3J81Q

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j81Q00
4B3RE 1FWKA 4HACA 1Z0EA 2XEXA 4JI8E 4DR7I 4DV0E 4JV5I 2J7KA 4DR1E 4B3TE 2VQEE 2HK2A 2OI2A 2BM0A 4DR5I 1KVKA 2WW4A 4DV1E 5FLXC 2UXBI 1XNRE 1HR0E 3ZZTA 2V2QA 3WU3A 1ZM3A 2UUAI 4NXNE 3CWVA 4EMDA 4DR2E 4DU7A 4DV6I 4LF7E 1UEKA 4JI1I 4R1FA 1ZM2A 4URLA 4JI2E 4USMA 1PIEA 4DV7E 1HNXE 1U2RA 4AQYE 4JI7I 5GMDA 3T1YI 4LF8E 4ZVIA 1J5EE 1MX0A 4JI6E 2X7IA 3ZKDA 1MU5A 4LF4I 4DUZI 1N0VC 3LTOA 4JI4I 3PYGA 3PYDA 1NHJA 4DV3I 1XMQE 2V2ZA 1HNWE 4DR3E 2EFGA 2NPFA 4HYMA 4YY3E 4P52A 3ZZUA 1VISA 4B3MI 3J7AM 1N32I 4LF9I 4YHHE 4K0KE 4DPTA 3HULA 5BR8E 3WU5A 2HKEA 2R42A 4X64I 4JYAI 3ZZ0A 2UXCI 4X65E 3V5RA 1EI1A 1Z0BA 4KHPI 1DARA 5IWAE 4JI3E 4DUYE 4WUCA 4DPUA 3J81Q 2HFSA 4HACB 4GKKE 4B3SI 2F4VI 2V8PA 1XMOI 2LJPA 3QT5A 3D4JA 3PYFA 3T1HI 1HNZE 1ZXNA 5LL6R 1K47A 4WUBA 3OTOI 1XNQE 1IBKE 4KQVA 2ZBKB 4DV2I 1N34I 1S16A 2UUCE 4LFCI 4LFAE 3JAMQ 3Q1QA 1IBME 1FJGI 4LF6I 4DV4E 4Z7YA 2VQFE 4X66I 1N36I 1I94I 4DR6E 1PVGA 4NXME 1IBLI 1ZM4A 1ZM9A 1H7UA 4PRVA 5LMNE 2BV3A 4HXZA 3V2UC 1NZ0A 3B82A 1Z5CA 4LF5E 3F0NA 4GKJE 1N0UA 4ED4A 4X62E 2DEIA 5LMUI 4JI5E 3J7AG 4FWGA 1KKHA 4B3RI 1EA6A 2UUBE 4JI8I 2E1RA 3ZKBA 4DV0I 4DR1I 1WUUA 4B3TI 2VQEI 2ZM6E 5IT9Q 4RPFA 1FI4A 4JI0E 1Z0CA 1NHHA 3J80Q 2A2DA 2HHHE 4DV1I 4OX9E 4FWDA 1XNRI 1HR0I 1N33E 4NXNI 2UU9E 4DR4E 3J81C 4DR2I 1Z0WA 4LF7I 2E5LE 4LFBE 4DV5E 2R3VA 4UTGA 4JG4A 1NHIA 4JI2I 4DR7E 4JV5E 1HNXI 4DV7I 1FKAE 4JI5I 4AQYI 1Z59A 1XHKA 4LF8I 3B78A 2Q2EB 5GMEA 1H73A 1J5EI 4DR5E 4JI6I 4XTJA 3H4LA 5L3JA 2UXBE 1QZRA 1Z5AA 3JAMC 2V34A 2UUAE 1XMQI 1HNWI 4DR3I 3K1JA 4DV6E 4FWHA 4JI1E 4YY3I 4DXLA 2GS8A 2HK3A 3M6AA 2CZ9A 4YHHI 4K0KI 4FW9A 4FN5A 3QT6A 4JI7E 1Z5BA 3T1YE 5BR8I 1KTVA 3WU6A 4X65I 5A2QQ 4LF4E 2UXDE 4DUZE 2HFUA 2V2VA 5IWAI 4JI3I 1OJ4A 4DUYI 4JI4E 4DV3E 2A2CA 1KIJA 4MYUA 5IT9C 3B8HA 2ZITA 1B62A 2AJ4A 3PYEA 4DPWA 4GKKI 1MG7A 2VF3A 3J80C 4B3ME 1N32E 4LF9E 1BKNA 4MYTA 1HNZI 1XNQI 3WU4A 1IBKI 4M1KA 1S4EA 1Z0VA 4X64E 4JYAE 2UXCE 3QT7A 3ZM7A 4PU9A 4WUDA 5FLXQ 2UUCI 4LFAI 4KHPE 1IBMI 4DV4I 2VQFI 4DR6I 4NXMI 4HY1A 4DU8A 2X36A 2UXDI 2DEJA 5LMNI 4B3SE 4Z7CA 1A6FA 2F4VE 1XMOE 1ELOA 1FWLA 3T1HE 2BM1A 4LF5I 1RREA 4GKJI 4PRXA 3OTOE 4X62I 4DV2E 1N34E 3GONA 4LFCE 4DPXA 4P7AA 1B63A 1ZXMA 2UUBI 1FJGE 4LF6E 1N36E 4X66E 4UT4A 1I94E 1PKPA 4I3HA 2ZM6I 1H72C 1IBLE 4DPYA 4JI0I 1H7SA 3LPSA 1FNMA 1Z0GA 2HHHI 4USKA 5A2QC 4OX9I 1D6TA 1N33I 2UU9I 4DR4I 3LNUA 3K17A 3QT8A 1RR9A 5LMUE 1H74A 2E5LI 4LFBI 1Z0TA 4DV5I 2HKJA
chains in the Genus database with same CATH superfamily
4B3RE 3PS3A 2O1TA 1FWKA 4HACA 1Z0EA 2XEXA 4JI8E 4DR7I 4DV0E 4JV5I 2J7KA 4DR1E 4B3TE 2VQEE 5C0XD 2HK2A 1E3HA 2OI2A 2BM0A 4DR5I 2Z5EA 1KVKA 4FW4A 2WW4A 4DV1E 5FLXC 1YHCA 2UXBI 2GQ0A 1XNRE 1HR0E 4LCFA 4N3OA 5DNLA 3ZZTA 2V2QA 3B4TA 3WU3A 1ZM3A 2UUAI 4NXNE 3CWVA 4FW7A 4EMDA 4OO1D 1HK7A 4DR2E 4DU7A 4DV6I 4LF7E 4IFDA 1UEKA 4JI1I 2AE8A 4R1FA 2BR2B 1ZM2A 3U1YA 4URLA 4JI2E 4USMA 1PIEA 4DV7E 1HNXE 1U2RA 4AQYE 5DRQA 4JI7I 5GMDA 3T1YI 4LF8E 4ZVIA 1R6LA 4OZEA 5JEAD 4MU3A 4NBQA 1J5EE 1MX0A 4JI6E 2X7IA 2O1WA 3ZKDA 1MU5A 2NN6B 4LF4I 4DUZI 1N0VC 3LTOA 4BA2B 4FW6A 3PYGA 2C39A 1NHJA 3P3EA 3PYDA 4JI4I 4DV3I 1XMQE 2BA0G 1USUA 2V2ZA 1HNWE 4DR3E 2EFGA 2NPFA 4HYMA 4YY3E 3Q6NA 4P52A 3ZZUA 1VISA 4B3MI 3P3GA 3J7AM 1N32I 4LF9I 2BA1D 4YHHE 4K0KE 2IESA 4DPTA 3HULA 5BR8E 3WU5A 2HKEA 2R42A 4X64I 4JYAI 3ZZ0A 2UXCI 4X65E 2NN6C 3V5RA 2WNRA 5K36B 1EI1A 2C37A 4OO1E 1Z0BA 4KHPI 1DARA 4U3DA 5IWAE 4JI3E 4QNJA 4DUYE 4WUCA 4DPUA 3J81Q 3DD6A 2PO2A 4IFDF 2HFSA 4HACB 4GKKE 2Z5CB 2NN6E 3PS2A 4B3SI 2V8PA 2F4VI 2IERA 2VESA 1UDSA 3GLLA 1XMOI 2LJPA 3QT5A 2IOPA 3U1KA 5JEAE 3D4JA 3PYFA 4MQYA 3T1HI 1HNZE 1ZXNA 5LL6R 1K47A 4WUBA 3OTOI 1XNQE 1IBKE 4KQVA 3K85A 2ZBKB 4DV2I 1N34I 1S16A 2UUCE 4LFCI 2C38B 2JT2A 5K36C 4LFAE 2CG9A 3JAMQ 3Q1QA 1IBME 1FJGI 4FW5A 4LF6I 4DV4E 3L7ZB 1RHYA 4Z7YA 2VQFE 4X66I 1N36I 1I94I 4DR6E 1PVGA 4NXME 4IFDB 1IBLI 1ZM4A 1ZM9A 1H7UA 2PO0A 4PRVA 5LMNE 2BV3A 4IZJA 4HXZA 5K36E 4MU1A 3NZKA 3V2UC 1NZ0A 3B82A 1Z5CA 4LF5E 3F0NA 4GKJE 1N0UA 4ED4A 4X62E 2DEIA 3M85G 5FWKA 2NN6D 5LMUI 4JI5E 3J7AG 4FWGA 4AIDA 1Y4SA 4OKGA 1KKHA 5C0XA 4B3RI 3M7NG 1EA6A 2UUBE 4JI8I 2E1RA 3ZKBA 4DV0I 4DR1I 1WUUA 4B3TI 2VQEI 4IFDC 1E3PA 2ZM6E 5IT9Q 4RPFA 1FI4A 2CVEA 2WP8B 4JI0E 1Z0CA 3P06A 2Z5BB 1NHHA 3J80Q 2A2DA 2HHHE 2PNZB 4DV1I 2J65A 2BR2A 4MU4A 4OX9E 2JEBB 4FWDA 4OO1A 1XNRI 3GCMA 1HR0I 1N33E 4NXNI 2UU9E 4DR4E 2PO1B 3J81C 4DR2I 2IOQA 5DROA 1Z0WA 4U3BA 4LF7I 2C37B 2E5LE 4LFBE 1OYPA 5K36D 2JE6A 4DV5E 2R3VA 2NN6A 1VI7A 3PRYA 4UTGA 4JG4A 4FW3A 1NHIA 4JI2I 1XXEA 4AM3A 4DR7E 1YH8A 5JEAA 4JV5E 2PO2B 1HNXI 4DV7I 2O1UA 1FKAE 4JI5I 4AQYI 1Z59A 1XHKA 4LF8I 3B78A 2Q2EB 5GMEA 2BA0D 4LCGA 1H73A 1J5EI 4DR5E 4JI6I 4XTJA 2GO4A 3H4LA 5L3JA 4IZKA 4IS9A 2UXBE 1QZRA 1Z5AA 3UHMA 3JAMC 2V34A 2UUAE 1Y4UA 1XMQI 2JEAA 1HNWI 4DR3I 1Y6ZA 3K1JA 4DV6E 4FWHA 4JI1E 5C0XF 4YY3I 4DXLA 2GS8A 2HK3A 3M6AA 5K36A 1Y60A 2CZ9A 4YHHI 4IFDD 4K0KI 5DNXA 4BA1A 1OYRA 4FW9A 4FN5A 3CDJA 3QT6A 4JI7E 1Z5BA 3T1YE 5BR8I 2O1VA 4IZJB 1KTVA 1UDOA 3WU6A 4X65I 2Z5CA 5A2QQ 4LF4E 2UXDE 4OO1F 4DUZE 2HFUA 2V2VA 5IWAI 4JI3I 1OJ4A 4DUYI 4JI4E 2F1DA 3H1CA 4DV3E 4MDTA 2A2CA 3P76A 3Q6MA 5EL9A 1KIJA 3PS1A 3HKMA 4MYUA 4GQUA 5IT9C 3B8HA 2ZITA 1B62A 5C0XB 2AJ4A 3PYEA 4DPWA 4GKKI 1MG7A 2NN6F 2VF3A 5ELWA 3J80C 4B3ME 1N32E 2C38A 4LF9E 1BKNA 5JEAF 3KRNA 4LCHA 4MYTA 2GO3A 1HNZI 2C39B 3L7ZA 3GMEA 2CGEA 1XNQI 3WU4A 1IBKI 4M1KA 1UDNA 1S4EA 1Z0VA 4X64E 4JYAE 2UXCE 3QT7A 3ZM7A 4PU9A 4WUDA 4OO1B 2BA1G 5FLXQ 2UUCI 4LFAI 1Y5YA 4KHPE 1IBMI 4J3DA 4DV4I 2VQFI 4DR6I 4NXMI 2JE6B 4HY1A 5C0XC 4DU8A 2X36A 3P3CA 2UXDI 2PNLA 4IFDE 3M85D 4LPFA 1R6MA 2DEJA 4AIMA 4ISAA 5JEAB 5LMNI 4B3SE 2WNRB 1A6FA 4Z7CA 2F4VE 5K36F 1XMOE 1ELOA 1FWLA 5DRRA 3M7ND 3T1HE 4LOMA 2BM1A 4LF5I 1RREA 4GKJI 4PRXA 3OTOE 4X62I 4BA2A 1UDQA 4QNKA 5C0XE 4IZKB 2WP8A 2Z5BA 4OO1C 4DV2E 1N34E 3GONA 2PNZA 4LFCE 4DPXA 4P7AA 5DRPA 1B63A 1ZXMA 2UUBI 2JEBA 1FJGE 2JEAB 4LF6E 4X66E 4UT4A 1N36E 1I94E 1PKPA 4I3HA 2ZM6I 2PO1A 1H72C 4MU0A 1IBLE 4DPYA 4JI0I 1H7SA 3LPSA 1FNMA 5JEAC 1Z0GA 2HHHI 4BA1B 4USKA 5A2QC 4OX9I 2PNMA 2O3ZA 1D6TA 1P42A 3HJCA 1N33I 4IZJD 2UU9I 4DR4I 3LNUA 3K17A 3QT8A 1RR9A 5LMUE 1H74A 3CDIA 5EKWA 2E5LI 4LFBI 2PO0B 1Z0TA 1USVA 4DV5I 1OYSA 2HKJA
chains in the Genus database with same CATH topology
4B3RE 2O1TA 1FWKA 4HACA 1Z0EA 2XEXA 4JI8E 4DR7I 4DV0E 4JV5I 2J7KA 4DR1E 4B3TE 2VQEE 2HK2A 2OI2A 2BM0A 4DR5I 2Z5EA 1KVKA 2WW4A 4DV1E 5FLXC 2UXBI 2GQ0A 1XNRE 1HR0E 4N3OA 3ZZTA 2V2QA 3WU3A 1ZM3A 2UUAI 4NXNE 3CWVA 4EMDA 1HK7A 4DR2E 4DU7A 4DV6I 4LF7E 1UEKA 4JI1I 4R1FA 1ZM2A 4URLA 4JI2E 4USMA 1PIEA 4DV7E 1HNXE 1U2RA 4AQYE 4JI7I 5GMDA 3T1YI 4LF8E 4ZVIA 1J5EE 1MX0A 4JI6E 2X7IA 2O1WA 3ZKDA 1MU5A 4LF4I 4DUZI 1N0VC 3LTOA 4JI4I 3PYGA 3PYDA 1NHJA 4DV3I 1XMQE 1USUA 2V2ZA 1HNWE 4DR3E 2EFGA 2NPFA 4HYMA 4YY3E 3Q6NA 4P52A 3ZZUA 1VISA 4B3MI 3J7AM 1N32I 4LF9I 4YHHE 4K0KE 4DPTA 3HULA 5BR8E 3WU5A 2HKEA 2R42A 4X64I 4JYAI 3ZZ0A 2UXCI 4X65E 3V5RA 1EI1A 1Z0BA 4KHPI 1DARA 5IWAE 4JI3E 4DUYE 4WUCA 4DPUA 3J81Q 2HFSA 4HACB 4GKKE 2Z5CB 4B3SI 2F4VI 2V8PA 1XMOI 2LJPA 3QT5A 2IOPA 3D4JA 3PYFA 3T1HI 1HNZE 1ZXNA 5LL6R 1K47A 4WUBA 3OTOI 1XNQE 1IBKE 4KQVA 3K85A 2ZBKB 4DV2I 1N34I 1S16A 2UUCE 4LFCI 4LFAE 2CG9A 3JAMQ 3Q1QA 1IBME 1FJGI 4LF6I 4DV4E 4Z7YA 2VQFE 4X66I 1N36I 1I94I 4DR6E 1PVGA 4NXME 1IBLI 1ZM4A 1ZM9A 1H7UA 4PRVA 5LMNE 2BV3A 4IZJA 4HXZA 3V2UC 1NZ0A 3B82A 1Z5CA 4LF5E 3F0NA 4GKJE 4ED4A 1N0UA 4X62E 2DEIA 5FWKA 5LMUI 4JI5E 3J7AG 4FWGA 1Y4SA 1KKHA 4B3RI 1EA6A 2UUBE 4JI8I 2E1RA 3ZKBA 4DV0I 4DR1I 1WUUA 4B3TI 2VQEI 2ZM6E 5IT9Q 4RPFA 1FI4A 4JI0E 1Z0CA 3P06A 2Z5BB 1NHHA 3J80Q 2A2DA 2HHHE 4DV1I 4OX9E 4FWDA 1XNRI 1HR0I 1N33E 4NXNI 2UU9E 4DR4E 3J81C 4DR2I 2IOQA 1Z0WA 4LF7I 2E5LE 4LFBE 4DV5E 2R3VA 3PRYA 4UTGA 4JG4A 1NHIA 4JI2I 4DR7E 4JV5E 1HNXI 4DV7I 2O1UA 1FKAE 4JI5I 4AQYI 1Z59A 1XHKA 4LF8I 3B78A 2Q2EB 5GMEA 1H73A 1J5EI 4DR5E 4JI6I 4XTJA 3H4LA 5L3JA 4IZKA 2UXBE 1QZRA 1Z5AA 3JAMC 2V34A 2UUAE 1Y4UA 1XMQI 1HNWI 4DR3I 1Y6ZA 3K1JA 4DV6E 4FWHA 4JI1E 4YY3I 4DXLA 2GS8A 2HK3A 3M6AA 2CZ9A 4YHHI 4K0KI 4FW9A 4FN5A 3QT6A 4JI7E 1Z5BA 3T1YE 5BR8I 2O1VA 4IZJB 1KTVA 3WU6A 4X65I 2Z5CA 5A2QQ 4LF4E 2UXDE 4DUZE 2HFUA 2V2VA 5IWAI 4JI3I 1OJ4A 4DUYI 4JI4E 4DV3E 2A2CA 3Q6MA 1KIJA 4MYUA 5IT9C 3B8HA 2ZITA 1B62A 2AJ4A 3PYEA 4DPWA 4GKKI 1MG7A 2VF3A 3J80C 4B3ME 1N32E 4LF9E 1BKNA 4MYTA 1HNZI 1XNQI 2CGEA 3WU4A 1IBKI 4M1KA 1S4EA 1Z0VA 4X64E 4JYAE 2UXCE 3QT7A 3ZM7A 4PU9A 4WUDA 5FLXQ 2UUCI 4LFAI 4KHPE 1IBMI 4DV4I 2VQFI 4DR6I 4NXMI 4HY1A 4DU8A 2X36A 2UXDI 2PNLA 2DEJA 5LMNI 4B3SE 4Z7CA 1A6FA 2F4VE 1XMOE 1ELOA 1FWLA 3T1HE 2BM1A 4LF5I 1RREA 4GKJI 4PRXA 3OTOE 4X62I 4IZKB 2Z5BA 4DV2E 1N34E 3GONA 4LFCE 4DPXA 4P7AA 1B63A 1ZXMA 2UUBI 1FJGE 4LF6E 1N36E 4X66E 4UT4A 1I94E 1PKPA 4I3HA 2ZM6I 1H72C 1IBLE 4DPYA 4JI0I 1H7SA 3LPSA 1FNMA 1Z0GA 2HHHI 4USKA 5A2QC 4OX9I 2PNMA 1D6TA 3HJCA 1N33I 4IZJD 2UU9I 4DR4I 3LNUA 3K17A 3QT8A 1RR9A 5LMUE 1H74A 2E5LI 4LFBI 1Z0TA 1USVA 4DV5I 2HKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R E;  1FWK A;  4HAC A;  1Z0E A;  2XEX A;  4JI8 E;  4DR7 I;  4DV0 E;  4JV5 I;  2J7K A;  4DR1 E;  4B3T E;  2VQE E;  2HK2 A;  2OI2 A;  2BM0 A;  4DR5 I;  1KVK A;  2WW4 A;  4DV1 E;  5FLX C;  2UXB I;  1XNR E;  1HR0 E;  3ZZT A;  2V2Q A;  3WU3 A;  1ZM3 A;  2UUA I;  4NXN E;  3CWV A;  4EMD A;  4DR2 E;  4DU7 A;  4DV6 I;  4LF7 E;  1UEK A;  4JI1 I;  4R1F A;  1ZM2 A;  4URL A;  4JI2 E;  4USM A;  1PIE A;  4DV7 E;  1HNX E;  1U2R A;  4AQY E;  4JI7 I;  5GMD A;  3T1Y I;  4LF8 E;  4ZVI A;  1J5E E;  1MX0 A;  4JI6 E;  2X7I A;  3ZKD A;  1MU5 A;  4LF4 I;  4DUZ I;  1N0V C;  3LTO A;  4JI4 I;  3PYG A;  3PYD A;  1NHJ A;  4DV3 I;  1XMQ E;  2V2Z A;  1HNW E;  4DR3 E;  2EFG A;  2NPF A;  4HYM A;  4YY3 E;  4P52 A;  3ZZU A;  1VIS A;  4B3M I;  3J7A M;  1N32 I;  4LF9 I;  4YHH E;  4K0K E;  4DPT A;  3HUL A;  5BR8 E;  3WU5 A;  2HKE A;  2R42 A;  4X64 I;  4JYA I;  3ZZ0 A;  2UXC I;  4X65 E;  3V5R A;  1EI1 A;  1Z0B A;  4KHP I;  1DAR A;  5IWA E;  4JI3 E;  4DUY E;  4WUC A;  4DPU A;  3J81 Q;  2HFS A;  4HAC B;  4GKK E;  4B3S I;  2F4V I;  2V8P A;  1XMO I;  2LJP A;  3QT5 A;  3D4J A;  3PYF A;  3T1H I;  1HNZ E;  1ZXN A;  5LL6 R;  1K47 A;  4WUB A;  3OTO I;  1XNQ E;  1IBK E;  4KQV A;  2ZBK B;  4DV2 I;  1N34 I;  1S16 A;  2UUC E;  4LFC I;  4LFA E;  3JAM Q;  3Q1Q A;  1IBM E;  1FJG I;  4LF6 I;  4DV4 E;  4Z7Y A;  2VQF E;  4X66 I;  1N36 I;  1I94 I;  4DR6 E;  1PVG A;  4NXM E;  1IBL I;  1ZM4 A;  1ZM9 A;  1H7U A;  4PRV A;  5LMN E;  2BV3 A;  4HXZ A;  3V2U C;  1NZ0 A;  3B82 A;  1Z5C A;  4LF5 E;  3F0N A;  4GKJ E;  1N0U A;  4ED4 A;  4X62 E;  2DEI A;  5LMU I;  4JI5 E;  3J7A G;  4FWG A;  1KKH A;  4B3R I;  1EA6 A;  2UUB E;  4JI8 I;  2E1R A;  3ZKB A;  4DV0 I;  4DR1 I;  1WUU A;  4B3T I;  2VQE I;  2ZM6 E;  5IT9 Q;  4RPF A;  1FI4 A;  4JI0 E;  1Z0C A;  1NHH A;  3J80 Q;  2A2D A;  2HHH E;  4DV1 I;  4OX9 E;  4FWD A;  1XNR I;  1HR0 I;  1N33 E;  4NXN I;  2UU9 E;  4DR4 E;  3J81 C;  4DR2 I;  1Z0W A;  4LF7 I;  2E5L E;  4LFB E;  4DV5 E;  2R3V A;  4UTG A;  4JG4 A;  1NHI A;  4JI2 I;  4DR7 E;  4JV5 E;  1HNX I;  4DV7 I;  1FKA E;  4JI5 I;  4AQY I;  1Z59 A;  1XHK A;  4LF8 I;  3B78 A;  2Q2E B;  5GME A;  1H73 A;  1J5E I;  4DR5 E;  4JI6 I;  4XTJ A;  3H4L A;  5L3J A;  2UXB E;  1QZR A;  1Z5A A;  3JAM C;  2V34 A;  2UUA E;  1XMQ I;  1HNW I;  4DR3 I;  3K1J A;  4DV6 E;  4FWH A;  4JI1 E;  4YY3 I;  4DXL A;  2GS8 A;  2HK3 A;  3M6A A;  2CZ9 A;  4YHH I;  4K0K I;  4FW9 A;  4FN5 A;  3QT6 A;  4JI7 E;  1Z5B A;  3T1Y E;  5BR8 I;  1KTV A;  3WU6 A;  4X65 I;  5A2Q Q;  4LF4 E;  2UXD E;  4DUZ E;  2HFU A;  2V2V A;  5IWA I;  4JI3 I;  1OJ4 A;  4DUY I;  4JI4 E;  4DV3 E;  2A2C A;  1KIJ A;  4MYU A;  5IT9 C;  3B8H A;  2ZIT A;  1B62 A;  2AJ4 A;  3PYE A;  4DPW A;  4GKK I;  1MG7 A;  2VF3 A;  3J80 C;  4B3M E;  1N32 E;  4LF9 E;  1BKN A;  4MYT A;  1HNZ I;  1XNQ I;  3WU4 A;  1IBK I;  4M1K A;  1S4E A;  1Z0V A;  4X64 E;  4JYA E;  2UXC E;  3QT7 A;  3ZM7 A;  4PU9 A;  4WUD A;  5FLX Q;  2UUC I;  4LFA I;  4KHP E;  1IBM I;  4DV4 I;  2VQF I;  4DR6 I;  4NXM I;  4HY1 A;  4DU8 A;  2X36 A;  2UXD I;  2DEJ A;  5LMN I;  4B3S E;  4Z7C A;  1A6F A;  2F4V E;  1XMO E;  1ELO A;  1FWL A;  3T1H E;  2BM1 A;  4LF5 I;  1RRE A;  4GKJ I;  4PRX A;  3OTO E;  4X62 I;  4DV2 E;  1N34 E;  3GON A;  4LFC E;  4DPX A;  4P7A A;  1B63 A;  1ZXM A;  2UUB I;  1FJG E;  4LF6 E;  1N36 E;  4X66 E;  4UT4 A;  1I94 E;  1PKP A;  4I3H A;  2ZM6 I;  1H72 C;  1IBL E;  4DPY A;  4JI0 I;  1H7S A;  3LPS A;  1FNM A;  1Z0G A;  2HHH I;  4USK A;  5A2Q C;  4OX9 I;  1D6T A;  1N33 I;  2UU9 I;  4DR4 I;  3LNU A;  3K17 A;  3QT8 A;  1RR9 A;  5LMU E;  1H74 A;  2E5L I;  4LFB I;  1Z0T A;  4DV5 I;  2HKJ A; 
#chains in the Genus database with same CATH topology
 4B3R E;  3PS3 A;  2O1T A;  1FWK A;  4HAC A;  1Z0E A;  2XEX A;  4JI8 E;  4DR7 I;  4DV0 E;  4JV5 I;  2J7K A;  4DR1 E;  4B3T E;  2VQE E;  5C0X D;  2HK2 A;  1E3H A;  2OI2 A;  2BM0 A;  4DR5 I;  2Z5E A;  1KVK A;  4FW4 A;  2WW4 A;  4DV1 E;  5FLX C;  1YHC A;  2UXB I;  2GQ0 A;  1XNR E;  1HR0 E;  4LCF A;  4N3O A;  5DNL A;  3ZZT A;  2V2Q A;  3B4T A;  3WU3 A;  1ZM3 A;  2UUA I;  4NXN E;  3CWV A;  4FW7 A;  4EMD A;  4OO1 D;  1HK7 A;  4DR2 E;  4DU7 A;  4DV6 I;  4LF7 E;  4IFD A;  1UEK A;  4JI1 I;  2AE8 A;  4R1F A;  2BR2 B;  1ZM2 A;  3U1Y A;  4URL A;  4JI2 E;  4USM A;  1PIE A;  4DV7 E;  1HNX E;  1U2R A;  4AQY E;  5DRQ A;  4JI7 I;  5GMD A;  3T1Y I;  4LF8 E;  4ZVI A;  1R6L A;  4OZE A;  5JEA D;  4MU3 A;  4NBQ A;  1J5E E;  1MX0 A;  4JI6 E;  2X7I A;  2O1W A;  3ZKD A;  1MU5 A;  2NN6 B;  4LF4 I;  4DUZ I;  1N0V C;  3LTO A;  4BA2 B;  4FW6 A;  3PYG A;  2C39 A;  1NHJ A;  3P3E A;  3PYD A;  4JI4 I;  4DV3 I;  1XMQ E;  2BA0 G;  1USU A;  2V2Z A;  1HNW E;  4DR3 E;  2EFG A;  2NPF A;  4HYM A;  4YY3 E;  3Q6N A;  4P52 A;  3ZZU A;  1VIS A;  4B3M I;  3P3G A;  3J7A M;  1N32 I;  4LF9 I;  2BA1 D;  4YHH E;  4K0K E;  2IES A;  4DPT A;  3HUL A;  5BR8 E;  3WU5 A;  2HKE A;  2R42 A;  4X64 I;  4JYA I;  3ZZ0 A;  2UXC I;  4X65 E;  2NN6 C;  3V5R A;  2WNR A;  5K36 B;  1EI1 A;  2C37 A;  4OO1 E;  1Z0B A;  4KHP I;  1DAR A;  4U3D A;  5IWA E;  4JI3 E;  4QNJ A;  4DUY E;  4WUC A;  4DPU A;  3J81 Q;  3DD6 A;  2PO2 A;  4IFD F;  2HFS A;  4HAC B;  4GKK E;  2Z5C B;  2NN6 E;  3PS2 A;  4B3S I;  2V8P A;  2F4V I;  2IER A;  2VES A;  1UDS A;  3GLL A;  1XMO I;  2LJP A;  3QT5 A;  2IOP A;  3U1K A;  5JEA E;  3D4J A;  3PYF A;  4MQY A;  3T1H I;  1HNZ E;  1ZXN A;  5LL6 R;  1K47 A;  4WUB A;  3OTO I;  1XNQ E;  1IBK E;  4KQV A;  3K85 A;  2ZBK B;  4DV2 I;  1N34 I;  1S16 A;  2UUC E;  4LFC I;  2C38 B;  2JT2 A;  5K36 C;  4LFA E;  2CG9 A;  3JAM Q;  3Q1Q A;  1IBM E;  1FJG I;  4FW5 A;  4LF6 I;  4DV4 E;  3L7Z B;  1RHY A;  4Z7Y A;  2VQF E;  4X66 I;  1N36 I;  1I94 I;  4DR6 E;  1PVG A;  4NXM E;  4IFD B;  1IBL I;  1ZM4 A;  1ZM9 A;  1H7U A;  2PO0 A;  4PRV A;  5LMN E;  2BV3 A;  4IZJ A;  4HXZ A;  5K36 E;  4MU1 A;  3NZK A;  3V2U C;  1NZ0 A;  3B82 A;  1Z5C A;  4LF5 E;  3F0N A;  4GKJ E;  1N0U A;  4ED4 A;  4X62 E;  2DEI A;  3M85 G;  5FWK A;  2NN6 D;  5LMU I;  4JI5 E;  3J7A G;  4FWG A;  4AID A;  1Y4S A;  4OKG A;  1KKH A;  5C0X A;  4B3R I;  3M7N G;  1EA6 A;  2UUB E;  4JI8 I;  2E1R A;  3ZKB A;  4DV0 I;  4DR1 I;  1WUU A;  4B3T I;  2VQE I;  4IFD C;  1E3P A;  2ZM6 E;  5IT9 Q;  4RPF A;  1FI4 A;  2CVE A;  2WP8 B;  4JI0 E;  1Z0C A;  3P06 A;  2Z5B B;  1NHH A;  3J80 Q;  2A2D A;  2HHH E;  2PNZ B;  4DV1 I;  2J65 A;  2BR2 A;  4MU4 A;  4OX9 E;  2JEB B;  4FWD A;  4OO1 A;  1XNR I;  3GCM A;  1HR0 I;  1N33 E;  4NXN I;  2UU9 E;  4DR4 E;  2PO1 B;  3J81 C;  4DR2 I;  2IOQ A;  5DRO A;  1Z0W A;  4U3B A;  4LF7 I;  2C37 B;  2E5L E;  4LFB E;  1OYP A;  5K36 D;  2JE6 A;  4DV5 E;  2R3V A;  2NN6 A;  1VI7 A;  3PRY A;  4UTG A;  4JG4 A;  4FW3 A;  1NHI A;  4JI2 I;  1XXE A;  4AM3 A;  4DR7 E;  1YH8 A;  5JEA A;  4JV5 E;  2PO2 B;  1HNX I;  4DV7 I;  2O1U A;  1FKA E;  4JI5 I;  4AQY I;  1Z59 A;  1XHK A;  4LF8 I;  3B78 A;  2Q2E B;  5GME A;  2BA0 D;  4LCG A;  1H73 A;  1J5E I;  4DR5 E;  4JI6 I;  4XTJ A;  2GO4 A;  3H4L A;  5L3J A;  4IZK A;  4IS9 A;  2UXB E;  1QZR A;  1Z5A A;  3UHM A;  3JAM C;  2V34 A;  2UUA E;  1Y4U A;  1XMQ I;  2JEA A;  1HNW I;  4DR3 I;  1Y6Z A;  3K1J A;  4DV6 E;  4FWH A;  4JI1 E;  5C0X F;  4YY3 I;  4DXL A;  2GS8 A;  2HK3 A;  3M6A A;  5K36 A;  1Y60 A;  2CZ9 A;  4YHH I;  4IFD D;  4K0K I;  5DNX A;  4BA1 A;  1OYR A;  4FW9 A;  4FN5 A;  3CDJ A;  3QT6 A;  4JI7 E;  1Z5B A;  3T1Y E;  5BR8 I;  2O1V A;  4IZJ B;  1KTV A;  1UDO A;  3WU6 A;  4X65 I;  2Z5C A;  5A2Q Q;  4LF4 E;  2UXD E;  4OO1 F;  4DUZ E;  2HFU A;  2V2V A;  5IWA I;  4JI3 I;  1OJ4 A;  4DUY I;  4JI4 E;  2F1D A;  3H1C A;  4DV3 E;  4MDT A;  2A2C A;  3P76 A;  3Q6M A;  5EL9 A;  1KIJ A;  3PS1 A;  3HKM A;  4MYU A;  4GQU A;  5IT9 C;  3B8H A;  2ZIT A;  1B62 A;  5C0X B;  2AJ4 A;  3PYE A;  4DPW A;  4GKK I;  1MG7 A;  2NN6 F;  2VF3 A;  5ELW A;  3J80 C;  4B3M E;  1N32 E;  2C38 A;  4LF9 E;  1BKN A;  5JEA F;  3KRN A;  4LCH A;  4MYT A;  2GO3 A;  1HNZ I;  2C39 B;  3L7Z A;  3GME A;  2CGE A;  1XNQ I;  3WU4 A;  1IBK I;  4M1K A;  1UDN A;  1S4E A;  1Z0V A;  4X64 E;  4JYA E;  2UXC E;  3QT7 A;  3ZM7 A;  4PU9 A;  4WUD A;  4OO1 B;  2BA1 G;  5FLX Q;  2UUC I;  4LFA I;  1Y5Y A;  4KHP E;  1IBM I;  4J3D A;  4DV4 I;  2VQF I;  4DR6 I;  4NXM I;  2JE6 B;  4HY1 A;  5C0X C;  4DU8 A;  2X36 A;  3P3C A;  2UXD I;  2PNL A;  4IFD E;  3M85 D;  4LPF A;  1R6M A;  2DEJ A;  4AIM A;  4ISA A;  5JEA B;  5LMN I;  4B3S E;  2WNR B;  1A6F A;  4Z7C A;  2F4V E;  5K36 F;  1XMO E;  1ELO A;  1FWL A;  5DRR A;  3M7N D;  3T1H E;  4LOM A;  2BM1 A;  4LF5 I;  1RRE A;  4GKJ I;  4PRX A;  3OTO E;  4X62 I;  4BA2 A;  1UDQ A;  4QNK A;  5C0X E;  4IZK B;  2WP8 A;  2Z5B A;  4OO1 C;  4DV2 E;  1N34 E;  3GON A;  2PNZ A;  4LFC E;  4DPX A;  4P7A A;  5DRP A;  1B63 A;  1ZXM A;  2UUB I;  2JEB A;  1FJG E;  2JEA B;  4LF6 E;  4X66 E;  4UT4 A;  1N36 E;  1I94 E;  1PKP A;  4I3H A;  2ZM6 I;  2PO1 A;  1H72 C;  4MU0 A;  1IBL E;  4DPY A;  4JI0 I;  1H7S A;  3LPS A;  1FNM A;  5JEA C;  1Z0G A;  2HHH I;  4BA1 B;  4USK A;  5A2Q C;  4OX9 I;  2PNM A;  2O3Z A;  1D6T A;  1P42 A;  3HJC A;  1N33 I;  4IZJ D;  2UU9 I;  4DR4 I;  3LNU A;  3K17 A;  3QT8 A;  1RR9 A;  5LMU E;  1H74 A;  3CDI A;  5EKW A;  2E5L I;  4LFB I;  2PO0 B;  1Z0T A;  1USV A;  4DV5 I;  1OYS A;  2HKJ A; 
#chains in the Genus database with same CATH homology
 4B3R E;  2O1T A;  1FWK A;  4HAC A;  1Z0E A;  2XEX A;  4JI8 E;  4DR7 I;  4DV0 E;  4JV5 I;  2J7K A;  4DR1 E;  4B3T E;  2VQE E;  2HK2 A;  2OI2 A;  2BM0 A;  4DR5 I;  2Z5E A;  1KVK A;  2WW4 A;  4DV1 E;  5FLX C;  2UXB I;  2GQ0 A;  1XNR E;  1HR0 E;  4N3O A;  3ZZT A;  2V2Q A;  3WU3 A;  1ZM3 A;  2UUA I;  4NXN E;  3CWV A;  4EMD A;  1HK7 A;  4DR2 E;  4DU7 A;  4DV6 I;  4LF7 E;  1UEK A;  4JI1 I;  4R1F A;  1ZM2 A;  4URL A;  4JI2 E;  4USM A;  1PIE A;  4DV7 E;  1HNX E;  1U2R A;  4AQY E;  4JI7 I;  5GMD A;  3T1Y I;  4LF8 E;  4ZVI A;  1J5E E;  1MX0 A;  4JI6 E;  2X7I A;  2O1W A;  3ZKD A;  1MU5 A;  4LF4 I;  4DUZ I;  1N0V C;  3LTO A;  4JI4 I;  3PYG A;  3PYD A;  1NHJ A;  4DV3 I;  1XMQ E;  1USU A;  2V2Z A;  1HNW E;  4DR3 E;  2EFG A;  2NPF A;  4HYM A;  4YY3 E;  3Q6N A;  4P52 A;  3ZZU A;  1VIS A;  4B3M I;  3J7A M;  1N32 I;  4LF9 I;  4YHH E;  4K0K E;  4DPT A;  3HUL A;  5BR8 E;  3WU5 A;  2HKE A;  2R42 A;  4X64 I;  4JYA I;  3ZZ0 A;  2UXC I;  4X65 E;  3V5R A;  1EI1 A;  1Z0B A;  4KHP I;  1DAR A;  5IWA E;  4JI3 E;  4DUY E;  4WUC A;  4DPU A;  3J81 Q;  2HFS A;  4HAC B;  4GKK E;  2Z5C B;  4B3S I;  2F4V I;  2V8P A;  1XMO I;  2LJP A;  3QT5 A;  2IOP A;  3D4J A;  3PYF A;  3T1H I;  1HNZ E;  1ZXN A;  5LL6 R;  1K47 A;  4WUB A;  3OTO I;  1XNQ E;  1IBK E;  4KQV A;  3K85 A;  2ZBK B;  4DV2 I;  1N34 I;  1S16 A;  2UUC E;  4LFC I;  4LFA E;  2CG9 A;  3JAM Q;  3Q1Q A;  1IBM E;  1FJG I;  4LF6 I;  4DV4 E;  4Z7Y A;  2VQF E;  4X66 I;  1N36 I;  1I94 I;  4DR6 E;  1PVG A;  4NXM E;  1IBL I;  1ZM4 A;  1ZM9 A;  1H7U A;  4PRV A;  5LMN E;  2BV3 A;  4IZJ A;  4HXZ A;  3V2U C;  1NZ0 A;  3B82 A;  1Z5C A;  4LF5 E;  3F0N A;  4GKJ E;  4ED4 A;  1N0U A;  4X62 E;  2DEI A;  5FWK A;  5LMU I;  4JI5 E;  3J7A G;  4FWG A;  1Y4S A;  1KKH A;  4B3R I;  1EA6 A;  2UUB E;  4JI8 I;  2E1R A;  3ZKB A;  4DV0 I;  4DR1 I;  1WUU A;  4B3T I;  2VQE I;  2ZM6 E;  5IT9 Q;  4RPF A;  1FI4 A;  4JI0 E;  1Z0C A;  3P06 A;  2Z5B B;  1NHH A;  3J80 Q;  2A2D A;  2HHH E;  4DV1 I;  4OX9 E;  4FWD A;  1XNR I;  1HR0 I;  1N33 E;  4NXN I;  2UU9 E;  4DR4 E;  3J81 C;  4DR2 I;  2IOQ A;  1Z0W A;  4LF7 I;  2E5L E;  4LFB E;  4DV5 E;  2R3V A;  3PRY A;  4UTG A;  4JG4 A;  1NHI A;  4JI2 I;  4DR7 E;  4JV5 E;  1HNX I;  4DV7 I;  2O1U A;  1FKA E;  4JI5 I;  4AQY I;  1Z59 A;  1XHK A;  4LF8 I;  3B78 A;  2Q2E B;  5GME A;  1H73 A;  1J5E I;  4DR5 E;  4JI6 I;  4XTJ A;  3H4L A;  5L3J A;  4IZK A;  2UXB E;  1QZR A;  1Z5A A;  3JAM C;  2V34 A;  2UUA E;  1Y4U A;  1XMQ I;  1HNW I;  4DR3 I;  1Y6Z A;  3K1J A;  4DV6 E;  4FWH A;  4JI1 E;  4YY3 I;  4DXL A;  2GS8 A;  2HK3 A;  3M6A A;  2CZ9 A;  4YHH I;  4K0K I;  4FW9 A;  4FN5 A;  3QT6 A;  4JI7 E;  1Z5B A;  3T1Y E;  5BR8 I;  2O1V A;  4IZJ B;  1KTV A;  3WU6 A;  4X65 I;  2Z5C A;  5A2Q Q;  4LF4 E;  2UXD E;  4DUZ E;  2HFU A;  2V2V A;  5IWA I;  4JI3 I;  1OJ4 A;  4DUY I;  4JI4 E;  4DV3 E;  2A2C A;  3Q6M A;  1KIJ A;  4MYU A;  5IT9 C;  3B8H A;  2ZIT A;  1B62 A;  2AJ4 A;  3PYE A;  4DPW A;  4GKK I;  1MG7 A;  2VF3 A;  3J80 C;  4B3M E;  1N32 E;  4LF9 E;  1BKN A;  4MYT A;  1HNZ I;  1XNQ I;  2CGE A;  3WU4 A;  1IBK I;  4M1K A;  1S4E A;  1Z0V A;  4X64 E;  4JYA E;  2UXC E;  3QT7 A;  3ZM7 A;  4PU9 A;  4WUD A;  5FLX Q;  2UUC I;  4LFA I;  4KHP E;  1IBM I;  4DV4 I;  2VQF I;  4DR6 I;  4NXM I;  4HY1 A;  4DU8 A;  2X36 A;  2UXD I;  2PNL A;  2DEJ A;  5LMN I;  4B3S E;  4Z7C A;  1A6F A;  2F4V E;  1XMO E;  1ELO A;  1FWL A;  3T1H E;  2BM1 A;  4LF5 I;  1RRE A;  4GKJ I;  4PRX A;  3OTO E;  4X62 I;  4IZK B;  2Z5B A;  4DV2 E;  1N34 E;  3GON A;  4LFC E;  4DPX A;  4P7A A;  1B63 A;  1ZXM A;  2UUB I;  1FJG E;  4LF6 E;  1N36 E;  4X66 E;  4UT4 A;  1I94 E;  1PKP A;  4I3H A;  2ZM6 I;  1H72 C;  1IBL E;  4DPY A;  4JI0 I;  1H7S A;  3LPS A;  1FNM A;  1Z0G A;  2HHH I;  4USK A;  5A2Q C;  4OX9 I;  2PNM A;  1D6T A;  3HJC A;  1N33 I;  4IZJ D;  2UU9 I;  4DR4 I;  3LNU A;  3K17 A;  3QT8 A;  1RR9 A;  5LMU E;  1H74 A;  2E5L I;  4LFB I;  1Z0T A;  1USV A;  4DV5 I;  2HKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...