4LF8E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf8E02
4X62E 4MYUA 4ED4A 4JI3E 2CPNA 3J81C 4AQYE 4X8WA 1Z5AA 3HULA 4FWHA 5LMNE 5A2QQ 3JAMQ 4JI3I 1HR0I 4DV3E 4DXLA 2RSMA 1X47A 4AQYI 2HKJA 5BR8I 1IBLE 1XNQE 4Z7YA 4DU8A 3F0NA 1MG7A 4JI8I 1RQ0A 1X49A 2E5LI 5BR8E 2YT4A 1BKNA 3PYGA 2LTSA 4PU9A 4DR4E 2HK3A 2UUAE 2VQEE 3ZKDA 1UILA 2V2QA 4OOGC 1FNMA 2MDRA 1T4LB 2UXCE 1ZXNA 3GONA 2LJPA 3J7Yp 2GS8A 3Q1QA 4K0KI 1OJ4A 3V5RA 5IT9C 2LRSA 2HKEA 3V2UC 4DKKA 1HR0E 2ZBKB 1WHQA 2DMYA 2VQFI 2HK2A 4URLA 4HYMA 4DR7I 1XMQE 2LUPB 4YY3I 4LF4I 2EZ6A 1PVGA 4JI8E 4JI5I 4FWGA 5LMNI 1VISA 1XHKA 2V34A 3VYXA 1NHIA 1FJGE 1ZM2A 4B3MI 3ZZTA 1B63A 2XEXA 4DPXA 3ZZUA 4HXZA 1FI4A 2L2KB 2UU9E 4JI7I 4UT4A 3CWVA 4WUBA 1Z0GA 3T1YI 2RTXA 1WUUA 3J80C 1FWLA 4PRVA 1H73A 1K47A 4DV4E 2DEIA 1N33E 4DR1I 1H7SA 2UUAI 4X64E 3LTOA 2NA2A 4DV1E 1EKZA 1O0WA 1A6FA 3M6AA 5LMUI 1Z5BA 4DR7E 1NHJA 4LFCI 4X66I 5L3JA 1YYKA 4FN5A 1XNQI 5LMUE 1RREA 3OTOI 3C4BA 4KQVA 4PRXA 4M30A 2LBSB 2UUBE 4B3RE 1ZM3A 1N34I 2X7IA 3T1HI 3QT7A 3J7AG 4P7AA 1N32I 4LF7E 4EMDA 4JYAI 4HACB 1Z0VA 4YHHI 4RPFA 4JV5I 2L33A 1J5EI 2ZITA 1IBME 1S16A 1IBKE 2UUCI 1H74A 5IWAI 4DV1I 4WUDA 2V2VA 2F4VE 4HACA 4YHHE 5CFFE 2UXDE 2B7TA 4DR1E 2CZ9A 1IBMI 3B82A 4X65I 4FW9A 4LFBI 2DIXA 1I94E 5IT9Q 1J26A 3ZM7A 2L3CA 4DV7E 1S4EA 2UXBI 3T1HE 1ZM9A 3D4JA 1EI1A 2LUQA 4LF6E 4DV2I 4LFBE 1N33I 4DUYI 3WU4A 4R1FA 1RC7A 2NUEA 1YZ9A 3HTXA 1KIJA 4B3SI 4DV6E 2NUFA 1IBKI 4DV2E 4LF6I 4LFCE 4DR6I 3J80Q 2JY9A 2ZM6E 3C4TA 5GMEA 1J5EE 4JI7E 2BV3A 1UEKA 4JI2I 1KVKA 1H72C 4DPUA 4LF9I 4DV0I 5LL6R 4JI6E 4UTGA 4DR5E 2F4VI 3QT6A 3B78A 2X36A 1XNRI 3VYYA 1ZXMA 2DEJA 4OX9I 4B3RI 2LJHA 4JI2E 1UHZA 1FWKA 1STUA 3LLHA 4K0KE 4JG4A 4JV5E 4DUZI 4DR5I 3JAMC 2RS6A 1Z5CA 4X64I 1T4NA 4DU7A 1KKHA 2V8PA 4DUYE 2L2NA 3ADIA 3K17A 3J81Q 1HNWE 4DPTA 4XTJA 3H4LA 4ZVIA 2VQEI 4X65E 1N0VC 1Z59A 1QZRA 2LTRA 1HNWI 4DV6I 1X48A 3J7AM 2R3VA 4USKA 3ZKBA 4JI6I 1H7UA 1MX0A 1N32E 2L3JA 1YYOA 1B62A 2EFGA 4DV7I 4JI1E 2HFUA 2V2ZA 3QT5A 4LF8E 1NZ0A 2OI2A 3LPSA 4LF5E 1D6TA 4B3SE 2IHR1 1N0UA 2VQFE 2RS7A 4Z7CA 4NXME 2L2MA 4GKKI 3WU6A 2UXDI 4LFAI 4DUZE 4DR2E 1XMQI 2AJ4A 3ADJA 4WUCA 4JI5E 2E1RA 3B8HA 2B3TB 1I94I 4DV0E 5A2QC 4DR2I 4JI4I 1FJGI 4FWDA 4X66E 1HNXI 1DARA 4B3TI 4JI0I 4OX9E 1Z0WA 3T1YE 1Z0CA 4JI1I 3OTOE 4DR3E 4LF8I 1XMOE 1N36I 3ADGA 1N34E 3PYDA 2BM1A 2A2DA 2NPFA 4I3HA 3K1JA 4JYAE 4LF7I 1NHHA 4NXMI 1HNZI 4P52A 1FKAE 4LF5I 4YY3E 4LF4E 2N3HA 4GKJI 1Z0TA 1T4OA 4DV5E 2UUCE 4NXNI 1YYWA 2A2CA 3LNUA 2HHHE 5GMDA 3ZZ0A 5FLXC 2WW4A 2B7VA 2E5LE 4X62I 2KHXA 4LFAE 1RR9A 3WU5A 4B3ME 4JI4E 2UU9I 1KTVA 4B3TE 3WU3A 1MU5A 1PKPA 1QU6A 2DB2A 2HHHI 3P1XA 2Q2EB 2UUBI 3PYFA 4MYTA 1Z0BA 4DR3I 4JI0E 4GKKE 1ZBTA 4KHPI 1IBLI 2BM0A 1XMOI 4HY1A 2HFSA 2NUGA 1ELOA 5IWAE 2VF3A 4DV5I 4DR4I 4KHPE 1WHNA 1HNXE 2ZM6I 4DV3I 2N3GA 1Z0EA 2JVAA 4USMA 4LF9E 4NXNE 4M2ZA 3ADLA 5FLXQ 1XNRE 1PIEA 4WYQB 1N36E 4DPWA 2UXBE 1EA6A 3QT8A 1HNZE 4WFTA 1ZM4A 4M1KA 1DI2A 1U2RA 1GQEA 2J7KA 4GKJE 4DV4I 4DPYA 2UXCI 3PYEA 4DR6E 2R42A
chains in the Genus database with same CATH superfamily
4X62E 4MYUA 1SR9A 2YRHA 3MHHC 4ED4A 4JI3E 3L7ZA 2EOZA 3KWRA 2EOQA 2NABA 4F6NA 2CPNA 3J81C 4AQYE 4X8WA 3BIDA 1Z5AA 1IQSA 3PS1A 4ZYDA 3HULA 4FWHA 5LMNE 2Z5CB 5A2QQ 2V85A 3JAMQ 2JE6B 2EPKX 4MU4A 2JXPA 4JI3I 1HR0I 5C0XC 4DV3E 4DXLA 3THNA 4IFDC 2RSMA 2V8QB 1X47A 2PNMA 4R2SA 4AQYI 3M85G 4MU0A 2HKJA 4Q35B 3F6GA 5BR8I 2BA1G 1OYRA 1IBLE 1XNQE 5TSEA 1USUA 4Z7YA 4DU8A 3BGHA 3DF6A 2EM0A 3F0NA 2M1SA 1X6HA 2EPPA 4F9CB 4BC7A 1MG7A 4BC9A 3PS3A 4WPYA 4JI8I 2E1MA 3UHMA 5DRRA 3OMLA 4IFDB 1RQ0A 1AH5A 3GLLA 1R6MA 1X49A 2C37A 5BR8E 2E5LI 2JT2A 2ELZA 2YT4A 1N3GA 2EOHA 1BKNA 3PYGA 2LTSA 1L4SA 4PU9A 2EMXA 3IWDA 3M7ND 4DR4E 2HK3A 2UUAE 2IOQA 2EJ4A 2G7HA 2VQEE 3ZKDA 1UILA 2V2QA 4OOGC 4N3OA 1SFEA 1FNMA 3VK6A 5DRPA 2D9HA 2MDRA 4DMIA 2EN4A 1T4LB 4O43A 1NEIA 2UXCE 3T1YI 4OO1C 1ZXNA 2WZOA 5KL7A 1UDNA 2F4VI 3GONA 2LJPA 4NXNI 4QNKA 3J7Yp 2GS8A 1UN6B 2O1VA 3GMEA 4IZKA 4AIDA 3Q1QA 4K0KI 2EE8A 1OJ4A 3V5RA 1KYQA 5IT9C 2LRSA 4P78A 4LPFA 2HKEA 3V2UC 2LVHA 4J3DA 5A69A 5A6BD 4DKKA 1YH8A 1Y60A 1GZ6A 3HPZA 3KZZA 1ZBQA 2BB8A 1HR0E 1IMUA 2ZBKB 3THOB 1WHQA 2DMYA 2BA0G 2VQFI 3HPSA 1YUIA 5C0XB 3BF2A 2EPUA 5JEAD 2HK2A 4URLA 4R03A 5DNYA 3CDJA 4HYMA 4DR7I 5K36F 4OO1F 2WNRA 1XMQE 4OZEA 2LUPB 2JEAA 4YY3I 4LF4I 1PDAA 4F54A 2EZ6A 2M4IA 4FW6A 1PJTA 4JI8E 5KL2A 1PVGA 2EMLA 4JI5I 4FWGA 5LMNI 2K4VA 2EMFA 4M0VA 4J8ZA 1VISA 5C0XD 2DSYA 1XHKA 2V34A 3VYXA 1NHIA 2O1WA 5AE3A 1FJGE 2EPOA 1ZM2A 4B3MI 2LCEA 3ZZTA 1B63A 2XEXA 4DPXA 2L6MA 1P47A 4HXZA 3DD6A 4U3DA 3ZZUA 1FI4A 2L2KB 2UU9E 4JI7I 1RHYA 2WNRB 4UT4A 1F2IG 3CWVA 2EMZA 2J7JA 1JK2A 2EOSA 2RTXA 1Z0GA 2HJJA 3UK3C 4WUBA 4RH8A 3J80C 1WUUA 2RQLA 2IESA 2FGGA 2YTEA 2FTXB 2GPIA 2VESA 1A1IA 4R2QA 2R1FA 2JYAA 1Z1BA 1FWLA 5DNXA 3M99B 5K36A 4PRVA 1H73A 1K47A 4DV4E 2DEIA 4IZJB 4M9VC 2EN3A 3B4TA 2EPCA 2CT1A 1Y4SA 1N33E 4FW4A 2YPNA 4BCAA 2RPCA 4IS9A 2NN6F 4R2AA 4DR1I 1H7SA 2UUAI 1NCSA 4X64E 2ADRA 3LTOA 4OO1D 2NA2A 1A1GA 2NN6C 4DV1E 2EM9A 2YTDA 5JEAF 1EKZA 1O0WA 1A6FA 3M6AA 5LMUI 2YTPA 1Z5BA 4BHBA 3PRYA 4DR7E 3AUZA 1NHJA 4LFCI 5AC5A 4X66I 4NBQA 5L3JA 4RHBB 4F6MA 2EM2A 1BBGA 1JK1A 1YYKA 2C38B 4FN5A 2EORA 3HQ1A 4X9JA 4R2RA 1XNQI 2LO3A 4FW3A 5LMUE 4R8OA 1RREA 4MU1A 3OTOI 3C4BA 4KQVA 4PRXA 1UDSA 4M30A 5KL5A 1P42A 2LBSB 2GHFA 2L8TA 2YZTA 2UUBE 4B3RE 1ZM3A 2EN8A 2F1DA 2X7IA 4QNJA 1N34I 3T1HI 2I9IA 3QT7A 3J7AG 4P7AA 2EM7A 1LLMC 1N32I 2IERA 5IXMB 5KL3A 4LF7E 4EMDA 4IFDD 4JYAI 2EPNA 4HACB 2JEAB 3F6HA 5IV8B 1Z0VA 4MDTA 4RPFA 5C0XE 4YHHI 4IFDE 4JV5I 2JOXA 2L33A 2PNZB 2KONA 2PO0A 1J5EI 2EM4A 2ZITA 1YPNA 2GQ0A 1IBME 1S16A 2YRMA 1IBKE 1UDOA 2UUCI 2YWQA 1H74A 3EPLA 2JE6A 2GO4A 5IWAI 4Q28A 2L92A 4MLQA 4WUDA 4DV1I 2V2VA 1X3CA 2F4VE 4HACA 4YHHE 2EOXA 2EQ0A 5CFFE 4BBYA 2EOIA 4IFDF 2EPZA 1A1JA 2B7TA 2EM5A 2UXDE 2BA0D 3P3EA 4ISAA 2EN2A 4DR1E 3P06A 2EOJA 2CZ9A 1IBMI 3B82A 1DQ3A 4X65I 4FW9A 1WRJA 2ENHA 4LFBI 5T6JA 4NZVA 2DIXA 2M9AA 4LU9A 1I94E 2JPAA 5IT9Q 1J26A 1E3PA 2L3CA 2J65A 3ZM7A 4DV7E 2C38A 1S4EA 4ZYEA 2UXBI 3T1HE 2JWOA 5A6AA 2K7IA 1ZM9A 3D4JA 1EI1A 5JEAA 2LUQA 4LF6E 4DV2I 2R76A 4LFBE 4HTGA 2EPMX 1YHCA 1N33I 4LTYA 3WU4A 4DUYI 1YSAC 3U1YA 4R1FA 1MGTA 2H36X 3ZOQB 4WSPA 2V87A 1RC7A 2NUEA 2N8XA 4IFDA 1YZ9A 3HTXA 1KIJA 2GO3A 5C0XA 4B3SI 2LMZA 3EPKA 4DV6E 2NUFA 1IBKI 4DV2E 4LF6I 1WJPA 4LFCE 1ZAAC 4DR6I 3J80Q 2JY9A 2ZM6E 4O4KA 2PO2B 2YTJA 2ENAA 3EPHA 1KJKA 3C4TA 3HJCA 5GMEA 2GLIA 1J5EE 4JI7E 2BV3A 5EKWA 1UEKA 2EN1A 4JI2I 1KVKA 1H72C 4DPUA 5K36B 3PS2A 4LF9I 1QNTA 4DV0I 5LL6R 4JI6E 2YU8A 4DR5E 3Q6MA 4LCFA 2E72A 4UTGA 3TQMA 4BS9A 3B78A 3QT6A 2X36A 1XNRI 3VYYA 1ZXMA 2LT7A 2VF1A 2C39B 2DEJA 3EPJA 4OX9I 2LJHA 4B3RI 2ENCA 4JI2E 2PNZA 2BR2A 2Z5BB 3HKMA 1UHZA 1FWKA 1STUA 3LLHA 4K0KE 4BHCA 3L00A 2CTDA 2JR1A 3LMLA 4JV5E 4JG4A 3U1KA 4L5NC 1Y5YA 4DUZI 4DR5I 3JAMC 1PJQA 2RS6A 2YTNA 1Z5CA 4X64I 1T4NA 2JEBB 4OO1A 1Y6ZA 4DU7A 1KKHA 2V8PA 2EPRA 2WCC3 4DUYE 2YTGA 2L2NA 2V88A 3ADIA 3K17A 3J81Q 1BB8A 1X5WA 1HNWE 3VHTB 5A6JA 3MHSC 4DPTA 1EH7A 4XTJA 1EH8A 2EMCA 2V89A 5K36E 3H4LA 4ZVIA 2YU5A 5LLQA 2BBGA 2VQEI 5K36D 4X65E 1N0VC 2Q8UA 2CVEA 1Z59A 2VE7C 3CDIA 4MQYA 1QZRA 2LTRA 2M7QA 4AM3A 1HNWI 1DGCA 4DV6I 2AE8A 4NHRA 1PJSA 1X48A 3Q6NA 3J7AM 2R3VA 2EMAA 1AAYA 2PNLA 4R2DA 1TF3A 4USKA 3ZKBA 4JI6I 2EMIA 2NN6E 1H7UA 3K85A 1MX0A 1N32E 1HK7A 2L3JA 1YYOA 2KOUA 4LCGA 4WXCA 1B62A 2EFGA 2PO0B 2EM3A 4DV7I 4BA1A 1G2FC 4JI1E 2HFUA 2V2ZA 2DLKA 2EL6A 2YSPA 2YTIA 4R2PA 2O3ZA 3QT5A 5DROA 4LF8E 2ODRD 1NZ0A 2OI2A 5C0XF 3LPSA 2EPLX 4LF5E 2EOOA 4R2CA 3M7NG 2EOFA 5DRQA 4BA2A 1D6TA 4IZJA 3GCMA 4B3SE 1OYPA 2IHR1 1N0UA 2VQFE 2RS7A 4Z7CA 3FIGA 4NXME 2F8BA 2L2MA 2LV2A 2MKDA 2PRTA 4GKKI 3WU6A 1B69A 2UXDI 1X6FA 4LFAI 2FV4B 4DUZE 4DR2E 2MC5A 1ZR9A 1XMQI 3KRNA 1ZU1A 2AJ4A 3ADJA 2A25A 4WXDA 3AV0A 4WUCA 4JI5E 2E1RA 2JEBA 3B8HA 4OO1B 2B3TB 2WP8A 4F9AB 2EMBA 1I94I 2EN6A 5A6BA 1T38A 5A2QC 4DV0E 4DR2I 2EM6A 4JI4I 1GTKA 2EMWA 1FJGI 4FWDA 4X66E 2BR2B 1HNXI 2Z5BA 1DARA 5DNLA 2WBTA 2RSIA 4B3TI 4JI0I 4OX9E 1Z0WA 3T1YE 1T39A 4L8NA 4FW5A 2B9DA 1Z0CA 3P76A 3JTZA 1UDQA 4JI1I 3OTOE 2YTOA 1EH6A 4O5GA 2EL5A 4DR3E 1YFHA 1XMOE 1N36I 4LF8I 3ADGA 4HEIA 3M85D 1N34E 3PYDA 1A1FA 3HXLA 4KZSA 2BM1A 2A2DA 2NPFA 1YUJA 4I3HA 3EQ1A 4LCHA 2EMYA 1A1LA 3K1JA 3IWBA 4JYAE 1NHHA 4LF7I 2DMIA 4NXMI 2WBUA 2LE2A 1MEYC 5AASA 5F3WA 1HNZI 4P52A 2MKNA 2YSOA 1FKAE 2EL4A 4YY3E 1TF6A 4LF4E 4LF5I 2N3HA 2I13A 2DLQA 5ELWA 4GKJI 4R2EA 1Z0TA 4MLVA 2IOPA 5JEAE 1T4OA 4DV5E 4IS1C 5FLXC 2UUCE 4TUGA 1YYWA 2A2CA 2HHHE 2CG9A 2NN6B 3LNUA 5GMDA 3NZKA 3ZZ0A 2WW4A 2B7VA 2E5LE 4OKGA 2KHXA 4X62I 2BA1D 4LFAE 2EMGA 4LOMA 3H09A 1RR9A 4P7DA 2JP9A 3WU5A 5FWKA 2PO1A 4B3ME 4JI4E 4TUIA 2WBSA 4GZNC 3KZYA 2UU9I 1VI7A 4ZYGA 1KTVA 4B3TE 3WU3A 1MU5A 1PKPA 1QU6A 1Y4UA 2DB2A 2HHHI 5EL9A 3P1XA 2ELYA 2Q2EB 1BBOA 1R6LA 2UUBI 2YTQA 3PYFA 2WP8B 4MYTA 1Z0BA 4GQUA 2EWLA 3MSWA 5JEAC 4AIMA 2DRPA 4DR3I 2LJUA 3IWCA 4JI0E 4KWYA 2EM8A 4FK5C 4GKKE 4WX9A 1ZBTA 1RMDA 2MC6A 2VRDA 2EN7A 3K6QA 1E3HA 4U3BA 2C39A 3C6MA 3DJWA 1X6EA 3H1CA 4KHPI 2EMKA 5KL4A 1IBLI 5KL6A 2O1TA 2BM0A 1XMOI 3RMPA 4HY1A 2JOBA 2V86A 4I8OA 2HFSA 2Z5CA 4IZKB 4IJDA 1A1HA 1IQOA 3P3GA 1TN9A 4GEQB 2NUGA 1ELOA 3ECRA 5IWAE 2VF3A 2EPAA 4DV5I 2EQ3A 4BA2B 4DR4I 3C6KA 4F2JC 4KHPE 1WHNA 2YRKA 1HNXE 2ZM6I 2MDGA 1WXRA 2PO2A 4OO1E 4DV3I 2N3GA 2YTFA 1Z0EA 4BA1B 3L7ZB 2JVAA 5AE2A 1A1KA 4USMA 4LF9E 2CSHA 2EPXA 4NXNE 2Z5EA 5K36C 5A6KA 4M2ZA 1XXEA 2EMHA 2EQ1A 3ADLA 4ZYHA 1USVA 5FLXQ 1XNRE 1PIEA 5ADZA 2HGHA 4WYQB 1N36E 3P3CA 4DPWA 2UXBE 2EOEA 2EOYA 1EA6A 3QT8A 1HNZE 2CGEA 4WFTA 2V83A 3QG5C 1ZM4A 4M1KA 1G2DC 2NN6D 2NN6A 1OYSA 2EOMA 4FW7A 4IZJD 5JEAB 4N4RB 2HC5A 4BMJA 5AC4A 1DI2A 1U2RA 2C37B 2DGCA 2ODRC 1UBDC 1GQEA 4WSGA 2J7KA 4GKJE 4MU3A 4DV4I 5AE1A 4DPYA 2O1UA 2UXCI 4O24A 3BBGA 3PYEA 4F9BB 4DR6E 2PO1B 2EP3A 2R42A 3JU0A
chains in the Genus database with same CATH topology
4X62E 4MYUA 1SR9A 4ED4A 4JI3E 3KWRA 2CPNA 3J81C 4AQYE 4X8WA 1Z5AA 3HULA 4FWHA 5LMNE 2Z5CB 5A2QQ 2V85A 3JAMQ 4JI3I 1HR0I 4DV3E 4DXLA 2RSMA 2V8QB 1X47A 2PNMA 4AQYI 2HKJA 3F6GA 5BR8I 1IBLE 1XNQE 1USUA 4Z7YA 4DU8A 3DF6A 3F0NA 2M1SA 4F9CB 1MG7A 4BC7A 4BC9A 4WPYA 4JI8I 2E1MA 3OMLA 1RQ0A 1X49A 2E5LI 5BR8E 2YT4A 1BKNA 3PYGA 2LTSA 4PU9A 3IWDA 4DR4E 2HK3A 2UUAE 2IOQA 2G7HA 2VQEE 3ZKDA 1UILA 2V2QA 4OOGC 4N3OA 1FNMA 3VK6A 2MDRA 4DMIA 1T4LB 2UXCE 1ZXNA 2WZOA 3GONA 2LJPA 3J7Yp 2GS8A 2O1VA 4IZKA 3Q1QA 4K0KI 1OJ4A 3V5RA 5IT9C 2LRSA 4P78A 2HKEA 3V2UC 4DKKA 1GZ6A 3HPZA 1HR0E 1ZBQA 2ZBKB 1WHQA 2DMYA 2VQFI 3HPSA 2HK2A 4URLA 4R03A 5DNYA 4HYMA 4DR7I 1XMQE 2LUPB 4YY3I 4LF4I 4F54A 2EZ6A 2M4IA 1PVGA 4JI8E 4JI5I 4FWGA 5LMNI 2K4VA 4M0VA 4J8ZA 1VISA 2DSYA 1XHKA 2V34A 3VYXA 1NHIA 2O1WA 5AE3A 1FJGE 1ZM2A 4B3MI 3ZZTA 1B63A 2XEXA 4DPXA 2L6MA 3ZZUA 4HXZA 1FI4A 2L2KB 2UU9E 4JI7I 4UT4A 3CWVA 4WUBA 1Z0GA 3T1YI 2RTXA 1WUUA 3J80C 2FGGA 2FTXB 1FWLA 4PRVA 1H73A 1K47A 4DV4E 2DEIA 4IZJB 1Y4SA 1N33E 4BCAA 4DR1I 1H7SA 2UUAI 4X64E 3LTOA 2NA2A 4DV1E 1EKZA 1O0WA 1A6FA 3M6AA 5LMUI 1Z5BA 3PRYA 4DR7E 3AUZA 1NHJA 4LFCI 4X66I 5L3JA 1YYKA 4FN5A 3HQ1A 1XNQI 5LMUE 4R8OA 1RREA 3OTOI 3C4BA 4KQVA 4PRXA 4M30A 2LBSB 2L8TA 2YZTA 2UUBE 4B3RE 1ZM3A 1N34I 2X7IA 3T1HI 3QT7A 3J7AG 4P7AA 1N32I 4LF7E 4EMDA 4JYAI 4HACB 3F6HA 1Z0VA 4RPFA 4YHHI 4JV5I 2JOXA 2L33A 2KONA 1J5EI 2ZITA 2GQ0A 1IBME 1S16A 1IBKE 2UUCI 1H74A 5IWAI 4Q28A 2L92A 4WUDA 4DV1I 2V2VA 2F4VE 4HACA 4YHHE 5CFFE 4BBYA 2UXDE 2B7TA 4DR1E 3P06A 2CZ9A 1IBMI 3B82A 1DQ3A 4X65I 4FW9A 4LFBI 5T6JA 2DIXA 4LU9A 1I94E 5IT9Q 1J26A 3ZM7A 2L3CA 4DV7E 1S4EA 2UXBI 3T1HE 2JWOA 1ZM9A 3D4JA 1EI1A 2LUQA 4LF6E 4DV2I 4LFBE 1N33I 4LTYA 3WU4A 4DUYI 4R1FA 2H36X 3ZOQB 1RC7A 4WSPA 2V87A 2NUEA 1YZ9A 3HTXA 1KIJA 4B3SI 2LMZA 4DV6E 2NUFA 1IBKI 4DV2E 4LF6I 4LFCE 4DR6I 3J80Q 2ZM6E 2JY9A 3C4TA 3HJCA 5GMEA 1J5EE 4JI7E 2BV3A 1UEKA 4JI2I 1KVKA 1H72C 4DPUA 4LF9I 4DV0I 5LL6R 4JI6E 3Q6MA 4DR5E 4UTGA 2F4VI 3QT6A 4BS9A 3B78A 2X36A 1XNRI 3VYYA 1ZXMA 2VF1A 2DEJA 4OX9I 4B3RI 2LJHA 4JI2E 2Z5BB 1UHZA 1FWKA 1STUA 3LLHA 4K0KE 2JR1A 3LMLA 4JV5E 4JG4A 4L5NC 4DUZI 4DR5I 3JAMC 2RS6A 1Z5CA 4X64I 1T4NA 4DU7A 1Y6ZA 1KKHA 2V8PA 4DUYE 2L2NA 2V88A 3ADIA 3K17A 3J81Q 1HNWE 4DPTA 4XTJA 2V89A 3H4LA 4ZVIA 2VQEI 4X65E 1N0VC 1Z59A 2VE7C 1QZRA 2LTRA 2M7QA 1HNWI 4DV6I 1X48A 3Q6NA 3J7AM 2R3VA 2PNLA 4USKA 3ZKBA 4JI6I 1H7UA 3K85A 1MX0A 1N32E 1HK7A 2L3JA 1YYOA 2KOUA 1B62A 2EFGA 4DV7I 4JI1E 2HFUA 2V2ZA 3QT5A 4LF8E 2ODRD 1NZ0A 2OI2A 3LPSA 4LF5E 1D6TA 4IZJA 4B3SE 2IHR1 1N0UA 2VQFE 2RS7A 4Z7CA 3FIGA 4NXME 2F8BA 2L2MA 4GKKI 3WU6A 2UXDI 4LFAI 2FV4B 4DUZE 4DR2E 2MC5A 1XMQI 2AJ4A 3ADJA 4WUCA 3AV0A 4JI5E 2E1RA 3B8HA 2B3TB 4F9AB 1I94I 5A2QC 4DV0E 4DR2I 4JI4I 1FJGI 4FWDA 4X66E 1HNXI 2Z5BA 1DARA 4B3TI 4JI0I 4OX9E 1Z0WA 3T1YE 4L8NA 2B9DA 1Z0CA 3JTZA 4JI1I 3OTOE 4DR3E 4LF8I 1XMOE 1N36I 3ADGA 1N34E 3PYDA 3HXLA 4KZSA 2BM1A 2A2DA 2NPFA 4I3HA 3K1JA 3IWBA 4JYAE 1NHHA 4LF7I 4NXMI 2LE2A 5AASA 5F3WA 1HNZI 4P52A 1FKAE 4LF5I 4YY3E 4LF4E 2N3HA 4GKJI 1Z0TA 2IOPA 1T4OA 4DV5E 5FLXC 2UUCE 4TUGA 1YYWA 2A2CA 2HHHE 2CG9A 3LNUA 5GMDA 4NXNI 3ZZ0A 2WW4A 2B7VA 2E5LE 4X62I 2KHXA 4LFAE 3H09A 1RR9A 4P7DA 3WU5A 5FWKA 4B3ME 4JI4E 4TUIA 2UU9I 1KTVA 4B3TE 3WU3A 1MU5A 1PKPA 1QU6A 1Y4UA 2DB2A 2HHHI 3P1XA 2Q2EB 2UUBI 3PYFA 4MYTA 1Z0BA 4DR3I 2EWLA 3MSWA 3IWCA 4JI0E 4GKKE 1ZBTA 2MC6A 3K6QA 3DJWA 4KHPI 1IBLI 2O1TA 2BM0A 1XMOI 3RMPA 4HY1A 2JOBA 2V86A 4I8OA 2HFSA 2Z5CA 4IZKB 4GEQB 2NUGA 1ELOA 5IWAE 2VF3A 4DV5I 4DR4I 4KHPE 1WHNA 1HNXE 2ZM6I 1WXRA 4DV3I 2N3GA 1Z0EA 2JVAA 5AE2A 4USMA 4LF9E 4NXNE 2Z5EA 4M2ZA 3ADLA 1USVA 5FLXQ 1XNRE 1PIEA 5ADZA 4WYQB 1N36E 4DPWA 2UXBE 1EA6A 3QT8A 1HNZE 2CGEA 4WFTA 2V83A 1ZM4A 4M1KA 4IZJD 4BMJA 1DI2A 1U2RA 2ODRC 1GQEA 2J7KA 4GKJE 4DV4I 5AE1A 4DPYA 2O1UA 2UXCI 3PYEA 4F9BB 4DR6E 2R42A 3JU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 E;  4MYU A;  4ED4 A;  4JI3 E;  2CPN A;  3J81 C;  4AQY E;  4X8W A;  1Z5A A;  3HUL A;  4FWH A;  5LMN E;  5A2Q Q;  3JAM Q;  4JI3 I;  1HR0 I;  4DV3 E;  4DXL A;  2RSM A;  1X47 A;  4AQY I;  2HKJ A;  5BR8 I;  1IBL E;  1XNQ E;  4Z7Y A;  4DU8 A;  3F0N A;  1MG7 A;  4JI8 I;  1RQ0 A;  1X49 A;  2E5L I;  5BR8 E;  2YT4 A;  1BKN A;  3PYG A;  2LTS A;  4PU9 A;  4DR4 E;  2HK3 A;  2UUA E;  2VQE E;  3ZKD A;  1UIL A;  2V2Q A;  4OOG C;  1FNM A;  2MDR A;  1T4L B;  2UXC E;  1ZXN A;  3GON A;  2LJP A;  3J7Y p;  2GS8 A;  3Q1Q A;  4K0K I;  1OJ4 A;  3V5R A;  5IT9 C;  2LRS A;  2HKE A;  3V2U C;  4DKK A;  1HR0 E;  2ZBK B;  1WHQ A;  2DMY A;  2VQF I;  2HK2 A;  4URL A;  4HYM A;  4DR7 I;  1XMQ E;  2LUP B;  4YY3 I;  4LF4 I;  2EZ6 A;  1PVG A;  4JI8 E;  4JI5 I;  4FWG A;  5LMN I;  1VIS A;  1XHK A;  2V34 A;  3VYX A;  1NHI A;  1FJG E;  1ZM2 A;  4B3M I;  3ZZT A;  1B63 A;  2XEX A;  4DPX A;  3ZZU A;  4HXZ A;  1FI4 A;  2L2K B;  2UU9 E;  4JI7 I;  4UT4 A;  3CWV A;  4WUB A;  1Z0G A;  3T1Y I;  2RTX A;  1WUU A;  3J80 C;  1FWL A;  4PRV A;  1H73 A;  1K47 A;  4DV4 E;  2DEI A;  1N33 E;  4DR1 I;  1H7S A;  2UUA I;  4X64 E;  3LTO A;  2NA2 A;  4DV1 E;  1EKZ A;  1O0W A;  1A6F A;  3M6A A;  5LMU I;  1Z5B A;  4DR7 E;  1NHJ A;  4LFC I;  4X66 I;  5L3J A;  1YYK A;  4FN5 A;  1XNQ I;  5LMU E;  1RRE A;  3OTO I;  3C4B A;  4KQV A;  4PRX A;  4M30 A;  2LBS B;  2UUB E;  4B3R E;  1ZM3 A;  1N34 I;  2X7I A;  3T1H I;  3QT7 A;  3J7A G;  4P7A A;  1N32 I;  4LF7 E;  4EMD A;  4JYA I;  4HAC B;  1Z0V A;  4YHH I;  4RPF A;  4JV5 I;  2L33 A;  1J5E I;  2ZIT A;  1IBM E;  1S16 A;  1IBK E;  2UUC I;  1H74 A;  5IWA I;  4DV1 I;  4WUD A;  2V2V A;  2F4V E;  4HAC A;  4YHH E;  5CFF E;  2UXD E;  2B7T A;  4DR1 E;  2CZ9 A;  1IBM I;  3B82 A;  4X65 I;  4FW9 A;  4LFB I;  2DIX A;  1I94 E;  5IT9 Q;  1J26 A;  3ZM7 A;  2L3C A;  4DV7 E;  1S4E A;  2UXB I;  3T1H E;  1ZM9 A;  3D4J A;  1EI1 A;  2LUQ A;  4LF6 E;  4DV2 I;  4LFB E;  1N33 I;  4DUY I;  3WU4 A;  4R1F A;  1RC7 A;  2NUE A;  1YZ9 A;  3HTX A;  1KIJ A;  4B3S I;  4DV6 E;  2NUF A;  1IBK I;  4DV2 E;  4LF6 I;  4LFC E;  4DR6 I;  3J80 Q;  2JY9 A;  2ZM6 E;  3C4T A;  5GME A;  1J5E E;  4JI7 E;  2BV3 A;  1UEK A;  4JI2 I;  1KVK A;  1H72 C;  4DPU A;  4LF9 I;  4DV0 I;  5LL6 R;  4JI6 E;  4UTG A;  4DR5 E;  2F4V I;  3QT6 A;  3B78 A;  2X36 A;  1XNR I;  3VYY A;  1ZXM A;  2DEJ A;  4OX9 I;  4B3R I;  2LJH A;  4JI2 E;  1UHZ A;  1FWK A;  1STU A;  3LLH A;  4K0K E;  4JG4 A;  4JV5 E;  4DUZ I;  4DR5 I;  3JAM C;  2RS6 A;  1Z5C A;  4X64 I;  1T4N A;  4DU7 A;  1KKH A;  2V8P A;  4DUY E;  2L2N A;  3ADI A;  3K17 A;  3J81 Q;  1HNW E;  4DPT A;  4XTJ A;  3H4L A;  4ZVI A;  2VQE I;  4X65 E;  1N0V C;  1Z59 A;  1QZR A;  2LTR A;  1HNW I;  4DV6 I;  1X48 A;  3J7A M;  2R3V A;  4USK A;  3ZKB A;  4JI6 I;  1H7U A;  1MX0 A;  1N32 E;  2L3J A;  1YYO A;  1B62 A;  2EFG A;  4DV7 I;  4JI1 E;  2HFU A;  2V2Z A;  3QT5 A;  4LF8 E;  1NZ0 A;  2OI2 A;  3LPS A;  4LF5 E;  1D6T A;  4B3S E;  2IHR 1;  1N0U A;  2VQF E;  2RS7 A;  4Z7C A;  4NXM E;  2L2M A;  4GKK I;  3WU6 A;  2UXD I;  4LFA I;  4DUZ E;  4DR2 E;  1XMQ I;  2AJ4 A;  3ADJ A;  4WUC A;  4JI5 E;  2E1R A;  3B8H A;  2B3T B;  1I94 I;  4DV0 E;  5A2Q C;  4DR2 I;  4JI4 I;  1FJG I;  4FWD A;  4X66 E;  1HNX I;  1DAR A;  4B3T I;  4JI0 I;  4OX9 E;  1Z0W A;  3T1Y E;  1Z0C A;  4JI1 I;  3OTO E;  4DR3 E;  4LF8 I;  1XMO E;  1N36 I;  3ADG A;  1N34 E;  3PYD A;  2BM1 A;  2A2D A;  2NPF A;  4I3H A;  3K1J A;  4JYA E;  4LF7 I;  1NHH A;  4NXM I;  1HNZ I;  4P52 A;  1FKA E;  4LF5 I;  4YY3 E;  4LF4 E;  2N3H A;  4GKJ I;  1Z0T A;  1T4O A;  4DV5 E;  2UUC E;  4NXN I;  1YYW A;  2A2C A;  3LNU A;  2HHH E;  5GMD A;  3ZZ0 A;  5FLX C;  2WW4 A;  2B7V A;  2E5L E;  4X62 I;  2KHX A;  4LFA E;  1RR9 A;  3WU5 A;  4B3M E;  4JI4 E;  2UU9 I;  1KTV A;  4B3T E;  3WU3 A;  1MU5 A;  1PKP A;  1QU6 A;  2DB2 A;  2HHH I;  3P1X A;  2Q2E B;  2UUB I;  3PYF A;  4MYT A;  1Z0B A;  4DR3 I;  4JI0 E;  4GKK E;  1ZBT A;  4KHP I;  1IBL I;  2BM0 A;  1XMO I;  4HY1 A;  2HFS A;  2NUG A;  1ELO A;  5IWA E;  2VF3 A;  4DV5 I;  4DR4 I;  4KHP E;  1WHN A;  1HNX E;  2ZM6 I;  4DV3 I;  2N3G A;  1Z0E A;  2JVA A;  4USM A;  4LF9 E;  4NXN E;  4M2Z A;  3ADL A;  5FLX Q;  1XNR E;  1PIE A;  4WYQ B;  1N36 E;  4DPW A;  2UXB E;  1EA6 A;  3QT8 A;  1HNZ E;  4WFT A;  1ZM4 A;  4M1K A;  1DI2 A;  1U2R A;  1GQE A;  2J7K A;  4GKJ E;  4DV4 I;  4DPY A;  2UXC I;  3PYE A;  4DR6 E;  2R42 A; 
#chains in the Genus database with same CATH topology
 4X62 E;  4MYU A;  1SR9 A;  2YRH A;  3MHH C;  4ED4 A;  4JI3 E;  3L7Z A;  2EOZ A;  3KWR A;  2EOQ A;  2NAB A;  4F6N A;  2CPN A;  3J81 C;  4AQY E;  4X8W A;  3BID A;  1Z5A A;  1IQS A;  3PS1 A;  4ZYD A;  3HUL A;  4FWH A;  5LMN E;  2Z5C B;  5A2Q Q;  2V85 A;  3JAM Q;  2JE6 B;  2EPK X;  4MU4 A;  2JXP A;  4JI3 I;  1HR0 I;  5C0X C;  4DV3 E;  4DXL A;  3THN A;  4IFD C;  2RSM A;  2V8Q B;  1X47 A;  2PNM A;  4R2S A;  4AQY I;  3M85 G;  4MU0 A;  2HKJ A;  4Q35 B;  3F6G A;  5BR8 I;  2BA1 G;  1OYR A;  1IBL E;  1XNQ E;  5TSE A;  1USU A;  4Z7Y A;  4DU8 A;  3BGH A;  3DF6 A;  2EM0 A;  3F0N A;  2M1S A;  1X6H A;  2EPP A;  4F9C B;  4BC7 A;  1MG7 A;  4BC9 A;  3PS3 A;  4WPY A;  4JI8 I;  2E1M A;  3UHM A;  5DRR A;  3OML A;  4IFD B;  1RQ0 A;  1AH5 A;  3GLL A;  1R6M A;  1X49 A;  2C37 A;  5BR8 E;  2E5L I;  2JT2 A;  2ELZ A;  2YT4 A;  1N3G A;  2EOH A;  1BKN A;  3PYG A;  2LTS A;  1L4S A;  4PU9 A;  2EMX A;  3IWD A;  3M7N D;  4DR4 E;  2HK3 A;  2UUA E;  2IOQ A;  2EJ4 A;  2G7H A;  2VQE E;  3ZKD A;  1UIL A;  2V2Q A;  4OOG C;  4N3O A;  1SFE A;  1FNM A;  3VK6 A;  5DRP A;  2D9H A;  2MDR A;  4DMI A;  2EN4 A;  1T4L B;  4O43 A;  1NEI A;  2UXC E;  3T1Y I;  4OO1 C;  1ZXN A;  2WZO A;  5KL7 A;  1UDN A;  2F4V I;  3GON A;  2LJP A;  4NXN I;  4QNK A;  3J7Y p;  2GS8 A;  1UN6 B;  2O1V A;  3GME A;  4IZK A;  4AID A;  3Q1Q A;  4K0K I;  2EE8 A;  1OJ4 A;  3V5R A;  1KYQ A;  5IT9 C;  2LRS A;  4P78 A;  4LPF A;  2HKE A;  3V2U C;  2LVH A;  4J3D A;  5A69 A;  5A6B D;  4DKK A;  1YH8 A;  1Y60 A;  1GZ6 A;  3HPZ A;  3KZZ A;  1ZBQ A;  2BB8 A;  1HR0 E;  1IMU A;  2ZBK B;  3THO B;  1WHQ A;  2DMY A;  2BA0 G;  2VQF I;  3HPS A;  1YUI A;  5C0X B;  3BF2 A;  2EPU A;  5JEA D;  2HK2 A;  4URL A;  4R03 A;  5DNY A;  3CDJ A;  4HYM A;  4DR7 I;  5K36 F;  4OO1 F;  2WNR A;  1XMQ E;  4OZE A;  2LUP B;  2JEA A;  4YY3 I;  4LF4 I;  1PDA A;  4F54 A;  2EZ6 A;  2M4I A;  4FW6 A;  1PJT A;  4JI8 E;  5KL2 A;  1PVG A;  2EML A;  4JI5 I;  4FWG A;  5LMN I;  2K4V A;  2EMF A;  4M0V A;  4J8Z A;  1VIS A;  5C0X D;  2DSY A;  1XHK A;  2V34 A;  3VYX A;  1NHI A;  2O1W A;  5AE3 A;  1FJG E;  2EPO A;  1ZM2 A;  4B3M I;  2LCE A;  3ZZT A;  1B63 A;  2XEX A;  4DPX A;  2L6M A;  1P47 A;  4HXZ A;  3DD6 A;  4U3D A;  3ZZU A;  1FI4 A;  2L2K B;  2UU9 E;  4JI7 I;  1RHY A;  2WNR B;  4UT4 A;  1F2I G;  3CWV A;  2EMZ A;  2J7J A;  1JK2 A;  2EOS A;  2RTX A;  1Z0G A;  2HJJ A;  3UK3 C;  4WUB A;  4RH8 A;  3J80 C;  1WUU A;  2RQL A;  2IES A;  2FGG A;  2YTE A;  2FTX B;  2GPI A;  2VES A;  1A1I A;  4R2Q A;  2R1F A;  2JYA A;  1Z1B A;  1FWL A;  5DNX A;  3M99 B;  5K36 A;  4PRV A;  1H73 A;  1K47 A;  4DV4 E;  2DEI A;  4IZJ B;  4M9V C;  2EN3 A;  3B4T A;  2EPC A;  2CT1 A;  1Y4S A;  1N33 E;  4FW4 A;  2YPN A;  4BCA A;  2RPC A;  4IS9 A;  2NN6 F;  4R2A A;  4DR1 I;  1H7S A;  2UUA I;  1NCS A;  4X64 E;  2ADR A;  3LTO A;  4OO1 D;  2NA2 A;  1A1G A;  2NN6 C;  4DV1 E;  2EM9 A;  2YTD A;  5JEA F;  1EKZ A;  1O0W A;  1A6F A;  3M6A A;  5LMU I;  2YTP A;  1Z5B A;  4BHB A;  3PRY A;  4DR7 E;  3AUZ A;  1NHJ A;  4LFC I;  5AC5 A;  4X66 I;  4NBQ A;  5L3J A;  4RHB B;  4F6M A;  2EM2 A;  1BBG A;  1JK1 A;  1YYK A;  2C38 B;  4FN5 A;  2EOR A;  3HQ1 A;  4X9J A;  4R2R A;  1XNQ I;  2LO3 A;  4FW3 A;  5LMU E;  4R8O A;  1RRE A;  4MU1 A;  3OTO I;  3C4B A;  4KQV A;  4PRX A;  1UDS A;  4M30 A;  5KL5 A;  1P42 A;  2LBS B;  2GHF A;  2L8T A;  2YZT A;  2UUB E;  4B3R E;  1ZM3 A;  2EN8 A;  2F1D A;  2X7I A;  4QNJ A;  1N34 I;  3T1H I;  2I9I A;  3QT7 A;  3J7A G;  4P7A A;  2EM7 A;  1LLM C;  1N32 I;  2IER A;  5IXM B;  5KL3 A;  4LF7 E;  4EMD A;  4IFD D;  4JYA I;  2EPN A;  4HAC B;  2JEA B;  3F6H A;  5IV8 B;  1Z0V A;  4MDT A;  4RPF A;  5C0X E;  4YHH I;  4IFD E;  4JV5 I;  2JOX A;  2L33 A;  2PNZ B;  2KON A;  2PO0 A;  1J5E I;  2EM4 A;  2ZIT A;  1YPN A;  2GQ0 A;  1IBM E;  1S16 A;  2YRM A;  1IBK E;  1UDO A;  2UUC I;  2YWQ A;  1H74 A;  3EPL A;  2JE6 A;  2GO4 A;  5IWA I;  4Q28 A;  2L92 A;  4MLQ A;  4WUD A;  4DV1 I;  2V2V A;  1X3C A;  2F4V E;  4HAC A;  4YHH E;  2EOX A;  2EQ0 A;  5CFF E;  4BBY A;  2EOI A;  4IFD F;  2EPZ A;  1A1J A;  2B7T A;  2EM5 A;  2UXD E;  2BA0 D;  3P3E A;  4ISA A;  2EN2 A;  4DR1 E;  3P06 A;  2EOJ A;  2CZ9 A;  1IBM I;  3B82 A;  1DQ3 A;  4X65 I;  4FW9 A;  1WRJ A;  2ENH A;  4LFB I;  5T6J A;  4NZV A;  2DIX A;  2M9A A;  4LU9 A;  1I94 E;  2JPA A;  5IT9 Q;  1J26 A;  1E3P A;  2L3C A;  2J65 A;  3ZM7 A;  4DV7 E;  2C38 A;  1S4E A;  4ZYE A;  2UXB I;  3T1H E;  2JWO A;  5A6A A;  2K7I A;  1ZM9 A;  3D4J A;  1EI1 A;  5JEA A;  2LUQ A;  4LF6 E;  4DV2 I;  2R76 A;  4LFB E;  4HTG A;  2EPM X;  1YHC A;  1N33 I;  4LTY A;  3WU4 A;  4DUY I;  1YSA C;  3U1Y A;  4R1F A;  1MGT A;  2H36 X;  3ZOQ B;  4WSP A;  2V87 A;  1RC7 A;  2NUE A;  2N8X A;  4IFD A;  1YZ9 A;  3HTX A;  1KIJ A;  2GO3 A;  5C0X A;  4B3S I;  2LMZ A;  3EPK A;  4DV6 E;  2NUF A;  1IBK I;  4DV2 E;  4LF6 I;  1WJP A;  4LFC E;  1ZAA C;  4DR6 I;  3J80 Q;  2JY9 A;  2ZM6 E;  4O4K A;  2PO2 B;  2YTJ A;  2ENA A;  3EPH A;  1KJK A;  3C4T A;  3HJC A;  5GME A;  2GLI A;  1J5E E;  4JI7 E;  2BV3 A;  5EKW A;  1UEK A;  2EN1 A;  4JI2 I;  1KVK A;  1H72 C;  4DPU A;  5K36 B;  3PS2 A;  4LF9 I;  1QNT A;  4DV0 I;  5LL6 R;  4JI6 E;  2YU8 A;  4DR5 E;  3Q6M A;  4LCF A;  2E72 A;  4UTG A;  3TQM A;  4BS9 A;  3B78 A;  3QT6 A;  2X36 A;  1XNR I;  3VYY A;  1ZXM A;  2LT7 A;  2VF1 A;  2C39 B;  2DEJ A;  3EPJ A;  4OX9 I;  2LJH A;  4B3R I;  2ENC A;  4JI2 E;  2PNZ A;  2BR2 A;  2Z5B B;  3HKM A;  1UHZ A;  1FWK A;  1STU A;  3LLH A;  4K0K E;  4BHC A;  3L00 A;  2CTD A;  2JR1 A;  3LML A;  4JV5 E;  4JG4 A;  3U1K A;  4L5N C;  1Y5Y A;  4DUZ I;  4DR5 I;  3JAM C;  1PJQ A;  2RS6 A;  2YTN A;  1Z5C A;  4X64 I;  1T4N A;  2JEB B;  4OO1 A;  1Y6Z A;  4DU7 A;  1KKH A;  2V8P A;  2EPR A;  2WCC 3;  4DUY E;  2YTG A;  2L2N A;  2V88 A;  3ADI A;  3K17 A;  3J81 Q;  1BB8 A;  1X5W A;  1HNW E;  3VHT B;  5A6J A;  3MHS C;  4DPT A;  1EH7 A;  4XTJ A;  1EH8 A;  2EMC A;  2V89 A;  5K36 E;  3H4L A;  4ZVI A;  2YU5 A;  5LLQ A;  2BBG A;  2VQE I;  5K36 D;  4X65 E;  1N0V C;  2Q8U A;  2CVE A;  1Z59 A;  2VE7 C;  3CDI A;  4MQY A;  1QZR A;  2LTR A;  2M7Q A;  4AM3 A;  1HNW I;  1DGC A;  4DV6 I;  2AE8 A;  4NHR A;  1PJS A;  1X48 A;  3Q6N A;  3J7A M;  2R3V A;  2EMA A;  1AAY A;  2PNL A;  4R2D A;  1TF3 A;  4USK A;  3ZKB A;  4JI6 I;  2EMI A;  2NN6 E;  1H7U A;  3K85 A;  1MX0 A;  1N32 E;  1HK7 A;  2L3J A;  1YYO A;  2KOU A;  4LCG A;  4WXC A;  1B62 A;  2EFG A;  2PO0 B;  2EM3 A;  4DV7 I;  4BA1 A;  1G2F C;  4JI1 E;  2HFU A;  2V2Z A;  2DLK A;  2EL6 A;  2YSP A;  2YTI A;  4R2P A;  2O3Z A;  3QT5 A;  5DRO A;  4LF8 E;  2ODR D;  1NZ0 A;  2OI2 A;  5C0X F;  3LPS A;  2EPL X;  4LF5 E;  2EOO A;  4R2C A;  3M7N G;  2EOF A;  5DRQ A;  4BA2 A;  1D6T A;  4IZJ A;  3GCM A;  4B3S E;  1OYP A;  2IHR 1;  1N0U A;  2VQF E;  2RS7 A;  4Z7C A;  3FIG A;  4NXM E;  2F8B A;  2L2M A;  2LV2 A;  2MKD A;  2PRT A;  4GKK I;  3WU6 A;  1B69 A;  2UXD I;  1X6F A;  4LFA I;  2FV4 B;  4DUZ E;  4DR2 E;  2MC5 A;  1ZR9 A;  1XMQ I;  3KRN A;  1ZU1 A;  2AJ4 A;  3ADJ A;  2A25 A;  4WXD A;  3AV0 A;  4WUC A;  4JI5 E;  2E1R A;  2JEB A;  3B8H A;  4OO1 B;  2B3T B;  2WP8 A;  4F9A B;  2EMB A;  1I94 I;  2EN6 A;  5A6B A;  1T38 A;  5A2Q C;  4DV0 E;  4DR2 I;  2EM6 A;  4JI4 I;  1GTK A;  2EMW A;  1FJG I;  4FWD A;  4X66 E;  2BR2 B;  1HNX I;  2Z5B A;  1DAR A;  5DNL A;  2WBT A;  2RSI A;  4B3T I;  4JI0 I;  4OX9 E;  1Z0W A;  3T1Y E;  1T39 A;  4L8N A;  4FW5 A;  2B9D A;  1Z0C A;  3P76 A;  3JTZ A;  1UDQ A;  4JI1 I;  3OTO E;  2YTO A;  1EH6 A;  4O5G A;  2EL5 A;  4DR3 E;  1YFH A;  1XMO E;  1N36 I;  4LF8 I;  3ADG A;  4HEI A;  3M85 D;  1N34 E;  3PYD A;  1A1F A;  3HXL A;  4KZS A;  2BM1 A;  2A2D A;  2NPF A;  1YUJ A;  4I3H A;  3EQ1 A;  4LCH A;  2EMY A;  1A1L A;  3K1J A;  3IWB A;  4JYA E;  1NHH A;  4LF7 I;  2DMI A;  4NXM I;  2WBU A;  2LE2 A;  1MEY C;  5AAS A;  5F3W A;  1HNZ I;  4P52 A;  2MKN A;  2YSO A;  1FKA E;  2EL4 A;  4YY3 E;  1TF6 A;  4LF4 E;  4LF5 I;  2N3H A;  2I13 A;  2DLQ A;  5ELW A;  4GKJ I;  4R2E A;  1Z0T A;  4MLV A;  2IOP A;  5JEA E;  1T4O A;  4DV5 E;  4IS1 C;  5FLX C;  2UUC E;  4TUG A;  1YYW A;  2A2C A;  2HHH E;  2CG9 A;  2NN6 B;  3LNU A;  5GMD A;  3NZK A;  3ZZ0 A;  2WW4 A;  2B7V A;  2E5L E;  4OKG A;  2KHX A;  4X62 I;  2BA1 D;  4LFA E;  2EMG A;  4LOM A;  3H09 A;  1RR9 A;  4P7D A;  2JP9 A;  3WU5 A;  5FWK A;  2PO1 A;  4B3M E;  4JI4 E;  4TUI A;  2WBS A;  4GZN C;  3KZY A;  2UU9 I;  1VI7 A;  4ZYG A;  1KTV A;  4B3T E;  3WU3 A;  1MU5 A;  1PKP A;  1QU6 A;  1Y4U A;  2DB2 A;  2HHH I;  5EL9 A;  3P1X A;  2ELY A;  2Q2E B;  1BBO A;  1R6L A;  2UUB I;  2YTQ A;  3PYF A;  2WP8 B;  4MYT A;  1Z0B A;  4GQU A;  2EWL A;  3MSW A;  5JEA C;  4AIM A;  2DRP A;  4DR3 I;  2LJU A;  3IWC A;  4JI0 E;  4KWY A;  2EM8 A;  4FK5 C;  4GKK E;  4WX9 A;  1ZBT A;  1RMD A;  2MC6 A;  2VRD A;  2EN7 A;  3K6Q A;  1E3H A;  4U3B A;  2C39 A;  3C6M A;  3DJW A;  1X6E A;  3H1C A;  4KHP I;  2EMK A;  5KL4 A;  1IBL I;  5KL6 A;  2O1T A;  2BM0 A;  1XMO I;  3RMP A;  4HY1 A;  2JOB A;  2V86 A;  4I8O A;  2HFS A;  2Z5C A;  4IZK B;  4IJD A;  1A1H A;  1IQO A;  3P3G A;  1TN9 A;  4GEQ B;  2NUG A;  1ELO A;  3ECR A;  5IWA E;  2VF3 A;  2EPA A;  4DV5 I;  2EQ3 A;  4BA2 B;  4DR4 I;  3C6K A;  4F2J C;  4KHP E;  1WHN A;  2YRK A;  1HNX E;  2ZM6 I;  2MDG A;  1WXR A;  2PO2 A;  4OO1 E;  4DV3 I;  2N3G A;  2YTF A;  1Z0E A;  4BA1 B;  3L7Z B;  2JVA A;  5AE2 A;  1A1K A;  4USM A;  4LF9 E;  2CSH A;  2EPX A;  4NXN E;  2Z5E A;  5K36 C;  5A6K A;  4M2Z A;  1XXE A;  2EMH A;  2EQ1 A;  3ADL A;  4ZYH A;  1USV A;  5FLX Q;  1XNR E;  1PIE A;  5ADZ A;  2HGH A;  4WYQ B;  1N36 E;  3P3C A;  4DPW A;  2UXB E;  2EOE A;  2EOY A;  1EA6 A;  3QT8 A;  1HNZ E;  2CGE A;  4WFT A;  2V83 A;  3QG5 C;  1ZM4 A;  4M1K A;  1G2D C;  2NN6 D;  2NN6 A;  1OYS A;  2EOM A;  4FW7 A;  4IZJ D;  5JEA B;  4N4R B;  2HC5 A;  4BMJ A;  5AC4 A;  1DI2 A;  1U2R A;  2C37 B;  2DGC A;  2ODR C;  1UBD C;  1GQE A;  4WSG A;  2J7K A;  4GKJ E;  4MU3 A;  4DV4 I;  5AE1 A;  4DPY A;  2O1U A;  2UXC I;  4O24 A;  3BBG A;  3PYE A;  4F9B B;  4DR6 E;  2PO1 B;  2EP3 A;  2R42 A;  3JU0 A; 
#chains in the Genus database with same CATH homology
 4X62 E;  4MYU A;  1SR9 A;  4ED4 A;  4JI3 E;  3KWR A;  2CPN A;  3J81 C;  4AQY E;  4X8W A;  1Z5A A;  3HUL A;  4FWH A;  5LMN E;  2Z5C B;  5A2Q Q;  2V85 A;  3JAM Q;  4JI3 I;  1HR0 I;  4DV3 E;  4DXL A;  2RSM A;  2V8Q B;  1X47 A;  2PNM A;  4AQY I;  2HKJ A;  3F6G A;  5BR8 I;  1IBL E;  1XNQ E;  1USU A;  4Z7Y A;  4DU8 A;  3DF6 A;  3F0N A;  2M1S A;  4F9C B;  1MG7 A;  4BC7 A;  4BC9 A;  4WPY A;  4JI8 I;  2E1M A;  3OML A;  1RQ0 A;  1X49 A;  2E5L I;  5BR8 E;  2YT4 A;  1BKN A;  3PYG A;  2LTS A;  4PU9 A;  3IWD A;  4DR4 E;  2HK3 A;  2UUA E;  2IOQ A;  2G7H A;  2VQE E;  3ZKD A;  1UIL A;  2V2Q A;  4OOG C;  4N3O A;  1FNM A;  3VK6 A;  2MDR A;  4DMI A;  1T4L B;  2UXC E;  1ZXN A;  2WZO A;  3GON A;  2LJP A;  3J7Y p;  2GS8 A;  2O1V A;  4IZK A;  3Q1Q A;  4K0K I;  1OJ4 A;  3V5R A;  5IT9 C;  2LRS A;  4P78 A;  2HKE A;  3V2U C;  4DKK A;  1GZ6 A;  3HPZ A;  1HR0 E;  1ZBQ A;  2ZBK B;  1WHQ A;  2DMY A;  2VQF I;  3HPS A;  2HK2 A;  4URL A;  4R03 A;  5DNY A;  4HYM A;  4DR7 I;  1XMQ E;  2LUP B;  4YY3 I;  4LF4 I;  4F54 A;  2EZ6 A;  2M4I A;  1PVG A;  4JI8 E;  4JI5 I;  4FWG A;  5LMN I;  2K4V A;  4M0V A;  4J8Z A;  1VIS A;  2DSY A;  1XHK A;  2V34 A;  3VYX A;  1NHI A;  2O1W A;  5AE3 A;  1FJG E;  1ZM2 A;  4B3M I;  3ZZT A;  1B63 A;  2XEX A;  4DPX A;  2L6M A;  3ZZU A;  4HXZ A;  1FI4 A;  2L2K B;  2UU9 E;  4JI7 I;  4UT4 A;  3CWV A;  4WUB A;  1Z0G A;  3T1Y I;  2RTX A;  1WUU A;  3J80 C;  2FGG A;  2FTX B;  1FWL A;  4PRV A;  1H73 A;  1K47 A;  4DV4 E;  2DEI A;  4IZJ B;  1Y4S A;  1N33 E;  4BCA A;  4DR1 I;  1H7S A;  2UUA I;  4X64 E;  3LTO A;  2NA2 A;  4DV1 E;  1EKZ A;  1O0W A;  1A6F A;  3M6A A;  5LMU I;  1Z5B A;  3PRY A;  4DR7 E;  3AUZ A;  1NHJ A;  4LFC I;  4X66 I;  5L3J A;  1YYK A;  4FN5 A;  3HQ1 A;  1XNQ I;  5LMU E;  4R8O A;  1RRE A;  3OTO I;  3C4B A;  4KQV A;  4PRX A;  4M30 A;  2LBS B;  2L8T A;  2YZT A;  2UUB E;  4B3R E;  1ZM3 A;  1N34 I;  2X7I A;  3T1H I;  3QT7 A;  3J7A G;  4P7A A;  1N32 I;  4LF7 E;  4EMD A;  4JYA I;  4HAC B;  3F6H A;  1Z0V A;  4RPF A;  4YHH I;  4JV5 I;  2JOX A;  2L33 A;  2KON A;  1J5E I;  2ZIT A;  2GQ0 A;  1IBM E;  1S16 A;  1IBK E;  2UUC I;  1H74 A;  5IWA I;  4Q28 A;  2L92 A;  4WUD A;  4DV1 I;  2V2V A;  2F4V E;  4HAC A;  4YHH E;  5CFF E;  4BBY A;  2UXD E;  2B7T A;  4DR1 E;  3P06 A;  2CZ9 A;  1IBM I;  3B82 A;  1DQ3 A;  4X65 I;  4FW9 A;  4LFB I;  5T6J A;  2DIX A;  4LU9 A;  1I94 E;  5IT9 Q;  1J26 A;  3ZM7 A;  2L3C A;  4DV7 E;  1S4E A;  2UXB I;  3T1H E;  2JWO A;  1ZM9 A;  3D4J A;  1EI1 A;  2LUQ A;  4LF6 E;  4DV2 I;  4LFB E;  1N33 I;  4LTY A;  3WU4 A;  4DUY I;  4R1F A;  2H36 X;  3ZOQ B;  1RC7 A;  4WSP A;  2V87 A;  2NUE A;  1YZ9 A;  3HTX A;  1KIJ A;  4B3S I;  2LMZ A;  4DV6 E;  2NUF A;  1IBK I;  4DV2 E;  4LF6 I;  4LFC E;  4DR6 I;  3J80 Q;  2ZM6 E;  2JY9 A;  3C4T A;  3HJC A;  5GME A;  1J5E E;  4JI7 E;  2BV3 A;  1UEK A;  4JI2 I;  1KVK A;  1H72 C;  4DPU A;  4LF9 I;  4DV0 I;  5LL6 R;  4JI6 E;  3Q6M A;  4DR5 E;  4UTG A;  2F4V I;  3QT6 A;  4BS9 A;  3B78 A;  2X36 A;  1XNR I;  3VYY A;  1ZXM A;  2VF1 A;  2DEJ A;  4OX9 I;  4B3R I;  2LJH A;  4JI2 E;  2Z5B B;  1UHZ A;  1FWK A;  1STU A;  3LLH A;  4K0K E;  2JR1 A;  3LML A;  4JV5 E;  4JG4 A;  4L5N C;  4DUZ I;  4DR5 I;  3JAM C;  2RS6 A;  1Z5C A;  4X64 I;  1T4N A;  4DU7 A;  1Y6Z A;  1KKH A;  2V8P A;  4DUY E;  2L2N A;  2V88 A;  3ADI A;  3K17 A;  3J81 Q;  1HNW E;  4DPT A;  4XTJ A;  2V89 A;  3H4L A;  4ZVI A;  2VQE I;  4X65 E;  1N0V C;  1Z59 A;  2VE7 C;  1QZR A;  2LTR A;  2M7Q A;  1HNW I;  4DV6 I;  1X48 A;  3Q6N A;  3J7A M;  2R3V A;  2PNL A;  4USK A;  3ZKB A;  4JI6 I;  1H7U A;  3K85 A;  1MX0 A;  1N32 E;  1HK7 A;  2L3J A;  1YYO A;  2KOU A;  1B62 A;  2EFG A;  4DV7 I;  4JI1 E;  2HFU A;  2V2Z A;  3QT5 A;  4LF8 E;  2ODR D;  1NZ0 A;  2OI2 A;  3LPS A;  4LF5 E;  1D6T A;  4IZJ A;  4B3S E;  2IHR 1;  1N0U A;  2VQF E;  2RS7 A;  4Z7C A;  3FIG A;  4NXM E;  2F8B A;  2L2M A;  4GKK I;  3WU6 A;  2UXD I;  4LFA I;  2FV4 B;  4DUZ E;  4DR2 E;  2MC5 A;  1XMQ I;  2AJ4 A;  3ADJ A;  4WUC A;  3AV0 A;  4JI5 E;  2E1R A;  3B8H A;  2B3T B;  4F9A B;  1I94 I;  5A2Q C;  4DV0 E;  4DR2 I;  4JI4 I;  1FJG I;  4FWD A;  4X66 E;  1HNX I;  2Z5B A;  1DAR A;  4B3T I;  4JI0 I;  4OX9 E;  1Z0W A;  3T1Y E;  4L8N A;  2B9D A;  1Z0C A;  3JTZ A;  4JI1 I;  3OTO E;  4DR3 E;  4LF8 I;  1XMO E;  1N36 I;  3ADG A;  1N34 E;  3PYD A;  3HXL A;  4KZS A;  2BM1 A;  2A2D A;  2NPF A;  4I3H A;  3K1J A;  3IWB A;  4JYA E;  1NHH A;  4LF7 I;  4NXM I;  2LE2 A;  5AAS A;  5F3W A;  1HNZ I;  4P52 A;  1FKA E;  4LF5 I;  4YY3 E;  4LF4 E;  2N3H A;  4GKJ I;  1Z0T A;  2IOP A;  1T4O A;  4DV5 E;  5FLX C;  2UUC E;  4TUG A;  1YYW A;  2A2C A;  2HHH E;  2CG9 A;  3LNU A;  5GMD A;  4NXN I;  3ZZ0 A;  2WW4 A;  2B7V A;  2E5L E;  4X62 I;  2KHX A;  4LFA E;  3H09 A;  1RR9 A;  4P7D A;  3WU5 A;  5FWK A;  4B3M E;  4JI4 E;  4TUI A;  2UU9 I;  1KTV A;  4B3T E;  3WU3 A;  1MU5 A;  1PKP A;  1QU6 A;  1Y4U A;  2DB2 A;  2HHH I;  3P1X A;  2Q2E B;  2UUB I;  3PYF A;  4MYT A;  1Z0B A;  4DR3 I;  2EWL A;  3MSW A;  3IWC A;  4JI0 E;  4GKK E;  1ZBT A;  2MC6 A;  3K6Q A;  3DJW A;  4KHP I;  1IBL I;  2O1T A;  2BM0 A;  1XMO I;  3RMP A;  4HY1 A;  2JOB A;  2V86 A;  4I8O A;  2HFS A;  2Z5C A;  4IZK B;  4GEQ B;  2NUG A;  1ELO A;  5IWA E;  2VF3 A;  4DV5 I;  4DR4 I;  4KHP E;  1WHN A;  1HNX E;  2ZM6 I;  1WXR A;  4DV3 I;  2N3G A;  1Z0E A;  2JVA A;  5AE2 A;  4USM A;  4LF9 E;  4NXN E;  2Z5E A;  4M2Z A;  3ADL A;  1USV A;  5FLX Q;  1XNR E;  1PIE A;  5ADZ A;  4WYQ B;  1N36 E;  4DPW A;  2UXB E;  1EA6 A;  3QT8 A;  1HNZ E;  2CGE A;  4WFT A;  2V83 A;  1ZM4 A;  4M1K A;  4IZJ D;  4BMJ A;  1DI2 A;  1U2R A;  2ODR C;  1GQE A;  2J7K A;  4GKJ E;  4DV4 I;  5AE1 A;  4DPY A;  2O1U A;  2UXC I;  3PYE A;  4F9B B;  4DR6 E;  2R42 A;  3JU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...