4DV2E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 32
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv2E02
1HNZE 1QU6A 1H7UA 4JV5I 1HNXI 4K0KI 5A2QQ 1N34E 2LJHA 4B3ME 1MG7A 1B63A 2IHR1 4GKKE 4JI5E 1RC7A 4NXNI 1Z59A 4JI6I 2VQFE 1DARA 4X8WA 4DR6E 1H72C 2YT4A 1FNMA 1S16A 5FLXC 3HTXA 4DV2E 4UTGA 3QT8A 4DR3I 4JI4I 2UXCI 2BM1A 2RSMA 4PRXA 4DV3E 3T1HE 1FJGI 1H7SA 1ZM9A 1ZBTA 3QT7A 4DR2I 2EZ6A 2UUCE 1XNRE 4FW9A 5A2QC 4DR1I 3HULA 4KQVA 1XHKA 1HR0E 4FWGA 4DUYI 3WU6A 4HACA 1KVKA 4LF6E 3K17A 1RREA 3ADIA 5IWAE 1N33E 1UEKA 2N3GA 4WFTA 4PRVA 2A2CA 4YHHE 3OTOE 4DV4E 2ZBKB 1HNWI 1H74A 4LFBE 2L3JA 5LMNE 1VISA 3J7AG 4FN5A 2ZM6E 4LF9I 3J81Q 2A2DA 4DR5I 2EFGA 1N36I 2NUGA 4JI0I 4JI8I 2R3VA 4DV0I 1Z5CA 2E5LI 1X47A 1PIEA 2HHHE 1I94I 1Z5BA 4DPUA 1XNQE 4AQYI 4DR4I 1YYOA 4OX9E 4UT4A 5LMUI 4LFAI 1N0VC 4X66I 4DR7E 4DUZI 4LFCE 3J7AM 2HFSA 4LF8E 3PYDA 1QZRA 3J81C 4JI1E 3T1YI 4LF5I 2JVAA 2OI2A 2DEIA 5FLXQ 2BM0A 4DPWA 2HK2A 2UUAI 4DR6I 3PYEA 2L3CA 2RS6A 4M30A 2UXDI 2XEXA 4KHPI 2B7TA 4DV3I 4FWHA 4B3TE 1MU5A 4WUCA 1H73A 4DV1I 4X64I 1XMQE 4GKJE 2L2MA 3QT6A 4DXLA 3WU3A 2LTRA 3C4TA 4DV7E 2R42A 1IBKI 3JAMC 1MX0A 1FWKA 4P52A 3M6AA 1T4NA 4B3SI 4RPFA 4LF6I 2V2QA 4URLA 3ADJA 2UXBE 4HACB 5IT9C 2L2NA 1ZXMA 2F4VE 3OTOI 1IBMI 1KKHA 5LMNI 2KHXA 3GONA 1Z0GA 1B62A 4DKKA 3WU4A 4JI7E 2UU9I 1U2RA 2CPNA 5BR8I 1KTVA 1N32E 3ZZTA 2VQEI 2V2VA 1BKNA 1IBLI 4X65E 1Z0BA 1J5EE 2L2KB 4X62E 1N0UA 3VYYA 4MYTA 3LLHA 2NA2A 2GS8A 3ADGA 2X7IA 4DV6I 4JV5E 1HNXE 1FWLA 4K0KE 4M2ZA 2UUBI 4XTJA 4DU8A 2LUPB 3ZM7A 4OX9I 4B3RI 3K1JA 2LJPA 1ZM3A 1X48A 3F0NA 4DPXA 4HYMA 2VF3A 3QT5A 4NXNE 4JI2E 4LFCI 3LTOA 4JI6E 1T4OA 3VYXA 3Q1QA 3B78A 4OOGC 3V2UC 1Z5AA 5LL6R 4JYAI 2LBSB 4LF4E 1ZM4A 2X36A 4NXMI 2LTSA 4DR3E 4JI4E 2UXCE 2HKJA 4USMA 1YZ9A 5CFFE 1FJGE 2E1RA 2RTXA 4YY3I 4DR2E 1HNZI 4JG4A 1STUA 2NUEA 4LF7E 1S4EA 5GMEA 4DR1E 4B3TI 2WW4A 1N34I 4B3MI 4DUYE 1J26A 4M1KA 3H4LA 3JAMQ 1FKAE 1YYWA 2DEJA 4GKKI 4JI5I 1O0WA 1RQ0A 2VQFI 2B7VA 5IT9Q 2JY9A 4DV5E 1HNWE 4EMDA 2Q2EB 4USKA 4WUDA 3ZKBA 3LNUA 4DV2I 1XMOE 1K47A 1N36E 4JI0E 1EI1A 4ZVIA 4JI8E 2L33A 1WHNA 3T1HI 4DPTA 4DV0E 2E5LE 1ZM2A 1I94E 2UUCI 1XNRI 1OJ4A 4DPYA 1D6TA 4AQYE 4DU7A 1HR0I 4X62I 5LMUE 1EA6A 4LFAE 4X66E 4JI3E 4DUZE 5IWAI 1N33I 3ZZUA 3J80C 4YHHI 4DV4I 4LFBI 2ZM6I 5L3JA 3T1YE 4LF5E 4JI2I 2NUFA 3V5RA 2UUAE 1A6FA 2V34A 1Z0WA 3WU5A 2ZITA 4LF4I 2NPFA 2J7KA 2UXDE 1NHIA 1ELOA 2HHHI 4WYQB 4KHPE 1XNQI 1Z0TA 2AJ4A 4DV1E 4X64E 2BV3A 4HXZA 4LF7I 3B82A 4DR7I 3PYFA 1IBKE 1WHQA 1WUUA 1UHZA 2MDRA 4B3SE 4LF8I 3ZZ0A 3CWVA 4JI1I 4Z7YA 1EKZA 3B8HA 4DV5I 1IBME 1X49A 3C4BA 1NHJA 4PU9A 1XMOI 2CZ9A 2HFUA 1T4LB 2UU9E 1RR9A 2N3HA 3ADLA 5BR8E 2VQEE 4MYUA 1IBLE 2RS7A 1FI4A 2HKEA 1NZ0A 1Z0EA 1XMQI 4WUBA 4R1FA 4DV6E 2HK3A 4GKJI 2LUQA 2UUBE 4DV7I 4P7AA 2V2ZA 1PKPA 2DIXA 2LRSA 1DI2A 4B3RE 1Z0CA 4JI3I 4Z7CA 3J80Q 1Z0VA 4HY1A 3D4JA 4LF9E 2UXBI 4I3HA 4DR5E 1KIJA 3PYGA 2DB2A 3P1XA 3ZKDA 2F4VI 4JYAE 1NHHA 1YYKA 1GQEA 2V8PA 4NXME 4JI7I 5GMDA 3J7Yp 2B3TB 1UILA 1N32I 3LPSA 2DMYA 4FWDA 4X65I 4ED4A 1PVGA 1ZXNA 1J5EI 4DR4E 4YY3E
chains in the Genus database with same CATH superfamily
4NZVA 1HNZE 1QU6A 1H7UA 2NABA 1SR9A 1ZBQA 1G2FC 2PNZA 4JV5I 1HNXI 1IQOA 4IFDA 1WJPA 4K0KI 2EPRA 5A2QQ 3MHSC 1N34E 2LJHA 4B3ME 4WSPA 3VK6A 5C0XD 2DMIA 2JPAA 5K36F 2C37A 1MG7A 2MC6A 2EL5A 2O1WA 2EMIA 4BC7A 2EM6A 2IHR1 4JI5E 4GKKE 1B63A 2PNMA 5JEAC 1RC7A 2EPKX 1TF6A 4NXNI 1Z59A 4JI6I 5C0XA 2VQFE 2YRKA 1DARA 3BBGA 2K7IA 1UN6B 4X8WA 4DR6E 2CGEA 1H72C 4RHBB 2YT4A 3C6KA 1FNMA 2EL4A 2LMZA 1S16A 1G2DC 2RQLA 5FLXC 4KWYA 3HTXA 4DV2E 4UTGA 3QT8A 5K36B 4DR3I 2EWLA 4JI4I 2UXCI 3CDJA 2BM1A 4GEQB 2EM2A 4HEIA 2RSMA 3FIGA 4PRXA 4DV3E 2VESA 3T1HE 2EOZA 2WNRA 2JEBB 3HXLA 1FJGI 2EMKA 1H7SA 4BHBA 1ZM9A 5ELWA 2KONA 1ZBTA 2DSYA 3QT7A 2EMGA 4DR2I 2EZ6A 3THOB 2UUCE 1XNRE 4FW9A 2NN6B 2C38B 5A2QC 5JEAD 2BA1G 2EM7A 5AASA 4DR1I 2MKDA 3HULA 4KQVA 1XHKA 1HR0E 4FWGA 4DUYI 3WU6A 1AAYA 4HACA 2EMYA 3MSWA 1KVKA 4J3DA 4LF6E 3K17A 1RREA 1Y4UA 3ADIA 5IWAE 1N33E 1UEKA 1YFHA 2N3GA 2EMLA 4WFTA 1BB8A 4PRVA 3BGHA 5ADZA 4L5NC 2PNLA 1UDQA 2A2CA 4OO1E 4YHHE 3OTOE 4DV4E 2ZBKB 4F9CB 1HNWI 1H74A 4LFBE 4MDTA 2L3JA 5LMNE 2YTEA 1NEIA 4TUIA 1JK2A 2EOJA 1VISA 3J7AG 4FN5A 2ODRC 2ZM6E 4QNKA 4LF9I 2BBGA 3J81Q 2A2DA 3DF6A 4DR5I 2CSHA 2JEAA 4MU3A 2EFGA 2L92A 1N36I 2NUGA 1YUIA 2EPPA 4ZYEA 2EM0A 1HK7A 4JI0I 4JI8I 5AE2A 2BB8A 5A6KA 2EMCA 2HJJA 1VI7A 2V85A 3F6HA 2R3VA 1EH7A 4R03A 4DV0I 1DQ3A 1UBDC 1Z5CA 2E5LI 1X47A 1PIEA 2C39B 3JU0A 2HHHE 1I94I 1Z5BA 4DPUA 4BA1A 1XNQE 2Z5CB 2YSPA 2Z5BB 1R6LA 4AQYI 3DD6A 2GHFA 4IZKA 2EOSA 1OYSA 4DR4I 2EN6A 1YYOA 4OX9E 4MQYA 5DNXA 4TUGA 4R2SA 4UT4A 5FWKA 2IESA 5LMUI 2EMWA 1N0VC 4LFAI 4X66I 2YPNA 1PJTA 4DR7E 4FW6A 4DUZI 4I8OA 2LT7A 2WP8A 3HKMA 4LFCE 4IFDD 2EQ0A 3M7NG 4M0VA 3U1KA 2R76A 3J7AM 2PO2B 2GO4A 2HFSA 4IFDB 4LF8E 3PYDA 4OO1C 1QZRA 2M1SA 2EN3A 3J81C 4JI1E 2YTNA 2FTXB 3T1YI 4LF5I 2JVAA 3DJWA 3P3CA 2OI2A 2DEIA 2EMXA 5FLXQ 2BM0A 2C37B 4DPWA 4WSGA 2HK2A 2JE6B 2BR2B 2Z5EA 4MU1A 2UUAI 4DR6I 3HPZA 2EORA 2LO3A 3PYEA 1KJKA 5K36E 1JK1A 4BS9A 2ENCA 2YTOA 2CT1A 2L3CA 4WX9A 2RS6A 4R2EA 2HC5A 4O5GA 4M30A 4LPFA 3M85G 3EPJA 2UXDI 2LE2A 2XEXA 4KHPI 2KOUA 3M7ND 2B7TA 4P78A 4DV3I 2EN2A 4FWHA 1QNTA 4B3TE 1DGCA 1MU5A 4WUCA 4BA2B 4HTGA 1H73A 5EL9A 4DV1I 1GTKA 1XMQE 2EQ3A 4X64I 5JEAF 2PO1B 3LMLA 4OO1D 2EMBA 2MKNA 3HPSA 4GKJE 4MLVA 2EOYA 2L2MA 3F6GA 3QT6A 4DXLA 3WU3A 4ZYDA 2LTRA 3C4TA 4DV7E 1F2IG 2R42A 4N4RB 2EM4A 3JAMC 1MX0A 3H1CA 1IBKI 4OO1A 1FWKA 1YHCA 3PS1A 4P52A 4RH8A 3M6AA 1T4NA 1USVA 4B3SI 2EPAA 1AH5A 4R2QA 1A1JA 4RPFA 4LF6I 3M85D 3THNA 2YTIA 2V2QA 2NN6F 4URLA 2ELYA 3ADJA 2GQ0A 2EPCA 2UXBE 4HACB 5IXMB 5IT9C 5JEAB 2MC5A 1P42A 3B4TA 2EMHA 2L2NA 4BC9A 4LCHA 3M99B 3K85A 2RSIA 1ZXMA 2F4VE 3OTOI 1IBMI 1KKHA 5KL7A 1TF3A 5LMNI 2EM5A 2EN8A 4MLQA 5K36C 2KHXA 3GONA 1Z0GA 2EPZA 2YRMA 2EMZA 3HJCA 1B62A 4DKKA 3WU4A 4JI7E 5T6JA 4M9VC 2UU9I 1T39A 1U2RA 1TN9A 5DRQA 2CPNA 5BR8I 4J8ZA 3UHMA 3P76A 2AE8A 1RMDA 1N32E 1KTVA 2PO0B 3ZZTA 2JOBA 2IERA 2V2VA 3K6QA 2VQEI 2ELZA 1BKNA 2YTJA 4X65E 1Z0BA 1IBLI 2JEAB 1P47A 1J5EE 1A1GA 5AC4A 1Y5YA 2L2KB 4X62E 1N0UA 3VYYA 4MYTA 3AUZA 3LLHA 2M7QA 2NA2A 1IMUA 1E3HA 1A1KA 2GS8A 1SFEA 3ADGA 2X7IA 4GQUA 4DV6I 2YTQA 4JV5E 1HNXE 1FWLA 4K0KE 4M2ZA 2UUBI 2EOOA 2HGHA 4XTJA 1EH6A 2J65A 2J7JA 4BA1B 2LUPB 3ZM7A 4DU8A 4OX9I 2YZTA 3GMEA 2EM8A 4B3RI 3K1JA 2LJPA 4IZKB 1ZM3A 1X48A 2EOHA 3F0NA 4R2AA 4HYMA 4N3OA 4DPXA 5K36D 4F6MA 2LVHA 2VF3A 3QT5A 1YSAC 5KL5A 4JI2E 4NXNE 4LFCI 1T4OA 4JI6E 3LTOA 4AM3A 3VYXA 4O24A 3ECRA 3Q1QA 3H09A 3B78A 2EM3A 4OOGC 3V2UC 1Z5AA 4Q35B 5LL6R 5K36A 4JYAI 4DMIA 2JWOA 2WP8B 2EJ4A 4ZYGA 2O3ZA 2LBSB 2WBSA 4LF4E 1ZM4A 3L7ZA 2X36A 4NXMI 2LTSA 4DR3E 1UDNA 2JEBA 4F2JC 4JI4E 3PS2A 2UXCE 3TQMA 2EE8A 2V88A 2YU8A 2HKJA 1OYPA 1UDSA 4USMA 1YH8A 3AV0A 4IFDF 4F9AB 1YZ9A 3U1YA 5CFFE 3JTZA 1FJGE 2E1RA 2RTXA 4IZJD 4YY3I 4DR2E 1HNZI 1USUA 4JG4A 2YTDA 1STUA 2NUEA 4LF7E 1S4EA 2WBUA 2ENHA 5GMEA 4IZJA 4DR1E 4F9BB 4B3TI 2WW4A 2R1FA 2N8XA 2EN7A 2DLQA 1N34I 1UDOA 5C0XF 4F54A 4DUYE 1A1HA 4DR4E 4B3MI 2V83A 2YTPA 1J26A 4M1KA 2PNZB 3H4LA 3JAMQ 2EPMX 1FKAE 2V87A 1YYWA 2DEJA 1L4SA 4GKKI 1PDAA 4JI5I 1O0WA 2EOMA 2I9IA 1RQ0A 1Y6ZA 2YRHA 2WCC3 2VQFI 2EL6A 5EKWA 4LTYA 2B7VA 4QNJA 5IT9Q 1N3GA 2EPXA 2JY9A 4DV5E 1HNWE 4EMDA 5KL2A 5JEAE 2JR1A 4ZYHA 2Q2EB 4USKA 4OZEA 3IWBA 4IJDA 4O43A 3GLLA 4WUDA 5C0XB 3ZKBA 2Q8UA 4LOMA 3LNUA 2LJUA 2IOQA 3PS3A 4FW5A 4DV2I 1XMOE 4FK5C 2CVEA 4P7DA 1MGTA 1K47A 5LLQA 5KL4A 1MEYC 1N36E 4JI0E 1EI1A 4ZVIA 5KL3A 4JI8E 1OYRA 2C39A 1EH8A 2B9DA 2L33A 1WHNA 5A6BD 1BBOA 2NN6E 4DPTA 2Z5CA 3T1HI 4MU0A 2FGGA 4DV0E 2H36X 2VE7C 2E72A 2YU5A 2E5LE 1E3PA 4LCGA 3P3EA 3UK3C 1RHYA 1ZM2A 2EOEA 1I94E 1A1IA 2UUCI 1OJ4A 1XNRI 4DPYA 2WNRB 2M9AA 5A6BA 4FW3A 2EPLX 1D6TA 4AQYE 2V89A 2IOPA 4U3BA 1B69A 2GPIA 3GCMA 4L8NA 4DU7A 2L6MA 2WBTA 2EM9A 1HR0I 4X62I 2EPUA 2LV2A 5F3WA 5LMUE 1GZ6A 1X3CA 5A6JA 1BBGA 4F6NA 2G7HA 4X66E 4JI3E 5A69A 4LFAE 2PO2A 2DGCA 4KZSA 2VF1A 3ZOQB 4DUZE 1J5EI 2JT2A 1ZR9A 5IWAI 4R2DA 1Z1BA 4WXCA 3ZZUA 1N33I 2A25A 3J80C 2EOFA 4R2CA 3BF2A 3P06A 4YHHI 4DV4I 2F8BA 4LFBI 2YTFA 3IWDA 2JE6A 2BR2A 1XXEA 2ZM6I 4FW7A 3T1YE 5L3JA 4LF5E 2JOXA 3KRNA 4JI2I 4LCFA 3KZYA 2NUFA 1IQSA 3V5RA 2UUAE 5KL6A 1A6FA 1Y4SA 2V34A 1Z0WA 2V86A 2F1DA 4WXDA 2EPNA 3C6MA 3WU5A 2K4VA 2ZITA 4LF4I 2VRDA 2NPFA 1LLMC 5A6AA 2NN6C 1R6MA 2J7KA 3NZKA 2UXDE 1NHIA 1ELOA 5DRRA 3QG5C 2HHHI 4U3DA 4WYQB 4KHPE 4BA2A 2V8QB 1XNQI 4BHCA 3L7ZB 2PO1A 1Z0TA 4X9JA 2AJ4A 4BCAA 2DRPA 4DV1E 4X64E 2BV3A 4HXZA 2O1VA 4MU4A 1A1LA 4LF7I 4R2PA 3B82A 4DR7I 4IFDE 3CDIA 2DLKA 4NHRA 3PYFA 1IBKE 2D9HA 4NBQA 1WHQA 1WUUA 2GLIA 1UHZA 2MDRA 3L00A 4R8OA 2O1TA 4LU9A 4B3SE 5JEAA 4IZJB 4LF8I 3VHTB 2ENAA 1T38A 3EPLA 3ZZ0A 4O4KA 3CWVA 1X5WA 4FW4A 4JI1I 2NN6D 2EOXA 4Z7YA 2YTGA 5C0XE 2EMFA 1KYQA 3KWRA 2JP9A 1EKZA 3B8HA 5DNLA 4DV5I 1IBME 1X49A 4OKGA 3Q6MA 3C4BA 2NN6A 2EOIA 4WPYA 2C38A 1NHJA 3HQ1A 2PO0A 1X6FA 4PU9A 2BA1D 1XMOI 2WZOA 2CZ9A 2HFUA 1T4LB 2UU9E 1RR9A 2N3HA 3ADLA 5BR8E 3RMPA 2BA0G 2MDGA 5DNYA 2E1MA 2EN4A 5DRPA 1NCSA 2VQEE 1YUJA 4MYUA 1IBLE 2M4IA 2EN1A 2LCEA 2RS7A 1EA6A 1FI4A 2HKEA 1NZ0A 4OO1F 2EQ1A 1Z0EA 1XMQI 2EPOA 1X6EA 4WUBA 4R1FA 2JYAA 4DV6E 2HK3A 2YSOA 4GKJI 2LUQA 4AIDA 2FV4B 3EQ1A 2UUBE 1WXRA 3PRYA 4DV7I 3EPHA 4P7AA 2ADRA 1Y60A 2V2ZA 4IFDC 1PKPA 2EMAA 3EPKA 2DIXA 3KZZA 1PJQA 1X6HA 2LRSA 3OMLA 1DI2A 4B3RE 4IS1C 1Z0CA 4ISAA 4Z7CA 4JI3I 3J80Q 1Z0VA 4HY1A 3D4JA 2ODRD 1YPNA 2O1UA 4R2RA 2BA0D 4OO1B 4LF9E 2UXBI 4I3HA 2L8TA 4DR5E 4BMJA 4AIMA 3BIDA 1KIJA 3PYGA 2EOQA 2DB2A 3P1XA 2EP3A 3ZKDA 5C0XC 2F4VI 4JYAE 3IWCA 2GO3A 1NHHA 1A1FA 1YYKA 2CTDA 1GQEA 1WRJA 2RPCA 1ZAAC 4BBYA 2V8PA 2Z5BA 3Q6NA 4NXME 2JXPA 4JI7I 1PJSA 5TSEA 4GZNC 5GMDA 5AC5A 1UILA 2B3TB 3J7Yp 3MHHC 1N32I 1ZU1A 3P3GA 2YWQA 5AE1A 3LPSA 4IS9A 2CG9A 2DMYA 2I13A 5DROA 4FWDA 4X65I 4ED4A 5IV8B 1PVGA 1ZXNA 5AE3A 2PRTA 4YY3E 4Q28A
chains in the Genus database with same CATH topology
1HNZE 1QU6A 1H7UA 1SR9A 1ZBQA 4JV5I 1HNXI 4K0KI 5A2QQ 1N34E 2LJHA 4B3ME 4WSPA 3VK6A 1MG7A 2MC6A 2O1WA 4BC7A 1B63A 2IHR1 4GKKE 4JI5E 2PNMA 1RC7A 4NXNI 1Z59A 4JI6I 2VQFE 1DARA 2CGEA 4X8WA 4DR6E 1H72C 2YT4A 1FNMA 2LMZA 1S16A 5FLXC 3HTXA 4DV2E 4UTGA 3QT8A 4DR3I 2EWLA 4JI4I 2UXCI 2BM1A 4GEQB 2RSMA 3FIGA 4PRXA 4DV3E 3T1HE 3HXLA 1FJGI 1H7SA 1ZM9A 2KONA 1ZBTA 2DSYA 3QT7A 4DR2I 2EZ6A 2UUCE 1XNRE 4FW9A 5A2QC 5AASA 4DR1I 3HULA 4KQVA 1XHKA 1HR0E 4FWGA 4DUYI 3WU6A 4HACA 3MSWA 1KVKA 4LF6E 3K17A 1RREA 1Y4UA 3ADIA 5IWAE 1N33E 1UEKA 2N3GA 4WFTA 4PRVA 2PNLA 5ADZA 4L5NC 2A2CA 4YHHE 3OTOE 4DV4E 2ZBKB 4F9CB 1HNWI 1H74A 4LFBE 2L3JA 5LMNE 4TUIA 1VISA 3J7AG 4FN5A 2ODRC 2ZM6E 4LF9I 3J81Q 2A2DA 3DF6A 4DR5I 2EFGA 2L92A 1N36I 2NUGA 4JI0I 1HK7A 4JI8I 5AE2A 2V85A 3F6HA 2R3VA 4R03A 4DV0I 1DQ3A 1Z5CA 2E5LI 1X47A 1PIEA 3JU0A 2HHHE 1I94I 1Z5BA 4DPUA 1XNQE 2Z5CB 2Z5BB 4AQYI 4IZKA 4DR4I 1YYOA 4OX9E 4TUGA 4UT4A 5FWKA 5LMUI 4LFAI 1N0VC 4X66I 4DR7E 4DUZI 4I8OA 4LFCE 4M0VA 3J7AM 2HFSA 4LF8E 3PYDA 1QZRA 2M1SA 3J81C 4JI1E 3T1YI 2FTXB 4LF5I 2JVAA 3DJWA 2OI2A 2DEIA 5FLXQ 2BM0A 4DPWA 2HK2A 2Z5EA 2UUAI 4DR6I 3HPZA 3PYEA 4BS9A 2L3CA 2RS6A 4M30A 2UXDI 2LE2A 2XEXA 4KHPI 2KOUA 2B7TA 4P78A 4DV3I 4FWHA 4B3TE 1MU5A 4WUCA 1H73A 4DV1I 4X64I 1XMQE 3LMLA 3HPSA 4GKJE 2L2MA 3F6GA 3QT6A 4DXLA 3WU3A 2LTRA 3C4TA 4DV7E 2R42A 1IBKI 3JAMC 1MX0A 1FWKA 4P52A 3M6AA 1T4NA 1USVA 4B3SI 4RPFA 4LF6I 2V2QA 4URLA 3ADJA 2GQ0A 2UXBE 4HACB 5IT9C 2MC5A 2L2NA 4BC9A 3K85A 1ZXMA 2F4VE 3OTOI 1IBMI 1KKHA 5LMNI 2KHXA 3GONA 1Z0GA 3HJCA 1B62A 4DKKA 3WU4A 4JI7E 5T6JA 2UU9I 1U2RA 2CPNA 5BR8I 4J8ZA 1KTVA 1N32E 3ZZTA 2JOBA 2VQEI 2V2VA 3K6QA 1BKNA 1IBLI 4X65E 1Z0BA 1J5EE 2L2KB 4X62E 1N0UA 3VYYA 4MYTA 3AUZA 3LLHA 2M7QA 2NA2A 2GS8A 3ADGA 2X7IA 4DV6I 4JV5E 1HNXE 1FWLA 4K0KE 4M2ZA 2UUBI 4XTJA 4DU8A 2LUPB 3ZM7A 4OX9I 2YZTA 4B3RI 3K1JA 2LJPA 4IZKB 1ZM3A 1X48A 3F0NA 4N3OA 4HYMA 4DPXA 2VF3A 3QT5A 4NXNE 4JI2E 4LFCI 1T4OA 4JI6E 3LTOA 3VYXA 3Q1QA 3H09A 3B78A 4OOGC 3V2UC 1Z5AA 5LL6R 4JYAI 4DMIA 2JWOA 2LBSB 4LF4E 1ZM4A 2X36A 4NXMI 2LTSA 4DR3E 4JI4E 2UXCE 2V88A 2HKJA 4USMA 3AV0A 4F9AB 1YZ9A 5CFFE 3JTZA 1FJGE 2E1RA 2RTXA 4IZJD 4YY3I 4DR2E 1HNZI 1USUA 4JG4A 1STUA 2NUEA 4LF7E 1S4EA 5GMEA 4IZJA 4DR1E 4F9BB 4B3TI 2WW4A 1N34I 4B3MI 4F54A 4DUYE 2V83A 1J26A 4M1KA 3H4LA 3JAMQ 1FKAE 2V87A 1YYWA 2DEJA 4GKKI 4JI5I 1O0WA 1Y6ZA 1RQ0A 2VQFI 4LTYA 2B7VA 5IT9Q 2JY9A 4DV5E 1HNWE 4EMDA 2JR1A 2Q2EB 4USKA 4WUDA 3IWBA 3ZKBA 3LNUA 2IOQA 4DV2I 1XMOE 4P7DA 1K47A 1N36E 4JI0E 1EI1A 4ZVIA 4JI8E 2B9DA 2L33A 1WHNA 3T1HI 4DPTA 2Z5CA 2FGGA 4DV0E 2H36X 2VE7C 2E5LE 1ZM2A 1I94E 2UUCI 1XNRI 1OJ4A 4DPYA 1D6TA 4AQYE 2V89A 2IOPA 4L8NA 4DU7A 2L6MA 1HR0I 4X62I 5F3WA 5LMUE 1GZ6A 4LFAE 1EA6A 2G7HA 4X66E 4JI3E 4KZSA 2VF1A 3ZOQB 4DUZE 1J5EI 5IWAI 1N33I 3ZZUA 3J80C 3P06A 4YHHI 4DV4I 2F8BA 4LFBI 3IWDA 2ZM6I 5L3JA 3T1YE 4LF5E 2JOXA 4JI2I 2NUFA 3V5RA 2UUAE 1A6FA 1Y4SA 2V34A 1Z0WA 2V86A 3WU5A 2K4VA 2ZITA 4LF4I 2NPFA 2J7KA 2UXDE 1NHIA 1ELOA 2HHHI 4WYQB 4KHPE 2V8QB 1XNQI 1Z0TA 2AJ4A 4BCAA 4DV1E 4X64E 2BV3A 4HXZA 2O1VA 4LF7I 3B82A 4DR7I 3PYFA 1IBKE 1WHQA 1WUUA 1UHZA 2MDRA 4R8OA 2O1TA 4LU9A 4B3SE 4IZJB 4LF8I 3ZZ0A 3CWVA 4JI1I 4Z7YA 3KWRA 1EKZA 3B8HA 4DV5I 1IBME 1X49A 3Q6MA 3C4BA 4WPYA 1NHJA 3HQ1A 4PU9A 1XMOI 2WZOA 2CZ9A 2HFUA 1T4LB 2UU9E 1RR9A 2N3HA 3ADLA 5BR8E 3RMPA 5DNYA 2E1MA 2VQEE 4MYUA 1IBLE 2M4IA 2RS7A 1FI4A 2HKEA 1NZ0A 1Z0EA 1XMQI 4WUBA 4R1FA 4DV6E 2HK3A 4GKJI 2LUQA 2FV4B 2UUBE 1WXRA 3PRYA 4DV7I 4P7AA 2V2ZA 1PKPA 2DIXA 2LRSA 3OMLA 1DI2A 4B3RE 1Z0CA 4JI3I 4Z7CA 3J80Q 1Z0VA 4HY1A 3D4JA 2ODRD 2O1UA 4LF9E 2UXBI 4I3HA 2L8TA 4DR5E 4BMJA 1KIJA 3PYGA 2DB2A 3P1XA 3ZKDA 2F4VI 4JYAE 3IWCA 1NHHA 1YYKA 1GQEA 4BBYA 2V8PA 2Z5BA 3Q6NA 4NXME 4JI7I 5GMDA 3J7Yp 1UILA 2B3TB 1N32I 5AE1A 3LPSA 2CG9A 2DMYA 4FWDA 4X65I 4ED4A 1PVGA 1ZXNA 5AE3A 4DR4E 4YY3E 4Q28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ E;  1QU6 A;  1H7U A;  4JV5 I;  1HNX I;  4K0K I;  5A2Q Q;  1N34 E;  2LJH A;  4B3M E;  1MG7 A;  1B63 A;  2IHR 1;  4GKK E;  4JI5 E;  1RC7 A;  4NXN I;  1Z59 A;  4JI6 I;  2VQF E;  1DAR A;  4X8W A;  4DR6 E;  1H72 C;  2YT4 A;  1FNM A;  1S16 A;  5FLX C;  3HTX A;  4DV2 E;  4UTG A;  3QT8 A;  4DR3 I;  4JI4 I;  2UXC I;  2BM1 A;  2RSM A;  4PRX A;  4DV3 E;  3T1H E;  1FJG I;  1H7S A;  1ZM9 A;  1ZBT A;  3QT7 A;  4DR2 I;  2EZ6 A;  2UUC E;  1XNR E;  4FW9 A;  5A2Q C;  4DR1 I;  3HUL A;  4KQV A;  1XHK A;  1HR0 E;  4FWG A;  4DUY I;  3WU6 A;  4HAC A;  1KVK A;  4LF6 E;  3K17 A;  1RRE A;  3ADI A;  5IWA E;  1N33 E;  1UEK A;  2N3G A;  4WFT A;  4PRV A;  2A2C A;  4YHH E;  3OTO E;  4DV4 E;  2ZBK B;  1HNW I;  1H74 A;  4LFB E;  2L3J A;  5LMN E;  1VIS A;  3J7A G;  4FN5 A;  2ZM6 E;  4LF9 I;  3J81 Q;  2A2D A;  4DR5 I;  2EFG A;  1N36 I;  2NUG A;  4JI0 I;  4JI8 I;  2R3V A;  4DV0 I;  1Z5C A;  2E5L I;  1X47 A;  1PIE A;  2HHH E;  1I94 I;  1Z5B A;  4DPU A;  1XNQ E;  4AQY I;  4DR4 I;  1YYO A;  4OX9 E;  4UT4 A;  5LMU I;  4LFA I;  1N0V C;  4X66 I;  4DR7 E;  4DUZ I;  4LFC E;  3J7A M;  2HFS A;  4LF8 E;  3PYD A;  1QZR A;  3J81 C;  4JI1 E;  3T1Y I;  4LF5 I;  2JVA A;  2OI2 A;  2DEI A;  5FLX Q;  2BM0 A;  4DPW A;  2HK2 A;  2UUA I;  4DR6 I;  3PYE A;  2L3C A;  2RS6 A;  4M30 A;  2UXD I;  2XEX A;  4KHP I;  2B7T A;  4DV3 I;  4FWH A;  4B3T E;  1MU5 A;  4WUC A;  1H73 A;  4DV1 I;  4X64 I;  1XMQ E;  4GKJ E;  2L2M A;  3QT6 A;  4DXL A;  3WU3 A;  2LTR A;  3C4T A;  4DV7 E;  2R42 A;  1IBK I;  3JAM C;  1MX0 A;  1FWK A;  4P52 A;  3M6A A;  1T4N A;  4B3S I;  4RPF A;  4LF6 I;  2V2Q A;  4URL A;  3ADJ A;  2UXB E;  4HAC B;  5IT9 C;  2L2N A;  1ZXM A;  2F4V E;  3OTO I;  1IBM I;  1KKH A;  5LMN I;  2KHX A;  3GON A;  1Z0G A;  1B62 A;  4DKK A;  3WU4 A;  4JI7 E;  2UU9 I;  1U2R A;  2CPN A;  5BR8 I;  1KTV A;  1N32 E;  3ZZT A;  2VQE I;  2V2V A;  1BKN A;  1IBL I;  4X65 E;  1Z0B A;  1J5E E;  2L2K B;  4X62 E;  1N0U A;  3VYY A;  4MYT A;  3LLH A;  2NA2 A;  2GS8 A;  3ADG A;  2X7I A;  4DV6 I;  4JV5 E;  1HNX E;  1FWL A;  4K0K E;  4M2Z A;  2UUB I;  4XTJ A;  4DU8 A;  2LUP B;  3ZM7 A;  4OX9 I;  4B3R I;  3K1J A;  2LJP A;  1ZM3 A;  1X48 A;  3F0N A;  4DPX A;  4HYM A;  2VF3 A;  3QT5 A;  4NXN E;  4JI2 E;  4LFC I;  3LTO A;  4JI6 E;  1T4O A;  3VYX A;  3Q1Q A;  3B78 A;  4OOG C;  3V2U C;  1Z5A A;  5LL6 R;  4JYA I;  2LBS B;  4LF4 E;  1ZM4 A;  2X36 A;  4NXM I;  2LTS A;  4DR3 E;  4JI4 E;  2UXC E;  2HKJ A;  4USM A;  1YZ9 A;  5CFF E;  1FJG E;  2E1R A;  2RTX A;  4YY3 I;  4DR2 E;  1HNZ I;  4JG4 A;  1STU A;  2NUE A;  4LF7 E;  1S4E A;  5GME A;  4DR1 E;  4B3T I;  2WW4 A;  1N34 I;  4B3M I;  4DUY E;  1J26 A;  4M1K A;  3H4L A;  3JAM Q;  1FKA E;  1YYW A;  2DEJ A;  4GKK I;  4JI5 I;  1O0W A;  1RQ0 A;  2VQF I;  2B7V A;  5IT9 Q;  2JY9 A;  4DV5 E;  1HNW E;  4EMD A;  2Q2E B;  4USK A;  4WUD A;  3ZKB A;  3LNU A;  4DV2 I;  1XMO E;  1K47 A;  1N36 E;  4JI0 E;  1EI1 A;  4ZVI A;  4JI8 E;  2L33 A;  1WHN A;  3T1H I;  4DPT A;  4DV0 E;  2E5L E;  1ZM2 A;  1I94 E;  2UUC I;  1XNR I;  1OJ4 A;  4DPY A;  1D6T A;  4AQY E;  4DU7 A;  1HR0 I;  4X62 I;  5LMU E;  1EA6 A;  4LFA E;  4X66 E;  4JI3 E;  4DUZ E;  5IWA I;  1N33 I;  3ZZU A;  3J80 C;  4YHH I;  4DV4 I;  4LFB I;  2ZM6 I;  5L3J A;  3T1Y E;  4LF5 E;  4JI2 I;  2NUF A;  3V5R A;  2UUA E;  1A6F A;  2V34 A;  1Z0W A;  3WU5 A;  2ZIT A;  4LF4 I;  2NPF A;  2J7K A;  2UXD E;  1NHI A;  1ELO A;  2HHH I;  4WYQ B;  4KHP E;  1XNQ I;  1Z0T A;  2AJ4 A;  4DV1 E;  4X64 E;  2BV3 A;  4HXZ A;  4LF7 I;  3B82 A;  4DR7 I;  3PYF A;  1IBK E;  1WHQ A;  1WUU A;  1UHZ A;  2MDR A;  4B3S E;  4LF8 I;  3ZZ0 A;  3CWV A;  4JI1 I;  4Z7Y A;  1EKZ A;  3B8H A;  4DV5 I;  1IBM E;  1X49 A;  3C4B A;  1NHJ A;  4PU9 A;  1XMO I;  2CZ9 A;  2HFU A;  1T4L B;  2UU9 E;  1RR9 A;  2N3H A;  3ADL A;  5BR8 E;  2VQE E;  4MYU A;  1IBL E;  2RS7 A;  1FI4 A;  2HKE A;  1NZ0 A;  1Z0E A;  1XMQ I;  4WUB A;  4R1F A;  4DV6 E;  2HK3 A;  4GKJ I;  2LUQ A;  2UUB E;  4DV7 I;  4P7A A;  2V2Z A;  1PKP A;  2DIX A;  2LRS A;  1DI2 A;  4B3R E;  1Z0C A;  4JI3 I;  4Z7C A;  3J80 Q;  1Z0V A;  4HY1 A;  3D4J A;  4LF9 E;  2UXB I;  4I3H A;  4DR5 E;  1KIJ A;  3PYG A;  2DB2 A;  3P1X A;  3ZKD A;  2F4V I;  4JYA E;  1NHH A;  1YYK A;  1GQE A;  2V8P A;  4NXM E;  4JI7 I;  5GMD A;  3J7Y p;  2B3T B;  1UIL A;  1N32 I;  3LPS A;  2DMY A;  4FWD A;  4X65 I;  4ED4 A;  1PVG A;  1ZXN A;  1J5E I;  4DR4 E;  4YY3 E; 
#chains in the Genus database with same CATH topology
 4NZV A;  1HNZ E;  1QU6 A;  1H7U A;  2NAB A;  1SR9 A;  1ZBQ A;  1G2F C;  2PNZ A;  4JV5 I;  1HNX I;  1IQO A;  4IFD A;  1WJP A;  4K0K I;  2EPR A;  5A2Q Q;  3MHS C;  1N34 E;  2LJH A;  4B3M E;  4WSP A;  3VK6 A;  5C0X D;  2DMI A;  2JPA A;  5K36 F;  2C37 A;  1MG7 A;  2MC6 A;  2EL5 A;  2O1W A;  2EMI A;  4BC7 A;  2EM6 A;  2IHR 1;  4JI5 E;  4GKK E;  1B63 A;  2PNM A;  5JEA C;  1RC7 A;  2EPK X;  1TF6 A;  4NXN I;  1Z59 A;  4JI6 I;  5C0X A;  2VQF E;  2YRK A;  1DAR A;  3BBG A;  2K7I A;  1UN6 B;  4X8W A;  4DR6 E;  2CGE A;  1H72 C;  4RHB B;  2YT4 A;  3C6K A;  1FNM A;  2EL4 A;  2LMZ A;  1S16 A;  1G2D C;  2RQL A;  5FLX C;  4KWY A;  3HTX A;  4DV2 E;  4UTG A;  3QT8 A;  5K36 B;  4DR3 I;  2EWL A;  4JI4 I;  2UXC I;  3CDJ A;  2BM1 A;  4GEQ B;  2EM2 A;  4HEI A;  2RSM A;  3FIG A;  4PRX A;  4DV3 E;  2VES A;  3T1H E;  2EOZ A;  2WNR A;  2JEB B;  3HXL A;  1FJG I;  2EMK A;  1H7S A;  4BHB A;  1ZM9 A;  5ELW A;  2KON A;  1ZBT A;  2DSY A;  3QT7 A;  2EMG A;  4DR2 I;  2EZ6 A;  3THO B;  2UUC E;  1XNR E;  4FW9 A;  2NN6 B;  2C38 B;  5A2Q C;  5JEA D;  2BA1 G;  2EM7 A;  5AAS A;  4DR1 I;  2MKD A;  3HUL A;  4KQV A;  1XHK A;  1HR0 E;  4FWG A;  4DUY I;  3WU6 A;  1AAY A;  4HAC A;  2EMY A;  3MSW A;  1KVK A;  4J3D A;  4LF6 E;  3K17 A;  1RRE A;  1Y4U A;  3ADI A;  5IWA E;  1N33 E;  1UEK A;  1YFH A;  2N3G A;  2EML A;  4WFT A;  1BB8 A;  4PRV A;  3BGH A;  5ADZ A;  4L5N C;  2PNL A;  1UDQ A;  2A2C A;  4OO1 E;  4YHH E;  3OTO E;  4DV4 E;  2ZBK B;  4F9C B;  1HNW I;  1H74 A;  4LFB E;  4MDT A;  2L3J A;  5LMN E;  2YTE A;  1NEI A;  4TUI A;  1JK2 A;  2EOJ A;  1VIS A;  3J7A G;  4FN5 A;  2ODR C;  2ZM6 E;  4QNK A;  4LF9 I;  2BBG A;  3J81 Q;  2A2D A;  3DF6 A;  4DR5 I;  2CSH A;  2JEA A;  4MU3 A;  2EFG A;  2L92 A;  1N36 I;  2NUG A;  1YUI A;  2EPP A;  4ZYE A;  2EM0 A;  1HK7 A;  4JI0 I;  4JI8 I;  5AE2 A;  2BB8 A;  5A6K A;  2EMC A;  2HJJ A;  1VI7 A;  2V85 A;  3F6H A;  2R3V A;  1EH7 A;  4R03 A;  4DV0 I;  1DQ3 A;  1UBD C;  1Z5C A;  2E5L I;  1X47 A;  1PIE A;  2C39 B;  3JU0 A;  2HHH E;  1I94 I;  1Z5B A;  4DPU A;  4BA1 A;  1XNQ E;  2Z5C B;  2YSP A;  2Z5B B;  1R6L A;  4AQY I;  3DD6 A;  2GHF A;  4IZK A;  2EOS A;  1OYS A;  4DR4 I;  2EN6 A;  1YYO A;  4OX9 E;  4MQY A;  5DNX A;  4TUG A;  4R2S A;  4UT4 A;  5FWK A;  2IES A;  5LMU I;  2EMW A;  1N0V C;  4LFA I;  4X66 I;  2YPN A;  1PJT A;  4DR7 E;  4FW6 A;  4DUZ I;  4I8O A;  2LT7 A;  2WP8 A;  3HKM A;  4LFC E;  4IFD D;  2EQ0 A;  3M7N G;  4M0V A;  3U1K A;  2R76 A;  3J7A M;  2PO2 B;  2GO4 A;  2HFS A;  4IFD B;  4LF8 E;  3PYD A;  4OO1 C;  1QZR A;  2M1S A;  2EN3 A;  3J81 C;  4JI1 E;  2YTN A;  2FTX B;  3T1Y I;  4LF5 I;  2JVA A;  3DJW A;  3P3C A;  2OI2 A;  2DEI A;  2EMX A;  5FLX Q;  2BM0 A;  2C37 B;  4DPW A;  4WSG A;  2HK2 A;  2JE6 B;  2BR2 B;  2Z5E A;  4MU1 A;  2UUA I;  4DR6 I;  3HPZ A;  2EOR A;  2LO3 A;  3PYE A;  1KJK A;  5K36 E;  1JK1 A;  4BS9 A;  2ENC A;  2YTO A;  2CT1 A;  2L3C A;  4WX9 A;  2RS6 A;  4R2E A;  2HC5 A;  4O5G A;  4M30 A;  4LPF A;  3M85 G;  3EPJ A;  2UXD I;  2LE2 A;  2XEX A;  4KHP I;  2KOU A;  3M7N D;  2B7T A;  4P78 A;  4DV3 I;  2EN2 A;  4FWH A;  1QNT A;  4B3T E;  1DGC A;  1MU5 A;  4WUC A;  4BA2 B;  4HTG A;  1H73 A;  5EL9 A;  4DV1 I;  1GTK A;  1XMQ E;  2EQ3 A;  4X64 I;  5JEA F;  2PO1 B;  3LML A;  4OO1 D;  2EMB A;  2MKN A;  3HPS A;  4GKJ E;  4MLV A;  2EOY A;  2L2M A;  3F6G A;  3QT6 A;  4DXL A;  3WU3 A;  4ZYD A;  2LTR A;  3C4T A;  4DV7 E;  1F2I G;  2R42 A;  4N4R B;  2EM4 A;  3JAM C;  1MX0 A;  3H1C A;  1IBK I;  4OO1 A;  1FWK A;  1YHC A;  3PS1 A;  4P52 A;  4RH8 A;  3M6A A;  1T4N A;  1USV A;  4B3S I;  2EPA A;  1AH5 A;  4R2Q A;  1A1J A;  4RPF A;  4LF6 I;  3M85 D;  3THN A;  2YTI A;  2V2Q A;  2NN6 F;  4URL A;  2ELY A;  3ADJ A;  2GQ0 A;  2EPC A;  2UXB E;  4HAC B;  5IXM B;  5IT9 C;  5JEA B;  2MC5 A;  1P42 A;  3B4T A;  2EMH A;  2L2N A;  4BC9 A;  4LCH A;  3M99 B;  3K85 A;  2RSI A;  1ZXM A;  2F4V E;  3OTO I;  1IBM I;  1KKH A;  5KL7 A;  1TF3 A;  5LMN I;  2EM5 A;  2EN8 A;  4MLQ A;  5K36 C;  2KHX A;  3GON A;  1Z0G A;  2EPZ A;  2YRM A;  2EMZ A;  3HJC A;  1B62 A;  4DKK A;  3WU4 A;  4JI7 E;  5T6J A;  4M9V C;  2UU9 I;  1T39 A;  1U2R A;  1TN9 A;  5DRQ A;  2CPN A;  5BR8 I;  4J8Z A;  3UHM A;  3P76 A;  2AE8 A;  1RMD A;  1N32 E;  1KTV A;  2PO0 B;  3ZZT A;  2JOB A;  2IER A;  2V2V A;  3K6Q A;  2VQE I;  2ELZ A;  1BKN A;  2YTJ A;  4X65 E;  1Z0B A;  1IBL I;  2JEA B;  1P47 A;  1J5E E;  1A1G A;  5AC4 A;  1Y5Y A;  2L2K B;  4X62 E;  1N0U A;  3VYY A;  4MYT A;  3AUZ A;  3LLH A;  2M7Q A;  2NA2 A;  1IMU A;  1E3H A;  1A1K A;  2GS8 A;  1SFE A;  3ADG A;  2X7I A;  4GQU A;  4DV6 I;  2YTQ A;  4JV5 E;  1HNX E;  1FWL A;  4K0K E;  4M2Z A;  2UUB I;  2EOO A;  2HGH A;  4XTJ A;  1EH6 A;  2J65 A;  2J7J A;  4BA1 B;  2LUP B;  3ZM7 A;  4DU8 A;  4OX9 I;  2YZT A;  3GME A;  2EM8 A;  4B3R I;  3K1J A;  2LJP A;  4IZK B;  1ZM3 A;  1X48 A;  2EOH A;  3F0N A;  4R2A A;  4HYM A;  4N3O A;  4DPX A;  5K36 D;  4F6M A;  2LVH A;  2VF3 A;  3QT5 A;  1YSA C;  5KL5 A;  4JI2 E;  4NXN E;  4LFC I;  1T4O A;  4JI6 E;  3LTO A;  4AM3 A;  3VYX A;  4O24 A;  3ECR A;  3Q1Q A;  3H09 A;  3B78 A;  2EM3 A;  4OOG C;  3V2U C;  1Z5A A;  4Q35 B;  5LL6 R;  5K36 A;  4JYA I;  4DMI A;  2JWO A;  2WP8 B;  2EJ4 A;  4ZYG A;  2O3Z A;  2LBS B;  2WBS A;  4LF4 E;  1ZM4 A;  3L7Z A;  2X36 A;  4NXM I;  2LTS A;  4DR3 E;  1UDN A;  2JEB A;  4F2J C;  4JI4 E;  3PS2 A;  2UXC E;  3TQM A;  2EE8 A;  2V88 A;  2YU8 A;  2HKJ A;  1OYP A;  1UDS A;  4USM A;  1YH8 A;  3AV0 A;  4IFD F;  4F9A B;  1YZ9 A;  3U1Y A;  5CFF E;  3JTZ A;  1FJG E;  2E1R A;  2RTX A;  4IZJ D;  4YY3 I;  4DR2 E;  1HNZ I;  1USU A;  4JG4 A;  2YTD A;  1STU A;  2NUE A;  4LF7 E;  1S4E A;  2WBU A;  2ENH A;  5GME A;  4IZJ A;  4DR1 E;  4F9B B;  4B3T I;  2WW4 A;  2R1F A;  2N8X A;  2EN7 A;  2DLQ A;  1N34 I;  1UDO A;  5C0X F;  4F54 A;  4DUY E;  1A1H A;  4DR4 E;  4B3M I;  2V83 A;  2YTP A;  1J26 A;  4M1K A;  2PNZ B;  3H4L A;  3JAM Q;  2EPM X;  1FKA E;  2V87 A;  1YYW A;  2DEJ A;  1L4S A;  4GKK I;  1PDA A;  4JI5 I;  1O0W A;  2EOM A;  2I9I A;  1RQ0 A;  1Y6Z A;  2YRH A;  2WCC 3;  2VQF I;  2EL6 A;  5EKW A;  4LTY A;  2B7V A;  4QNJ A;  5IT9 Q;  1N3G A;  2EPX A;  2JY9 A;  4DV5 E;  1HNW E;  4EMD A;  5KL2 A;  5JEA E;  2JR1 A;  4ZYH A;  2Q2E B;  4USK A;  4OZE A;  3IWB A;  4IJD A;  4O43 A;  3GLL A;  4WUD A;  5C0X B;  3ZKB A;  2Q8U A;  4LOM A;  3LNU A;  2LJU A;  2IOQ A;  3PS3 A;  4FW5 A;  4DV2 I;  1XMO E;  4FK5 C;  2CVE A;  4P7D A;  1MGT A;  1K47 A;  5LLQ A;  5KL4 A;  1MEY C;  1N36 E;  4JI0 E;  1EI1 A;  4ZVI A;  5KL3 A;  4JI8 E;  1OYR A;  2C39 A;  1EH8 A;  2B9D A;  2L33 A;  1WHN A;  5A6B D;  1BBO A;  2NN6 E;  4DPT A;  2Z5C A;  3T1H I;  4MU0 A;  2FGG A;  4DV0 E;  2H36 X;  2VE7 C;  2E72 A;  2YU5 A;  2E5L E;  1E3P A;  4LCG A;  3P3E A;  3UK3 C;  1RHY A;  1ZM2 A;  2EOE A;  1I94 E;  1A1I A;  2UUC I;  1OJ4 A;  1XNR I;  4DPY A;  2WNR B;  2M9A A;  5A6B A;  4FW3 A;  2EPL X;  1D6T A;  4AQY E;  2V89 A;  2IOP A;  4U3B A;  1B69 A;  2GPI A;  3GCM A;  4L8N A;  4DU7 A;  2L6M A;  2WBT A;  2EM9 A;  1HR0 I;  4X62 I;  2EPU A;  2LV2 A;  5F3W A;  5LMU E;  1GZ6 A;  1X3C A;  5A6J A;  1BBG A;  4F6N A;  2G7H A;  4X66 E;  4JI3 E;  5A69 A;  4LFA E;  2PO2 A;  2DGC A;  4KZS A;  2VF1 A;  3ZOQ B;  4DUZ E;  1J5E I;  2JT2 A;  1ZR9 A;  5IWA I;  4R2D A;  1Z1B A;  4WXC A;  3ZZU A;  1N33 I;  2A25 A;  3J80 C;  2EOF A;  4R2C A;  3BF2 A;  3P06 A;  4YHH I;  4DV4 I;  2F8B A;  4LFB I;  2YTF A;  3IWD A;  2JE6 A;  2BR2 A;  1XXE A;  2ZM6 I;  4FW7 A;  3T1Y E;  5L3J A;  4LF5 E;  2JOX A;  3KRN A;  4JI2 I;  4LCF A;  3KZY A;  2NUF A;  1IQS A;  3V5R A;  2UUA E;  5KL6 A;  1A6F A;  1Y4S A;  2V34 A;  1Z0W A;  2V86 A;  2F1D A;  4WXD A;  2EPN A;  3C6M A;  3WU5 A;  2K4V A;  2ZIT A;  4LF4 I;  2VRD A;  2NPF A;  1LLM C;  5A6A A;  2NN6 C;  1R6M A;  2J7K A;  3NZK A;  2UXD E;  1NHI A;  1ELO A;  5DRR A;  3QG5 C;  2HHH I;  4U3D A;  4WYQ B;  4KHP E;  4BA2 A;  2V8Q B;  1XNQ I;  4BHC A;  3L7Z B;  2PO1 A;  1Z0T A;  4X9J A;  2AJ4 A;  4BCA A;  2DRP A;  4DV1 E;  4X64 E;  2BV3 A;  4HXZ A;  2O1V A;  4MU4 A;  1A1L A;  4LF7 I;  4R2P A;  3B82 A;  4DR7 I;  4IFD E;  3CDI A;  2DLK A;  4NHR A;  3PYF A;  1IBK E;  2D9H A;  4NBQ A;  1WHQ A;  1WUU A;  2GLI A;  1UHZ A;  2MDR A;  3L00 A;  4R8O A;  2O1T A;  4LU9 A;  4B3S E;  5JEA A;  4IZJ B;  4LF8 I;  3VHT B;  2ENA A;  1T38 A;  3EPL A;  3ZZ0 A;  4O4K A;  3CWV A;  1X5W A;  4FW4 A;  4JI1 I;  2NN6 D;  2EOX A;  4Z7Y A;  2YTG A;  5C0X E;  2EMF A;  1KYQ A;  3KWR A;  2JP9 A;  1EKZ A;  3B8H A;  5DNL A;  4DV5 I;  1IBM E;  1X49 A;  4OKG A;  3Q6M A;  3C4B A;  2NN6 A;  2EOI A;  4WPY A;  2C38 A;  1NHJ A;  3HQ1 A;  2PO0 A;  1X6F A;  4PU9 A;  2BA1 D;  1XMO I;  2WZO A;  2CZ9 A;  2HFU A;  1T4L B;  2UU9 E;  1RR9 A;  2N3H A;  3ADL A;  5BR8 E;  3RMP A;  2BA0 G;  2MDG A;  5DNY A;  2E1M A;  2EN4 A;  5DRP A;  1NCS A;  2VQE E;  1YUJ A;  4MYU A;  1IBL E;  2M4I A;  2EN1 A;  2LCE A;  2RS7 A;  1EA6 A;  1FI4 A;  2HKE A;  1NZ0 A;  4OO1 F;  2EQ1 A;  1Z0E A;  1XMQ I;  2EPO A;  1X6E A;  4WUB A;  4R1F A;  2JYA A;  4DV6 E;  2HK3 A;  2YSO A;  4GKJ I;  2LUQ A;  4AID A;  2FV4 B;  3EQ1 A;  2UUB E;  1WXR A;  3PRY A;  4DV7 I;  3EPH A;  4P7A A;  2ADR A;  1Y60 A;  2V2Z A;  4IFD C;  1PKP A;  2EMA A;  3EPK A;  2DIX A;  3KZZ A;  1PJQ A;  1X6H A;  2LRS A;  3OML A;  1DI2 A;  4B3R E;  4IS1 C;  1Z0C A;  4ISA A;  4Z7C A;  4JI3 I;  3J80 Q;  1Z0V A;  4HY1 A;  3D4J A;  2ODR D;  1YPN A;  2O1U A;  4R2R A;  2BA0 D;  4OO1 B;  4LF9 E;  2UXB I;  4I3H A;  2L8T A;  4DR5 E;  4BMJ A;  4AIM A;  3BID A;  1KIJ A;  3PYG A;  2EOQ A;  2DB2 A;  3P1X A;  2EP3 A;  3ZKD A;  5C0X C;  2F4V I;  4JYA E;  3IWC A;  2GO3 A;  1NHH A;  1A1F A;  1YYK A;  2CTD A;  1GQE A;  1WRJ A;  2RPC A;  1ZAA C;  4BBY A;  2V8P A;  2Z5B A;  3Q6N A;  4NXM E;  2JXP A;  4JI7 I;  1PJS A;  5TSE A;  4GZN C;  5GMD A;  5AC5 A;  1UIL A;  2B3T B;  3J7Y p;  3MHH C;  1N32 I;  1ZU1 A;  3P3G A;  2YWQ A;  5AE1 A;  3LPS A;  4IS9 A;  2CG9 A;  2DMY A;  2I13 A;  5DRO A;  4FWD A;  4X65 I;  4ED4 A;  5IV8 B;  1PVG A;  1ZXN A;  5AE3 A;  2PRT A;  4YY3 E;  4Q28 A; 
#chains in the Genus database with same CATH homology
 1HNZ E;  1QU6 A;  1H7U A;  1SR9 A;  1ZBQ A;  4JV5 I;  1HNX I;  4K0K I;  5A2Q Q;  1N34 E;  2LJH A;  4B3M E;  4WSP A;  3VK6 A;  1MG7 A;  2MC6 A;  2O1W A;  4BC7 A;  1B63 A;  2IHR 1;  4GKK E;  4JI5 E;  2PNM A;  1RC7 A;  4NXN I;  1Z59 A;  4JI6 I;  2VQF E;  1DAR A;  2CGE A;  4X8W A;  4DR6 E;  1H72 C;  2YT4 A;  1FNM A;  2LMZ A;  1S16 A;  5FLX C;  3HTX A;  4DV2 E;  4UTG A;  3QT8 A;  4DR3 I;  2EWL A;  4JI4 I;  2UXC I;  2BM1 A;  4GEQ B;  2RSM A;  3FIG A;  4PRX A;  4DV3 E;  3T1H E;  3HXL A;  1FJG I;  1H7S A;  1ZM9 A;  2KON A;  1ZBT A;  2DSY A;  3QT7 A;  4DR2 I;  2EZ6 A;  2UUC E;  1XNR E;  4FW9 A;  5A2Q C;  5AAS A;  4DR1 I;  3HUL A;  4KQV A;  1XHK A;  1HR0 E;  4FWG A;  4DUY I;  3WU6 A;  4HAC A;  3MSW A;  1KVK A;  4LF6 E;  3K17 A;  1RRE A;  1Y4U A;  3ADI A;  5IWA E;  1N33 E;  1UEK A;  2N3G A;  4WFT A;  4PRV A;  2PNL A;  5ADZ A;  4L5N C;  2A2C A;  4YHH E;  3OTO E;  4DV4 E;  2ZBK B;  4F9C B;  1HNW I;  1H74 A;  4LFB E;  2L3J A;  5LMN E;  4TUI A;  1VIS A;  3J7A G;  4FN5 A;  2ODR C;  2ZM6 E;  4LF9 I;  3J81 Q;  2A2D A;  3DF6 A;  4DR5 I;  2EFG A;  2L92 A;  1N36 I;  2NUG A;  4JI0 I;  1HK7 A;  4JI8 I;  5AE2 A;  2V85 A;  3F6H A;  2R3V A;  4R03 A;  4DV0 I;  1DQ3 A;  1Z5C A;  2E5L I;  1X47 A;  1PIE A;  3JU0 A;  2HHH E;  1I94 I;  1Z5B A;  4DPU A;  1XNQ E;  2Z5C B;  2Z5B B;  4AQY I;  4IZK A;  4DR4 I;  1YYO A;  4OX9 E;  4TUG A;  4UT4 A;  5FWK A;  5LMU I;  4LFA I;  1N0V C;  4X66 I;  4DR7 E;  4DUZ I;  4I8O A;  4LFC E;  4M0V A;  3J7A M;  2HFS A;  4LF8 E;  3PYD A;  1QZR A;  2M1S A;  3J81 C;  4JI1 E;  3T1Y I;  2FTX B;  4LF5 I;  2JVA A;  3DJW A;  2OI2 A;  2DEI A;  5FLX Q;  2BM0 A;  4DPW A;  2HK2 A;  2Z5E A;  2UUA I;  4DR6 I;  3HPZ A;  3PYE A;  4BS9 A;  2L3C A;  2RS6 A;  4M30 A;  2UXD I;  2LE2 A;  2XEX A;  4KHP I;  2KOU A;  2B7T A;  4P78 A;  4DV3 I;  4FWH A;  4B3T E;  1MU5 A;  4WUC A;  1H73 A;  4DV1 I;  4X64 I;  1XMQ E;  3LML A;  3HPS A;  4GKJ E;  2L2M A;  3F6G A;  3QT6 A;  4DXL A;  3WU3 A;  2LTR A;  3C4T A;  4DV7 E;  2R42 A;  1IBK I;  3JAM C;  1MX0 A;  1FWK A;  4P52 A;  3M6A A;  1T4N A;  1USV A;  4B3S I;  4RPF A;  4LF6 I;  2V2Q A;  4URL A;  3ADJ A;  2GQ0 A;  2UXB E;  4HAC B;  5IT9 C;  2MC5 A;  2L2N A;  4BC9 A;  3K85 A;  1ZXM A;  2F4V E;  3OTO I;  1IBM I;  1KKH A;  5LMN I;  2KHX A;  3GON A;  1Z0G A;  3HJC A;  1B62 A;  4DKK A;  3WU4 A;  4JI7 E;  5T6J A;  2UU9 I;  1U2R A;  2CPN A;  5BR8 I;  4J8Z A;  1KTV A;  1N32 E;  3ZZT A;  2JOB A;  2VQE I;  2V2V A;  3K6Q A;  1BKN A;  1IBL I;  4X65 E;  1Z0B A;  1J5E E;  2L2K B;  4X62 E;  1N0U A;  3VYY A;  4MYT A;  3AUZ A;  3LLH A;  2M7Q A;  2NA2 A;  2GS8 A;  3ADG A;  2X7I A;  4DV6 I;  4JV5 E;  1HNX E;  1FWL A;  4K0K E;  4M2Z A;  2UUB I;  4XTJ A;  4DU8 A;  2LUP B;  3ZM7 A;  4OX9 I;  2YZT A;  4B3R I;  3K1J A;  2LJP A;  4IZK B;  1ZM3 A;  1X48 A;  3F0N A;  4N3O A;  4HYM A;  4DPX A;  2VF3 A;  3QT5 A;  4NXN E;  4JI2 E;  4LFC I;  1T4O A;  4JI6 E;  3LTO A;  3VYX A;  3Q1Q A;  3H09 A;  3B78 A;  4OOG C;  3V2U C;  1Z5A A;  5LL6 R;  4JYA I;  4DMI A;  2JWO A;  2LBS B;  4LF4 E;  1ZM4 A;  2X36 A;  4NXM I;  2LTS A;  4DR3 E;  4JI4 E;  2UXC E;  2V88 A;  2HKJ A;  4USM A;  3AV0 A;  4F9A B;  1YZ9 A;  5CFF E;  3JTZ A;  1FJG E;  2E1R A;  2RTX A;  4IZJ D;  4YY3 I;  4DR2 E;  1HNZ I;  1USU A;  4JG4 A;  1STU A;  2NUE A;  4LF7 E;  1S4E A;  5GME A;  4IZJ A;  4DR1 E;  4F9B B;  4B3T I;  2WW4 A;  1N34 I;  4B3M I;  4F54 A;  4DUY E;  2V83 A;  1J26 A;  4M1K A;  3H4L A;  3JAM Q;  1FKA E;  2V87 A;  1YYW A;  2DEJ A;  4GKK I;  4JI5 I;  1O0W A;  1Y6Z A;  1RQ0 A;  2VQF I;  4LTY A;  2B7V A;  5IT9 Q;  2JY9 A;  4DV5 E;  1HNW E;  4EMD A;  2JR1 A;  2Q2E B;  4USK A;  4WUD A;  3IWB A;  3ZKB A;  3LNU A;  2IOQ A;  4DV2 I;  1XMO E;  4P7D A;  1K47 A;  1N36 E;  4JI0 E;  1EI1 A;  4ZVI A;  4JI8 E;  2B9D A;  2L33 A;  1WHN A;  3T1H I;  4DPT A;  2Z5C A;  2FGG A;  4DV0 E;  2H36 X;  2VE7 C;  2E5L E;  1ZM2 A;  1I94 E;  2UUC I;  1XNR I;  1OJ4 A;  4DPY A;  1D6T A;  4AQY E;  2V89 A;  2IOP A;  4L8N A;  4DU7 A;  2L6M A;  1HR0 I;  4X62 I;  5F3W A;  5LMU E;  1GZ6 A;  4LFA E;  1EA6 A;  2G7H A;  4X66 E;  4JI3 E;  4KZS A;  2VF1 A;  3ZOQ B;  4DUZ E;  1J5E I;  5IWA I;  1N33 I;  3ZZU A;  3J80 C;  3P06 A;  4YHH I;  4DV4 I;  2F8B A;  4LFB I;  3IWD A;  2ZM6 I;  5L3J A;  3T1Y E;  4LF5 E;  2JOX A;  4JI2 I;  2NUF A;  3V5R A;  2UUA E;  1A6F A;  1Y4S A;  2V34 A;  1Z0W A;  2V86 A;  3WU5 A;  2K4V A;  2ZIT A;  4LF4 I;  2NPF A;  2J7K A;  2UXD E;  1NHI A;  1ELO A;  2HHH I;  4WYQ B;  4KHP E;  2V8Q B;  1XNQ I;  1Z0T A;  2AJ4 A;  4BCA A;  4DV1 E;  4X64 E;  2BV3 A;  4HXZ A;  2O1V A;  4LF7 I;  3B82 A;  4DR7 I;  3PYF A;  1IBK E;  1WHQ A;  1WUU A;  1UHZ A;  2MDR A;  4R8O A;  2O1T A;  4LU9 A;  4B3S E;  4IZJ B;  4LF8 I;  3ZZ0 A;  3CWV A;  4JI1 I;  4Z7Y A;  3KWR A;  1EKZ A;  3B8H A;  4DV5 I;  1IBM E;  1X49 A;  3Q6M A;  3C4B A;  4WPY A;  1NHJ A;  3HQ1 A;  4PU9 A;  1XMO I;  2WZO A;  2CZ9 A;  2HFU A;  1T4L B;  2UU9 E;  1RR9 A;  2N3H A;  3ADL A;  5BR8 E;  3RMP A;  5DNY A;  2E1M A;  2VQE E;  4MYU A;  1IBL E;  2M4I A;  2RS7 A;  1FI4 A;  2HKE A;  1NZ0 A;  1Z0E A;  1XMQ I;  4WUB A;  4R1F A;  4DV6 E;  2HK3 A;  4GKJ I;  2LUQ A;  2FV4 B;  2UUB E;  1WXR A;  3PRY A;  4DV7 I;  4P7A A;  2V2Z A;  1PKP A;  2DIX A;  2LRS A;  3OML A;  1DI2 A;  4B3R E;  1Z0C A;  4JI3 I;  4Z7C A;  3J80 Q;  1Z0V A;  4HY1 A;  3D4J A;  2ODR D;  2O1U A;  4LF9 E;  2UXB I;  4I3H A;  2L8T A;  4DR5 E;  4BMJ A;  1KIJ A;  3PYG A;  2DB2 A;  3P1X A;  3ZKD A;  2F4V I;  4JYA E;  3IWC A;  1NHH A;  1YYK A;  1GQE A;  4BBY A;  2V8P A;  2Z5B A;  3Q6N A;  4NXM E;  4JI7 I;  5GMD A;  3J7Y p;  1UIL A;  2B3T B;  1N32 I;  5AE1 A;  3LPS A;  2CG9 A;  2DMY A;  4FWD A;  4X65 I;  4ED4 A;  1PVG A;  1ZXN A;  5AE3 A;  4DR4 E;  4YY3 E;  4Q28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...