4DR5I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr5I00
2E1RA 3Q1QA 4DV2I 2ZM6I 1Z0BA 2R3VA 4DR5I 4HACA 1NHIA 4LF6E 3J7AM 1EA6A 1J5EE 4LFBE 4JI3E 4XTJA 1H7SA 4LF4I 1D6TA 4DXLA 3ZKBA 4DUZI 4LFAE 4YHHE 2F4VI 3ZM7A 3JAMQ 1N32E 4NXME 1FJGE 1N36E 2DEIA 2UXBE 3ZZTA 1Z0VA 4P52A 4DV7I 5FLXQ 1Z5AA 4Z7CA 2XEXA 1H74A 4JV5E 2CZ9A 1VISA 1IBKI 4GKJI 4DV5E 4DR4E 4DV0E 1S16A 4USMA 4X64I 4LFCI 1XNQI 1S4EA 4DR2I 4B3TI 3T1HE 3J81C 3J7AG 5A2QQ 2HHHI 1HNWE 1XMQE 3ZZ0A 4DV1I 2ZBKB 4FWDA 1XNRI 4LF9I 4KQVA 2GS8A 4DV2E 4DR3I 4JI0I 4DU8A 4K0KI 1B63A 4B3RI 4KHPE 1IBLI 1ZXMA 3OTOE 4B3MI 4X66I 4JI6E 2UU9E 3ZKDA 3ZZUA 4LF7E 2HK3A 3WU4A 4DPUA 4RPFA 2VQFI 4LF4E 1ELOA 4DR7E 4P7AA 5GMDA 1N34I 1Z59A 4DR1E 3V2UC 4B3SE 1I94E 2LJPA 3J81Q 3JAMC 4DR6E 1NHJA 4JI5I 4JI1E 1Z0TA 1Z0EA 1ZM4A 5FLXC 4JYAE 3QT8A 5BR8I 4DR4I 4LF8E 2UXCI 1N33I 4X64E 1ZM3A 4B3TE 4HXZA 4DPTA 2UUAE 4AQYI 1ZM9A 4URLA 4JI7E 4DV6E 1HNWI 2V2VA 4LF9E 3HULA 4DR3E 4JI0E 4JG4A 4KHPI 4YY3E 3OTOI 4B3ME 1XHKA 1EI1A 1B62A 4LF6I 2UUCI 2AJ4A 2BM0A 1ZM2A 4DUZE 4ZVIA 4LFAI 1N34E 4WUBA 1N32I 1KIJA 1Z5CA 2VQEI 1PKPA 3D4JA 4MYUA 2V8PA 4GKKE 4DPYA 4JI5E 4JI1I 1OJ4A 1FKAE 4X65E 1FI4A 3PYDA 1FWLA 1MG7A 4DV0I 1U2RA 3V5RA 5LMNE 1XNQE 4JI7I 4FW9A 4FN5A 3T1HI 1ZXNA 2V2ZA 1Z0CA 4DV1E 1XNRE 4X62E 3H4LA 2ZITA 4JI2E 1PIEA 3PYGA 4K0KE 4EMDA 4B3RE 5LMUE 1IBLE 4JI6I 1HNZI 3PYFA 2UU9I 4JI8E 3K1JA 2DEJA 2UUCE 2WW4A 1H72C 1XMOI 4LF7I 2HKJA 1HR0I 1IBME 2OI2A 2V2QA 5IT9C 2X7IA 3LPSA 2BM1A 2VQEE 5L3JA 3T1YE 3B78A 4M1KA 1KKHA 2HK2A 4JI4E 2UXDE 4LF5I 2HFUA 4B3SI 1FNMA 1I94I 2R42A 4WUDA 5GMEA 4OX9I 4DR5E 1H7UA 4USKA 2NPFA 4UTGA 2J7KA 4LFBI 2BV3A 4DV4I 4FWGA 2V34A 4HACB 3WU5A 1KTVA 4DU7A 4YHHI 2F4VE 4PU9A 1N36I 4DUYE 4DV6I 4HYMA 1FWKA 3QT7A 1KVKA 4R1FA 1A6FA 4DV7E 4X62I 3QT5A 4JI2I 4DPWA 2A2CA 4YY3I 5LMUI 1HNZE 1IBKE 5IWAE 3K17A 2A2DA 1DARA 4NXNE 4LFCE 3J80Q 1HNXE 4MYTA 1K47A 2EFGA 2Q2EB 3T1YI 1QZRA 4I3HA 4DV3I 1N0VC 1N0UA 1RREA 2UUBE 4JI4I 2UXDI 3QT6A 3B8HA 2E5LE 5IT9Q 1Z5BA 2ZM6E 3F0NA 1Z0GA 4GKKI 1WUUA 4OX9E 4X66E 5LL6R 4FWHA 4WUCA 4ED4A 4X65I 2VQFE 1J5EI 4DV4E 1Z0WA 4JI3I 4DR7I 3GONA 2HFSA 1MU5A 5LMNI 1RR9A 4DUYI 4NXMI 1FJGI 2HKEA 4DPXA 3LTOA 4Z7YA 4DR1I 2UXBI 2X36A 3J80C 4HY1A 2VF3A 4DR6I 4PRVA 1MX0A 3CWVA 1H73A 5A2QC 4JV5I 4JI8I 3PYEA 3WU6A 5IWAI 4JYAI 3LNUA 1XMOE 5BR8E 1NZ0A 4LF8I 2UXCE 1N33E 4GKJE 4NXNI 4DV5I 1HR0E 1HNXI 1IBMI 2UUAI 4AQYE 4DR2E 4UT4A 3WU3A 4DV3E 4PRXA 2HHHE 1BKNA 2UUBI 3M6AA 1XMQI 1UEKA 3B82A 1PVGA 1NHHA 4LF5E 2E5LI
chains in the Genus database with same CATH superfamily
2E1RA 3Q1QA 5JEAC 4DV2I 2PO0B 2ZM6I 1Z0BA 2NN6E 2R3VA 4DR5I 1R6LA 4HACA 1NHIA 4LF6E 3J7AM 1EA6A 4IFDA 1J5EE 4LFBE 4JI3E 4XTJA 4OO1E 1H7SA 4LF4I 1D6TA 3HJCA 4DXLA 3ZKBA 4DUZI 3KRNA 5K36F 4LFAE 4YHHE 2F4VI 3ZM7A 3JAMQ 1N32E 4NXME 1FJGE 1N36E 4MU0A 2CG9A 5ELWA 2J65A 2DEIA 2UXBE 5K36B 3Q6MA 3ZZTA 3L7ZA 2Z5BB 1Z0VA 4P52A 4DV7I 5FLXQ 4FW4A 1E3HA 5DNXA 1Z5AA 2NN6B 5JEAB 4Z7CA 2XEXA 1H74A 5C0XE 4JV5E 2CZ9A 4BA1B 3B4TA 1VISA 1IBKI 2PO1A 2WNRB 4OZEA 4DV5E 4GKJI 2PO2B 4DR4E 4DV0E 1S16A 4QNKA 4USMA 4X64I 4LFCI 1XNQI 1S4EA 4DR2I 4B3TI 1YHCA 3T1HE 3J81C 3M85G 3J7AG 5A2QQ 4IZJD 2HHHI 2PNLA 1HNWE 1XMQE 3ZZ0A 4DV1I 5EKWA 2ZBKB 3U1KA 4FWDA 1Y6ZA 1XNRI 4LF9I 4KQVA 2GS8A 4DV2E 4QNJA 4DR3I 4IFDC 4JI0I 4DU8A 4K0KI 1B63A 4B3RI 4KHPE 1IBLI 1ZXMA 3OTOE 4B3MI 4X66I 4JI6E 2UU9E 2C38B 3HKMA 3ZKDA 3ZZUA 4LF7E 2HK3A 3WU4A 3PS2A 4DPUA 2VESA 4LCGA 4RPFA 2VQFI 4LF4E 1ELOA 4FW6A 4DR7E 4J3DA 3UHMA 4P7AA 2IESA 5GMDA 2AE8A 4FW3A 1N34I 4IS9A 1Z59A 4DR1E 3V2UC 4B3SE 1I94E 2LJPA 3CDIA 3J81Q 5K36C 3JAMC 2C39A 4DR6E 4IFDB 1NHJA 4JI5I 5K36D 4JI1E 2GO4A 2JE6B 2BR2A 4OO1A 4U3BA 1Z0TA 1Z0EA 2GQ0A 1ZM4A 5FLXC 4JYAE 1HK7A 3QT8A 2NN6C 5BR8I 4DR4I 4LF8E 2UXCI 5DRRA 1N33I 4OO1F 4X64E 2PNZA 1ZM3A 4B3TE 1UDNA 4HXZA 4DPTA 4ISAA 2UUAE 4AQYI 2BA1G 1ZM9A 4URLA 4JI7E 4DV6E 1HNWI 1RHYA 1OYRA 2V2VA 4FW5A 4LF9E 3M7NG 3HULA 4MDTA 4DR3E 4JI0E 4JG4A 2CGEA 4KHPI 4YY3E 4IFDE 3OTOI 4B3ME 5DRQA 3GLLA 2PO1B 1OYSA 1XHKA 1EI1A 1B62A 3GMEA 3PRYA 4LF6I 2UUCI 5C0XC 5DROA 2C37A 2AJ4A 5C0XA 2BM0A 4BA2B 1ZM2A 4DUZE 4ZVIA 5K36A 2WP8B 4LFAI 3L7ZB 2Z5BA 1N34E 4WUBA 3Q6NA 1N32I 1KIJA 2CVEA 1Z5CA 2VQEI 1PKPA 3D4JA 1USVA 4MYUA 2V8PA 4AM3A 4GKKE 2C38A 1VI7A 1XXEA 4DPYA 4JI5E 1UDOA 4JI1I 5JEAF 1OJ4A 1FKAE 4X65E 1FI4A 3PYDA 5DRPA 5K36E 1FWLA 2JT2A 2PO0A 3CDJA 1MG7A 4DV0I 1U2RA 2Z5CB 1UDSA 3V5RA 5LMNE 1XNQE 4JI7I 4FW9A 4FN5A 3T1HI 2JEAB 5JEAE 1ZXNA 2V2ZA 1Z0CA 4IZKA 4DV1E 2C39B 1XNRE 4IZJA 1UDQA 3P76A 4NBQA 4X62E 3H4LA 2ZITA 5EL9A 2JE6A 2JEBA 2O1WA 4JI2E 4LCFA 1PIEA 3PYGA 4OO1D 4K0KE 4EMDA 4B3RE 4MU1A 2F1DA 1Y4UA 5LMUE 1IBLE 4JI6I 1HNZI 3PYFA 2UU9I 4JI8E 1E3PA 3K1JA 2DEJA 2UUCE 2WW4A 1H72C 1XMOI 4LF7I 4U3DA 2HKJA 1HR0I 1IBME 2OI2A 2V2QA 4AIDA 1USUA 5IT9C 2X7IA 3LPSA 2BM1A 2VQEE 5L3JA 3T1YE 2BA0G 3B78A 4M1KA 1KKHA 2HK2A 3DD6A 4JI4E 2UXDE 4LF5I 3K85A 2HFUA 4B3SI 1FNMA 1I94I 2PO2A 2R42A 4WUDA 5GMEA 3M85D 3PS1A 4OX9I 4DR5E 1H7UA 4MU3A 4USKA 2NPFA 4IFDD 4UTGA 4LOMA 2J7KA 5DNLA 4LFBI 2BV3A 4DV4I 4FWGA 2V34A 4HACB 1Y60A 3WU5A 1KTVA 4DU7A 2O1UA 4YHHI 2F4VE 4PU9A 3P3CA 2NN6A 1N36I 5JEAA 4DUYE 4DV6I 5JEAD 4HYMA 1FWKA 3QT7A 1KVKA 4R1FA 1A6FA 4DV7E 4X62I 3QT5A 2IERA 3P3GA 4JI2I 2BA0D 4DPWA 2A2CA 2O1TA 4YY3I 4GQUA 5LMUI 1HNZE 2C37B 5C0XB 2BA1D 5IWAE 1Y5YA 1IBKE 4OO1C 3K17A 2GO3A 2A2DA 1DARA 4NXNE 4LFCE 5C0XF 3J80Q 2IOPA 1HNXE 4MYTA 4AIMA 2PNMA 4IZKB 4LPFA 1K47A 2EFGA 4IZJB 2Q2EB 3T1YI 1QZRA 1Y4SA 5FWKA 4I3HA 4DV3I 1N0VC 1OYPA 1N0UA 1RREA 2UUBE 4JI4I 2UXDI 3P3EA 4LCHA 4IFDF 3QT6A 3B8HA 2E5LE 5IT9Q 1Z5BA 2ZM6E 3F0NA 1Z0GA 4GKKI 1WUUA 4OX9E 2NN6D 4X66E 5LL6R 4FWHA 4WUCA 3U1YA 4ED4A 4X65I 2Z5CA 2VQFE 1J5EI 4DV4E 1Z0WA 4JI3I 4DR7I 1YH8A 4BA1A 3GONA 2HFSA 1MU5A 5LMNI 2WNRA 1RR9A 4DUYI 4NXMI 1FJGI 3GCMA 2HKEA 4DPXA 3LTOA 4Z7YA 2JEBB 4DR1I 2Z5EA 2UXBI 2X36A 3J80C 4HY1A 2VF3A 4BA2A 3H1CA 5C0XD 2PNZB 4DR6I 4PRVA 2JEAA 4MU4A 2WP8A 1MX0A 3CWVA 3NZKA 4OKGA 3M7ND 1H73A 5A2QC 4JV5I 3P06A 4JI8I 3PYEA 3WU6A 5IWAI 4JYAI 3LNUA 1XMOE 2O3ZA 5BR8E 1NZ0A 4LF8I 1P42A 2UXCE 1N33E 4GKJE 2BR2B 4NXNI 4DV5I 4OO1B 1HR0E 2IOQA 1HNXI 1IBMI 2UUAI 4MQYA 4AQYE 3PS3A 4DR2E 2NN6F 4UT4A 3WU3A 4DV3E 2O1VA 4PRXA 2HHHE 1BKNA 2UUBI 1R6MA 3M6AA 1XMQI 1UEKA 4N3OA 3B82A 1PVGA 1NHHA 4LF5E 4FW7A 2E5LI
chains in the Genus database with same CATH topology
2E1RA 3Q1QA 4DV2I 2ZM6I 1Z0BA 2R3VA 4DR5I 4HACA 1NHIA 4LF6E 3J7AM 1EA6A 1J5EE 4LFBE 4JI3E 4XTJA 1H7SA 4LF4I 1D6TA 3HJCA 4DXLA 3ZKBA 4DUZI 4LFAE 4YHHE 2F4VI 3ZM7A 3JAMQ 1N32E 4NXME 1FJGE 1N36E 2CG9A 2DEIA 2UXBE 3Q6MA 3ZZTA 2Z5BB 1Z0VA 4P52A 4DV7I 5FLXQ 1Z5AA 4Z7CA 2XEXA 1H74A 4JV5E 2CZ9A 1VISA 1IBKI 4GKJI 4DV5E 4DR4E 4DV0E 1S16A 4USMA 4X64I 4LFCI 1XNQI 1S4EA 4DR2I 4B3TI 3T1HE 3J81C 3J7AG 5A2QQ 4IZJD 2HHHI 2PNLA 1HNWE 1XMQE 3ZZ0A 4DV1I 2ZBKB 4FWDA 1Y6ZA 1XNRI 4LF9I 4KQVA 2GS8A 4DV2E 4DR3I 4JI0I 4DU8A 4K0KI 1B63A 4B3RI 4KHPE 1IBLI 1ZXMA 3OTOE 4B3MI 4X66I 4JI6E 2UU9E 3ZKDA 3ZZUA 4LF7E 2HK3A 3WU4A 4DPUA 4RPFA 2VQFI 4LF4E 1ELOA 4DR7E 4P7AA 5GMDA 1N34I 1Z59A 4DR1E 3V2UC 4B3SE 1I94E 2LJPA 3J81Q 3JAMC 4DR6E 1NHJA 4JI5I 4JI1E 1Z0TA 1Z0EA 2GQ0A 1ZM4A 5FLXC 4JYAE 1HK7A 3QT8A 5BR8I 4DR4I 4LF8E 2UXCI 1N33I 4X64E 1ZM3A 4B3TE 4HXZA 4DPTA 2UUAE 4AQYI 1ZM9A 4URLA 4JI7E 4DV6E 1HNWI 2V2VA 4LF9E 3HULA 4DR3E 4JI0E 4JG4A 2CGEA 4KHPI 4YY3E 3OTOI 4B3ME 1XHKA 1EI1A 1B62A 3PRYA 4LF6I 2UUCI 2AJ4A 2BM0A 1ZM2A 4DUZE 4ZVIA 4LFAI 1N34E 2Z5BA 4WUBA 3Q6NA 1N32I 1KIJA 1Z5CA 2VQEI 1PKPA 3D4JA 1USVA 4MYUA 2V8PA 4GKKE 4DPYA 4JI5E 4JI1I 1OJ4A 1FKAE 4X65E 1FI4A 3PYDA 1FWLA 1MG7A 4DV0I 1U2RA 2Z5CB 3V5RA 5LMNE 1XNQE 4JI7I 4FW9A 4FN5A 3T1HI 1ZXNA 2V2ZA 1Z0CA 4IZKA 4DV1E 1XNRE 4IZJA 4X62E 3H4LA 2ZITA 2O1WA 4JI2E 1PIEA 3PYGA 4K0KE 4EMDA 4B3RE 1Y4UA 5LMUE 1IBLE 4JI6I 1HNZI 3PYFA 2UU9I 4JI8E 3K1JA 2DEJA 2UUCE 2WW4A 1H72C 1XMOI 4LF7I 2HKJA 1HR0I 1IBME 2OI2A 2V2QA 1USUA 5IT9C 2X7IA 3LPSA 2BM1A 2VQEE 5L3JA 3T1YE 3B78A 4M1KA 1KKHA 2HK2A 4JI4E 2UXDE 4LF5I 3K85A 2HFUA 4B3SI 1FNMA 1I94I 2R42A 4WUDA 5GMEA 4OX9I 4DR5E 1H7UA 4USKA 2NPFA 4UTGA 2J7KA 4LFBI 2BV3A 4DV4I 4FWGA 2V34A 4HACB 3WU5A 1KTVA 4DU7A 2O1UA 4YHHI 2F4VE 4PU9A 1N36I 4DUYE 4DV6I 4HYMA 1FWKA 3QT7A 1KVKA 4R1FA 1A6FA 4DV7E 4X62I 3QT5A 4JI2I 4DPWA 2A2CA 2O1TA 4YY3I 5LMUI 1HNZE 1IBKE 5IWAE 3K17A 2A2DA 1DARA 4NXNE 4LFCE 3J80Q 2IOPA 1HNXE 4MYTA 2PNMA 4IZKB 1K47A 2EFGA 4IZJB 2Q2EB 3T1YI 1QZRA 1Y4SA 5FWKA 4I3HA 4DV3I 1N0VC 1N0UA 1RREA 2UUBE 4JI4I 2UXDI 3QT6A 3B8HA 2E5LE 5IT9Q 1Z5BA 2ZM6E 3F0NA 1Z0GA 4GKKI 1WUUA 4OX9E 4X66E 5LL6R 4FWHA 4WUCA 4ED4A 4X65I 2Z5CA 2VQFE 1J5EI 4DV4E 1Z0WA 4JI3I 4DR7I 3GONA 2HFSA 1MU5A 5LMNI 1RR9A 4DUYI 4NXMI 1FJGI 2HKEA 4DPXA 3LTOA 4Z7YA 4DR1I 2Z5EA 2UXBI 2X36A 3J80C 4HY1A 2VF3A 4DR6I 4PRVA 1MX0A 3CWVA 1H73A 5A2QC 4JV5I 3P06A 4JI8I 3PYEA 3WU6A 5IWAI 4JYAI 3LNUA 1XMOE 5BR8E 1NZ0A 4LF8I 2UXCE 1N33E 4GKJE 4NXNI 4DV5I 1HR0E 2IOQA 1HNXI 1IBMI 2UUAI 4AQYE 4DR2E 4UT4A 3WU3A 4DV3E 2O1VA 4PRXA 2HHHE 1BKNA 2UUBI 3M6AA 1XMQI 1UEKA 4N3OA 3B82A 1PVGA 1NHHA 4LF5E 2E5LI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1R A;  3Q1Q A;  4DV2 I;  2ZM6 I;  1Z0B A;  2R3V A;  4DR5 I;  4HAC A;  1NHI A;  4LF6 E;  3J7A M;  1EA6 A;  1J5E E;  4LFB E;  4JI3 E;  4XTJ A;  1H7S A;  4LF4 I;  1D6T A;  4DXL A;  3ZKB A;  4DUZ I;  4LFA E;  4YHH E;  2F4V I;  3ZM7 A;  3JAM Q;  1N32 E;  4NXM E;  1FJG E;  1N36 E;  2DEI A;  2UXB E;  3ZZT A;  1Z0V A;  4P52 A;  4DV7 I;  5FLX Q;  1Z5A A;  4Z7C A;  2XEX A;  1H74 A;  4JV5 E;  2CZ9 A;  1VIS A;  1IBK I;  4GKJ I;  4DV5 E;  4DR4 E;  4DV0 E;  1S16 A;  4USM A;  4X64 I;  4LFC I;  1XNQ I;  1S4E A;  4DR2 I;  4B3T I;  3T1H E;  3J81 C;  3J7A G;  5A2Q Q;  2HHH I;  1HNW E;  1XMQ E;  3ZZ0 A;  4DV1 I;  2ZBK B;  4FWD A;  1XNR I;  4LF9 I;  4KQV A;  2GS8 A;  4DV2 E;  4DR3 I;  4JI0 I;  4DU8 A;  4K0K I;  1B63 A;  4B3R I;  4KHP E;  1IBL I;  1ZXM A;  3OTO E;  4B3M I;  4X66 I;  4JI6 E;  2UU9 E;  3ZKD A;  3ZZU A;  4LF7 E;  2HK3 A;  3WU4 A;  4DPU A;  4RPF A;  2VQF I;  4LF4 E;  1ELO A;  4DR7 E;  4P7A A;  5GMD A;  1N34 I;  1Z59 A;  4DR1 E;  3V2U C;  4B3S E;  1I94 E;  2LJP A;  3J81 Q;  3JAM C;  4DR6 E;  1NHJ A;  4JI5 I;  4JI1 E;  1Z0T A;  1Z0E A;  1ZM4 A;  5FLX C;  4JYA E;  3QT8 A;  5BR8 I;  4DR4 I;  4LF8 E;  2UXC I;  1N33 I;  4X64 E;  1ZM3 A;  4B3T E;  4HXZ A;  4DPT A;  2UUA E;  4AQY I;  1ZM9 A;  4URL A;  4JI7 E;  4DV6 E;  1HNW I;  2V2V A;  4LF9 E;  3HUL A;  4DR3 E;  4JI0 E;  4JG4 A;  4KHP I;  4YY3 E;  3OTO I;  4B3M E;  1XHK A;  1EI1 A;  1B62 A;  4LF6 I;  2UUC I;  2AJ4 A;  2BM0 A;  1ZM2 A;  4DUZ E;  4ZVI A;  4LFA I;  1N34 E;  4WUB A;  1N32 I;  1KIJ A;  1Z5C A;  2VQE I;  1PKP A;  3D4J A;  4MYU A;  2V8P A;  4GKK E;  4DPY A;  4JI5 E;  4JI1 I;  1OJ4 A;  1FKA E;  4X65 E;  1FI4 A;  3PYD A;  1FWL A;  1MG7 A;  4DV0 I;  1U2R A;  3V5R A;  5LMN E;  1XNQ E;  4JI7 I;  4FW9 A;  4FN5 A;  3T1H I;  1ZXN A;  2V2Z A;  1Z0C A;  4DV1 E;  1XNR E;  4X62 E;  3H4L A;  2ZIT A;  4JI2 E;  1PIE A;  3PYG A;  4K0K E;  4EMD A;  4B3R E;  5LMU E;  1IBL E;  4JI6 I;  1HNZ I;  3PYF A;  2UU9 I;  4JI8 E;  3K1J A;  2DEJ A;  2UUC E;  2WW4 A;  1H72 C;  1XMO I;  4LF7 I;  2HKJ A;  1HR0 I;  1IBM E;  2OI2 A;  2V2Q A;  5IT9 C;  2X7I A;  3LPS A;  2BM1 A;  2VQE E;  5L3J A;  3T1Y E;  3B78 A;  4M1K A;  1KKH A;  2HK2 A;  4JI4 E;  2UXD E;  4LF5 I;  2HFU A;  4B3S I;  1FNM A;  1I94 I;  2R42 A;  4WUD A;  5GME A;  4OX9 I;  4DR5 E;  1H7U A;  4USK A;  2NPF A;  4UTG A;  2J7K A;  4LFB I;  2BV3 A;  4DV4 I;  4FWG A;  2V34 A;  4HAC B;  3WU5 A;  1KTV A;  4DU7 A;  4YHH I;  2F4V E;  4PU9 A;  1N36 I;  4DUY E;  4DV6 I;  4HYM A;  1FWK A;  3QT7 A;  1KVK A;  4R1F A;  1A6F A;  4DV7 E;  4X62 I;  3QT5 A;  4JI2 I;  4DPW A;  2A2C A;  4YY3 I;  5LMU I;  1HNZ E;  1IBK E;  5IWA E;  3K17 A;  2A2D A;  1DAR A;  4NXN E;  4LFC E;  3J80 Q;  1HNX E;  4MYT A;  1K47 A;  2EFG A;  2Q2E B;  3T1Y I;  1QZR A;  4I3H A;  4DV3 I;  1N0V C;  1N0U A;  1RRE A;  2UUB E;  4JI4 I;  2UXD I;  3QT6 A;  3B8H A;  2E5L E;  5IT9 Q;  1Z5B A;  2ZM6 E;  3F0N A;  1Z0G A;  4GKK I;  1WUU A;  4OX9 E;  4X66 E;  5LL6 R;  4FWH A;  4WUC A;  4ED4 A;  4X65 I;  2VQF E;  1J5E I;  4DV4 E;  1Z0W A;  4JI3 I;  4DR7 I;  3GON A;  2HFS A;  1MU5 A;  5LMN I;  1RR9 A;  4DUY I;  4NXM I;  1FJG I;  2HKE A;  4DPX A;  3LTO A;  4Z7Y A;  4DR1 I;  2UXB I;  2X36 A;  3J80 C;  4HY1 A;  2VF3 A;  4DR6 I;  4PRV A;  1MX0 A;  3CWV A;  1H73 A;  5A2Q C;  4JV5 I;  4JI8 I;  3PYE A;  3WU6 A;  5IWA I;  4JYA I;  3LNU A;  1XMO E;  5BR8 E;  1NZ0 A;  4LF8 I;  2UXC E;  1N33 E;  4GKJ E;  4NXN I;  4DV5 I;  1HR0 E;  1HNX I;  1IBM I;  2UUA I;  4AQY E;  4DR2 E;  4UT4 A;  3WU3 A;  4DV3 E;  4PRX A;  2HHH E;  1BKN A;  2UUB I;  3M6A A;  1XMQ I;  1UEK A;  3B82 A;  1PVG A;  1NHH A;  4LF5 E;  2E5L I; 
#chains in the Genus database with same CATH topology
 2E1R A;  3Q1Q A;  5JEA C;  4DV2 I;  2PO0 B;  2ZM6 I;  1Z0B A;  2NN6 E;  2R3V A;  4DR5 I;  1R6L A;  4HAC A;  1NHI A;  4LF6 E;  3J7A M;  1EA6 A;  4IFD A;  1J5E E;  4LFB E;  4JI3 E;  4XTJ A;  4OO1 E;  1H7S A;  4LF4 I;  1D6T A;  3HJC A;  4DXL A;  3ZKB A;  4DUZ I;  3KRN A;  5K36 F;  4LFA E;  4YHH E;  2F4V I;  3ZM7 A;  3JAM Q;  1N32 E;  4NXM E;  1FJG E;  1N36 E;  4MU0 A;  2CG9 A;  5ELW A;  2J65 A;  2DEI A;  2UXB E;  5K36 B;  3Q6M A;  3ZZT A;  3L7Z A;  2Z5B B;  1Z0V A;  4P52 A;  4DV7 I;  5FLX Q;  4FW4 A;  1E3H A;  5DNX A;  1Z5A A;  2NN6 B;  5JEA B;  4Z7C A;  2XEX A;  1H74 A;  5C0X E;  4JV5 E;  2CZ9 A;  4BA1 B;  3B4T A;  1VIS A;  1IBK I;  2PO1 A;  2WNR B;  4OZE A;  4DV5 E;  4GKJ I;  2PO2 B;  4DR4 E;  4DV0 E;  1S16 A;  4QNK A;  4USM A;  4X64 I;  4LFC I;  1XNQ I;  1S4E A;  4DR2 I;  4B3T I;  1YHC A;  3T1H E;  3J81 C;  3M85 G;  3J7A G;  5A2Q Q;  4IZJ D;  2HHH I;  2PNL A;  1HNW E;  1XMQ E;  3ZZ0 A;  4DV1 I;  5EKW A;  2ZBK B;  3U1K A;  4FWD A;  1Y6Z A;  1XNR I;  4LF9 I;  4KQV A;  2GS8 A;  4DV2 E;  4QNJ A;  4DR3 I;  4IFD C;  4JI0 I;  4DU8 A;  4K0K I;  1B63 A;  4B3R I;  4KHP E;  1IBL I;  1ZXM A;  3OTO E;  4B3M I;  4X66 I;  4JI6 E;  2UU9 E;  2C38 B;  3HKM A;  3ZKD A;  3ZZU A;  4LF7 E;  2HK3 A;  3WU4 A;  3PS2 A;  4DPU A;  2VES A;  4LCG A;  4RPF A;  2VQF I;  4LF4 E;  1ELO A;  4FW6 A;  4DR7 E;  4J3D A;  3UHM A;  4P7A A;  2IES A;  5GMD A;  2AE8 A;  4FW3 A;  1N34 I;  4IS9 A;  1Z59 A;  4DR1 E;  3V2U C;  4B3S E;  1I94 E;  2LJP A;  3CDI A;  3J81 Q;  5K36 C;  3JAM C;  2C39 A;  4DR6 E;  4IFD B;  1NHJ A;  4JI5 I;  5K36 D;  4JI1 E;  2GO4 A;  2JE6 B;  2BR2 A;  4OO1 A;  4U3B A;  1Z0T A;  1Z0E A;  2GQ0 A;  1ZM4 A;  5FLX C;  4JYA E;  1HK7 A;  3QT8 A;  2NN6 C;  5BR8 I;  4DR4 I;  4LF8 E;  2UXC I;  5DRR A;  1N33 I;  4OO1 F;  4X64 E;  2PNZ A;  1ZM3 A;  4B3T E;  1UDN A;  4HXZ A;  4DPT A;  4ISA A;  2UUA E;  4AQY I;  2BA1 G;  1ZM9 A;  4URL A;  4JI7 E;  4DV6 E;  1HNW I;  1RHY A;  1OYR A;  2V2V A;  4FW5 A;  4LF9 E;  3M7N G;  3HUL A;  4MDT A;  4DR3 E;  4JI0 E;  4JG4 A;  2CGE A;  4KHP I;  4YY3 E;  4IFD E;  3OTO I;  4B3M E;  5DRQ A;  3GLL A;  2PO1 B;  1OYS A;  1XHK A;  1EI1 A;  1B62 A;  3GME A;  3PRY A;  4LF6 I;  2UUC I;  5C0X C;  5DRO A;  2C37 A;  2AJ4 A;  5C0X A;  2BM0 A;  4BA2 B;  1ZM2 A;  4DUZ E;  4ZVI A;  5K36 A;  2WP8 B;  4LFA I;  3L7Z B;  2Z5B A;  1N34 E;  4WUB A;  3Q6N A;  1N32 I;  1KIJ A;  2CVE A;  1Z5C A;  2VQE I;  1PKP A;  3D4J A;  1USV A;  4MYU A;  2V8P A;  4AM3 A;  4GKK E;  2C38 A;  1VI7 A;  1XXE A;  4DPY A;  4JI5 E;  1UDO A;  4JI1 I;  5JEA F;  1OJ4 A;  1FKA E;  4X65 E;  1FI4 A;  3PYD A;  5DRP A;  5K36 E;  1FWL A;  2JT2 A;  2PO0 A;  3CDJ A;  1MG7 A;  4DV0 I;  1U2R A;  2Z5C B;  1UDS A;  3V5R A;  5LMN E;  1XNQ E;  4JI7 I;  4FW9 A;  4FN5 A;  3T1H I;  2JEA B;  5JEA E;  1ZXN A;  2V2Z A;  1Z0C A;  4IZK A;  4DV1 E;  2C39 B;  1XNR E;  4IZJ A;  1UDQ A;  3P76 A;  4NBQ A;  4X62 E;  3H4L A;  2ZIT A;  5EL9 A;  2JE6 A;  2JEB A;  2O1W A;  4JI2 E;  4LCF A;  1PIE A;  3PYG A;  4OO1 D;  4K0K E;  4EMD A;  4B3R E;  4MU1 A;  2F1D A;  1Y4U A;  5LMU E;  1IBL E;  4JI6 I;  1HNZ I;  3PYF A;  2UU9 I;  4JI8 E;  1E3P A;  3K1J A;  2DEJ A;  2UUC E;  2WW4 A;  1H72 C;  1XMO I;  4LF7 I;  4U3D A;  2HKJ A;  1HR0 I;  1IBM E;  2OI2 A;  2V2Q A;  4AID A;  1USU A;  5IT9 C;  2X7I A;  3LPS A;  2BM1 A;  2VQE E;  5L3J A;  3T1Y E;  2BA0 G;  3B78 A;  4M1K A;  1KKH A;  2HK2 A;  3DD6 A;  4JI4 E;  2UXD E;  4LF5 I;  3K85 A;  2HFU A;  4B3S I;  1FNM A;  1I94 I;  2PO2 A;  2R42 A;  4WUD A;  5GME A;  3M85 D;  3PS1 A;  4OX9 I;  4DR5 E;  1H7U A;  4MU3 A;  4USK A;  2NPF A;  4IFD D;  4UTG A;  4LOM A;  2J7K A;  5DNL A;  4LFB I;  2BV3 A;  4DV4 I;  4FWG A;  2V34 A;  4HAC B;  1Y60 A;  3WU5 A;  1KTV A;  4DU7 A;  2O1U A;  4YHH I;  2F4V E;  4PU9 A;  3P3C A;  2NN6 A;  1N36 I;  5JEA A;  4DUY E;  4DV6 I;  5JEA D;  4HYM A;  1FWK A;  3QT7 A;  1KVK A;  4R1F A;  1A6F A;  4DV7 E;  4X62 I;  3QT5 A;  2IER A;  3P3G A;  4JI2 I;  2BA0 D;  4DPW A;  2A2C A;  2O1T A;  4YY3 I;  4GQU A;  5LMU I;  1HNZ E;  2C37 B;  5C0X B;  2BA1 D;  5IWA E;  1Y5Y A;  1IBK E;  4OO1 C;  3K17 A;  2GO3 A;  2A2D A;  1DAR A;  4NXN E;  4LFC E;  5C0X F;  3J80 Q;  2IOP A;  1HNX E;  4MYT A;  4AIM A;  2PNM A;  4IZK B;  4LPF A;  1K47 A;  2EFG A;  4IZJ B;  2Q2E B;  3T1Y I;  1QZR A;  1Y4S A;  5FWK A;  4I3H A;  4DV3 I;  1N0V C;  1OYP A;  1N0U A;  1RRE A;  2UUB E;  4JI4 I;  2UXD I;  3P3E A;  4LCH A;  4IFD F;  3QT6 A;  3B8H A;  2E5L E;  5IT9 Q;  1Z5B A;  2ZM6 E;  3F0N A;  1Z0G A;  4GKK I;  1WUU A;  4OX9 E;  2NN6 D;  4X66 E;  5LL6 R;  4FWH A;  4WUC A;  3U1Y A;  4ED4 A;  4X65 I;  2Z5C A;  2VQF E;  1J5E I;  4DV4 E;  1Z0W A;  4JI3 I;  4DR7 I;  1YH8 A;  4BA1 A;  3GON A;  2HFS A;  1MU5 A;  5LMN I;  2WNR A;  1RR9 A;  4DUY I;  4NXM I;  1FJG I;  3GCM A;  2HKE A;  4DPX A;  3LTO A;  4Z7Y A;  2JEB B;  4DR1 I;  2Z5E A;  2UXB I;  2X36 A;  3J80 C;  4HY1 A;  2VF3 A;  4BA2 A;  3H1C A;  5C0X D;  2PNZ B;  4DR6 I;  4PRV A;  2JEA A;  4MU4 A;  2WP8 A;  1MX0 A;  3CWV A;  3NZK A;  4OKG A;  3M7N D;  1H73 A;  5A2Q C;  4JV5 I;  3P06 A;  4JI8 I;  3PYE A;  3WU6 A;  5IWA I;  4JYA I;  3LNU A;  1XMO E;  2O3Z A;  5BR8 E;  1NZ0 A;  4LF8 I;  1P42 A;  2UXC E;  1N33 E;  4GKJ E;  2BR2 B;  4NXN I;  4DV5 I;  4OO1 B;  1HR0 E;  2IOQ A;  1HNX I;  1IBM I;  2UUA I;  4MQY A;  4AQY E;  3PS3 A;  4DR2 E;  2NN6 F;  4UT4 A;  3WU3 A;  4DV3 E;  2O1V A;  4PRX A;  2HHH E;  1BKN A;  2UUB I;  1R6M A;  3M6A A;  1XMQ I;  1UEK A;  4N3O A;  3B82 A;  1PVG A;  1NHH A;  4LF5 E;  4FW7 A;  2E5L I; 
#chains in the Genus database with same CATH homology
 2E1R A;  3Q1Q A;  4DV2 I;  2ZM6 I;  1Z0B A;  2R3V A;  4DR5 I;  4HAC A;  1NHI A;  4LF6 E;  3J7A M;  1EA6 A;  1J5E E;  4LFB E;  4JI3 E;  4XTJ A;  1H7S A;  4LF4 I;  1D6T A;  3HJC A;  4DXL A;  3ZKB A;  4DUZ I;  4LFA E;  4YHH E;  2F4V I;  3ZM7 A;  3JAM Q;  1N32 E;  4NXM E;  1FJG E;  1N36 E;  2CG9 A;  2DEI A;  2UXB E;  3Q6M A;  3ZZT A;  2Z5B B;  1Z0V A;  4P52 A;  4DV7 I;  5FLX Q;  1Z5A A;  4Z7C A;  2XEX A;  1H74 A;  4JV5 E;  2CZ9 A;  1VIS A;  1IBK I;  4GKJ I;  4DV5 E;  4DR4 E;  4DV0 E;  1S16 A;  4USM A;  4X64 I;  4LFC I;  1XNQ I;  1S4E A;  4DR2 I;  4B3T I;  3T1H E;  3J81 C;  3J7A G;  5A2Q Q;  4IZJ D;  2HHH I;  2PNL A;  1HNW E;  1XMQ E;  3ZZ0 A;  4DV1 I;  2ZBK B;  4FWD A;  1Y6Z A;  1XNR I;  4LF9 I;  4KQV A;  2GS8 A;  4DV2 E;  4DR3 I;  4JI0 I;  4DU8 A;  4K0K I;  1B63 A;  4B3R I;  4KHP E;  1IBL I;  1ZXM A;  3OTO E;  4B3M I;  4X66 I;  4JI6 E;  2UU9 E;  3ZKD A;  3ZZU A;  4LF7 E;  2HK3 A;  3WU4 A;  4DPU A;  4RPF A;  2VQF I;  4LF4 E;  1ELO A;  4DR7 E;  4P7A A;  5GMD A;  1N34 I;  1Z59 A;  4DR1 E;  3V2U C;  4B3S E;  1I94 E;  2LJP A;  3J81 Q;  3JAM C;  4DR6 E;  1NHJ A;  4JI5 I;  4JI1 E;  1Z0T A;  1Z0E A;  2GQ0 A;  1ZM4 A;  5FLX C;  4JYA E;  1HK7 A;  3QT8 A;  5BR8 I;  4DR4 I;  4LF8 E;  2UXC I;  1N33 I;  4X64 E;  1ZM3 A;  4B3T E;  4HXZ A;  4DPT A;  2UUA E;  4AQY I;  1ZM9 A;  4URL A;  4JI7 E;  4DV6 E;  1HNW I;  2V2V A;  4LF9 E;  3HUL A;  4DR3 E;  4JI0 E;  4JG4 A;  2CGE A;  4KHP I;  4YY3 E;  3OTO I;  4B3M E;  1XHK A;  1EI1 A;  1B62 A;  3PRY A;  4LF6 I;  2UUC I;  2AJ4 A;  2BM0 A;  1ZM2 A;  4DUZ E;  4ZVI A;  4LFA I;  1N34 E;  2Z5B A;  4WUB A;  3Q6N A;  1N32 I;  1KIJ A;  1Z5C A;  2VQE I;  1PKP A;  3D4J A;  1USV A;  4MYU A;  2V8P A;  4GKK E;  4DPY A;  4JI5 E;  4JI1 I;  1OJ4 A;  1FKA E;  4X65 E;  1FI4 A;  3PYD A;  1FWL A;  1MG7 A;  4DV0 I;  1U2R A;  2Z5C B;  3V5R A;  5LMN E;  1XNQ E;  4JI7 I;  4FW9 A;  4FN5 A;  3T1H I;  1ZXN A;  2V2Z A;  1Z0C A;  4IZK A;  4DV1 E;  1XNR E;  4IZJ A;  4X62 E;  3H4L A;  2ZIT A;  2O1W A;  4JI2 E;  1PIE A;  3PYG A;  4K0K E;  4EMD A;  4B3R E;  1Y4U A;  5LMU E;  1IBL E;  4JI6 I;  1HNZ I;  3PYF A;  2UU9 I;  4JI8 E;  3K1J A;  2DEJ A;  2UUC E;  2WW4 A;  1H72 C;  1XMO I;  4LF7 I;  2HKJ A;  1HR0 I;  1IBM E;  2OI2 A;  2V2Q A;  1USU A;  5IT9 C;  2X7I A;  3LPS A;  2BM1 A;  2VQE E;  5L3J A;  3T1Y E;  3B78 A;  4M1K A;  1KKH A;  2HK2 A;  4JI4 E;  2UXD E;  4LF5 I;  3K85 A;  2HFU A;  4B3S I;  1FNM A;  1I94 I;  2R42 A;  4WUD A;  5GME A;  4OX9 I;  4DR5 E;  1H7U A;  4USK A;  2NPF A;  4UTG A;  2J7K A;  4LFB I;  2BV3 A;  4DV4 I;  4FWG A;  2V34 A;  4HAC B;  3WU5 A;  1KTV A;  4DU7 A;  2O1U A;  4YHH I;  2F4V E;  4PU9 A;  1N36 I;  4DUY E;  4DV6 I;  4HYM A;  1FWK A;  3QT7 A;  1KVK A;  4R1F A;  1A6F A;  4DV7 E;  4X62 I;  3QT5 A;  4JI2 I;  4DPW A;  2A2C A;  2O1T A;  4YY3 I;  5LMU I;  1HNZ E;  1IBK E;  5IWA E;  3K17 A;  2A2D A;  1DAR A;  4NXN E;  4LFC E;  3J80 Q;  2IOP A;  1HNX E;  4MYT A;  2PNM A;  4IZK B;  1K47 A;  2EFG A;  4IZJ B;  2Q2E B;  3T1Y I;  1QZR A;  1Y4S A;  5FWK A;  4I3H A;  4DV3 I;  1N0V C;  1N0U A;  1RRE A;  2UUB E;  4JI4 I;  2UXD I;  3QT6 A;  3B8H A;  2E5L E;  5IT9 Q;  1Z5B A;  2ZM6 E;  3F0N A;  1Z0G A;  4GKK I;  1WUU A;  4OX9 E;  4X66 E;  5LL6 R;  4FWH A;  4WUC A;  4ED4 A;  4X65 I;  2Z5C A;  2VQF E;  1J5E I;  4DV4 E;  1Z0W A;  4JI3 I;  4DR7 I;  3GON A;  2HFS A;  1MU5 A;  5LMN I;  1RR9 A;  4DUY I;  4NXM I;  1FJG I;  2HKE A;  4DPX A;  3LTO A;  4Z7Y A;  4DR1 I;  2Z5E A;  2UXB I;  2X36 A;  3J80 C;  4HY1 A;  2VF3 A;  4DR6 I;  4PRV A;  1MX0 A;  3CWV A;  1H73 A;  5A2Q C;  4JV5 I;  3P06 A;  4JI8 I;  3PYE A;  3WU6 A;  5IWA I;  4JYA I;  3LNU A;  1XMO E;  5BR8 E;  1NZ0 A;  4LF8 I;  2UXC E;  1N33 E;  4GKJ E;  4NXN I;  4DV5 I;  1HR0 E;  2IOQ A;  1HNX I;  1IBM I;  2UUA I;  4AQY E;  4DR2 E;  4UT4 A;  3WU3 A;  4DV3 E;  2O1V A;  4PRX A;  2HHH E;  1BKN A;  2UUB I;  3M6A A;  1XMQ I;  1UEK A;  4N3O A;  3B82 A;  1PVG A;  1NHH A;  4LF5 E;  2E5L I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...