4DV2E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 32
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv2E02
1Z5BA 4DUYI 1UILA 1PKPA 4M2ZA 4YY3E 4JI5E 2V2VA 1Z0GA 1IBME 1S4EA 1DI2A 4DR5E 2UUBE 3QT8A 3WU4A 4GKJE 4X62I 1ZBTA 1U2RA 4DPUA 3ZM7A 4DR1I 1J5EI 1H7UA 4LFAE 1N34I 4DV4E 4X64E 4LFCI 1X47A 5LMUE 4JI1I 3B8HA 1KIJA 5FLXQ 4DV0I 4JI3E 4DPXA 2NUEA 3PYFA 4MYTA 1EI1A 4FWDA 2HK2A 1EKZA 1Z5AA 1UEKA 1OJ4A 3ZZ0A 1YYOA 4FW9A 1ZM3A 3ADJA 1XNRE 2OI2A 1N33E 2YT4A 3LTOA 4HACB 4WUCA 1A6FA 2JVAA 2RS7A 5FLXC 1GQEA 4B3RI 3WU3A 1ZXNA 2B3TB 4DR3E 1X48A 4LFBI 2HK3A 4X65I 4JI8E 2CPNA 4NXME 4DXLA 4DR7I 1XMOE 2UUAI 2LTSA 4B3MI 2HHHE 1NHIA 4FWGA 3PYDA 4DPWA 2LJHA 1N36I 4GKKE 4KQVA 1T4OA 2MDRA 2NUGA 4HACA 5BR8I 4DU7A 4AQYI 3C4TA 1YYKA 1BKNA 4YHHI 2IHR1 1MG7A 1YZ9A 4UT4A 4MYUA 1XNQI 4JV5I 1VISA 4R1FA 1NHJA 1I94I 4DPYA 1HNWI 1J26A 4X62E 2VQEI 1FWKA 4DR1E 1J5EE 2WW4A 2UXDI 1N34E 4DR2I 4K0KI 5A2QQ 4JYAI 2XEXA 2A2DA 4DR6I 3LLHA 1KTVA 1Z0VA 4JI1E 1EA6A 4DR4I 2RTXA 3T1YI 4DV2I 4DV0E 1T4NA 4RPFA 2N3GA 1XMQI 1ZM9A 4DU8A 1FKAE 3ZKDA 4DV1I 1MU5A 4DKKA 4LF5I 5A2QC 2BM0A 5GMDA 1IBLI 1WHNA 2L2NA 4B3RE 1Z0EA 2LBSB 3Q1QA 1RC7A 2VQFE 4LFBE 2N3HA 4DV6I 4Z7YA 2L3JA 1HNZI 3F0NA 4X65E 1HR0I 2UU9I 4WFTA 2DEIA 4DR7E 2HKEA 2ZM6I 2UUAE 4B3ME 4WYQB 1XHKA 4PRVA 1N32I 2ZITA 3T1HI 4X8WA 2VF3A 3J81Q 2JY9A 1N36E 5BR8E 2E5LE 4AQYE 1ZM2A 1FI4A 4DV3E 4YHHE 2F4VI 3JAMQ 1H72C 1ZM4A 1XNQE 4JV5E 5IWAI 4NXNE 2V34A 4LF6I 3B78A 1I94E 2X36A 2V2QA 3V2UC 3J81C 4JI5I 2VQEE 2KHXA 2UUCI 2UXDE 2J7KA 4DR2E 4K0KE 1RQ0A 4JYAE 1MX0A 4DR6E 2HKJA 2L2KB 3B82A 3J7AM 3JAMC 2NA2A 2CZ9A 4FN5A 4DR4E 4LF8I 1IBKI 3T1YE 4DV2E 1FWLA 4X66I 4LF9E 2L33A 2HFUA 1N0UA 2RSMA 3QT6A 5CFFE 1ZXMA 1PIEA 4DUYE 4DPTA 4DV1E 5GMEA 1FNMA 2DMYA 4LF5E 4OOGC 5IT9Q 4XTJA 4JI2I 2BV3A 4PU9A 2DB2A 4USMA 4B3SI 2NUFA 4JI0I 1FJGI 3M6AA 3QT5A 1O0WA 2X7IA 4JI7I 4B3TI 1PVGA 4DV6E 4DV5I 1B62A 4KHPI 4LFCE 1HNZE 3K17A 1H7SA 4HY1A 1HR0E 1S16A 1WHQA 1RR9A 3VYYA 2UU9E 5IT9C 3HTXA 4JI6I 2ZM6E 1ELOA 1DARA 4LF4I 2LUQA 4M30A 1WUUA 3OTOI 1N32E 3T1HE 4DUZI 2L2MA 4NXMI 2V8PA 3D4JA 2LRSA 2DIXA 1T4LB 1YYWA 2F4VE 4Z7CA 2EZ6A 3WU5A 3PYGA 1B63A 4URLA 3P1XA 5IWAE 5LMNI 2UXCI 1HNXI 4LF6E 4UTGA 1H74A 4OX9I 2UUCE 3CWVA 1Z0WA 4JI4I 2GS8A 1N0VC 4LF8E 2BM1A 1IBKE 4X66E 1Z5CA 4HXZA 4FWHA 2L3CA 4DV7I 3H4LA 2UXBI 3J7Yp 4LF7I 2V2ZA 2ZBKB 1KKHA 4P7AA 1X49A 2NPFA 2E1RA 4JI2E 2A2CA 4B3SE 3LPSA 4JI0E 1FJGE 3WU6A 1HNWE 4YY3I 1Z59A 4JI7E 4EMDA 1IBMI 4B3TE 3J80Q 4DR5I 4DV5E 2B7TA 4KHPE 3ZKBA 4ED4A 4JG4A 1Z0CA 1STUA 2DEJA 2UUBI 1UHZA 5L3JA 2LUPB 1D6TA 4GKJI 3ZZUA 1H73A 3VYXA 3HULA 2HFSA 3ADIA 2LTRA 2VQFI 4I3HA 4LFAI 4DV4I 4JI6E 4LF4E 4X64I 5LMUI 3ADLA 2R42A 1XMQE 3OTOE 4WUBA 3J7AG 1KVKA 3PYEA 2R3VA 4DUZE 4JI3I 3J80C 4ZVIA 3ADGA 3V5RA 1IBLE 1K47A 3LNUA 1XNRI 1N33I 2E5LI 1QU6A 5LMNE 2UXCE 1NZ0A 1HNXE 4DV3I 3ZZTA 2Q2EB 4OX9E 2AJ4A 4DR3I 4NXNI 3C4BA 4HYMA 4JI4E 1Z0TA 1NHHA 4USKA 5LL6R 4JI8I 1QZRA 4M1KA 1RREA 4DV7E 3GONA 2LJPA 4WUDA 1XMOI 3QT7A 4PRXA 2HHHI 1Z0BA 2UXBE 4LF7E 2RS6A 4LF9I 2EFGA 3K1JA 4P52A 4GKKI 2B7VA
chains in the Genus database with same CATH superfamily
5DNYA 2EQ1A 2EPRA 1Z5BA 4DUYI 1UILA 1YUJA 1PKPA 2JPAA 4M2ZA 1MGTA 4IFDC 4L8NA 4FW5A 4YY3E 4JI5E 2EM4A 2V2VA 1Z0GA 1IBME 1S4EA 4IS1C 1DI2A 2EMIA 4DR5E 2YTJA 3F6HA 4BMJA 1ZBQA 2FV4B 2UUBE 1XXEA 2DMIA 3QT8A 3WU4A 2BB8A 4GKJE 4X62I 2EPUA 1ZBTA 3C6MA 2GHFA 1U2RA 2BA0G 3ZM7A 4DPUA 4DR1I 2KONA 1J5EI 1H7UA 4LFAE 1N34I 2EOSA 4DV4E 2EJ4A 4MQYA 2JEAA 3KZYA 4TUIA 2BBGA 2WNRA 2V83A 4X64E 4LFCI 1X47A 5LMUE 2NN6B 4JI1I 1RMDA 4LCHA 2E1MA 3B8HA 2M4IA 1KIJA 5FLXQ 5JEAD 4DV0I 2GO4A 2IOPA 4JI3E 2C38B 4AIDA 4DPXA 2NUEA 3GCMA 3PYFA 4OZEA 4MYTA 1EI1A 4FWDA 2HK2A 3C6KA 1EKZA 1Z5AA 1UEKA 2F8BA 1QNTA 1OJ4A 1YYOA 3ZZ0A 4FW9A 2EMLA 2JR1A 1NEIA 1ZM3A 2YTDA 3ADJA 3K85A 4MU3A 3Q6MA 1XNRE 2EOJA 1N33E 2OI2A 4IZKB 4HEIA 2YT4A 4BA2A 3L00A 4O24A 3BIDA 1X3CA 4J8ZA 3LTOA 4HACB 2D9HA 2LV2A 2EMHA 2YTIA 5KL5A 1X6HA 2JVAA 2RS7A 1A6FA 4WUCA 3THNA 3GMEA 5FLXC 1GQEA 2PO2A 4B3RI 2V8QB 3WU3A 1ZXNA 2B3TB 3PS1A 4DR3E 3LMLA 1X48A 2V89A 5F3WA 4JI6I 4LFBI 5AE3A 2EPNA 4ZYEA 2HK3A 2NN6A 2NN6F 3ECRA 1YSAC 4X65I 3BGHA 2C38A 2WP8B 2EMCA 4JI8E 2CPNA 5T6JA 4NXME 4DXLA 4DR7I 3AUZA 2EM7A 2MC5A 1XMOE 2UUAI 2YSOA 2EM2A 2LTSA 5ADZA 4WPYA 1EH6A 4MU0A 2HC5A 4B3MI 2HHHE 1EH8A 4IFDB 1NHIA 4FWGA 3M7ND 3PYDA 4DPWA 4B3TI 5A6JA 4N4RB 4IZKA 2MKDA 2LJHA 2V85A 4MU1A 2EPMX 1N36I 4GKKE 4KQVA 1T4OA 2MDRA 2NUGA 2BR2B 2EN8A 4HACA 5BR8I 2PO1B 4DU7A 4AQYI 3C4TA 1YYKA 2R1FA 3IWBA 2JEBB 5C0XE 2MDGA 3MHSC 1BKNA 2EPZA 4YHHI 2IHR1 2CTDA 2EMFA 4RHBB 1MG7A 1YZ9A 4GEQB 1AAYA 4UT4A 2YZTA 2M7QA 4MYUA 1XNQI 4JV5I 1VISA 4R1FA 1YPNA 5C0XC 1A1LA 2L92A 1NHJA 4OO1D 1I94I 2EOEA 4DPYA 1HNWI 1J26A 4GZNC 1N3GA 3JTZA 4X62E 3ZOQB 2Z5BB 5EKWA 1FWKA 2WP8A 5DRRA 4DR1E 1KJKA 2VQEI 5K36D 1J5EE 2WW4A 2UXDI 1N34E 4DR2I 2YTGA 2EN7A 2VESA 4K0KI 2F1DA 3Q6NA 5A2QQ 2EE8A 3MSWA 4JYAI 3EQ1A 2XEXA 5A6BD 2A2DA 1R6MA 4DR6I 3LLHA 1KTVA 2JE6B 4IFDA 4IFDF 1Z0VA 4JI1E 4HTGA 1EA6A 2EMKA 4DR4I 2L8TA 2RTXA 3T1YI 4DV2I 4DV0E 2V86A 2YWQA 1T4NA 4DMIA 2V87A 4RPFA 5AC4A 2BR2A 2PO1A 2Q8UA 2N3GA 2JEBA 4NBQA 4Q35B 2BA1D 1XMQI 2YTNA 5JEAE 5A6AA 1G2DC 1ZM9A 4DU8A 2LJUA 1FKAE 3HPSA 2J65A 2JOXA 1PJTA 3ZKDA 2EL6A 4DV1I 4MLQA 4BA1A 1MU5A 4DKKA 4LF5I 5A2QC 1UN6B 2C39B 3H1CA 2BM0A 3B4TA 4BA2B 5GMDA 2PNLA 2EMYA 2J7JA 1WHNA 5AASA 2O1VA 3P3GA 1IBLI 3M99B 2L2NA 4B3RE 1Y4UA 2Z5BA 1Z0EA 1OYRA 2LBSB 2PO2B 3CDIA 5LLQA 5DRQA 3Q1QA 3OMLA 1RC7A 2EM8A 1A1FA 3KZZA 2VQFE 2N3HA 4LFBE 4DV6I 4NHRA 4Z7YA 4LOMA 2L3JA 2JE6A 1KYQA 1HNZI 3EPJA 4F9AB 3F0NA 4X65E 1HR0I 2A25A 4OO1C 2UU9I 4J3DA 4M0VA 4WFTA 2EPLX 2EN4A 2DEIA 4DR7E 2HKEA 2ZM6I 2UUAE 1GZ6A 5DRPA 4B3ME 2EL4A 2YSPA 4WYQB 1TN9A 1XHKA 4PRVA 1N32I 5A6KA 5KL2A 1R6LA 4X8WA 2ZITA 3T1HI 2VF3A 4RH8A 3GLLA 3J81Q 2C39A 2JY9A 1N36E 5C0XB 2EM6A 1DQ3A 2MC6A 4IZJB 5BR8E 2E5LE 2M1SA 4AQYE 1ZM2A 1A1IA 2FGGA 4LCGA 1FI4A 2EWLA 4DV3E 2EOHA 4YHHE 2F4VI 1Y5YA 2O1WA 3JAMQ 2V88A 2EN2A 4ZYGA 2JWOA 1H72C 1ZM4A 4BC9A 1XNQE 1SR9A 1X6EA 4JV5E 5IWAI 1B69A 2PO0A 3DJWA 4NXNE 3HPZA 4NZVA 2V34A 4LF6I 4F9CB 3B78A 1I94E 2EORA 2X36A 2V2QA 3V2UC 2JXPA 4TUGA 2LCEA 3J81C 4R2RA 2VQEE 4JI5I 1DGCA 2EOXA 2KHXA 3M85G 2UUCI 2UXDE 1Y6ZA 2J7KA 4DR2E 4K0KE 3U1KA 4OO1E 1RQ0A 4JYAE 1MX0A 2L6MA 2EOFA 2EOQA 4DR6E 2HKJA 5KL7A 1USVA 4O4KA 2L2KB 3B82A 2DSYA 3J7AM 3JAMC 2NA2A 5K36E 2CZ9A 4FN5A 4DR4E 4LF8I 3KRNA 1IBKI 3T1YE 4DV2E 1FWLA 1EH7A 4X66I 2WZOA 4R8OA 4LF9E 2L33A 5C0XA 5C0XF 2HFUA 1N0UA 2NABA 4IZJA 2EPAA 5KL3A 2RSMA 2O1UA 4R2AA 5AC5A 2ENAA 3QT6A 5CFFE 2EPOA 5K36C 2CG9A 2R42A 1ZXMA 4KWYA 1PIEA 4DUYE 4DPTA 2YRHA 1Z1BA 2IESA 4DV1E 1MEYC 1AH5A 2VF1A 3IWCA 2BA0D 5GMEA 4F6MA 1FNMA 1WJPA 3JU0A 2DMYA 4LF5E 3BBGA 4OOGC 4BA1B 2CSHA 2HGHA 5IT9Q 2EM5A 4XTJA 4JI2I 2WBTA 2BV3A 2EP3A 2YTFA 4PU9A 2DB2A 4USMA 4MLVA 4LTYA 2NUFA 5A69A 4JI0I 4B3SI 3HQ1A 2YRMA 1FJGI 1NCSA 4FK5C 3M6AA 3QT5A 2YU8A 1HK7A 1O0WA 2X7IA 2VRDA 4JI7I 3HJCA 2EQ3A 4BHCA 2KOUA 1JK1A 2B9DA 2EMAA 1PVGA 3NZKA 4DV6E 3P3EA 4DV5I 1B62A 4KHPI 1ZAAC 5ELWA 2EN3A 4ISAA 2CGEA 3BF2A 1USUA 4LFCE 1HNZE 1A1GA 3K17A 2EPXA 2EPKX 1H7SA 4HY1A 1HR0E 1S16A 3P3CA 2H36X 1OYSA 2PNZB 1WHQA 2ENCA 2YTEA 1RR9A 3VYYA 4F54A 2UU9E 5IT9C 2EOMA 5JEAA 3HTXA 5JEAF 1RHYA 4U3BA 1PDAA 2LE2A 2ZM6E 1BB8A 1ELOA 2C37B 1DARA 2NN6D 2EN6A 4LF4I 2LUQA 4OKGA 4M30A 4AM3A 1A1KA 2EOIA 2YU5A 2DGCA 1WUUA 1YHCA 3OTOI 2EM9A 2O3ZA 5AE1A 1N32E 1UDQA 3T1HE 2I9IA 2LO3A 4M9VC 2GO3A 5FWKA 2L2MA 1OYPA 2MKNA 3P06A 4GQUA 4DUZI 4NXMI 2PRTA 4BBYA 2V8PA 3D4JA 2ENHA 2LRSA 2DIXA 5JEAC 1IQSA 4MDTA 1X6FA 1YFHA 1ZU1A 1T4LB 2DRPA 4AIMA 1YYWA 3EPKA 2F4VE 4BS9A 1G2FC 4Z7CA 2EZ6A 3MHHC 3PYGA 3WU5A 2YRKA 1B63A 1GTKA 1T38A 4URLA 3P1XA 4R2PA 2EMZA 5IWAE 5LMNI 2UXCI 1HNXI 4LF6E 2PO0B 3L7ZA 2WCC3 1UDNA 4UTGA 4N3OA 1F2IG 3M7NG 4OO1B 2PNZA 1H74A 1UBDC 4OX9I 2JYAA 5IV8B 2UUCE 3PS3A 4FW4A 4R2CA 2DLQA 2C37A 5K36B 2JP9A 4WX9A 3CWVA 2ODRD 3HXLA 1Z0WA 4JI4I 4WXCA 2EOYA 1N0VC 2GS8A 3F6GA 2EPPA 4F2JC 4LF8E 2WBUA 2BM1A 4QNJA 1IBKE 3PS2A 2G7HA 4X66E 3HKMA 1YH8A 2K7IA 3IWDA 1Z5CA 4HXZA 3VK6A 4FWHA 2L3CA 1TF3A 4DV7I 1IQOA 4LCFA 1WRJA 4IFDD 4MU4A 4IS9A 3H4LA 2UXBI 2JT2A 1T39A 5KL4A 3J7Yp 4LF7I 4O43A 2EOZA 1SFEA 2V2ZA 2EL5A 2ZBKB 4P7DA 1KKHA 3RMPA 3U1YA 4P7AA 1X49A 2NPFA 1PJSA 2E1RA 4FW6A 4JI2E 3DF6A 2A2CA 2CT1A 4B3SE 3LPSA 4JI0E 1VI7A 5DNXA 1ZR9A 4OO1A 1FJGE 4OO1F 4WSGA 3WU6A 1HNWE 3AV0A 1BBOA 4YY3I 5AE2A 1L4SA 3P76A 1Z59A 3PRYA 3EPLA 4JI7E 1UDSA 1A1JA 4EMDA 1IBMI 4B3TE 5K36A 1LLMC 5K36F 3J80Q 4DR5I 3QG5C 4BCAA 2B7TA 4DV5E 4KHPE 3DD6A 3KWRA 4JG4A 3ZKBA 1Y60A 2BA1G 4ED4A 1Z0CA 1STUA 2DEJA 5DROA 2UUBI 1UHZA 5A6BA 5L3JA 3VHTB 2LUPB 1D6TA 4R2DA 3ZZUA 2LVHA 1H73A 1UDOA 4GKJI 3VYXA 3K6QA 1IMUA 3HULA 2R76A 5KL6A 2HFSA 3ADIA 2LTRA 1E3PA 4I3HA 2VQFI 4DV4I 4LFAI 4JI6E 2YTOA 5JEAB 4LF4E 4X64I 4ZYHA 5DNLA 3UHMA 5LMUI 1BBGA 4ZYDA 2ADRA 2EMGA 1WXRA 1XMQE 4O5GA 3FIGA 3OTOE 3ADLA 2IOQA 2GPIA 3J7AG 2WBSA 1KVKA 4WUBA 4I8OA 3PYEA 4R2SA 2R3VA 4DUZE 2NN6E 2GQ0A 4JI3I 4Q28A 3J80C 4ZVIA 2EOOA 2EQ0A 2RPCA 3ADGA 3V5RA 1YUIA 4F6NA 4WSPA 2LT7A 1IBLE 4QNKA 5EL9A 2NN6C 1K47A 4R2EA 2CVEA 4FW3A 2Z5CB 3LNUA 2ELYA 2PNMA 1XNRI 1N33I 2N8XA 4FW7A 2E5LI 1QU6A 2IERA 2EMBA 2EM0A 4R03A 5LMNE 2UXCE 1NZ0A 2HJJA 1HNXE 3UK3C 3CDJA 4DV3I 3EPHA 1Y4SA 3L7ZB 3H09A 4LPFA 3ZZTA 2Q2EB 1JK2A 4KZSA 2I13A 4X9JA 2DLKA 4OX9E 2O1TA 2AJ4A 4DR3I 5IXMB 4NXNI 2K4VA 1X5WA 4U3DA 3C4BA 2E72A 4WXDA 4HYMA 3THOB 2ELZA 4BC7A 4JI4E 2YTQA 1E3HA 5TSEA 2RQLA 4BHBA 1Z0TA 1TF6A 1PJQA 1NHHA 4USKA 2AE8A 2RSIA 4P78A 2YPNA 5LL6R 4JI8I 1P42A 1QZRA 4M1KA 1RREA 4DV7E 3GONA 2LJPA 4WUDA 1XMOI 2JEAB 2WNRB 3QT7A 4PRXA 2HHHI 1Z0BA 2FTXB 2JOBA 2EMWA 2EN1A 2VE7C 2YTPA 1A1HA 2UXBE 2GLIA 4IJDA 2M9AA 4LU9A 4LF7E 2EM3A 2LMZA 3TQMA 2ODRC 2RS6A 5C0XD 1P47A 4R2QA 2Z5CA 4LF9I 2EPCA 4IZJD 4IFDE 4F9BB 2EFGA 3K1JA 3M85D 2Z5EA 4P52A 4GKKI 2B7VA 4L5NC 2EMXA
chains in the Genus database with same CATH topology
5DNYA 1Z5BA 4DUYI 1UILA 1PKPA 4M2ZA 4L8NA 4YY3E 4JI5E 2V2VA 1Z0GA 1IBME 1S4EA 1DI2A 4DR5E 3F6HA 4BMJA 1ZBQA 2FV4B 2UUBE 3QT8A 3WU4A 4GKJE 4X62I 1ZBTA 1U2RA 4DPUA 3ZM7A 4DR1I 2KONA 1J5EI 1H7UA 4LFAE 1N34I 4DV4E 4TUIA 2V83A 4X64E 4LFCI 1X47A 5LMUE 4JI1I 2E1MA 3B8HA 2M4IA 1KIJA 5FLXQ 4DV0I 2IOPA 4JI3E 4DPXA 2NUEA 3PYFA 4MYTA 1EI1A 4FWDA 2HK2A 1EKZA 1Z5AA 1UEKA 2F8BA 1OJ4A 3ZZ0A 1YYOA 4FW9A 2JR1A 1ZM3A 3ADJA 3K85A 3Q6MA 1XNRE 2OI2A 1N33E 4IZKB 2YT4A 4J8ZA 3LTOA 4HACB 4WUCA 1A6FA 2JVAA 2RS7A 5FLXC 1GQEA 4B3RI 2V8QB 3WU3A 1ZXNA 2B3TB 4DR3E 3LMLA 1X48A 2V89A 5F3WA 4LFBI 5AE3A 2HK3A 4X65I 4JI8E 2CPNA 5T6JA 4NXME 4DXLA 4DR7I 3AUZA 2MC5A 1XMOE 2UUAI 2LTSA 5ADZA 4WPYA 4B3MI 2HHHE 1NHIA 4FWGA 3PYDA 4DPWA 4IZKA 2LJHA 2V85A 1N36I 4GKKE 4KQVA 1T4OA 2MDRA 2NUGA 4HACA 5BR8I 4DU7A 4AQYI 3C4TA 1YYKA 3IWBA 1BKNA 4YHHI 2IHR1 1MG7A 1YZ9A 4GEQB 4UT4A 2YZTA 2M7QA 4MYUA 1XNQI 4JV5I 1VISA 4R1FA 2L92A 1NHJA 1I94I 4DPYA 1HNWI 1J26A 2Z5BB 3JTZA 4X62E 3ZOQB 2VQEI 1FWKA 4DR1E 1J5EE 2WW4A 2UXDI 1N34E 4DR2I 4K0KI 3Q6NA 5A2QQ 3MSWA 4JYAI 2XEXA 2A2DA 4DR6I 3LLHA 1KTVA 1Z0VA 4JI1E 1EA6A 4DR4I 2L8TA 2RTXA 3T1YI 4DV2I 4DV0E 2V86A 1T4NA 4DMIA 2V87A 4RPFA 2N3GA 1XMQI 1ZM9A 4DU8A 1FKAE 3HPSA 2JOXA 3ZKDA 4DV1I 1MU5A 4DKKA 4LF5I 5A2QC 2BM0A 5GMDA 2PNLA 5AASA 1WHNA 2O1VA 1IBLI 2L2NA 4B3RE 1Y4UA 2Z5BA 1Z0EA 2LBSB 3Q1QA 3OMLA 1RC7A 2VQFE 4LFBE 2N3HA 4DV6I 4Z7YA 2L3JA 1HNZI 4F9AB 3F0NA 4X65E 1HR0I 2UU9I 4M0VA 4WFTA 2DEIA 4DR7E 2HKEA 2ZM6I 2UUAE 1GZ6A 4B3ME 4WYQB 1XHKA 4PRVA 1N32I 2ZITA 3T1HI 4X8WA 2VF3A 3J81Q 2JY9A 1N36E 1DQ3A 2MC6A 4IZJB 5BR8E 2E5LE 2M1SA 4AQYE 1ZM2A 2FGGA 1FI4A 2EWLA 4DV3E 4YHHE 2F4VI 2O1WA 3JAMQ 2V88A 2JWOA 1H72C 1ZM4A 4BC9A 1XNQE 1SR9A 4JV5E 5IWAI 3DJWA 4NXNE 3HPZA 2V34A 4LF6I 4F9CB 3B78A 1I94E 2X36A 2V2QA 3V2UC 4TUGA 3J81C 4JI5I 2VQEE 2KHXA 2UUCI 2UXDE 1Y6ZA 2J7KA 4DR2E 4K0KE 1RQ0A 4JYAE 1MX0A 2L6MA 4DR6E 2HKJA 1USVA 2L2KB 3B82A 3J7AM 2DSYA 3JAMC 2NA2A 2CZ9A 4FN5A 4DR4E 4LF8I 1IBKI 3T1YE 4DV2E 1FWLA 4X66I 2WZOA 4R8OA 4LF9E 2L33A 2HFUA 1N0UA 4IZJA 2RSMA 2O1UA 3QT6A 5CFFE 2CG9A 1ZXMA 1PIEA 4DUYE 4DPTA 4DV1E 2VF1A 3IWCA 5GMEA 1FNMA 3JU0A 2DMYA 4LF5E 4OOGC 5IT9Q 4XTJA 4JI2I 2BV3A 4PU9A 2DB2A 4USMA 4B3SI 4LTYA 2NUFA 4JI0I 3HQ1A 1FJGI 3M6AA 3QT5A 1HK7A 1O0WA 2X7IA 4JI7I 3HJCA 4B3TI 2KOUA 1PVGA 2B9DA 4DV6E 4DV5I 1B62A 4KHPI 2CGEA 1USUA 4LFCE 1HNZE 3K17A 1H7SA 4HY1A 1HR0E 1S16A 2H36X 1WHQA 1RR9A 3VYYA 4F54A 2UU9E 5IT9C 3HTXA 4JI6I 2LE2A 2ZM6E 1ELOA 1DARA 4LF4I 2LUQA 4M30A 1WUUA 3OTOI 5AE1A 1N32E 3T1HE 5FWKA 2L2MA 4DUZI 3P06A 4NXMI 4BBYA 2V8PA 3D4JA 2LRSA 2DIXA 1T4LB 1YYWA 2F4VE 4BS9A 4Z7CA 2EZ6A 3WU5A 3PYGA 1B63A 4URLA 3P1XA 5IWAE 5LMNI 2UXCI 1HNXI 4LF6E 4UTGA 4N3OA 1H74A 4OX9I 2UUCE 3CWVA 2ODRD 3HXLA 1Z0WA 4JI4I 2GS8A 1N0VC 3F6GA 4LF8E 2BM1A 1IBKE 2G7HA 4X66E 3IWDA 1Z5CA 4HXZA 3VK6A 4FWHA 2L3CA 4DV7I 3H4LA 2UXBI 3J7Yp 4LF7I 2V2ZA 2ZBKB 4P7DA 1KKHA 3RMPA 4P7AA 1X49A 2NPFA 2E1RA 4JI2E 3DF6A 2A2CA 4B3SE 3LPSA 4JI0E 1FJGE 3WU6A 1HNWE 3AV0A 4YY3I 5AE2A 3PRYA 1Z59A 4JI7E 4EMDA 1IBMI 4B3TE 3J80Q 4DR5I 4DV5E 4BCAA 2B7TA 4KHPE 3ZKBA 4ED4A 3KWRA 4JG4A 1Z0CA 1STUA 2DEJA 2UUBI 1UHZA 5L3JA 2LUPB 1D6TA 4GKJI 3ZZUA 1H73A 3VYXA 3K6QA 3HULA 2HFSA 3ADIA 2LTRA 2VQFI 4I3HA 4LFAI 4DV4I 4JI6E 4LF4E 4X64I 5LMUI 1WXRA 3ADLA 1XMQE 3FIGA 2IOQA 3OTOE 2R42A 4WUBA 3J7AG 1KVKA 4I8OA 3PYEA 2R3VA 4DUZE 2GQ0A 4JI3I 4Q28A 3J80C 4ZVIA 3ADGA 3V5RA 4WSPA 1IBLE 1K47A 2Z5CB 3LNUA 2PNMA 1XNRI 1N33I 2E5LI 1QU6A 4R03A 5LMNE 2UXCE 1NZ0A 1HNXE 4DV3I 1Y4SA 3H09A 3ZZTA 2Q2EB 4KZSA 4OX9E 2O1TA 2AJ4A 4DR3I 4NXNI 2K4VA 3C4BA 4HYMA 4BC7A 4JI4E 1Z0TA 1NHHA 4USKA 4P78A 5LL6R 4JI8I 1QZRA 4M1KA 1RREA 4DV7E 3GONA 2LJPA 4WUDA 1XMOI 3QT7A 4PRXA 2HHHI 1Z0BA 2FTXB 2JOBA 2UXBE 2VE7C 4LF7E 4LU9A 2LMZA 2ODRC 2RS6A 4LF9I 2Z5CA 4IZJD 4F9BB 2EFGA 3K1JA 2Z5EA 4P52A 4GKKI 2B7VA 4L5NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5B A;  4DUY I;  1UIL A;  1PKP A;  4M2Z A;  4YY3 E;  4JI5 E;  2V2V A;  1Z0G A;  1IBM E;  1S4E A;  1DI2 A;  4DR5 E;  2UUB E;  3QT8 A;  3WU4 A;  4GKJ E;  4X62 I;  1ZBT A;  1U2R A;  4DPU A;  3ZM7 A;  4DR1 I;  1J5E I;  1H7U A;  4LFA E;  1N34 I;  4DV4 E;  4X64 E;  4LFC I;  1X47 A;  5LMU E;  4JI1 I;  3B8H A;  1KIJ A;  5FLX Q;  4DV0 I;  4JI3 E;  4DPX A;  2NUE A;  3PYF A;  4MYT A;  1EI1 A;  4FWD A;  2HK2 A;  1EKZ A;  1Z5A A;  1UEK A;  1OJ4 A;  3ZZ0 A;  1YYO A;  4FW9 A;  1ZM3 A;  3ADJ A;  1XNR E;  2OI2 A;  1N33 E;  2YT4 A;  3LTO A;  4HAC B;  4WUC A;  1A6F A;  2JVA A;  2RS7 A;  5FLX C;  1GQE A;  4B3R I;  3WU3 A;  1ZXN A;  2B3T B;  4DR3 E;  1X48 A;  4LFB I;  2HK3 A;  4X65 I;  4JI8 E;  2CPN A;  4NXM E;  4DXL A;  4DR7 I;  1XMO E;  2UUA I;  2LTS A;  4B3M I;  2HHH E;  1NHI A;  4FWG A;  3PYD A;  4DPW A;  2LJH A;  1N36 I;  4GKK E;  4KQV A;  1T4O A;  2MDR A;  2NUG A;  4HAC A;  5BR8 I;  4DU7 A;  4AQY I;  3C4T A;  1YYK A;  1BKN A;  4YHH I;  2IHR 1;  1MG7 A;  1YZ9 A;  4UT4 A;  4MYU A;  1XNQ I;  4JV5 I;  1VIS A;  4R1F A;  1NHJ A;  1I94 I;  4DPY A;  1HNW I;  1J26 A;  4X62 E;  2VQE I;  1FWK A;  4DR1 E;  1J5E E;  2WW4 A;  2UXD I;  1N34 E;  4DR2 I;  4K0K I;  5A2Q Q;  4JYA I;  2XEX A;  2A2D A;  4DR6 I;  3LLH A;  1KTV A;  1Z0V A;  4JI1 E;  1EA6 A;  4DR4 I;  2RTX A;  3T1Y I;  4DV2 I;  4DV0 E;  1T4N A;  4RPF A;  2N3G A;  1XMQ I;  1ZM9 A;  4DU8 A;  1FKA E;  3ZKD A;  4DV1 I;  1MU5 A;  4DKK A;  4LF5 I;  5A2Q C;  2BM0 A;  5GMD A;  1IBL I;  1WHN A;  2L2N A;  4B3R E;  1Z0E A;  2LBS B;  3Q1Q A;  1RC7 A;  2VQF E;  4LFB E;  2N3H A;  4DV6 I;  4Z7Y A;  2L3J A;  1HNZ I;  3F0N A;  4X65 E;  1HR0 I;  2UU9 I;  4WFT A;  2DEI A;  4DR7 E;  2HKE A;  2ZM6 I;  2UUA E;  4B3M E;  4WYQ B;  1XHK A;  4PRV A;  1N32 I;  2ZIT A;  3T1H I;  4X8W A;  2VF3 A;  3J81 Q;  2JY9 A;  1N36 E;  5BR8 E;  2E5L E;  4AQY E;  1ZM2 A;  1FI4 A;  4DV3 E;  4YHH E;  2F4V I;  3JAM Q;  1H72 C;  1ZM4 A;  1XNQ E;  4JV5 E;  5IWA I;  4NXN E;  2V34 A;  4LF6 I;  3B78 A;  1I94 E;  2X36 A;  2V2Q A;  3V2U C;  3J81 C;  4JI5 I;  2VQE E;  2KHX A;  2UUC I;  2UXD E;  2J7K A;  4DR2 E;  4K0K E;  1RQ0 A;  4JYA E;  1MX0 A;  4DR6 E;  2HKJ A;  2L2K B;  3B82 A;  3J7A M;  3JAM C;  2NA2 A;  2CZ9 A;  4FN5 A;  4DR4 E;  4LF8 I;  1IBK I;  3T1Y E;  4DV2 E;  1FWL A;  4X66 I;  4LF9 E;  2L33 A;  2HFU A;  1N0U A;  2RSM A;  3QT6 A;  5CFF E;  1ZXM A;  1PIE A;  4DUY E;  4DPT A;  4DV1 E;  5GME A;  1FNM A;  2DMY A;  4LF5 E;  4OOG C;  5IT9 Q;  4XTJ A;  4JI2 I;  2BV3 A;  4PU9 A;  2DB2 A;  4USM A;  4B3S I;  2NUF A;  4JI0 I;  1FJG I;  3M6A A;  3QT5 A;  1O0W A;  2X7I A;  4JI7 I;  4B3T I;  1PVG A;  4DV6 E;  4DV5 I;  1B62 A;  4KHP I;  4LFC E;  1HNZ E;  3K17 A;  1H7S A;  4HY1 A;  1HR0 E;  1S16 A;  1WHQ A;  1RR9 A;  3VYY A;  2UU9 E;  5IT9 C;  3HTX A;  4JI6 I;  2ZM6 E;  1ELO A;  1DAR A;  4LF4 I;  2LUQ A;  4M30 A;  1WUU A;  3OTO I;  1N32 E;  3T1H E;  4DUZ I;  2L2M A;  4NXM I;  2V8P A;  3D4J A;  2LRS A;  2DIX A;  1T4L B;  1YYW A;  2F4V E;  4Z7C A;  2EZ6 A;  3WU5 A;  3PYG A;  1B63 A;  4URL A;  3P1X A;  5IWA E;  5LMN I;  2UXC I;  1HNX I;  4LF6 E;  4UTG A;  1H74 A;  4OX9 I;  2UUC E;  3CWV A;  1Z0W A;  4JI4 I;  2GS8 A;  1N0V C;  4LF8 E;  2BM1 A;  1IBK E;  4X66 E;  1Z5C A;  4HXZ A;  4FWH A;  2L3C A;  4DV7 I;  3H4L A;  2UXB I;  3J7Y p;  4LF7 I;  2V2Z A;  2ZBK B;  1KKH A;  4P7A A;  1X49 A;  2NPF A;  2E1R A;  4JI2 E;  2A2C A;  4B3S E;  3LPS A;  4JI0 E;  1FJG E;  3WU6 A;  1HNW E;  4YY3 I;  1Z59 A;  4JI7 E;  4EMD A;  1IBM I;  4B3T E;  3J80 Q;  4DR5 I;  4DV5 E;  2B7T A;  4KHP E;  3ZKB A;  4ED4 A;  4JG4 A;  1Z0C A;  1STU A;  2DEJ A;  2UUB I;  1UHZ A;  5L3J A;  2LUP B;  1D6T A;  4GKJ I;  3ZZU A;  1H73 A;  3VYX A;  3HUL A;  2HFS A;  3ADI A;  2LTR A;  2VQF I;  4I3H A;  4LFA I;  4DV4 I;  4JI6 E;  4LF4 E;  4X64 I;  5LMU I;  3ADL A;  2R42 A;  1XMQ E;  3OTO E;  4WUB A;  3J7A G;  1KVK A;  3PYE A;  2R3V A;  4DUZ E;  4JI3 I;  3J80 C;  4ZVI A;  3ADG A;  3V5R A;  1IBL E;  1K47 A;  3LNU A;  1XNR I;  1N33 I;  2E5L I;  1QU6 A;  5LMN E;  2UXC E;  1NZ0 A;  1HNX E;  4DV3 I;  3ZZT A;  2Q2E B;  4OX9 E;  2AJ4 A;  4DR3 I;  4NXN I;  3C4B A;  4HYM A;  4JI4 E;  1Z0T A;  1NHH A;  4USK A;  5LL6 R;  4JI8 I;  1QZR A;  4M1K A;  1RRE A;  4DV7 E;  3GON A;  2LJP A;  4WUD A;  1XMO I;  3QT7 A;  4PRX A;  2HHH I;  1Z0B A;  2UXB E;  4LF7 E;  2RS6 A;  4LF9 I;  2EFG A;  3K1J A;  4P52 A;  4GKK I;  2B7V A; 
#chains in the Genus database with same CATH topology
 5DNY A;  2EQ1 A;  2EPR A;  1Z5B A;  4DUY I;  1UIL A;  1YUJ A;  1PKP A;  2JPA A;  4M2Z A;  1MGT A;  4IFD C;  4L8N A;  4FW5 A;  4YY3 E;  4JI5 E;  2EM4 A;  2V2V A;  1Z0G A;  1IBM E;  1S4E A;  4IS1 C;  1DI2 A;  2EMI A;  4DR5 E;  2YTJ A;  3F6H A;  4BMJ A;  1ZBQ A;  2FV4 B;  2UUB E;  1XXE A;  2DMI A;  3QT8 A;  3WU4 A;  2BB8 A;  4GKJ E;  4X62 I;  2EPU A;  1ZBT A;  3C6M A;  2GHF A;  1U2R A;  2BA0 G;  3ZM7 A;  4DPU A;  4DR1 I;  2KON A;  1J5E I;  1H7U A;  4LFA E;  1N34 I;  2EOS A;  4DV4 E;  2EJ4 A;  4MQY A;  2JEA A;  3KZY A;  4TUI A;  2BBG A;  2WNR A;  2V83 A;  4X64 E;  4LFC I;  1X47 A;  5LMU E;  2NN6 B;  4JI1 I;  1RMD A;  4LCH A;  2E1M A;  3B8H A;  2M4I A;  1KIJ A;  5FLX Q;  5JEA D;  4DV0 I;  2GO4 A;  2IOP A;  4JI3 E;  2C38 B;  4AID A;  4DPX A;  2NUE A;  3GCM A;  3PYF A;  4OZE A;  4MYT A;  1EI1 A;  4FWD A;  2HK2 A;  3C6K A;  1EKZ A;  1Z5A A;  1UEK A;  2F8B A;  1QNT A;  1OJ4 A;  1YYO A;  3ZZ0 A;  4FW9 A;  2EML A;  2JR1 A;  1NEI A;  1ZM3 A;  2YTD A;  3ADJ A;  3K85 A;  4MU3 A;  3Q6M A;  1XNR E;  2EOJ A;  1N33 E;  2OI2 A;  4IZK B;  4HEI A;  2YT4 A;  4BA2 A;  3L00 A;  4O24 A;  3BID A;  1X3C A;  4J8Z A;  3LTO A;  4HAC B;  2D9H A;  2LV2 A;  2EMH A;  2YTI A;  5KL5 A;  1X6H A;  2JVA A;  2RS7 A;  1A6F A;  4WUC A;  3THN A;  3GME A;  5FLX C;  1GQE A;  2PO2 A;  4B3R I;  2V8Q B;  3WU3 A;  1ZXN A;  2B3T B;  3PS1 A;  4DR3 E;  3LML A;  1X48 A;  2V89 A;  5F3W A;  4JI6 I;  4LFB I;  5AE3 A;  2EPN A;  4ZYE A;  2HK3 A;  2NN6 A;  2NN6 F;  3ECR A;  1YSA C;  4X65 I;  3BGH A;  2C38 A;  2WP8 B;  2EMC A;  4JI8 E;  2CPN A;  5T6J A;  4NXM E;  4DXL A;  4DR7 I;  3AUZ A;  2EM7 A;  2MC5 A;  1XMO E;  2UUA I;  2YSO A;  2EM2 A;  2LTS A;  5ADZ A;  4WPY A;  1EH6 A;  4MU0 A;  2HC5 A;  4B3M I;  2HHH E;  1EH8 A;  4IFD B;  1NHI A;  4FWG A;  3M7N D;  3PYD A;  4DPW A;  4B3T I;  5A6J A;  4N4R B;  4IZK A;  2MKD A;  2LJH A;  2V85 A;  4MU1 A;  2EPM X;  1N36 I;  4GKK E;  4KQV A;  1T4O A;  2MDR A;  2NUG A;  2BR2 B;  2EN8 A;  4HAC A;  5BR8 I;  2PO1 B;  4DU7 A;  4AQY I;  3C4T A;  1YYK A;  2R1F A;  3IWB A;  2JEB B;  5C0X E;  2MDG A;  3MHS C;  1BKN A;  2EPZ A;  4YHH I;  2IHR 1;  2CTD A;  2EMF A;  4RHB B;  1MG7 A;  1YZ9 A;  4GEQ B;  1AAY A;  4UT4 A;  2YZT A;  2M7Q A;  4MYU A;  1XNQ I;  4JV5 I;  1VIS A;  4R1F A;  1YPN A;  5C0X C;  1A1L A;  2L92 A;  1NHJ A;  4OO1 D;  1I94 I;  2EOE A;  4DPY A;  1HNW I;  1J26 A;  4GZN C;  1N3G A;  3JTZ A;  4X62 E;  3ZOQ B;  2Z5B B;  5EKW A;  1FWK A;  2WP8 A;  5DRR A;  4DR1 E;  1KJK A;  2VQE I;  5K36 D;  1J5E E;  2WW4 A;  2UXD I;  1N34 E;  4DR2 I;  2YTG A;  2EN7 A;  2VES A;  4K0K I;  2F1D A;  3Q6N A;  5A2Q Q;  2EE8 A;  3MSW A;  4JYA I;  3EQ1 A;  2XEX A;  5A6B D;  2A2D A;  1R6M A;  4DR6 I;  3LLH A;  1KTV A;  2JE6 B;  4IFD A;  4IFD F;  1Z0V A;  4JI1 E;  4HTG A;  1EA6 A;  2EMK A;  4DR4 I;  2L8T A;  2RTX A;  3T1Y I;  4DV2 I;  4DV0 E;  2V86 A;  2YWQ A;  1T4N A;  4DMI A;  2V87 A;  4RPF A;  5AC4 A;  2BR2 A;  2PO1 A;  2Q8U A;  2N3G A;  2JEB A;  4NBQ A;  4Q35 B;  2BA1 D;  1XMQ I;  2YTN A;  5JEA E;  5A6A A;  1G2D C;  1ZM9 A;  4DU8 A;  2LJU A;  1FKA E;  3HPS A;  2J65 A;  2JOX A;  1PJT A;  3ZKD A;  2EL6 A;  4DV1 I;  4MLQ A;  4BA1 A;  1MU5 A;  4DKK A;  4LF5 I;  5A2Q C;  1UN6 B;  2C39 B;  3H1C A;  2BM0 A;  3B4T A;  4BA2 B;  5GMD A;  2PNL A;  2EMY A;  2J7J A;  1WHN A;  5AAS A;  2O1V A;  3P3G A;  1IBL I;  3M99 B;  2L2N A;  4B3R E;  1Y4U A;  2Z5B A;  1Z0E A;  1OYR A;  2LBS B;  2PO2 B;  3CDI A;  5LLQ A;  5DRQ A;  3Q1Q A;  3OML A;  1RC7 A;  2EM8 A;  1A1F A;  3KZZ A;  2VQF E;  2N3H A;  4LFB E;  4DV6 I;  4NHR A;  4Z7Y A;  4LOM A;  2L3J A;  2JE6 A;  1KYQ A;  1HNZ I;  3EPJ A;  4F9A B;  3F0N A;  4X65 E;  1HR0 I;  2A25 A;  4OO1 C;  2UU9 I;  4J3D A;  4M0V A;  4WFT A;  2EPL X;  2EN4 A;  2DEI A;  4DR7 E;  2HKE A;  2ZM6 I;  2UUA E;  1GZ6 A;  5DRP A;  4B3M E;  2EL4 A;  2YSP A;  4WYQ B;  1TN9 A;  1XHK A;  4PRV A;  1N32 I;  5A6K A;  5KL2 A;  1R6L A;  4X8W A;  2ZIT A;  3T1H I;  2VF3 A;  4RH8 A;  3GLL A;  3J81 Q;  2C39 A;  2JY9 A;  1N36 E;  5C0X B;  2EM6 A;  1DQ3 A;  2MC6 A;  4IZJ B;  5BR8 E;  2E5L E;  2M1S A;  4AQY E;  1ZM2 A;  1A1I A;  2FGG A;  4LCG A;  1FI4 A;  2EWL A;  4DV3 E;  2EOH A;  4YHH E;  2F4V I;  1Y5Y A;  2O1W A;  3JAM Q;  2V88 A;  2EN2 A;  4ZYG A;  2JWO A;  1H72 C;  1ZM4 A;  4BC9 A;  1XNQ E;  1SR9 A;  1X6E A;  4JV5 E;  5IWA I;  1B69 A;  2PO0 A;  3DJW A;  4NXN E;  3HPZ A;  4NZV A;  2V34 A;  4LF6 I;  4F9C B;  3B78 A;  1I94 E;  2EOR A;  2X36 A;  2V2Q A;  3V2U C;  2JXP A;  4TUG A;  2LCE A;  3J81 C;  4R2R A;  2VQE E;  4JI5 I;  1DGC A;  2EOX A;  2KHX A;  3M85 G;  2UUC I;  2UXD E;  1Y6Z A;  2J7K A;  4DR2 E;  4K0K E;  3U1K A;  4OO1 E;  1RQ0 A;  4JYA E;  1MX0 A;  2L6M A;  2EOF A;  2EOQ A;  4DR6 E;  2HKJ A;  5KL7 A;  1USV A;  4O4K A;  2L2K B;  3B82 A;  2DSY A;  3J7A M;  3JAM C;  2NA2 A;  5K36 E;  2CZ9 A;  4FN5 A;  4DR4 E;  4LF8 I;  3KRN A;  1IBK I;  3T1Y E;  4DV2 E;  1FWL A;  1EH7 A;  4X66 I;  2WZO A;  4R8O A;  4LF9 E;  2L33 A;  5C0X A;  5C0X F;  2HFU A;  1N0U A;  2NAB A;  4IZJ A;  2EPA A;  5KL3 A;  2RSM A;  2O1U A;  4R2A A;  5AC5 A;  2ENA A;  3QT6 A;  5CFF E;  2EPO A;  5K36 C;  2CG9 A;  2R42 A;  1ZXM A;  4KWY A;  1PIE A;  4DUY E;  4DPT A;  2YRH A;  1Z1B A;  2IES A;  4DV1 E;  1MEY C;  1AH5 A;  2VF1 A;  3IWC A;  2BA0 D;  5GME A;  4F6M A;  1FNM A;  1WJP A;  3JU0 A;  2DMY A;  4LF5 E;  3BBG A;  4OOG C;  4BA1 B;  2CSH A;  2HGH A;  5IT9 Q;  2EM5 A;  4XTJ A;  4JI2 I;  2WBT A;  2BV3 A;  2EP3 A;  2YTF A;  4PU9 A;  2DB2 A;  4USM A;  4MLV A;  4LTY A;  2NUF A;  5A69 A;  4JI0 I;  4B3S I;  3HQ1 A;  2YRM A;  1FJG I;  1NCS A;  4FK5 C;  3M6A A;  3QT5 A;  2YU8 A;  1HK7 A;  1O0W A;  2X7I A;  2VRD A;  4JI7 I;  3HJC A;  2EQ3 A;  4BHC A;  2KOU A;  1JK1 A;  2B9D A;  2EMA A;  1PVG A;  3NZK A;  4DV6 E;  3P3E A;  4DV5 I;  1B62 A;  4KHP I;  1ZAA C;  5ELW A;  2EN3 A;  4ISA A;  2CGE A;  3BF2 A;  1USU A;  4LFC E;  1HNZ E;  1A1G A;  3K17 A;  2EPX A;  2EPK X;  1H7S A;  4HY1 A;  1HR0 E;  1S16 A;  3P3C A;  2H36 X;  1OYS A;  2PNZ B;  1WHQ A;  2ENC A;  2YTE A;  1RR9 A;  3VYY A;  4F54 A;  2UU9 E;  5IT9 C;  2EOM A;  5JEA A;  3HTX A;  5JEA F;  1RHY A;  4U3B A;  1PDA A;  2LE2 A;  2ZM6 E;  1BB8 A;  1ELO A;  2C37 B;  1DAR A;  2NN6 D;  2EN6 A;  4LF4 I;  2LUQ A;  4OKG A;  4M30 A;  4AM3 A;  1A1K A;  2EOI A;  2YU5 A;  2DGC A;  1WUU A;  1YHC A;  3OTO I;  2EM9 A;  2O3Z A;  5AE1 A;  1N32 E;  1UDQ A;  3T1H E;  2I9I A;  2LO3 A;  4M9V C;  2GO3 A;  5FWK A;  2L2M A;  1OYP A;  2MKN A;  3P06 A;  4GQU A;  4DUZ I;  4NXM I;  2PRT A;  4BBY A;  2V8P A;  3D4J A;  2ENH A;  2LRS A;  2DIX A;  5JEA C;  1IQS A;  4MDT A;  1X6F A;  1YFH A;  1ZU1 A;  1T4L B;  2DRP A;  4AIM A;  1YYW A;  3EPK A;  2F4V E;  4BS9 A;  1G2F C;  4Z7C A;  2EZ6 A;  3MHH C;  3PYG A;  3WU5 A;  2YRK A;  1B63 A;  1GTK A;  1T38 A;  4URL A;  3P1X A;  4R2P A;  2EMZ A;  5IWA E;  5LMN I;  2UXC I;  1HNX I;  4LF6 E;  2PO0 B;  3L7Z A;  2WCC 3;  1UDN A;  4UTG A;  4N3O A;  1F2I G;  3M7N G;  4OO1 B;  2PNZ A;  1H74 A;  1UBD C;  4OX9 I;  2JYA A;  5IV8 B;  2UUC E;  3PS3 A;  4FW4 A;  4R2C A;  2DLQ A;  2C37 A;  5K36 B;  2JP9 A;  4WX9 A;  3CWV A;  2ODR D;  3HXL A;  1Z0W A;  4JI4 I;  4WXC A;  2EOY A;  1N0V C;  2GS8 A;  3F6G A;  2EPP A;  4F2J C;  4LF8 E;  2WBU A;  2BM1 A;  4QNJ A;  1IBK E;  3PS2 A;  2G7H A;  4X66 E;  3HKM A;  1YH8 A;  2K7I A;  3IWD A;  1Z5C A;  4HXZ A;  3VK6 A;  4FWH A;  2L3C A;  1TF3 A;  4DV7 I;  1IQO A;  4LCF A;  1WRJ A;  4IFD D;  4MU4 A;  4IS9 A;  3H4L A;  2UXB I;  2JT2 A;  1T39 A;  5KL4 A;  3J7Y p;  4LF7 I;  4O43 A;  2EOZ A;  1SFE A;  2V2Z A;  2EL5 A;  2ZBK B;  4P7D A;  1KKH A;  3RMP A;  3U1Y A;  4P7A A;  1X49 A;  2NPF A;  1PJS A;  2E1R A;  4FW6 A;  4JI2 E;  3DF6 A;  2A2C A;  2CT1 A;  4B3S E;  3LPS A;  4JI0 E;  1VI7 A;  5DNX A;  1ZR9 A;  4OO1 A;  1FJG E;  4OO1 F;  4WSG A;  3WU6 A;  1HNW E;  3AV0 A;  1BBO A;  4YY3 I;  5AE2 A;  1L4S A;  3P76 A;  1Z59 A;  3PRY A;  3EPL A;  4JI7 E;  1UDS A;  1A1J A;  4EMD A;  1IBM I;  4B3T E;  5K36 A;  1LLM C;  5K36 F;  3J80 Q;  4DR5 I;  3QG5 C;  4BCA A;  2B7T A;  4DV5 E;  4KHP E;  3DD6 A;  3KWR A;  4JG4 A;  3ZKB A;  1Y60 A;  2BA1 G;  4ED4 A;  1Z0C A;  1STU A;  2DEJ A;  5DRO A;  2UUB I;  1UHZ A;  5A6B A;  5L3J A;  3VHT B;  2LUP B;  1D6T A;  4R2D A;  3ZZU A;  2LVH A;  1H73 A;  1UDO A;  4GKJ I;  3VYX A;  3K6Q A;  1IMU A;  3HUL A;  2R76 A;  5KL6 A;  2HFS A;  3ADI A;  2LTR A;  1E3P A;  4I3H A;  2VQF I;  4DV4 I;  4LFA I;  4JI6 E;  2YTO A;  5JEA B;  4LF4 E;  4X64 I;  4ZYH A;  5DNL A;  3UHM A;  5LMU I;  1BBG A;  4ZYD A;  2ADR A;  2EMG A;  1WXR A;  1XMQ E;  4O5G A;  3FIG A;  3OTO E;  3ADL A;  2IOQ A;  2GPI A;  3J7A G;  2WBS A;  1KVK A;  4WUB A;  4I8O A;  3PYE A;  4R2S A;  2R3V A;  4DUZ E;  2NN6 E;  2GQ0 A;  4JI3 I;  4Q28 A;  3J80 C;  4ZVI A;  2EOO A;  2EQ0 A;  2RPC A;  3ADG A;  3V5R A;  1YUI A;  4F6N A;  4WSP A;  2LT7 A;  1IBL E;  4QNK A;  5EL9 A;  2NN6 C;  1K47 A;  4R2E A;  2CVE A;  4FW3 A;  2Z5C B;  3LNU A;  2ELY A;  2PNM A;  1XNR I;  1N33 I;  2N8X A;  4FW7 A;  2E5L I;  1QU6 A;  2IER A;  2EMB A;  2EM0 A;  4R03 A;  5LMN E;  2UXC E;  1NZ0 A;  2HJJ A;  1HNX E;  3UK3 C;  3CDJ A;  4DV3 I;  3EPH A;  1Y4S A;  3L7Z B;  3H09 A;  4LPF A;  3ZZT A;  2Q2E B;  1JK2 A;  4KZS A;  2I13 A;  4X9J A;  2DLK A;  4OX9 E;  2O1T A;  2AJ4 A;  4DR3 I;  5IXM B;  4NXN I;  2K4V A;  1X5W A;  4U3D A;  3C4B A;  2E72 A;  4WXD A;  4HYM A;  3THO B;  2ELZ A;  4BC7 A;  4JI4 E;  2YTQ A;  1E3H A;  5TSE A;  2RQL A;  4BHB A;  1Z0T A;  1TF6 A;  1PJQ A;  1NHH A;  4USK A;  2AE8 A;  2RSI A;  4P78 A;  2YPN A;  5LL6 R;  4JI8 I;  1P42 A;  1QZR A;  4M1K A;  1RRE A;  4DV7 E;  3GON A;  2LJP A;  4WUD A;  1XMO I;  2JEA B;  2WNR B;  3QT7 A;  4PRX A;  2HHH I;  1Z0B A;  2FTX B;  2JOB A;  2EMW A;  2EN1 A;  2VE7 C;  2YTP A;  1A1H A;  2UXB E;  2GLI A;  4IJD A;  2M9A A;  4LU9 A;  4LF7 E;  2EM3 A;  2LMZ A;  3TQM A;  2ODR C;  2RS6 A;  5C0X D;  1P47 A;  4R2Q A;  2Z5C A;  4LF9 I;  2EPC A;  4IZJ D;  4IFD E;  4F9B B;  2EFG A;  3K1J A;  3M85 D;  2Z5E A;  4P52 A;  4GKK I;  2B7V A;  4L5N C;  2EMX A; 
#chains in the Genus database with same CATH homology
 5DNY A;  1Z5B A;  4DUY I;  1UIL A;  1PKP A;  4M2Z A;  4L8N A;  4YY3 E;  4JI5 E;  2V2V A;  1Z0G A;  1IBM E;  1S4E A;  1DI2 A;  4DR5 E;  3F6H A;  4BMJ A;  1ZBQ A;  2FV4 B;  2UUB E;  3QT8 A;  3WU4 A;  4GKJ E;  4X62 I;  1ZBT A;  1U2R A;  4DPU A;  3ZM7 A;  4DR1 I;  2KON A;  1J5E I;  1H7U A;  4LFA E;  1N34 I;  4DV4 E;  4TUI A;  2V83 A;  4X64 E;  4LFC I;  1X47 A;  5LMU E;  4JI1 I;  2E1M A;  3B8H A;  2M4I A;  1KIJ A;  5FLX Q;  4DV0 I;  2IOP A;  4JI3 E;  4DPX A;  2NUE A;  3PYF A;  4MYT A;  1EI1 A;  4FWD A;  2HK2 A;  1EKZ A;  1Z5A A;  1UEK A;  2F8B A;  1OJ4 A;  3ZZ0 A;  1YYO A;  4FW9 A;  2JR1 A;  1ZM3 A;  3ADJ A;  3K85 A;  3Q6M A;  1XNR E;  2OI2 A;  1N33 E;  4IZK B;  2YT4 A;  4J8Z A;  3LTO A;  4HAC B;  4WUC A;  1A6F A;  2JVA A;  2RS7 A;  5FLX C;  1GQE A;  4B3R I;  2V8Q B;  3WU3 A;  1ZXN A;  2B3T B;  4DR3 E;  3LML A;  1X48 A;  2V89 A;  5F3W A;  4LFB I;  5AE3 A;  2HK3 A;  4X65 I;  4JI8 E;  2CPN A;  5T6J A;  4NXM E;  4DXL A;  4DR7 I;  3AUZ A;  2MC5 A;  1XMO E;  2UUA I;  2LTS A;  5ADZ A;  4WPY A;  4B3M I;  2HHH E;  1NHI A;  4FWG A;  3PYD A;  4DPW A;  4IZK A;  2LJH A;  2V85 A;  1N36 I;  4GKK E;  4KQV A;  1T4O A;  2MDR A;  2NUG A;  4HAC A;  5BR8 I;  4DU7 A;  4AQY I;  3C4T A;  1YYK A;  3IWB A;  1BKN A;  4YHH I;  2IHR 1;  1MG7 A;  1YZ9 A;  4GEQ B;  4UT4 A;  2YZT A;  2M7Q A;  4MYU A;  1XNQ I;  4JV5 I;  1VIS A;  4R1F A;  2L92 A;  1NHJ A;  1I94 I;  4DPY A;  1HNW I;  1J26 A;  2Z5B B;  3JTZ A;  4X62 E;  3ZOQ B;  2VQE I;  1FWK A;  4DR1 E;  1J5E E;  2WW4 A;  2UXD I;  1N34 E;  4DR2 I;  4K0K I;  3Q6N A;  5A2Q Q;  3MSW A;  4JYA I;  2XEX A;  2A2D A;  4DR6 I;  3LLH A;  1KTV A;  1Z0V A;  4JI1 E;  1EA6 A;  4DR4 I;  2L8T A;  2RTX A;  3T1Y I;  4DV2 I;  4DV0 E;  2V86 A;  1T4N A;  4DMI A;  2V87 A;  4RPF A;  2N3G A;  1XMQ I;  1ZM9 A;  4DU8 A;  1FKA E;  3HPS A;  2JOX A;  3ZKD A;  4DV1 I;  1MU5 A;  4DKK A;  4LF5 I;  5A2Q C;  2BM0 A;  5GMD A;  2PNL A;  5AAS A;  1WHN A;  2O1V A;  1IBL I;  2L2N A;  4B3R E;  1Y4U A;  2Z5B A;  1Z0E A;  2LBS B;  3Q1Q A;  3OML A;  1RC7 A;  2VQF E;  4LFB E;  2N3H A;  4DV6 I;  4Z7Y A;  2L3J A;  1HNZ I;  4F9A B;  3F0N A;  4X65 E;  1HR0 I;  2UU9 I;  4M0V A;  4WFT A;  2DEI A;  4DR7 E;  2HKE A;  2ZM6 I;  2UUA E;  1GZ6 A;  4B3M E;  4WYQ B;  1XHK A;  4PRV A;  1N32 I;  2ZIT A;  3T1H I;  4X8W A;  2VF3 A;  3J81 Q;  2JY9 A;  1N36 E;  1DQ3 A;  2MC6 A;  4IZJ B;  5BR8 E;  2E5L E;  2M1S A;  4AQY E;  1ZM2 A;  2FGG A;  1FI4 A;  2EWL A;  4DV3 E;  4YHH E;  2F4V I;  2O1W A;  3JAM Q;  2V88 A;  2JWO A;  1H72 C;  1ZM4 A;  4BC9 A;  1XNQ E;  1SR9 A;  4JV5 E;  5IWA I;  3DJW A;  4NXN E;  3HPZ A;  2V34 A;  4LF6 I;  4F9C B;  3B78 A;  1I94 E;  2X36 A;  2V2Q A;  3V2U C;  4TUG A;  3J81 C;  4JI5 I;  2VQE E;  2KHX A;  2UUC I;  2UXD E;  1Y6Z A;  2J7K A;  4DR2 E;  4K0K E;  1RQ0 A;  4JYA E;  1MX0 A;  2L6M A;  4DR6 E;  2HKJ A;  1USV A;  2L2K B;  3B82 A;  3J7A M;  2DSY A;  3JAM C;  2NA2 A;  2CZ9 A;  4FN5 A;  4DR4 E;  4LF8 I;  1IBK I;  3T1Y E;  4DV2 E;  1FWL A;  4X66 I;  2WZO A;  4R8O A;  4LF9 E;  2L33 A;  2HFU A;  1N0U A;  4IZJ A;  2RSM A;  2O1U A;  3QT6 A;  5CFF E;  2CG9 A;  1ZXM A;  1PIE A;  4DUY E;  4DPT A;  4DV1 E;  2VF1 A;  3IWC A;  5GME A;  1FNM A;  3JU0 A;  2DMY A;  4LF5 E;  4OOG C;  5IT9 Q;  4XTJ A;  4JI2 I;  2BV3 A;  4PU9 A;  2DB2 A;  4USM A;  4B3S I;  4LTY A;  2NUF A;  4JI0 I;  3HQ1 A;  1FJG I;  3M6A A;  3QT5 A;  1HK7 A;  1O0W A;  2X7I A;  4JI7 I;  3HJC A;  4B3T I;  2KOU A;  1PVG A;  2B9D A;  4DV6 E;  4DV5 I;  1B62 A;  4KHP I;  2CGE A;  1USU A;  4LFC E;  1HNZ E;  3K17 A;  1H7S A;  4HY1 A;  1HR0 E;  1S16 A;  2H36 X;  1WHQ A;  1RR9 A;  3VYY A;  4F54 A;  2UU9 E;  5IT9 C;  3HTX A;  4JI6 I;  2LE2 A;  2ZM6 E;  1ELO A;  1DAR A;  4LF4 I;  2LUQ A;  4M30 A;  1WUU A;  3OTO I;  5AE1 A;  1N32 E;  3T1H E;  5FWK A;  2L2M A;  4DUZ I;  3P06 A;  4NXM I;  4BBY A;  2V8P A;  3D4J A;  2LRS A;  2DIX A;  1T4L B;  1YYW A;  2F4V E;  4BS9 A;  4Z7C A;  2EZ6 A;  3WU5 A;  3PYG A;  1B63 A;  4URL A;  3P1X A;  5IWA E;  5LMN I;  2UXC I;  1HNX I;  4LF6 E;  4UTG A;  4N3O A;  1H74 A;  4OX9 I;  2UUC E;  3CWV A;  2ODR D;  3HXL A;  1Z0W A;  4JI4 I;  2GS8 A;  1N0V C;  3F6G A;  4LF8 E;  2BM1 A;  1IBK E;  2G7H A;  4X66 E;  3IWD A;  1Z5C A;  4HXZ A;  3VK6 A;  4FWH A;  2L3C A;  4DV7 I;  3H4L A;  2UXB I;  3J7Y p;  4LF7 I;  2V2Z A;  2ZBK B;  4P7D A;  1KKH A;  3RMP A;  4P7A A;  1X49 A;  2NPF A;  2E1R A;  4JI2 E;  3DF6 A;  2A2C A;  4B3S E;  3LPS A;  4JI0 E;  1FJG E;  3WU6 A;  1HNW E;  3AV0 A;  4YY3 I;  5AE2 A;  3PRY A;  1Z59 A;  4JI7 E;  4EMD A;  1IBM I;  4B3T E;  3J80 Q;  4DR5 I;  4DV5 E;  4BCA A;  2B7T A;  4KHP E;  3ZKB A;  4ED4 A;  3KWR A;  4JG4 A;  1Z0C A;  1STU A;  2DEJ A;  2UUB I;  1UHZ A;  5L3J A;  2LUP B;  1D6T A;  4GKJ I;  3ZZU A;  1H73 A;  3VYX A;  3K6Q A;  3HUL A;  2HFS A;  3ADI A;  2LTR A;  2VQF I;  4I3H A;  4LFA I;  4DV4 I;  4JI6 E;  4LF4 E;  4X64 I;  5LMU I;  1WXR A;  3ADL A;  1XMQ E;  3FIG A;  2IOQ A;  3OTO E;  2R42 A;  4WUB A;  3J7A G;  1KVK A;  4I8O A;  3PYE A;  2R3V A;  4DUZ E;  2GQ0 A;  4JI3 I;  4Q28 A;  3J80 C;  4ZVI A;  3ADG A;  3V5R A;  4WSP A;  1IBL E;  1K47 A;  2Z5C B;  3LNU A;  2PNM A;  1XNR I;  1N33 I;  2E5L I;  1QU6 A;  4R03 A;  5LMN E;  2UXC E;  1NZ0 A;  1HNX E;  4DV3 I;  1Y4S A;  3H09 A;  3ZZT A;  2Q2E B;  4KZS A;  4OX9 E;  2O1T A;  2AJ4 A;  4DR3 I;  4NXN I;  2K4V A;  3C4B A;  4HYM A;  4BC7 A;  4JI4 E;  1Z0T A;  1NHH A;  4USK A;  4P78 A;  5LL6 R;  4JI8 I;  1QZR A;  4M1K A;  1RRE A;  4DV7 E;  3GON A;  2LJP A;  4WUD A;  1XMO I;  3QT7 A;  4PRX A;  2HHH I;  1Z0B A;  2FTX B;  2JOB A;  2UXB E;  2VE7 C;  4LF7 E;  4LU9 A;  2LMZ A;  2ODR C;  2RS6 A;  4LF9 I;  2Z5C A;  4IZJ D;  4F9B B;  2EFG A;  3K1J A;  2Z5E A;  4P52 A;  4GKK I;  2B7V A;  4L5N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...