4LF8E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf8E02
5BR8E 1XMOI 2DB2A 1B63A 2B7VA 2J7KA 4OOGC 3J80C 4WUDA 2E1RA 4DV7I 4USMA 2NUEA 3C4TA 4EMDA 4ED4A 1HNWE 4JG4A 4FWHA 1YYWA 1Z0CA 3ADIA 3T1HI 3ZKBA 3ZM7A 1K47A 4LFCI 4YHHE 4M1KA 3CWVA 5A2QC 4DR1I 4DR4I 2UUBE 2UXDE 1ZXNA 1Z5AA 2RSMA 4WFTA 4ZVIA 2RS6A 4B3MI 4KHPE 2N3GA 4DV2I 2R42A 4DPWA 2OI2A 4JI5I 1FJGI 4YY3E 4LF9E 4NXNI 3LNUA 4LF6E 1IBKE 4JI7E 3T1YE 1MG7A 4B3SE 2L33A 3ZZUA 1O0WA 4X64E 1A6FA 1X49A 2ZM6I 2VQFI 4DKKA 3GONA 4RPFA 4X66I 2JVAA 3JAMC 4WUBA 4DXLA 2UU9I 3B78A 4LF5I 1DARA 2R3VA 4P7AA 4HACB 2LJPA 1S16A 2V8PA 3QT8A 2LTRA 4JI2E 1Z0WA 1X47A 5IT9C 2X7IA 2DEJA 1N36I 1NZ0A 5FLXC 1EI1A 1HNXE 1IBLE 2V2QA 4X62I 3ADGA 1KKHA 4JV5I 5LMNE 2XEXA 4K0KI 1X48A 2UUAI 2HKJA 3VYXA 1NHJA 4GKJE 4DR2E 3H4LA 1STUA 2L3JA 1ZM3A 3J81Q 4X65E 3QT7A 4NXME 1HR0I 1ZBTA 2HHHI 1I94E 4HXZA 1NHHA 3Q1QA 4JI0I 2LTSA 4JYAE 5GMEA 5L3JA 1XNRE 2F4VE 2RS7A 2NA2A 3J7Yp 2L2MA 1WHQA 2LJHA 1N33E 2VQEE 1VISA 4R1FA 1MX0A 1HNWI 1YYOA 2B7TA 2WW4A 4FWDA 3QT5A 2LUPB 3PYEA 3LTOA 4JI8E 3D4JA 4YHHI 2NUFA 1Z0GA 1Z59A 4JI1E 2UUBI 2E5LE 3ZZTA 4LF8E 4KHPI 2LBSB 2ZITA 4YY3I 1PKPA 4LF9I 2HFUA 4Z7CA 4LF6I 4GKKE 1IBKI 2DMYA 2Q2EB 4JI7I 3T1YI 4B3SI 1FI4A 4X64I 1Z5BA 1HNZE 4XTJA 1T4LB 3ZZ0A 4PRXA 4DV0E 2A2DA 4DV4E 2B3TB 1WUUA 1RR9A 1N0UA 2V2ZA 3J7AM 2RTXA 4DV7E 3K17A 1RREA 3VYYA 1U2RA 4DPUA 5LL6R 1XNQI 3HTXA 4HY1A 1ZXMA 2HFSA 5GMDA 1T4NA 2CZ9A 4JI2I 2EZ6A 4MYUA 4USKA 4Z7YA 2EFGA 1HNXI 2V2VA 4DPYA 4AQYE 3V2UC 1KVKA 4MYTA 1XHKA 5LMNI 1XMQE 4JI6E 4LFAE 3ZKDA 4UT4A 3QT6A 1QZRA 4GKJI 3JAMQ 1MU5A 4DR6E 2V34A 4X65I 4JI4E 3PYDA 2L2KB 4DV5E 4NXMI 2YT4A 1I94I 4LF7E 2UUCI 4DUZE 4WUCA 4JYAI 4DV1E 1PIEA 1XNRI 2F4VI 2NUGA 2AJ4A 3F0NA 1UEKA 2UXCE 1IBME 1N33I 2UXBI 2VQEI 4DU8A 4B3TI 5FLXQ 3OTOE 3PYFA 4DV3E 5BR8I 3WU6A 3LLHA 4DV6E 1KIJA 1OJ4A 3B8HA 4JI1I 4DR5E 1N34E 2E5LI 4DUYE 4LF8I 1ZM4A 4P52A 1KTVA 1WHNA 4I3HA 3WU5A 5IWAE 4DR7E 4FN5A 4M2ZA 1FWLA 2UXDI 1ZM2A 4GKKI 1HR0E 4JI3E 3K1JA 2ZBKB 2JY9A 4DPXA 1PVGA 4JI0E 4B3RE 1N32E 1HNZI 1H7UA 1Z0BA 3LPSA 3PYGA 1DI2A 4DR3E 4HACA 4DV0I 3C4BA 4LF4E 4DV4I 1J5EE 4LFBE 3HULA 5LMUE 1YZ9A 1UILA 4OX9E 2NPFA 3J80Q 1FKAE 2X36A 1ELOA 1XMOE 1S4EA 2HK3A 2DIXA 1D6TA 1H73A 2L2NA 1H74A 2LRSA 5A2QQ 2MDRA 1UHZA 3T1HE 4AQYI 3B82A 3J7AG 2IHR1 4LFCE 1Z0EA 4PRVA 2VF3A 1XMQI 4DR1E 4DR4E 2BM1A 4DPTA 4JI6I 4B3ME 4LFAI 1H72C 4DU7A 4DV2E 1IBLI 4WYQB 4JI5E 1FJGE 3ADLA 4DR6I 2CPNA 1NHIA 4JI4I 4NXNE 1EA6A 2BV3A 4DV5I 1FWKA 4LF7I 4DUZI 4DV1I 4DR2I 2KHXA 1XNQE 4HYMA 2A2CA 2ZM6E 2VQFE 2DEIA 3WU3A 1RQ0A 1EKZA 1Z5CA 2UXCI 4X66E 1IBMI 5CFFE 2HK2A 1GQEA 2UU9E 3OTOI 4LF5E 4DV3I 1H7SA 3J81C 1BKNA 5IT9Q 2N3HA 4DV6I 4X8WA 4URLA 1QU6A 4DR5I 1N34I 1FNMA 1N36E 2HKEA 4DUYI 4JI8I 1N0VC 2GS8A 3ADJA 4X62E 5IWAI 4DR7I 4JV5E 3V5RA 2L3CA 4K0KE 2UUAE 1ZM9A 4JI3I 4FW9A 2UUCE 4B3RI 1N32I 1T4OA 1RC7A 1J26A 4PU9A 4DR3I 4KQVA 1Z0TA 4LF4I 1YYKA 4M30A 1B62A 2UXBE 1Z0VA 3P1XA 1J5EI 4FWGA 4B3TE 5LMUI 4LFBI 3M6AA 2HHHE 4OX9I 4UTGA 2BM0A 2LUQA 3WU4A
chains in the Genus database with same CATH superfamily
5BR8E 1NEIA 3FIGA 2DB2A 1B63A 2D9HA 1XMOI 2B7VA 2E1MA 2J7KA 4OOGC 3MSWA 2EMGA 3J80C 4WUDA 2E1RA 2R1FA 1ZR9A 1PJQA 2WNRA 2EOQA 2WP8A 2EM0A 4X9JA 1A1FA 4LPFA 4USMA 2NUEA 3C4TA 4EMDA 4I8OA 4ED4A 4DV7I 1HNWE 4JG4A 4FWHA 1GTKA 4F6NA 2YTNA 4OO1B 2CT1A 1YYWA 1EH8A 4MU0A 2O3ZA 2EOMA 1Z0CA 3ADIA 3T1HI 3ZKBA 3ZM7A 1K47A 2EN4A 2NABA 2CGEA 1R6LA 4LFCI 4MLVA 4YHHE 4M1KA 2B9DA 4BA2B 3CWVA 2EN8A 4AIMA 5AC4A 5A2QC 2HGHA 1KJKA 5C0XB 4DR1I 4DR4I 2UUBE 2EOHA 2V88A 2UXDE 1ZXNA 1Z5AA 2RSMA 2N8XA 4WFTA 2RS6A 4WSGA 4ZVIA 3M85G 2JEBB 4KHPE 2Z5CA 2N3GA 4IFDA 2M4IA 4DV2I 1BBOA 5IV8B 3LMLA 1A1GA 2JT2A 3PS3A 1OYSA 4IFDC 2R42A 4DPWA 2OI2A 4JI5I 2JOXA 1FJGI 4YY3E 4OO1F 3M85D 1PDAA 1IQSA 2AE8A 4LF9E 2EL4A 2YTFA 3L7ZA 4NXNI 2GLIA 3LNUA 4LF6E 2LO3A 5KL6A 5A6BA 2V87A 1IBKE 1YPNA 4JI7E 3T1YE 1MG7A 4B3SE 3EPJA 5JEAB 2DMIA 2L33A 2K4VA 3ZZUA 1O0WA 2JOBA 2EQ3A 4X64E 2ELZA 1A6FA 2NN6D 1AAYA 1X49A 2EMYA 3GCMA 2ZM6I 3MHSC 3HKMA 4ZYHA 1EH7A 2YTJA 2VQFI 4DKKA 3GONA 4OO1E 4RPFA 3DF6A 4X66I 3C6KA 2JVAA 2IOPA 3JAMC 4WUBA 3PS1A 3F6HA 4DXLA 2DGCA 3PRYA 2UU9I 3B78A 2EM7A 1DARA 2R3VA 4MU3A 4P7AA 4LF5I 2C39B 5DROA 5LMUI 3EPKA 1G2FC 4MLQA 2ADRA 4HACB 2ENHA 5DNYA 2EPRA 4FW5A 4WSPA 2YTPA 2EJ4A 1S16A 2C38A 2LJPA 2V8PA 3H1CA 1WRJA 2CVEA 3L00A 2E72A 3QT8A 2LTRA 4JI2E 2ODRD 4B3MI 1T39A 4IS9A 1Z0WA 1X47A 5IT9C 2EPAA 2IOQA 2X7IA 2DEJA 1N36I 4OZEA 1NZ0A 2EMZA 5FLXC 1EI1A 4U3BA 1HNXE 2JEAB 1IBLE 1A1IA 2V2QA 4X62I 3ADGA 2C37B 1KKHA 3IWDA 1UBDC 4O43A 2M7QA 4JV5I 5LMNE 2XEXA 4QNJA 4IJDA 2EPNA 3HPSA 4K0KI 2LV2A 3THNA 1X48A 2EE8A 1Y4SA 2JPAA 2UUAI 5DNLA 2HKJA 3VYXA 1NHJA 2NN6A 4GKJE 4BA1B 1L4SA 1AH5A 4DR2E 1TF6A 3H4LA 1STUA 2JYAA 2L3JA 2EQ1A 1ZM3A 3J81Q 4X65E 2EPUA 2EL5A 3BGHA 3QT7A 4OO1C 2BA1G 4NXME 1HR0I 3IWCA 1ZBTA 2HHHI 2HC5A 1I94E 3KWRA 4L8NA 4HXZA 4JI4I 1NHHA 2YTQA 3B4TA 3Q1QA 1P47A 4JI0I 2LTSA 4JYAE 5GMEA 5L3JA 1XNRE 2LE2A 2F4VE 2RS7A 4IFDD 3HQ1A 2NA2A 3J7Yp 4ISAA 2MDGA 1KYQA 4TUGA 2L2MA 1WHQA 2LJHA 4LTYA 4WXDA 1N33E 1Y4UA 2VQEE 1OYPA 1VISA 5K36B 2EMXA 4R1FA 4O4KA 2PNZB 1TF3A 1MX0A 3HPZA 4WXCA 1HNWI 2LT7A 1YYOA 4FK5C 2BA0D 2PO1B 1YH8A 2B7TA 3F6GA 2WW4A 4FWDA 3QT5A 2LUPB 2YTEA 3PYEA 2BR2A 1USUA 3LTOA 4R2PA 4JI8E 5EKWA 5AE3A 2EM9A 2EN3A 3AUZA 2GHFA 4RH8A 2JR1A 4P7DA 4IZJB 2PO0B 3D4JA 4YHHI 2NUFA 1Z0GA 1SR9A 1Z59A 2MC6A 4JI1E 2PO2A 2UUBI 2JWOA 2E5LE 3ZZTA 2FTXB 4BHBA 4LF8E 4KHPI 4R8OA 2LBSB 1X5WA 2V85A 1Z1BA 2ZITA 5K36F 2GPIA 5F3WA 2MKDA 1UDOA 2LCEA 4YY3I 3ZOQB 2IERA 2EOYA 2EN1A 1G2DC 1PKPA 4LF9I 2HFUA 4Z7CA 3P3CA 2MKNA 4LF6I 2V86A 4IZKA 4GKKE 1IBKI 4O5GA 2DMYA 2EMLA 2Q2EB 3T1YI 2Z5BA 4B3SI 2WCC3 2ENAA 4JI7I 1DQ3A 2EMFA 2A25A 1FI4A 4X64I 1J5EI 1Z5BA 2EP3A 1HNZE 1T4LB 4XTJA 1IMUA 3ZZ0A 5K36E 2V83A 2V89A 4PRXA 4LOMA 3EPLA 4F54A 4DV0E 2A2DA 4DV4E 2B3TB 2JEAA 1WUUA 1MEYC 2EORA 2JE6B 4FW7A 1RR9A 4ZYEA 1N0UA 2V2ZA 2YRMA 3J7AM 2RTXA 2EM2A 4DV7E 3K17A 2YU8A 1RREA 3BBGA 1EH6A 3VYYA 3PS2A 1U2RA 3P76A 4DPUA 5LL6R 5T6JA 5C0XF 1ZBQA 1XNQI 2RQLA 2EPCA 3HTXA 4HY1A 1ZXMA 2HFSA 5GMDA 2O1WA 5DRRA 2GO4A 4OO1D 1T4NA 4BBYA 2CZ9A 4JI2I 2EZ6A 4MYUA 3IWBA 4ZYDA 2ENCA 4USKA 4R2SA 3U1YA 1ZU1A 1YFHA 1F2IG 2M1SA 3CDJA 4Z7YA 2EPKX 3GLLA 4P78A 1PJTA 4HTGA 5C0XE 5A6KA 2EL6A 2EFGA 1HNXI 2V2VA 4DPYA 2YZTA 4AQYE 3V2UC 1LLMC 1KVKA 4MYTA 2WNRB 2WP8B 4L5NC 1XHKA 5JEAF 4BC9A 2EN2A 3KZYA 1Y6ZA 3GMEA 1A1JA 5LMNI 1XMQE 5AE1A 4NBQA 3U1KA 1MGTA 4JI6E 2HJJA 2EOSA 1YUIA 2DLKA 4LFAE 4R2EA 3ZKDA 1Y60A 4UT4A 2LJUA 3QT6A 1QZRA 1R6MA 2F8BA 4GKJI 4R2QA 4FW4A 3JAMQ 1MU5A 5K36C 4RHBB 4DR6E 2V34A 3TQMA 5JEAE 2YTOA 4X65I 3P3GA 2EM5A 4JI4E 3PYDA 2Z5CB 2L2KB 4F9BB 4DV5E 4F2JC 4NXMI 4IFDB 4HEIA 2YT4A 3RMPA 1I94I 4LF7E 2PNLA 4MU4A 2UUCI 4DUZE 2GQ0A 4R2RA 4WUCA 4LFBI 3NZKA 4JYAI 4DV1E 1PIEA 2EOFA 2EPPA 3EPHA 2R76A 1XNRI 2F4VI 2DSYA 4WPYA 3M99B 2NUGA 1IQOA 2V8QB 2AJ4A 4OO1A 2O1UA 3F0NA 3AV0A 1UEKA 3L7ZB 4Q28A 2UXCE 1IBME 1N33I 2UXBI 2G7HA 2VQEI 4DU8A 4B3TI 5FLXQ 2EQ0A 4BS9A 3OMLA 4BA2A 5A6AA 3OTOE 3PYFA 4DV3E 5C0XA 5TSEA 2YSPA 1USVA 5BR8I 5C0XC 4NZVA 2JEBA 3WU6A 2BA1D 3LLHA 1VI7A 5FWKA 1DGCA 2YRKA 2JXPA 2VF1A 4DV6E 4N3OA 2RPCA 1KIJA 3M7NG 1OJ4A 3B8HA 3K6QA 2H36X 4BC7A 4F9AB 4JI1I 4R03A 4BMJA 4DR5E 1N34E 2E5LI 2L8TA 4DUYE 3THOB 2YTGA 1ZM4A 4LF8I 5A6JA 1X3CA 2LVHA 4P52A 4M0VA 2C38B 4LCGA 5JEAA 1KTVA 1WHNA 4I3HA 3DJWA 3WU5A 4FW6A 3KZZA 5IWAE 4DR7E 4FN5A 5DRPA 4R2AA 5JEAC 2O1TA 4M2ZA 2M9AA 2EM6A 1FWLA 2UXDI 3UHMA 1UN6B 1ZM2A 1TN9A 2DLQA 4GKKI 4U3DA 1HR0E 4JI3E 3K1JA 2VESA 2ZBKB 2JY9A 2EM3A 5KL4A 4DPXA 1PVGA 4JI0E 3UK3C 2FV4B 4B3RE 1N32E 4MU1A 1E3PA 1H7UA 1HNZI 2VRDA 1Z0BA 5AASA 2C39A 4F6MA 5DRQA 2EPZA 3LPSA 3PYGA 2EMAA 4DR3E 1DI2A 3VK6A 4HACA 4DV0I 3C4BA 4LF4E 4DV4I 4WX9A 1J5EE 4LFBE 3HXLA 5LMUE 2F1DA 3HULA 1YUJA 1YZ9A 2NN6B 1UILA 4OX9E 2EOIA 2NPFA 5AE2A 3J80Q 5AC5A 3K85A 2Q8UA 5K36D 1FKAE 3EQ1A 5ADZA 2X36A 1ELOA 3VHTB 1XMOE 1A1KA 2EMCA 1S4EA 1RMDA 2EOJA 2HK3A 2DIXA 3MHHC 2RSIA 1JK1A 1OYRA 5ELWA 2EOOA 2C37A 1D6TA 4R2CA 1ZAAC 2DRPA 4IZJD 1H73A 2J7JA 1UDNA 2J65A 2L2NA 5IXMB 1H74A 2LRSA 5A2QQ 2MDRA 1UHZA 1N3GA 3T1HE 1SFEA 4AQYI 2NN6F 2I9IA 3B82A 3J7AG 2IHR1 4LFCE 1Z0EA 4PRVA 4QNKA 4BA1A 4MDTA 2VF3A 2L92A 1XMQI 1WJPA 4DR1E 3Q6NA 1NCSA 2VE7C 4DR4E 2BM1A 2BB8A 2EWLA 2Z5EA 4DPTA 4JI6I 4B3ME 2BR2B 2I13A 2EOEA 4AM3A 1T38A 4LFAI 1H72C 1XXEA 4MQYA 2EN6A 5A69A 5C0XD 2EMKA 4DV2E 4DU7A 4GEQB 2EOZA 1Y5YA 1IBLI 4WYQB 1BBGA 2WZOA 2CTDA 5KL3A 2YRHA 4JI5E 1FJGE 3ADLA 2CPNA 2NN6E 4LCFA 4DR6I 2PO2B 1P42A 4KZSA 1NHIA 5EL9A 3ECRA 1QNTA 1X6EA 1A1HA 2EOXA 4NXNE 1BB8A 1EA6A 2BV3A 1JK2A 2FGGA 1E3HA 3P06A 1WXRA 1FWKA 2KOUA 4DV5I 3HJCA 4LF7I 5K36A 4NHRA 4DUZI 3JTZA 3BF2A 4Q35B 4F9CB 5KL7A 2PNZA 4DV1I 4DR2I 2KHXA 1XNQE 4HYMA 2PO1A 2A2CA 2ZM6E 4R2DA 4GQUA 5JEAD 4TUIA 2EPXA 2VQFE 2CG9A 2DEIA 1GZ6A 1RQ0A 1EKZA 1Z5CA 3WU3A 2UXCI 2EPMX 4IZKB 4X66E 1IBMI 5CFFE 2HK2A 3JU0A 2PO0A 2Z5BB 4IZJA 1HK7A 4BCAA 1GQEA 2UU9E 3OTOI 4LF5E 2EN7A 4DV3I 2YTDA 1H7SA 3J81C 2YPNA 4J8ZA 2EMWA 2K7IA 1BKNA 3CDIA 5IT9Q 4KWYA 2O1VA 1UDQA 1YHCA 2N3HA 2YSOA 4FW3A 1A1LA 4BHCA 4DV6I 4GZNC 4X8WA 1X6HA 2CSHA 4URLA 4M9VC 2PNMA 2YTIA 1QU6A 4DR5I 1N34I 1FNMA 2WBTA 1N36E 2HKEA 4DUYI 1X6FA 4JI8I 4IS1C 1N0VC 2PRTA 4IFDF 3KRNA 2GS8A 5DNXA 3ADJA 2EMBA 4X62E 2NN6C 5IWAI 4DR7I 4JV5E 3BIDA 4LU9A 3V5RA 2MC5A 4DMIA 3H09A 2L3CA 4K0KE 3P3EA 4LCHA 2EPLX 2EM8A 5LLQA 4N4RB 2JE6A 5KL2A 2UUAE 1ZM9A 4JI3I 2EMIA 2L6MA 2UUCE 4FW9A 4J3DA 2BBGA 3M7ND 4AIDA 2YU5A 2EM4A 2JP9A 4B3RI 4IFDE 1T4OA 1N32I 1RC7A 4FWGA 2EPOA 1J26A 4PU9A 2YWQA 2BA0G 4DR3I 5KL5A 1UDSA 4KQVA 3Q6MA 1Z0TA 3QG5C 1RHYA 4LF4I 1YYKA 2GO3A 4M30A 3C6MA 2UXBE 1B62A 3P1XA 1Z0VA 2EMHA 2KONA 1YSAC 4B3TE 2ELYA 2LMZA 1PJSA 2ODRC 2WBSA 2IESA 2HHHE 3M6AA 4OX9I 4OKGA 4UTGA 2WBUA 5A6BD 4O24A 2BM0A 1B69A 2LUQA 3WU4A 4ZYGA 3DD6A
chains in the Genus database with same CATH topology
5BR8E 3FIGA 1XMOI 2DB2A 1B63A 2B7VA 2E1MA 2J7KA 4OOGC 3MSWA 3J80C 4WUDA 2E1RA 4DV7I 4USMA 2NUEA 3C4TA 4EMDA 4I8OA 4ED4A 1HNWE 4JG4A 4FWHA 1YYWA 1Z0CA 3ADIA 3T1HI 3ZKBA 3ZM7A 1K47A 4LFCI 2CGEA 4YHHE 4M1KA 2B9DA 3CWVA 5A2QC 4DR1I 4DR4I 2UUBE 2V88A 2UXDE 1ZXNA 1Z5AA 2RSMA 4WFTA 4ZVIA 2RS6A 4B3MI 4KHPE 2Z5CA 2N3GA 2M4IA 4DV2I 3LMLA 2R42A 4DPWA 2OI2A 4JI5I 2JOXA 1FJGI 4YY3E 4LF9E 4NXNI 3LNUA 4LF6E 2V87A 1IBKE 4JI7E 3T1YE 1MG7A 4B3SE 2L33A 2K4VA 3ZZUA 1O0WA 2JOBA 4X64E 1A6FA 1X49A 2ZM6I 2VQFI 4DKKA 3GONA 4RPFA 3DF6A 4X66I 2JVAA 2IOPA 3JAMC 4WUBA 4DXLA 3F6HA 3PRYA 2UU9I 3B78A 4LF5I 1DARA 2R3VA 4P7AA 4HACB 5DNYA 4WSPA 2LJPA 1S16A 2V8PA 3QT8A 2LTRA 4JI2E 2ODRD 1Z0WA 1X47A 5IT9C 2IOQA 2X7IA 2DEJA 1N36I 1NZ0A 5FLXC 1EI1A 1HNXE 1IBLE 2V2QA 4X62I 3ADGA 1KKHA 3IWDA 2M7QA 4JV5I 5LMNE 2XEXA 4K0KI 3HPSA 1X48A 1Y4SA 2UUAI 2HKJA 3VYXA 1NHJA 4GKJE 4DR2E 3H4LA 1STUA 2L3JA 1ZM3A 3J81Q 4X65E 3QT7A 4NXME 1HR0I 3IWCA 1ZBTA 2HHHI 1I94E 4HXZA 3KWRA 4L8NA 1NHHA 3Q1QA 4JI0I 2LTSA 4JYAE 5GMEA 5L3JA 1XNRE 2LE2A 2F4VE 2RS7A 3HQ1A 2NA2A 3J7Yp 4TUGA 2L2MA 1WHQA 2LJHA 4LTYA 1N33E 1Y4UA 2VQEE 1VISA 4R1FA 1MX0A 3HPZA 1HNWI 1YYOA 2B7TA 3F6GA 2WW4A 4FWDA 3QT5A 2LUPB 3PYEA 3LTOA 1USUA 4JI8E 5AE3A 3AUZA 2JR1A 4P7DA 4IZJB 3D4JA 4YHHI 2NUFA 1Z0GA 1SR9A 1Z59A 2MC6A 4JI1E 2UUBI 2JWOA 2E5LE 3ZZTA 2FTXB 4LF8E 4KHPI 4R8OA 2LBSB 2V85A 2ZITA 5F3WA 4YY3I 3ZOQB 1PKPA 4LF9I 2HFUA 4Z7CA 4LF6I 2V86A 4IZKA 4GKKE 1IBKI 2DMYA 2Q2EB 4JI7I 3T1YI 2Z5BA 4B3SI 1DQ3A 1FI4A 4X64I 1Z5BA 1HNZE 4XTJA 1T4LB 3ZZ0A 2V83A 2V89A 4PRXA 4F54A 4DV0E 2A2DA 4DV4E 2B3TB 1WUUA 1RR9A 1N0UA 2V2ZA 3J7AM 2RTXA 4DV7E 3K17A 1RREA 3VYYA 1U2RA 4DPUA 5LL6R 5T6JA 1XNQI 1ZBQA 3HTXA 4HY1A 1ZXMA 2HFSA 5GMDA 2O1WA 1T4NA 4BBYA 2CZ9A 4JI2I 2EZ6A 4MYUA 3IWBA 4USKA 2M1SA 4Z7YA 4P78A 2EFGA 1HNXI 2V2VA 4DPYA 2YZTA 4AQYE 3V2UC 1KVKA 4MYTA 4L5NC 1XHKA 4BC9A 1Y6ZA 5LMNI 1XMQE 5AE1A 4JI6E 4LFAE 3ZKDA 4UT4A 3QT6A 1QZRA 2F8BA 4GKJI 3JAMQ 1MU5A 4DR6E 2V34A 4X65I 4JI4E 3PYDA 2Z5CB 2L2KB 4F9BB 4DV5E 4NXMI 2YT4A 3RMPA 1I94I 4LF7E 2PNLA 2UUCI 4DUZE 2GQ0A 4WUCA 4JYAI 4DV1E 1PIEA 1XNRI 2F4VI 2DSYA 4WPYA 2NUGA 2AJ4A 2V8QB 2O1UA 3F0NA 3AV0A 1UEKA 4Q28A 2UXCE 1IBME 1N33I 2UXBI 2G7HA 2VQEI 4DU8A 4B3TI 5FLXQ 4BS9A 3OMLA 3OTOE 3PYFA 4DV3E 1USVA 5BR8I 3WU6A 3LLHA 5FWKA 4N3OA 2VF1A 4DV6E 1KIJA 1OJ4A 3B8HA 3K6QA 2H36X 4BC7A 4F9AB 4JI1I 4R03A 4BMJA 4DR5E 1N34E 2E5LI 2L8TA 4DUYE 4LF8I 1ZM4A 4P52A 4M0VA 1KTVA 1WHNA 4I3HA 3DJWA 3WU5A 5IWAE 4DR7E 4FN5A 2O1TA 4M2ZA 1FWLA 2UXDI 1ZM2A 4GKKI 1HR0E 4JI3E 3K1JA 2ZBKB 2JY9A 4DPXA 1PVGA 4JI0E 2FV4B 4B3RE 1N32E 1HNZI 1H7UA 1Z0BA 5AASA 3LPSA 3PYGA 1DI2A 4DR3E 3VK6A 4HACA 4DV0I 3C4BA 4LF4E 4DV4I 4LFBE 1J5EE 3HXLA 5LMUE 3HULA 1YZ9A 1UILA 4OX9E 2NPFA 5AE2A 3J80Q 3K85A 1FKAE 5ADZA 2X36A 1ELOA 1XMOE 1S4EA 2HK3A 2DIXA 1D6TA 4IZJD 1H73A 2L2NA 1H74A 2LRSA 5A2QQ 2MDRA 1UHZA 3T1HE 4AQYI 3B82A 3J7AG 2IHR1 4LFCE 1Z0EA 4PRVA 2VF3A 2L92A 1XMQI 4DR1E 3Q6NA 2VE7C 4DR4E 2BM1A 2EWLA 2Z5EA 4DPTA 4JI6I 4B3ME 4LFAI 1H72C 4DU7A 4DV2E 4GEQB 1IBLI 4WYQB 2WZOA 4JI5E 1FJGE 3ADLA 4DR6I 2CPNA 4KZSA 1NHIA 4JI4I 4NXNE 1EA6A 2BV3A 3P06A 2FGGA 4DV5I 1WXRA 1FWKA 2KOUA 3HJCA 4LF7I 4DUZI 3JTZA 4F9CB 4DV1I 4DR2I 2KHXA 1XNQE 4HYMA 2A2CA 2ZM6E 4TUIA 2VQFE 2CG9A 2DEIA 3WU3A 1GZ6A 1RQ0A 1EKZA 1Z5CA 2UXCI 4IZKB 4X66E 1IBMI 5CFFE 2HK2A 3JU0A 2Z5BB 4IZJA 1HK7A 4BCAA 1GQEA 2UU9E 3OTOI 4LF5E 4DV3I 1H7SA 3J81C 4J8ZA 1BKNA 5IT9Q 2O1VA 2N3HA 4DV6I 4X8WA 4URLA 2PNMA 1QU6A 4DR5I 1N34I 1FNMA 1N36E 2HKEA 4DUYI 4JI8I 1N0VC 2GS8A 3ADJA 4X62E 5IWAI 4DR7I 4JV5E 3V5RA 4LU9A 2MC5A 4DMIA 3H09A 2L3CA 4K0KE 2UUAE 1ZM9A 4JI3I 4FW9A 2L6MA 2UUCE 4B3RI 1N32I 1T4OA 1RC7A 1J26A 4PU9A 4DR3I 4KQVA 3Q6MA 1Z0TA 4LF4I 1YYKA 4M30A 1B62A 2UXBE 1Z0VA 3P1XA 1J5EI 4B3TE 2KONA 4FWGA 5LMUI 4LFBI 2LMZA 2ODRC 3M6AA 2HHHE 4OX9I 4UTGA 2BM0A 2LUQA 3WU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 E;  1XMO I;  2DB2 A;  1B63 A;  2B7V A;  2J7K A;  4OOG C;  3J80 C;  4WUD A;  2E1R A;  4DV7 I;  4USM A;  2NUE A;  3C4T A;  4EMD A;  4ED4 A;  1HNW E;  4JG4 A;  4FWH A;  1YYW A;  1Z0C A;  3ADI A;  3T1H I;  3ZKB A;  3ZM7 A;  1K47 A;  4LFC I;  4YHH E;  4M1K A;  3CWV A;  5A2Q C;  4DR1 I;  4DR4 I;  2UUB E;  2UXD E;  1ZXN A;  1Z5A A;  2RSM A;  4WFT A;  4ZVI A;  2RS6 A;  4B3M I;  4KHP E;  2N3G A;  4DV2 I;  2R42 A;  4DPW A;  2OI2 A;  4JI5 I;  1FJG I;  4YY3 E;  4LF9 E;  4NXN I;  3LNU A;  4LF6 E;  1IBK E;  4JI7 E;  3T1Y E;  1MG7 A;  4B3S E;  2L33 A;  3ZZU A;  1O0W A;  4X64 E;  1A6F A;  1X49 A;  2ZM6 I;  2VQF I;  4DKK A;  3GON A;  4RPF A;  4X66 I;  2JVA A;  3JAM C;  4WUB A;  4DXL A;  2UU9 I;  3B78 A;  4LF5 I;  1DAR A;  2R3V A;  4P7A A;  4HAC B;  2LJP A;  1S16 A;  2V8P A;  3QT8 A;  2LTR A;  4JI2 E;  1Z0W A;  1X47 A;  5IT9 C;  2X7I A;  2DEJ A;  1N36 I;  1NZ0 A;  5FLX C;  1EI1 A;  1HNX E;  1IBL E;  2V2Q A;  4X62 I;  3ADG A;  1KKH A;  4JV5 I;  5LMN E;  2XEX A;  4K0K I;  1X48 A;  2UUA I;  2HKJ A;  3VYX A;  1NHJ A;  4GKJ E;  4DR2 E;  3H4L A;  1STU A;  2L3J A;  1ZM3 A;  3J81 Q;  4X65 E;  3QT7 A;  4NXM E;  1HR0 I;  1ZBT A;  2HHH I;  1I94 E;  4HXZ A;  1NHH A;  3Q1Q A;  4JI0 I;  2LTS A;  4JYA E;  5GME A;  5L3J A;  1XNR E;  2F4V E;  2RS7 A;  2NA2 A;  3J7Y p;  2L2M A;  1WHQ A;  2LJH A;  1N33 E;  2VQE E;  1VIS A;  4R1F A;  1MX0 A;  1HNW I;  1YYO A;  2B7T A;  2WW4 A;  4FWD A;  3QT5 A;  2LUP B;  3PYE A;  3LTO A;  4JI8 E;  3D4J A;  4YHH I;  2NUF A;  1Z0G A;  1Z59 A;  4JI1 E;  2UUB I;  2E5L E;  3ZZT A;  4LF8 E;  4KHP I;  2LBS B;  2ZIT A;  4YY3 I;  1PKP A;  4LF9 I;  2HFU A;  4Z7C A;  4LF6 I;  4GKK E;  1IBK I;  2DMY A;  2Q2E B;  4JI7 I;  3T1Y I;  4B3S I;  1FI4 A;  4X64 I;  1Z5B A;  1HNZ E;  4XTJ A;  1T4L B;  3ZZ0 A;  4PRX A;  4DV0 E;  2A2D A;  4DV4 E;  2B3T B;  1WUU A;  1RR9 A;  1N0U A;  2V2Z A;  3J7A M;  2RTX A;  4DV7 E;  3K17 A;  1RRE A;  3VYY A;  1U2R A;  4DPU A;  5LL6 R;  1XNQ I;  3HTX A;  4HY1 A;  1ZXM A;  2HFS A;  5GMD A;  1T4N A;  2CZ9 A;  4JI2 I;  2EZ6 A;  4MYU A;  4USK A;  4Z7Y A;  2EFG A;  1HNX I;  2V2V A;  4DPY A;  4AQY E;  3V2U C;  1KVK A;  4MYT A;  1XHK A;  5LMN I;  1XMQ E;  4JI6 E;  4LFA E;  3ZKD A;  4UT4 A;  3QT6 A;  1QZR A;  4GKJ I;  3JAM Q;  1MU5 A;  4DR6 E;  2V34 A;  4X65 I;  4JI4 E;  3PYD A;  2L2K B;  4DV5 E;  4NXM I;  2YT4 A;  1I94 I;  4LF7 E;  2UUC I;  4DUZ E;  4WUC A;  4JYA I;  4DV1 E;  1PIE A;  1XNR I;  2F4V I;  2NUG A;  2AJ4 A;  3F0N A;  1UEK A;  2UXC E;  1IBM E;  1N33 I;  2UXB I;  2VQE I;  4DU8 A;  4B3T I;  5FLX Q;  3OTO E;  3PYF A;  4DV3 E;  5BR8 I;  3WU6 A;  3LLH A;  4DV6 E;  1KIJ A;  1OJ4 A;  3B8H A;  4JI1 I;  4DR5 E;  1N34 E;  2E5L I;  4DUY E;  4LF8 I;  1ZM4 A;  4P52 A;  1KTV A;  1WHN A;  4I3H A;  3WU5 A;  5IWA E;  4DR7 E;  4FN5 A;  4M2Z A;  1FWL A;  2UXD I;  1ZM2 A;  4GKK I;  1HR0 E;  4JI3 E;  3K1J A;  2ZBK B;  2JY9 A;  4DPX A;  1PVG A;  4JI0 E;  4B3R E;  1N32 E;  1HNZ I;  1H7U A;  1Z0B A;  3LPS A;  3PYG A;  1DI2 A;  4DR3 E;  4HAC A;  4DV0 I;  3C4B A;  4LF4 E;  4DV4 I;  1J5E E;  4LFB E;  3HUL A;  5LMU E;  1YZ9 A;  1UIL A;  4OX9 E;  2NPF A;  3J80 Q;  1FKA E;  2X36 A;  1ELO A;  1XMO E;  1S4E A;  2HK3 A;  2DIX A;  1D6T A;  1H73 A;  2L2N A;  1H74 A;  2LRS A;  5A2Q Q;  2MDR A;  1UHZ A;  3T1H E;  4AQY I;  3B82 A;  3J7A G;  2IHR 1;  4LFC E;  1Z0E A;  4PRV A;  2VF3 A;  1XMQ I;  4DR1 E;  4DR4 E;  2BM1 A;  4DPT A;  4JI6 I;  4B3M E;  4LFA I;  1H72 C;  4DU7 A;  4DV2 E;  1IBL I;  4WYQ B;  4JI5 E;  1FJG E;  3ADL A;  4DR6 I;  2CPN A;  1NHI A;  4JI4 I;  4NXN E;  1EA6 A;  2BV3 A;  4DV5 I;  1FWK A;  4LF7 I;  4DUZ I;  4DV1 I;  4DR2 I;  2KHX A;  1XNQ E;  4HYM A;  2A2C A;  2ZM6 E;  2VQF E;  2DEI A;  3WU3 A;  1RQ0 A;  1EKZ A;  1Z5C A;  2UXC I;  4X66 E;  1IBM I;  5CFF E;  2HK2 A;  1GQE A;  2UU9 E;  3OTO I;  4LF5 E;  4DV3 I;  1H7S A;  3J81 C;  1BKN A;  5IT9 Q;  2N3H A;  4DV6 I;  4X8W A;  4URL A;  1QU6 A;  4DR5 I;  1N34 I;  1FNM A;  1N36 E;  2HKE A;  4DUY I;  4JI8 I;  1N0V C;  2GS8 A;  3ADJ A;  4X62 E;  5IWA I;  4DR7 I;  4JV5 E;  3V5R A;  2L3C A;  4K0K E;  2UUA E;  1ZM9 A;  4JI3 I;  4FW9 A;  2UUC E;  4B3R I;  1N32 I;  1T4O A;  1RC7 A;  1J26 A;  4PU9 A;  4DR3 I;  4KQV A;  1Z0T A;  4LF4 I;  1YYK A;  4M30 A;  1B62 A;  2UXB E;  1Z0V A;  3P1X A;  1J5E I;  4FWG A;  4B3T E;  5LMU I;  4LFB I;  3M6A A;  2HHH E;  4OX9 I;  4UTG A;  2BM0 A;  2LUQ A;  3WU4 A; 
#chains in the Genus database with same CATH topology
 5BR8 E;  1NEI A;  3FIG A;  2DB2 A;  1B63 A;  2D9H A;  1XMO I;  2B7V A;  2E1M A;  2J7K A;  4OOG C;  3MSW A;  2EMG A;  3J80 C;  4WUD A;  2E1R A;  2R1F A;  1ZR9 A;  1PJQ A;  2WNR A;  2EOQ A;  2WP8 A;  2EM0 A;  4X9J A;  1A1F A;  4LPF A;  4USM A;  2NUE A;  3C4T A;  4EMD A;  4I8O A;  4ED4 A;  4DV7 I;  1HNW E;  4JG4 A;  4FWH A;  1GTK A;  4F6N A;  2YTN A;  4OO1 B;  2CT1 A;  1YYW A;  1EH8 A;  4MU0 A;  2O3Z A;  2EOM A;  1Z0C A;  3ADI A;  3T1H I;  3ZKB A;  3ZM7 A;  1K47 A;  2EN4 A;  2NAB A;  2CGE A;  1R6L A;  4LFC I;  4MLV A;  4YHH E;  4M1K A;  2B9D A;  4BA2 B;  3CWV A;  2EN8 A;  4AIM A;  5AC4 A;  5A2Q C;  2HGH A;  1KJK A;  5C0X B;  4DR1 I;  4DR4 I;  2UUB E;  2EOH A;  2V88 A;  2UXD E;  1ZXN A;  1Z5A A;  2RSM A;  2N8X A;  4WFT A;  2RS6 A;  4WSG A;  4ZVI A;  3M85 G;  2JEB B;  4KHP E;  2Z5C A;  2N3G A;  4IFD A;  2M4I A;  4DV2 I;  1BBO A;  5IV8 B;  3LML A;  1A1G A;  2JT2 A;  3PS3 A;  1OYS A;  4IFD C;  2R42 A;  4DPW A;  2OI2 A;  4JI5 I;  2JOX A;  1FJG I;  4YY3 E;  4OO1 F;  3M85 D;  1PDA A;  1IQS A;  2AE8 A;  4LF9 E;  2EL4 A;  2YTF A;  3L7Z A;  4NXN I;  2GLI A;  3LNU A;  4LF6 E;  2LO3 A;  5KL6 A;  5A6B A;  2V87 A;  1IBK E;  1YPN A;  4JI7 E;  3T1Y E;  1MG7 A;  4B3S E;  3EPJ A;  5JEA B;  2DMI A;  2L33 A;  2K4V A;  3ZZU A;  1O0W A;  2JOB A;  2EQ3 A;  4X64 E;  2ELZ A;  1A6F A;  2NN6 D;  1AAY A;  1X49 A;  2EMY A;  3GCM A;  2ZM6 I;  3MHS C;  3HKM A;  4ZYH A;  1EH7 A;  2YTJ A;  2VQF I;  4DKK A;  3GON A;  4OO1 E;  4RPF A;  3DF6 A;  4X66 I;  3C6K A;  2JVA A;  2IOP A;  3JAM C;  4WUB A;  3PS1 A;  3F6H A;  4DXL A;  2DGC A;  3PRY A;  2UU9 I;  3B78 A;  2EM7 A;  1DAR A;  2R3V A;  4MU3 A;  4P7A A;  4LF5 I;  2C39 B;  5DRO A;  5LMU I;  3EPK A;  1G2F C;  4MLQ A;  2ADR A;  4HAC B;  2ENH A;  5DNY A;  2EPR A;  4FW5 A;  4WSP A;  2YTP A;  2EJ4 A;  1S16 A;  2C38 A;  2LJP A;  2V8P A;  3H1C A;  1WRJ A;  2CVE A;  3L00 A;  2E72 A;  3QT8 A;  2LTR A;  4JI2 E;  2ODR D;  4B3M I;  1T39 A;  4IS9 A;  1Z0W A;  1X47 A;  5IT9 C;  2EPA A;  2IOQ A;  2X7I A;  2DEJ A;  1N36 I;  4OZE A;  1NZ0 A;  2EMZ A;  5FLX C;  1EI1 A;  4U3B A;  1HNX E;  2JEA B;  1IBL E;  1A1I A;  2V2Q A;  4X62 I;  3ADG A;  2C37 B;  1KKH A;  3IWD A;  1UBD C;  4O43 A;  2M7Q A;  4JV5 I;  5LMN E;  2XEX A;  4QNJ A;  4IJD A;  2EPN A;  3HPS A;  4K0K I;  2LV2 A;  3THN A;  1X48 A;  2EE8 A;  1Y4S A;  2JPA A;  2UUA I;  5DNL A;  2HKJ A;  3VYX A;  1NHJ A;  2NN6 A;  4GKJ E;  4BA1 B;  1L4S A;  1AH5 A;  4DR2 E;  1TF6 A;  3H4L A;  1STU A;  2JYA A;  2L3J A;  2EQ1 A;  1ZM3 A;  3J81 Q;  4X65 E;  2EPU A;  2EL5 A;  3BGH A;  3QT7 A;  4OO1 C;  2BA1 G;  4NXM E;  1HR0 I;  3IWC A;  1ZBT A;  2HHH I;  2HC5 A;  1I94 E;  3KWR A;  4L8N A;  4HXZ A;  4JI4 I;  1NHH A;  2YTQ A;  3B4T A;  3Q1Q A;  1P47 A;  4JI0 I;  2LTS A;  4JYA E;  5GME A;  5L3J A;  1XNR E;  2LE2 A;  2F4V E;  2RS7 A;  4IFD D;  3HQ1 A;  2NA2 A;  3J7Y p;  4ISA A;  2MDG A;  1KYQ A;  4TUG A;  2L2M A;  1WHQ A;  2LJH A;  4LTY A;  4WXD A;  1N33 E;  1Y4U A;  2VQE E;  1OYP A;  1VIS A;  5K36 B;  2EMX A;  4R1F A;  4O4K A;  2PNZ B;  1TF3 A;  1MX0 A;  3HPZ A;  4WXC A;  1HNW I;  2LT7 A;  1YYO A;  4FK5 C;  2BA0 D;  2PO1 B;  1YH8 A;  2B7T A;  3F6G A;  2WW4 A;  4FWD A;  3QT5 A;  2LUP B;  2YTE A;  3PYE A;  2BR2 A;  1USU A;  3LTO A;  4R2P A;  4JI8 E;  5EKW A;  5AE3 A;  2EM9 A;  2EN3 A;  3AUZ A;  2GHF A;  4RH8 A;  2JR1 A;  4P7D A;  4IZJ B;  2PO0 B;  3D4J A;  4YHH I;  2NUF A;  1Z0G A;  1SR9 A;  1Z59 A;  2MC6 A;  4JI1 E;  2PO2 A;  2UUB I;  2JWO A;  2E5L E;  3ZZT A;  2FTX B;  4BHB A;  4LF8 E;  4KHP I;  4R8O A;  2LBS B;  1X5W A;  2V85 A;  1Z1B A;  2ZIT A;  5K36 F;  2GPI A;  5F3W A;  2MKD A;  1UDO A;  2LCE A;  4YY3 I;  3ZOQ B;  2IER A;  2EOY A;  2EN1 A;  1G2D C;  1PKP A;  4LF9 I;  2HFU A;  4Z7C A;  3P3C A;  2MKN A;  4LF6 I;  2V86 A;  4IZK A;  4GKK E;  1IBK I;  4O5G A;  2DMY A;  2EML A;  2Q2E B;  3T1Y I;  2Z5B A;  4B3S I;  2WCC 3;  2ENA A;  4JI7 I;  1DQ3 A;  2EMF A;  2A25 A;  1FI4 A;  4X64 I;  1J5E I;  1Z5B A;  2EP3 A;  1HNZ E;  1T4L B;  4XTJ A;  1IMU A;  3ZZ0 A;  5K36 E;  2V83 A;  2V89 A;  4PRX A;  4LOM A;  3EPL A;  4F54 A;  4DV0 E;  2A2D A;  4DV4 E;  2B3T B;  2JEA A;  1WUU A;  1MEY C;  2EOR A;  2JE6 B;  4FW7 A;  1RR9 A;  4ZYE A;  1N0U A;  2V2Z A;  2YRM A;  3J7A M;  2RTX A;  2EM2 A;  4DV7 E;  3K17 A;  2YU8 A;  1RRE A;  3BBG A;  1EH6 A;  3VYY A;  3PS2 A;  1U2R A;  3P76 A;  4DPU A;  5LL6 R;  5T6J A;  5C0X F;  1ZBQ A;  1XNQ I;  2RQL A;  2EPC A;  3HTX A;  4HY1 A;  1ZXM A;  2HFS A;  5GMD A;  2O1W A;  5DRR A;  2GO4 A;  4OO1 D;  1T4N A;  4BBY A;  2CZ9 A;  4JI2 I;  2EZ6 A;  4MYU A;  3IWB A;  4ZYD A;  2ENC A;  4USK A;  4R2S A;  3U1Y A;  1ZU1 A;  1YFH A;  1F2I G;  2M1S A;  3CDJ A;  4Z7Y A;  2EPK X;  3GLL A;  4P78 A;  1PJT A;  4HTG A;  5C0X E;  5A6K A;  2EL6 A;  2EFG A;  1HNX I;  2V2V A;  4DPY A;  2YZT A;  4AQY E;  3V2U C;  1LLM C;  1KVK A;  4MYT A;  2WNR B;  2WP8 B;  4L5N C;  1XHK A;  5JEA F;  4BC9 A;  2EN2 A;  3KZY A;  1Y6Z A;  3GME A;  1A1J A;  5LMN I;  1XMQ E;  5AE1 A;  4NBQ A;  3U1K A;  1MGT A;  4JI6 E;  2HJJ A;  2EOS A;  1YUI A;  2DLK A;  4LFA E;  4R2E A;  3ZKD A;  1Y60 A;  4UT4 A;  2LJU A;  3QT6 A;  1QZR A;  1R6M A;  2F8B A;  4GKJ I;  4R2Q A;  4FW4 A;  3JAM Q;  1MU5 A;  5K36 C;  4RHB B;  4DR6 E;  2V34 A;  3TQM A;  5JEA E;  2YTO A;  4X65 I;  3P3G A;  2EM5 A;  4JI4 E;  3PYD A;  2Z5C B;  2L2K B;  4F9B B;  4DV5 E;  4F2J C;  4NXM I;  4IFD B;  4HEI A;  2YT4 A;  3RMP A;  1I94 I;  4LF7 E;  2PNL A;  4MU4 A;  2UUC I;  4DUZ E;  2GQ0 A;  4R2R A;  4WUC A;  4LFB I;  3NZK A;  4JYA I;  4DV1 E;  1PIE A;  2EOF A;  2EPP A;  3EPH A;  2R76 A;  1XNR I;  2F4V I;  2DSY A;  4WPY A;  3M99 B;  2NUG A;  1IQO A;  2V8Q B;  2AJ4 A;  4OO1 A;  2O1U A;  3F0N A;  3AV0 A;  1UEK A;  3L7Z B;  4Q28 A;  2UXC E;  1IBM E;  1N33 I;  2UXB I;  2G7H A;  2VQE I;  4DU8 A;  4B3T I;  5FLX Q;  2EQ0 A;  4BS9 A;  3OML A;  4BA2 A;  5A6A A;  3OTO E;  3PYF A;  4DV3 E;  5C0X A;  5TSE A;  2YSP A;  1USV A;  5BR8 I;  5C0X C;  4NZV A;  2JEB A;  3WU6 A;  2BA1 D;  3LLH A;  1VI7 A;  5FWK A;  1DGC A;  2YRK A;  2JXP A;  2VF1 A;  4DV6 E;  4N3O A;  2RPC A;  1KIJ A;  3M7N G;  1OJ4 A;  3B8H A;  3K6Q A;  2H36 X;  4BC7 A;  4F9A B;  4JI1 I;  4R03 A;  4BMJ A;  4DR5 E;  1N34 E;  2E5L I;  2L8T A;  4DUY E;  3THO B;  2YTG A;  1ZM4 A;  4LF8 I;  5A6J A;  1X3C A;  2LVH A;  4P52 A;  4M0V A;  2C38 B;  4LCG A;  5JEA A;  1KTV A;  1WHN A;  4I3H A;  3DJW A;  3WU5 A;  4FW6 A;  3KZZ A;  5IWA E;  4DR7 E;  4FN5 A;  5DRP A;  4R2A A;  5JEA C;  2O1T A;  4M2Z A;  2M9A A;  2EM6 A;  1FWL A;  2UXD I;  3UHM A;  1UN6 B;  1ZM2 A;  1TN9 A;  2DLQ A;  4GKK I;  4U3D A;  1HR0 E;  4JI3 E;  3K1J A;  2VES A;  2ZBK B;  2JY9 A;  2EM3 A;  5KL4 A;  4DPX A;  1PVG A;  4JI0 E;  3UK3 C;  2FV4 B;  4B3R E;  1N32 E;  4MU1 A;  1E3P A;  1H7U A;  1HNZ I;  2VRD A;  1Z0B A;  5AAS A;  2C39 A;  4F6M A;  5DRQ A;  2EPZ A;  3LPS A;  3PYG A;  2EMA A;  4DR3 E;  1DI2 A;  3VK6 A;  4HAC A;  4DV0 I;  3C4B A;  4LF4 E;  4DV4 I;  4WX9 A;  1J5E E;  4LFB E;  3HXL A;  5LMU E;  2F1D A;  3HUL A;  1YUJ A;  1YZ9 A;  2NN6 B;  1UIL A;  4OX9 E;  2EOI A;  2NPF A;  5AE2 A;  3J80 Q;  5AC5 A;  3K85 A;  2Q8U A;  5K36 D;  1FKA E;  3EQ1 A;  5ADZ A;  2X36 A;  1ELO A;  3VHT B;  1XMO E;  1A1K A;  2EMC A;  1S4E A;  1RMD A;  2EOJ A;  2HK3 A;  2DIX A;  3MHH C;  2RSI A;  1JK1 A;  1OYR A;  5ELW A;  2EOO A;  2C37 A;  1D6T A;  4R2C A;  1ZAA C;  2DRP A;  4IZJ D;  1H73 A;  2J7J A;  1UDN A;  2J65 A;  2L2N A;  5IXM B;  1H74 A;  2LRS A;  5A2Q Q;  2MDR A;  1UHZ A;  1N3G A;  3T1H E;  1SFE A;  4AQY I;  2NN6 F;  2I9I A;  3B82 A;  3J7A G;  2IHR 1;  4LFC E;  1Z0E A;  4PRV A;  4QNK A;  4BA1 A;  4MDT A;  2VF3 A;  2L92 A;  1XMQ I;  1WJP A;  4DR1 E;  3Q6N A;  1NCS A;  2VE7 C;  4DR4 E;  2BM1 A;  2BB8 A;  2EWL A;  2Z5E A;  4DPT A;  4JI6 I;  4B3M E;  2BR2 B;  2I13 A;  2EOE A;  4AM3 A;  1T38 A;  4LFA I;  1H72 C;  1XXE A;  4MQY A;  2EN6 A;  5A69 A;  5C0X D;  2EMK A;  4DV2 E;  4DU7 A;  4GEQ B;  2EOZ A;  1Y5Y A;  1IBL I;  4WYQ B;  1BBG A;  2WZO A;  2CTD A;  5KL3 A;  2YRH A;  4JI5 E;  1FJG E;  3ADL A;  2CPN A;  2NN6 E;  4LCF A;  4DR6 I;  2PO2 B;  1P42 A;  4KZS A;  1NHI A;  5EL9 A;  3ECR A;  1QNT A;  1X6E A;  1A1H A;  2EOX A;  4NXN E;  1BB8 A;  1EA6 A;  2BV3 A;  1JK2 A;  2FGG A;  1E3H A;  3P06 A;  1WXR A;  1FWK A;  2KOU A;  4DV5 I;  3HJC A;  4LF7 I;  5K36 A;  4NHR A;  4DUZ I;  3JTZ A;  3BF2 A;  4Q35 B;  4F9C B;  5KL7 A;  2PNZ A;  4DV1 I;  4DR2 I;  2KHX A;  1XNQ E;  4HYM A;  2PO1 A;  2A2C A;  2ZM6 E;  4R2D A;  4GQU A;  5JEA D;  4TUI A;  2EPX A;  2VQF E;  2CG9 A;  2DEI A;  1GZ6 A;  1RQ0 A;  1EKZ A;  1Z5C A;  3WU3 A;  2UXC I;  2EPM X;  4IZK B;  4X66 E;  1IBM I;  5CFF E;  2HK2 A;  3JU0 A;  2PO0 A;  2Z5B B;  4IZJ A;  1HK7 A;  4BCA A;  1GQE A;  2UU9 E;  3OTO I;  4LF5 E;  2EN7 A;  4DV3 I;  2YTD A;  1H7S A;  3J81 C;  2YPN A;  4J8Z A;  2EMW A;  2K7I A;  1BKN A;  3CDI A;  5IT9 Q;  4KWY A;  2O1V A;  1UDQ A;  1YHC A;  2N3H A;  2YSO A;  4FW3 A;  1A1L A;  4BHC A;  4DV6 I;  4GZN C;  4X8W A;  1X6H A;  2CSH A;  4URL A;  4M9V C;  2PNM A;  2YTI A;  1QU6 A;  4DR5 I;  1N34 I;  1FNM A;  2WBT A;  1N36 E;  2HKE A;  4DUY I;  1X6F A;  4JI8 I;  4IS1 C;  1N0V C;  2PRT A;  4IFD F;  3KRN A;  2GS8 A;  5DNX A;  3ADJ A;  2EMB A;  4X62 E;  2NN6 C;  5IWA I;  4DR7 I;  4JV5 E;  3BID A;  4LU9 A;  3V5R A;  2MC5 A;  4DMI A;  3H09 A;  2L3C A;  4K0K E;  3P3E A;  4LCH A;  2EPL X;  2EM8 A;  5LLQ A;  4N4R B;  2JE6 A;  5KL2 A;  2UUA E;  1ZM9 A;  4JI3 I;  2EMI A;  2L6M A;  2UUC E;  4FW9 A;  4J3D A;  2BBG A;  3M7N D;  4AID A;  2YU5 A;  2EM4 A;  2JP9 A;  4B3R I;  4IFD E;  1T4O A;  1N32 I;  1RC7 A;  4FWG A;  2EPO A;  1J26 A;  4PU9 A;  2YWQ A;  2BA0 G;  4DR3 I;  5KL5 A;  1UDS A;  4KQV A;  3Q6M A;  1Z0T A;  3QG5 C;  1RHY A;  4LF4 I;  1YYK A;  2GO3 A;  4M30 A;  3C6M A;  2UXB E;  1B62 A;  3P1X A;  1Z0V A;  2EMH A;  2KON A;  1YSA C;  4B3T E;  2ELY A;  2LMZ A;  1PJS A;  2ODR C;  2WBS A;  2IES A;  2HHH E;  3M6A A;  4OX9 I;  4OKG A;  4UTG A;  2WBU A;  5A6B D;  4O24 A;  2BM0 A;  1B69 A;  2LUQ A;  3WU4 A;  4ZYG A;  3DD6 A; 
#chains in the Genus database with same CATH homology
 5BR8 E;  3FIG A;  1XMO I;  2DB2 A;  1B63 A;  2B7V A;  2E1M A;  2J7K A;  4OOG C;  3MSW A;  3J80 C;  4WUD A;  2E1R A;  4DV7 I;  4USM A;  2NUE A;  3C4T A;  4EMD A;  4I8O A;  4ED4 A;  1HNW E;  4JG4 A;  4FWH A;  1YYW A;  1Z0C A;  3ADI A;  3T1H I;  3ZKB A;  3ZM7 A;  1K47 A;  4LFC I;  2CGE A;  4YHH E;  4M1K A;  2B9D A;  3CWV A;  5A2Q C;  4DR1 I;  4DR4 I;  2UUB E;  2V88 A;  2UXD E;  1ZXN A;  1Z5A A;  2RSM A;  4WFT A;  4ZVI A;  2RS6 A;  4B3M I;  4KHP E;  2Z5C A;  2N3G A;  2M4I A;  4DV2 I;  3LML A;  2R42 A;  4DPW A;  2OI2 A;  4JI5 I;  2JOX A;  1FJG I;  4YY3 E;  4LF9 E;  4NXN I;  3LNU A;  4LF6 E;  2V87 A;  1IBK E;  4JI7 E;  3T1Y E;  1MG7 A;  4B3S E;  2L33 A;  2K4V A;  3ZZU A;  1O0W A;  2JOB A;  4X64 E;  1A6F A;  1X49 A;  2ZM6 I;  2VQF I;  4DKK A;  3GON A;  4RPF A;  3DF6 A;  4X66 I;  2JVA A;  2IOP A;  3JAM C;  4WUB A;  4DXL A;  3F6H A;  3PRY A;  2UU9 I;  3B78 A;  4LF5 I;  1DAR A;  2R3V A;  4P7A A;  4HAC B;  5DNY A;  4WSP A;  2LJP A;  1S16 A;  2V8P A;  3QT8 A;  2LTR A;  4JI2 E;  2ODR D;  1Z0W A;  1X47 A;  5IT9 C;  2IOQ A;  2X7I A;  2DEJ A;  1N36 I;  1NZ0 A;  5FLX C;  1EI1 A;  1HNX E;  1IBL E;  2V2Q A;  4X62 I;  3ADG A;  1KKH A;  3IWD A;  2M7Q A;  4JV5 I;  5LMN E;  2XEX A;  4K0K I;  3HPS A;  1X48 A;  1Y4S A;  2UUA I;  2HKJ A;  3VYX A;  1NHJ A;  4GKJ E;  4DR2 E;  3H4L A;  1STU A;  2L3J A;  1ZM3 A;  3J81 Q;  4X65 E;  3QT7 A;  4NXM E;  1HR0 I;  3IWC A;  1ZBT A;  2HHH I;  1I94 E;  4HXZ A;  3KWR A;  4L8N A;  1NHH A;  3Q1Q A;  4JI0 I;  2LTS A;  4JYA E;  5GME A;  5L3J A;  1XNR E;  2LE2 A;  2F4V E;  2RS7 A;  3HQ1 A;  2NA2 A;  3J7Y p;  4TUG A;  2L2M A;  1WHQ A;  2LJH A;  4LTY A;  1N33 E;  1Y4U A;  2VQE E;  1VIS A;  4R1F A;  1MX0 A;  3HPZ A;  1HNW I;  1YYO A;  2B7T A;  3F6G A;  2WW4 A;  4FWD A;  3QT5 A;  2LUP B;  3PYE A;  3LTO A;  1USU A;  4JI8 E;  5AE3 A;  3AUZ A;  2JR1 A;  4P7D A;  4IZJ B;  3D4J A;  4YHH I;  2NUF A;  1Z0G A;  1SR9 A;  1Z59 A;  2MC6 A;  4JI1 E;  2UUB I;  2JWO A;  2E5L E;  3ZZT A;  2FTX B;  4LF8 E;  4KHP I;  4R8O A;  2LBS B;  2V85 A;  2ZIT A;  5F3W A;  4YY3 I;  3ZOQ B;  1PKP A;  4LF9 I;  2HFU A;  4Z7C A;  4LF6 I;  2V86 A;  4IZK A;  4GKK E;  1IBK I;  2DMY A;  2Q2E B;  4JI7 I;  3T1Y I;  2Z5B A;  4B3S I;  1DQ3 A;  1FI4 A;  4X64 I;  1Z5B A;  1HNZ E;  4XTJ A;  1T4L B;  3ZZ0 A;  2V83 A;  2V89 A;  4PRX A;  4F54 A;  4DV0 E;  2A2D A;  4DV4 E;  2B3T B;  1WUU A;  1RR9 A;  1N0U A;  2V2Z A;  3J7A M;  2RTX A;  4DV7 E;  3K17 A;  1RRE A;  3VYY A;  1U2R A;  4DPU A;  5LL6 R;  5T6J A;  1XNQ I;  1ZBQ A;  3HTX A;  4HY1 A;  1ZXM A;  2HFS A;  5GMD A;  2O1W A;  1T4N A;  4BBY A;  2CZ9 A;  4JI2 I;  2EZ6 A;  4MYU A;  3IWB A;  4USK A;  2M1S A;  4Z7Y A;  4P78 A;  2EFG A;  1HNX I;  2V2V A;  4DPY A;  2YZT A;  4AQY E;  3V2U C;  1KVK A;  4MYT A;  4L5N C;  1XHK A;  4BC9 A;  1Y6Z A;  5LMN I;  1XMQ E;  5AE1 A;  4JI6 E;  4LFA E;  3ZKD A;  4UT4 A;  3QT6 A;  1QZR A;  2F8B A;  4GKJ I;  3JAM Q;  1MU5 A;  4DR6 E;  2V34 A;  4X65 I;  4JI4 E;  3PYD A;  2Z5C B;  2L2K B;  4F9B B;  4DV5 E;  4NXM I;  2YT4 A;  3RMP A;  1I94 I;  4LF7 E;  2PNL A;  2UUC I;  4DUZ E;  2GQ0 A;  4WUC A;  4JYA I;  4DV1 E;  1PIE A;  1XNR I;  2F4V I;  2DSY A;  4WPY A;  2NUG A;  2AJ4 A;  2V8Q B;  2O1U A;  3F0N A;  3AV0 A;  1UEK A;  4Q28 A;  2UXC E;  1IBM E;  1N33 I;  2UXB I;  2G7H A;  2VQE I;  4DU8 A;  4B3T I;  5FLX Q;  4BS9 A;  3OML A;  3OTO E;  3PYF A;  4DV3 E;  1USV A;  5BR8 I;  3WU6 A;  3LLH A;  5FWK A;  4N3O A;  2VF1 A;  4DV6 E;  1KIJ A;  1OJ4 A;  3B8H A;  3K6Q A;  2H36 X;  4BC7 A;  4F9A B;  4JI1 I;  4R03 A;  4BMJ A;  4DR5 E;  1N34 E;  2E5L I;  2L8T A;  4DUY E;  4LF8 I;  1ZM4 A;  4P52 A;  4M0V A;  1KTV A;  1WHN A;  4I3H A;  3DJW A;  3WU5 A;  5IWA E;  4DR7 E;  4FN5 A;  2O1T A;  4M2Z A;  1FWL A;  2UXD I;  1ZM2 A;  4GKK I;  1HR0 E;  4JI3 E;  3K1J A;  2ZBK B;  2JY9 A;  4DPX A;  1PVG A;  4JI0 E;  2FV4 B;  4B3R E;  1N32 E;  1HNZ I;  1H7U A;  1Z0B A;  5AAS A;  3LPS A;  3PYG A;  1DI2 A;  4DR3 E;  3VK6 A;  4HAC A;  4DV0 I;  3C4B A;  4LF4 E;  4DV4 I;  4LFB E;  1J5E E;  3HXL A;  5LMU E;  3HUL A;  1YZ9 A;  1UIL A;  4OX9 E;  2NPF A;  5AE2 A;  3J80 Q;  3K85 A;  1FKA E;  5ADZ A;  2X36 A;  1ELO A;  1XMO E;  1S4E A;  2HK3 A;  2DIX A;  1D6T A;  4IZJ D;  1H73 A;  2L2N A;  1H74 A;  2LRS A;  5A2Q Q;  2MDR A;  1UHZ A;  3T1H E;  4AQY I;  3B82 A;  3J7A G;  2IHR 1;  4LFC E;  1Z0E A;  4PRV A;  2VF3 A;  2L92 A;  1XMQ I;  4DR1 E;  3Q6N A;  2VE7 C;  4DR4 E;  2BM1 A;  2EWL A;  2Z5E A;  4DPT A;  4JI6 I;  4B3M E;  4LFA I;  1H72 C;  4DU7 A;  4DV2 E;  4GEQ B;  1IBL I;  4WYQ B;  2WZO A;  4JI5 E;  1FJG E;  3ADL A;  4DR6 I;  2CPN A;  4KZS A;  1NHI A;  4JI4 I;  4NXN E;  1EA6 A;  2BV3 A;  3P06 A;  2FGG A;  4DV5 I;  1WXR A;  1FWK A;  2KOU A;  3HJC A;  4LF7 I;  4DUZ I;  3JTZ A;  4F9C B;  4DV1 I;  4DR2 I;  2KHX A;  1XNQ E;  4HYM A;  2A2C A;  2ZM6 E;  4TUI A;  2VQF E;  2CG9 A;  2DEI A;  3WU3 A;  1GZ6 A;  1RQ0 A;  1EKZ A;  1Z5C A;  2UXC I;  4IZK B;  4X66 E;  1IBM I;  5CFF E;  2HK2 A;  3JU0 A;  2Z5B B;  4IZJ A;  1HK7 A;  4BCA A;  1GQE A;  2UU9 E;  3OTO I;  4LF5 E;  4DV3 I;  1H7S A;  3J81 C;  4J8Z A;  1BKN A;  5IT9 Q;  2O1V A;  2N3H A;  4DV6 I;  4X8W A;  4URL A;  2PNM A;  1QU6 A;  4DR5 I;  1N34 I;  1FNM A;  1N36 E;  2HKE A;  4DUY I;  4JI8 I;  1N0V C;  2GS8 A;  3ADJ A;  4X62 E;  5IWA I;  4DR7 I;  4JV5 E;  3V5R A;  4LU9 A;  2MC5 A;  4DMI A;  3H09 A;  2L3C A;  4K0K E;  2UUA E;  1ZM9 A;  4JI3 I;  4FW9 A;  2L6M A;  2UUC E;  4B3R I;  1N32 I;  1T4O A;  1RC7 A;  1J26 A;  4PU9 A;  4DR3 I;  4KQV A;  3Q6M A;  1Z0T A;  4LF4 I;  1YYK A;  4M30 A;  1B62 A;  2UXB E;  1Z0V A;  3P1X A;  1J5E I;  4B3T E;  2KON A;  4FWG A;  5LMU I;  4LFB I;  2LMZ A;  2ODR C;  3M6A A;  2HHH E;  4OX9 I;  4UTG A;  2BM0 A;  2LUQ A;  3WU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...