4DV2E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 32
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv2E02
4GKJE 5IT9C 4B3TI 4DR3I 4OX9I 1FKAE 1ZM4A 4DR6I 4DV2E 4DR4I 4JI8I 4DV6I 2UUCI 1MX0A 4JI1I 2HHHI 4GKKI 1J5EE 2LBSB 1B62A 4WUBA 2NPFA 5IT9Q 3V5RA 2LUPB 1Z0BA 3QT5A 1IBKI 1XNQI 2E5LI 2L2KB 1YYWA 2DMYA 2N3GA 1EI1A 4HXZA 1HNZE 4JI3I 3J80Q 1HR0E 4LF7E 1EKZA 2EZ6A 1WHNA 2F4VE 2B3TB 4LF8I 4DPWA 1EA6A 4DPUA 4B3MI 1XMOE 3K1JA 4NXMI 2HFSA 4DV0I 1IBLE 5LMNI 2UUAE 2LRSA 4Z7YA 4DUZI 5LL6R 4LFAI 3T1HE 2UXDE 4DV5I 4WFTA 1N36I 3LPSA 4LFBI 3HULA 4B3SI 1UILA 1N32E 2V2ZA 1YZ9A 1HNWI 4DV7E 2ZM6E 4DR1E 5FLXC 1NHIA 1O0WA 3JAMQ 2CPNA 2UXCE 1HNXI 1J26A 4JI2E 3Q1QA 5LMUE 2UU9E 1VISA 5L3JA 4JYAI 4YHHE 4P52A 2BM0A 5FLXQ 1UEKA 4JV5E 1Z0TA 4HY1A 3CWVA 4MYUA 2IHR1 1KKHA 4LFCI 2HK3A 1PIEA 4DR7I 4DR3E 1N33I 1X47A 4DR6E 4DR4E 1Z5BA 4JI8E 4DR5I 5CFFE 2UUCE 1UHZA 1FI4A 3J81Q 1RQ0A 3PYFA 2HHHE 4NXNI 4PRXA 3K17A 4DV1I 2J7KA 4JG4A 2MDRA 3D4JA 1IBKE 1XNQE 3ZZ0A 2E5LE 4JI6I 2A2DA 4DPXA 4RPFA 1Z0CA 4JI3E 2R42A 1KIJA 2VF3A 3GONA 2A2CA 4X65I 5IWAI 2X7IA 4JI5E 3B8HA 2ZBKB 4X66I 4JI4I 1N0UA 2NA2A 2BM1A 4LF8E 4NXME 2UXBE 1PVGA 3ZZUA 4DV3I 4LF5E 2B7VA 1QU6A 4DV0E 4FW9A 5LMNE 1H72C 4X64E 3C4TA 3LLHA 2DIXA 4M30A 4DUZE 2V34A 4LF9I 1H73A 3J80C 4LFAE 2Q2EB 1Z5AA 3OTOI 4DV5E 4DPYA 3T1YE 2DEJA 1N36E 1ZBTA 4USKA 4LFBE 4B3SE 1XHKA 1HNWE 2LJPA 1T4OA 4B3RE 2WW4A 2VQFI 1RC7A 2NUGA 4LF6I 2OI2A 1S4EA 4JYAE 4YY3I 4KHPI 4AQYI 2V2VA 1NHJA 3B82A 1XNRE 4XTJA 3WU4A 4JI0I 3PYEA 1DARA 4LFCE 4R1FA 3JAMC 4LF4I 1BKNA 4DV2I 1N33E 3QT8A 1XMQI 1FJGE 1Z0VA 3LNUA 4DV4I 4HACB 3ZM7A 4NXNE 1RREA 2V8PA 4DV1E 3ADJA 4DUYI 4ZVIA 1WHQA 2NUEA 1RR9A 4FWGA 3P1XA 4DR2I 2LTRA 1HR0I 2RS7A 1U2RA 3J81C 1Z0EA 2LTSA 4X65E 5IWAE 2LUQA 4X66E 1H74A 1XMOI 4B3TE 4OX9E 2DEIA 2HKEA 1WUUA 2HFUA 4DV6E 1H7SA 2RS6A 2UUAI 4JI1E 4KQVA 1Z5CA 4GKKE 1N34I 1QZRA 4LF9E 2ZITA 3H4LA 3T1HI 3WU3A 5BR8I 4DU8A 4K0KI 2UXDI 4OOGC 3OTOE 4I3HA 1ZM3A 2VQEI 1H7UA 3J7AM 4HACA 2YT4A 3PYGA 1IBMI 3HTXA 4URLA 1FWLA 2L33A 2ZM6I 4DR1I 2L3CA 1PKPA 1ZXNA 2EFGA 4Z7CA 2UXCI 4B3ME 2VQFE 3WU6A 2HKJA 3C4BA 2L3JA 1X49A 4LF6E 2RSMA 4YY3E 1ZM9A 4AQYE 2UUBI 4WUCA 5GMDA 2B7TA 4FWHA 1GQEA 4EMDA 4JI0E 2GS8A 3ADIA 4LF4E 1XMQE 3B78A 4DKKA 4UT4A 4DV4E 4P7AA 1KTVA 4X62I 4DUYE 1NHHA 1S16A 1ZM2A 1HNXE 4X8WA 4DR2E 1KVKA 3ADGA 1B63A 3J7Yp 3ZKBA 1I94I 2E1RA 2LJHA 3F0NA 2HK2A 2JVAA 4JI7I 4JI5I 3QT6A 4GKJI 4DU7A 4DR7E 1T4LB 4PU9A 2UXBI 4LF5I 2KHXA 4USMA 4DR5E 1MU5A 2NUFA 4MYTA 5GMEA 4X64I 1J5EI 1N34E 5BR8E 1N0VC 4K0KE 2DB2A 2BV3A 3T1YI 1D6TA 4JI6E 2VQEE 4UTGA 2X36A 1HNZI 1X48A 2V2QA 4LF7I 3VYYA 2RTXA 1IBME 1Z0WA 2F4VI 4JI4E 4B3RI 2L2NA 3WU5A 2XEXA 3ZZTA 4DV3E 3PYDA 1IBLI 4DPTA 1FNMA 4FN5A 3LTOA 2UUBE 1YYOA 4WYQB 4HYMA 3ZKDA 4FWDA 1A6FA 1XNRI 3J7AG 4DXLA 1MG7A 1K47A 4M2ZA 1DI2A 2L2MA 2AJ4A 1FJGI 1ELOA 1Z0GA 1Z59A 4PRVA 1N32I 1T4NA 4DV7I 3VYXA 2JY9A 4M1KA 3M6AA 1ZXMA 2N3HA 3QT7A 4X62E 2CZ9A 5A2QC 3V2UC 4JI2I 4ED4A 5LMUI 3ADLA 1FWKA 2UU9I 1NZ0A 4YHHI 2R3VA 1I94E 4KHPE 4JV5I 4WUDA 1YYKA 5A2QQ 1STUA 4JI7E 1OJ4A
chains in the Genus database with same CATH superfamily
4GKJE 5IT9C 4B3TI 2ODRD 4DR3I 4OX9I 1FKAE 4WSGA 1ZM4A 2EOQA 2V87A 2NABA 4DR6I 4DV2E 2GPIA 1UBDC 4BA2B 4MU1A 2E72A 5IV8B 4GZNC 2EMZA 1GZ6A 1PJTA 2YU5A 4JI8I 5JEAB 4DV6I 2UUCI 3M7NG 2BR2A 1MX0A 4JI1I 2YTFA 2HHHI 2DMIA 3EPKA 4BCAA 1G2DC 1Y4SA 4GKKI 1J5EE 2LBSB 1B62A 1A1JA 2UUAI 2VE7C 2AE8A 2KONA 2NN6D 3HJCA 4WUBA 2NPFA 5IT9Q 3V5RA 2FTXB 1E3PA 2EM3A 2LUPB 4O43A 1Z0BA 4WX9A 4OO1A 3QT5A 1IBKI 1XNQI 4X9JA 2E5LI 2EMBA 2L2KB 1LLMC 1YYWA 2DMYA 2N3GA 1EI1A 1Y4UA 5JEAD 2JT2A 1HNZE 4HXZA 4LCGA 2RPCA 5A69A 5A6JA 1KYQA 2EOEA 2EOIA 4I8OA 4R2CA 1HR0E 2EOSA 3C6KA 4LF7E 3J80Q 1EKZA 5KL6A 2BA0D 1ZBQA 3KWRA 2EZ6A 1WHNA 2C39A 2EN8A 2EOJA 2F4VE 2B3TB 4LF8I 4DPWA 5DNYA 1EA6A 4DPUA 4B3MI 1XMOE 3K1JA 2Z5CB 4NXMI 2HFSA 4DV0I 1IBLE 5LMNI 2UUAE 4ZYEA 2LRSA 1OYRA 2C37B 1JK1A 4Z7YA 4DUZI 5LL6R 3QG5C 2F1DA 4R2SA 2A25A 5C0XC 4O4KA 3T1HE 3BF2A 3IWDA 4IZKB 4LFAI 5ADZA 2G7HA 2IERA 2UXDE 4DV5I 1ZR9A 2EMIA 5KL3A 4BA2A 2NN6F 1GTKA 2IESA 1WRJA 4WFTA 3PS3A 1N36I 3HKMA 1OYSA 2WP8B 3LPSA 2LT7A 2GHFA 4LFBI 3HULA 2JOXA 4B3SI 3EPLA 2DGCA 1UILA 1N32E 2V2ZA 2V89A 2M7QA 5KL2A 1YZ9A 4DV7E 1RMDA 2O3ZA 2ZM6E 4DR1E 4NZVA 5FLXC 5JEAF 2YTQA 2CSHA 4WPYA 2EM4A 1O0WA 1NHIA 3JAMQ 4IZJB 2CPNA 2YZTA 2FV4B 2UXCE 1HNXI 1J26A 1WJPA 4JI2E 2LVHA 2NN6E 3Q1QA 5LMUE 3VK6A 5C0XB 2EMHA 2UU9E 1VISA 5L3JA 4JYAI 2V88A 4YHHE 4R2QA 4TUGA 4ZYDA 2BM0A 1PJSA 4P52A 5FLXQ 2EM2A 1UEKA 2JXPA 4JV5E 2LJUA 4WXCA 1Z0TA 2GQ0A 4HY1A 5JEAE 3IWCA 4ZYHA 3CWVA 3PS2A 2IHR1 4MYUA 1KKHA 2EL6A 4P7DA 2Z5CA 2C38A 2HK3A 2O1TA 2EPPA 2LE2A 1PIEA 2PNMA 4IZJD 4LFCI 4DR7I 3C6MA 2DLKA 4DR3E 2M1SA 4R2PA 1N33I 1X47A 3VHTB 1EH7A 1EH8A 2EP3A 4DR4E 4DR6E 1R6LA 1Z5BA 4JI8E 2C37A 4DR5I 5CFFE 3JTZA 2UUCE 1UHZA 3H1CA 1FI4A 2EN1A 5K36D 3J81Q 2YU8A 1RQ0A 4IFDF 2WBUA 3PYFA 4IZKA 2HHHE 2EOFA 4NXNI 2DSYA 3K17A 4PRXA 5KL5A 5KL7A 2PNZB 4DV1I 1MGTA 2VF1A 3PRYA 4ISAA 4BA1A 2PNLA 2ENCA 2J7KA 3Q6MA 1NCSA 2EL4A 4R2RA 4OKGA 3L00A 4HEIA 5AE1A 2EMFA 5AE3A 4JG4A 3M85D 4QNKA 2MDRA 2WP8A 1IBKE 1XNQE 3D4JA 2E5LE 1UDNA 2A2DA 4L5NC 3ZZ0A 4DPXA 4OO1D 4RPFA 2BBGA 1YUIA 3DJWA 2V8QB 1Z0CA 4IFDE 2V85A 4F9AB 1AAYA 1DGCA 4JI3E 3HQ1A 2YTGA 1USVA 1L4SA 1Y5YA 2R42A 1KIJA 2VF3A 4J3DA 4QNJA 5AC5A 1WXRA 2YPNA 3GONA 1Z1BA 5DROA 2A2CA 4X65I 5IWAI 1Y60A 4JI5E 2X7IA 3B8HA 4MQYA 2L8TA 2ZBKB 4X66I 2EPOA 4JI4I 1N0UA 2NA2A 5C0XA 2Z5EA 2BM1A 1JK2A 1A1KA 4LF8E 2YTOA 4LOMA 3GMEA 4N4RB 4HTGA 4NXME 2UXBE 1PVGA 3GLLA 3ZZUA 4LF5E 4DV3I 5KL4A 2B7VA 3B4TA 1QU6A 4DV0E 4FW9A 5LMNE 1H72C 4IJDA 4X64E 3C4TA 3LLHA 5EKWA 3U1KA 1HK7A 2EMAA 2DIXA 2H36X 4M30A 4DUZE 2V34A 4LF9I 4F2JC 3J80C 2V83A 1H73A 1F2IG 4LFAE 2IOQA 4DMIA 2Q2EB 5K36F 1Z5AA 1A1FA 3OTOI 3K85A 4IS9A 5A6KA 4DV5E 3H09A 5AASA 2IOPA 1G2FC 2O1VA 4DPYA 3T1YE 2EQ0A 1P42A 3ZOQB 4DR4I 2MKDA 2EMWA 2DEJA 2VRDA 1ZBTA 1N36E 4USKA 2J65A 3U1YA 2VESA 4LFBE 2PNZA 1IMUA 4B3SE 3EPHA 3P3GA 2EN4A 2EM8A 2EPUA 1XHKA 2EJ4A 4GEQB 4OO1F 3LMLA 1HNWE 2GO4A 5K36E 2PO0B 3BGHA 3ECRA 2LJPA 3HPZA 4NHRA 1T4OA 4B3RE 2WW4A 2BA1D 4N3OA 3AV0A 1T39A 2VQFI 1RC7A 2C38B 2JE6B 4U3BA 2NUGA 4LF6I 4M0VA 2I13A 2OI2A 1S4EA 4JYAE 1YSAC 1PJQA 4YY3I 4AQYI 2EMKA 4ZYGA 4KHPI 2V2VA 2ELZA 1NHJA 4OO1E 2EQ3A 3B82A 4BC7A 4JI6I 3IWBA 2LCEA 2PRTA 1XNRE 4XTJA 3WU4A 2CGEA 4R2DA 4BA1B 4JI0I 3PYEA 1DARA 4LFCE 2EPKX 2ENAA 4R1FA 3JAMC 1TF6A 4LF4I 1QNTA 3HPSA 1X6FA 1SFEA 1BKNA 4DV2I 1N33E 3QT8A 1XMQI 1SR9A 4LPFA 1YFHA 1FJGE 1A1IA 4MLQA 1Z0VA 4F6MA 1Y6ZA 3LNUA 4DV4I 4HACB 1DQ3A 2EWLA 2PO1B 1ZAAC 3ZM7A 4NXNE 4F9CB 2V86A 1RREA 4DV1E 1UDOA 2V8PA 2CVEA 2CG9A 3ADJA 4DUYI 4ZVIA 1USUA 4Q35B 1WHQA 5FWKA 4GQUA 2NUEA 2JOBA 1RR9A 2YRHA 2MC6A 4FWGA 2F8BA 3P1XA 2PO2B 4AIDA 4DR2I 2LTRA 3JU0A 4WXDA 4F6NA 2Q8UA 4MDTA 3EPJA 1HR0I 2K4VA 2R1FA 2BA0G 2RS7A 2PO0A 2YRKA 2LO3A 4TUIA 1U2RA 3K6QA 3J81C 1Z0EA 2LTSA 4X65E 5IWAE 2E1MA 3P3CA 2LUQA 2RSIA 4X66E 1H74A 1BBOA 3KZZA 2JE6A 2ADRA 1XMOI 5A6AA 4B3TE 4OX9E 2DEIA 2HKEA 2WBSA 5C0XD 1YUJA 1WUUA 2EL5A 2HFUA 1BBGA 3EQ1A 4O5GA 4DV6E 1H7SA 5EL9A 3PS1A 2DRPA 3BIDA 3NZKA 2D9HA 2RS6A 2HJJA 4JI1E 3Q6NA 4KQVA 2DLQA 3KZYA 1X5WA 1Z5CA 4LU9A 5K36A 4GKKE 1N34I 2ODRC 1QZRA 4LF9E 2EPAA 1IQSA 2ZITA 3AUZA 3H4LA 3T1HI 3P76A 2MKNA 3WU3A 5BR8I 5TSEA 4DU8A 4K0KI 2UXDI 4OOGC 3OTOE 2EN7A 2EORA 4I3HA 4WSPA 2GLIA 4LTYA 3P3EA 1ZM3A 1YPNA 3HXLA 5A6BA 2EM5A 2VQEI 1H7UA 3J7AM 2NN6C 4HACA 4NBQA 2EPCA 2YT4A 1TN9A 2PO1A 2JEBB 4AM3A 4FK5C 3PYGA 1IBMI 3HTXA 4URLA 1FWLA 2L33A 2ZM6I 4DR1I 2L3CA 2EM0A 1PDAA 5JEAC 1PKPA 1ZXNA 3F6GA 2EFGA 4AIMA 4Z7CA 2MC5A 2PO2A 2UXCI 2B9DA 4B3ME 2VQFE 2CT1A 3WU6A 2HKJA 2YTPA 1KJKA 3C4BA 2EPXA 2L3JA 1X49A 4LF6E 1XXEA 2EOOA 2RSMA 4YY3E 1ZM9A 4AQYE 5C0XF 2UUBI 4WUCA 2HC5A 5GMDA 2B7TA 1A1GA 4FWHA 4FW7A 2I9IA 1GQEA 1X6HA 2K7IA 4EMDA 4JI0E 2GS8A 1YH8A 3ADIA 4R8OA 2JPAA 4LF4E 2JR1A 3BBGA 1XMQE 1UDSA 3DD6A 3B78A 4DKKA 2ENHA 5C0XE 2EOHA 5LLQA 3RMPA 4UT4A 4DV4E 4P7AA 2MDGA 2M4IA 4IFDC 4U3DA 1KTVA 2HGHA 4X62I 4DUYE 1NHHA 2EOMA 4BHBA 1S16A 2YTEA 4BBYA 1ZM2A 3M85G 1HNXE 3F6HA 4FW5A 4F9BB 3UHMA 4X8WA 2JEBA 4DR2E 3FIGA 1KVKA 2R76A 1E3HA 2EPMX 3ADGA 1B63A 2EMLA 4Q28A 3J7Yp 3ZKBA 1YHCA 1I94I 3L7ZA 1ZU1A 2EE8A 2M9AA 2YRMA 2YSOA 2E1RA 2WNRB 2LJHA 3F0NA 1UDQA 2HK2A 2EMCA 2JVAA 4JI7I 4JI5I 2JWOA 4KZSA 4R03A 3QT6A 4R2EA 4R2AA 2JP9A 4L8NA 4GKJI 2EMXA 1TF3A 2EMYA 4DU7A 4DR7E 1T4LB 1OYPA 4PU9A 1HNWI 2J7JA 4IFDB 4MU4A 2UXBI 4LF5I 2KHXA 4USMA 4DR5E 4OZEA 1B69A 1MU5A 5F3WA 2N8XA 2NUFA 4MYTA 5GMEA 4X64I 1P47A 4MU3A 1J5EI 2RQLA 2NN6A 3UK3C 1N34E 1X6EA 2LMZA 2WCC3 1NEIA 5DRRA 5BR8E 4F54A 1N0VC 4K0KE 2DB2A 5K36C 2BV3A 3T1YI 1D6TA 4JI6E 1A1LA 4P78A 3KRNA 5JEAA 2EM9A 4IFDD 3TQMA 2VQEE 4UTGA 3THNA 2X36A 1HNZI 2BB8A 2L92A 1X48A 3OMLA 4BC9A 5A6BD 2V2QA 4LF7I 2JYAA 2YWQA 1VI7A 3VYYA 4BS9A 2KOUA 2RTXA 1IBME 2JEAB 2WBTA 2YSPA 1Z0WA 2Z5BB 4OO1C 2F4VI 4FW6A 3MHHC 4JI4E 5DNXA 4B3RI 2BA1G 2L2NA 2GO3A 3WU5A 2XEXA 2LV2A 1X3CA 2YTIA 3ZZTA 1N3GA 4JI3I 4DV3E 3PYDA 2EOYA 1IBLI 2YTJA 3M99B 3M7ND 5DRPA 1FNMA 2WNRA 4DPTA 1RHYA 4FN5A 4BHCA 4MU0A 5K36B 3LTOA 4RH8A 3THOB 2UUBE 2BR2B 1YYOA 2EPNA 4WYQB 4HYMA 3ZKDA 2EQ1A 4FWDA 1A6FA 1XNRI 3J7AG 4IS1C 4FW3A 4DXLA 2EN3A 2EM7A 2EN6A 1MG7A 1UN6B 5AE2A 4IFDA 1BB8A 4M2ZA 1IQOA 1K47A 2EPZA 2L6MA 2EPLX 2YTDA 4O24A 2WZOA 4J8ZA 1MEYC 2L2MA 1DI2A 2EM6A 5DNLA 5DRQA 4OO1B 2AJ4A 4LCFA 1FJGI 4RHBB 1ELOA 4LCHA 1Z0GA 4MLVA 1EH6A 1Z59A 3CDJA 4PRVA 1N32I 3DF6A 1T4NA 4DV7I 3VYXA 2JY9A 4M1KA 2O1WA 3M6AA 1ZXMA 3L7ZB 4M9VC 2N3HA 2ELYA 1R6MA 3GCMA 3P06A 3QT7A 4X62E 1T38A 2CZ9A 5T6JA 5A2QC 3CDIA 3V2UC 2C39B 4JI2I 4ED4A 5LMUI 3ADLA 1FWKA 2UU9I 4BMJA 1NZ0A 2CTDA 1A1HA 3MSWA 2EPRA 5AC4A 5IXMB 4YHHI 5ELWA 2R3VA 1I94E 4KHPE 2JEAA 4JV5I 4WUDA 2EOZA 1YYKA 2O1UA 2EOXA 2Z5BA 4FW4A 3MHSC 2FGGA 5A2QQ 4KWYA 2NN6B 2YTNA 4IZJA 1STUA 4JI7E 1AH5A 1OJ4A 2EN2A 2EMGA
chains in the Genus database with same CATH topology
4GKJE 5IT9C 4B3TI 2ODRD 4DR3I 4OX9I 1FKAE 1ZM4A 2V87A 4DR6I 4DV2E 4DR4I 4JI8I 4DV6I 2UUCI 1GZ6A 1MX0A 4JI1I 2HHHI 4BCAA 1Y4SA 4GKKI 1J5EE 2LBSB 1B62A 2VE7C 2KONA 3HJCA 4WUBA 2NPFA 5IT9Q 3V5RA 2FTXB 2LUPB 1Z0BA 3QT5A 1IBKI 1XNQI 2E5LI 2L2KB 1YYWA 2DMYA 2N3GA 1EI1A 1Y4UA 1HNZE 4HXZA 4JI3I 3J80Q 4I8OA 1HR0E 4LF7E 1EKZA 1ZBQA 3KWRA 2EZ6A 1WHNA 2F4VE 2B3TB 4LF8I 4DPWA 5DNYA 1EA6A 4DPUA 4B3MI 1XMOE 3K1JA 2Z5CB 4NXMI 2HFSA 4DV0I 1IBLE 5LMNI 2UUAE 2LRSA 4Z7YA 4DUZI 5LL6R 4LFAI 3T1HE 3IWDA 4IZKB 5ADZA 2G7HA 2UXDE 4DV5I 4WFTA 1N36I 3LPSA 4LFBI 3HULA 2JOXA 4B3SI 1UILA 1N32E 2V2ZA 2V89A 2M7QA 1YZ9A 1HNWI 4DV7E 2ZM6E 4DR1E 5FLXC 4WPYA 1NHIA 1O0WA 3JAMQ 4IZJB 2CPNA 2YZTA 2FV4B 2UXCE 1HNXI 1J26A 4JI2E 3Q1QA 5LMUE 3VK6A 2UU9E 1VISA 5L3JA 4JYAI 2V88A 4YHHE 4TUGA 4P52A 2BM0A 5FLXQ 1UEKA 4JV5E 2GQ0A 1Z0TA 4HY1A 3IWCA 3CWVA 4MYUA 2IHR1 1KKHA 4P7DA 2Z5CA 4LFCI 2HK3A 2O1TA 2LE2A 2PNMA 1PIEA 4IZJD 4DR7I 4DR3E 2M1SA 1N33I 1X47A 4DR6E 4DR4E 1Z5BA 4JI8E 4DR5I 5CFFE 3JTZA 2UUCE 1UHZA 1FI4A 3J81Q 1RQ0A 3PYFA 4IZKA 2HHHE 4NXNI 2DSYA 3K17A 4PRXA 4DV1I 2VF1A 3PRYA 2PNLA 2J7KA 3Q6MA 5AE1A 5AE3A 4JG4A 2MDRA 3D4JA 1IBKE 1XNQE 3ZZ0A 2E5LE 4JI6I 2A2DA 4L5NC 4DPXA 4RPFA 3DJWA 2V8QB 1Z0CA 2V85A 4F9AB 1USVA 4JI3E 3HQ1A 2R42A 1KIJA 2VF3A 1WXRA 3GONA 2A2CA 4X65I 5IWAI 2X7IA 4JI5E 3B8HA 2L8TA 2ZBKB 4X66I 4JI4I 1N0UA 2NA2A 2Z5EA 2BM1A 4LF8E 4NXME 2UXBE 1PVGA 3ZZUA 4DV3I 4LF5E 2B7VA 1QU6A 4DV0E 4FW9A 5LMNE 1H72C 4X64E 3C4TA 3LLHA 1HK7A 2DIXA 2H36X 4M30A 4DUZE 2V34A 4LF9I 3J80C 2V83A 1H73A 4LFAE 2IOQA 4DMIA 2Q2EB 1Z5AA 3OTOI 3K85A 4DV5E 3H09A 5AASA 2IOPA 2O1VA 4DPYA 3T1YE 3ZOQB 2DEJA 1N36E 1ZBTA 4USKA 4LFBE 4B3SE 1XHKA 4GEQB 3LMLA 1HNWE 2LJPA 3HPZA 1T4OA 4B3RE 2WW4A 4N3OA 3AV0A 2VQFI 1RC7A 2NUGA 4LF6I 4M0VA 2OI2A 1S4EA 4JYAE 4YY3I 4KHPI 4AQYI 2V2VA 1NHJA 3B82A 4BC7A 3IWBA 1XNRE 4XTJA 3WU4A 2CGEA 4JI0I 3PYEA 1DARA 4LFCE 4R1FA 3JAMC 4LF4I 3HPSA 1BKNA 4DV2I 1N33E 3QT8A 1XMQI 1SR9A 1FJGE 1Z0VA 1Y6ZA 3LNUA 4DV4I 4HACB 1DQ3A 2EWLA 3ZM7A 4NXNE 4F9CB 2V86A 1RREA 4DV1E 2V8PA 2CG9A 3ADJA 4DUYI 4ZVIA 1USUA 1WHQA 5FWKA 2NUEA 2JOBA 1RR9A 2MC6A 4FWGA 2F8BA 3P1XA 4DR2I 2LTRA 3JU0A 1HR0I 2K4VA 2RS7A 4TUIA 1U2RA 3K6QA 3J81C 1Z0EA 2LTSA 4X65E 5IWAE 2E1MA 2LUQA 4X66E 1H74A 1XMOI 4B3TE 4OX9E 2DEIA 2HKEA 1WUUA 2HFUA 4DV6E 1H7SA 2RS6A 3Q6NA 2UUAI 4JI1E 4KQVA 1Z5CA 4LU9A 4GKKE 1N34I 2ODRC 1QZRA 4LF9E 2ZITA 3AUZA 3H4LA 3T1HI 3WU3A 5BR8I 4DU8A 4K0KI 2UXDI 4OOGC 3OTOE 4I3HA 4WSPA 4LTYA 1ZM3A 3HXLA 2VQEI 1H7UA 3J7AM 4HACA 2YT4A 3PYGA 1IBMI 3HTXA 4URLA 1FWLA 2L33A 2ZM6I 4DR1I 2L3CA 1PKPA 1ZXNA 3F6GA 2EFGA 4Z7CA 2MC5A 2UXCI 2B9DA 4B3ME 2VQFE 3WU6A 2HKJA 3C4BA 2L3JA 1X49A 4LF6E 2RSMA 4YY3E 1ZM9A 4AQYE 2UUBI 4WUCA 5GMDA 2B7TA 4FWHA 1GQEA 4EMDA 4JI0E 2GS8A 3ADIA 4R8OA 4LF4E 2JR1A 1XMQE 3B78A 4DKKA 4UT4A 3RMPA 4DV4E 4P7AA 2M4IA 1KTVA 4X62I 4DUYE 1NHHA 1S16A 4BBYA 1ZM2A 1HNXE 3F6HA 4F9BB 4X8WA 4DR2E 3FIGA 1KVKA 3ADGA 1B63A 4Q28A 3J7Yp 3ZKBA 1I94I 2E1RA 2LJHA 3F0NA 2HK2A 2JVAA 4JI7I 4JI5I 2JWOA 4KZSA 4R03A 3QT6A 4L8NA 4GKJI 4DU7A 4DR7E 1T4LB 4PU9A 2UXBI 4LF5I 2KHXA 4USMA 4DR5E 1MU5A 5F3WA 2NUFA 4MYTA 5GMEA 4X64I 1J5EI 1N34E 2LMZA 5BR8E 4F54A 1N0VC 4K0KE 2DB2A 2BV3A 3T1YI 1D6TA 4JI6E 4P78A 2VQEE 4UTGA 2X36A 1HNZI 2L92A 1X48A 3OMLA 4BC9A 2V2QA 4LF7I 3VYYA 4BS9A 2KOUA 2RTXA 1IBME 1Z0WA 2Z5BB 2F4VI 4JI4E 4B3RI 2L2NA 3WU5A 2XEXA 3ZZTA 4DV3E 3PYDA 1IBLI 4DPTA 1FNMA 4FN5A 3LTOA 2UUBE 1YYOA 4WYQB 4HYMA 3ZKDA 4FWDA 1A6FA 1XNRI 3J7AG 4DXLA 1MG7A 5AE2A 1K47A 4M2ZA 2L6MA 2WZOA 4J8ZA 1DI2A 2L2MA 2AJ4A 1FJGI 1ELOA 1Z0GA 1Z59A 4PRVA 1N32I 3DF6A 1T4NA 4DV7I 3VYXA 2JY9A 4M1KA 2O1WA 3M6AA 1ZXMA 2N3HA 3P06A 3QT7A 4X62E 2CZ9A 5T6JA 5A2QC 3V2UC 4JI2I 4ED4A 5LMUI 3ADLA 1FWKA 2UU9I 4BMJA 1NZ0A 3MSWA 4YHHI 2R3VA 1I94E 4KHPE 4JV5I 4WUDA 1YYKA 2O1UA 2Z5BA 2FGGA 5A2QQ 4IZJA 1STUA 4JI7E 1OJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ E;  5IT9 C;  4B3T I;  4DR3 I;  4OX9 I;  1FKA E;  1ZM4 A;  4DR6 I;  4DV2 E;  4DR4 I;  4JI8 I;  4DV6 I;  2UUC I;  1MX0 A;  4JI1 I;  2HHH I;  4GKK I;  1J5E E;  2LBS B;  1B62 A;  4WUB A;  2NPF A;  5IT9 Q;  3V5R A;  2LUP B;  1Z0B A;  3QT5 A;  1IBK I;  1XNQ I;  2E5L I;  2L2K B;  1YYW A;  2DMY A;  2N3G A;  1EI1 A;  4HXZ A;  1HNZ E;  4JI3 I;  3J80 Q;  1HR0 E;  4LF7 E;  1EKZ A;  2EZ6 A;  1WHN A;  2F4V E;  2B3T B;  4LF8 I;  4DPW A;  1EA6 A;  4DPU A;  4B3M I;  1XMO E;  3K1J A;  4NXM I;  2HFS A;  4DV0 I;  1IBL E;  5LMN I;  2UUA E;  2LRS A;  4Z7Y A;  4DUZ I;  5LL6 R;  4LFA I;  3T1H E;  2UXD E;  4DV5 I;  4WFT A;  1N36 I;  3LPS A;  4LFB I;  3HUL A;  4B3S I;  1UIL A;  1N32 E;  2V2Z A;  1YZ9 A;  1HNW I;  4DV7 E;  2ZM6 E;  4DR1 E;  5FLX C;  1NHI A;  1O0W A;  3JAM Q;  2CPN A;  2UXC E;  1HNX I;  1J26 A;  4JI2 E;  3Q1Q A;  5LMU E;  2UU9 E;  1VIS A;  5L3J A;  4JYA I;  4YHH E;  4P52 A;  2BM0 A;  5FLX Q;  1UEK A;  4JV5 E;  1Z0T A;  4HY1 A;  3CWV A;  4MYU A;  2IHR 1;  1KKH A;  4LFC I;  2HK3 A;  1PIE A;  4DR7 I;  4DR3 E;  1N33 I;  1X47 A;  4DR6 E;  4DR4 E;  1Z5B A;  4JI8 E;  4DR5 I;  5CFF E;  2UUC E;  1UHZ A;  1FI4 A;  3J81 Q;  1RQ0 A;  3PYF A;  2HHH E;  4NXN I;  4PRX A;  3K17 A;  4DV1 I;  2J7K A;  4JG4 A;  2MDR A;  3D4J A;  1IBK E;  1XNQ E;  3ZZ0 A;  2E5L E;  4JI6 I;  2A2D A;  4DPX A;  4RPF A;  1Z0C A;  4JI3 E;  2R42 A;  1KIJ A;  2VF3 A;  3GON A;  2A2C A;  4X65 I;  5IWA I;  2X7I A;  4JI5 E;  3B8H A;  2ZBK B;  4X66 I;  4JI4 I;  1N0U A;  2NA2 A;  2BM1 A;  4LF8 E;  4NXM E;  2UXB E;  1PVG A;  3ZZU A;  4DV3 I;  4LF5 E;  2B7V A;  1QU6 A;  4DV0 E;  4FW9 A;  5LMN E;  1H72 C;  4X64 E;  3C4T A;  3LLH A;  2DIX A;  4M30 A;  4DUZ E;  2V34 A;  4LF9 I;  1H73 A;  3J80 C;  4LFA E;  2Q2E B;  1Z5A A;  3OTO I;  4DV5 E;  4DPY A;  3T1Y E;  2DEJ A;  1N36 E;  1ZBT A;  4USK A;  4LFB E;  4B3S E;  1XHK A;  1HNW E;  2LJP A;  1T4O A;  4B3R E;  2WW4 A;  2VQF I;  1RC7 A;  2NUG A;  4LF6 I;  2OI2 A;  1S4E A;  4JYA E;  4YY3 I;  4KHP I;  4AQY I;  2V2V A;  1NHJ A;  3B82 A;  1XNR E;  4XTJ A;  3WU4 A;  4JI0 I;  3PYE A;  1DAR A;  4LFC E;  4R1F A;  3JAM C;  4LF4 I;  1BKN A;  4DV2 I;  1N33 E;  3QT8 A;  1XMQ I;  1FJG E;  1Z0V A;  3LNU A;  4DV4 I;  4HAC B;  3ZM7 A;  4NXN E;  1RRE A;  2V8P A;  4DV1 E;  3ADJ A;  4DUY I;  4ZVI A;  1WHQ A;  2NUE A;  1RR9 A;  4FWG A;  3P1X A;  4DR2 I;  2LTR A;  1HR0 I;  2RS7 A;  1U2R A;  3J81 C;  1Z0E A;  2LTS A;  4X65 E;  5IWA E;  2LUQ A;  4X66 E;  1H74 A;  1XMO I;  4B3T E;  4OX9 E;  2DEI A;  2HKE A;  1WUU A;  2HFU A;  4DV6 E;  1H7S A;  2RS6 A;  2UUA I;  4JI1 E;  4KQV A;  1Z5C A;  4GKK E;  1N34 I;  1QZR A;  4LF9 E;  2ZIT A;  3H4L A;  3T1H I;  3WU3 A;  5BR8 I;  4DU8 A;  4K0K I;  2UXD I;  4OOG C;  3OTO E;  4I3H A;  1ZM3 A;  2VQE I;  1H7U A;  3J7A M;  4HAC A;  2YT4 A;  3PYG A;  1IBM I;  3HTX A;  4URL A;  1FWL A;  2L33 A;  2ZM6 I;  4DR1 I;  2L3C A;  1PKP A;  1ZXN A;  2EFG A;  4Z7C A;  2UXC I;  4B3M E;  2VQF E;  3WU6 A;  2HKJ A;  3C4B A;  2L3J A;  1X49 A;  4LF6 E;  2RSM A;  4YY3 E;  1ZM9 A;  4AQY E;  2UUB I;  4WUC A;  5GMD A;  2B7T A;  4FWH A;  1GQE A;  4EMD A;  4JI0 E;  2GS8 A;  3ADI A;  4LF4 E;  1XMQ E;  3B78 A;  4DKK A;  4UT4 A;  4DV4 E;  4P7A A;  1KTV A;  4X62 I;  4DUY E;  1NHH A;  1S16 A;  1ZM2 A;  1HNX E;  4X8W A;  4DR2 E;  1KVK A;  3ADG A;  1B63 A;  3J7Y p;  3ZKB A;  1I94 I;  2E1R A;  2LJH A;  3F0N A;  2HK2 A;  2JVA A;  4JI7 I;  4JI5 I;  3QT6 A;  4GKJ I;  4DU7 A;  4DR7 E;  1T4L B;  4PU9 A;  2UXB I;  4LF5 I;  2KHX A;  4USM A;  4DR5 E;  1MU5 A;  2NUF A;  4MYT A;  5GME A;  4X64 I;  1J5E I;  1N34 E;  5BR8 E;  1N0V C;  4K0K E;  2DB2 A;  2BV3 A;  3T1Y I;  1D6T A;  4JI6 E;  2VQE E;  4UTG A;  2X36 A;  1HNZ I;  1X48 A;  2V2Q A;  4LF7 I;  3VYY A;  2RTX A;  1IBM E;  1Z0W A;  2F4V I;  4JI4 E;  4B3R I;  2L2N A;  3WU5 A;  2XEX A;  3ZZT A;  4DV3 E;  3PYD A;  1IBL I;  4DPT A;  1FNM A;  4FN5 A;  3LTO A;  2UUB E;  1YYO A;  4WYQ B;  4HYM A;  3ZKD A;  4FWD A;  1A6F A;  1XNR I;  3J7A G;  4DXL A;  1MG7 A;  1K47 A;  4M2Z A;  1DI2 A;  2L2M A;  2AJ4 A;  1FJG I;  1ELO A;  1Z0G A;  1Z59 A;  4PRV A;  1N32 I;  1T4N A;  4DV7 I;  3VYX A;  2JY9 A;  4M1K A;  3M6A A;  1ZXM A;  2N3H A;  3QT7 A;  4X62 E;  2CZ9 A;  5A2Q C;  3V2U C;  4JI2 I;  4ED4 A;  5LMU I;  3ADL A;  1FWK A;  2UU9 I;  1NZ0 A;  4YHH I;  2R3V A;  1I94 E;  4KHP E;  4JV5 I;  4WUD A;  1YYK A;  5A2Q Q;  1STU A;  4JI7 E;  1OJ4 A; 
#chains in the Genus database with same CATH topology
 4GKJ E;  5IT9 C;  4B3T I;  2ODR D;  4DR3 I;  4OX9 I;  1FKA E;  4WSG A;  1ZM4 A;  2EOQ A;  2V87 A;  2NAB A;  4DR6 I;  4DV2 E;  2GPI A;  1UBD C;  4BA2 B;  4MU1 A;  2E72 A;  5IV8 B;  4GZN C;  2EMZ A;  1GZ6 A;  1PJT A;  2YU5 A;  4JI8 I;  5JEA B;  4DV6 I;  2UUC I;  3M7N G;  2BR2 A;  1MX0 A;  4JI1 I;  2YTF A;  2HHH I;  2DMI A;  3EPK A;  4BCA A;  1G2D C;  1Y4S A;  4GKK I;  1J5E E;  2LBS B;  1B62 A;  1A1J A;  2UUA I;  2VE7 C;  2AE8 A;  2KON A;  2NN6 D;  3HJC A;  4WUB A;  2NPF A;  5IT9 Q;  3V5R A;  2FTX B;  1E3P A;  2EM3 A;  2LUP B;  4O43 A;  1Z0B A;  4WX9 A;  4OO1 A;  3QT5 A;  1IBK I;  1XNQ I;  4X9J A;  2E5L I;  2EMB A;  2L2K B;  1LLM C;  1YYW A;  2DMY A;  2N3G A;  1EI1 A;  1Y4U A;  5JEA D;  2JT2 A;  1HNZ E;  4HXZ A;  4LCG A;  2RPC A;  5A69 A;  5A6J A;  1KYQ A;  2EOE A;  2EOI A;  4I8O A;  4R2C A;  1HR0 E;  2EOS A;  3C6K A;  4LF7 E;  3J80 Q;  1EKZ A;  5KL6 A;  2BA0 D;  1ZBQ A;  3KWR A;  2EZ6 A;  1WHN A;  2C39 A;  2EN8 A;  2EOJ A;  2F4V E;  2B3T B;  4LF8 I;  4DPW A;  5DNY A;  1EA6 A;  4DPU A;  4B3M I;  1XMO E;  3K1J A;  2Z5C B;  4NXM I;  2HFS A;  4DV0 I;  1IBL E;  5LMN I;  2UUA E;  4ZYE A;  2LRS A;  1OYR A;  2C37 B;  1JK1 A;  4Z7Y A;  4DUZ I;  5LL6 R;  3QG5 C;  2F1D A;  4R2S A;  2A25 A;  5C0X C;  4O4K A;  3T1H E;  3BF2 A;  3IWD A;  4IZK B;  4LFA I;  5ADZ A;  2G7H A;  2IER A;  2UXD E;  4DV5 I;  1ZR9 A;  2EMI A;  5KL3 A;  4BA2 A;  2NN6 F;  1GTK A;  2IES A;  1WRJ A;  4WFT A;  3PS3 A;  1N36 I;  3HKM A;  1OYS A;  2WP8 B;  3LPS A;  2LT7 A;  2GHF A;  4LFB I;  3HUL A;  2JOX A;  4B3S I;  3EPL A;  2DGC A;  1UIL A;  1N32 E;  2V2Z A;  2V89 A;  2M7Q A;  5KL2 A;  1YZ9 A;  4DV7 E;  1RMD A;  2O3Z A;  2ZM6 E;  4DR1 E;  4NZV A;  5FLX C;  5JEA F;  2YTQ A;  2CSH A;  4WPY A;  2EM4 A;  1O0W A;  1NHI A;  3JAM Q;  4IZJ B;  2CPN A;  2YZT A;  2FV4 B;  2UXC E;  1HNX I;  1J26 A;  1WJP A;  4JI2 E;  2LVH A;  2NN6 E;  3Q1Q A;  5LMU E;  3VK6 A;  5C0X B;  2EMH A;  2UU9 E;  1VIS A;  5L3J A;  4JYA I;  2V88 A;  4YHH E;  4R2Q A;  4TUG A;  4ZYD A;  2BM0 A;  1PJS A;  4P52 A;  5FLX Q;  2EM2 A;  1UEK A;  2JXP A;  4JV5 E;  2LJU A;  4WXC A;  1Z0T A;  2GQ0 A;  4HY1 A;  5JEA E;  3IWC A;  4ZYH A;  3CWV A;  3PS2 A;  2IHR 1;  4MYU A;  1KKH A;  2EL6 A;  4P7D A;  2Z5C A;  2C38 A;  2HK3 A;  2O1T A;  2EPP A;  2LE2 A;  1PIE A;  2PNM A;  4IZJ D;  4LFC I;  4DR7 I;  3C6M A;  2DLK A;  4DR3 E;  2M1S A;  4R2P A;  1N33 I;  1X47 A;  3VHT B;  1EH7 A;  1EH8 A;  2EP3 A;  4DR4 E;  4DR6 E;  1R6L A;  1Z5B A;  4JI8 E;  2C37 A;  4DR5 I;  5CFF E;  3JTZ A;  2UUC E;  1UHZ A;  3H1C A;  1FI4 A;  2EN1 A;  5K36 D;  3J81 Q;  2YU8 A;  1RQ0 A;  4IFD F;  2WBU A;  3PYF A;  4IZK A;  2HHH E;  2EOF A;  4NXN I;  2DSY A;  3K17 A;  4PRX A;  5KL5 A;  5KL7 A;  2PNZ B;  4DV1 I;  1MGT A;  2VF1 A;  3PRY A;  4ISA A;  4BA1 A;  2PNL A;  2ENC A;  2J7K A;  3Q6M A;  1NCS A;  2EL4 A;  4R2R A;  4OKG A;  3L00 A;  4HEI A;  5AE1 A;  2EMF A;  5AE3 A;  4JG4 A;  3M85 D;  4QNK A;  2MDR A;  2WP8 A;  1IBK E;  1XNQ E;  3D4J A;  2E5L E;  1UDN A;  2A2D A;  4L5N C;  3ZZ0 A;  4DPX A;  4OO1 D;  4RPF A;  2BBG A;  1YUI A;  3DJW A;  2V8Q B;  1Z0C A;  4IFD E;  2V85 A;  4F9A B;  1AAY A;  1DGC A;  4JI3 E;  3HQ1 A;  2YTG A;  1USV A;  1L4S A;  1Y5Y A;  2R42 A;  1KIJ A;  2VF3 A;  4J3D A;  4QNJ A;  5AC5 A;  1WXR A;  2YPN A;  3GON A;  1Z1B A;  5DRO A;  2A2C A;  4X65 I;  5IWA I;  1Y60 A;  4JI5 E;  2X7I A;  3B8H A;  4MQY A;  2L8T A;  2ZBK B;  4X66 I;  2EPO A;  4JI4 I;  1N0U A;  2NA2 A;  5C0X A;  2Z5E A;  2BM1 A;  1JK2 A;  1A1K A;  4LF8 E;  2YTO A;  4LOM A;  3GME A;  4N4R B;  4HTG A;  4NXM E;  2UXB E;  1PVG A;  3GLL A;  3ZZU A;  4LF5 E;  4DV3 I;  5KL4 A;  2B7V A;  3B4T A;  1QU6 A;  4DV0 E;  4FW9 A;  5LMN E;  1H72 C;  4IJD A;  4X64 E;  3C4T A;  3LLH A;  5EKW A;  3U1K A;  1HK7 A;  2EMA A;  2DIX A;  2H36 X;  4M30 A;  4DUZ E;  2V34 A;  4LF9 I;  4F2J C;  3J80 C;  2V83 A;  1H73 A;  1F2I G;  4LFA E;  2IOQ A;  4DMI A;  2Q2E B;  5K36 F;  1Z5A A;  1A1F A;  3OTO I;  3K85 A;  4IS9 A;  5A6K A;  4DV5 E;  3H09 A;  5AAS A;  2IOP A;  1G2F C;  2O1V A;  4DPY A;  3T1Y E;  2EQ0 A;  1P42 A;  3ZOQ B;  4DR4 I;  2MKD A;  2EMW A;  2DEJ A;  2VRD A;  1ZBT A;  1N36 E;  4USK A;  2J65 A;  3U1Y A;  2VES A;  4LFB E;  2PNZ A;  1IMU A;  4B3S E;  3EPH A;  3P3G A;  2EN4 A;  2EM8 A;  2EPU A;  1XHK A;  2EJ4 A;  4GEQ B;  4OO1 F;  3LML A;  1HNW E;  2GO4 A;  5K36 E;  2PO0 B;  3BGH A;  3ECR A;  2LJP A;  3HPZ A;  4NHR A;  1T4O A;  4B3R E;  2WW4 A;  2BA1 D;  4N3O A;  3AV0 A;  1T39 A;  2VQF I;  1RC7 A;  2C38 B;  2JE6 B;  4U3B A;  2NUG A;  4LF6 I;  4M0V A;  2I13 A;  2OI2 A;  1S4E A;  4JYA E;  1YSA C;  1PJQ A;  4YY3 I;  4AQY I;  2EMK A;  4ZYG A;  4KHP I;  2V2V A;  2ELZ A;  1NHJ A;  4OO1 E;  2EQ3 A;  3B82 A;  4BC7 A;  4JI6 I;  3IWB A;  2LCE A;  2PRT A;  1XNR E;  4XTJ A;  3WU4 A;  2CGE A;  4R2D A;  4BA1 B;  4JI0 I;  3PYE A;  1DAR A;  4LFC E;  2EPK X;  2ENA A;  4R1F A;  3JAM C;  1TF6 A;  4LF4 I;  1QNT A;  3HPS A;  1X6F A;  1SFE A;  1BKN A;  4DV2 I;  1N33 E;  3QT8 A;  1XMQ I;  1SR9 A;  4LPF A;  1YFH A;  1FJG E;  1A1I A;  4MLQ A;  1Z0V A;  4F6M A;  1Y6Z A;  3LNU A;  4DV4 I;  4HAC B;  1DQ3 A;  2EWL A;  2PO1 B;  1ZAA C;  3ZM7 A;  4NXN E;  4F9C B;  2V86 A;  1RRE A;  4DV1 E;  1UDO A;  2V8P A;  2CVE A;  2CG9 A;  3ADJ A;  4DUY I;  4ZVI A;  1USU A;  4Q35 B;  1WHQ A;  5FWK A;  4GQU A;  2NUE A;  2JOB A;  1RR9 A;  2YRH A;  2MC6 A;  4FWG A;  2F8B A;  3P1X A;  2PO2 B;  4AID A;  4DR2 I;  2LTR A;  3JU0 A;  4WXD A;  4F6N A;  2Q8U A;  4MDT A;  3EPJ A;  1HR0 I;  2K4V A;  2R1F A;  2BA0 G;  2RS7 A;  2PO0 A;  2YRK A;  2LO3 A;  4TUI A;  1U2R A;  3K6Q A;  3J81 C;  1Z0E A;  2LTS A;  4X65 E;  5IWA E;  2E1M A;  3P3C A;  2LUQ A;  2RSI A;  4X66 E;  1H74 A;  1BBO A;  3KZZ A;  2JE6 A;  2ADR A;  1XMO I;  5A6A A;  4B3T E;  4OX9 E;  2DEI A;  2HKE A;  2WBS A;  5C0X D;  1YUJ A;  1WUU A;  2EL5 A;  2HFU A;  1BBG A;  3EQ1 A;  4O5G A;  4DV6 E;  1H7S A;  5EL9 A;  3PS1 A;  2DRP A;  3BID A;  3NZK A;  2D9H A;  2RS6 A;  2HJJ A;  4JI1 E;  3Q6N A;  4KQV A;  2DLQ A;  3KZY A;  1X5W A;  1Z5C A;  4LU9 A;  5K36 A;  4GKK E;  1N34 I;  2ODR C;  1QZR A;  4LF9 E;  2EPA A;  1IQS A;  2ZIT A;  3AUZ A;  3H4L A;  3T1H I;  3P76 A;  2MKN A;  3WU3 A;  5BR8 I;  5TSE A;  4DU8 A;  4K0K I;  2UXD I;  4OOG C;  3OTO E;  2EN7 A;  2EOR A;  4I3H A;  4WSP A;  2GLI A;  4LTY A;  3P3E A;  1ZM3 A;  1YPN A;  3HXL A;  5A6B A;  2EM5 A;  2VQE I;  1H7U A;  3J7A M;  2NN6 C;  4HAC A;  4NBQ A;  2EPC A;  2YT4 A;  1TN9 A;  2PO1 A;  2JEB B;  4AM3 A;  4FK5 C;  3PYG A;  1IBM I;  3HTX A;  4URL A;  1FWL A;  2L33 A;  2ZM6 I;  4DR1 I;  2L3C A;  2EM0 A;  1PDA A;  5JEA C;  1PKP A;  1ZXN A;  3F6G A;  2EFG A;  4AIM A;  4Z7C A;  2MC5 A;  2PO2 A;  2UXC I;  2B9D A;  4B3M E;  2VQF E;  2CT1 A;  3WU6 A;  2HKJ A;  2YTP A;  1KJK A;  3C4B A;  2EPX A;  2L3J A;  1X49 A;  4LF6 E;  1XXE A;  2EOO A;  2RSM A;  4YY3 E;  1ZM9 A;  4AQY E;  5C0X F;  2UUB I;  4WUC A;  2HC5 A;  5GMD A;  2B7T A;  1A1G A;  4FWH A;  4FW7 A;  2I9I A;  1GQE A;  1X6H A;  2K7I A;  4EMD A;  4JI0 E;  2GS8 A;  1YH8 A;  3ADI A;  4R8O A;  2JPA A;  4LF4 E;  2JR1 A;  3BBG A;  1XMQ E;  1UDS A;  3DD6 A;  3B78 A;  4DKK A;  2ENH A;  5C0X E;  2EOH A;  5LLQ A;  3RMP A;  4UT4 A;  4DV4 E;  4P7A A;  2MDG A;  2M4I A;  4IFD C;  4U3D A;  1KTV A;  2HGH A;  4X62 I;  4DUY E;  1NHH A;  2EOM A;  4BHB A;  1S16 A;  2YTE A;  4BBY A;  1ZM2 A;  3M85 G;  1HNX E;  3F6H A;  4FW5 A;  4F9B B;  3UHM A;  4X8W A;  2JEB A;  4DR2 E;  3FIG A;  1KVK A;  2R76 A;  1E3H A;  2EPM X;  3ADG A;  1B63 A;  2EML A;  4Q28 A;  3J7Y p;  3ZKB A;  1YHC A;  1I94 I;  3L7Z A;  1ZU1 A;  2EE8 A;  2M9A A;  2YRM A;  2YSO A;  2E1R A;  2WNR B;  2LJH A;  3F0N A;  1UDQ A;  2HK2 A;  2EMC A;  2JVA A;  4JI7 I;  4JI5 I;  2JWO A;  4KZS A;  4R03 A;  3QT6 A;  4R2E A;  4R2A A;  2JP9 A;  4L8N A;  4GKJ I;  2EMX A;  1TF3 A;  2EMY A;  4DU7 A;  4DR7 E;  1T4L B;  1OYP A;  4PU9 A;  1HNW I;  2J7J A;  4IFD B;  4MU4 A;  2UXB I;  4LF5 I;  2KHX A;  4USM A;  4DR5 E;  4OZE A;  1B69 A;  1MU5 A;  5F3W A;  2N8X A;  2NUF A;  4MYT A;  5GME A;  4X64 I;  1P47 A;  4MU3 A;  1J5E I;  2RQL A;  2NN6 A;  3UK3 C;  1N34 E;  1X6E A;  2LMZ A;  2WCC 3;  1NEI A;  5DRR A;  5BR8 E;  4F54 A;  1N0V C;  4K0K E;  2DB2 A;  5K36 C;  2BV3 A;  3T1Y I;  1D6T A;  4JI6 E;  1A1L A;  4P78 A;  3KRN A;  5JEA A;  2EM9 A;  4IFD D;  3TQM A;  2VQE E;  4UTG A;  3THN A;  2X36 A;  1HNZ I;  2BB8 A;  2L92 A;  1X48 A;  3OML A;  4BC9 A;  5A6B D;  2V2Q A;  4LF7 I;  2JYA A;  2YWQ A;  1VI7 A;  3VYY A;  4BS9 A;  2KOU A;  2RTX A;  1IBM E;  2JEA B;  2WBT A;  2YSP A;  1Z0W A;  2Z5B B;  4OO1 C;  2F4V I;  4FW6 A;  3MHH C;  4JI4 E;  5DNX A;  4B3R I;  2BA1 G;  2L2N A;  2GO3 A;  3WU5 A;  2XEX A;  2LV2 A;  1X3C A;  2YTI A;  3ZZT A;  1N3G A;  4JI3 I;  4DV3 E;  3PYD A;  2EOY A;  1IBL I;  2YTJ A;  3M99 B;  3M7N D;  5DRP A;  1FNM A;  2WNR A;  4DPT A;  1RHY A;  4FN5 A;  4BHC A;  4MU0 A;  5K36 B;  3LTO A;  4RH8 A;  3THO B;  2UUB E;  2BR2 B;  1YYO A;  2EPN A;  4WYQ B;  4HYM A;  3ZKD A;  2EQ1 A;  4FWD A;  1A6F A;  1XNR I;  3J7A G;  4IS1 C;  4FW3 A;  4DXL A;  2EN3 A;  2EM7 A;  2EN6 A;  1MG7 A;  1UN6 B;  5AE2 A;  4IFD A;  1BB8 A;  4M2Z A;  1IQO A;  1K47 A;  2EPZ A;  2L6M A;  2EPL X;  2YTD A;  4O24 A;  2WZO A;  4J8Z A;  1MEY C;  2L2M A;  1DI2 A;  2EM6 A;  5DNL A;  5DRQ A;  4OO1 B;  2AJ4 A;  4LCF A;  1FJG I;  4RHB B;  1ELO A;  4LCH A;  1Z0G A;  4MLV A;  1EH6 A;  1Z59 A;  3CDJ A;  4PRV A;  1N32 I;  3DF6 A;  1T4N A;  4DV7 I;  3VYX A;  2JY9 A;  4M1K A;  2O1W A;  3M6A A;  1ZXM A;  3L7Z B;  4M9V C;  2N3H A;  2ELY A;  1R6M A;  3GCM A;  3P06 A;  3QT7 A;  4X62 E;  1T38 A;  2CZ9 A;  5T6J A;  5A2Q C;  3CDI A;  3V2U C;  2C39 B;  4JI2 I;  4ED4 A;  5LMU I;  3ADL A;  1FWK A;  2UU9 I;  4BMJ A;  1NZ0 A;  2CTD A;  1A1H A;  3MSW A;  2EPR A;  5AC4 A;  5IXM B;  4YHH I;  5ELW A;  2R3V A;  1I94 E;  4KHP E;  2JEA A;  4JV5 I;  4WUD A;  2EOZ A;  1YYK A;  2O1U A;  2EOX A;  2Z5B A;  4FW4 A;  3MHS C;  2FGG A;  5A2Q Q;  4KWY A;  2NN6 B;  2YTN A;  4IZJ A;  1STU A;  4JI7 E;  1AH5 A;  1OJ4 A;  2EN2 A;  2EMG A; 
#chains in the Genus database with same CATH homology
 4GKJ E;  5IT9 C;  4B3T I;  2ODR D;  4DR3 I;  4OX9 I;  1FKA E;  1ZM4 A;  2V87 A;  4DR6 I;  4DV2 E;  4DR4 I;  4JI8 I;  4DV6 I;  2UUC I;  1GZ6 A;  1MX0 A;  4JI1 I;  2HHH I;  4BCA A;  1Y4S A;  4GKK I;  1J5E E;  2LBS B;  1B62 A;  2VE7 C;  2KON A;  3HJC A;  4WUB A;  2NPF A;  5IT9 Q;  3V5R A;  2FTX B;  2LUP B;  1Z0B A;  3QT5 A;  1IBK I;  1XNQ I;  2E5L I;  2L2K B;  1YYW A;  2DMY A;  2N3G A;  1EI1 A;  1Y4U A;  1HNZ E;  4HXZ A;  4JI3 I;  3J80 Q;  4I8O A;  1HR0 E;  4LF7 E;  1EKZ A;  1ZBQ A;  3KWR A;  2EZ6 A;  1WHN A;  2F4V E;  2B3T B;  4LF8 I;  4DPW A;  5DNY A;  1EA6 A;  4DPU A;  4B3M I;  1XMO E;  3K1J A;  2Z5C B;  4NXM I;  2HFS A;  4DV0 I;  1IBL E;  5LMN I;  2UUA E;  2LRS A;  4Z7Y A;  4DUZ I;  5LL6 R;  4LFA I;  3T1H E;  3IWD A;  4IZK B;  5ADZ A;  2G7H A;  2UXD E;  4DV5 I;  4WFT A;  1N36 I;  3LPS A;  4LFB I;  3HUL A;  2JOX A;  4B3S I;  1UIL A;  1N32 E;  2V2Z A;  2V89 A;  2M7Q A;  1YZ9 A;  1HNW I;  4DV7 E;  2ZM6 E;  4DR1 E;  5FLX C;  4WPY A;  1NHI A;  1O0W A;  3JAM Q;  4IZJ B;  2CPN A;  2YZT A;  2FV4 B;  2UXC E;  1HNX I;  1J26 A;  4JI2 E;  3Q1Q A;  5LMU E;  3VK6 A;  2UU9 E;  1VIS A;  5L3J A;  4JYA I;  2V88 A;  4YHH E;  4TUG A;  4P52 A;  2BM0 A;  5FLX Q;  1UEK A;  4JV5 E;  2GQ0 A;  1Z0T A;  4HY1 A;  3IWC A;  3CWV A;  4MYU A;  2IHR 1;  1KKH A;  4P7D A;  2Z5C A;  4LFC I;  2HK3 A;  2O1T A;  2LE2 A;  2PNM A;  1PIE A;  4IZJ D;  4DR7 I;  4DR3 E;  2M1S A;  1N33 I;  1X47 A;  4DR6 E;  4DR4 E;  1Z5B A;  4JI8 E;  4DR5 I;  5CFF E;  3JTZ A;  2UUC E;  1UHZ A;  1FI4 A;  3J81 Q;  1RQ0 A;  3PYF A;  4IZK A;  2HHH E;  4NXN I;  2DSY A;  3K17 A;  4PRX A;  4DV1 I;  2VF1 A;  3PRY A;  2PNL A;  2J7K A;  3Q6M A;  5AE1 A;  5AE3 A;  4JG4 A;  2MDR A;  3D4J A;  1IBK E;  1XNQ E;  3ZZ0 A;  2E5L E;  4JI6 I;  2A2D A;  4L5N C;  4DPX A;  4RPF A;  3DJW A;  2V8Q B;  1Z0C A;  2V85 A;  4F9A B;  1USV A;  4JI3 E;  3HQ1 A;  2R42 A;  1KIJ A;  2VF3 A;  1WXR A;  3GON A;  2A2C A;  4X65 I;  5IWA I;  2X7I A;  4JI5 E;  3B8H A;  2L8T A;  2ZBK B;  4X66 I;  4JI4 I;  1N0U A;  2NA2 A;  2Z5E A;  2BM1 A;  4LF8 E;  4NXM E;  2UXB E;  1PVG A;  3ZZU A;  4DV3 I;  4LF5 E;  2B7V A;  1QU6 A;  4DV0 E;  4FW9 A;  5LMN E;  1H72 C;  4X64 E;  3C4T A;  3LLH A;  1HK7 A;  2DIX A;  2H36 X;  4M30 A;  4DUZ E;  2V34 A;  4LF9 I;  3J80 C;  2V83 A;  1H73 A;  4LFA E;  2IOQ A;  4DMI A;  2Q2E B;  1Z5A A;  3OTO I;  3K85 A;  4DV5 E;  3H09 A;  5AAS A;  2IOP A;  2O1V A;  4DPY A;  3T1Y E;  3ZOQ B;  2DEJ A;  1N36 E;  1ZBT A;  4USK A;  4LFB E;  4B3S E;  1XHK A;  4GEQ B;  3LML A;  1HNW E;  2LJP A;  3HPZ A;  1T4O A;  4B3R E;  2WW4 A;  4N3O A;  3AV0 A;  2VQF I;  1RC7 A;  2NUG A;  4LF6 I;  4M0V A;  2OI2 A;  1S4E A;  4JYA E;  4YY3 I;  4KHP I;  4AQY I;  2V2V A;  1NHJ A;  3B82 A;  4BC7 A;  3IWB A;  1XNR E;  4XTJ A;  3WU4 A;  2CGE A;  4JI0 I;  3PYE A;  1DAR A;  4LFC E;  4R1F A;  3JAM C;  4LF4 I;  3HPS A;  1BKN A;  4DV2 I;  1N33 E;  3QT8 A;  1XMQ I;  1SR9 A;  1FJG E;  1Z0V A;  1Y6Z A;  3LNU A;  4DV4 I;  4HAC B;  1DQ3 A;  2EWL A;  3ZM7 A;  4NXN E;  4F9C B;  2V86 A;  1RRE A;  4DV1 E;  2V8P A;  2CG9 A;  3ADJ A;  4DUY I;  4ZVI A;  1USU A;  1WHQ A;  5FWK A;  2NUE A;  2JOB A;  1RR9 A;  2MC6 A;  4FWG A;  2F8B A;  3P1X A;  4DR2 I;  2LTR A;  3JU0 A;  1HR0 I;  2K4V A;  2RS7 A;  4TUI A;  1U2R A;  3K6Q A;  3J81 C;  1Z0E A;  2LTS A;  4X65 E;  5IWA E;  2E1M A;  2LUQ A;  4X66 E;  1H74 A;  1XMO I;  4B3T E;  4OX9 E;  2DEI A;  2HKE A;  1WUU A;  2HFU A;  4DV6 E;  1H7S A;  2RS6 A;  3Q6N A;  2UUA I;  4JI1 E;  4KQV A;  1Z5C A;  4LU9 A;  4GKK E;  1N34 I;  2ODR C;  1QZR A;  4LF9 E;  2ZIT A;  3AUZ A;  3H4L A;  3T1H I;  3WU3 A;  5BR8 I;  4DU8 A;  4K0K I;  2UXD I;  4OOG C;  3OTO E;  4I3H A;  4WSP A;  4LTY A;  1ZM3 A;  3HXL A;  2VQE I;  1H7U A;  3J7A M;  4HAC A;  2YT4 A;  3PYG A;  1IBM I;  3HTX A;  4URL A;  1FWL A;  2L33 A;  2ZM6 I;  4DR1 I;  2L3C A;  1PKP A;  1ZXN A;  3F6G A;  2EFG A;  4Z7C A;  2MC5 A;  2UXC I;  2B9D A;  4B3M E;  2VQF E;  3WU6 A;  2HKJ A;  3C4B A;  2L3J A;  1X49 A;  4LF6 E;  2RSM A;  4YY3 E;  1ZM9 A;  4AQY E;  2UUB I;  4WUC A;  5GMD A;  2B7T A;  4FWH A;  1GQE A;  4EMD A;  4JI0 E;  2GS8 A;  3ADI A;  4R8O A;  4LF4 E;  2JR1 A;  1XMQ E;  3B78 A;  4DKK A;  4UT4 A;  3RMP A;  4DV4 E;  4P7A A;  2M4I A;  1KTV A;  4X62 I;  4DUY E;  1NHH A;  1S16 A;  4BBY A;  1ZM2 A;  1HNX E;  3F6H A;  4F9B B;  4X8W A;  4DR2 E;  3FIG A;  1KVK A;  3ADG A;  1B63 A;  4Q28 A;  3J7Y p;  3ZKB A;  1I94 I;  2E1R A;  2LJH A;  3F0N A;  2HK2 A;  2JVA A;  4JI7 I;  4JI5 I;  2JWO A;  4KZS A;  4R03 A;  3QT6 A;  4L8N A;  4GKJ I;  4DU7 A;  4DR7 E;  1T4L B;  4PU9 A;  2UXB I;  4LF5 I;  2KHX A;  4USM A;  4DR5 E;  1MU5 A;  5F3W A;  2NUF A;  4MYT A;  5GME A;  4X64 I;  1J5E I;  1N34 E;  2LMZ A;  5BR8 E;  4F54 A;  1N0V C;  4K0K E;  2DB2 A;  2BV3 A;  3T1Y I;  1D6T A;  4JI6 E;  4P78 A;  2VQE E;  4UTG A;  2X36 A;  1HNZ I;  2L92 A;  1X48 A;  3OML A;  4BC9 A;  2V2Q A;  4LF7 I;  3VYY A;  4BS9 A;  2KOU A;  2RTX A;  1IBM E;  1Z0W A;  2Z5B B;  2F4V I;  4JI4 E;  4B3R I;  2L2N A;  3WU5 A;  2XEX A;  3ZZT A;  4DV3 E;  3PYD A;  1IBL I;  4DPT A;  1FNM A;  4FN5 A;  3LTO A;  2UUB E;  1YYO A;  4WYQ B;  4HYM A;  3ZKD A;  4FWD A;  1A6F A;  1XNR I;  3J7A G;  4DXL A;  1MG7 A;  5AE2 A;  1K47 A;  4M2Z A;  2L6M A;  2WZO A;  4J8Z A;  1DI2 A;  2L2M A;  2AJ4 A;  1FJG I;  1ELO A;  1Z0G A;  1Z59 A;  4PRV A;  1N32 I;  3DF6 A;  1T4N A;  4DV7 I;  3VYX A;  2JY9 A;  4M1K A;  2O1W A;  3M6A A;  1ZXM A;  2N3H A;  3P06 A;  3QT7 A;  4X62 E;  2CZ9 A;  5T6J A;  5A2Q C;  3V2U C;  4JI2 I;  4ED4 A;  5LMU I;  3ADL A;  1FWK A;  2UU9 I;  4BMJ A;  1NZ0 A;  3MSW A;  4YHH I;  2R3V A;  1I94 E;  4KHP E;  4JV5 I;  4WUD A;  1YYK A;  2O1U A;  2Z5B A;  2FGG A;  5A2Q Q;  4IZJ A;  1STU A;  4JI7 E;  1OJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...