4DR5I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr5I00
1ZM3A 4JI2I 4JI3I 4DR3E 2VQEE 4LF6E 1XMQE 3V2UC 4DPTA 4ED4A 2HHHE 2UXBE 4P7AA 2ZM6E 3T1YI 3H4LA 4DV2I 1BKNA 4USMA 4X65I 2UUBE 3ZZ0A 4LFCI 2GS8A 4HYMA 4DPWA 4JI7I 1Z0CA 1QZRA 4YY3I 3HULA 5LMUE 2CZ9A 5IT9Q 3WU3A 1H74A 2NPFA 1IBLE 1N36E 3J81C 4KQVA 1XNRI 1HNXI 4DU8A 4LF5E 4JI4I 3J7AM 4X62I 4PU9A 4HACA 3T1HE 1KIJA 4JI5E 4JV5I 1FI4A 4Z7CA 4DR5E 4DR7E 2XEXA 1IBMI 1K47A 4YHHI 1HNZE 1Z0TA 1N34I 5BR8I 5IT9C 4JI6I 1J5EI 1U2RA 1VISA 4B3ME 1Z0EA 4GKKI 1HNWI 4DV3E 4DR3I 4ZVIA 2VQEI 3V5RA 1XMQI 4DV6I 1ZM2A 4X66E 1NHHA 1RR9A 4DR1E 2UUAE 2HHHI 2UXBI 2UU9I 1ELOA 4LF7E 4FW9A 2ZM6I 1FJGE 1H73A 3QT8A 1IBKE 4LF8E 4Z7YA 2UUBI 4AQYI 5LMNE 1ZM9A 1Z0GA 4LF9E 2V34A 1H72C 3QT7A 5LMUI 1Z5AA 1IBLI 3D4JA 2DEJA 1N36I 4WUDA 4UTGA 4NXME 2R3VA 4B3TE 1S16A 2BM0A 4FWGA 2BV3A 4DUZI 3OTOE 1I94E 4MYUA 3ZZUA 4DPYA 3LNUA 2R42A 4LF5I 4P52A 4KHPE 4DV5E 1NZ0A 2HK2A 1A6FA 3T1HI 4JI5I 4FWHA 2UUCE 3PYFA 4DR5I 4JI1I 4DUYE 2E5LE 1H7UA 5GMDA 1HNZI 4JI8E 4B3RE 2VF3A 2ZITA 1Z0WA 4M1KA 4HXZA 4B3MI 4LFBE 4DV3I 4NXNI 2V2QA 3J80C 3B78A 4X64E 4X66I 1D6TA 1H7SA 2EFGA 4DV4E 1NHIA 4URLA 1N32E 3WU4A 4LF7I 5LL6R 4LFAI 4UT4A 2V8PA 1FJGI 3PYEA 3K1JA 1IBKI 4XTJA 1Z0VA 2F4VE 4DV1E 1KTVA 2OI2A 1XMOE 4DR4E 1XNQE 3F0NA 5LMNI 1N0UA 4LF9I 4FN5A 4JYAE 3JAMQ 4NXMI 4B3TI 1Z5BA 4I3HA 3ZKDA 3OTOI 1I94I 4LF6I 4EMDA 3ZM7A 1RREA 1ZM4A 4KHPI 4DV5I 4DR2E 2UXCE 3LPSA 3LTOA 1MU5A 1B63A 1HR0E 1NHJA 1XHKA 2UUCI 4FWDA 3Q1QA 1Z0BA 4DUYI 1S4EA 1KKHA 1PVGA 4DXLA 1FWKA 4JI8I 5FLXQ 4LF4E 4B3SE 3JAMC 4K0KE 2AJ4A 2HKJA 4LFBI 4GKJE 1PKPA 4OX9E 4JI0E 2LJPA 4X64I 3J80Q 4DV4I 1N33E 1IBME 1N32I 2HFSA 3PYDA 2UXDE 4DR6E 4DV0E 2F4VI 4DV1I 4GKKE 2X7IA 1ZXNA 1XMOI 1HNWE 4DR4I 4DR7I 1XNQI 3QT6A 1Z59A 1B62A 4DV6E 4MYTA 5FLXC 2VQFE 2HKEA 3ZZTA 4JYAI 2UU9E 2ZBKB 2A2CA 3PYGA 2V2VA 1N0VC 4USKA 1ZXMA 4HY1A 2E1RA 3B82A 4AQYE 4DR1I 5IWAE 2DEIA 4DR2I 2UUAI 2UXCI 4DU7A 1EI1A 1MG7A 4DPUA 4DV7E 1HR0I 4LF8I 1UEKA 5GMEA 4DUZE 4JI2E 4JI3E 4LF4I 1OJ4A 5A2QQ 2J7KA 4B3SI 4K0KI 1WUUA 2A2DA 4GKJI 3QT5A 4WUCA 4OX9I 4JI0I 3T1YE 4DV2E 1KVKA 4JI1E 2HFUA 1N33I 4PRXA 1DARA 4X65E 3GONA 4LFCE 3ZKBA 1FKAE 4WUBA 1FNMA 4JI7E 4YY3E 2UXDI 4JG4A 2BM1A 1MX0A 2V2ZA 4DR6I 4DV0I 1Z5CA 3CWVA 1XNRE 1HNXE 4NXNE 2E5LI 2HK3A 2VQFI 4B3RI 5A2QC 4JI4E 2WW4A 4RPFA 3WU5A 4X62E 2Q2EB 3K17A 4LFAE 4PRVA 3WU6A 3J7AG 4JV5E 4HACB 2X36A 3B8HA 5L3JA 5IWAI 3M6AA 4YHHE 1N34E 5BR8E 4DV7I 4R1FA 4JI6E 1J5EE 4DPXA 1PIEA 1EA6A 1FWLA 3J81Q
chains in the Genus database with same CATH superfamily
1ZM3A 4JI2I 4JI3I 4DR3E 2VQEE 1Y5YA 4LF6E 5JEAC 1XMQE 2WP8A 4IFDB 1HK7A 4IS9A 3V2UC 4DPTA 4ED4A 3M85D 2HHHE 2UXBE 4IZJA 4P7AA 4MDTA 5DNLA 2C38A 2ZM6E 3T1YI 3H4LA 4DV2I 2BA1D 3GMEA 2CVEA 2AE8A 1R6MA 1BKNA 4USMA 3U1KA 4X65I 4BA2A 2UUBE 3ZZ0A 4LFCI 2PNLA 2GS8A 4HYMA 4IFDE 4DPWA 4JI7I 1Z0CA 1QZRA 4YY3I 3HULA 5LMUE 2CZ9A 5IT9Q 3WU3A 1H74A 2NPFA 4MU3A 1IBLE 1N36E 2C39A 3GCMA 3J81C 4KQVA 2PNMA 1XNRI 4LPFA 1HNXI 1E3HA 4DU8A 2NN6A 1UDNA 3NZKA 4LF5E 2O1TA 4JI4I 3KRNA 4NBQA 3J7AM 4X62I 4PU9A 4HACA 3GLLA 3T1HE 1KIJA 4JI5E 4JV5I 1FI4A 4Z7CA 4DR5E 4DR7E 4AIDA 2XEXA 1IBMI 1OYSA 1K47A 4YHHI 1HNZE 1Z0TA 2Z5CB 1N34I 5BR8I 5IT9C 2Z5EA 1J5EI 4JI6I 4IZKB 1U2RA 1VISA 4IZJD 4B3ME 1Z0EA 4GKKI 1HNWI 4QNKA 4DV3E 4DR3I 4ZVIA 2VQEI 4AIMA 5JEAA 1UDQA 3V5RA 1XMQI 1ZM2A 2PNZB 4DV6I 4X66E 1NHHA 4OKGA 1RR9A 4DR1E 2C37B 2UUAE 2HHHI 2UXBI 4OO1F 2UU9I 1ELOA 4LF7E 4FW9A 3U1YA 2ZM6I 3PS3A 1H73A 1FJGE 3QT8A 1IBKE 4LF8E 4Z7YA 2WNRB 2UUBI 4AQYI 5LMNE 3CDJA 2NN6D 1Z0GA 1ZM9A 4LF9E 2V34A 1H72C 1Y4SA 3QT7A 4LCFA 5LMUI 1Z5AA 1IBLI 3D4JA 2PO2A 2DEJA 1N36I 4WUDA 4UTGA 5C0XB 4NXME 2R3VA 2O1VA 4B3TE 1S16A 2BM0A 4FWGA 1USUA 2BV3A 4OO1B 2Z5BA 1YHCA 5DRRA 4DUZI 3OTOE 1I94E 4MYUA 3ZZUA 4IFDC 2GO3A 4DPYA 3LNUA 2R42A 4AM3A 4LF5I 4P52A 4KHPE 4DV5E 1NZ0A 2HK2A 1A6FA 5K36B 1YH8A 5C0XE 3T1HI 1P42A 4JI5I 4FWHA 3H1CA 4OO1E 2UUCE 2IERA 3PYFA 4DR5I 2JT2A 4JI1I 4DUYE 2E5LE 5JEAD 4FW5A 4OZEA 2JEAA 1H7UA 5GMDA 1HNZI 2PO0B 4JI8E 4B3RE 4IZKA 2VF3A 2ZITA 1USVA 4FW7A 3Q6MA 1Z0WA 5K36E 4M1KA 4HXZA 4B3MI 1VI7A 2GQ0A 3L7ZB 4DV3I 4NXNI 4LFBE 2V2QA 3J80C 3B78A 4X64E 2C37A 4X66I 1OYRA 1D6TA 4QNJA 1H7SA 2EFGA 4DV4E 2PO1B 1NHIA 4URLA 1N32E 4MU1A 3WU4A 4LF7I 5LL6R 4LFAI 4UT4A 2V8PA 1FJGI 3PYEA 3K1JA 1IBKI 4XTJA 1Z0VA 2F4VE 3PS2A 1KTVA 2OI2A 4DV1E 5FWKA 1XMOE 3HJCA 4DR4E 1XNQE 3F0NA 5LMNI 3Q6NA 1N0UA 4LF9I 5C0XA 2WP8B 4FN5A 4JYAE 3JAMQ 4NXMI 4B3TI 1Z5BA 4MU4A 4I3HA 3ZKDA 4IZJB 4N3OA 3OTOI 1I94I 2BA0G 2JE6B 2NN6F 4LF6I 4IFDA 2C38B 4MQYA 4EMDA 3ZM7A 1RREA 1ZM4A 2JEBB 4KHPI 4DV5I 5K36A 4DR2E 2UXCE 3LPSA 3LTOA 1MU5A 1B63A 1HR0E 1NHJA 1XHKA 2BR2B 2UUCI 4FWDA 4U3BA 3Q1QA 1Z0BA 4DUYI 1S4EA 4J3DA 1KKHA 5ELWA 2PO0A 1PVGA 3UHMA 4DXLA 1FWKA 4JI8I 5FLXQ 4LF4E 2NN6B 4B3SE 5C0XC 3JAMC 4K0KE 4OO1C 2AJ4A 2HKJA 4LFBI 4GKJE 5JEAF 1PKPA 4OX9E 4JI0E 2LJPA 4X64I 3J80Q 1Y60A 4DV4I 2BA1G 1N33E 3M7NG 1IBME 1N32I 2GO4A 4FW3A 5K36C 2NN6E 2HFSA 4LOMA 5C0XD 3PYDA 2UXDE 4DR6E 3PS1A 4DV0E 2F4VI 4DV1I 4FW4A 4GKKE 2X7IA 4FW6A 1ZXNA 1XMOI 1HNWE 4DR4I 4DR7I 1XNQI 3P06A 3QT6A 1Z59A 5DROA 4IFDD 2Z5CA 1B62A 4DV6E 4MYTA 2IOPA 5JEAB 5FLXC 4U3DA 2VQFE 2HKEA 3ZZTA 5K36D 4JYAI 2UU9E 2ZBKB 2A2CA 3PYGA 2V2VA 2JE6A 1N0VC 4USKA 4BA1B 1ZXMA 2PNZA 2JEBA 3M7ND 4HY1A 3P3EA 2E1RA 5EKWA 3B82A 4AQYE 4DR1I 5IWAE 5JEAE 2DEIA 4DR2I 5DNXA 2UUAI 2UXCI 4DU7A 1EI1A 5DRPA 1MG7A 4DPUA 2BR2A 2VESA 4DV7E 1HR0I 2WNRA 1OYPA 2IESA 2PO2B 4MU0A 4LF8I 1UEKA 2CG9A 5DRQA 5GMEA 4ISAA 4DUZE 4JI2E 4JI3E 4GQUA 2Z5BB 2IOQA 4LF4I 1OJ4A 5A2QQ 2J7KA 2O1UA 4B3SI 1E3PA 4K0KI 3K85A 1WUUA 3P3CA 4OO1A 2A2DA 3HKMA 4GKJI 5EL9A 3QT5A 1Y4UA 4WUCA 4OX9I 4JI0I 3T1YE 3CDIA 1UDOA 4DV2E 1KVKA 4JI1E 2HFUA 4LCHA 3DD6A 1N33I 4PRXA 1DARA 4X65E 3GONA 2O1WA 4LCGA 3ZKBA 4LFCE 1RHYA 4WUBA 1FKAE 1FNMA 4JI7E 4BA2B 4YY3E 2UXDI 2JEAB 4JG4A 2BM1A 1MX0A 2V2ZA 4DR6I 4DV0I 1Z5CA 3CWVA 3PRYA 1XNRE 1HNXE 4NXNE 2C39B 2F1DA 2E5LI 2O3ZA 5C0XF 2HK3A 2NN6C 1XXEA 3P3GA 2VQFI 4B3RI 5A2QC 4JI4E 2J65A 2WW4A 4BA1A 4RPFA 3WU5A 2CGEA 4X62E 3L7ZA 2BA0D 2Q2EB 3K17A 3M85G 4LFAE 4PRVA 3WU6A 3J7AG 4IFDF 3B4TA 4HACB 4JV5E 2X36A 3B8HA 2PO1A 1Y6ZA 5L3JA 5K36F 5IWAI 3M6AA 1R6LA 3P76A 4YHHE 1UDSA 1N34E 5BR8E 4DV7I 4R1FA 4JI6E 1J5EE 4DPXA 1PIEA 1EA6A 1FWLA 4OO1D 3J81Q
chains in the Genus database with same CATH topology
1ZM3A 4JI2I 4JI3I 4DR3E 2VQEE 4LF6E 1XMQE 1HK7A 3V2UC 4DPTA 4ED4A 2HHHE 2UXBE 4IZJA 4P7AA 2ZM6E 3T1YI 3H4LA 4DV2I 1BKNA 4USMA 4X65I 2UUBE 3ZZ0A 4LFCI 2PNLA 2GS8A 4HYMA 4DPWA 4JI7I 1Z0CA 1QZRA 4YY3I 3HULA 5LMUE 2CZ9A 5IT9Q 3WU3A 1H74A 2NPFA 1IBLE 1N36E 3J81C 4KQVA 2PNMA 1XNRI 1HNXI 4DU8A 4LF5E 2O1TA 4JI4I 3J7AM 4X62I 4PU9A 4HACA 3T1HE 1KIJA 4JI5E 4JV5I 1FI4A 4Z7CA 4DR5E 4DR7E 2XEXA 1IBMI 1K47A 4YHHI 1HNZE 1Z0TA 1N34I 2Z5CB 5BR8I 5IT9C 2Z5EA 1J5EI 4JI6I 4IZKB 1U2RA 1VISA 4IZJD 4B3ME 1Z0EA 4GKKI 1HNWI 4DV3E 4DR3I 4ZVIA 2VQEI 3V5RA 1XMQI 4DV6I 1ZM2A 4X66E 1NHHA 1RR9A 4DR1E 2UUAE 2HHHI 2UXBI 2UU9I 1ELOA 4LF7E 4FW9A 2ZM6I 1FJGE 1H73A 3QT8A 1IBKE 4LF8E 4Z7YA 2UUBI 4AQYI 5LMNE 1ZM9A 1Z0GA 4LF9E 2V34A 1H72C 1Y4SA 3QT7A 5LMUI 1Z5AA 1IBLI 3D4JA 2DEJA 1N36I 4WUDA 4UTGA 4NXME 2R3VA 2O1VA 4B3TE 1S16A 2BM0A 4FWGA 1USUA 2BV3A 2Z5BA 4DUZI 3OTOE 1I94E 4MYUA 3ZZUA 4DPYA 3LNUA 2R42A 4LF5I 4P52A 4KHPE 4DV5E 1NZ0A 2HK2A 1A6FA 3T1HI 4JI5I 4FWHA 2UUCE 3PYFA 4DR5I 4JI1I 4DUYE 2E5LE 1H7UA 5GMDA 1HNZI 4JI8E 4B3RE 4IZKA 2VF3A 2ZITA 1USVA 3Q6MA 1Z0WA 4M1KA 4HXZA 4B3MI 2GQ0A 4LFBE 4DV3I 4NXNI 2V2QA 3J80C 3B78A 4X64E 4X66I 1D6TA 1H7SA 2EFGA 4DV4E 1NHIA 4URLA 1N32E 3WU4A 4LF7I 5LL6R 4LFAI 4UT4A 2V8PA 1FJGI 3PYEA 3K1JA 1IBKI 4XTJA 1Z0VA 2F4VE 4DV1E 1KTVA 2OI2A 5FWKA 1XMOE 3HJCA 4DR4E 1XNQE 3F0NA 5LMNI 3Q6NA 1N0UA 4LF9I 4FN5A 4JYAE 3JAMQ 4NXMI 4B3TI 1Z5BA 4I3HA 3ZKDA 4IZJB 4N3OA 3OTOI 1I94I 4LF6I 4EMDA 3ZM7A 1RREA 1ZM4A 4KHPI 4DV5I 4DR2E 2UXCE 3LPSA 3LTOA 1MU5A 1B63A 1HR0E 1NHJA 1XHKA 2UUCI 4FWDA 3Q1QA 1Z0BA 4DUYI 1S4EA 1KKHA 1PVGA 4DXLA 1FWKA 4JI8I 5FLXQ 4LF4E 4B3SE 3JAMC 4K0KE 2AJ4A 2HKJA 4LFBI 4GKJE 1PKPA 4OX9E 4JI0E 2LJPA 4X64I 3J80Q 4DV4I 1N33E 1IBME 1N32I 2HFSA 3PYDA 2UXDE 4DR6E 4DV0E 2F4VI 4DV1I 4GKKE 2X7IA 1ZXNA 1XMOI 1HNWE 4DR4I 4DR7I 1XNQI 3P06A 3QT6A 1Z59A 2Z5CA 4DV6E 1B62A 4MYTA 2IOPA 5FLXC 2VQFE 2HKEA 3ZZTA 4JYAI 2UU9E 2ZBKB 2A2CA 3PYGA 2V2VA 1N0VC 4USKA 1ZXMA 4HY1A 2E1RA 3B82A 4AQYE 4DR1I 5IWAE 2DEIA 4DR2I 2UUAI 2UXCI 4DU7A 1EI1A 1MG7A 4DPUA 4DV7E 1HR0I 4LF8I 1UEKA 2CG9A 5GMEA 4DUZE 4JI2E 4JI3E 2Z5BB 2IOQA 4LF4I 1OJ4A 5A2QQ 2J7KA 2O1UA 4B3SI 4K0KI 3K85A 1WUUA 2A2DA 4GKJI 3QT5A 1Y4UA 4WUCA 4OX9I 4JI0I 3T1YE 4DV2E 1KVKA 4JI1E 2HFUA 1N33I 4PRXA 1DARA 4X65E 3GONA 2O1WA 4LFCE 3ZKBA 1FKAE 4WUBA 1FNMA 4JI7E 4YY3E 2UXDI 4JG4A 2BM1A 1MX0A 2V2ZA 4DR6I 4DV0I 1Z5CA 3CWVA 3PRYA 1XNRE 1HNXE 4NXNE 2E5LI 2HK3A 2VQFI 4B3RI 5A2QC 4JI4E 2WW4A 4RPFA 3WU5A 2CGEA 4X62E 2Q2EB 3K17A 4LFAE 4PRVA 3WU6A 3J7AG 4JV5E 4HACB 2X36A 3B8HA 1Y6ZA 5L3JA 5IWAI 3M6AA 4YHHE 1N34E 5BR8E 4DV7I 4R1FA 4JI6E 1J5EE 4DPXA 1PIEA 1EA6A 1FWLA 3J81Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZM3 A;  4JI2 I;  4JI3 I;  4DR3 E;  2VQE E;  4LF6 E;  1XMQ E;  3V2U C;  4DPT A;  4ED4 A;  2HHH E;  2UXB E;  4P7A A;  2ZM6 E;  3T1Y I;  3H4L A;  4DV2 I;  1BKN A;  4USM A;  4X65 I;  2UUB E;  3ZZ0 A;  4LFC I;  2GS8 A;  4HYM A;  4DPW A;  4JI7 I;  1Z0C A;  1QZR A;  4YY3 I;  3HUL A;  5LMU E;  2CZ9 A;  5IT9 Q;  3WU3 A;  1H74 A;  2NPF A;  1IBL E;  1N36 E;  3J81 C;  4KQV A;  1XNR I;  1HNX I;  4DU8 A;  4LF5 E;  4JI4 I;  3J7A M;  4X62 I;  4PU9 A;  4HAC A;  3T1H E;  1KIJ A;  4JI5 E;  4JV5 I;  1FI4 A;  4Z7C A;  4DR5 E;  4DR7 E;  2XEX A;  1IBM I;  1K47 A;  4YHH I;  1HNZ E;  1Z0T A;  1N34 I;  5BR8 I;  5IT9 C;  4JI6 I;  1J5E I;  1U2R A;  1VIS A;  4B3M E;  1Z0E A;  4GKK I;  1HNW I;  4DV3 E;  4DR3 I;  4ZVI A;  2VQE I;  3V5R A;  1XMQ I;  4DV6 I;  1ZM2 A;  4X66 E;  1NHH A;  1RR9 A;  4DR1 E;  2UUA E;  2HHH I;  2UXB I;  2UU9 I;  1ELO A;  4LF7 E;  4FW9 A;  2ZM6 I;  1FJG E;  1H73 A;  3QT8 A;  1IBK E;  4LF8 E;  4Z7Y A;  2UUB I;  4AQY I;  5LMN E;  1ZM9 A;  1Z0G A;  4LF9 E;  2V34 A;  1H72 C;  3QT7 A;  5LMU I;  1Z5A A;  1IBL I;  3D4J A;  2DEJ A;  1N36 I;  4WUD A;  4UTG A;  4NXM E;  2R3V A;  4B3T E;  1S16 A;  2BM0 A;  4FWG A;  2BV3 A;  4DUZ I;  3OTO E;  1I94 E;  4MYU A;  3ZZU A;  4DPY A;  3LNU A;  2R42 A;  4LF5 I;  4P52 A;  4KHP E;  4DV5 E;  1NZ0 A;  2HK2 A;  1A6F A;  3T1H I;  4JI5 I;  4FWH A;  2UUC E;  3PYF A;  4DR5 I;  4JI1 I;  4DUY E;  2E5L E;  1H7U A;  5GMD A;  1HNZ I;  4JI8 E;  4B3R E;  2VF3 A;  2ZIT A;  1Z0W A;  4M1K A;  4HXZ A;  4B3M I;  4LFB E;  4DV3 I;  4NXN I;  2V2Q A;  3J80 C;  3B78 A;  4X64 E;  4X66 I;  1D6T A;  1H7S A;  2EFG A;  4DV4 E;  1NHI A;  4URL A;  1N32 E;  3WU4 A;  4LF7 I;  5LL6 R;  4LFA I;  4UT4 A;  2V8P A;  1FJG I;  3PYE A;  3K1J A;  1IBK I;  4XTJ A;  1Z0V A;  2F4V E;  4DV1 E;  1KTV A;  2OI2 A;  1XMO E;  4DR4 E;  1XNQ E;  3F0N A;  5LMN I;  1N0U A;  4LF9 I;  4FN5 A;  4JYA E;  3JAM Q;  4NXM I;  4B3T I;  1Z5B A;  4I3H A;  3ZKD A;  3OTO I;  1I94 I;  4LF6 I;  4EMD A;  3ZM7 A;  1RRE A;  1ZM4 A;  4KHP I;  4DV5 I;  4DR2 E;  2UXC E;  3LPS A;  3LTO A;  1MU5 A;  1B63 A;  1HR0 E;  1NHJ A;  1XHK A;  2UUC I;  4FWD A;  3Q1Q A;  1Z0B A;  4DUY I;  1S4E A;  1KKH A;  1PVG A;  4DXL A;  1FWK A;  4JI8 I;  5FLX Q;  4LF4 E;  4B3S E;  3JAM C;  4K0K E;  2AJ4 A;  2HKJ A;  4LFB I;  4GKJ E;  1PKP A;  4OX9 E;  4JI0 E;  2LJP A;  4X64 I;  3J80 Q;  4DV4 I;  1N33 E;  1IBM E;  1N32 I;  2HFS A;  3PYD A;  2UXD E;  4DR6 E;  4DV0 E;  2F4V I;  4DV1 I;  4GKK E;  2X7I A;  1ZXN A;  1XMO I;  1HNW E;  4DR4 I;  4DR7 I;  1XNQ I;  3QT6 A;  1Z59 A;  1B62 A;  4DV6 E;  4MYT A;  5FLX C;  2VQF E;  2HKE A;  3ZZT A;  4JYA I;  2UU9 E;  2ZBK B;  2A2C A;  3PYG A;  2V2V A;  1N0V C;  4USK A;  1ZXM A;  4HY1 A;  2E1R A;  3B82 A;  4AQY E;  4DR1 I;  5IWA E;  2DEI A;  4DR2 I;  2UUA I;  2UXC I;  4DU7 A;  1EI1 A;  1MG7 A;  4DPU A;  4DV7 E;  1HR0 I;  4LF8 I;  1UEK A;  5GME A;  4DUZ E;  4JI2 E;  4JI3 E;  4LF4 I;  1OJ4 A;  5A2Q Q;  2J7K A;  4B3S I;  4K0K I;  1WUU A;  2A2D A;  4GKJ I;  3QT5 A;  4WUC A;  4OX9 I;  4JI0 I;  3T1Y E;  4DV2 E;  1KVK A;  4JI1 E;  2HFU A;  1N33 I;  4PRX A;  1DAR A;  4X65 E;  3GON A;  4LFC E;  3ZKB A;  1FKA E;  4WUB A;  1FNM A;  4JI7 E;  4YY3 E;  2UXD I;  4JG4 A;  2BM1 A;  1MX0 A;  2V2Z A;  4DR6 I;  4DV0 I;  1Z5C A;  3CWV A;  1XNR E;  1HNX E;  4NXN E;  2E5L I;  2HK3 A;  2VQF I;  4B3R I;  5A2Q C;  4JI4 E;  2WW4 A;  4RPF A;  3WU5 A;  4X62 E;  2Q2E B;  3K17 A;  4LFA E;  4PRV A;  3WU6 A;  3J7A G;  4JV5 E;  4HAC B;  2X36 A;  3B8H A;  5L3J A;  5IWA I;  3M6A A;  4YHH E;  1N34 E;  5BR8 E;  4DV7 I;  4R1F A;  4JI6 E;  1J5E E;  4DPX A;  1PIE A;  1EA6 A;  1FWL A;  3J81 Q; 
#chains in the Genus database with same CATH topology
 1ZM3 A;  4JI2 I;  4JI3 I;  4DR3 E;  2VQE E;  1Y5Y A;  4LF6 E;  5JEA C;  1XMQ E;  2WP8 A;  4IFD B;  1HK7 A;  4IS9 A;  3V2U C;  4DPT A;  4ED4 A;  3M85 D;  2HHH E;  2UXB E;  4IZJ A;  4P7A A;  4MDT A;  5DNL A;  2C38 A;  2ZM6 E;  3T1Y I;  3H4L A;  4DV2 I;  2BA1 D;  3GME A;  2CVE A;  2AE8 A;  1R6M A;  1BKN A;  4USM A;  3U1K A;  4X65 I;  4BA2 A;  2UUB E;  3ZZ0 A;  4LFC I;  2PNL A;  2GS8 A;  4HYM A;  4IFD E;  4DPW A;  4JI7 I;  1Z0C A;  1QZR A;  4YY3 I;  3HUL A;  5LMU E;  2CZ9 A;  5IT9 Q;  3WU3 A;  1H74 A;  2NPF A;  4MU3 A;  1IBL E;  1N36 E;  2C39 A;  3GCM A;  3J81 C;  4KQV A;  2PNM A;  1XNR I;  4LPF A;  1HNX I;  1E3H A;  4DU8 A;  2NN6 A;  1UDN A;  3NZK A;  4LF5 E;  2O1T A;  4JI4 I;  3KRN A;  4NBQ A;  3J7A M;  4X62 I;  4PU9 A;  4HAC A;  3GLL A;  3T1H E;  1KIJ A;  4JI5 E;  4JV5 I;  1FI4 A;  4Z7C A;  4DR5 E;  4DR7 E;  4AID A;  2XEX A;  1IBM I;  1OYS A;  1K47 A;  4YHH I;  1HNZ E;  1Z0T A;  2Z5C B;  1N34 I;  5BR8 I;  5IT9 C;  2Z5E A;  1J5E I;  4JI6 I;  4IZK B;  1U2R A;  1VIS A;  4IZJ D;  4B3M E;  1Z0E A;  4GKK I;  1HNW I;  4QNK A;  4DV3 E;  4DR3 I;  4ZVI A;  2VQE I;  4AIM A;  5JEA A;  1UDQ A;  3V5R A;  1XMQ I;  1ZM2 A;  2PNZ B;  4DV6 I;  4X66 E;  1NHH A;  4OKG A;  1RR9 A;  4DR1 E;  2C37 B;  2UUA E;  2HHH I;  2UXB I;  4OO1 F;  2UU9 I;  1ELO A;  4LF7 E;  4FW9 A;  3U1Y A;  2ZM6 I;  3PS3 A;  1H73 A;  1FJG E;  3QT8 A;  1IBK E;  4LF8 E;  4Z7Y A;  2WNR B;  2UUB I;  4AQY I;  5LMN E;  3CDJ A;  2NN6 D;  1Z0G A;  1ZM9 A;  4LF9 E;  2V34 A;  1H72 C;  1Y4S A;  3QT7 A;  4LCF A;  5LMU I;  1Z5A A;  1IBL I;  3D4J A;  2PO2 A;  2DEJ A;  1N36 I;  4WUD A;  4UTG A;  5C0X B;  4NXM E;  2R3V A;  2O1V A;  4B3T E;  1S16 A;  2BM0 A;  4FWG A;  1USU A;  2BV3 A;  4OO1 B;  2Z5B A;  1YHC A;  5DRR A;  4DUZ I;  3OTO E;  1I94 E;  4MYU A;  3ZZU A;  4IFD C;  2GO3 A;  4DPY A;  3LNU A;  2R42 A;  4AM3 A;  4LF5 I;  4P52 A;  4KHP E;  4DV5 E;  1NZ0 A;  2HK2 A;  1A6F A;  5K36 B;  1YH8 A;  5C0X E;  3T1H I;  1P42 A;  4JI5 I;  4FWH A;  3H1C A;  4OO1 E;  2UUC E;  2IER A;  3PYF A;  4DR5 I;  2JT2 A;  4JI1 I;  4DUY E;  2E5L E;  5JEA D;  4FW5 A;  4OZE A;  2JEA A;  1H7U A;  5GMD A;  1HNZ I;  2PO0 B;  4JI8 E;  4B3R E;  4IZK A;  2VF3 A;  2ZIT A;  1USV A;  4FW7 A;  3Q6M A;  1Z0W A;  5K36 E;  4M1K A;  4HXZ A;  4B3M I;  1VI7 A;  2GQ0 A;  3L7Z B;  4DV3 I;  4NXN I;  4LFB E;  2V2Q A;  3J80 C;  3B78 A;  4X64 E;  2C37 A;  4X66 I;  1OYR A;  1D6T A;  4QNJ A;  1H7S A;  2EFG A;  4DV4 E;  2PO1 B;  1NHI A;  4URL A;  1N32 E;  4MU1 A;  3WU4 A;  4LF7 I;  5LL6 R;  4LFA I;  4UT4 A;  2V8P A;  1FJG I;  3PYE A;  3K1J A;  1IBK I;  4XTJ A;  1Z0V A;  2F4V E;  3PS2 A;  1KTV A;  2OI2 A;  4DV1 E;  5FWK A;  1XMO E;  3HJC A;  4DR4 E;  1XNQ E;  3F0N A;  5LMN I;  3Q6N A;  1N0U A;  4LF9 I;  5C0X A;  2WP8 B;  4FN5 A;  4JYA E;  3JAM Q;  4NXM I;  4B3T I;  1Z5B A;  4MU4 A;  4I3H A;  3ZKD A;  4IZJ B;  4N3O A;  3OTO I;  1I94 I;  2BA0 G;  2JE6 B;  2NN6 F;  4LF6 I;  4IFD A;  2C38 B;  4MQY A;  4EMD A;  3ZM7 A;  1RRE A;  1ZM4 A;  2JEB B;  4KHP I;  4DV5 I;  5K36 A;  4DR2 E;  2UXC E;  3LPS A;  3LTO A;  1MU5 A;  1B63 A;  1HR0 E;  1NHJ A;  1XHK A;  2BR2 B;  2UUC I;  4FWD A;  4U3B A;  3Q1Q A;  1Z0B A;  4DUY I;  1S4E A;  4J3D A;  1KKH A;  5ELW A;  2PO0 A;  1PVG A;  3UHM A;  4DXL A;  1FWK A;  4JI8 I;  5FLX Q;  4LF4 E;  2NN6 B;  4B3S E;  5C0X C;  3JAM C;  4K0K E;  4OO1 C;  2AJ4 A;  2HKJ A;  4LFB I;  4GKJ E;  5JEA F;  1PKP A;  4OX9 E;  4JI0 E;  2LJP A;  4X64 I;  3J80 Q;  1Y60 A;  4DV4 I;  2BA1 G;  1N33 E;  3M7N G;  1IBM E;  1N32 I;  2GO4 A;  4FW3 A;  5K36 C;  2NN6 E;  2HFS A;  4LOM A;  5C0X D;  3PYD A;  2UXD E;  4DR6 E;  3PS1 A;  4DV0 E;  2F4V I;  4DV1 I;  4FW4 A;  4GKK E;  2X7I A;  4FW6 A;  1ZXN A;  1XMO I;  1HNW E;  4DR4 I;  4DR7 I;  1XNQ I;  3P06 A;  3QT6 A;  1Z59 A;  5DRO A;  4IFD D;  2Z5C A;  1B62 A;  4DV6 E;  4MYT A;  2IOP A;  5JEA B;  5FLX C;  4U3D A;  2VQF E;  2HKE A;  3ZZT A;  5K36 D;  4JYA I;  2UU9 E;  2ZBK B;  2A2C A;  3PYG A;  2V2V A;  2JE6 A;  1N0V C;  4USK A;  4BA1 B;  1ZXM A;  2PNZ A;  2JEB A;  3M7N D;  4HY1 A;  3P3E A;  2E1R A;  5EKW A;  3B82 A;  4AQY E;  4DR1 I;  5IWA E;  5JEA E;  2DEI A;  4DR2 I;  5DNX A;  2UUA I;  2UXC I;  4DU7 A;  1EI1 A;  5DRP A;  1MG7 A;  4DPU A;  2BR2 A;  2VES A;  4DV7 E;  1HR0 I;  2WNR A;  1OYP A;  2IES A;  2PO2 B;  4MU0 A;  4LF8 I;  1UEK A;  2CG9 A;  5DRQ A;  5GME A;  4ISA A;  4DUZ E;  4JI2 E;  4JI3 E;  4GQU A;  2Z5B B;  2IOQ A;  4LF4 I;  1OJ4 A;  5A2Q Q;  2J7K A;  2O1U A;  4B3S I;  1E3P A;  4K0K I;  3K85 A;  1WUU A;  3P3C A;  4OO1 A;  2A2D A;  3HKM A;  4GKJ I;  5EL9 A;  3QT5 A;  1Y4U A;  4WUC A;  4OX9 I;  4JI0 I;  3T1Y E;  3CDI A;  1UDO A;  4DV2 E;  1KVK A;  4JI1 E;  2HFU A;  4LCH A;  3DD6 A;  1N33 I;  4PRX A;  1DAR A;  4X65 E;  3GON A;  2O1W A;  4LCG A;  3ZKB A;  4LFC E;  1RHY A;  4WUB A;  1FKA E;  1FNM A;  4JI7 E;  4BA2 B;  4YY3 E;  2UXD I;  2JEA B;  4JG4 A;  2BM1 A;  1MX0 A;  2V2Z A;  4DR6 I;  4DV0 I;  1Z5C A;  3CWV A;  3PRY A;  1XNR E;  1HNX E;  4NXN E;  2C39 B;  2F1D A;  2E5L I;  2O3Z A;  5C0X F;  2HK3 A;  2NN6 C;  1XXE A;  3P3G A;  2VQF I;  4B3R I;  5A2Q C;  4JI4 E;  2J65 A;  2WW4 A;  4BA1 A;  4RPF A;  3WU5 A;  2CGE A;  4X62 E;  3L7Z A;  2BA0 D;  2Q2E B;  3K17 A;  3M85 G;  4LFA E;  4PRV A;  3WU6 A;  3J7A G;  4IFD F;  3B4T A;  4HAC B;  4JV5 E;  2X36 A;  3B8H A;  2PO1 A;  1Y6Z A;  5L3J A;  5K36 F;  5IWA I;  3M6A A;  1R6L A;  3P76 A;  4YHH E;  1UDS A;  1N34 E;  5BR8 E;  4DV7 I;  4R1F A;  4JI6 E;  1J5E E;  4DPX A;  1PIE A;  1EA6 A;  1FWL A;  4OO1 D;  3J81 Q; 
#chains in the Genus database with same CATH homology
 1ZM3 A;  4JI2 I;  4JI3 I;  4DR3 E;  2VQE E;  4LF6 E;  1XMQ E;  1HK7 A;  3V2U C;  4DPT A;  4ED4 A;  2HHH E;  2UXB E;  4IZJ A;  4P7A A;  2ZM6 E;  3T1Y I;  3H4L A;  4DV2 I;  1BKN A;  4USM A;  4X65 I;  2UUB E;  3ZZ0 A;  4LFC I;  2PNL A;  2GS8 A;  4HYM A;  4DPW A;  4JI7 I;  1Z0C A;  1QZR A;  4YY3 I;  3HUL A;  5LMU E;  2CZ9 A;  5IT9 Q;  3WU3 A;  1H74 A;  2NPF A;  1IBL E;  1N36 E;  3J81 C;  4KQV A;  2PNM A;  1XNR I;  1HNX I;  4DU8 A;  4LF5 E;  2O1T A;  4JI4 I;  3J7A M;  4X62 I;  4PU9 A;  4HAC A;  3T1H E;  1KIJ A;  4JI5 E;  4JV5 I;  1FI4 A;  4Z7C A;  4DR5 E;  4DR7 E;  2XEX A;  1IBM I;  1K47 A;  4YHH I;  1HNZ E;  1Z0T A;  1N34 I;  2Z5C B;  5BR8 I;  5IT9 C;  2Z5E A;  1J5E I;  4JI6 I;  4IZK B;  1U2R A;  1VIS A;  4IZJ D;  4B3M E;  1Z0E A;  4GKK I;  1HNW I;  4DV3 E;  4DR3 I;  4ZVI A;  2VQE I;  3V5R A;  1XMQ I;  4DV6 I;  1ZM2 A;  4X66 E;  1NHH A;  1RR9 A;  4DR1 E;  2UUA E;  2HHH I;  2UXB I;  2UU9 I;  1ELO A;  4LF7 E;  4FW9 A;  2ZM6 I;  1FJG E;  1H73 A;  3QT8 A;  1IBK E;  4LF8 E;  4Z7Y A;  2UUB I;  4AQY I;  5LMN E;  1ZM9 A;  1Z0G A;  4LF9 E;  2V34 A;  1H72 C;  1Y4S A;  3QT7 A;  5LMU I;  1Z5A A;  1IBL I;  3D4J A;  2DEJ A;  1N36 I;  4WUD A;  4UTG A;  4NXM E;  2R3V A;  2O1V A;  4B3T E;  1S16 A;  2BM0 A;  4FWG A;  1USU A;  2BV3 A;  2Z5B A;  4DUZ I;  3OTO E;  1I94 E;  4MYU A;  3ZZU A;  4DPY A;  3LNU A;  2R42 A;  4LF5 I;  4P52 A;  4KHP E;  4DV5 E;  1NZ0 A;  2HK2 A;  1A6F A;  3T1H I;  4JI5 I;  4FWH A;  2UUC E;  3PYF A;  4DR5 I;  4JI1 I;  4DUY E;  2E5L E;  1H7U A;  5GMD A;  1HNZ I;  4JI8 E;  4B3R E;  4IZK A;  2VF3 A;  2ZIT A;  1USV A;  3Q6M A;  1Z0W A;  4M1K A;  4HXZ A;  4B3M I;  2GQ0 A;  4LFB E;  4DV3 I;  4NXN I;  2V2Q A;  3J80 C;  3B78 A;  4X64 E;  4X66 I;  1D6T A;  1H7S A;  2EFG A;  4DV4 E;  1NHI A;  4URL A;  1N32 E;  3WU4 A;  4LF7 I;  5LL6 R;  4LFA I;  4UT4 A;  2V8P A;  1FJG I;  3PYE A;  3K1J A;  1IBK I;  4XTJ A;  1Z0V A;  2F4V E;  4DV1 E;  1KTV A;  2OI2 A;  5FWK A;  1XMO E;  3HJC A;  4DR4 E;  1XNQ E;  3F0N A;  5LMN I;  3Q6N A;  1N0U A;  4LF9 I;  4FN5 A;  4JYA E;  3JAM Q;  4NXM I;  4B3T I;  1Z5B A;  4I3H A;  3ZKD A;  4IZJ B;  4N3O A;  3OTO I;  1I94 I;  4LF6 I;  4EMD A;  3ZM7 A;  1RRE A;  1ZM4 A;  4KHP I;  4DV5 I;  4DR2 E;  2UXC E;  3LPS A;  3LTO A;  1MU5 A;  1B63 A;  1HR0 E;  1NHJ A;  1XHK A;  2UUC I;  4FWD A;  3Q1Q A;  1Z0B A;  4DUY I;  1S4E A;  1KKH A;  1PVG A;  4DXL A;  1FWK A;  4JI8 I;  5FLX Q;  4LF4 E;  4B3S E;  3JAM C;  4K0K E;  2AJ4 A;  2HKJ A;  4LFB I;  4GKJ E;  1PKP A;  4OX9 E;  4JI0 E;  2LJP A;  4X64 I;  3J80 Q;  4DV4 I;  1N33 E;  1IBM E;  1N32 I;  2HFS A;  3PYD A;  2UXD E;  4DR6 E;  4DV0 E;  2F4V I;  4DV1 I;  4GKK E;  2X7I A;  1ZXN A;  1XMO I;  1HNW E;  4DR4 I;  4DR7 I;  1XNQ I;  3P06 A;  3QT6 A;  1Z59 A;  2Z5C A;  4DV6 E;  1B62 A;  4MYT A;  2IOP A;  5FLX C;  2VQF E;  2HKE A;  3ZZT A;  4JYA I;  2UU9 E;  2ZBK B;  2A2C A;  3PYG A;  2V2V A;  1N0V C;  4USK A;  1ZXM A;  4HY1 A;  2E1R A;  3B82 A;  4AQY E;  4DR1 I;  5IWA E;  2DEI A;  4DR2 I;  2UUA I;  2UXC I;  4DU7 A;  1EI1 A;  1MG7 A;  4DPU A;  4DV7 E;  1HR0 I;  4LF8 I;  1UEK A;  2CG9 A;  5GME A;  4DUZ E;  4JI2 E;  4JI3 E;  2Z5B B;  2IOQ A;  4LF4 I;  1OJ4 A;  5A2Q Q;  2J7K A;  2O1U A;  4B3S I;  4K0K I;  3K85 A;  1WUU A;  2A2D A;  4GKJ I;  3QT5 A;  1Y4U A;  4WUC A;  4OX9 I;  4JI0 I;  3T1Y E;  4DV2 E;  1KVK A;  4JI1 E;  2HFU A;  1N33 I;  4PRX A;  1DAR A;  4X65 E;  3GON A;  2O1W A;  4LFC E;  3ZKB A;  1FKA E;  4WUB A;  1FNM A;  4JI7 E;  4YY3 E;  2UXD I;  4JG4 A;  2BM1 A;  1MX0 A;  2V2Z A;  4DR6 I;  4DV0 I;  1Z5C A;  3CWV A;  3PRY A;  1XNR E;  1HNX E;  4NXN E;  2E5L I;  2HK3 A;  2VQF I;  4B3R I;  5A2Q C;  4JI4 E;  2WW4 A;  4RPF A;  3WU5 A;  2CGE A;  4X62 E;  2Q2E B;  3K17 A;  4LFA E;  4PRV A;  3WU6 A;  3J7A G;  4JV5 E;  4HAC B;  2X36 A;  3B8H A;  1Y6Z A;  5L3J A;  5IWA I;  3M6A A;  4YHH E;  1N34 E;  5BR8 E;  4DV7 I;  4R1F A;  4JI6 E;  1J5E E;  4DPX A;  1PIE A;  1EA6 A;  1FWL A;  3J81 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...