4DV5E 4NXNI 4JI8E 2UXBE 2V2VA 5LL6R 1VISA 4JI0E 1FJGI 2GS8A 1HNWI 2UU9I 2X36A 4DV3I 1HNXE 3LNUA 5GMDA 4JI2E 4PU9A 1N32E 5A2QC 4X66E 4HY1A 4B3ME 4JI5I 3J80Q 4HXZA 4FWHA 4DR4E 4X66I 1N0UA 4FWDA 1N33E 3WU6A 3JAMQ 4USMA 4DR4I 2E5LI 5FLXC 1Z0TA 3OTOE 4JI8I 1EA6A 1H7SA 3PYGA 2XEXA 3OTOI 4GKJE 5LMUE 1HNZI 1Z0GA 2UUAI 4DUYE 4HACB 1HNWE 4GKJI 4EMDA 1EI1A 4HYMA 4JI7E 2UUCE 3T1HE 4JYAE 1UEKA 4DR5I 3ZKBA 2UUCI 4JI3I 4UT4A 3H4LA 4JI7I 1NZ0A 3GONA 1IBLE 3QT8A 4DR1I 4JYAI 2BV3A 4I3HA 1HR0E 1RR9A 1OJ4A 4LF9E 2X7IA 4DV1I 2E5LE 3Q1QA 2Q2EB 1MG7A 4K0KI 1MU5A 1MX0A 4JI4E 4XTJA 3CWVA 2VF3A 1D6TA 4X62I 3V2UC 4DPWA 3WU4A 1ZXNA 4DR5E 4JI3E 5LMNE 1B62A 2ZITA 4URLA 4DR2E 1DARA 4DV1E 2HFSA 4DUZE 1Z5CA 1NHIA 4LF6I 4LFBI 1XMQI 4GKKI 4MYTA 3T1YE 1XMQE 5BR8E 1Z0EA 5FLXQ 4NXMI 4DR3I 3LTOA 1FWKA 4OX9E 1PKPA 1NHHA 1FWLA 2VQFE 4DPTA 2V2ZA 2BM0A 4DR2I 4OX9I 1A6FA 1KVKA 4JV5I 4LFAI 4DPYA 1ZM3A 4DR7I 4WUBA 3PYDA 4LF5I 2V34A 4GKKE 4DR7E 4DV0E 1XNQE 4P52A 2UXCE 4LF5E 1H72C 1ZM2A 3J7AM 2UUBE 1N0VC 3WU5A 4FW9A 1PIEA 4JI1I 4JG4A 1I94E 5L3JA 1FJGE 1Z0VA 4DXLA 4JI6I 1I94I 2EFGA 4DPXA 4X65I 2VQEI 4DV6I 4UTGA 3PYEA 1FNMA 4DU8A 3PYFA 5IT9C 5IWAE 4LF4I 4DV0I 4B3MI 1KTVA 1N34E 4B3SE 5GMEA 3WU3A 4M1KA 5IWAI 3ZZUA 2J7KA 4RPFA 3J81Q 2V8PA 3B8HA 1Z5AA 2HKJA 4KQVA 4ZVIA 3HULA 4KHPE 5LMUI 4AQYE 1FKAE 4DV2E 4DUYI 4LF7I 4DR6E 1Z0CA 3T1HI 1XMOE 1IBMI 4Z7CA 4X64E 4HACA
chains in the Genus database with same CATH superfamily
4DV3E 3P76A 1YH8A 4DR1E 4JI2I 4X64I 4BA2B 4DV4E 5DRQA 4OO1C 4U3DA 4LF9I 1ELOA 3LPSA 1E3PA 4WUCA 1H73A 1B63A 4OZEA 2PNZA 3J7AG 2AJ4A 4K0KE 3GMEA 1U2RA 5K36B 2NN6E 4JI0I 3J81C 4LF7E 4DR6I 1OYRA 4B3RE 4MU0A 1XHKA 1HNXI 2F4VI 1IBME 4B3RI 2PNMA 3M6AA 4DV4I 4BA2A 4OO1F 2WW4A 3PS1A 1UDNA 5A2QQ 4DUZI 4WUDA 4USKA 1VI7A 3B78A 4DV5I 2HKEA 2BR2A 4DPUA 4FW7A 4OO1A 1ZM4A 4PRXA 4LPFA 4PRVA 1H74A 2UXBI 2UUAE 4MDTA 2Z5CB 2BR2B 3T1YI 1RHYA 2IOQA 5K36F 4LFCI 2F4VE 4QNJA 4YY3E 3L7ZB 2UU9E 1H7UA 2BA0D 1IBLI 4LFCE 5JEAC 2HHHI 2HK3A 2UXDE 1HR0I 5LMNI 5C0XD 4JI5E 2Z5BB 3QT6A 2R3VA 2IERA 2UXDI 4JV5E 1ZM9A 2JEBB 1N33I 1OYPA 3DD6A 1XNRI 3F0NA 3V5RA 2Z5BA 3UHMA 4IZKA 1N36I 5DRPA 1Z5BA 4IFDF 3ZM7A 2PO2B 4LFBE 3QT5A 1HNZE 1N36E 2E1RA 4X62E 3JAMC 4YY3I 3GCMA 2NPFA 3P3EA 4YHHI 2HHHE 4NXME 5JEAF 1KKHA 2ZBKB 4NBQA 2JEBA 2GQ0A 2AE8A 3M85G 4FW6A 1RREA 1PVGA 2ZM6I 2F1DA 4DU7A 4MQYA 5C0XA 3P3CA 4MU1A 2IESA 4B3TE 2O3ZA 2ZM6E 1XNRE 3CDJA 1Y6ZA 4LF6E 4LFAE 2VQEE 4DV6E 2JE6A 1USUA 2WNRA 4IZKB 4JI4I 1ZXMA 4R1FA 2UXCI 1KIJA 2A2DA 3KRNA 2C37A 4DR3E 4YHHE 2A2CA 2UUBI 2DEIA 1J5EE 1IBKE 4KHPI 3D4JA 2LJPA 2J65A 3J80C 4DV2I 1J5EI 1IBKI 5IT9Q 4ED4A 4B3TI 4FN5A 3QT7A 3ZZ0A 2DEJA 5K36D 3Q6MA 5C0XE 2CZ9A 1XNQI 2R42A 1Y4UA 4P7AA 3B82A 4DV7E 4IFDC 4LF4E 4FW3A 1N34I 4MYUA 4B3SI 3ZZTA 4DV7I 2HFUA 1Z0WA 1Z0BA 4OO1D 5BR8I 1BKNA 2HK2A 4JI1E 2OI2A 1E3HA 4LF8I 2NN6F 2BM1A 2VQFI 4LF8E 4JI6E 1S16A 4AQYI 1QZRA 3K17A 5DRRA 2PNLA 4X65E 1S4EA 2C39B 4FWGA 1XMOI 5DROA 1K47A 1N32I 2Z5CA 2V2QA 3H1CA 2C38A 3ZKDA 1NHJA 1FI4A 5K36E 4AM3A 1WUUA 2BA0G 3K1JA 4Z7YA 4NXNE 1Z59A 1UDOA 5C0XF 5C0XB 4DV5E 3HKMA 2O1TA 4NXNI 4J3DA 4JI8E 2UXBE 3B4TA 2PO2A 2V2VA 3Q6NA 5LL6R 1VISA 4JI0E 1FJGI 2GS8A 2JE6B 2WNRB 1USVA 3K85A 1HNWI 2UU9I 2CVEA 5ELWA 2X36A 4DV3I 1HNXE 3LNUA 5GMDA 4JI2E 4PU9A 1N32E 5A2QC 4X66E 4HY1A 4B3ME 3GLLA 4JI5I 2C39A 3J80Q 4HXZA 3M85D 4FWHA 4DR4E 5JEAD 4X66I 1N0UA 1R6MA 4FWDA 1N33E 3WU6A 4QNKA 3JAMQ 4USMA 4MU4A 4DR4I 2E5LI 5FLXC 1Z0TA 3OTOE 5K36A 4JI8I 1EA6A 1H7SA 3PYGA 3PRYA 4IS9A 2XEXA 3OTOI 4GKJE 5LMUE 1HNZI 1Z0GA 4IZJD 2UUAI 4DUYE 4HACB 2BA1D 1HNWE 4GKJI 4EMDA 1EI1A 2GO4A 4HYMA 4JI7E 2UUCE 4N3OA 1R6LA 3T1HE 4JYAE 1UEKA 4DR5I 3ZKBA 2UUCI 4JI3I 4UT4A 3H4LA 4JI7I 1NZ0A 2NN6B 3CDIA 3GONA 3U1KA 3QT8A 4DR1I 3PS2A 1IBLE 3M7NG 4JYAI 2BV3A 4I3HA 2NN6D 1OYSA 1HR0E 1RR9A 1OJ4A 1XXEA 3P3GA 4LF9E 4BA1B 2X7IA 1Y60A 4DV1I 2E5LE 3Q1QA 2Q2EB 1MG7A 4U3BA 4K0KI 1MU5A 1MX0A 2WP8B 5JEAE 5DNXA 4JI4E 3M7ND 1UDQA 4XTJA 3CWVA 2VF3A 4IZJA 1Y4SA 1D6TA 4X62I 3V2UC 4DPWA 3WU4A 1ZXNA 4DR5E 4JI3E 4BA1A 5LMNE 1P42A 4IFDE 1B62A 2ZITA 2NN6C 2PO0A 4URLA 4FW4A 2NN6A 4DR2E 1DARA 4DV1E 2O1WA 2HFSA 4DUZE 1Z5CA 3U1YA 2PO1A 1UDSA 1NHIA 4LF6I 5EL9A 3HJCA 4LCFA 4LFBI 2C38B 1XMQI 4GKKI 3NZKA 5FWKA 4MYTA 4FW5A 3T1YE 1XMQE 5JEAA 4IFDD 2IOPA 5BR8E 1Z0EA 5FLXQ 4NXMI 2BA1G 1Y5YA 4ISAA 2CG9A 4DR3I 3LTOA 2O1VA 1FWKA 4OX9E 2JEAB 1PKPA 5JEAB 1NHHA 1FWLA 2VQFE 4DPTA 2V2ZA 2BM0A 4DR2I 4OX9I 1A6FA 2O1UA 1KVKA 4JV5I 4AIDA 4LFAI 4DPYA 1ZM3A 3PS3A 4IFDB 4DR7I 4WUBA 3PYDA 4OO1E 4LF5I 2V34A 4GKKE 4DR7E 4DV0E 1XNQE 4P52A 2UXCE 1YHCA 4LF5E 1H72C 1ZM2A 4LCGA 2PO0B 3J7AM 2JT2A 4AIMA 2UUBE 1N0VC 2VESA 3WU5A 5C0XC 4FW9A 4JI1I 1PIEA 4LOMA 5EKWA 4JG4A 2Z5EA 1I94E 5L3JA 2GO3A 4MU3A 1FJGE 1Z0VA 2WP8A 4DXLA 4JI6I 1I94I 2EFGA 4GQUA 4DPXA 4IZJB 2C37B 4X65I 2VQEI 4DV6I 5K36C 4UTGA 3PYEA 1FNMA 2CGEA 4DU8A 3PYFA 5IT9C 5IWAE 4LF4I 4DV0I 4B3MI 1KTVA 1N34E 3P06A 4B3SE 5GMEA 3WU3A 4M1KA 5IWAI 3ZZUA 2J7KA 4RPFA 3J81Q 2PNZB 2V8PA 3L7ZA 4OKGA 3B8HA 4OO1B 1Z5AA 1HK7A 2PO1B 5DNLA 2HKJA 2JEAA 4KQVA 4ZVIA 3HULA 4KHPE 5LMUI 4AQYE 1FKAE 4DV2E 4DUYI 4LF7I 4DR6E 1Z0CA 3T1HI 1XMOE 1IBMI 4Z7CA 4X64E 4IFDA 4LCHA 4HACA
chains in the Genus database with same CATH topology
4DV3E 4DR1E 4JI2I 4X64I 4DV4E 4LF9I 1ELOA 3LPSA 4WUCA 1H73A 1B63A 3J7AG 2AJ4A 4K0KE 1U2RA 4JI0I 3J81C 4LF7E 4DR6I 4B3RE 1XHKA 1HNXI 2F4VI 1IBME 4B3RI 2PNMA 3M6AA 4DV4I 2WW4A 5A2QQ 4DUZI 4WUDA 4USKA 3B78A 4DV5I 2HKEA 4DPUA 1ZM4A 4PRXA 4PRVA 1H74A 2UXBI 2UUAE 2Z5CB 3T1YI 2IOQA 4LFCI 2F4VE 4YY3E 2UU9E 1H7UA 1IBLI 4LFCE 2HHHI 2HK3A 2UXDE 1HR0I 5LMNI 4JI5E 2Z5BB 3QT6A 2R3VA 2UXDI 4JV5E 1ZM9A 1N33I 1XNRI 3F0NA 3V5RA 2Z5BA 4IZKA 1N36I 1Z5BA 3ZM7A 4LFBE 3QT5A 1HNZE 1N36E 2E1RA 4X62E 3JAMC 4YY3I 2NPFA 4YHHI 2HHHE 4NXME 1KKHA 2ZBKB 2GQ0A 1RREA 1PVGA 2ZM6I 4DU7A 4B3TE 2ZM6E 1XNRE 1Y6ZA 4LF6E 4LFAE 2VQEE 4DV6E 1USUA 4IZKB 4JI4I 1ZXMA 4R1FA 2UXCI 1KIJA 2A2DA 4DR3E 4YHHE 2A2CA 2UUBI 2DEIA 1J5EE 1IBKE 4KHPI 3D4JA 2LJPA 3J80C 4DV2I 1J5EI 1IBKI 5IT9Q 4ED4A 4B3TI 4FN5A 3QT7A 3ZZ0A 2DEJA 3Q6MA 2CZ9A 1XNQI 2R42A 1Y4UA 4P7AA 3B82A 4DV7E 4LF4E 1N34I 4MYUA 4B3SI 3ZZTA 4DV7I 2HFUA 1Z0WA 1Z0BA 5BR8I 1BKNA 2HK2A 4JI1E 2OI2A 4LF8I 2BM1A 2VQFI 4LF8E 4JI6E 1S16A 4AQYI 1QZRA 3K17A 2PNLA 4X65E 1S4EA 4FWGA 1XMOI 1K47A 1N32I 2Z5CA 2V2QA 3ZKDA 1NHJA 1FI4A 1WUUA 3K1JA 4Z7YA 4NXNE 1Z59A 4DV5E 2O1TA 4NXNI 4JI8E 2UXBE 2V2VA 3Q6NA 5LL6R 1VISA 4JI0E 1FJGI 2GS8A 3K85A 1USVA 1HNWI 2UU9I 2X36A 4DV3I 1HNXE 3LNUA 5GMDA 4JI2E 4PU9A 1N32E 5A2QC 4X66E 4HY1A 4B3ME 4JI5I 3J80Q 4HXZA 4FWHA 4DR4E 4X66I 1N0UA 4FWDA 1N33E 3WU6A 3JAMQ 4USMA 4DR4I 2E5LI 5FLXC 1Z0TA 3OTOE 4JI8I 1EA6A 1H7SA 3PYGA 3PRYA 2XEXA 3OTOI 4GKJE 5LMUE 1HNZI 1Z0GA 4IZJD 2UUAI 4DUYE 4HACB 1HNWE 4GKJI 4EMDA 1EI1A 4HYMA 4JI7E 2UUCE 4N3OA 3T1HE 4JYAE 1UEKA 4DR5I 3ZKBA 2UUCI 4JI3I 4UT4A 3H4LA 4JI7I 1NZ0A 3GONA 1IBLE 3QT8A 4DR1I 4JYAI 2BV3A 4I3HA 1HR0E 1RR9A 1OJ4A 4LF9E 2X7IA 4DV1I 2E5LE 3Q1QA 2Q2EB 1MG7A 4K0KI 1MU5A 1MX0A 4JI4E 4XTJA 3CWVA 2VF3A 4IZJA 1Y4SA 1D6TA 4X62I 3V2UC 4DPWA 3WU4A 1ZXNA 4DR5E 4JI3E 5LMNE 1B62A 2ZITA 4URLA 4DR2E 1DARA 4DV1E 2O1WA 2HFSA 4DUZE 1Z5CA 1NHIA 4LF6I 3HJCA 4LFBI 1XMQI 4GKKI 5FWKA 4MYTA 3T1YE 1XMQE 2IOPA 5BR8E 1Z0EA 5FLXQ 4NXMI 2CG9A 4DR3I 3LTOA 2O1VA 1FWKA 4OX9E 1PKPA 1NHHA 1FWLA 2VQFE 4DPTA 2V2ZA 2BM0A 4DR2I 4OX9I 1A6FA 2O1UA 1KVKA 4JV5I 4LFAI 4DPYA 1ZM3A 4DR7I 4WUBA 3PYDA 4LF5I 2V34A 4GKKE 4DR7E 4DV0E 1XNQE 4P52A 2UXCE 4LF5E 1H72C 1ZM2A 3J7AM 2UUBE 1N0VC 3WU5A 4FW9A 1PIEA 4JI1I 4JG4A 2Z5EA 1I94E 5L3JA 1FJGE 1Z0VA 4DXLA 4JI6I 1I94I 2EFGA 4DPXA 4IZJB 4X65I 2VQEI 4DV6I 4UTGA 3PYEA 1FNMA 2CGEA 4DU8A 3PYFA 5IT9C 5IWAE 4LF4I 4DV0I 4B3MI 1KTVA 1N34E 3P06A 4B3SE 5GMEA 3WU3A 4M1KA 5IWAI 3ZZUA 2J7KA 4RPFA 3J81Q 2V8PA 3B8HA 1Z5AA 1HK7A 2HKJA 4KQVA 4ZVIA 3HULA 4KHPE 5LMUI 4AQYE 1FKAE 4DV2E 4DUYI 4LF7I 4DR6E 1Z0CA 3T1HI 1XMOE 1IBMI 4Z7CA 4X64E 4HACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 E;  4DR1 E;  4JI2 I;  4X64 I;  4DV4 E;  4LF9 I;  1ELO A;  3LPS A;  4WUC A;  1H73 A;  1B63 A;  3J7A G;  2AJ4 A;  4K0K E;  1U2R A;  4JI0 I;  3J81 C;  4LF7 E;  4DR6 I;  4B3R E;  1XHK A;  1HNX I;  2F4V I;  1IBM E;  4B3R I;  3M6A A;  4DV4 I;  2WW4 A;  5A2Q Q;  4DUZ I;  4WUD A;  4USK A;  3B78 A;  4DV5 I;  2HKE A;  4DPU A;  1ZM4 A;  4PRX A;  4PRV A;  1H74 A;  2UXB I;  2UUA E;  3T1Y I;  4LFC I;  2F4V E;  4YY3 E;  2UU9 E;  1H7U A;  1IBL I;  4LFC E;  2HHH I;  2HK3 A;  2UXD E;  1HR0 I;  5LMN I;  4JI5 E;  3QT6 A;  2R3V A;  2UXD I;  4JV5 E;  1ZM9 A;  1N33 I;  1XNR I;  3F0N A;  3V5R A;  1N36 I;  1Z5B A;  3ZM7 A;  4LFB E;  3QT5 A;  1HNZ E;  1N36 E;  2E1R A;  4X62 E;  3JAM C;  4YY3 I;  2NPF A;  4YHH I;  2HHH E;  4NXM E;  1KKH A;  2ZBK B;  1RRE A;  1PVG A;  2ZM6 I;  4DU7 A;  4B3T E;  2ZM6 E;  1XNR E;  4LF6 E;  4LFA E;  2VQE E;  4DV6 E;  4JI4 I;  1ZXM A;  4R1F A;  2UXC I;  1KIJ A;  2A2D A;  4DR3 E;  4YHH E;  2A2C A;  2UUB I;  2DEI A;  1J5E E;  1IBK E;  4KHP I;  3D4J A;  2LJP A;  3J80 C;  4DV2 I;  1J5E I;  1IBK I;  5IT9 Q;  4ED4 A;  4B3T I;  4FN5 A;  3QT7 A;  3ZZ0 A;  2DEJ A;  2CZ9 A;  1XNQ I;  2R42 A;  4P7A A;  3B82 A;  4DV7 E;  4LF4 E;  1N34 I;  4MYU A;  4B3S I;  3ZZT A;  4DV7 I;  2HFU A;  1Z0W A;  1Z0B A;  5BR8 I;  1BKN A;  2HK2 A;  4JI1 E;  2OI2 A;  4LF8 I;  2BM1 A;  2VQF I;  4LF8 E;  4JI6 E;  1S16 A;  4AQY I;  1QZR A;  3K17 A;  4X65 E;  1S4E A;  4FWG A;  1XMO I;  1K47 A;  1N32 I;  2V2Q A;  3ZKD A;  1NHJ A;  1FI4 A;  1WUU A;  3K1J A;  4Z7Y A;  4NXN E;  1Z59 A;  4DV5 E;  4NXN I;  4JI8 E;  2UXB E;  2V2V A;  5LL6 R;  1VIS A;  4JI0 E;  1FJG I;  2GS8 A;  1HNW I;  2UU9 I;  2X36 A;  4DV3 I;  1HNX E;  3LNU A;  5GMD A;  4JI2 E;  4PU9 A;  1N32 E;  5A2Q C;  4X66 E;  4HY1 A;  4B3M E;  4JI5 I;  3J80 Q;  4HXZ A;  4FWH A;  4DR4 E;  4X66 I;  1N0U A;  4FWD A;  1N33 E;  3WU6 A;  3JAM Q;  4USM A;  4DR4 I;  2E5L I;  5FLX C;  1Z0T A;  3OTO E;  4JI8 I;  1EA6 A;  1H7S A;  3PYG A;  2XEX A;  3OTO I;  4GKJ E;  5LMU E;  1HNZ I;  1Z0G A;  2UUA I;  4DUY E;  4HAC B;  1HNW E;  4GKJ I;  4EMD A;  1EI1 A;  4HYM A;  4JI7 E;  2UUC E;  3T1H E;  4JYA E;  1UEK A;  4DR5 I;  3ZKB A;  2UUC I;  4JI3 I;  4UT4 A;  3H4L A;  4JI7 I;  1NZ0 A;  3GON A;  1IBL E;  3QT8 A;  4DR1 I;  4JYA I;  2BV3 A;  4I3H A;  1HR0 E;  1RR9 A;  1OJ4 A;  4LF9 E;  2X7I A;  4DV1 I;  2E5L E;  3Q1Q A;  2Q2E B;  1MG7 A;  4K0K I;  1MU5 A;  1MX0 A;  4JI4 E;  4XTJ A;  3CWV A;  2VF3 A;  1D6T A;  4X62 I;  3V2U C;  4DPW A;  3WU4 A;  1ZXN A;  4DR5 E;  4JI3 E;  5LMN E;  1B62 A;  2ZIT A;  4URL A;  4DR2 E;  1DAR A;  4DV1 E;  2HFS A;  4DUZ E;  1Z5C A;  1NHI A;  4LF6 I;  4LFB I;  1XMQ I;  4GKK I;  4MYT A;  3T1Y E;  1XMQ E;  5BR8 E;  1Z0E A;  5FLX Q;  4NXM I;  4DR3 I;  3LTO A;  1FWK A;  4OX9 E;  1PKP A;  1NHH A;  1FWL A;  2VQF E;  4DPT A;  2V2Z A;  2BM0 A;  4DR2 I;  4OX9 I;  1A6F A;  1KVK A;  4JV5 I;  4LFA I;  4DPY A;  1ZM3 A;  4DR7 I;  4WUB A;  3PYD A;  4LF5 I;  2V34 A;  4GKK E;  4DR7 E;  4DV0 E;  1XNQ E;  4P52 A;  2UXC E;  4LF5 E;  1H72 C;  1ZM2 A;  3J7A M;  2UUB E;  1N0V C;  3WU5 A;  4FW9 A;  1PIE A;  4JI1 I;  4JG4 A;  1I94 E;  5L3J A;  1FJG E;  1Z0V A;  4DXL A;  4JI6 I;  1I94 I;  2EFG A;  4DPX A;  4X65 I;  2VQE I;  4DV6 I;  4UTG A;  3PYE A;  1FNM A;  4DU8 A;  3PYF A;  5IT9 C;  5IWA E;  4LF4 I;  4DV0 I;  4B3M I;  1KTV A;  1N34 E;  4B3S E;  5GME A;  3WU3 A;  4M1K A;  5IWA I;  3ZZU A;  2J7K A;  4RPF A;  3J81 Q;  2V8P A;  3B8H A;  1Z5A A;  2HKJ A;  4KQV A;  4ZVI A;  3HUL A;  4KHP E;  5LMU I;  4AQY E;  1FKA E;  4DV2 E;  4DUY I;  4LF7 I;  4DR6 E;  1Z0C A;  3T1H I;  1XMO E;  1IBM I;  4Z7C A;  4X64 E;  4HAC A; 
#chains in the Genus database with same CATH topology
 4DV3 E;  3P76 A;  1YH8 A;  4DR1 E;  4JI2 I;  4X64 I;  4BA2 B;  4DV4 E;  5DRQ A;  4OO1 C;  4U3D A;  4LF9 I;  1ELO A;  3LPS A;  1E3P A;  4WUC A;  1H73 A;  1B63 A;  4OZE A;  2PNZ A;  3J7A G;  2AJ4 A;  4K0K E;  3GME A;  1U2R A;  5K36 B;  2NN6 E;  4JI0 I;  3J81 C;  4LF7 E;  4DR6 I;  1OYR A;  4B3R E;  4MU0 A;  1XHK A;  1HNX I;  2F4V I;  1IBM E;  4B3R I;  2PNM A;  3M6A A;  4DV4 I;  4BA2 A;  4OO1 F;  2WW4 A;  3PS1 A;  1UDN A;  5A2Q Q;  4DUZ I;  4WUD A;  4USK A;  1VI7 A;  3B78 A;  4DV5 I;  2HKE A;  2BR2 A;  4DPU A;  4FW7 A;  4OO1 A;  1ZM4 A;  4PRX A;  4LPF A;  4PRV A;  1H74 A;  2UXB I;  2UUA E;  4MDT A;  2Z5C B;  2BR2 B;  3T1Y I;  1RHY A;  2IOQ A;  5K36 F;  4LFC I;  2F4V E;  4QNJ A;  4YY3 E;  3L7Z B;  2UU9 E;  1H7U A;  2BA0 D;  1IBL I;  4LFC E;  5JEA C;  2HHH I;  2HK3 A;  2UXD E;  1HR0 I;  5LMN I;  5C0X D;  4JI5 E;  2Z5B B;  3QT6 A;  2R3V A;  2IER A;  2UXD I;  4JV5 E;  1ZM9 A;  2JEB B;  1N33 I;  1OYP A;  3DD6 A;  1XNR I;  3F0N A;  3V5R A;  2Z5B A;  3UHM A;  4IZK A;  1N36 I;  5DRP A;  1Z5B A;  4IFD F;  3ZM7 A;  2PO2 B;  4LFB E;  3QT5 A;  1HNZ E;  1N36 E;  2E1R A;  4X62 E;  3JAM C;  4YY3 I;  3GCM A;  2NPF A;  3P3E A;  4YHH I;  2HHH E;  4NXM E;  5JEA F;  1KKH A;  2ZBK B;  4NBQ A;  2JEB A;  2GQ0 A;  2AE8 A;  3M85 G;  4FW6 A;  1RRE A;  1PVG A;  2ZM6 I;  2F1D A;  4DU7 A;  4MQY A;  5C0X A;  3P3C A;  4MU1 A;  2IES A;  4B3T E;  2O3Z A;  2ZM6 E;  1XNR E;  3CDJ A;  1Y6Z A;  4LF6 E;  4LFA E;  2VQE E;  4DV6 E;  2JE6 A;  1USU A;  2WNR A;  4IZK B;  4JI4 I;  1ZXM A;  4R1F A;  2UXC I;  1KIJ A;  2A2D A;  3KRN A;  2C37 A;  4DR3 E;  4YHH E;  2A2C A;  2UUB I;  2DEI A;  1J5E E;  1IBK E;  4KHP I;  3D4J A;  2LJP A;  2J65 A;  3J80 C;  4DV2 I;  1J5E I;  1IBK I;  5IT9 Q;  4ED4 A;  4B3T I;  4FN5 A;  3QT7 A;  3ZZ0 A;  2DEJ A;  5K36 D;  3Q6M A;  5C0X E;  2CZ9 A;  1XNQ I;  2R42 A;  1Y4U A;  4P7A A;  3B82 A;  4DV7 E;  4IFD C;  4LF4 E;  4FW3 A;  1N34 I;  4MYU A;  4B3S I;  3ZZT A;  4DV7 I;  2HFU A;  1Z0W A;  1Z0B A;  4OO1 D;  5BR8 I;  1BKN A;  2HK2 A;  4JI1 E;  2OI2 A;  1E3H A;  4LF8 I;  2NN6 F;  2BM1 A;  2VQF I;  4LF8 E;  4JI6 E;  1S16 A;  4AQY I;  1QZR A;  3K17 A;  5DRR A;  2PNL A;  4X65 E;  1S4E A;  2C39 B;  4FWG A;  1XMO I;  5DRO A;  1K47 A;  1N32 I;  2Z5C A;  2V2Q A;  3H1C A;  2C38 A;  3ZKD A;  1NHJ A;  1FI4 A;  5K36 E;  4AM3 A;  1WUU A;  2BA0 G;  3K1J A;  4Z7Y A;  4NXN E;  1Z59 A;  1UDO A;  5C0X F;  5C0X B;  4DV5 E;  3HKM A;  2O1T A;  4NXN I;  4J3D A;  4JI8 E;  2UXB E;  3B4T A;  2PO2 A;  2V2V A;  3Q6N A;  5LL6 R;  1VIS A;  4JI0 E;  1FJG I;  2GS8 A;  2JE6 B;  2WNR B;  1USV A;  3K85 A;  1HNW I;  2UU9 I;  2CVE A;  5ELW A;  2X36 A;  4DV3 I;  1HNX E;  3LNU A;  5GMD A;  4JI2 E;  4PU9 A;  1N32 E;  5A2Q C;  4X66 E;  4HY1 A;  4B3M E;  3GLL A;  4JI5 I;  2C39 A;  3J80 Q;  4HXZ A;  3M85 D;  4FWH A;  4DR4 E;  5JEA D;  4X66 I;  1N0U A;  1R6M A;  4FWD A;  1N33 E;  3WU6 A;  4QNK A;  3JAM Q;  4USM A;  4MU4 A;  4DR4 I;  2E5L I;  5FLX C;  1Z0T A;  3OTO E;  5K36 A;  4JI8 I;  1EA6 A;  1H7S A;  3PYG A;  3PRY A;  4IS9 A;  2XEX A;  3OTO I;  4GKJ E;  5LMU E;  1HNZ I;  1Z0G A;  4IZJ D;  2UUA I;  4DUY E;  4HAC B;  2BA1 D;  1HNW E;  4GKJ I;  4EMD A;  1EI1 A;  2GO4 A;  4HYM A;  4JI7 E;  2UUC E;  4N3O A;  1R6L A;  3T1H E;  4JYA E;  1UEK A;  4DR5 I;  3ZKB A;  2UUC I;  4JI3 I;  4UT4 A;  3H4L A;  4JI7 I;  1NZ0 A;  2NN6 B;  3CDI A;  3GON A;  3U1K A;  3QT8 A;  4DR1 I;  3PS2 A;  1IBL E;  3M7N G;  4JYA I;  2BV3 A;  4I3H A;  2NN6 D;  1OYS A;  1HR0 E;  1RR9 A;  1OJ4 A;  1XXE A;  3P3G A;  4LF9 E;  4BA1 B;  2X7I A;  1Y60 A;  4DV1 I;  2E5L E;  3Q1Q A;  2Q2E B;  1MG7 A;  4U3B A;  4K0K I;  1MU5 A;  1MX0 A;  2WP8 B;  5JEA E;  5DNX A;  4JI4 E;  3M7N D;  1UDQ A;  4XTJ A;  3CWV A;  2VF3 A;  4IZJ A;  1Y4S A;  1D6T A;  4X62 I;  3V2U C;  4DPW A;  3WU4 A;  1ZXN A;  4DR5 E;  4JI3 E;  4BA1 A;  5LMN E;  1P42 A;  4IFD E;  1B62 A;  2ZIT A;  2NN6 C;  2PO0 A;  4URL A;  4FW4 A;  2NN6 A;  4DR2 E;  1DAR A;  4DV1 E;  2O1W A;  2HFS A;  4DUZ E;  1Z5C A;  3U1Y A;  2PO1 A;  1UDS A;  1NHI A;  4LF6 I;  5EL9 A;  3HJC A;  4LCF A;  4LFB I;  2C38 B;  1XMQ I;  4GKK I;  3NZK A;  5FWK A;  4MYT A;  4FW5 A;  3T1Y E;  1XMQ E;  5JEA A;  4IFD D;  2IOP A;  5BR8 E;  1Z0E A;  5FLX Q;  4NXM I;  2BA1 G;  1Y5Y A;  4ISA A;  2CG9 A;  4DR3 I;  3LTO A;  2O1V A;  1FWK A;  4OX9 E;  2JEA B;  1PKP A;  5JEA B;  1NHH A;  1FWL A;  2VQF E;  4DPT A;  2V2Z A;  2BM0 A;  4DR2 I;  4OX9 I;  1A6F A;  2O1U A;  1KVK A;  4JV5 I;  4AID A;  4LFA I;  4DPY A;  1ZM3 A;  3PS3 A;  4IFD B;  4DR7 I;  4WUB A;  3PYD A;  4OO1 E;  4LF5 I;  2V34 A;  4GKK E;  4DR7 E;  4DV0 E;  1XNQ E;  4P52 A;  2UXC E;  1YHC A;  4LF5 E;  1H72 C;  1ZM2 A;  4LCG A;  2PO0 B;  3J7A M;  2JT2 A;  4AIM A;  2UUB E;  1N0V C;  2VES A;  3WU5 A;  5C0X C;  4FW9 A;  4JI1 I;  1PIE A;  4LOM A;  5EKW A;  4JG4 A;  2Z5E A;  1I94 E;  5L3J A;  2GO3 A;  4MU3 A;  1FJG E;  1Z0V A;  2WP8 A;  4DXL A;  4JI6 I;  1I94 I;  2EFG A;  4GQU A;  4DPX A;  4IZJ B;  2C37 B;  4X65 I;  2VQE I;  4DV6 I;  5K36 C;  4UTG A;  3PYE A;  1FNM A;  2CGE A;  4DU8 A;  3PYF A;  5IT9 C;  5IWA E;  4LF4 I;  4DV0 I;  4B3M I;  1KTV A;  1N34 E;  3P06 A;  4B3S E;  5GME A;  3WU3 A;  4M1K A;  5IWA I;  3ZZU A;  2J7K A;  4RPF A;  3J81 Q;  2PNZ B;  2V8P A;  3L7Z A;  4OKG A;  3B8H A;  4OO1 B;  1Z5A A;  1HK7 A;  2PO1 B;  5DNL A;  2HKJ A;  2JEA A;  4KQV A;  4ZVI A;  3HUL A;  4KHP E;  5LMU I;  4AQY E;  1FKA E;  4DV2 E;  4DUY I;  4LF7 I;  4DR6 E;  1Z0C A;  3T1H I;  1XMO E;  1IBM I;  4Z7C A;  4X64 E;  4IFD A;  4LCH A;  4HAC A; 
#chains in the Genus database with same CATH homology
 4DV3 E;  4DR1 E;  4JI2 I;  4X64 I;  4DV4 E;  4LF9 I;  1ELO A;  3LPS A;  4WUC A;  1H73 A;  1B63 A;  3J7A G;  2AJ4 A;  4K0K E;  1U2R A;  4JI0 I;  3J81 C;  4LF7 E;  4DR6 I;  4B3R E;  1XHK A;  1HNX I;  2F4V I;  1IBM E;  4B3R I;  2PNM A;  3M6A A;  4DV4 I;  2WW4 A;  5A2Q Q;  4DUZ I;  4WUD A;  4USK A;  3B78 A;  4DV5 I;  2HKE A;  4DPU A;  1ZM4 A;  4PRX A;  4PRV A;  1H74 A;  2UXB I;  2UUA E;  2Z5C B;  3T1Y I;  2IOQ A;  4LFC I;  2F4V E;  4YY3 E;  2UU9 E;  1H7U A;  1IBL I;  4LFC E;  2HHH I;  2HK3 A;  2UXD E;  1HR0 I;  5LMN I;  4JI5 E;  2Z5B B;  3QT6 A;  2R3V A;  2UXD I;  4JV5 E;  1ZM9 A;  1N33 I;  1XNR I;  3F0N A;  3V5R A;  2Z5B A;  4IZK A;  1N36 I;  1Z5B A;  3ZM7 A;  4LFB E;  3QT5 A;  1HNZ E;  1N36 E;  2E1R A;  4X62 E;  3JAM C;  4YY3 I;  2NPF A;  4YHH I;  2HHH E;  4NXM E;  1KKH A;  2ZBK B;  2GQ0 A;  1RRE A;  1PVG A;  2ZM6 I;  4DU7 A;  4B3T E;  2ZM6 E;  1XNR E;  1Y6Z A;  4LF6 E;  4LFA E;  2VQE E;  4DV6 E;  1USU A;  4IZK B;  4JI4 I;  1ZXM A;  4R1F A;  2UXC I;  1KIJ A;  2A2D A;  4DR3 E;  4YHH E;  2A2C A;  2UUB I;  2DEI A;  1J5E E;  1IBK E;  4KHP I;  3D4J A;  2LJP A;  3J80 C;  4DV2 I;  1J5E I;  1IBK I;  5IT9 Q;  4ED4 A;  4B3T I;  4FN5 A;  3QT7 A;  3ZZ0 A;  2DEJ A;  3Q6M A;  2CZ9 A;  1XNQ I;  2R42 A;  1Y4U A;  4P7A A;  3B82 A;  4DV7 E;  4LF4 E;  1N34 I;  4MYU A;  4B3S I;  3ZZT A;  4DV7 I;  2HFU A;  1Z0W A;  1Z0B A;  5BR8 I;  1BKN A;  2HK2 A;  4JI1 E;  2OI2 A;  4LF8 I;  2BM1 A;  2VQF I;  4LF8 E;  4JI6 E;  1S16 A;  4AQY I;  1QZR A;  3K17 A;  2PNL A;  4X65 E;  1S4E A;  4FWG A;  1XMO I;  1K47 A;  1N32 I;  2Z5C A;  2V2Q A;  3ZKD A;  1NHJ A;  1FI4 A;  1WUU A;  3K1J A;  4Z7Y A;  4NXN E;  1Z59 A;  4DV5 E;  2O1T A;  4NXN I;  4JI8 E;  2UXB E;  2V2V A;  3Q6N A;  5LL6 R;  1VIS A;  4JI0 E;  1FJG I;  2GS8 A;  3K85 A;  1USV A;  1HNW I;  2UU9 I;  2X36 A;  4DV3 I;  1HNX E;  3LNU A;  5GMD A;  4JI2 E;  4PU9 A;  1N32 E;  5A2Q C;  4X66 E;  4HY1 A;  4B3M E;  4JI5 I;  3J80 Q;  4HXZ A;  4FWH A;  4DR4 E;  4X66 I;  1N0U A;  4FWD A;  1N33 E;  3WU6 A;  3JAM Q;  4USM A;  4DR4 I;  2E5L I;  5FLX C;  1Z0T A;  3OTO E;  4JI8 I;  1EA6 A;  1H7S A;  3PYG A;  3PRY A;  2XEX A;  3OTO I;  4GKJ E;  5LMU E;  1HNZ I;  1Z0G A;  4IZJ D;  2UUA I;  4DUY E;  4HAC B;  1HNW E;  4GKJ I;  4EMD A;  1EI1 A;  4HYM A;  4JI7 E;  2UUC E;  4N3O A;  3T1H E;  4JYA E;  1UEK A;  4DR5 I;  3ZKB A;  2UUC I;  4JI3 I;  4UT4 A;  3H4L A;  4JI7 I;  1NZ0 A;  3GON A;  1IBL E;  3QT8 A;  4DR1 I;  4JYA I;  2BV3 A;  4I3H A;  1HR0 E;  1RR9 A;  1OJ4 A;  4LF9 E;  2X7I A;  4DV1 I;  2E5L E;  3Q1Q A;  2Q2E B;  1MG7 A;  4K0K I;  1MU5 A;  1MX0 A;  4JI4 E;  4XTJ A;  3CWV A;  2VF3 A;  4IZJ A;  1Y4S A;  1D6T A;  4X62 I;  3V2U C;  4DPW A;  3WU4 A;  1ZXN A;  4DR5 E;  4JI3 E;  5LMN E;  1B62 A;  2ZIT A;  4URL A;  4DR2 E;  1DAR A;  4DV1 E;  2O1W A;  2HFS A;  4DUZ E;  1Z5C A;  1NHI A;  4LF6 I;  3HJC A;  4LFB I;  1XMQ I;  4GKK I;  5FWK A;  4MYT A;  3T1Y E;  1XMQ E;  2IOP A;  5BR8 E;  1Z0E A;  5FLX Q;  4NXM I;  2CG9 A;  4DR3 I;  3LTO A;  2O1V A;  1FWK A;  4OX9 E;  1PKP A;  1NHH A;  1FWL A;  2VQF E;  4DPT A;  2V2Z A;  2BM0 A;  4DR2 I;  4OX9 I;  1A6F A;  2O1U A;  1KVK A;  4JV5 I;  4LFA I;  4DPY A;  1ZM3 A;  4DR7 I;  4WUB A;  3PYD A;  4LF5 I;  2V34 A;  4GKK E;  4DR7 E;  4DV0 E;  1XNQ E;  4P52 A;  2UXC E;  4LF5 E;  1H72 C;  1ZM2 A;  3J7A M;  2UUB E;  1N0V C;  3WU5 A;  4FW9 A;  1PIE A;  4JI1 I;  4JG4 A;  2Z5E A;  1I94 E;  5L3J A;  1FJG E;  1Z0V A;  4DXL A;  4JI6 I;  1I94 I;  2EFG A;  4DPX A;  4IZJ B;  4X65 I;  2VQE I;  4DV6 I;  4UTG A;  3PYE A;  1FNM A;  2CGE A;  4DU8 A;  3PYF A;  5IT9 C;  5IWA E;  4LF4 I;  4DV0 I;  4B3M I;  1KTV A;  1N34 E;  3P06 A;  4B3S E;  5GME A;  3WU3 A;  4M1K A;  5IWA I;  3ZZU A;  2J7K A;  4RPF A;  3J81 Q;  2V8P A;  3B8H A;  1Z5A A;  1HK7 A;  2HKJ A;  4KQV A;  4ZVI A;  3HUL A;  4KHP E;  5LMU I;  4AQY E;  1FKA E;  4DV2 E;  4DUY I;  4LF7 I;  4DR6 E;  1Z0C A;  3T1H I;  1XMO E;  1IBM I;  4Z7C A;  4X64 E;  4HAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...