4DV2E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 32
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv2E02
1QZRA 1KVKA 2L2MA 3ADGA 2BV3A 4DR4I 3GONA 4JI5E 4NXNE 3JAMQ 4NXNI 1VISA 1Z5BA 5FLXC 2UU9E 4LFAE 1NHHA 4DV1I 2DMYA 3VYXA 4DV4E 4B3SE 2DEJA 4JI4I 4GKKI 1PVGA 4UTGA 1HNZI 4X64E 2RTXA 4DUYI 2UUBI 3T1HE 4DR5E 4HXZA 4JI8I 5LMUI 4B3ME 4B3TI 1WHNA 2N3GA 4LF8I 3J80Q 4DR7I 4K0KI 2E1RA 3B78A 4XTJA 1H72C 3WU5A 1HNXE 1IBKE 2LTRA 4M2ZA 1XNQE 2UUAI 1DARA 4USKA 4HACA 1B62A 2VQEI 3M6AA 1N0UA 4LF9I 4DV6E 1FJGE 4AQYE 1X48A 3V2UC 2ZM6I 2UUCE 1I94E 4DR6E 2HKJA 4DR6I 4R1FA 2ZITA 1I94I 4DXLA 2UUCI 4USMA 3WU6A 4YHHI 4DPYA 2A2DA 4FN5A 4JI7I 3LLHA 4LF9E 1H73A 4JI2I 4JV5E 1HNWI 2NPFA 2UUAE 5FLXQ 1XMQI 1HNXI 1XNQI 1PKPA 1DI2A 1N0VC 1Z5AA 2V2ZA 2LBSB 3K1JA 1WHQA 1FI4A 4MYUA 4NXME 4KQVA 1KKHA 4WUBA 2UXDI 4FWGA 4FW9A 4B3MI 1J26A 1J5EE 4JI8E 4HACB 4X8WA 4DR5I 1Z0VA 1Z0GA 2KHXA 1Z0CA 2UUBE 2L3JA 1Z0TA 4DV2E 1IBLI 2CPNA 4LF6I 2LUQA 2N3HA 4DV4I 4B3RE 2DIXA 4YY3E 4FWHA 2V2QA 1H74A 1H7UA 2L33A 1KIJA 4JI0I 4JI5I 1GQEA 4HY1A 4JG4A 1ELOA 3Q1QA 4LFBI 4JI1E 4X66E 1EI1A 5GMEA 2E5LI 1MG7A 5LMNE 2CZ9A 1STUA 2RS7A 3QT6A 3P1XA 2BM1A 1X47A 3OTOI 1Z0EA 3ZZ0A 1FWKA 1H7SA 3F0NA 5IT9C 3PYDA 2VQFI 4OX9I 4DR2I 1T4OA 1ZM3A 3QT7A 4LF4I 2UXCI 2V34A 5A2QQ 2L2NA 4LF7I 2LUPB 1XMQE 4WYQB 1S16A 4P7AA 4LFCI 2NUGA 3PYEA 4FWDA 3B8HA 3WU3A 4AQYI 2B7TA 1FJGI 4DPTA 2B7VA 3ZKDA 1IBKI 5L3JA 1XMOI 2RS6A 4KHPI 5IWAE 4LF4E 1RQ0A 5IT9Q 4LF5E 4WFTA 4DR2E 4DV5E 2VQFE 2AJ4A 4DV3E 1UHZA 1MU5A 4Z7YA 2JY9A 2HKEA 4URLA 3T1HI 3C4TA 1YZ9A 2J7KA 2IHR1 4UT4A 4DR1I 4DUYE 2EFGA 5LMNI 2JVAA 1XHKA 4JI1I 1ZXNA 3ADLA 4DV1E 4RPFA 1RR9A 2NUEA 1MX0A 3VYYA 4JI0E 1WUUA 3QT5A 1Z0BA 2GS8A 2R3VA 3ADJA 4YY3I 1YYOA 4B3RI 2HK2A 1YYKA 4OOGC 4GKJI 1N34I 4MYTA 1IBMI 2ZBKB 1RREA 3PYGA 3ADIA 4DV5I 2UXDE 2V8PA 1BKNA 4DV0I 4NXMI 4X62E 2HHHI 1XMOE 1S4EA 4DPUA 1HNWE 1U2RA 4JV5I 5A2QC 1T4NA 3LPSA 1A6FA 1YYWA 1EKZA 4YHHE 3J81C 2OI2A 3CWVA 2R42A 2LJPA 5BR8I 1FNMA 4JYAE 1ZXMA 1UILA 1O0WA 2NUFA 1Z0WA 1N36I 1UEKA 1N33I 4DPXA 5LL6R 2LRSA 1K47A 4P52A 4PU9A 2VQEE 2DB2A 1NHJA 2F4VI 4LF7E 2VF3A 3JAMC 4K0KE 3H4LA 4DR7E 1N32E 3ZZUA 4M30A 4DV0E 1QU6A 4OX9E 5LMUE 4B3TE 4DPWA 3D4JA 3J80C 2HFSA 2HK3A 3OTOE 1ZBTA 3HULA 4PRXA 2BM0A 4GKJE 4I3HA 1Z5CA 4JI4E 4X64I 4PRVA 2E5LE 2A2CA 5GMDA 4X66I 2LTSA 1B63A 4B3SI 2UU9I 4LFAI 4JI6E 3J7AM 4DV7I 4DKKA 4DV7E 2HFUA 4DR4E 1FKAE 4JI6I 4Z7CA 2MDRA 2L3CA 4LF6E 3LNUA 4JI3E 1IBLE 4DR1E 5CFFE 4DV2I 2WW4A 2UXBI 1NZ0A 2YT4A 2Q2EB 1T4LB 1Z59A 2B3TB 1ZM9A 1D6TA 4DV3I 1J5EI 2X36A 4LF5I 1N32I 5IWAI 4KHPE 4DR3I 4DU7A 1OJ4A 4WUDA 2NA2A 3PYFA 2F4VE 4DUZI 1KTVA 4X65E 4JI2E 1EA6A 2X7IA 4JI7E 2RSMA 1ZM2A 1N33E 1HR0E 1N36E 2LJHA 1ZM4A 3T1YI 3V5RA 4WUCA 1XNRE 4JYAI 3LTOA 1XNRI 3ZM7A 5BR8E 4ZVIA 4HYMA 2ZM6E 3T1YE 3WU4A 2DEIA 1HR0I 3B82A 4LFCE 3HTXA 2XEXA 3ZZTA 4DV6I 3K17A 3ZKBA 1X49A 3J7AG 3J7Yp 4X65I 1NHIA 4DUZE 2L2KB 4ED4A 4DR3E 2HHHE 4X62I 2UXCE 3QT8A 1FWLA 4LF8E 1RC7A 1PIEA 4EMDA 3J81Q 2EZ6A 1IBME 1N34E 4DU8A 2V2VA 2UXBE 3C4BA 4JI3I 1HNZE 4GKKE 4M1KA 4LFBE
chains in the Genus database with same CATH superfamily
2EMZA 4IZKA 1QZRA 1KVKA 1T38A 1IQSA 1B69A 1JK2A 2L2MA 1DQ3A 2MC5A 3ADGA 1MGTA 2AE8A 4R03A 2BV3A 4DR4I 1PJSA 2EL6A 3GONA 5AE1A 2EPAA 4JI5E 4GKKE 4NXNE 1PJQA 3JAMQ 2EPKX 4NXNI 1PJTA 2EOSA 2YRKA 4O5GA 3KRNA 1VISA 1Z5BA 2WBTA 1G2DC 5FLXC 2UU9E 4LFAE 1NHHA 4DV1I 2EMWA 2DMYA 2WP8A 3VYXA 4DV4E 1G2FC 2EJ4A 4B3SE 5IV8B 2DEJA 4JI4I 4GKKI 1PVGA 2JEBB 4UTGA 1HNZI 4X64E 2RTXA 4DUYI 4QNJA 4L5NC 2EM0A 5KL2A 2UUBI 3M7ND 2EMLA 3HPSA 3EPKA 4GZNC 3T1HE 2C39A 3P76A 4DR5E 4BHBA 1E3PA 2YTGA 4WX9A 5KL7A 4NBQA 2GPIA 4HXZA 4JI8I 5LMUI 4B3ME 1TF3A 2YTQA 2H36X 4B3TI 1WHNA 2WP8B 2LCEA 2N3GA 4LF8I 3J80Q 3VHTB 2JR1A 4DR7I 4K0KI 2E1RA 3B78A 4XTJA 1H72C 3EPLA 3EQ1A 1HNXE 1IBKE 2LTRA 4M2ZA 1XNQE 5IXMB 3WU5A 3BBGA 1DARA 4USKA 2UUAI 4MU1A 4HACA 2EWLA 1B62A 2BA1G 2VQEI 2EMCA 3M6AA 1F2IG 1N0UA 4FW5A 2NN6F 4LF9I 5K36F 3C6KA 4MDTA 2Z5BB 2EN3A 4OO1A 2VF1A 1YPNA 2K4VA 2PRTA 4DV6E 1HK7A 4LCFA 3HKMA 1FJGE 4AQYE 1ZU1A 2WNRB 4X9JA 5K36D 4ZYGA 1X48A 3V2UC 2ZM6I 1KYQA 2UUCE 4LPFA 1I94E 2EMIA 4DR6E 2HKJA 1UBDC 2WBSA 1PDAA 2EM4A 3DD6A 2D9HA 1USVA 2ZITA 4IZJB 4R1FA 5ELWA 1I94I 4DR6I 4DXLA 4IFDB 3U1YA 2UUCI 4IFDC 4USMA 3WU6A 2YSOA 1A1GA 3PS1A 2CG9A 1YFHA 4YHHI 4IZJA 4DPYA 2O1VA 1JK1A 5F3WA 2A2DA 4FN5A 1YUJA 4IZJD 3Q6MA 4JI7I 4IFDD 3LLHA 1EH8A 4LF9E 1H73A 4LCHA 2DLQA 4JV5E 4LCGA 4JI2I 1HNWI 3K6QA 2EMBA 2UUAE 2NPFA 5KL6A 5FLXQ 1XMQI 3IWBA 2IOPA 2JOXA 1PKPA 1HNXI 1A1FA 1XNQI 5K36B 1DI2A 1N0VC 1Z5AA 2YTPA 2V2ZA 3DF6A 2LBSB 3K1JA 1WHQA 2V8QB 1FI4A 4MYUA 2YTJA 4NXME 2J65A 4KQVA 1KKHA 4WUBA 2UXDI 2ADRA 4Q35B 4FWGA 4FW9A 2YTOA 4B3MI 5T6JA 1J26A 3CDIA 1J5EE 4JI8E 2EMAA 1P47A 3HJCA 4HACB 3ZOQB 2PO1B 4X8WA 4BCAA 1X3CA 2EPPA 2JEAB 4DR5I 1Z0VA 2GO4A 4R2EA 1Z0GA 2KHXA 2YSPA 4R2CA 1XXEA 1Z0CA 2UUBE 3K85A 3IWCA 2L3JA 1Z0TA 2EM7A 2O1WA 4RH8A 4DV2E 5DRQA 1IBLI 2EM2A 2PO2B 2CPNA 2YTIA 1R6MA 2Z5CB 4LF6I 2LE2A 1UDOA 2LUQA 5KL4A 3H09A 2N3HA 2FTXB 4DV4I 4B3RE 1NEIA 2DMIA 3MHHC 1IMUA 2DIXA 2L92A 2IOQA 2LT7A 4YY3E 2NN6D 4FWHA 2EPZA 4R2RA 2V2QA 1H74A 1H7UA 2L33A 4AIMA 1KIJA 3M7NG 4JI0I 2EMYA 4JI5I 1GQEA 2O1UA 2EN6A 2EPNA 1GZ6A 4O43A 3F6HA 4HY1A 4JG4A 1ELOA 3Q1QA 2C37A 2YZTA 4WXCA 4JI1E 4LFBI 4X66E 1EI1A 5GMEA 2E5LI 2HC5A 1MG7A 5LMNE 2CZ9A 4P78A 2EN8A 2EPXA 1STUA 2EOXA 2RS7A 5AE2A 3PS2A 3QT6A 3P1XA 2BM1A 1X47A 2EORA 4I8OA 1UDQA 4LTYA 3OTOI 1Z0EA 3ZZ0A 1FWKA 1H7SA 3F0NA 5C0XC 5IT9C 3PYDA 5C0XB 2VQFI 4OX9I 4DR2I 1T4OA 2KONA 4M0VA 1ZM3A 3QT7A 4FW4A 2EN7A 4LF4I 2YRHA 2UXCI 3L7ZA 5C0XE 2V34A 5AASA 2L2NA 5A2QQ 2EN4A 2EOOA 2LMZA 2LUPB 4LF7I 2JEAA 1XMQE 2EPLX 2I9IA 4BHCA 2JXPA 4MLQA 1LLMC 4WYQB 2F1DA 2PNZA 4ISAA 1S16A 2Q8UA 3THOB 1BBGA 4P7AA 4LFCI 2JE6B 3GCMA 4GQUA 2WNRA 1Y60A 2NUGA 3UK3C 2FV4B 4R2AA 2EM9A 3PYEA 5JEAF 4F9AB 4FWDA 3B8HA 5JEAC 3WU3A 4FK5C 2N8XA 4MLVA 2WZOA 4AQYI 2B7TA 1FJGI 4WSGA 2EQ0A 2V87A 4DPTA 4X62I 2EOQA 2MKDA 2GLIA 5KL5A 2B7VA 2EOMA 1YUIA 3B4TA 3ZKDA 2EPUA 2EPRA 2JYAA 5AC4A 2RQLA 3P06A 4GEQB 4F9BB 2EN2A 2HJJA 3HPZA 1IBKI 3Q6NA 5L3JA 2NN6A 4M9VC 2YTDA 2NN6E 4IFDE 1XMOI 4ZYHA 2EMFA 2RS6A 4BA1A 4KHPI 5IWAE 4LF4E 1RQ0A 1OYPA 5IT9Q 2EP3A 4OZEA 4LF5E 4WFTA 4DR2E 1Z1BA 2ENHA 3KZYA 2VQFE 4DV5E 3L00A 2DRPA 2AJ4A 2V88A 4DV3E 4WXDA 2PO0A 1UHZA 2EL4A 2JOBA 1MU5A 4Z7YA 2JY9A 4FW7A 2HKEA 4URLA 3BIDA 3T1HI 2C38A 1GTKA 3C4TA 3M99B 3KZZA 2IHR1 4ZYDA 4IS1C 1YZ9A 3EPHA 2J7KA 4DUYE 2EFGA 2EOJA 4DR1I 1EH6A 2V89A 5AE3A 4J3DA 5LMNI 2ODRC 2JVAA 1XHKA 4JI1I 4ZYEA 1ZXNA 4MU0A 2EPOA 4U3DA 3ADLA 2BBGA 5DROA 4DV1E 1UDNA 4BS9A 4RPFA 1RR9A 2EPCA 4F6MA 2NUEA 1MX0A 3VYYA 4Q28A 1Y4UA 2PO2A 4JI0E 5LLQA 1WUUA 3QT5A 4WPYA 1X5WA 3VK6A 1Z0BA 2GO3A 2GS8A 3AUZA 1BB8A 2BR2B 2JEBA 2R3VA 3ADJA 2DGCA 2YRMA 4YY3I 5DRPA 4RHBB 1YYOA 3FIGA 2EOIA 1NCSA 2EOYA 4B3RI 2CSHA 4DMIA 2HK2A 4IJDA 2EPMX 3P3CA 1YYKA 4OOGC 1SR9A 4GKJI 4BA1B 1N34I 4O4KA 4BA2A 4R8OA 5TSEA 2WBUA 2RSIA 4MYTA 1IBMI 4OO1C 2ZBKB 1RREA 3PYGA 3RMPA 4OO1F 3OMLA 4F6NA 1QNTA 3ADIA 4DV5I 2UXDE 2V8PA 1E3HA 4R2SA 1BKNA 3TQMA 4DV0I 4NXMI 4F54A 4X62E 2HHHI 3EPJA 1XMOE 1X6HA 1S4EA 1VI7A 5JEAD 2IERA 4IFDA 2PNLA 4BA2B 2EQ3A 4N3OA 4DPUA 2DSYA 2ENAA 2EM8A 1HNWE 2EMXA 5A2QC 1U2RA 2BA0G 1T4NA 4JV5I 3LPSA 2M7QA 1A6FA 1YYWA 1EKZA 4FW3A 2FGGA 2YU5A 2L6MA 2LJUA 4OKGA 4FW6A 4YHHE 2LV2A 3J81C 2CT1A 4MQYA 2OI2A 3CWVA 3M85D 2LVHA 2R42A 2LJPA 2PNZB 5BR8I 4OO1B 1FNMA 4JYAE 1ZXMA 4KZSA 1YSAC 1UILA 1O0WA 5K36E 2NUFA 4NHRA 1Z0WA 5KL3A 1N36I 1UEKA 1N33I 2JPAA 4DPXA 2JT2A 5LL6R 2LRSA 1K47A 4J8ZA 2RPCA 1WXRA 3F6GA 3PRYA 4P52A 4OO1E 2ELYA 3L7ZB 4PU9A 5FWKA 2VQEE 2DB2A 1X6EA 1NHJA 5C0XD 2NN6B 4LU9A 2I13A 4F9CB 2F4VI 5JEAE 4LF7E 2VF3A 2E72A 2V83A 3JAMC 4K0KE 3H4LA 4DR7E 2MKNA 1N32E 3ZZUA 4M30A 4DV0E 4AIDA 5A6BA 1RHYA 4N4RB 1A1IA 3HXLA 1QU6A 3MSWA 4BC9A 4OX9E 3JTZA 5LMUE 2MDGA 2M9AA 4B3TE 1R6LA 2O3ZA 3D4JA 4DPWA 3J80C 2HFSA 2EOHA 5JEAB 2YTEA 2YPNA 1A1JA 1YH8A 2BA0D 3HQ1A 2HK3A 4UT4A 2GQ0A 3OTOE 2EQ1A 1T39A 2C38B 2L8TA 1ZBTA 1KJKA 1Y6ZA 2BM0A 1RMDA 3HULA 4PRXA 4QNKA 5DNLA 4GKJE 4I3HA 1Z5CA 4MU3A 5DNYA 4X64I 3C6MA 4PRVA 2PO0B 5A6AA 2E5LE 2A2CA 5GMDA 4X66I 2EOEA 2PNMA 2LTSA 3NZKA 1ZR9A 1B63A 4B3SI 2Z5BA 4OO1D 2UU9I 4LFAI 4JI6E 3J7AM 2Z5CA 2O1TA 4HEIA 2EM5A 4IZKB 1ZAAC 5AC5A 4DV7I 4R2PA 4DKKA 4DV7E 2C37B 2HFUA 2CGEA 1P42A 1TF6A 4DR4E 2DLKA 1FKAE 4R2DA 2BR2A 1AAYA 1UN6B 1L4SA 4JI6I 4L8NA 3DJWA 3KWRA 1USUA 4Z7CA 2MDRA 5ADZA 4IS9A 1DGCA 2GHFA 2L3CA 1BBOA 4MU4A 4LF6E 3LNUA 4JI3E 1IBLE 4DR1E 5CFFE 4DV2I 2WW4A 2UXBI 2WCC3 2C39B 3CDJA 1NZ0A 4F2JC 2YT4A 2A25A 2Q2EB 5K36A 1T4LB 2EMHA 3BF2A 1Z59A 5DNXA 2B3TB 1ZM9A 1D6TA 1WJPA 2IESA 4DV3I 2E1MA 2YU8A 1J5EI 2VE7C 2BB8A 2HGHA 2ELZA 4NZVA 4BMJA 4IFDF 2ODRD 2X36A 4LF5I 2LO3A 2NN6C 1Y5YA 1N32I 5IWAI 4KHPE 4WSPA 4DR3I 2BA1D 4DU7A 1OJ4A 4WUDA 5JEAA 2NA2A 3PYFA 2F4VE 1YHCA 1EH7A 2EM3A 1KTVA 4DUZI 4X65E 4JI2E 2M1SA 2CTDA 1EA6A 2X7IA 4JI7E 5A6JA 3THNA 5K36C 4AM3A 2RSMA 1ZM2A 1MEYC 1N33E 5C0XA 1HR0E 1N36E 3BGHA 2LJHA 1ZM4A 3U1KA 3T1YI 3AV0A 3V5RA 2R1FA 2JE6A 3JU0A 1A1KA 4WUCA 2YTFA 2F8BA 2YWQA 1AH5A 1XNRE 3LTOA 4HTGA 1XNRI 4JYAI 5C0XF 3ZM7A 5BR8E 4R2QA 2Z5EA 4HYMA 2R76A 4ZVIA 2MC6A 4LOMA 1WRJA 2ZM6E 3T1YE 3UHMA 3WU4A 2DEIA 5EKWA 1HR0I 3B82A 2K7IA 4LFCE 1N3GA 3HTXA 2XEXA 3ZZTA 2M4IA 1TN9A 2JP9A 3MHSC 2EMKA 4DV6I 3K17A 3QG5C 2EOFA 3ZKBA 2EE8A 2EL5A 1X49A 1X6FA 2G7HA 3J7AG 3J7Yp 2EN1A 5A69A 4U3BA 2ENCA 4X65I 2V86A 2VRDA 1NHIA 4DUZE 4BC7A 4TUGA 2L2KB 1OYSA 4ED4A 1ZBQA 3P3EA 5DRRA 3GLLA 1Y4SA 4DR3E 5A6KA 2HHHE 4O24A 2EOZA 2UXCE 3H1CA 2NABA 3IWDA 2KOUA 4P7DA 5A6BD 1RC7A 4LF8E 1FWLA 3QT8A 5EL9A 3LMLA 1PIEA 4EMDA 2B9DA 1OYRA 1A1LA 3P3GA 3PS3A 2VESA 2EM6A 2V85A 3J81Q 1A1HA 2YTNA 4TUIA 2EZ6A 1IBME 3M85G 3ECRA 2EMGA 1UDSA 1N34E 4BBYA 1IQOA 2UXBE 2V2VA 4DU8A 2JWOA 3C4BA 2J7JA 4KWYA 4JI3I 1HNZE 2PO1A 3GMEA 1SFEA 2CVEA 4JI4E 4M1KA 4LFBE
chains in the Genus database with same CATH topology
4IZKA 1QZRA 1KVKA 2L2MA 1DQ3A 2MC5A 3ADGA 4R03A 2BV3A 4DR4I 3GONA 5AE1A 4JI5E 4NXNE 3JAMQ 4NXNI 1VISA 1Z5BA 5FLXC 2UU9E 4LFAE 1NHHA 4DV1I 2DMYA 3VYXA 4DV4E 4B3SE 2DEJA 4JI4I 4GKKI 1PVGA 4UTGA 1HNZI 4X64E 2RTXA 4DUYI 4L5NC 2UUBI 3T1HE 3HPSA 4DR5E 4HXZA 4JI8I 5LMUI 4B3ME 4B3TI 2H36X 1WHNA 2N3GA 4LF8I 3J80Q 2JR1A 4DR7I 4K0KI 2E1RA 3B78A 4XTJA 1H72C 1HNXE 1IBKE 2LTRA 4M2ZA 1XNQE 3WU5A 2UUAI 1DARA 4USKA 4HACA 2EWLA 1B62A 2VQEI 3M6AA 1N0UA 4LF9I 2Z5BB 2VF1A 2K4VA 4DV6E 1HK7A 1FJGE 4AQYE 1X48A 3V2UC 2ZM6I 2UUCE 1I94E 4DR6E 2HKJA 4DR6I 4R1FA 1USVA 2ZITA 4IZJB 1I94I 4DXLA 2UUCI 4USMA 3WU6A 2CG9A 4YHHI 4IZJA 4DPYA 2O1VA 2A2DA 5F3WA 4FN5A 4IZJD 3Q6MA 4JI7I 3LLHA 4LF9E 1H73A 4JI2I 4JV5E 1HNWI 3K6QA 2NPFA 2UUAE 5FLXQ 1XMQI 3IWBA 2IOPA 2JOXA 1PKPA 1HNXI 1XNQI 1DI2A 1N0VC 1Z5AA 2V2ZA 3DF6A 2LBSB 3K1JA 1WHQA 1FI4A 2V8QB 4MYUA 4NXME 4KQVA 1KKHA 4WUBA 2UXDI 4FWGA 4FW9A 4B3MI 5T6JA 1J26A 1J5EE 4JI8E 3HJCA 4HACB 3ZOQB 4X8WA 4BCAA 4DR5I 1Z0VA 1Z0GA 2KHXA 1Z0CA 2UUBE 3K85A 3IWCA 2L3JA 1Z0TA 2O1WA 4DV2E 1IBLI 2CPNA 4LF6I 2Z5CB 2LE2A 2LUQA 3H09A 2N3HA 2FTXB 4DV4I 4B3RE 2DIXA 2L92A 2IOQA 4YY3E 4FWHA 2V2QA 1H74A 1H7UA 2L33A 1KIJA 4JI0I 4JI5I 1GQEA 2O1UA 1GZ6A 3F6HA 4HY1A 4JG4A 1ELOA 3Q1QA 2YZTA 4JI1E 4LFBI 4X66E 1EI1A 5GMEA 2E5LI 1MG7A 5LMNE 2CZ9A 4P78A 1STUA 5AE2A 2RS7A 3QT6A 3P1XA 2BM1A 1X47A 4I8OA 4LTYA 3OTOI 1Z0EA 3ZZ0A 1FWKA 1H7SA 3F0NA 5IT9C 3PYDA 2VQFI 4OX9I 4DR2I 1T4OA 2KONA 4M0VA 1ZM3A 3QT7A 4LF4I 2UXCI 2V34A 5AASA 2L2NA 5A2QQ 2LMZA 4LF7I 2LUPB 1XMQE 4WYQB 1S16A 4P7AA 4LFCI 2NUGA 2FV4B 3PYEA 4F9AB 4FWDA 3B8HA 3WU3A 2WZOA 4AQYI 2B7TA 1FJGI 2V87A 4DPTA 2B7VA 3ZKDA 3P06A 4GEQB 4F9BB 3HPZA 1IBKI 3Q6NA 5L3JA 1XMOI 2RS6A 4KHPI 5IWAE 4LF4E 1RQ0A 5IT9Q 4LF5E 4WFTA 4DR2E 4DV5E 2VQFE 2AJ4A 2V88A 4DV3E 1UHZA 2JOBA 1MU5A 4Z7YA 2JY9A 2HKEA 4URLA 3T1HI 3C4TA 1YZ9A 2J7KA 2IHR1 4UT4A 4DR1I 4DUYE 2EFGA 5LMNI 2V89A 5AE3A 2ODRC 2JVAA 1XHKA 4JI1I 1ZXNA 3ADLA 4DV1E 4BS9A 4RPFA 1RR9A 2NUEA 1MX0A 3VYYA 4Q28A 1Y4UA 4JI0E 1WUUA 3QT5A 4WPYA 3VK6A 1Z0BA 2GS8A 3AUZA 2R3VA 3ADJA 4YY3I 1YYOA 3FIGA 4B3RI 4DMIA 2HK2A 1YYKA 4OOGC 1SR9A 4GKJI 1N34I 4R8OA 4MYTA 1IBMI 2ZBKB 1RREA 3PYGA 3RMPA 3OMLA 3ADIA 4DV5I 2UXDE 2V8PA 1BKNA 4DV0I 4NXMI 4F54A 4X62E 2HHHI 1XMOE 1S4EA 2PNLA 4N3OA 4DPUA 2DSYA 1HNWE 1U2RA 4JV5I 5A2QC 1T4NA 3LPSA 2M7QA 1A6FA 1YYWA 1EKZA 2FGGA 2L6MA 4YHHE 3J81C 2OI2A 3CWVA 2R42A 2LJPA 5BR8I 1FNMA 4JYAE 1ZXMA 4KZSA 1UILA 1O0WA 2NUFA 1Z0WA 1N36I 1UEKA 1N33I 4DPXA 5LL6R 2LRSA 1K47A 4J8ZA 1WXRA 3F6GA 3PRYA 4P52A 4PU9A 5FWKA 2VQEE 2DB2A 1NHJA 4LU9A 2F4VI 4F9CB 4LF7E 2VF3A 2V83A 3JAMC 4K0KE 3H4LA 4DR7E 1N32E 3ZZUA 4M30A 4DV0E 3HXLA 1QU6A 3MSWA 4BC9A 4OX9E 3JTZA 5LMUE 4B3TE 4DPWA 3D4JA 3J80C 2HFSA 2HK3A 3HQ1A 2GQ0A 3OTOE 2L8TA 1ZBTA 3HULA 1Y6ZA 2BM0A 4PRXA 4GKJE 4I3HA 1Z5CA 4JI4E 5DNYA 4X64I 4PRVA 2E5LE 2A2CA 5GMDA 4X66I 2PNMA 2LTSA 1B63A 4B3SI 2Z5BA 2UU9I 4LFAI 4JI6E 3J7AM 2Z5CA 2O1TA 4IZKB 4DV7I 4DKKA 4DV7E 2HFUA 2CGEA 4DR4E 1FKAE 4JI6I 4L8NA 3DJWA 3KWRA 1USUA 4Z7CA 2MDRA 5ADZA 2L3CA 4LF6E 3LNUA 4JI3E 1IBLE 4DR1E 5CFFE 4DV2I 2WW4A 2UXBI 1NZ0A 2YT4A 2Q2EB 1T4LB 1Z59A 2B3TB 1ZM9A 1D6TA 4DV3I 2E1MA 1J5EI 2VE7C 4BMJA 2ODRD 2X36A 4LF5I 1N32I 5IWAI 4KHPE 4WSPA 4DR3I 4DU7A 1OJ4A 4WUDA 2NA2A 3PYFA 2F4VE 4DUZI 1KTVA 4X65E 4JI2E 2M1SA 1EA6A 2X7IA 4JI7E 2RSMA 1ZM2A 1N33E 1HR0E 1N36E 2LJHA 1ZM4A 3T1YI 3AV0A 3V5RA 3JU0A 4WUCA 1XNRE 2F8BA 4JYAI 3LTOA 1XNRI 3ZM7A 5BR8E 2Z5EA 4ZVIA 4HYMA 2MC6A 2ZM6E 3T1YE 3WU4A 2DEIA 1HR0I 3B82A 4LFCE 3HTXA 2XEXA 3ZZTA 2M4IA 4DV6I 3K17A 3ZKBA 1X49A 2G7HA 3J7AG 3J7Yp 4X65I 2V86A 1NHIA 4DUZE 4BC7A 4TUGA 2L2KB 4ED4A 1ZBQA 1Y4SA 4DR3E 2HHHE 4X62I 2UXCE 3QT8A 3IWDA 4P7DA 2KOUA 1RC7A 4LF8E 1FWLA 3LMLA 1PIEA 4EMDA 2B9DA 3J81Q 2V85A 4TUIA 2EZ6A 1IBME 1N34E 4BBYA 4DU8A 2UXBE 2V2VA 2JWOA 3C4BA 4JI3I 1HNZE 4GKKE 4M1KA 4LFBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZR A;  1KVK A;  2L2M A;  3ADG A;  2BV3 A;  4DR4 I;  3GON A;  4JI5 E;  4NXN E;  3JAM Q;  4NXN I;  1VIS A;  1Z5B A;  5FLX C;  2UU9 E;  4LFA E;  1NHH A;  4DV1 I;  2DMY A;  3VYX A;  4DV4 E;  4B3S E;  2DEJ A;  4JI4 I;  4GKK I;  1PVG A;  4UTG A;  1HNZ I;  4X64 E;  2RTX A;  4DUY I;  2UUB I;  3T1H E;  4DR5 E;  4HXZ A;  4JI8 I;  5LMU I;  4B3M E;  4B3T I;  1WHN A;  2N3G A;  4LF8 I;  3J80 Q;  4DR7 I;  4K0K I;  2E1R A;  3B78 A;  4XTJ A;  1H72 C;  3WU5 A;  1HNX E;  1IBK E;  2LTR A;  4M2Z A;  1XNQ E;  2UUA I;  1DAR A;  4USK A;  4HAC A;  1B62 A;  2VQE I;  3M6A A;  1N0U A;  4LF9 I;  4DV6 E;  1FJG E;  4AQY E;  1X48 A;  3V2U C;  2ZM6 I;  2UUC E;  1I94 E;  4DR6 E;  2HKJ A;  4DR6 I;  4R1F A;  2ZIT A;  1I94 I;  4DXL A;  2UUC I;  4USM A;  3WU6 A;  4YHH I;  4DPY A;  2A2D A;  4FN5 A;  4JI7 I;  3LLH A;  4LF9 E;  1H73 A;  4JI2 I;  4JV5 E;  1HNW I;  2NPF A;  2UUA E;  5FLX Q;  1XMQ I;  1HNX I;  1XNQ I;  1PKP A;  1DI2 A;  1N0V C;  1Z5A A;  2V2Z A;  2LBS B;  3K1J A;  1WHQ A;  1FI4 A;  4MYU A;  4NXM E;  4KQV A;  1KKH A;  4WUB A;  2UXD I;  4FWG A;  4FW9 A;  4B3M I;  1J26 A;  1J5E E;  4JI8 E;  4HAC B;  4X8W A;  4DR5 I;  1Z0V A;  1Z0G A;  2KHX A;  1Z0C A;  2UUB E;  2L3J A;  1Z0T A;  4DV2 E;  1IBL I;  2CPN A;  4LF6 I;  2LUQ A;  2N3H A;  4DV4 I;  4B3R E;  2DIX A;  4YY3 E;  4FWH A;  2V2Q A;  1H74 A;  1H7U A;  2L33 A;  1KIJ A;  4JI0 I;  4JI5 I;  1GQE A;  4HY1 A;  4JG4 A;  1ELO A;  3Q1Q A;  4LFB I;  4JI1 E;  4X66 E;  1EI1 A;  5GME A;  2E5L I;  1MG7 A;  5LMN E;  2CZ9 A;  1STU A;  2RS7 A;  3QT6 A;  3P1X A;  2BM1 A;  1X47 A;  3OTO I;  1Z0E A;  3ZZ0 A;  1FWK A;  1H7S A;  3F0N A;  5IT9 C;  3PYD A;  2VQF I;  4OX9 I;  4DR2 I;  1T4O A;  1ZM3 A;  3QT7 A;  4LF4 I;  2UXC I;  2V34 A;  5A2Q Q;  2L2N A;  4LF7 I;  2LUP B;  1XMQ E;  4WYQ B;  1S16 A;  4P7A A;  4LFC I;  2NUG A;  3PYE A;  4FWD A;  3B8H A;  3WU3 A;  4AQY I;  2B7T A;  1FJG I;  4DPT A;  2B7V A;  3ZKD A;  1IBK I;  5L3J A;  1XMO I;  2RS6 A;  4KHP I;  5IWA E;  4LF4 E;  1RQ0 A;  5IT9 Q;  4LF5 E;  4WFT A;  4DR2 E;  4DV5 E;  2VQF E;  2AJ4 A;  4DV3 E;  1UHZ A;  1MU5 A;  4Z7Y A;  2JY9 A;  2HKE A;  4URL A;  3T1H I;  3C4T A;  1YZ9 A;  2J7K A;  2IHR 1;  4UT4 A;  4DR1 I;  4DUY E;  2EFG A;  5LMN I;  2JVA A;  1XHK A;  4JI1 I;  1ZXN A;  3ADL A;  4DV1 E;  4RPF A;  1RR9 A;  2NUE A;  1MX0 A;  3VYY A;  4JI0 E;  1WUU A;  3QT5 A;  1Z0B A;  2GS8 A;  2R3V A;  3ADJ A;  4YY3 I;  1YYO A;  4B3R I;  2HK2 A;  1YYK A;  4OOG C;  4GKJ I;  1N34 I;  4MYT A;  1IBM I;  2ZBK B;  1RRE A;  3PYG A;  3ADI A;  4DV5 I;  2UXD E;  2V8P A;  1BKN A;  4DV0 I;  4NXM I;  4X62 E;  2HHH I;  1XMO E;  1S4E A;  4DPU A;  1HNW E;  1U2R A;  4JV5 I;  5A2Q C;  1T4N A;  3LPS A;  1A6F A;  1YYW A;  1EKZ A;  4YHH E;  3J81 C;  2OI2 A;  3CWV A;  2R42 A;  2LJP A;  5BR8 I;  1FNM A;  4JYA E;  1ZXM A;  1UIL A;  1O0W A;  2NUF A;  1Z0W A;  1N36 I;  1UEK A;  1N33 I;  4DPX A;  5LL6 R;  2LRS A;  1K47 A;  4P52 A;  4PU9 A;  2VQE E;  2DB2 A;  1NHJ A;  2F4V I;  4LF7 E;  2VF3 A;  3JAM C;  4K0K E;  3H4L A;  4DR7 E;  1N32 E;  3ZZU A;  4M30 A;  4DV0 E;  1QU6 A;  4OX9 E;  5LMU E;  4B3T E;  4DPW A;  3D4J A;  3J80 C;  2HFS A;  2HK3 A;  3OTO E;  1ZBT A;  3HUL A;  4PRX A;  2BM0 A;  4GKJ E;  4I3H A;  1Z5C A;  4JI4 E;  4X64 I;  4PRV A;  2E5L E;  2A2C A;  5GMD A;  4X66 I;  2LTS A;  1B63 A;  4B3S I;  2UU9 I;  4LFA I;  4JI6 E;  3J7A M;  4DV7 I;  4DKK A;  4DV7 E;  2HFU A;  4DR4 E;  1FKA E;  4JI6 I;  4Z7C A;  2MDR A;  2L3C A;  4LF6 E;  3LNU A;  4JI3 E;  1IBL E;  4DR1 E;  5CFF E;  4DV2 I;  2WW4 A;  2UXB I;  1NZ0 A;  2YT4 A;  2Q2E B;  1T4L B;  1Z59 A;  2B3T B;  1ZM9 A;  1D6T A;  4DV3 I;  1J5E I;  2X36 A;  4LF5 I;  1N32 I;  5IWA I;  4KHP E;  4DR3 I;  4DU7 A;  1OJ4 A;  4WUD A;  2NA2 A;  3PYF A;  2F4V E;  4DUZ I;  1KTV A;  4X65 E;  4JI2 E;  1EA6 A;  2X7I A;  4JI7 E;  2RSM A;  1ZM2 A;  1N33 E;  1HR0 E;  1N36 E;  2LJH A;  1ZM4 A;  3T1Y I;  3V5R A;  4WUC A;  1XNR E;  4JYA I;  3LTO A;  1XNR I;  3ZM7 A;  5BR8 E;  4ZVI A;  4HYM A;  2ZM6 E;  3T1Y E;  3WU4 A;  2DEI A;  1HR0 I;  3B82 A;  4LFC E;  3HTX A;  2XEX A;  3ZZT A;  4DV6 I;  3K17 A;  3ZKB A;  1X49 A;  3J7A G;  3J7Y p;  4X65 I;  1NHI A;  4DUZ E;  2L2K B;  4ED4 A;  4DR3 E;  2HHH E;  4X62 I;  2UXC E;  3QT8 A;  1FWL A;  4LF8 E;  1RC7 A;  1PIE A;  4EMD A;  3J81 Q;  2EZ6 A;  1IBM E;  1N34 E;  4DU8 A;  2V2V A;  2UXB E;  3C4B A;  4JI3 I;  1HNZ E;  4GKK E;  4M1K A;  4LFB E; 
#chains in the Genus database with same CATH topology
 2EMZ A;  4IZK A;  1QZR A;  1KVK A;  1T38 A;  1IQS A;  1B69 A;  1JK2 A;  2L2M A;  1DQ3 A;  2MC5 A;  3ADG A;  1MGT A;  2AE8 A;  4R03 A;  2BV3 A;  4DR4 I;  1PJS A;  2EL6 A;  3GON A;  5AE1 A;  2EPA A;  4JI5 E;  4GKK E;  4NXN E;  1PJQ A;  3JAM Q;  2EPK X;  4NXN I;  1PJT A;  2EOS A;  2YRK A;  4O5G A;  3KRN A;  1VIS A;  1Z5B A;  2WBT A;  1G2D C;  5FLX C;  2UU9 E;  4LFA E;  1NHH A;  4DV1 I;  2EMW A;  2DMY A;  2WP8 A;  3VYX A;  4DV4 E;  1G2F C;  2EJ4 A;  4B3S E;  5IV8 B;  2DEJ A;  4JI4 I;  4GKK I;  1PVG A;  2JEB B;  4UTG A;  1HNZ I;  4X64 E;  2RTX A;  4DUY I;  4QNJ A;  4L5N C;  2EM0 A;  5KL2 A;  2UUB I;  3M7N D;  2EML A;  3HPS A;  3EPK A;  4GZN C;  3T1H E;  2C39 A;  3P76 A;  4DR5 E;  4BHB A;  1E3P A;  2YTG A;  4WX9 A;  5KL7 A;  4NBQ A;  2GPI A;  4HXZ A;  4JI8 I;  5LMU I;  4B3M E;  1TF3 A;  2YTQ A;  2H36 X;  4B3T I;  1WHN A;  2WP8 B;  2LCE A;  2N3G A;  4LF8 I;  3J80 Q;  3VHT B;  2JR1 A;  4DR7 I;  4K0K I;  2E1R A;  3B78 A;  4XTJ A;  1H72 C;  3EPL A;  3EQ1 A;  1HNX E;  1IBK E;  2LTR A;  4M2Z A;  1XNQ E;  5IXM B;  3WU5 A;  3BBG A;  1DAR A;  4USK A;  2UUA I;  4MU1 A;  4HAC A;  2EWL A;  1B62 A;  2BA1 G;  2VQE I;  2EMC A;  3M6A A;  1F2I G;  1N0U A;  4FW5 A;  2NN6 F;  4LF9 I;  5K36 F;  3C6K A;  4MDT A;  2Z5B B;  2EN3 A;  4OO1 A;  2VF1 A;  1YPN A;  2K4V A;  2PRT A;  4DV6 E;  1HK7 A;  4LCF A;  3HKM A;  1FJG E;  4AQY E;  1ZU1 A;  2WNR B;  4X9J A;  5K36 D;  4ZYG A;  1X48 A;  3V2U C;  2ZM6 I;  1KYQ A;  2UUC E;  4LPF A;  1I94 E;  2EMI A;  4DR6 E;  2HKJ A;  1UBD C;  2WBS A;  1PDA A;  2EM4 A;  3DD6 A;  2D9H A;  1USV A;  2ZIT A;  4IZJ B;  4R1F A;  5ELW A;  1I94 I;  4DR6 I;  4DXL A;  4IFD B;  3U1Y A;  2UUC I;  4IFD C;  4USM A;  3WU6 A;  2YSO A;  1A1G A;  3PS1 A;  2CG9 A;  1YFH A;  4YHH I;  4IZJ A;  4DPY A;  2O1V A;  1JK1 A;  5F3W A;  2A2D A;  4FN5 A;  1YUJ A;  4IZJ D;  3Q6M A;  4JI7 I;  4IFD D;  3LLH A;  1EH8 A;  4LF9 E;  1H73 A;  4LCH A;  2DLQ A;  4JV5 E;  4LCG A;  4JI2 I;  1HNW I;  3K6Q A;  2EMB A;  2UUA E;  2NPF A;  5KL6 A;  5FLX Q;  1XMQ I;  3IWB A;  2IOP A;  2JOX A;  1PKP A;  1HNX I;  1A1F A;  1XNQ I;  5K36 B;  1DI2 A;  1N0V C;  1Z5A A;  2YTP A;  2V2Z A;  3DF6 A;  2LBS B;  3K1J A;  1WHQ A;  2V8Q B;  1FI4 A;  4MYU A;  2YTJ A;  4NXM E;  2J65 A;  4KQV A;  1KKH A;  4WUB A;  2UXD I;  2ADR A;  4Q35 B;  4FWG A;  4FW9 A;  2YTO A;  4B3M I;  5T6J A;  1J26 A;  3CDI A;  1J5E E;  4JI8 E;  2EMA A;  1P47 A;  3HJC A;  4HAC B;  3ZOQ B;  2PO1 B;  4X8W A;  4BCA A;  1X3C A;  2EPP A;  2JEA B;  4DR5 I;  1Z0V A;  2GO4 A;  4R2E A;  1Z0G A;  2KHX A;  2YSP A;  4R2C A;  1XXE A;  1Z0C A;  2UUB E;  3K85 A;  3IWC A;  2L3J A;  1Z0T A;  2EM7 A;  2O1W A;  4RH8 A;  4DV2 E;  5DRQ A;  1IBL I;  2EM2 A;  2PO2 B;  2CPN A;  2YTI A;  1R6M A;  2Z5C B;  4LF6 I;  2LE2 A;  1UDO A;  2LUQ A;  5KL4 A;  3H09 A;  2N3H A;  2FTX B;  4DV4 I;  4B3R E;  1NEI A;  2DMI A;  3MHH C;  1IMU A;  2DIX A;  2L92 A;  2IOQ A;  2LT7 A;  4YY3 E;  2NN6 D;  4FWH A;  2EPZ A;  4R2R A;  2V2Q A;  1H74 A;  1H7U A;  2L33 A;  4AIM A;  1KIJ A;  3M7N G;  4JI0 I;  2EMY A;  4JI5 I;  1GQE A;  2O1U A;  2EN6 A;  2EPN A;  1GZ6 A;  4O43 A;  3F6H A;  4HY1 A;  4JG4 A;  1ELO A;  3Q1Q A;  2C37 A;  2YZT A;  4WXC A;  4JI1 E;  4LFB I;  4X66 E;  1EI1 A;  5GME A;  2E5L I;  2HC5 A;  1MG7 A;  5LMN E;  2CZ9 A;  4P78 A;  2EN8 A;  2EPX A;  1STU A;  2EOX A;  2RS7 A;  5AE2 A;  3PS2 A;  3QT6 A;  3P1X A;  2BM1 A;  1X47 A;  2EOR A;  4I8O A;  1UDQ A;  4LTY A;  3OTO I;  1Z0E A;  3ZZ0 A;  1FWK A;  1H7S A;  3F0N A;  5C0X C;  5IT9 C;  3PYD A;  5C0X B;  2VQF I;  4OX9 I;  4DR2 I;  1T4O A;  2KON A;  4M0V A;  1ZM3 A;  3QT7 A;  4FW4 A;  2EN7 A;  4LF4 I;  2YRH A;  2UXC I;  3L7Z A;  5C0X E;  2V34 A;  5AAS A;  2L2N A;  5A2Q Q;  2EN4 A;  2EOO A;  2LMZ A;  2LUP B;  4LF7 I;  2JEA A;  1XMQ E;  2EPL X;  2I9I A;  4BHC A;  2JXP A;  4MLQ A;  1LLM C;  4WYQ B;  2F1D A;  2PNZ A;  4ISA A;  1S16 A;  2Q8U A;  3THO B;  1BBG A;  4P7A A;  4LFC I;  2JE6 B;  3GCM A;  4GQU A;  2WNR A;  1Y60 A;  2NUG A;  3UK3 C;  2FV4 B;  4R2A A;  2EM9 A;  3PYE A;  5JEA F;  4F9A B;  4FWD A;  3B8H A;  5JEA C;  3WU3 A;  4FK5 C;  2N8X A;  4MLV A;  2WZO A;  4AQY I;  2B7T A;  1FJG I;  4WSG A;  2EQ0 A;  2V87 A;  4DPT A;  4X62 I;  2EOQ A;  2MKD A;  2GLI A;  5KL5 A;  2B7V A;  2EOM A;  1YUI A;  3B4T A;  3ZKD A;  2EPU A;  2EPR A;  2JYA A;  5AC4 A;  2RQL A;  3P06 A;  4GEQ B;  4F9B B;  2EN2 A;  2HJJ A;  3HPZ A;  1IBK I;  3Q6N A;  5L3J A;  2NN6 A;  4M9V C;  2YTD A;  2NN6 E;  4IFD E;  1XMO I;  4ZYH A;  2EMF A;  2RS6 A;  4BA1 A;  4KHP I;  5IWA E;  4LF4 E;  1RQ0 A;  1OYP A;  5IT9 Q;  2EP3 A;  4OZE A;  4LF5 E;  4WFT A;  4DR2 E;  1Z1B A;  2ENH A;  3KZY A;  2VQF E;  4DV5 E;  3L00 A;  2DRP A;  2AJ4 A;  2V88 A;  4DV3 E;  4WXD A;  2PO0 A;  1UHZ A;  2EL4 A;  2JOB A;  1MU5 A;  4Z7Y A;  2JY9 A;  4FW7 A;  2HKE A;  4URL A;  3BID A;  3T1H I;  2C38 A;  1GTK A;  3C4T A;  3M99 B;  3KZZ A;  2IHR 1;  4ZYD A;  4IS1 C;  1YZ9 A;  3EPH A;  2J7K A;  4DUY E;  2EFG A;  2EOJ A;  4DR1 I;  1EH6 A;  2V89 A;  5AE3 A;  4J3D A;  5LMN I;  2ODR C;  2JVA A;  1XHK A;  4JI1 I;  4ZYE A;  1ZXN A;  4MU0 A;  2EPO A;  4U3D A;  3ADL A;  2BBG A;  5DRO A;  4DV1 E;  1UDN A;  4BS9 A;  4RPF A;  1RR9 A;  2EPC A;  4F6M A;  2NUE A;  1MX0 A;  3VYY A;  4Q28 A;  1Y4U A;  2PO2 A;  4JI0 E;  5LLQ A;  1WUU A;  3QT5 A;  4WPY A;  1X5W A;  3VK6 A;  1Z0B A;  2GO3 A;  2GS8 A;  3AUZ A;  1BB8 A;  2BR2 B;  2JEB A;  2R3V A;  3ADJ A;  2DGC A;  2YRM A;  4YY3 I;  5DRP A;  4RHB B;  1YYO A;  3FIG A;  2EOI A;  1NCS A;  2EOY A;  4B3R I;  2CSH A;  4DMI A;  2HK2 A;  4IJD A;  2EPM X;  3P3C A;  1YYK A;  4OOG C;  1SR9 A;  4GKJ I;  4BA1 B;  1N34 I;  4O4K A;  4BA2 A;  4R8O A;  5TSE A;  2WBU A;  2RSI A;  4MYT A;  1IBM I;  4OO1 C;  2ZBK B;  1RRE A;  3PYG A;  3RMP A;  4OO1 F;  3OML A;  4F6N A;  1QNT A;  3ADI A;  4DV5 I;  2UXD E;  2V8P A;  1E3H A;  4R2S A;  1BKN A;  3TQM A;  4DV0 I;  4NXM I;  4F54 A;  4X62 E;  2HHH I;  3EPJ A;  1XMO E;  1X6H A;  1S4E A;  1VI7 A;  5JEA D;  2IER A;  4IFD A;  2PNL A;  4BA2 B;  2EQ3 A;  4N3O A;  4DPU A;  2DSY A;  2ENA A;  2EM8 A;  1HNW E;  2EMX A;  5A2Q C;  1U2R A;  2BA0 G;  1T4N A;  4JV5 I;  3LPS A;  2M7Q A;  1A6F A;  1YYW A;  1EKZ A;  4FW3 A;  2FGG A;  2YU5 A;  2L6M A;  2LJU A;  4OKG A;  4FW6 A;  4YHH E;  2LV2 A;  3J81 C;  2CT1 A;  4MQY A;  2OI2 A;  3CWV A;  3M85 D;  2LVH A;  2R42 A;  2LJP A;  2PNZ B;  5BR8 I;  4OO1 B;  1FNM A;  4JYA E;  1ZXM A;  4KZS A;  1YSA C;  1UIL A;  1O0W A;  5K36 E;  2NUF A;  4NHR A;  1Z0W A;  5KL3 A;  1N36 I;  1UEK A;  1N33 I;  2JPA A;  4DPX A;  2JT2 A;  5LL6 R;  2LRS A;  1K47 A;  4J8Z A;  2RPC A;  1WXR A;  3F6G A;  3PRY A;  4P52 A;  4OO1 E;  2ELY A;  3L7Z B;  4PU9 A;  5FWK A;  2VQE E;  2DB2 A;  1X6E A;  1NHJ A;  5C0X D;  2NN6 B;  4LU9 A;  2I13 A;  4F9C B;  2F4V I;  5JEA E;  4LF7 E;  2VF3 A;  2E72 A;  2V83 A;  3JAM C;  4K0K E;  3H4L A;  4DR7 E;  2MKN A;  1N32 E;  3ZZU A;  4M30 A;  4DV0 E;  4AID A;  5A6B A;  1RHY A;  4N4R B;  1A1I A;  3HXL A;  1QU6 A;  3MSW A;  4BC9 A;  4OX9 E;  3JTZ A;  5LMU E;  2MDG A;  2M9A A;  4B3T E;  1R6L A;  2O3Z A;  3D4J A;  4DPW A;  3J80 C;  2HFS A;  2EOH A;  5JEA B;  2YTE A;  2YPN A;  1A1J A;  1YH8 A;  2BA0 D;  3HQ1 A;  2HK3 A;  4UT4 A;  2GQ0 A;  3OTO E;  2EQ1 A;  1T39 A;  2C38 B;  2L8T A;  1ZBT A;  1KJK A;  1Y6Z A;  2BM0 A;  1RMD A;  3HUL A;  4PRX A;  4QNK A;  5DNL A;  4GKJ E;  4I3H A;  1Z5C A;  4MU3 A;  5DNY A;  4X64 I;  3C6M A;  4PRV A;  2PO0 B;  5A6A A;  2E5L E;  2A2C A;  5GMD A;  4X66 I;  2EOE A;  2PNM A;  2LTS A;  3NZK A;  1ZR9 A;  1B63 A;  4B3S I;  2Z5B A;  4OO1 D;  2UU9 I;  4LFA I;  4JI6 E;  3J7A M;  2Z5C A;  2O1T A;  4HEI A;  2EM5 A;  4IZK B;  1ZAA C;  5AC5 A;  4DV7 I;  4R2P A;  4DKK A;  4DV7 E;  2C37 B;  2HFU A;  2CGE A;  1P42 A;  1TF6 A;  4DR4 E;  2DLK A;  1FKA E;  4R2D A;  2BR2 A;  1AAY A;  1UN6 B;  1L4S A;  4JI6 I;  4L8N A;  3DJW A;  3KWR A;  1USU A;  4Z7C A;  2MDR A;  5ADZ A;  4IS9 A;  1DGC A;  2GHF A;  2L3C A;  1BBO A;  4MU4 A;  4LF6 E;  3LNU A;  4JI3 E;  1IBL E;  4DR1 E;  5CFF E;  4DV2 I;  2WW4 A;  2UXB I;  2WCC 3;  2C39 B;  3CDJ A;  1NZ0 A;  4F2J C;  2YT4 A;  2A25 A;  2Q2E B;  5K36 A;  1T4L B;  2EMH A;  3BF2 A;  1Z59 A;  5DNX A;  2B3T B;  1ZM9 A;  1D6T A;  1WJP A;  2IES A;  4DV3 I;  2E1M A;  2YU8 A;  1J5E I;  2VE7 C;  2BB8 A;  2HGH A;  2ELZ A;  4NZV A;  4BMJ A;  4IFD F;  2ODR D;  2X36 A;  4LF5 I;  2LO3 A;  2NN6 C;  1Y5Y A;  1N32 I;  5IWA I;  4KHP E;  4WSP A;  4DR3 I;  2BA1 D;  4DU7 A;  1OJ4 A;  4WUD A;  5JEA A;  2NA2 A;  3PYF A;  2F4V E;  1YHC A;  1EH7 A;  2EM3 A;  1KTV A;  4DUZ I;  4X65 E;  4JI2 E;  2M1S A;  2CTD A;  1EA6 A;  2X7I A;  4JI7 E;  5A6J A;  3THN A;  5K36 C;  4AM3 A;  2RSM A;  1ZM2 A;  1MEY C;  1N33 E;  5C0X A;  1HR0 E;  1N36 E;  3BGH A;  2LJH A;  1ZM4 A;  3U1K A;  3T1Y I;  3AV0 A;  3V5R A;  2R1F A;  2JE6 A;  3JU0 A;  1A1K A;  4WUC A;  2YTF A;  2F8B A;  2YWQ A;  1AH5 A;  1XNR E;  3LTO A;  4HTG A;  1XNR I;  4JYA I;  5C0X F;  3ZM7 A;  5BR8 E;  4R2Q A;  2Z5E A;  4HYM A;  2R76 A;  4ZVI A;  2MC6 A;  4LOM A;  1WRJ A;  2ZM6 E;  3T1Y E;  3UHM A;  3WU4 A;  2DEI A;  5EKW A;  1HR0 I;  3B82 A;  2K7I A;  4LFC E;  1N3G A;  3HTX A;  2XEX A;  3ZZT A;  2M4I A;  1TN9 A;  2JP9 A;  3MHS C;  2EMK A;  4DV6 I;  3K17 A;  3QG5 C;  2EOF A;  3ZKB A;  2EE8 A;  2EL5 A;  1X49 A;  1X6F A;  2G7H A;  3J7A G;  3J7Y p;  2EN1 A;  5A69 A;  4U3B A;  2ENC A;  4X65 I;  2V86 A;  2VRD A;  1NHI A;  4DUZ E;  4BC7 A;  4TUG A;  2L2K B;  1OYS A;  4ED4 A;  1ZBQ A;  3P3E A;  5DRR A;  3GLL A;  1Y4S A;  4DR3 E;  5A6K A;  2HHH E;  4O24 A;  2EOZ A;  2UXC E;  3H1C A;  2NAB A;  3IWD A;  2KOU A;  4P7D A;  5A6B D;  1RC7 A;  4LF8 E;  1FWL A;  3QT8 A;  5EL9 A;  3LML A;  1PIE A;  4EMD A;  2B9D A;  1OYR A;  1A1L A;  3P3G A;  3PS3 A;  2VES A;  2EM6 A;  2V85 A;  3J81 Q;  1A1H A;  2YTN A;  4TUI A;  2EZ6 A;  1IBM E;  3M85 G;  3ECR A;  2EMG A;  1UDS A;  1N34 E;  4BBY A;  1IQO A;  2UXB E;  2V2V A;  4DU8 A;  2JWO A;  3C4B A;  2J7J A;  4KWY A;  4JI3 I;  1HNZ E;  2PO1 A;  3GME A;  1SFE A;  2CVE A;  4JI4 E;  4M1K A;  4LFB E; 
#chains in the Genus database with same CATH homology
 4IZK A;  1QZR A;  1KVK A;  2L2M A;  1DQ3 A;  2MC5 A;  3ADG A;  4R03 A;  2BV3 A;  4DR4 I;  3GON A;  5AE1 A;  4JI5 E;  4NXN E;  3JAM Q;  4NXN I;  1VIS A;  1Z5B A;  5FLX C;  2UU9 E;  4LFA E;  1NHH A;  4DV1 I;  2DMY A;  3VYX A;  4DV4 E;  4B3S E;  2DEJ A;  4JI4 I;  4GKK I;  1PVG A;  4UTG A;  1HNZ I;  4X64 E;  2RTX A;  4DUY I;  4L5N C;  2UUB I;  3T1H E;  3HPS A;  4DR5 E;  4HXZ A;  4JI8 I;  5LMU I;  4B3M E;  4B3T I;  2H36 X;  1WHN A;  2N3G A;  4LF8 I;  3J80 Q;  2JR1 A;  4DR7 I;  4K0K I;  2E1R A;  3B78 A;  4XTJ A;  1H72 C;  1HNX E;  1IBK E;  2LTR A;  4M2Z A;  1XNQ E;  3WU5 A;  2UUA I;  1DAR A;  4USK A;  4HAC A;  2EWL A;  1B62 A;  2VQE I;  3M6A A;  1N0U A;  4LF9 I;  2Z5B B;  2VF1 A;  2K4V A;  4DV6 E;  1HK7 A;  1FJG E;  4AQY E;  1X48 A;  3V2U C;  2ZM6 I;  2UUC E;  1I94 E;  4DR6 E;  2HKJ A;  4DR6 I;  4R1F A;  1USV A;  2ZIT A;  4IZJ B;  1I94 I;  4DXL A;  2UUC I;  4USM A;  3WU6 A;  2CG9 A;  4YHH I;  4IZJ A;  4DPY A;  2O1V A;  2A2D A;  5F3W A;  4FN5 A;  4IZJ D;  3Q6M A;  4JI7 I;  3LLH A;  4LF9 E;  1H73 A;  4JI2 I;  4JV5 E;  1HNW I;  3K6Q A;  2NPF A;  2UUA E;  5FLX Q;  1XMQ I;  3IWB A;  2IOP A;  2JOX A;  1PKP A;  1HNX I;  1XNQ I;  1DI2 A;  1N0V C;  1Z5A A;  2V2Z A;  3DF6 A;  2LBS B;  3K1J A;  1WHQ A;  1FI4 A;  2V8Q B;  4MYU A;  4NXM E;  4KQV A;  1KKH A;  4WUB A;  2UXD I;  4FWG A;  4FW9 A;  4B3M I;  5T6J A;  1J26 A;  1J5E E;  4JI8 E;  3HJC A;  4HAC B;  3ZOQ B;  4X8W A;  4BCA A;  4DR5 I;  1Z0V A;  1Z0G A;  2KHX A;  1Z0C A;  2UUB E;  3K85 A;  3IWC A;  2L3J A;  1Z0T A;  2O1W A;  4DV2 E;  1IBL I;  2CPN A;  4LF6 I;  2Z5C B;  2LE2 A;  2LUQ A;  3H09 A;  2N3H A;  2FTX B;  4DV4 I;  4B3R E;  2DIX A;  2L92 A;  2IOQ A;  4YY3 E;  4FWH A;  2V2Q A;  1H74 A;  1H7U A;  2L33 A;  1KIJ A;  4JI0 I;  4JI5 I;  1GQE A;  2O1U A;  1GZ6 A;  3F6H A;  4HY1 A;  4JG4 A;  1ELO A;  3Q1Q A;  2YZT A;  4JI1 E;  4LFB I;  4X66 E;  1EI1 A;  5GME A;  2E5L I;  1MG7 A;  5LMN E;  2CZ9 A;  4P78 A;  1STU A;  5AE2 A;  2RS7 A;  3QT6 A;  3P1X A;  2BM1 A;  1X47 A;  4I8O A;  4LTY A;  3OTO I;  1Z0E A;  3ZZ0 A;  1FWK A;  1H7S A;  3F0N A;  5IT9 C;  3PYD A;  2VQF I;  4OX9 I;  4DR2 I;  1T4O A;  2KON A;  4M0V A;  1ZM3 A;  3QT7 A;  4LF4 I;  2UXC I;  2V34 A;  5AAS A;  2L2N A;  5A2Q Q;  2LMZ A;  4LF7 I;  2LUP B;  1XMQ E;  4WYQ B;  1S16 A;  4P7A A;  4LFC I;  2NUG A;  2FV4 B;  3PYE A;  4F9A B;  4FWD A;  3B8H A;  3WU3 A;  2WZO A;  4AQY I;  2B7T A;  1FJG I;  2V87 A;  4DPT A;  2B7V A;  3ZKD A;  3P06 A;  4GEQ B;  4F9B B;  3HPZ A;  1IBK I;  3Q6N A;  5L3J A;  1XMO I;  2RS6 A;  4KHP I;  5IWA E;  4LF4 E;  1RQ0 A;  5IT9 Q;  4LF5 E;  4WFT A;  4DR2 E;  4DV5 E;  2VQF E;  2AJ4 A;  2V88 A;  4DV3 E;  1UHZ A;  2JOB A;  1MU5 A;  4Z7Y A;  2JY9 A;  2HKE A;  4URL A;  3T1H I;  3C4T A;  1YZ9 A;  2J7K A;  2IHR 1;  4UT4 A;  4DR1 I;  4DUY E;  2EFG A;  5LMN I;  2V89 A;  5AE3 A;  2ODR C;  2JVA A;  1XHK A;  4JI1 I;  1ZXN A;  3ADL A;  4DV1 E;  4BS9 A;  4RPF A;  1RR9 A;  2NUE A;  1MX0 A;  3VYY A;  4Q28 A;  1Y4U A;  4JI0 E;  1WUU A;  3QT5 A;  4WPY A;  3VK6 A;  1Z0B A;  2GS8 A;  3AUZ A;  2R3V A;  3ADJ A;  4YY3 I;  1YYO A;  3FIG A;  4B3R I;  4DMI A;  2HK2 A;  1YYK A;  4OOG C;  1SR9 A;  4GKJ I;  1N34 I;  4R8O A;  4MYT A;  1IBM I;  2ZBK B;  1RRE A;  3PYG A;  3RMP A;  3OML A;  3ADI A;  4DV5 I;  2UXD E;  2V8P A;  1BKN A;  4DV0 I;  4NXM I;  4F54 A;  4X62 E;  2HHH I;  1XMO E;  1S4E A;  2PNL A;  4N3O A;  4DPU A;  2DSY A;  1HNW E;  1U2R A;  4JV5 I;  5A2Q C;  1T4N A;  3LPS A;  2M7Q A;  1A6F A;  1YYW A;  1EKZ A;  2FGG A;  2L6M A;  4YHH E;  3J81 C;  2OI2 A;  3CWV A;  2R42 A;  2LJP A;  5BR8 I;  1FNM A;  4JYA E;  1ZXM A;  4KZS A;  1UIL A;  1O0W A;  2NUF A;  1Z0W A;  1N36 I;  1UEK A;  1N33 I;  4DPX A;  5LL6 R;  2LRS A;  1K47 A;  4J8Z A;  1WXR A;  3F6G A;  3PRY A;  4P52 A;  4PU9 A;  5FWK A;  2VQE E;  2DB2 A;  1NHJ A;  4LU9 A;  2F4V I;  4F9C B;  4LF7 E;  2VF3 A;  2V83 A;  3JAM C;  4K0K E;  3H4L A;  4DR7 E;  1N32 E;  3ZZU A;  4M30 A;  4DV0 E;  3HXL A;  1QU6 A;  3MSW A;  4BC9 A;  4OX9 E;  3JTZ A;  5LMU E;  4B3T E;  4DPW A;  3D4J A;  3J80 C;  2HFS A;  2HK3 A;  3HQ1 A;  2GQ0 A;  3OTO E;  2L8T A;  1ZBT A;  3HUL A;  1Y6Z A;  2BM0 A;  4PRX A;  4GKJ E;  4I3H A;  1Z5C A;  4JI4 E;  5DNY A;  4X64 I;  4PRV A;  2E5L E;  2A2C A;  5GMD A;  4X66 I;  2PNM A;  2LTS A;  1B63 A;  4B3S I;  2Z5B A;  2UU9 I;  4LFA I;  4JI6 E;  3J7A M;  2Z5C A;  2O1T A;  4IZK B;  4DV7 I;  4DKK A;  4DV7 E;  2HFU A;  2CGE A;  4DR4 E;  1FKA E;  4JI6 I;  4L8N A;  3DJW A;  3KWR A;  1USU A;  4Z7C A;  2MDR A;  5ADZ A;  2L3C A;  4LF6 E;  3LNU A;  4JI3 E;  1IBL E;  4DR1 E;  5CFF E;  4DV2 I;  2WW4 A;  2UXB I;  1NZ0 A;  2YT4 A;  2Q2E B;  1T4L B;  1Z59 A;  2B3T B;  1ZM9 A;  1D6T A;  4DV3 I;  2E1M A;  1J5E I;  2VE7 C;  4BMJ A;  2ODR D;  2X36 A;  4LF5 I;  1N32 I;  5IWA I;  4KHP E;  4WSP A;  4DR3 I;  4DU7 A;  1OJ4 A;  4WUD A;  2NA2 A;  3PYF A;  2F4V E;  4DUZ I;  1KTV A;  4X65 E;  4JI2 E;  2M1S A;  1EA6 A;  2X7I A;  4JI7 E;  2RSM A;  1ZM2 A;  1N33 E;  1HR0 E;  1N36 E;  2LJH A;  1ZM4 A;  3T1Y I;  3AV0 A;  3V5R A;  3JU0 A;  4WUC A;  1XNR E;  2F8B A;  4JYA I;  3LTO A;  1XNR I;  3ZM7 A;  5BR8 E;  2Z5E A;  4ZVI A;  4HYM A;  2MC6 A;  2ZM6 E;  3T1Y E;  3WU4 A;  2DEI A;  1HR0 I;  3B82 A;  4LFC E;  3HTX A;  2XEX A;  3ZZT A;  2M4I A;  4DV6 I;  3K17 A;  3ZKB A;  1X49 A;  2G7H A;  3J7A G;  3J7Y p;  4X65 I;  2V86 A;  1NHI A;  4DUZ E;  4BC7 A;  4TUG A;  2L2K B;  4ED4 A;  1ZBQ A;  1Y4S A;  4DR3 E;  2HHH E;  4X62 I;  2UXC E;  3QT8 A;  3IWD A;  4P7D A;  2KOU A;  1RC7 A;  4LF8 E;  1FWL A;  3LML A;  1PIE A;  4EMD A;  2B9D A;  3J81 Q;  2V85 A;  4TUI A;  2EZ6 A;  1IBM E;  1N34 E;  4BBY A;  4DU8 A;  2UXB E;  2V2V A;  2JWO A;  3C4B A;  4JI3 I;  1HNZ E;  4GKK E;  4M1K A;  4LFB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...