3J81Q

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j81Q00
3WU3A 2ZBKB 4M1KA 1IBME 1N32I 1A6FA 3ZM7A 2V34A 5GMEA 4LF8I 4DUZI 1B63A 4JI2E 1KKHA 2EFGA 4X62I 4DPUA 3J81C 2A2DA 4LFCE 2VF3A 5IWAI 4ZVIA 5BR8I 3GONA 3PYEA 2HKEA 4YHHI 1XMQE 1I94I 3ZKBA 2UXCI 2LJPA 4AQYE 1N34E 2V2ZA 1NHIA 4DR7E 4DV3E 4DV1I 1HR0E 1N36I 4FWGA 5FLXQ 1HNWI 3JAMC 1XNQI 1ZM4A 3M6AA 4B3SE 2UUBI 2HK2A 4LF7E 3T1YE 4DR5E 1XMOI 2Q2EB 3V5RA 2UU9E 4X64I 2ZITA 1ZXMA 2HFSA 1S4EA 3QT5A 4YY3E 2HHHI 4DU7A 4MYTA 4XTJA 4KQVA 1KVKA 1N33I 3B82A 1HNZE 1MG7A 4PU9A 4KHPI 4Z7CA 1UEKA 1H74A 4JYAE 1U2RA 1FNMA 2ZM6E 4LFBE 4PRVA 4NXNE 4DPWA 1H73A 2A2CA 3J80Q 1D6TA 1H7UA 1Z0GA 4DPXA 4EMDA 4NXMI 1Z0EA 5L3JA 1FJGE 1FWLA 2HK3A 4JI6I 4OX9I 3D4JA 4UTGA 3J81Q 4LF9I 2BM0A 5LL6R 4DV0E 4DV6E 1N0VC 2F4VI 1H72C 1IBMI 4LF6E 3J80C 2UUCE 2UUAE 4GKKE 3JAMQ 4JI1E 2VQEI 4LFCI 4DR4I 3ZZUA 3OTOI 1Z0CA 2AJ4A 2BV3A 1XMQI 1FI4A 2UXBI 4WUDA 1VISA 4AQYI 3T1HE 1KTVA 1N34I 5IT9C 1ZXNA 4DR7I 4USKA 1Z59A 4DV3I 1ELOA 4DR6E 2J7KA 3LNUA 4JI0E 4X66E 1Z5AA 1ZM9A 4B3SI 4URLA 3CWVA 4LF7I 3T1YI 4DR5I 1EI1A 2NPFA 4DR3E 2X7IA 4Z7YA 4JI7E 2DEIA 4B3TI 4JV5E 3PYFA 2UU9I 1J5EE 4JI4I 4P7AA 1I94E 2UXCE 4P52A 4DV2I 4B3ME 1ZM3A 4DXLA 4YY3I 4DV7E 1N36E 1PVGA 2V8PA 1BKNA 1XNQE 4X65I 1RR9A 4UT4A 1MX0A 2VQFE 4FWDA 1Z0VA 2XEXA 5LMNI 4MYUA 4JI5E 1S16A 2DEJA 4JYAI 2ZM6I 2E5LI 4LFBI 1Z5CA 4GKJE 4NXNI 3F0NA 1PIEA 1NHJA 1DARA 4X64E 3WU5A 4DR1E 4JI3E 4LF5E 3HULA 4DU8A 1HNXE 1NZ0A 4JI8E 2R42A 1FJGI 1FWKA 4R1FA 4DV4I 4B3RE 3Q1QA 4DPTA 4DV0I 4DV6I 4LFAE 4LF6I 4HACA 1OJ4A 5IT9Q 2UXDE 2GS8A 2UUCI 1XNRE 4FW9A 2UUAI 4GKKI 4JI2I 4JI1I 4USMA 4LF4E 1IBLE 4FN5A 1IBKE 4JI6E 4ED4A 2HKJA 4JG4A 1Z5BA 4DUYE 5LMUE 4K0KE 4DR2E 1B62A 4DV5E 1Z0TA 4I3HA 1MU5A 4DR6I 4JI0I 4X66I 3J7AM 1N32E 2WW4A 1HR0I 4LF8E 4DUZE 4PRXA 2VQEE 4DR3I 4X62E 4FWHA 5A2QC 4HYMA 4JI7I 4DR4E 3OTOE 4JV5I 4DPYA 3H4LA 1J5EI 2UXBE 5IWAE 5BR8E 2R3VA 4YHHE 4B3MI 1KIJA 3J7AG 3WU4A 5GMDA 4DV7I 1EA6A 1H7SA 3PYDA 2X36A 3QT7A 3WU6A 2VQFI 3B78A 4DV1E 1HNWE 3ZKDA 2V2QA 4JI5I 2V2VA 4RPFA 2UUBE 1RREA 1HNZI 3QT8A 4GKJI 2E1RA 2BM1A 2OI2A 4B3TE 1XMOE 4JI4E 4DR1I 2CZ9A 4JI3I 1FKAE 4DV2E 4LF5I 1HNXI 4JI8I 1QZRA 4WUCA 1ZM2A 2HFUA 5FLXC 4X65E 1XHKA 3V2UC 4B3RI 2HHHE 4LFAI 4HY1A 5LMNE 3PYGA 4HXZA 3K17A 1N33E 2E5LE 3B8HA 4KHPE 3ZZ0A 2UXDI 1Z0BA 4HACB 1XNRI 1PKPA 1K47A 1NHHA 3LPSA 4WUBA 1N0UA 4NXME 4LF4I 1IBLI 1IBKI 4DV4E 4DUYI 5LMUI 5A2QQ 4OX9E 4K0KI 4DR2I 4DV5I 4LF9E 3LTOA 1Z0WA 3ZZTA 1WUUA 3QT6A 3T1HI 2F4VE 3K1JA
chains in the Genus database with same CATH superfamily
3WU3A 2ZBKB 4M1KA 1IBME 1N32I 1A6FA 1OYPA 5JEAC 3ZM7A 2V34A 5GMEA 4LF8I 2GQ0A 4DUZI 1B63A 4JI2E 1KKHA 3M85D 2EFGA 4X62I 4DPUA 3J81C 5DROA 2A2DA 2WNRB 2WNRA 1OYRA 4LFCE 2VF3A 5IWAI 4ZVIA 5BR8I 3GONA 3PYEA 5ELWA 2HKEA 4YHHI 1P42A 1XMQE 1I94I 3ZKBA 2UXCI 2LJPA 4AQYE 2AE8A 1N34E 3GCMA 3Q6MA 2V2ZA 1NHIA 4DR7E 4DV3E 4DV1I 1HR0E 1N36I 4FWGA 5FLXQ 1HNWI 3JAMC 1XNQI 1ZM4A 3M6AA 4B3SE 2UUBI 2WP8A 3H1CA 2HK2A 4LF7E 3T1YE 4DR5E 1XMOI 2Q2EB 3V5RA 3P3CA 2UU9E 4X64I 3HKMA 2ZITA 1ZXMA 4U3DA 2HFSA 4U3BA 2C37B 1E3HA 1S4EA 2O1WA 4FW5A 1UDQA 3QT5A 4YY3E 2HHHI 4DU7A 4MYTA 2BA1D 4XTJA 4KQVA 4IFDD 1KVKA 1N33I 3B82A 1HNZE 1MG7A 2PNMA 4PU9A 4KHPI 4Z7CA 5C0XD 1UEKA 1H74A 4JYAE 1U2RA 5C0XE 1FNMA 2PO2B 2PO2A 2ZM6E 4LFBE 2IERA 4PRVA 2NN6B 2NN6A 2NN6F 4NXNE 5DRPA 5DRRA 4DPWA 1H73A 2A2CA 3J80Q 1D6TA 1H7UA 1Z0GA 3P3GA 4DPXA 4EMDA 4NXMI 1Z0EA 4OO1D 5L3JA 4OO1E 1R6MA 1UDSA 4IZJB 1HK7A 1FJGE 1FWLA 2HK3A 4JI6I 4OX9I 3L7ZA 3L7ZB 3D4JA 2PO1A 2Z5BA 4UTGA 3J81Q 4LF9I 2JEBB 3P06A 2BM0A 1UDNA 2BA0D 4BA1B 5LL6R 3M7NG 4DV0E 4DV6E 1N0VC 2F4VI 1H72C 1IBMI 4LF6E 2CGEA 2NN6C 4LCGA 2NN6E 3J80C 2UUCE 4LPFA 3P76A 5EKWA 4FW4A 5DNXA 5JEAD 2UUAE 4MU4A 2VESA 4GKKE 5JEAE 3NZKA 3JAMQ 2F1DA 4JI1E 4IZJD 2VQEI 1E3PA 1YHCA 4LFCI 4DR4I 3ZZUA 3OTOI 1Z0CA 2AJ4A 2BV3A 1XMQI 1FI4A 1Y4SA 2UXBI 4WUDA 1VISA 4AQYI 3T1HE 3PS3A 1KTVA 1N34I 1UDOA 5IT9C 2BR2A 1ZXNA 4DR7I 1Y6ZA 4USKA 1Z59A 4DV3I 1ELOA 4DR6E 2J7KA 3LNUA 4JI0E 4X66E 1R6LA 1Z5AA 3UHMA 1ZM9A 4B3SI 4URLA 5K36A 3CWVA 4MU3A 4LF7I 3T1YI 4DR5I 1EI1A 2NPFA 4DR3E 2X7IA 2WP8B 2C38A 4Z7YA 4JI7E 3P3EA 2DEIA 4B3TI 2PO0A 4MU0A 2PO0B 4JV5E 3PYFA 2UU9I 1J5EE 4JI4I 4P7AA 1Y60A 4LCHA 5EL9A 1I94E 4MQYA 2UXCE 1XXEA 4FW3A 4P52A 4LCFA 4DV2I 3KRNA 2C39B 2C39A 4B3ME 1ZM3A 2O1VA 4DXLA 4YY3I 1YH8A 4DV7E 1N36E 1PVGA 2IOPA 2V8PA 1BKNA 1XNQE 4X65I 1RR9A 4UT4A 1MX0A 2VQFE 2Z5CB 2Z5CA 1Z0VA 4FWDA 4BA2A 2XEXA 5LMNI 4MYUA 4JI5E 4QNKA 1S16A 2DEJA 4JYAI 2ZM6I 2E5LI 4NBQA 1Z5CA 4GKJE 4ISAA 4OZEA 4LFBI 4NXNI 4FW6A 3F0NA 1PIEA 1NHJA 1DARA 3B4TA 4X64E 3WU5A 4J3DA 4DR1E 3Q6NA 4JI3E 4LF5E 3HULA 4DU8A 1Y5YA 1HNXE 1NZ0A 3K85A 1OYSA 2R42A 4JI8E 3PS2A 1FJGI 1FWKA 3PRYA 4R1FA 3GMEA 4QNJA 4LOMA 4DV4I 4B3RE 2JEAB 2JEAA 3Q1QA 4DPTA 4DV0I 4DV6I 4LFAE 2PO1B 2Z5BB 3M7ND 2O3ZA 4LF6I 2JE6A 4GQUA 4HACA 4AIDA 1OJ4A 5IT9Q 2UXDE 2GS8A 2J65A 2UUCI 2NN6D 1XNRE 4FW9A 2UUAI 4GKKI 4JI2I 4JI1I 4USMA 4LF4E 1IBLE 4FN5A 3U1KA 1IBKE 4JI6E 4ED4A 4IZKB 2CG9A 4IZKA 2HKJA 4JG4A 1Z5BA 4DUYE 1VI7A 5LMUE 2BA0G 4K0KE 4DR2E 3U1YA 1B62A 4DV5E 4FW7A 1Z0TA 4I3HA 1MU5A 4DR6I 2BR2B 4JI0I 4X66I 3J7AM 1N32E 3DD6A 2WW4A 1HR0I 3M85G 4LF8E 2IESA 4DUZE 4PRXA 2VQEE 4DR3I 4X62E 4FWHA 5A2QC 3CDIA 4HYMA 5K36B 4JI7I 4DR4E 5K36F 4OKGA 3OTOE 4JV5I 4DPYA 3H4LA 1J5EI 2C38B 4AM3A 3GLLA 2JT2A 2UXBE 4MU1A 2Z5EA 5FWKA 5BR8E 5IWAE 2PNLA 2R3VA 4YHHE 4B3MI 1KIJA 3J7AG 3WU4A 5GMDA 4DV7I 1EA6A 1H7SA 3PYDA 2X36A 3QT7A 3WU6A 4IFDA 4IFDB 1USUA 3HJCA 4AIMA 3B78A 2VQFI 4DV1E 4IFDF 1HNWE 3ZKDA 2V2QA 5C0XB 5C0XA 4JI5I 2V2VA 5C0XF 4RPFA 2UUBE 4BA2B 1RREA 1HNZI 3QT8A 4GKJI 5K36D 2E1RA 2BM1A 2OI2A 4B3TE 5K36C 5K36E 3CDJA 1XMOE 4JI4E 5DNLA 4DR1I 2PNZA 2PNZB 2CZ9A 1USVA 4OO1A 4JI3I 2GO4A 4OO1B 3PS1A 4DV2E 2C37A 1FKAE 4LF5I 4OO1F 1HNXI 4JI8I 4N3OA 2IOQA 1RHYA 1QZRA 4WUCA 2GO3A 1ZM2A 2HFUA 5FLXC 4X65E 1XHKA 3V2UC 1Y4UA 2BA1G 4B3RI 2HHHE 4IFDC 4IFDE 4LFAI 4HY1A 5LMNE 5DRQA 3PYGA 5C0XC 4HXZA 3K17A 4IS9A 2E5LE 3B8HA 1N33E 4KHPE 3ZZ0A 2UXDI 1Z0BA 2JE6B 5JEAB 4HACB 5JEAA 5JEAF 1XNRI 1PKPA 1K47A 1NHHA 3LPSA 4WUBA 4OO1C 1N0UA 4NXME 4IZJA 4LF4I 4MDTA 1IBLI 1IBKI 4DV4E 4DUYI 5LMUI 2CVEA 5A2QQ 2JEBA 4OX9E 4K0KI 4BA1A 4DR2I 4DV5I 2O1TA 4LF9E 2O1UA 3LTOA 1Z0WA 3ZZTA 1WUUA 3QT6A 3T1HI 2F4VE 3K1JA
chains in the Genus database with same CATH topology
3WU3A 2ZBKB 4M1KA 1IBME 1N32I 1A6FA 3ZM7A 2V34A 5GMEA 4LF8I 2GQ0A 4DUZI 1B63A 4JI2E 1KKHA 2EFGA 4X62I 4DPUA 3J81C 2A2DA 4LFCE 2VF3A 5IWAI 4ZVIA 5BR8I 3GONA 3PYEA 2HKEA 4YHHI 1XMQE 1I94I 3ZKBA 2UXCI 2LJPA 4AQYE 1N34E 3Q6MA 2V2ZA 1NHIA 4DR7E 4DV3E 4DV1I 1HR0E 1N36I 4FWGA 5FLXQ 1HNWI 3JAMC 1XNQI 1ZM4A 3M6AA 4B3SE 2UUBI 2HK2A 4LF7E 3T1YE 4DR5E 1XMOI 2Q2EB 3V5RA 2UU9E 4X64I 2ZITA 1ZXMA 2HFSA 1S4EA 2O1WA 3QT5A 4YY3E 2HHHI 4DU7A 4MYTA 4XTJA 4KQVA 1KVKA 1N33I 3B82A 1HNZE 1MG7A 2PNMA 4PU9A 4KHPI 4Z7CA 1UEKA 1H74A 4JYAE 1U2RA 1FNMA 2ZM6E 4LFBE 4PRVA 4NXNE 4DPWA 1H73A 2A2CA 3J80Q 1D6TA 1H7UA 1Z0GA 4DPXA 4EMDA 4NXMI 1Z0EA 5L3JA 4IZJB 1HK7A 1FJGE 1FWLA 2HK3A 4JI6I 4OX9I 3D4JA 2Z5BA 4UTGA 3J81Q 4LF9I 3P06A 2BM0A 5LL6R 4DV0E 4DV6E 1N0VC 2F4VI 1H72C 1IBMI 4LF6E 2CGEA 3J80C 2UUCE 2UUAE 4GKKE 3JAMQ 4JI1E 4IZJD 2VQEI 4LFCI 4DR4I 3ZZUA 3OTOI 1Z0CA 2AJ4A 2BV3A 1XMQI 1FI4A 1Y4SA 2UXBI 4WUDA 1VISA 4AQYI 3T1HE 1KTVA 1N34I 5IT9C 1ZXNA 4DR7I 1Y6ZA 4USKA 1Z59A 4DV3I 1ELOA 4DR6E 2J7KA 3LNUA 4JI0E 4X66E 1Z5AA 1ZM9A 4B3SI 4URLA 3CWVA 4LF7I 3T1YI 4DR5I 1EI1A 2NPFA 4DR3E 2X7IA 4Z7YA 4JI7E 2DEIA 4B3TI 4JV5E 3PYFA 2UU9I 1J5EE 4JI4I 4P7AA 1I94E 2UXCE 4P52A 4DV2I 4B3ME 1ZM3A 2O1VA 4DXLA 4YY3I 4DV7E 1N36E 1PVGA 2IOPA 2V8PA 1BKNA 1XNQE 4X65I 1RR9A 4UT4A 1MX0A 2VQFE 2Z5CB 2Z5CA 1Z0VA 4FWDA 2XEXA 5LMNI 4MYUA 4JI5E 1S16A 2DEJA 4JYAI 2ZM6I 2E5LI 4LFBI 1Z5CA 4GKJE 4NXNI 3F0NA 1PIEA 1NHJA 1DARA 4X64E 3WU5A 4DR1E 3Q6NA 4JI3E 4LF5E 3HULA 4DU8A 1HNXE 1NZ0A 3K85A 2R42A 4JI8E 1FJGI 1FWKA 3PRYA 4R1FA 4DV4I 4B3RE 3Q1QA 4DPTA 4DV0I 4DV6I 4LFAE 2Z5BB 4LF6I 4HACA 1OJ4A 5IT9Q 2UXDE 2GS8A 2UUCI 1XNRE 4FW9A 2UUAI 4GKKI 4JI2I 4JI1I 4USMA 4LF4E 1IBLE 4FN5A 1IBKE 4JI6E 4ED4A 4IZKB 2CG9A 4IZKA 2HKJA 4JG4A 1Z5BA 4DUYE 5LMUE 4K0KE 4DR2E 1B62A 4DV5E 1Z0TA 4I3HA 1MU5A 4DR6I 4JI0I 4X66I 3J7AM 1N32E 2WW4A 1HR0I 4LF8E 4DUZE 4PRXA 2VQEE 4DR3I 4X62E 4FWHA 5A2QC 4HYMA 4JI7I 4DR4E 3OTOE 4JV5I 4DPYA 3H4LA 1J5EI 2UXBE 2Z5EA 5FWKA 5BR8E 5IWAE 2PNLA 2R3VA 4YHHE 4B3MI 1KIJA 3J7AG 3WU4A 5GMDA 4DV7I 1EA6A 1H7SA 3PYDA 2X36A 3QT7A 3WU6A 1USUA 3HJCA 2VQFI 3B78A 4DV1E 1HNWE 3ZKDA 2V2QA 4JI5I 2V2VA 4RPFA 2UUBE 1RREA 1HNZI 3QT8A 4GKJI 2E1RA 2BM1A 2OI2A 4B3TE 1XMOE 4JI4E 4DR1I 2CZ9A 1USVA 4JI3I 1FKAE 4DV2E 4LF5I 1HNXI 4JI8I 4N3OA 2IOQA 1QZRA 4WUCA 1ZM2A 2HFUA 5FLXC 4X65E 1XHKA 3V2UC 1Y4UA 4B3RI 2HHHE 4LFAI 4HY1A 5LMNE 3PYGA 4HXZA 3K17A 1N33E 2E5LE 3B8HA 4KHPE 3ZZ0A 2UXDI 1Z0BA 4HACB 1XNRI 1PKPA 1K47A 1NHHA 3LPSA 4WUBA 1N0UA 4NXME 4IZJA 4LF4I 1IBLI 1IBKI 4DV4E 4DUYI 5LMUI 5A2QQ 4OX9E 4K0KI 4DR2I 4DV5I 2O1TA 4LF9E 2O1UA 3LTOA 1Z0WA 3ZZTA 1WUUA 3QT6A 3T1HI 2F4VE 3K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU3 A;  2ZBK B;  4M1K A;  1IBM E;  1N32 I;  1A6F A;  3ZM7 A;  2V34 A;  5GME A;  4LF8 I;  4DUZ I;  1B63 A;  4JI2 E;  1KKH A;  2EFG A;  4X62 I;  4DPU A;  3J81 C;  2A2D A;  4LFC E;  2VF3 A;  5IWA I;  4ZVI A;  5BR8 I;  3GON A;  3PYE A;  2HKE A;  4YHH I;  1XMQ E;  1I94 I;  3ZKB A;  2UXC I;  2LJP A;  4AQY E;  1N34 E;  2V2Z A;  1NHI A;  4DR7 E;  4DV3 E;  4DV1 I;  1HR0 E;  1N36 I;  4FWG A;  5FLX Q;  1HNW I;  3JAM C;  1XNQ I;  1ZM4 A;  3M6A A;  4B3S E;  2UUB I;  2HK2 A;  4LF7 E;  3T1Y E;  4DR5 E;  1XMO I;  2Q2E B;  3V5R A;  2UU9 E;  4X64 I;  2ZIT A;  1ZXM A;  2HFS A;  1S4E A;  3QT5 A;  4YY3 E;  2HHH I;  4DU7 A;  4MYT A;  4XTJ A;  4KQV A;  1KVK A;  1N33 I;  3B82 A;  1HNZ E;  1MG7 A;  4PU9 A;  4KHP I;  4Z7C A;  1UEK A;  1H74 A;  4JYA E;  1U2R A;  1FNM A;  2ZM6 E;  4LFB E;  4PRV A;  4NXN E;  4DPW A;  1H73 A;  2A2C A;  3J80 Q;  1D6T A;  1H7U A;  1Z0G A;  4DPX A;  4EMD A;  4NXM I;  1Z0E A;  5L3J A;  1FJG E;  1FWL A;  2HK3 A;  4JI6 I;  4OX9 I;  3D4J A;  4UTG A;  3J81 Q;  4LF9 I;  2BM0 A;  5LL6 R;  4DV0 E;  4DV6 E;  1N0V C;  2F4V I;  1H72 C;  1IBM I;  4LF6 E;  3J80 C;  2UUC E;  2UUA E;  4GKK E;  3JAM Q;  4JI1 E;  2VQE I;  4LFC I;  4DR4 I;  3ZZU A;  3OTO I;  1Z0C A;  2AJ4 A;  2BV3 A;  1XMQ I;  1FI4 A;  2UXB I;  4WUD A;  1VIS A;  4AQY I;  3T1H E;  1KTV A;  1N34 I;  5IT9 C;  1ZXN A;  4DR7 I;  4USK A;  1Z59 A;  4DV3 I;  1ELO A;  4DR6 E;  2J7K A;  3LNU A;  4JI0 E;  4X66 E;  1Z5A A;  1ZM9 A;  4B3S I;  4URL A;  3CWV A;  4LF7 I;  3T1Y I;  4DR5 I;  1EI1 A;  2NPF A;  4DR3 E;  2X7I A;  4Z7Y A;  4JI7 E;  2DEI A;  4B3T I;  4JV5 E;  3PYF A;  2UU9 I;  1J5E E;  4JI4 I;  4P7A A;  1I94 E;  2UXC E;  4P52 A;  4DV2 I;  4B3M E;  1ZM3 A;  4DXL A;  4YY3 I;  4DV7 E;  1N36 E;  1PVG A;  2V8P A;  1BKN A;  1XNQ E;  4X65 I;  1RR9 A;  4UT4 A;  1MX0 A;  2VQF E;  4FWD A;  1Z0V A;  2XEX A;  5LMN I;  4MYU A;  4JI5 E;  1S16 A;  2DEJ A;  4JYA I;  2ZM6 I;  2E5L I;  4LFB I;  1Z5C A;  4GKJ E;  4NXN I;  3F0N A;  1PIE A;  1NHJ A;  1DAR A;  4X64 E;  3WU5 A;  4DR1 E;  4JI3 E;  4LF5 E;  3HUL A;  4DU8 A;  1HNX E;  1NZ0 A;  4JI8 E;  2R42 A;  1FJG I;  1FWK A;  4R1F A;  4DV4 I;  4B3R E;  3Q1Q A;  4DPT A;  4DV0 I;  4DV6 I;  4LFA E;  4LF6 I;  4HAC A;  1OJ4 A;  5IT9 Q;  2UXD E;  2GS8 A;  2UUC I;  1XNR E;  4FW9 A;  2UUA I;  4GKK I;  4JI2 I;  4JI1 I;  4USM A;  4LF4 E;  1IBL E;  4FN5 A;  1IBK E;  4JI6 E;  4ED4 A;  2HKJ A;  4JG4 A;  1Z5B A;  4DUY E;  5LMU E;  4K0K E;  4DR2 E;  1B62 A;  4DV5 E;  1Z0T A;  4I3H A;  1MU5 A;  4DR6 I;  4JI0 I;  4X66 I;  3J7A M;  1N32 E;  2WW4 A;  1HR0 I;  4LF8 E;  4DUZ E;  4PRX A;  2VQE E;  4DR3 I;  4X62 E;  4FWH A;  5A2Q C;  4HYM A;  4JI7 I;  4DR4 E;  3OTO E;  4JV5 I;  4DPY A;  3H4L A;  1J5E I;  2UXB E;  5IWA E;  5BR8 E;  2R3V A;  4YHH E;  4B3M I;  1KIJ A;  3J7A G;  3WU4 A;  5GMD A;  4DV7 I;  1EA6 A;  1H7S A;  3PYD A;  2X36 A;  3QT7 A;  3WU6 A;  2VQF I;  3B78 A;  4DV1 E;  1HNW E;  3ZKD A;  2V2Q A;  4JI5 I;  2V2V A;  4RPF A;  2UUB E;  1RRE A;  1HNZ I;  3QT8 A;  4GKJ I;  2E1R A;  2BM1 A;  2OI2 A;  4B3T E;  1XMO E;  4JI4 E;  4DR1 I;  2CZ9 A;  4JI3 I;  1FKA E;  4DV2 E;  4LF5 I;  1HNX I;  4JI8 I;  1QZR A;  4WUC A;  1ZM2 A;  2HFU A;  5FLX C;  4X65 E;  1XHK A;  3V2U C;  4B3R I;  2HHH E;  4LFA I;  4HY1 A;  5LMN E;  3PYG A;  4HXZ A;  3K17 A;  1N33 E;  2E5L E;  3B8H A;  4KHP E;  3ZZ0 A;  2UXD I;  1Z0B A;  4HAC B;  1XNR I;  1PKP A;  1K47 A;  1NHH A;  3LPS A;  4WUB A;  1N0U A;  4NXM E;  4LF4 I;  1IBL I;  1IBK I;  4DV4 E;  4DUY I;  5LMU I;  5A2Q Q;  4OX9 E;  4K0K I;  4DR2 I;  4DV5 I;  4LF9 E;  3LTO A;  1Z0W A;  3ZZT A;  1WUU A;  3QT6 A;  3T1H I;  2F4V E;  3K1J A; 
#chains in the Genus database with same CATH topology
 3WU3 A;  2ZBK B;  4M1K A;  1IBM E;  1N32 I;  1A6F A;  1OYP A;  5JEA C;  3ZM7 A;  2V34 A;  5GME A;  4LF8 I;  2GQ0 A;  4DUZ I;  1B63 A;  4JI2 E;  1KKH A;  3M85 D;  2EFG A;  4X62 I;  4DPU A;  3J81 C;  5DRO A;  2A2D A;  2WNR B;  2WNR A;  1OYR A;  4LFC E;  2VF3 A;  5IWA I;  4ZVI A;  5BR8 I;  3GON A;  3PYE A;  5ELW A;  2HKE A;  4YHH I;  1P42 A;  1XMQ E;  1I94 I;  3ZKB A;  2UXC I;  2LJP A;  4AQY E;  2AE8 A;  1N34 E;  3GCM A;  3Q6M A;  2V2Z A;  1NHI A;  4DR7 E;  4DV3 E;  4DV1 I;  1HR0 E;  1N36 I;  4FWG A;  5FLX Q;  1HNW I;  3JAM C;  1XNQ I;  1ZM4 A;  3M6A A;  4B3S E;  2UUB I;  2WP8 A;  3H1C A;  2HK2 A;  4LF7 E;  3T1Y E;  4DR5 E;  1XMO I;  2Q2E B;  3V5R A;  3P3C A;  2UU9 E;  4X64 I;  3HKM A;  2ZIT A;  1ZXM A;  4U3D A;  2HFS A;  4U3B A;  2C37 B;  1E3H A;  1S4E A;  2O1W A;  4FW5 A;  1UDQ A;  3QT5 A;  4YY3 E;  2HHH I;  4DU7 A;  4MYT A;  2BA1 D;  4XTJ A;  4KQV A;  4IFD D;  1KVK A;  1N33 I;  3B82 A;  1HNZ E;  1MG7 A;  2PNM A;  4PU9 A;  4KHP I;  4Z7C A;  5C0X D;  1UEK A;  1H74 A;  4JYA E;  1U2R A;  5C0X E;  1FNM A;  2PO2 B;  2PO2 A;  2ZM6 E;  4LFB E;  2IER A;  4PRV A;  2NN6 B;  2NN6 A;  2NN6 F;  4NXN E;  5DRP A;  5DRR A;  4DPW A;  1H73 A;  2A2C A;  3J80 Q;  1D6T A;  1H7U A;  1Z0G A;  3P3G A;  4DPX A;  4EMD A;  4NXM I;  1Z0E A;  4OO1 D;  5L3J A;  4OO1 E;  1R6M A;  1UDS A;  4IZJ B;  1HK7 A;  1FJG E;  1FWL A;  2HK3 A;  4JI6 I;  4OX9 I;  3L7Z A;  3L7Z B;  3D4J A;  2PO1 A;  2Z5B A;  4UTG A;  3J81 Q;  4LF9 I;  2JEB B;  3P06 A;  2BM0 A;  1UDN A;  2BA0 D;  4BA1 B;  5LL6 R;  3M7N G;  4DV0 E;  4DV6 E;  1N0V C;  2F4V I;  1H72 C;  1IBM I;  4LF6 E;  2CGE A;  2NN6 C;  4LCG A;  2NN6 E;  3J80 C;  2UUC E;  4LPF A;  3P76 A;  5EKW A;  4FW4 A;  5DNX A;  5JEA D;  2UUA E;  4MU4 A;  2VES A;  4GKK E;  5JEA E;  3NZK A;  3JAM Q;  2F1D A;  4JI1 E;  4IZJ D;  2VQE I;  1E3P A;  1YHC A;  4LFC I;  4DR4 I;  3ZZU A;  3OTO I;  1Z0C A;  2AJ4 A;  2BV3 A;  1XMQ I;  1FI4 A;  1Y4S A;  2UXB I;  4WUD A;  1VIS A;  4AQY I;  3T1H E;  3PS3 A;  1KTV A;  1N34 I;  1UDO A;  5IT9 C;  2BR2 A;  1ZXN A;  4DR7 I;  1Y6Z A;  4USK A;  1Z59 A;  4DV3 I;  1ELO A;  4DR6 E;  2J7K A;  3LNU A;  4JI0 E;  4X66 E;  1R6L A;  1Z5A A;  3UHM A;  1ZM9 A;  4B3S I;  4URL A;  5K36 A;  3CWV A;  4MU3 A;  4LF7 I;  3T1Y I;  4DR5 I;  1EI1 A;  2NPF A;  4DR3 E;  2X7I A;  2WP8 B;  2C38 A;  4Z7Y A;  4JI7 E;  3P3E A;  2DEI A;  4B3T I;  2PO0 A;  4MU0 A;  2PO0 B;  4JV5 E;  3PYF A;  2UU9 I;  1J5E E;  4JI4 I;  4P7A A;  1Y60 A;  4LCH A;  5EL9 A;  1I94 E;  4MQY A;  2UXC E;  1XXE A;  4FW3 A;  4P52 A;  4LCF A;  4DV2 I;  3KRN A;  2C39 B;  2C39 A;  4B3M E;  1ZM3 A;  2O1V A;  4DXL A;  4YY3 I;  1YH8 A;  4DV7 E;  1N36 E;  1PVG A;  2IOP A;  2V8P A;  1BKN A;  1XNQ E;  4X65 I;  1RR9 A;  4UT4 A;  1MX0 A;  2VQF E;  2Z5C B;  2Z5C A;  1Z0V A;  4FWD A;  4BA2 A;  2XEX A;  5LMN I;  4MYU A;  4JI5 E;  4QNK A;  1S16 A;  2DEJ A;  4JYA I;  2ZM6 I;  2E5L I;  4NBQ A;  1Z5C A;  4GKJ E;  4ISA A;  4OZE A;  4LFB I;  4NXN I;  4FW6 A;  3F0N A;  1PIE A;  1NHJ A;  1DAR A;  3B4T A;  4X64 E;  3WU5 A;  4J3D A;  4DR1 E;  3Q6N A;  4JI3 E;  4LF5 E;  3HUL A;  4DU8 A;  1Y5Y A;  1HNX E;  1NZ0 A;  3K85 A;  1OYS A;  2R42 A;  4JI8 E;  3PS2 A;  1FJG I;  1FWK A;  3PRY A;  4R1F A;  3GME A;  4QNJ A;  4LOM A;  4DV4 I;  4B3R E;  2JEA B;  2JEA A;  3Q1Q A;  4DPT A;  4DV0 I;  4DV6 I;  4LFA E;  2PO1 B;  2Z5B B;  3M7N D;  2O3Z A;  4LF6 I;  2JE6 A;  4GQU A;  4HAC A;  4AID A;  1OJ4 A;  5IT9 Q;  2UXD E;  2GS8 A;  2J65 A;  2UUC I;  2NN6 D;  1XNR E;  4FW9 A;  2UUA I;  4GKK I;  4JI2 I;  4JI1 I;  4USM A;  4LF4 E;  1IBL E;  4FN5 A;  3U1K A;  1IBK E;  4JI6 E;  4ED4 A;  4IZK B;  2CG9 A;  4IZK A;  2HKJ A;  4JG4 A;  1Z5B A;  4DUY E;  1VI7 A;  5LMU E;  2BA0 G;  4K0K E;  4DR2 E;  3U1Y A;  1B62 A;  4DV5 E;  4FW7 A;  1Z0T A;  4I3H A;  1MU5 A;  4DR6 I;  2BR2 B;  4JI0 I;  4X66 I;  3J7A M;  1N32 E;  3DD6 A;  2WW4 A;  1HR0 I;  3M85 G;  4LF8 E;  2IES A;  4DUZ E;  4PRX A;  2VQE E;  4DR3 I;  4X62 E;  4FWH A;  5A2Q C;  3CDI A;  4HYM A;  5K36 B;  4JI7 I;  4DR4 E;  5K36 F;  4OKG A;  3OTO E;  4JV5 I;  4DPY A;  3H4L A;  1J5E I;  2C38 B;  4AM3 A;  3GLL A;  2JT2 A;  2UXB E;  4MU1 A;  2Z5E A;  5FWK A;  5BR8 E;  5IWA E;  2PNL A;  2R3V A;  4YHH E;  4B3M I;  1KIJ A;  3J7A G;  3WU4 A;  5GMD A;  4DV7 I;  1EA6 A;  1H7S A;  3PYD A;  2X36 A;  3QT7 A;  3WU6 A;  4IFD A;  4IFD B;  1USU A;  3HJC A;  4AIM A;  3B78 A;  2VQF I;  4DV1 E;  4IFD F;  1HNW E;  3ZKD A;  2V2Q A;  5C0X B;  5C0X A;  4JI5 I;  2V2V A;  5C0X F;  4RPF A;  2UUB E;  4BA2 B;  1RRE A;  1HNZ I;  3QT8 A;  4GKJ I;  5K36 D;  2E1R A;  2BM1 A;  2OI2 A;  4B3T E;  5K36 C;  5K36 E;  3CDJ A;  1XMO E;  4JI4 E;  5DNL A;  4DR1 I;  2PNZ A;  2PNZ B;  2CZ9 A;  1USV A;  4OO1 A;  4JI3 I;  2GO4 A;  4OO1 B;  3PS1 A;  4DV2 E;  2C37 A;  1FKA E;  4LF5 I;  4OO1 F;  1HNX I;  4JI8 I;  4N3O A;  2IOQ A;  1RHY A;  1QZR A;  4WUC A;  2GO3 A;  1ZM2 A;  2HFU A;  5FLX C;  4X65 E;  1XHK A;  3V2U C;  1Y4U A;  2BA1 G;  4B3R I;  2HHH E;  4IFD C;  4IFD E;  4LFA I;  4HY1 A;  5LMN E;  5DRQ A;  3PYG A;  5C0X C;  4HXZ A;  3K17 A;  4IS9 A;  2E5L E;  3B8H A;  1N33 E;  4KHP E;  3ZZ0 A;  2UXD I;  1Z0B A;  2JE6 B;  5JEA B;  4HAC B;  5JEA A;  5JEA F;  1XNR I;  1PKP A;  1K47 A;  1NHH A;  3LPS A;  4WUB A;  4OO1 C;  1N0U A;  4NXM E;  4IZJ A;  4LF4 I;  4MDT A;  1IBL I;  1IBK I;  4DV4 E;  4DUY I;  5LMU I;  2CVE A;  5A2Q Q;  2JEB A;  4OX9 E;  4K0K I;  4BA1 A;  4DR2 I;  4DV5 I;  2O1T A;  4LF9 E;  2O1U A;  3LTO A;  1Z0W A;  3ZZT A;  1WUU A;  3QT6 A;  3T1H I;  2F4V E;  3K1J A; 
#chains in the Genus database with same CATH homology
 3WU3 A;  2ZBK B;  4M1K A;  1IBM E;  1N32 I;  1A6F A;  3ZM7 A;  2V34 A;  5GME A;  4LF8 I;  2GQ0 A;  4DUZ I;  1B63 A;  4JI2 E;  1KKH A;  2EFG A;  4X62 I;  4DPU A;  3J81 C;  2A2D A;  4LFC E;  2VF3 A;  5IWA I;  4ZVI A;  5BR8 I;  3GON A;  3PYE A;  2HKE A;  4YHH I;  1XMQ E;  1I94 I;  3ZKB A;  2UXC I;  2LJP A;  4AQY E;  1N34 E;  3Q6M A;  2V2Z A;  1NHI A;  4DR7 E;  4DV3 E;  4DV1 I;  1HR0 E;  1N36 I;  4FWG A;  5FLX Q;  1HNW I;  3JAM C;  1XNQ I;  1ZM4 A;  3M6A A;  4B3S E;  2UUB I;  2HK2 A;  4LF7 E;  3T1Y E;  4DR5 E;  1XMO I;  2Q2E B;  3V5R A;  2UU9 E;  4X64 I;  2ZIT A;  1ZXM A;  2HFS A;  1S4E A;  2O1W A;  3QT5 A;  4YY3 E;  2HHH I;  4DU7 A;  4MYT A;  4XTJ A;  4KQV A;  1KVK A;  1N33 I;  3B82 A;  1HNZ E;  1MG7 A;  2PNM A;  4PU9 A;  4KHP I;  4Z7C A;  1UEK A;  1H74 A;  4JYA E;  1U2R A;  1FNM A;  2ZM6 E;  4LFB E;  4PRV A;  4NXN E;  4DPW A;  1H73 A;  2A2C A;  3J80 Q;  1D6T A;  1H7U A;  1Z0G A;  4DPX A;  4EMD A;  4NXM I;  1Z0E A;  5L3J A;  4IZJ B;  1HK7 A;  1FJG E;  1FWL A;  2HK3 A;  4JI6 I;  4OX9 I;  3D4J A;  2Z5B A;  4UTG A;  3J81 Q;  4LF9 I;  3P06 A;  2BM0 A;  5LL6 R;  4DV0 E;  4DV6 E;  1N0V C;  2F4V I;  1H72 C;  1IBM I;  4LF6 E;  2CGE A;  3J80 C;  2UUC E;  2UUA E;  4GKK E;  3JAM Q;  4JI1 E;  4IZJ D;  2VQE I;  4LFC I;  4DR4 I;  3ZZU A;  3OTO I;  1Z0C A;  2AJ4 A;  2BV3 A;  1XMQ I;  1FI4 A;  1Y4S A;  2UXB I;  4WUD A;  1VIS A;  4AQY I;  3T1H E;  1KTV A;  1N34 I;  5IT9 C;  1ZXN A;  4DR7 I;  1Y6Z A;  4USK A;  1Z59 A;  4DV3 I;  1ELO A;  4DR6 E;  2J7K A;  3LNU A;  4JI0 E;  4X66 E;  1Z5A A;  1ZM9 A;  4B3S I;  4URL A;  3CWV A;  4LF7 I;  3T1Y I;  4DR5 I;  1EI1 A;  2NPF A;  4DR3 E;  2X7I A;  4Z7Y A;  4JI7 E;  2DEI A;  4B3T I;  4JV5 E;  3PYF A;  2UU9 I;  1J5E E;  4JI4 I;  4P7A A;  1I94 E;  2UXC E;  4P52 A;  4DV2 I;  4B3M E;  1ZM3 A;  2O1V A;  4DXL A;  4YY3 I;  4DV7 E;  1N36 E;  1PVG A;  2IOP A;  2V8P A;  1BKN A;  1XNQ E;  4X65 I;  1RR9 A;  4UT4 A;  1MX0 A;  2VQF E;  2Z5C B;  2Z5C A;  1Z0V A;  4FWD A;  2XEX A;  5LMN I;  4MYU A;  4JI5 E;  1S16 A;  2DEJ A;  4JYA I;  2ZM6 I;  2E5L I;  4LFB I;  1Z5C A;  4GKJ E;  4NXN I;  3F0N A;  1PIE A;  1NHJ A;  1DAR A;  4X64 E;  3WU5 A;  4DR1 E;  3Q6N A;  4JI3 E;  4LF5 E;  3HUL A;  4DU8 A;  1HNX E;  1NZ0 A;  3K85 A;  2R42 A;  4JI8 E;  1FJG I;  1FWK A;  3PRY A;  4R1F A;  4DV4 I;  4B3R E;  3Q1Q A;  4DPT A;  4DV0 I;  4DV6 I;  4LFA E;  2Z5B B;  4LF6 I;  4HAC A;  1OJ4 A;  5IT9 Q;  2UXD E;  2GS8 A;  2UUC I;  1XNR E;  4FW9 A;  2UUA I;  4GKK I;  4JI2 I;  4JI1 I;  4USM A;  4LF4 E;  1IBL E;  4FN5 A;  1IBK E;  4JI6 E;  4ED4 A;  4IZK B;  2CG9 A;  4IZK A;  2HKJ A;  4JG4 A;  1Z5B A;  4DUY E;  5LMU E;  4K0K E;  4DR2 E;  1B62 A;  4DV5 E;  1Z0T A;  4I3H A;  1MU5 A;  4DR6 I;  4JI0 I;  4X66 I;  3J7A M;  1N32 E;  2WW4 A;  1HR0 I;  4LF8 E;  4DUZ E;  4PRX A;  2VQE E;  4DR3 I;  4X62 E;  4FWH A;  5A2Q C;  4HYM A;  4JI7 I;  4DR4 E;  3OTO E;  4JV5 I;  4DPY A;  3H4L A;  1J5E I;  2UXB E;  2Z5E A;  5FWK A;  5BR8 E;  5IWA E;  2PNL A;  2R3V A;  4YHH E;  4B3M I;  1KIJ A;  3J7A G;  3WU4 A;  5GMD A;  4DV7 I;  1EA6 A;  1H7S A;  3PYD A;  2X36 A;  3QT7 A;  3WU6 A;  1USU A;  3HJC A;  2VQF I;  3B78 A;  4DV1 E;  1HNW E;  3ZKD A;  2V2Q A;  4JI5 I;  2V2V A;  4RPF A;  2UUB E;  1RRE A;  1HNZ I;  3QT8 A;  4GKJ I;  2E1R A;  2BM1 A;  2OI2 A;  4B3T E;  1XMO E;  4JI4 E;  4DR1 I;  2CZ9 A;  1USV A;  4JI3 I;  1FKA E;  4DV2 E;  4LF5 I;  1HNX I;  4JI8 I;  4N3O A;  2IOQ A;  1QZR A;  4WUC A;  1ZM2 A;  2HFU A;  5FLX C;  4X65 E;  1XHK A;  3V2U C;  1Y4U A;  4B3R I;  2HHH E;  4LFA I;  4HY1 A;  5LMN E;  3PYG A;  4HXZ A;  3K17 A;  1N33 E;  2E5L E;  3B8H A;  4KHP E;  3ZZ0 A;  2UXD I;  1Z0B A;  4HAC B;  1XNR I;  1PKP A;  1K47 A;  1NHH A;  3LPS A;  4WUB A;  1N0U A;  4NXM E;  4IZJ A;  4LF4 I;  1IBL I;  1IBK I;  4DV4 E;  4DUY I;  5LMU I;  5A2Q Q;  4OX9 E;  4K0K I;  4DR2 I;  4DV5 I;  2O1T A;  4LF9 E;  2O1U A;  3LTO A;  1Z0W A;  3ZZT A;  1WUU A;  3QT6 A;  3T1H I;  2F4V E;  3K1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...