4LF8E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf8E02
4LF8E 4ZVIA 5IWAE 1GQEA 2RSMA 2IHR1 1Z5AA 4PRVA 1HNZE 4DPWA 1IBLI 5LMNI 4NXME 2NPFA 1BKNA 4WUDA 1IBMI 4DR4I 1STUA 1RC7A 4DUZE 2HKEA 1H7UA 3T1HI 1MX0A 4USMA 4LFCI 1FWLA 2GS8A 2CPNA 2UUCI 4JI6E 3PYFA 2V2VA 4DU8A 1U2RA 2A2CA 5GMEA 4DR2E 3LPSA 4DR1I 4JI3I 1IBKI 2DEIA 3K1JA 1N0VC 1N33I 4DR3E 4AQYI 3QT8A 3B82A 5GMDA 2UXDI 2B3TB 4DV1E 2N3HA 2HHHE 3J81Q 4JI7I 2LTSA 1S4EA 4NXNE 4DV0I 5IT9Q 2ZBKB 1N34I 4HYMA 2V2ZA 1FWKA 1RREA 5FLXC 1T4OA 3QT5A 1I94I 4JYAI 5LMUE 1XMQE 3T1YI 4LFBI 4DV5E 3ZZTA 2LTRA 2F4VI 4KQVA 4LF5E 1RR9A 4DUYI 4K0KE 1NHIA 1FJGI 3J7Yp 3J80C 4DR7I 4DR6I 2CZ9A 4P7AA 4JI1I 2HK3A 1K47A 4KHPE 1HNWE 5CFFE 4M1KA 1EI1A 1XHKA 2LBSB 4B3RI 4R1FA 1D6TA 2LJPA 4MYTA 2HKJA 4GKJI 4RPFA 3LNUA 2VQFI 3ZM7A 4WUCA 4JI8I 2J7KA 4XTJA 2HK2A 3WU6A 1Z59A 1PIEA 2L2MA 2NA2A 1YYWA 3F0NA 2L33A 4JI0E 4JI4E 1XMOI 1O0WA 1ZBTA 5A2QC 2EFGA 4YHHE 1B63A 4DPYA 2UXBI 2X7IA 2L3CA 1J5EI 2X36A 2AJ4A 1XNRE 1NZ0A 4LF8I 3J81C 5IWAI 3GONA 2ZITA 1HNZI 4LFAE 4NXMI 4HACA 4DV2E 4DV4E 4USKA 2VQEE 4DKKA 2L3JA 1KKHA 4DUZI 1X48A 1XNQE 2WW4A 4X65E 1PVGA 1ZM3A 3PYGA 1A6FA 4DPXA 4DPTA 4JI6I 1B62A 2V34A 4DR2I 3OTOE 2UXCE 2E5LE 5BR8E 2UUAE 2RS7A 3JAMC 3ZZ0A 4LF7E 1VISA 2V8PA 2NUFA 4Z7CA 2MDRA 2ZM6E 1MU5A 1MG7A 3ADJA 4DR3I 3K17A 3B8HA 3VYYA 3H4LA 5L3JA 4DV1I 2HHHI 4NXNI 4WUBA 2LJHA 4B3TE 1HNXE 4FW9A 1FNMA 4DR5E 1N32E 3M6AA 2L2NA 4PU9A 2LRSA 1QZRA 3QT7A 5LMUI 3D4JA 1XMQI 4DV5I 2VF3A 4FN5A 2YT4A 2LUQA 4DV7E 4X66E 4LF5I 4JI5E 4HACB 4GKKE 4DV3E 4K0KI 4OX9E 2UU9E 2R3VA 1Z0VA 1Z0EA 2HFSA 4FWGA 2L2KB 3V2UC 4DPUA 4KHPI 2NUGA 1HNWI 4UTGA 4JG4A 4HY1A 2UUBE 4YY3E 4DV6E 1ZM9A 4X62E 4LF9E 4FWHA 1ELOA 1N36E 3ADGA 4JV5E 3WU4A 1WHQA 4HXZA 3QT6A 4B3SE 2RS6A 4ED4A 4B3ME 4LF6E 1HR0E 1KVKA 4EMDA 1FKAE 4JI2E 2BM0A 3C4TA 1QU6A 2JVAA 3ADLA 4JI0I 4JI4I 2BV3A 3PYDA 4YHHI 1OJ4A 4M30A 1ZXMA 1KTVA 1Z5BA 3Q1QA 4X64E 5IT9C 3VYXA 1XNRI 1Z5CA 1RQ0A 4LF4E 4DXLA 4LFAI 1H74A 4DV2I 4DV4I 2VQEI 4P52A 1IBLE 4WYQB 5LMNE 1XNQI 1H72C 2B7TA 5LL6R 4X65I 1IBME 2V2QA 4DR4E 2OI2A 1Z0GA 1N0UA 2RTXA 1X47A 3HULA 3T1HE 1UHZA 4LFCE 3WU5A 3OTOI 3LTOA 2UUCE 2UXCI 2E5LI 5BR8I 2UUAI 4LF7I 3J7AM 4DR1E 2JY9A 4JI3E 4Z7YA 2ZM6I 3B78A 3HTXA 1IBKE 4X8WA 3V5RA 4I3HA 5A2QQ 4UT4A 2DEJA 1N33E 3C4BA 1H73A 4AQYE 1Z0CA 1H7SA 1Z0TA 4B3TI 1HNXI 1UEKA 3WU3A 2UXDE 4DU7A 4M2ZA 4JI7E 3ADIA 4DR5I 1N32I 3LLHA 2DB2A 4DV0E 1Z0WA 1PKPA 1X49A 1N34E 1YYOA 4OOGC 1S16A 1WHNA 1I94E 4JYAE 1EA6A 4PRXA 1ZM4A 3T1YE 4LFBE 4DV7I 3ZKDA 4X66I 4JI5I 4GKKI 4DV3I 2F4VE 4OX9I 2DIXA 2LUPB 2UU9I 2BM1A 4DUYE 1Z0BA 1FJGE 2Q2EB 2NUEA 2UUBI 4DR7E 4YY3I 4DR6E 3JAMQ 4JI1E 2XEXA 4DV6I 4X62I 1FI4A 4LF9I 2R42A 1N36I 2KHXA 4JV5I 3P1XA 1EKZA 2B7VA 1J26A 1NHJA 4B3RE 2EZ6A 4B3SI 4MYUA 1KIJA 4B3MI 4LF6I 4GKJE 1DI2A 1HR0I 4WFTA 2VQFE 5FLXQ 1T4NA 1T4LB 3J7AG 4JI8E 4JI2I 2A2DA 1ZXNA 1ZM2A 1YZ9A 2HFUA 3ZZUA 3PYEA 1NHHA 2N3GA 1DARA 1XMOE 1UILA 3J80Q 4X64I 2DMYA 2UXBE 1WUUA 4URLA 1J5EE 4LF4I 4FWDA 3CWVA 2E1RA 3ZKBA 1YYKA
chains in the Genus database with same CATH superfamily
2EPMX 4LF8E 4ZVIA 5IWAE 1GQEA 2RSMA 2YRMA 2CT1A 2IHR1 4BA2B 4IFDC 1Z5AA 4PRVA 1HNZE 5KL2A 2PNLA 4DPWA 2EORA 5DRRA 5LMNI 1IBLI 4FW5A 2DLKA 4DMIA 3EPLA 4NXME 1BKNA 2Z5EA 4WUDA 2NPFA 2HC5A 4MU4A 1IBMI 4KWYA 5FWKA 2EOIA 4DR4I 2GLIA 2EM3A 2K4VA 1STUA 1RC7A 4DUZE 2EOQA 2HKEA 1EH6A 2EN8A 1H7UA 2YZTA 2PNZA 3T1HI 1MX0A 4USMA 4LFCI 2BR2A 4IJDA 3DF6A 2CSHA 1FWLA 2CPNA 2GS8A 5K36F 2UUCI 3M85D 4JI6E 1IQOA 2V2VA 3PYFA 4MU1A 5EL9A 4DU8A 3HPZA 2GHFA 1U2RA 2A2CA 4BA1B 4IS9A 3P3GA 5GMEA 1SR9A 3AUZA 4DR2E 4N4RB 4R2AA 3LPSA 2V89A 2JE6A 4NBQA 4MU3A 2EPNA 2HJJA 4DR1I 1X6HA 4JI3I 1YH8A 1LLMC 3MSWA 1IBKI 2ODRC 1X6EA 2DEIA 2VE7C 3K1JA 1N0VC 4RHBB 4DR3E 5C0XA 4IFDF 1N33I 1Y5YA 4AQYI 5EKWA 3QT8A 5K36B 3KRNA 4R2RA 3B82A 1IQSA 5GMDA 2UXDI 4LU9A 5JEAC 2B3TB 2EM0A 2N3HA 4DV1E 1A1IA 4WSGA 2HHHE 3L7ZB 2LTSA 1S4EA 3J81Q 4NXNE 4JI7I 3HPSA 4DV0I 5IT9Q 2ZBKB 2EPAA 3BIDA 1PJSA 2EOJA 3MHHC 2NN6F 1N34I 4FW7A 2KONA 4HYMA 2Z5CA 1YHCA 2V2ZA 2YTFA 1YSAC 5FLXC 1FWKA 1T4OA 4ZYEA 1RREA 3QT5A 3F6HA 2O1WA 3DD6A 1I94I 4JYAI 2Q8UA 2EJ4A 3Q6NA 5LMUE 3EPKA 2FTXB 4OO1A 2ODRD 4WPYA 1XMQE 5JEAB 2JEBA 3T1YI 4IFDB 4DV5E 4LFBI 4MU0A 3HKMA 2I9IA 1Z1BA 2LCEA 2HGHA 3ZZTA 1TF6A 4U3DA 5AASA 4BA2A 2LTRA 2F4VI 5KL3A 4KQVA 4MQYA 2EPCA 4R03A 4LF5E 5A6JA 1RR9A 2EPKX 4DUYI 1ZU1A 2ENCA 1B69A 4K0KE 1NHIA 2JP9A 4O4KA 5JEAD 4IFDD 1FJGI 4HTGA 2EQ0A 3VHTB 2BA0G 3J80C 3J7Yp 2PNZB 4DR7I 4Q28A 4DR6I 1E3HA 1PJQA 2CZ9A 5C0XF 1BBOA 4R8OA 2BR2B 4P7AA 4JI1I 1Y4UA 2HK3A 1K47A 4KHPE 2EMGA 1HNWE 2ELYA 1T38A 4WXCA 2VRDA 5C0XC 5CFFE 4M1KA 1EI1A 2EN6A 2JE6B 1XHKA 3F6GA 2LBSB 4B3RI 4R1FA 1D6TA 2LJPA 4O5GA 1YUIA 2EN3A 2EN7A 4MYTA 2HKJA 1BBGA 3P06A 4O24A 4GKJI 2MKNA 1OYSA 4RPFA 3LNUA 2VQFI 1A1LA 4OO1F 2WZOA 3ZM7A 4WUCA 5C0XB 1DGCA 2EPUA 4JI8I 2LE2A 2J7KA 4XTJA 2HK2A 3WU6A 1Z59A 3M7NG 4OO1C 2IERA 1NEIA 1ZR9A 4F9AB 1PIEA 2O3ZA 2M7QA 2EPZA 2L2MA 1IMUA 2NA2A 1YYWA 5ADZA 4F2JC 3F0NA 2L33A 2JOBA 2JPAA 2Z5CB 2B9DA 5C0XD 5K36E 3C6KA 2V86A 1SFEA 2EMYA 4JI0E 4JI4E 2EMAA 1O0WA 2AE8A 3P76A 2EOEA 1ZBTA 5A2QC 3ECRA 2WNRA 2L8TA 5KL5A 2YTPA 2DGCA 3L00A 4OO1B 2JEBB 2EFGA 4YHHE 1B63A 4DPYA 4R2QA 1QNTA 2X7IA 2V83A 2UXBI 2LT7A 2L3CA 1J5EI 2CGEA 2X36A 2BA1D 4WXDA 5IV8B 2AJ4A 2BA1G 1X5WA 1XNRE 1NZ0A 4LF8I 3J81C 5IWAI 2PRTA 5A6KA 2C38A 1L4SA 4OO1D 3OMLA 3GONA 2ZITA 1HNZI 4IFDE 4LCHA 2EMHA 2LO3A 4LFAE 4NXMI 2GO4A 2EPOA 2JWOA 2YRKA 3EPJA 4HACA 4DV2E 4DV4E 4USKA 1Y4SA 2VQEE 3P3EA 2WCC3 4DKKA 4R2PA 1TF3A 1ZAAC 2V8QB 2L3JA 1KKHA 4DUZI 1X48A 4TUGA 5K36D 2EOZA 1XNQE 2WW4A 2A25A 4X65E 1PVGA 2L6MA 2LVHA 2NN6E 5AE3A 2YSPA 2M1SA 1ZM3A 3PYGA 1A6FA 4DPXA 2EMFA 4DPTA 3DJWA 1B62A 2V34A 4JI6I 2EOSA 1WRJA 2EM8A 4DR2I 3H1CA 2O1VA 2LJUA 3OTOE 3THNA 2UXCE 2E5LE 5BR8E 3AV0A 2RS7A 2UUAE 3JAMC 2V87A 1G2DC 4LF7E 2CVEA 1VISA 3K85A 4WSPA 3CDJA 3GLLA 3ZZ0A 2V8PA 2NUFA 5LLQA 5JEAF 3IWCA 1UDQA 4Z7CA 2F8BA 2MDRA 2EOMA 5KL6A 2ZM6E 5AC4A 1MG7A 1MU5A 3HQ1A 3JU0A 1USUA 3ADJA 2GO3A 4DR3I 3K17A 2NABA 3B8HA 2YU5A 3VYYA 1YPNA 3H4LA 2YWQA 4LTYA 2PO1A 5L3JA 4NZVA 2EOXA 5C0XE 4DV1I 4M0VA 2HHHI 2KOUA 5KL7A 4NXNI 2PO0A 1E3PA 4WUBA 3EQ1A 2EM5A 2LJHA 4B3TE 3PS1A 3H09A 1HNXE 4U3BA 2M4IA 2WNRB 2EN2A 4FW9A 1FNMA 2YTQA 3U1YA 3IWDA 2JOXA 2EPRA 4QNKA 4DR5E 1N32E 2Z5BA 2L2NA 2V88A 1AH5A 2LRSA 1QZRA 3M6AA 3PS3A 3QT7A 4PU9A 4LCGA 5DNYA 5LMUI 2JEAA 3KZYA 4QNJA 3D4JA 1XMQI 2EL6A 1P42A 4DV5I 2VF3A 3RMPA 4FN5A 2YT4A 2LUQA 2C38B 4OO1E 2EMCA 4F6MA 4LCFA 2YU8A 4DV7E 2BA0D 3C6MA 4X66E 4LF5I 2V85A 4JI5E 4HACB 4GKKE 4L8NA 4DV3E 4K0KI 4BHBA 3THOB 1NCSA 4OX9E 2UU9E 1WXRA 2R3VA 1Z0VA 1Z0EA 3BBGA 2HFSA 4J8ZA 2L2KB 2EP3A 4FW3A 4FWGA 3V2UC 1YUJA 4DPUA 4KHPI 2NUGA 1HNWI 4UTGA 1RMDA 5A69A 4JG4A 4HY1A 3KWRA 2UUBE 4YY3E 2IESA 4BBYA 1GZ6A 4DV6E 1ZM9A 4X62E 2JYAA 2EPXA 3FIGA 1P47A 4LF9E 4FWHA 2LV2A 2ELZA 3EPHA 1ELOA 1N36E 3ADGA 4I8OA 4JV5E 3WU4A 1WHQA 4HXZA 3QT6A 1UN6B 1DQ3A 2EWLA 2YTNA 3JTZA 1JK1A 1PDAA 4LOMA 4B3SE 2ENAA 2RS6A 4ED4A 4B3ME 4LF6E 3B4TA 1HR0E 2PO1B 2M9AA 1KVKA 5DROA 2LMZA 4RH8A 1A1GA 2YTIA 4EMDA 2EM4A 4R2DA 2C39A 2YTGA 4IZKA 1FKAE 2PO0B 4JI2E 1GTKA 4F9BB 5A6BA 2BM0A 2FV4B 4AM3A 4BMJA 2JXPA 3C4TA 1QU6A 2JVAA 3ADLA 2WBUA 4JI0I 2Z5BB 4JI4I 2YTDA 2DRPA 4FK5C 2JEAB 3Q6MA 4R2EA 2WP8A 2EMWA 2VF1A 2DSYA 2BV3A 3PYDA 4O43A 4YHHI 2R1FA 2WBSA 1OJ4A 1MEYC 1ZBQA 2BB8A 2N8XA 4M30A 1ZXMA 3ZKBA 1KTVA 2EE8A 1Z5BA 3Q1QA 4X64E 2RPCA 4WX9A 4R2CA 5IT9C 3PS2A 3VYXA 5JEAE 2EPPA 1XNRI 4IZJA 2MC5A 3K6QA 3KZZA 1Z5CA 4HEIA 1RQ0A 4J3DA 4LF4E 4R2SA 4DXLA 5AE1A 4N3OA 4BHCA 4LFAI 4ISAA 2EN4A 1Y60A 1H74A 2ADRA 5AC5A 2JR1A 2G7HA 4DV2I 4DV4I 2GPIA 5DNXA 4P52A 2VQEI 1R6MA 1T39A 1IBLE 3U1KA 4WYQB 4L5NC 5LMNE 2EOOA 2C37A 1AAYA 1H72C 1XNQI 2B7TA 5LL6R 2JT2A 4X65I 2YSOA 1A1FA 1IBME 2K7IA 2V2QA 1UDOA 2J7JA 2WBTA 3HXLA 4DR4E 2OI2A 1Z0GA 3PRYA 1N0UA 2RTXA 1X47A 2NN6A 4LPFA 3TQMA 1VI7A 3HULA 2PNMA 3T1HE 1UHZA 3UHMA 4LFCE 3WU5A 3OTOI 2PO2A 3LTOA 2UUCE 2UXCI 2EMBA 2E5LI 5BR8I 2UUAI 1EH7A 4GEQB 2EM2A 5AE2A 4LF7I 1TN9A 3J7AM 2RSIA 3M85G 2E1MA 4DR1E 2JY9A 4JI3E 4Z7YA 2RQLA 2ZM6I 3B78A 3HTXA 2D9HA 4F54A 1IBKE 2EMXA 2YTEA 5IXMB 1RHYA 2C39B 4BC9A 4IZKB 4ZYGA 1G2FC 3M99B 3NZKA 3UK3C 1PJTA 4X8WA 2EM7A 3V5RA 4I3HA 5A2QQ 4UT4A 1JK2A 2DEJA 1A1KA 1N33E 3C4BA 1HK7A 2O1TA 1H73A 4AQYE 1Z0CA 3GMEA 1H7SA 1Z0TA 4B3TI 2O1UA 1HNXI 1UDNA 1UEKA 3WU3A 3M7ND 2E72A 2EOFA 2UXDE 2WP8B 4DU7A 4M2ZA 4JI7E 3ADIA 4DR5I 1N32I 3LLHA 1A1JA 2DB2A 4DV0E 2I13A 5A6BD 1PKPA 1Z0WA 1X49A 3VK6A 1N34E 1YYOA 2IOPA 4OOGC 2EPLX 1WJPA 4BC7A 2MKDA 1S16A 1EH8A 2EMKA 3GCMA 1WHNA 4AIMA 1F2IG 1I94E 4FW4A 2ENHA 4JYAE 4GQUA 4IZJB 1EA6A 1N3GA 2EL4A 1OYPA 4PRXA 2MDGA 1ZM4A 4BS9A 3T1YE 4LFBE 2CG9A 4DV7I 3ZKDA 2EMIA 4X66I 2NN6C 4JI5I 4GKKI 2GQ0A 4IS1C 2EM9A 4DV3I 4NHRA 2H36X 1MGTA 2F4VE 4OX9I 4IZJD 2C37B 2DIXA 4F9CB 2LUPB 2UU9I 4Q35B 2BM1A 4DUYE 3LMLA 1Z0BA 2EL5A 2EOYA 2YPNA 5DRQA 1FJGE 2Q2EB 2NUEA 1BB8A 1UDSA 4FW6A 4DR7E 4YY3I 4DR6E 2NN6B 2UUBI 3JAMQ 1USVA 4JI1E 2XEXA 4DV6I 2EMZA 2PO2B 1Y6ZA 4X62I 1FI4A 4LF9I 2R42A 5TSEA 2CTDA 5DNLA 1N36I 4P78A 2EMLA 2KHXA 2J65A 3QG5C 2R76A 4JV5I 3P1XA 1YFHA 1EKZA 1KYQA 2B7VA 4GZNC 1J26A 1NHJA 4ZYDA 2NN6D 5F3WA 4BA1A 4B3RE 2EZ6A 4B3SI 1X6FA 4MYUA 1KIJA 2BBGA 4B3MI 4LF6I 4GKJE 2YTJA 1DI2A 1HR0I 4WFTA 2VQFE 4MDTA 1T4NA 2EOHA 3IWBA 3MHSC 1T4LB 1OYRA 5ELWA 5FLXQ 4BCAA 3J7AG 2VESA 4JI8E 4M9VC 2L92A 3CDIA 4MLQA 4JI2I 4OZEA 2A2DA 5A6AA 1ZXNA 4X9JA 4KZSA 1R6LA 1A1HA 2MC6A 2F1DA 1ZM2A 1YZ9A 2FGGA 1KJKA 1XMOI 5K36A 2HFUA 3HJCA 3ZZUA 4P7DA 2IOQA 5DRPA 1XXEA 3PYEA 2DMIA 4TUIA 3L7ZA 3BF2A 4OKGA 2EN1A 3BGHA 1NHHA 2N3GA 5T6JA 2EQ1A 1DARA 1XMOE 4AIDA 4MLVA 4ZYHA 1UILA 3J80Q 4X64I 2EM6A 2DLQA 2DMYA 2UXBE 1WUUA 5K36C 4URLA 5KL4A 1J5EE 3P3CA 2YTOA 1X3CA 3ZOQB 5JEAA 4LF4I 1UBDC 4F6NA 4FWDA 4IFDA 2EQ3A 3CWVA 2E1RA 2YRHA 1YYKA
chains in the Genus database with same CATH topology
4LF8E 4ZVIA 5IWAE 1GQEA 2RSMA 2IHR1 1Z5AA 4PRVA 1HNZE 2PNLA 4DPWA 5LMNI 1IBLI 4DMIA 4NXME 1BKNA 2Z5EA 2NPFA 4WUDA 1IBMI 5FWKA 4DR4I 2K4VA 1STUA 1RC7A 4DUZE 2HKEA 1H7UA 2YZTA 3T1HI 1MX0A 4USMA 4LFCI 1FWLA 3DF6A 2CPNA 2GS8A 2UUCI 4JI6E 3PYFA 2V2VA 4DU8A 3HPZA 1U2RA 2A2CA 5GMEA 1SR9A 3AUZA 4DR2E 3LPSA 2V89A 4DR1I 4JI3I 3MSWA 1IBKI 2ODRC 2DEIA 2VE7C 3K1JA 1N0VC 1N33I 4DR3E 4AQYI 3QT8A 3B82A 5GMDA 2UXDI 4LU9A 2B3TB 4DV1E 2N3HA 2HHHE 3J81Q 4JI7I 2LTSA 1S4EA 4NXNE 3HPSA 4DV0I 5IT9Q 2ZBKB 1N34I 4HYMA 2KONA 2Z5CA 2V2ZA 1FWKA 5FLXC 1RREA 1T4OA 3QT5A 1I94I 3F6HA 2O1WA 4JYAI 3Q6NA 5LMUE 2FTXB 2ODRD 4WPYA 1XMQE 3T1YI 4LFBI 4DV5E 3ZZTA 5AASA 2LTRA 2F4VI 4KQVA 4LF5E 4R03A 1RR9A 4DUYI 4K0KE 1NHIA 1FJGI 3J80C 3J7Yp 4DR7I 4Q28A 4DR6I 2CZ9A 4R8OA 4P7AA 4JI1I 1Y4UA 2HK3A 1K47A 4KHPE 1HNWE 5CFFE 4M1KA 1EI1A 1XHKA 3F6GA 2LBSB 4B3RI 4R1FA 1D6TA 2LJPA 4MYTA 2HKJA 3P06A 4GKJI 4RPFA 3LNUA 2VQFI 2WZOA 3ZM7A 4WUCA 4JI8I 2LE2A 2J7KA 4XTJA 2HK2A 3WU6A 1Z59A 4F9AB 1PIEA 2M7QA 2L2MA 2NA2A 1YYWA 5ADZA 3F0NA 2L33A 2JOBA 2Z5CB 2B9DA 2V86A 4JI0E 4JI4E 1XMOI 1O0WA 1ZBTA 5A2QC 2L8TA 2EFGA 4YHHE 1B63A 4DPYA 2UXBI 2X7IA 2V83A 2L3CA 1J5EI 2CGEA 2X36A 2AJ4A 1XNRE 1NZ0A 4LF8I 3J81C 5IWAI 3OMLA 3GONA 2ZITA 1HNZI 4LFAE 4NXMI 2JWOA 4HACA 4DV2E 4DV4E 4USKA 1Y4SA 2VQEE 4DKKA 2V8QB 2L3JA 1KKHA 4DUZI 1X48A 4TUGA 1XNQE 2WW4A 4X65E 1PVGA 2L6MA 5AE3A 2M1SA 1ZM3A 3PYGA 1A6FA 4DPXA 4DPTA 4JI6I 3DJWA 1B62A 2V34A 4DR2I 2O1VA 3OTOE 2UXCE 2E5LE 5BR8E 3AV0A 2RS7A 2UUAE 3JAMC 2V87A 3ZZ0A 4LF7E 1VISA 3K85A 4WSPA 2V8PA 2NUFA 3IWCA 4Z7CA 2F8BA 2MDRA 2ZM6E 1MU5A 1MG7A 1USUA 3HQ1A 3JU0A 3ADJA 4DR3I 3K17A 3B8HA 3VYYA 3H4LA 4LTYA 5L3JA 4DV1I 4M0VA 2HHHI 2KOUA 4NXNI 4WUBA 2LJHA 4B3TE 3H09A 1HNXE 2M4IA 4FW9A 1FNMA 3IWDA 2JOXA 4DR5E 1N32E 2Z5BA 2L2NA 2V88A 2LRSA 1QZRA 3M6AA 3QT7A 4PU9A 5LMUI 5DNYA 3D4JA 1XMQI 4DV5I 2VF3A 3RMPA 4FN5A 2YT4A 2LUQA 4DV7E 4X66E 4LF5I 2V85A 4JI5E 4HACB 4GKKE 4L8NA 4DV3E 4K0KI 4OX9E 2UU9E 1WXRA 2R3VA 1Z0VA 1Z0EA 2HFSA 4FWGA 4J8ZA 2L2KB 3V2UC 4DPUA 4KHPI 2NUGA 1HNWI 4UTGA 4JG4A 4HY1A 3KWRA 2UUBE 4YY3E 4BBYA 1GZ6A 4DV6E 1ZM9A 4X62E 3FIGA 4LF9E 4FWHA 1ELOA 1N36E 3ADGA 4I8OA 4JV5E 3WU4A 1WHQA 4HXZA 3QT6A 1DQ3A 2EWLA 3JTZA 4B3SE 2RS6A 4ED4A 4B3ME 4LF6E 1HR0E 1KVKA 2LMZA 4EMDA 4IZKA 1FKAE 4JI2E 4F9BB 2BM0A 2FV4B 4BMJA 3C4TA 1QU6A 2JVAA 3ADLA 4JI0I 2Z5BB 4JI4I 3Q6MA 2VF1A 2DSYA 2BV3A 3PYDA 4YHHI 1OJ4A 1ZBQA 4M30A 1ZXMA 1KTVA 1Z5BA 3Q1QA 4X64E 5IT9C 3VYXA 1XNRI 4IZJA 2MC5A 3K6QA 1Z5CA 1RQ0A 4LF4E 4DXLA 5AE1A 4N3OA 4LFAI 1H74A 2JR1A 2G7HA 4DV2I 4DV4I 2VQEI 4P52A 1IBLE 4WYQB 4L5NC 5LMNE 1XNQI 1H72C 2B7TA 5LL6R 4X65I 1IBME 2V2QA 3HXLA 4DR4E 2OI2A 1Z0GA 3PRYA 1N0UA 2RTXA 1X47A 3HULA 2PNMA 3T1HE 1UHZA 4LFCE 3WU5A 3OTOI 3LTOA 2UUCE 2UXCI 2E5LI 5BR8I 2UUAI 4GEQB 5AE2A 4LF7I 3J7AM 2E1MA 4DR1E 2JY9A 4JI3E 4Z7YA 2ZM6I 3B78A 3HTXA 4F54A 1IBKE 4BC9A 4IZKB 4X8WA 3V5RA 4I3HA 5A2QQ 4UT4A 2DEJA 1N33E 1HK7A 3C4BA 2O1TA 1H73A 4AQYE 1Z0CA 1H7SA 1Z0TA 4B3TI 2O1UA 1HNXI 1UEKA 3WU3A 2UXDE 4DU7A 4M2ZA 4JI7E 3ADIA 4DR5I 1N32I 3LLHA 2DB2A 4DV0E 1Z0WA 1PKPA 1X49A 3VK6A 1N34E 1YYOA 2IOPA 4OOGC 4BC7A 1S16A 1WHNA 1I94E 4IZJB 4JYAE 1EA6A 4PRXA 1ZM4A 4BS9A 3T1YE 4LFBE 2CG9A 4DV7I 3ZKDA 4X66I 4JI5I 4GKKI 2GQ0A 4DV3I 2H36X 2F4VE 4OX9I 4IZJD 2DIXA 4F9CB 2LUPB 2UU9I 2BM1A 4DUYE 3LMLA 1Z0BA 1FJGE 2Q2EB 2NUEA 2UUBI 4DR7E 4YY3I 4DR6E 3JAMQ 1USVA 4JI1E 2XEXA 4DV6I 4X62I 1Y6ZA 1FI4A 4LF9I 2R42A 1N36I 4P78A 2KHXA 4JV5I 3P1XA 1EKZA 2B7VA 1J26A 1NHJA 5F3WA 4B3RE 2EZ6A 4B3SI 4MYUA 1KIJA 4B3MI 4LF6I 4GKJE 1DI2A 1HR0I 4WFTA 2VQFE 5FLXQ 1T4NA 3IWBA 1T4LB 4BCAA 3J7AG 4JI8E 2L92A 4JI2I 2A2DA 1ZXNA 4KZSA 2MC6A 1ZM2A 1YZ9A 2FGGA 2HFUA 3HJCA 3ZZUA 4P7DA 2IOQA 3PYEA 4TUIA 1NHHA 2N3GA 5T6JA 1DARA 1XMOE 1UILA 3J80Q 4X64I 2DMYA 2UXBE 1WUUA 4URLA 1J5EE 3ZOQB 4LF4I 4FWDA 3CWVA 2E1RA 3ZKBA 1YYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 E;  4ZVI A;  5IWA E;  1GQE A;  2RSM A;  2IHR 1;  1Z5A A;  4PRV A;  1HNZ E;  4DPW A;  1IBL I;  5LMN I;  4NXM E;  2NPF A;  1BKN A;  4WUD A;  1IBM I;  4DR4 I;  1STU A;  1RC7 A;  4DUZ E;  2HKE A;  1H7U A;  3T1H I;  1MX0 A;  4USM A;  4LFC I;  1FWL A;  2GS8 A;  2CPN A;  2UUC I;  4JI6 E;  3PYF A;  2V2V A;  4DU8 A;  1U2R A;  2A2C A;  5GME A;  4DR2 E;  3LPS A;  4DR1 I;  4JI3 I;  1IBK I;  2DEI A;  3K1J A;  1N0V C;  1N33 I;  4DR3 E;  4AQY I;  3QT8 A;  3B82 A;  5GMD A;  2UXD I;  2B3T B;  4DV1 E;  2N3H A;  2HHH E;  3J81 Q;  4JI7 I;  2LTS A;  1S4E A;  4NXN E;  4DV0 I;  5IT9 Q;  2ZBK B;  1N34 I;  4HYM A;  2V2Z A;  1FWK A;  1RRE A;  5FLX C;  1T4O A;  3QT5 A;  1I94 I;  4JYA I;  5LMU E;  1XMQ E;  3T1Y I;  4LFB I;  4DV5 E;  3ZZT A;  2LTR A;  2F4V I;  4KQV A;  4LF5 E;  1RR9 A;  4DUY I;  4K0K E;  1NHI A;  1FJG I;  3J7Y p;  3J80 C;  4DR7 I;  4DR6 I;  2CZ9 A;  4P7A A;  4JI1 I;  2HK3 A;  1K47 A;  4KHP E;  1HNW E;  5CFF E;  4M1K A;  1EI1 A;  1XHK A;  2LBS B;  4B3R I;  4R1F A;  1D6T A;  2LJP A;  4MYT A;  2HKJ A;  4GKJ I;  4RPF A;  3LNU A;  2VQF I;  3ZM7 A;  4WUC A;  4JI8 I;  2J7K A;  4XTJ A;  2HK2 A;  3WU6 A;  1Z59 A;  1PIE A;  2L2M A;  2NA2 A;  1YYW A;  3F0N A;  2L33 A;  4JI0 E;  4JI4 E;  1XMO I;  1O0W A;  1ZBT A;  5A2Q C;  2EFG A;  4YHH E;  1B63 A;  4DPY A;  2UXB I;  2X7I A;  2L3C A;  1J5E I;  2X36 A;  2AJ4 A;  1XNR E;  1NZ0 A;  4LF8 I;  3J81 C;  5IWA I;  3GON A;  2ZIT A;  1HNZ I;  4LFA E;  4NXM I;  4HAC A;  4DV2 E;  4DV4 E;  4USK A;  2VQE E;  4DKK A;  2L3J A;  1KKH A;  4DUZ I;  1X48 A;  1XNQ E;  2WW4 A;  4X65 E;  1PVG A;  1ZM3 A;  3PYG A;  1A6F A;  4DPX A;  4DPT A;  4JI6 I;  1B62 A;  2V34 A;  4DR2 I;  3OTO E;  2UXC E;  2E5L E;  5BR8 E;  2UUA E;  2RS7 A;  3JAM C;  3ZZ0 A;  4LF7 E;  1VIS A;  2V8P A;  2NUF A;  4Z7C A;  2MDR A;  2ZM6 E;  1MU5 A;  1MG7 A;  3ADJ A;  4DR3 I;  3K17 A;  3B8H A;  3VYY A;  3H4L A;  5L3J A;  4DV1 I;  2HHH I;  4NXN I;  4WUB A;  2LJH A;  4B3T E;  1HNX E;  4FW9 A;  1FNM A;  4DR5 E;  1N32 E;  3M6A A;  2L2N A;  4PU9 A;  2LRS A;  1QZR A;  3QT7 A;  5LMU I;  3D4J A;  1XMQ I;  4DV5 I;  2VF3 A;  4FN5 A;  2YT4 A;  2LUQ A;  4DV7 E;  4X66 E;  4LF5 I;  4JI5 E;  4HAC B;  4GKK E;  4DV3 E;  4K0K I;  4OX9 E;  2UU9 E;  2R3V A;  1Z0V A;  1Z0E A;  2HFS A;  4FWG A;  2L2K B;  3V2U C;  4DPU A;  4KHP I;  2NUG A;  1HNW I;  4UTG A;  4JG4 A;  4HY1 A;  2UUB E;  4YY3 E;  4DV6 E;  1ZM9 A;  4X62 E;  4LF9 E;  4FWH A;  1ELO A;  1N36 E;  3ADG A;  4JV5 E;  3WU4 A;  1WHQ A;  4HXZ A;  3QT6 A;  4B3S E;  2RS6 A;  4ED4 A;  4B3M E;  4LF6 E;  1HR0 E;  1KVK A;  4EMD A;  1FKA E;  4JI2 E;  2BM0 A;  3C4T A;  1QU6 A;  2JVA A;  3ADL A;  4JI0 I;  4JI4 I;  2BV3 A;  3PYD A;  4YHH I;  1OJ4 A;  4M30 A;  1ZXM A;  1KTV A;  1Z5B A;  3Q1Q A;  4X64 E;  5IT9 C;  3VYX A;  1XNR I;  1Z5C A;  1RQ0 A;  4LF4 E;  4DXL A;  4LFA I;  1H74 A;  4DV2 I;  4DV4 I;  2VQE I;  4P52 A;  1IBL E;  4WYQ B;  5LMN E;  1XNQ I;  1H72 C;  2B7T A;  5LL6 R;  4X65 I;  1IBM E;  2V2Q A;  4DR4 E;  2OI2 A;  1Z0G A;  1N0U A;  2RTX A;  1X47 A;  3HUL A;  3T1H E;  1UHZ A;  4LFC E;  3WU5 A;  3OTO I;  3LTO A;  2UUC E;  2UXC I;  2E5L I;  5BR8 I;  2UUA I;  4LF7 I;  3J7A M;  4DR1 E;  2JY9 A;  4JI3 E;  4Z7Y A;  2ZM6 I;  3B78 A;  3HTX A;  1IBK E;  4X8W A;  3V5R A;  4I3H A;  5A2Q Q;  4UT4 A;  2DEJ A;  1N33 E;  3C4B A;  1H73 A;  4AQY E;  1Z0C A;  1H7S A;  1Z0T A;  4B3T I;  1HNX I;  1UEK A;  3WU3 A;  2UXD E;  4DU7 A;  4M2Z A;  4JI7 E;  3ADI A;  4DR5 I;  1N32 I;  3LLH A;  2DB2 A;  4DV0 E;  1Z0W A;  1PKP A;  1X49 A;  1N34 E;  1YYO A;  4OOG C;  1S16 A;  1WHN A;  1I94 E;  4JYA E;  1EA6 A;  4PRX A;  1ZM4 A;  3T1Y E;  4LFB E;  4DV7 I;  3ZKD A;  4X66 I;  4JI5 I;  4GKK I;  4DV3 I;  2F4V E;  4OX9 I;  2DIX A;  2LUP B;  2UU9 I;  2BM1 A;  4DUY E;  1Z0B A;  1FJG E;  2Q2E B;  2NUE A;  2UUB I;  4DR7 E;  4YY3 I;  4DR6 E;  3JAM Q;  4JI1 E;  2XEX A;  4DV6 I;  4X62 I;  1FI4 A;  4LF9 I;  2R42 A;  1N36 I;  2KHX A;  4JV5 I;  3P1X A;  1EKZ A;  2B7V A;  1J26 A;  1NHJ A;  4B3R E;  2EZ6 A;  4B3S I;  4MYU A;  1KIJ A;  4B3M I;  4LF6 I;  4GKJ E;  1DI2 A;  1HR0 I;  4WFT A;  2VQF E;  5FLX Q;  1T4N A;  1T4L B;  3J7A G;  4JI8 E;  4JI2 I;  2A2D A;  1ZXN A;  1ZM2 A;  1YZ9 A;  2HFU A;  3ZZU A;  3PYE A;  1NHH A;  2N3G A;  1DAR A;  1XMO E;  1UIL A;  3J80 Q;  4X64 I;  2DMY A;  2UXB E;  1WUU A;  4URL A;  1J5E E;  4LF4 I;  4FWD A;  3CWV A;  2E1R A;  3ZKB A;  1YYK A; 
#chains in the Genus database with same CATH topology
 2EPM X;  4LF8 E;  4ZVI A;  5IWA E;  1GQE A;  2RSM A;  2YRM A;  2CT1 A;  2IHR 1;  4BA2 B;  4IFD C;  1Z5A A;  4PRV A;  1HNZ E;  5KL2 A;  2PNL A;  4DPW A;  2EOR A;  5DRR A;  5LMN I;  1IBL I;  4FW5 A;  2DLK A;  4DMI A;  3EPL A;  4NXM E;  1BKN A;  2Z5E A;  4WUD A;  2NPF A;  2HC5 A;  4MU4 A;  1IBM I;  4KWY A;  5FWK A;  2EOI A;  4DR4 I;  2GLI A;  2EM3 A;  2K4V A;  1STU A;  1RC7 A;  4DUZ E;  2EOQ A;  2HKE A;  1EH6 A;  2EN8 A;  1H7U A;  2YZT A;  2PNZ A;  3T1H I;  1MX0 A;  4USM A;  4LFC I;  2BR2 A;  4IJD A;  3DF6 A;  2CSH A;  1FWL A;  2CPN A;  2GS8 A;  5K36 F;  2UUC I;  3M85 D;  4JI6 E;  1IQO A;  2V2V A;  3PYF A;  4MU1 A;  5EL9 A;  4DU8 A;  3HPZ A;  2GHF A;  1U2R A;  2A2C A;  4BA1 B;  4IS9 A;  3P3G A;  5GME A;  1SR9 A;  3AUZ A;  4DR2 E;  4N4R B;  4R2A A;  3LPS A;  2V89 A;  2JE6 A;  4NBQ A;  4MU3 A;  2EPN A;  2HJJ A;  4DR1 I;  1X6H A;  4JI3 I;  1YH8 A;  1LLM C;  3MSW A;  1IBK I;  2ODR C;  1X6E A;  2DEI A;  2VE7 C;  3K1J A;  1N0V C;  4RHB B;  4DR3 E;  5C0X A;  4IFD F;  1N33 I;  1Y5Y A;  4AQY I;  5EKW A;  3QT8 A;  5K36 B;  3KRN A;  4R2R A;  3B82 A;  1IQS A;  5GMD A;  2UXD I;  4LU9 A;  5JEA C;  2B3T B;  2EM0 A;  2N3H A;  4DV1 E;  1A1I A;  4WSG A;  2HHH E;  3L7Z B;  2LTS A;  1S4E A;  3J81 Q;  4NXN E;  4JI7 I;  3HPS A;  4DV0 I;  5IT9 Q;  2ZBK B;  2EPA A;  3BID A;  1PJS A;  2EOJ A;  3MHH C;  2NN6 F;  1N34 I;  4FW7 A;  2KON A;  4HYM A;  2Z5C A;  1YHC A;  2V2Z A;  2YTF A;  1YSA C;  5FLX C;  1FWK A;  1T4O A;  4ZYE A;  1RRE A;  3QT5 A;  3F6H A;  2O1W A;  3DD6 A;  1I94 I;  4JYA I;  2Q8U A;  2EJ4 A;  3Q6N A;  5LMU E;  3EPK A;  2FTX B;  4OO1 A;  2ODR D;  4WPY A;  1XMQ E;  5JEA B;  2JEB A;  3T1Y I;  4IFD B;  4DV5 E;  4LFB I;  4MU0 A;  3HKM A;  2I9I A;  1Z1B A;  2LCE A;  2HGH A;  3ZZT A;  1TF6 A;  4U3D A;  5AAS A;  4BA2 A;  2LTR A;  2F4V I;  5KL3 A;  4KQV A;  4MQY A;  2EPC A;  4R03 A;  4LF5 E;  5A6J A;  1RR9 A;  2EPK X;  4DUY I;  1ZU1 A;  2ENC A;  1B69 A;  4K0K E;  1NHI A;  2JP9 A;  4O4K A;  5JEA D;  4IFD D;  1FJG I;  4HTG A;  2EQ0 A;  3VHT B;  2BA0 G;  3J80 C;  3J7Y p;  2PNZ B;  4DR7 I;  4Q28 A;  4DR6 I;  1E3H A;  1PJQ A;  2CZ9 A;  5C0X F;  1BBO A;  4R8O A;  2BR2 B;  4P7A A;  4JI1 I;  1Y4U A;  2HK3 A;  1K47 A;  4KHP E;  2EMG A;  1HNW E;  2ELY A;  1T38 A;  4WXC A;  2VRD A;  5C0X C;  5CFF E;  4M1K A;  1EI1 A;  2EN6 A;  2JE6 B;  1XHK A;  3F6G A;  2LBS B;  4B3R I;  4R1F A;  1D6T A;  2LJP A;  4O5G A;  1YUI A;  2EN3 A;  2EN7 A;  4MYT A;  2HKJ A;  1BBG A;  3P06 A;  4O24 A;  4GKJ I;  2MKN A;  1OYS A;  4RPF A;  3LNU A;  2VQF I;  1A1L A;  4OO1 F;  2WZO A;  3ZM7 A;  4WUC A;  5C0X B;  1DGC A;  2EPU A;  4JI8 I;  2LE2 A;  2J7K A;  4XTJ A;  2HK2 A;  3WU6 A;  1Z59 A;  3M7N G;  4OO1 C;  2IER A;  1NEI A;  1ZR9 A;  4F9A B;  1PIE A;  2O3Z A;  2M7Q A;  2EPZ A;  2L2M A;  1IMU A;  2NA2 A;  1YYW A;  5ADZ A;  4F2J C;  3F0N A;  2L33 A;  2JOB A;  2JPA A;  2Z5C B;  2B9D A;  5C0X D;  5K36 E;  3C6K A;  2V86 A;  1SFE A;  2EMY A;  4JI0 E;  4JI4 E;  2EMA A;  1O0W A;  2AE8 A;  3P76 A;  2EOE A;  1ZBT A;  5A2Q C;  3ECR A;  2WNR A;  2L8T A;  5KL5 A;  2YTP A;  2DGC A;  3L00 A;  4OO1 B;  2JEB B;  2EFG A;  4YHH E;  1B63 A;  4DPY A;  4R2Q A;  1QNT A;  2X7I A;  2V83 A;  2UXB I;  2LT7 A;  2L3C A;  1J5E I;  2CGE A;  2X36 A;  2BA1 D;  4WXD A;  5IV8 B;  2AJ4 A;  2BA1 G;  1X5W A;  1XNR E;  1NZ0 A;  4LF8 I;  3J81 C;  5IWA I;  2PRT A;  5A6K A;  2C38 A;  1L4S A;  4OO1 D;  3OML A;  3GON A;  2ZIT A;  1HNZ I;  4IFD E;  4LCH A;  2EMH A;  2LO3 A;  4LFA E;  4NXM I;  2GO4 A;  2EPO A;  2JWO A;  2YRK A;  3EPJ A;  4HAC A;  4DV2 E;  4DV4 E;  4USK A;  1Y4S A;  2VQE E;  3P3E A;  2WCC 3;  4DKK A;  4R2P A;  1TF3 A;  1ZAA C;  2V8Q B;  2L3J A;  1KKH A;  4DUZ I;  1X48 A;  4TUG A;  5K36 D;  2EOZ A;  1XNQ E;  2WW4 A;  2A25 A;  4X65 E;  1PVG A;  2L6M A;  2LVH A;  2NN6 E;  5AE3 A;  2YSP A;  2M1S A;  1ZM3 A;  3PYG A;  1A6F A;  4DPX A;  2EMF A;  4DPT A;  3DJW A;  1B62 A;  2V34 A;  4JI6 I;  2EOS A;  1WRJ A;  2EM8 A;  4DR2 I;  3H1C A;  2O1V A;  2LJU A;  3OTO E;  3THN A;  2UXC E;  2E5L E;  5BR8 E;  3AV0 A;  2RS7 A;  2UUA E;  3JAM C;  2V87 A;  1G2D C;  4LF7 E;  2CVE A;  1VIS A;  3K85 A;  4WSP A;  3CDJ A;  3GLL A;  3ZZ0 A;  2V8P A;  2NUF A;  5LLQ A;  5JEA F;  3IWC A;  1UDQ A;  4Z7C A;  2F8B A;  2MDR A;  2EOM A;  5KL6 A;  2ZM6 E;  5AC4 A;  1MG7 A;  1MU5 A;  3HQ1 A;  3JU0 A;  1USU A;  3ADJ A;  2GO3 A;  4DR3 I;  3K17 A;  2NAB A;  3B8H A;  2YU5 A;  3VYY A;  1YPN A;  3H4L A;  2YWQ A;  4LTY A;  2PO1 A;  5L3J A;  4NZV A;  2EOX A;  5C0X E;  4DV1 I;  4M0V A;  2HHH I;  2KOU A;  5KL7 A;  4NXN I;  2PO0 A;  1E3P A;  4WUB A;  3EQ1 A;  2EM5 A;  2LJH A;  4B3T E;  3PS1 A;  3H09 A;  1HNX E;  4U3B A;  2M4I A;  2WNR B;  2EN2 A;  4FW9 A;  1FNM A;  2YTQ A;  3U1Y A;  3IWD A;  2JOX A;  2EPR A;  4QNK A;  4DR5 E;  1N32 E;  2Z5B A;  2L2N A;  2V88 A;  1AH5 A;  2LRS A;  1QZR A;  3M6A A;  3PS3 A;  3QT7 A;  4PU9 A;  4LCG A;  5DNY A;  5LMU I;  2JEA A;  3KZY A;  4QNJ A;  3D4J A;  1XMQ I;  2EL6 A;  1P42 A;  4DV5 I;  2VF3 A;  3RMP A;  4FN5 A;  2YT4 A;  2LUQ A;  2C38 B;  4OO1 E;  2EMC A;  4F6M A;  4LCF A;  2YU8 A;  4DV7 E;  2BA0 D;  3C6M A;  4X66 E;  4LF5 I;  2V85 A;  4JI5 E;  4HAC B;  4GKK E;  4L8N A;  4DV3 E;  4K0K I;  4BHB A;  3THO B;  1NCS A;  4OX9 E;  2UU9 E;  1WXR A;  2R3V A;  1Z0V A;  1Z0E A;  3BBG A;  2HFS A;  4J8Z A;  2L2K B;  2EP3 A;  4FW3 A;  4FWG A;  3V2U C;  1YUJ A;  4DPU A;  4KHP I;  2NUG A;  1HNW I;  4UTG A;  1RMD A;  5A69 A;  4JG4 A;  4HY1 A;  3KWR A;  2UUB E;  4YY3 E;  2IES A;  4BBY A;  1GZ6 A;  4DV6 E;  1ZM9 A;  4X62 E;  2JYA A;  2EPX A;  3FIG A;  1P47 A;  4LF9 E;  4FWH A;  2LV2 A;  2ELZ A;  3EPH A;  1ELO A;  1N36 E;  3ADG A;  4I8O A;  4JV5 E;  3WU4 A;  1WHQ A;  4HXZ A;  3QT6 A;  1UN6 B;  1DQ3 A;  2EWL A;  2YTN A;  3JTZ A;  1JK1 A;  1PDA A;  4LOM A;  4B3S E;  2ENA A;  2RS6 A;  4ED4 A;  4B3M E;  4LF6 E;  3B4T A;  1HR0 E;  2PO1 B;  2M9A A;  1KVK A;  5DRO A;  2LMZ A;  4RH8 A;  1A1G A;  2YTI A;  4EMD A;  2EM4 A;  4R2D A;  2C39 A;  2YTG A;  4IZK A;  1FKA E;  2PO0 B;  4JI2 E;  1GTK A;  4F9B B;  5A6B A;  2BM0 A;  2FV4 B;  4AM3 A;  4BMJ A;  2JXP A;  3C4T A;  1QU6 A;  2JVA A;  3ADL A;  2WBU A;  4JI0 I;  2Z5B B;  4JI4 I;  2YTD A;  2DRP A;  4FK5 C;  2JEA B;  3Q6M A;  4R2E A;  2WP8 A;  2EMW A;  2VF1 A;  2DSY A;  2BV3 A;  3PYD A;  4O43 A;  4YHH I;  2R1F A;  2WBS A;  1OJ4 A;  1MEY C;  1ZBQ A;  2BB8 A;  2N8X A;  4M30 A;  1ZXM A;  3ZKB A;  1KTV A;  2EE8 A;  1Z5B A;  3Q1Q A;  4X64 E;  2RPC A;  4WX9 A;  4R2C A;  5IT9 C;  3PS2 A;  3VYX A;  5JEA E;  2EPP A;  1XNR I;  4IZJ A;  2MC5 A;  3K6Q A;  3KZZ A;  1Z5C A;  4HEI A;  1RQ0 A;  4J3D A;  4LF4 E;  4R2S A;  4DXL A;  5AE1 A;  4N3O A;  4BHC A;  4LFA I;  4ISA A;  2EN4 A;  1Y60 A;  1H74 A;  2ADR A;  5AC5 A;  2JR1 A;  2G7H A;  4DV2 I;  4DV4 I;  2GPI A;  5DNX A;  4P52 A;  2VQE I;  1R6M A;  1T39 A;  1IBL E;  3U1K A;  4WYQ B;  4L5N C;  5LMN E;  2EOO A;  2C37 A;  1AAY A;  1H72 C;  1XNQ I;  2B7T A;  5LL6 R;  2JT2 A;  4X65 I;  2YSO A;  1A1F A;  1IBM E;  2K7I A;  2V2Q A;  1UDO A;  2J7J A;  2WBT A;  3HXL A;  4DR4 E;  2OI2 A;  1Z0G A;  3PRY A;  1N0U A;  2RTX A;  1X47 A;  2NN6 A;  4LPF A;  3TQM A;  1VI7 A;  3HUL A;  2PNM A;  3T1H E;  1UHZ A;  3UHM A;  4LFC E;  3WU5 A;  3OTO I;  2PO2 A;  3LTO A;  2UUC E;  2UXC I;  2EMB A;  2E5L I;  5BR8 I;  2UUA I;  1EH7 A;  4GEQ B;  2EM2 A;  5AE2 A;  4LF7 I;  1TN9 A;  3J7A M;  2RSI A;  3M85 G;  2E1M A;  4DR1 E;  2JY9 A;  4JI3 E;  4Z7Y A;  2RQL A;  2ZM6 I;  3B78 A;  3HTX A;  2D9H A;  4F54 A;  1IBK E;  2EMX A;  2YTE A;  5IXM B;  1RHY A;  2C39 B;  4BC9 A;  4IZK B;  4ZYG A;  1G2F C;  3M99 B;  3NZK A;  3UK3 C;  1PJT A;  4X8W A;  2EM7 A;  3V5R A;  4I3H A;  5A2Q Q;  4UT4 A;  1JK2 A;  2DEJ A;  1A1K A;  1N33 E;  3C4B A;  1HK7 A;  2O1T A;  1H73 A;  4AQY E;  1Z0C A;  3GME A;  1H7S A;  1Z0T A;  4B3T I;  2O1U A;  1HNX I;  1UDN A;  1UEK A;  3WU3 A;  3M7N D;  2E72 A;  2EOF A;  2UXD E;  2WP8 B;  4DU7 A;  4M2Z A;  4JI7 E;  3ADI A;  4DR5 I;  1N32 I;  3LLH A;  1A1J A;  2DB2 A;  4DV0 E;  2I13 A;  5A6B D;  1PKP A;  1Z0W A;  1X49 A;  3VK6 A;  1N34 E;  1YYO A;  2IOP A;  4OOG C;  2EPL X;  1WJP A;  4BC7 A;  2MKD A;  1S16 A;  1EH8 A;  2EMK A;  3GCM A;  1WHN A;  4AIM A;  1F2I G;  1I94 E;  4FW4 A;  2ENH A;  4JYA E;  4GQU A;  4IZJ B;  1EA6 A;  1N3G A;  2EL4 A;  1OYP A;  4PRX A;  2MDG A;  1ZM4 A;  4BS9 A;  3T1Y E;  4LFB E;  2CG9 A;  4DV7 I;  3ZKD A;  2EMI A;  4X66 I;  2NN6 C;  4JI5 I;  4GKK I;  2GQ0 A;  4IS1 C;  2EM9 A;  4DV3 I;  4NHR A;  2H36 X;  1MGT A;  2F4V E;  4OX9 I;  4IZJ D;  2C37 B;  2DIX A;  4F9C B;  2LUP B;  2UU9 I;  4Q35 B;  2BM1 A;  4DUY E;  3LML A;  1Z0B A;  2EL5 A;  2EOY A;  2YPN A;  5DRQ A;  1FJG E;  2Q2E B;  2NUE A;  1BB8 A;  1UDS A;  4FW6 A;  4DR7 E;  4YY3 I;  4DR6 E;  2NN6 B;  2UUB I;  3JAM Q;  1USV A;  4JI1 E;  2XEX A;  4DV6 I;  2EMZ A;  2PO2 B;  1Y6Z A;  4X62 I;  1FI4 A;  4LF9 I;  2R42 A;  5TSE A;  2CTD A;  5DNL A;  1N36 I;  4P78 A;  2EML A;  2KHX A;  2J65 A;  3QG5 C;  2R76 A;  4JV5 I;  3P1X A;  1YFH A;  1EKZ A;  1KYQ A;  2B7V A;  4GZN C;  1J26 A;  1NHJ A;  4ZYD A;  2NN6 D;  5F3W A;  4BA1 A;  4B3R E;  2EZ6 A;  4B3S I;  1X6F A;  4MYU A;  1KIJ A;  2BBG A;  4B3M I;  4LF6 I;  4GKJ E;  2YTJ A;  1DI2 A;  1HR0 I;  4WFT A;  2VQF E;  4MDT A;  1T4N A;  2EOH A;  3IWB A;  3MHS C;  1T4L B;  1OYR A;  5ELW A;  5FLX Q;  4BCA A;  3J7A G;  2VES A;  4JI8 E;  4M9V C;  2L92 A;  3CDI A;  4MLQ A;  4JI2 I;  4OZE A;  2A2D A;  5A6A A;  1ZXN A;  4X9J A;  4KZS A;  1R6L A;  1A1H A;  2MC6 A;  2F1D A;  1ZM2 A;  1YZ9 A;  2FGG A;  1KJK A;  1XMO I;  5K36 A;  2HFU A;  3HJC A;  3ZZU A;  4P7D A;  2IOQ A;  5DRP A;  1XXE A;  3PYE A;  2DMI A;  4TUI A;  3L7Z A;  3BF2 A;  4OKG A;  2EN1 A;  3BGH A;  1NHH A;  2N3G A;  5T6J A;  2EQ1 A;  1DAR A;  1XMO E;  4AID A;  4MLV A;  4ZYH A;  1UIL A;  3J80 Q;  4X64 I;  2EM6 A;  2DLQ A;  2DMY A;  2UXB E;  1WUU A;  5K36 C;  4URL A;  5KL4 A;  1J5E E;  3P3C A;  2YTO A;  1X3C A;  3ZOQ B;  5JEA A;  4LF4 I;  1UBD C;  4F6N A;  4FWD A;  4IFD A;  2EQ3 A;  3CWV A;  2E1R A;  2YRH A;  1YYK A; 
#chains in the Genus database with same CATH homology
 4LF8 E;  4ZVI A;  5IWA E;  1GQE A;  2RSM A;  2IHR 1;  1Z5A A;  4PRV A;  1HNZ E;  2PNL A;  4DPW A;  5LMN I;  1IBL I;  4DMI A;  4NXM E;  1BKN A;  2Z5E A;  2NPF A;  4WUD A;  1IBM I;  5FWK A;  4DR4 I;  2K4V A;  1STU A;  1RC7 A;  4DUZ E;  2HKE A;  1H7U A;  2YZT A;  3T1H I;  1MX0 A;  4USM A;  4LFC I;  1FWL A;  3DF6 A;  2CPN A;  2GS8 A;  2UUC I;  4JI6 E;  3PYF A;  2V2V A;  4DU8 A;  3HPZ A;  1U2R A;  2A2C A;  5GME A;  1SR9 A;  3AUZ A;  4DR2 E;  3LPS A;  2V89 A;  4DR1 I;  4JI3 I;  3MSW A;  1IBK I;  2ODR C;  2DEI A;  2VE7 C;  3K1J A;  1N0V C;  1N33 I;  4DR3 E;  4AQY I;  3QT8 A;  3B82 A;  5GMD A;  2UXD I;  4LU9 A;  2B3T B;  4DV1 E;  2N3H A;  2HHH E;  3J81 Q;  4JI7 I;  2LTS A;  1S4E A;  4NXN E;  3HPS A;  4DV0 I;  5IT9 Q;  2ZBK B;  1N34 I;  4HYM A;  2KON A;  2Z5C A;  2V2Z A;  1FWK A;  5FLX C;  1RRE A;  1T4O A;  3QT5 A;  1I94 I;  3F6H A;  2O1W A;  4JYA I;  3Q6N A;  5LMU E;  2FTX B;  2ODR D;  4WPY A;  1XMQ E;  3T1Y I;  4LFB I;  4DV5 E;  3ZZT A;  5AAS A;  2LTR A;  2F4V I;  4KQV A;  4LF5 E;  4R03 A;  1RR9 A;  4DUY I;  4K0K E;  1NHI A;  1FJG I;  3J80 C;  3J7Y p;  4DR7 I;  4Q28 A;  4DR6 I;  2CZ9 A;  4R8O A;  4P7A A;  4JI1 I;  1Y4U A;  2HK3 A;  1K47 A;  4KHP E;  1HNW E;  5CFF E;  4M1K A;  1EI1 A;  1XHK A;  3F6G A;  2LBS B;  4B3R I;  4R1F A;  1D6T A;  2LJP A;  4MYT A;  2HKJ A;  3P06 A;  4GKJ I;  4RPF A;  3LNU A;  2VQF I;  2WZO A;  3ZM7 A;  4WUC A;  4JI8 I;  2LE2 A;  2J7K A;  4XTJ A;  2HK2 A;  3WU6 A;  1Z59 A;  4F9A B;  1PIE A;  2M7Q A;  2L2M A;  2NA2 A;  1YYW A;  5ADZ A;  3F0N A;  2L33 A;  2JOB A;  2Z5C B;  2B9D A;  2V86 A;  4JI0 E;  4JI4 E;  1XMO I;  1O0W A;  1ZBT A;  5A2Q C;  2L8T A;  2EFG A;  4YHH E;  1B63 A;  4DPY A;  2UXB I;  2X7I A;  2V83 A;  2L3C A;  1J5E I;  2CGE A;  2X36 A;  2AJ4 A;  1XNR E;  1NZ0 A;  4LF8 I;  3J81 C;  5IWA I;  3OML A;  3GON A;  2ZIT A;  1HNZ I;  4LFA E;  4NXM I;  2JWO A;  4HAC A;  4DV2 E;  4DV4 E;  4USK A;  1Y4S A;  2VQE E;  4DKK A;  2V8Q B;  2L3J A;  1KKH A;  4DUZ I;  1X48 A;  4TUG A;  1XNQ E;  2WW4 A;  4X65 E;  1PVG A;  2L6M A;  5AE3 A;  2M1S A;  1ZM3 A;  3PYG A;  1A6F A;  4DPX A;  4DPT A;  4JI6 I;  3DJW A;  1B62 A;  2V34 A;  4DR2 I;  2O1V A;  3OTO E;  2UXC E;  2E5L E;  5BR8 E;  3AV0 A;  2RS7 A;  2UUA E;  3JAM C;  2V87 A;  3ZZ0 A;  4LF7 E;  1VIS A;  3K85 A;  4WSP A;  2V8P A;  2NUF A;  3IWC A;  4Z7C A;  2F8B A;  2MDR A;  2ZM6 E;  1MU5 A;  1MG7 A;  1USU A;  3HQ1 A;  3JU0 A;  3ADJ A;  4DR3 I;  3K17 A;  3B8H A;  3VYY A;  3H4L A;  4LTY A;  5L3J A;  4DV1 I;  4M0V A;  2HHH I;  2KOU A;  4NXN I;  4WUB A;  2LJH A;  4B3T E;  3H09 A;  1HNX E;  2M4I A;  4FW9 A;  1FNM A;  3IWD A;  2JOX A;  4DR5 E;  1N32 E;  2Z5B A;  2L2N A;  2V88 A;  2LRS A;  1QZR A;  3M6A A;  3QT7 A;  4PU9 A;  5LMU I;  5DNY A;  3D4J A;  1XMQ I;  4DV5 I;  2VF3 A;  3RMP A;  4FN5 A;  2YT4 A;  2LUQ A;  4DV7 E;  4X66 E;  4LF5 I;  2V85 A;  4JI5 E;  4HAC B;  4GKK E;  4L8N A;  4DV3 E;  4K0K I;  4OX9 E;  2UU9 E;  1WXR A;  2R3V A;  1Z0V A;  1Z0E A;  2HFS A;  4FWG A;  4J8Z A;  2L2K B;  3V2U C;  4DPU A;  4KHP I;  2NUG A;  1HNW I;  4UTG A;  4JG4 A;  4HY1 A;  3KWR A;  2UUB E;  4YY3 E;  4BBY A;  1GZ6 A;  4DV6 E;  1ZM9 A;  4X62 E;  3FIG A;  4LF9 E;  4FWH A;  1ELO A;  1N36 E;  3ADG A;  4I8O A;  4JV5 E;  3WU4 A;  1WHQ A;  4HXZ A;  3QT6 A;  1DQ3 A;  2EWL A;  3JTZ A;  4B3S E;  2RS6 A;  4ED4 A;  4B3M E;  4LF6 E;  1HR0 E;  1KVK A;  2LMZ A;  4EMD A;  4IZK A;  1FKA E;  4JI2 E;  4F9B B;  2BM0 A;  2FV4 B;  4BMJ A;  3C4T A;  1QU6 A;  2JVA A;  3ADL A;  4JI0 I;  2Z5B B;  4JI4 I;  3Q6M A;  2VF1 A;  2DSY A;  2BV3 A;  3PYD A;  4YHH I;  1OJ4 A;  1ZBQ A;  4M30 A;  1ZXM A;  1KTV A;  1Z5B A;  3Q1Q A;  4X64 E;  5IT9 C;  3VYX A;  1XNR I;  4IZJ A;  2MC5 A;  3K6Q A;  1Z5C A;  1RQ0 A;  4LF4 E;  4DXL A;  5AE1 A;  4N3O A;  4LFA I;  1H74 A;  2JR1 A;  2G7H A;  4DV2 I;  4DV4 I;  2VQE I;  4P52 A;  1IBL E;  4WYQ B;  4L5N C;  5LMN E;  1XNQ I;  1H72 C;  2B7T A;  5LL6 R;  4X65 I;  1IBM E;  2V2Q A;  3HXL A;  4DR4 E;  2OI2 A;  1Z0G A;  3PRY A;  1N0U A;  2RTX A;  1X47 A;  3HUL A;  2PNM A;  3T1H E;  1UHZ A;  4LFC E;  3WU5 A;  3OTO I;  3LTO A;  2UUC E;  2UXC I;  2E5L I;  5BR8 I;  2UUA I;  4GEQ B;  5AE2 A;  4LF7 I;  3J7A M;  2E1M A;  4DR1 E;  2JY9 A;  4JI3 E;  4Z7Y A;  2ZM6 I;  3B78 A;  3HTX A;  4F54 A;  1IBK E;  4BC9 A;  4IZK B;  4X8W A;  3V5R A;  4I3H A;  5A2Q Q;  4UT4 A;  2DEJ A;  1N33 E;  1HK7 A;  3C4B A;  2O1T A;  1H73 A;  4AQY E;  1Z0C A;  1H7S A;  1Z0T A;  4B3T I;  2O1U A;  1HNX I;  1UEK A;  3WU3 A;  2UXD E;  4DU7 A;  4M2Z A;  4JI7 E;  3ADI A;  4DR5 I;  1N32 I;  3LLH A;  2DB2 A;  4DV0 E;  1Z0W A;  1PKP A;  1X49 A;  3VK6 A;  1N34 E;  1YYO A;  2IOP A;  4OOG C;  4BC7 A;  1S16 A;  1WHN A;  1I94 E;  4IZJ B;  4JYA E;  1EA6 A;  4PRX A;  1ZM4 A;  4BS9 A;  3T1Y E;  4LFB E;  2CG9 A;  4DV7 I;  3ZKD A;  4X66 I;  4JI5 I;  4GKK I;  2GQ0 A;  4DV3 I;  2H36 X;  2F4V E;  4OX9 I;  4IZJ D;  2DIX A;  4F9C B;  2LUP B;  2UU9 I;  2BM1 A;  4DUY E;  3LML A;  1Z0B A;  1FJG E;  2Q2E B;  2NUE A;  2UUB I;  4DR7 E;  4YY3 I;  4DR6 E;  3JAM Q;  1USV A;  4JI1 E;  2XEX A;  4DV6 I;  4X62 I;  1Y6Z A;  1FI4 A;  4LF9 I;  2R42 A;  1N36 I;  4P78 A;  2KHX A;  4JV5 I;  3P1X A;  1EKZ A;  2B7V A;  1J26 A;  1NHJ A;  5F3W A;  4B3R E;  2EZ6 A;  4B3S I;  4MYU A;  1KIJ A;  4B3M I;  4LF6 I;  4GKJ E;  1DI2 A;  1HR0 I;  4WFT A;  2VQF E;  5FLX Q;  1T4N A;  3IWB A;  1T4L B;  4BCA A;  3J7A G;  4JI8 E;  2L92 A;  4JI2 I;  2A2D A;  1ZXN A;  4KZS A;  2MC6 A;  1ZM2 A;  1YZ9 A;  2FGG A;  2HFU A;  3HJC A;  3ZZU A;  4P7D A;  2IOQ A;  3PYE A;  4TUI A;  1NHH A;  2N3G A;  5T6J A;  1DAR A;  1XMO E;  1UIL A;  3J80 Q;  4X64 I;  2DMY A;  2UXB E;  1WUU A;  4URL A;  1J5E E;  3ZOQ B;  4LF4 I;  4FWD A;  3CWV A;  2E1R A;  3ZKB A;  1YYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...