4DR5I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr5I00
4JI6I 1HNWE 4JI2I 4AQYE 5L3JA 1N32I 4JI5E 3J80Q 5A2QC 1HNWI 1Z0VA 3QT8A 4DV2I 1Z5BA 1XNRE 4B3TI 2XEXA 2J7KA 2ZITA 4ZVIA 4KHPE 4DV0I 4JI7E 3K1JA 3ZKBA 2R3VA 1S4EA 4URLA 2A2CA 2DEIA 2X7IA 1ZM3A 1I94E 2OI2A 4DR5E 4DUZI 5FLXC 2UUAI 4LF5I 4DR7I 4AQYI 4B3RE 4YY3E 4LF9E 4JI1I 4JI1E 2EFGA 2CZ9A 5IT9Q 3OTOE 5LMUI 3WU4A 3PYFA 4DPXA 4JI2E 4RPFA 2HFUA 3T1YE 3T1HE 4YHHI 2ZM6E 1KVKA 2A2DA 2UU9I 1FWLA 1MG7A 4JI8I 1KKHA 4Z7CA 4LF7I 4DV3I 3D4JA 4LFAE 2VF3A 5BR8E 1HNZI 1MX0A 3J7AM 4MYTA 4USKA 1N36E 4JYAE 3QT5A 3JAMQ 4K0KE 1FWKA 1B63A 1Z5AA 3ZZ0A 3ZM7A 4P52A 1D6TA 1B62A 5IWAI 2Q2EB 4JI5I 1XNQE 4DU8A 2HKJA 3J7AG 1H72C 3WU5A 4EMDA 1ZM9A 3HULA 1HR0E 1N33I 1XMOI 4JI6E 3QT7A 3PYDA 4I3HA 4DR1E 1XMQE 4DV5I 1NHJA 2GS8A 4X65I 1IBLI 3M6AA 2X36A 2UU9E 4DV7E 1IBKE 4LFBE 5LMNE 1Z0GA 4X65E 4DV4E 1H73A 4DR1I 2V2QA 3J80C 2UUBE 4NXMI 4LFCE 1FNMA 4JI0I 4JV5E 4DUYE 3WU3A 4DR3I 4X62E 4DU7A 1N0VC 1H7UA 1PVGA 3B78A 4DR2E 4LF5E 2E1RA 1QZRA 4JI3I 1DARA 4PU9A 4NXME 1I94I 2ZBKB 4FW9A 1FKAE 3J81Q 2E5LE 3H4LA 1KTVA 5BR8I 4LF7E 2VQEI 4LF6E 4X66I 5LMNI 4KHPI 1Z0EA 4PRXA 1ZM4A 5IT9C 1IBLE 3ZZUA 4X64E 1FJGI 4XTJA 1ZXNA 1XMQI 4LF4E 2R42A 4GKJE 1IBME 3J81C 4WUDA 1RR9A 1H7SA 1N32E 5FLXQ 2BM1A 1K47A 5GMEA 3OTOI 2HHHI 4DV1I 4HXZA 1H74A 4GKJI 2UXCE 4WUBA 2UUAE 4YY3I 4LF9I 4DR5I 4UT4A 2NPFA 2DEJA 3PYGA 1FI4A 2V34A 1Z0BA 1N36I 4JYAI 3PYEA 4DUZE 2V2ZA 2VQFE 4X66E 4KQVA 4JI7I 2V2VA 4PRVA 2VQEE 4LF6I 1OJ4A 3WU6A 4DPWA 3Q1QA 4DV3E 2HFSA 5A2QQ 4HACB 4DV0E 1NHHA 3LTOA 3T1YI 1Z0CA 2HHHE 1WUUA 1NZ0A 1UEKA 1VISA 2UUBI 4OX9I 4NXNI 4NXNE 2LJPA 4LF4I 4DV1E 4HYMA 5LL6R 4DV6I 1XHKA 1IBMI 4DR7E 3B8HA 3JAMC 4JI4E 4DV7I 4DR4I 1HNXE 3GONA 2UXDI 4B3ME 3ZKDA 3LNUA 3V5RA 3F0NA 2WW4A 1XMOE 4B3SI 2UXBE 2F4VI 1XNQI 4DR6E 1BKNA 3V2UC 4DR2I 2HK3A 1Z5CA 1N34I 4DXLA 2HK2A 4HY1A 1XNRI 4FN5A 4LFCI 4DV2E 1N34E 3K17A 2UXCI 4DR6I 4USMA 5GMDA 1Z0WA 2UXBI 2V8PA 4FWDA 4GKKE 1IBKI 1KIJA 4HACA 4DV4I 4X64I 1PKPA 1FJGE 2HKEA 2BM0A 4DV5E 4UTGA 4LFBI 4YHHE 2ZM6I 4LF8I 1EI1A 4R1FA 1MU5A 4JG4A 2UUCE 4Z7YA 1S16A 5IWAE 4FWGA 4ED4A 1PIEA 1HR0I 1N33E 4OX9E 2E5LI 4GKKI 4B3RI 1J5EE 4WUCA 4FWHA 1RREA 1Z0TA 1NHIA 4JI3E 1Z59A 4K0KI 4X62I 1U2RA 4DR3E 4DUYI 4JI0E 4JV5I 4DPUA 1J5EI 1ELOA 2AJ4A 3CWVA 2F4VE 1HNZE 4B3SE 2UUCI 4JI8E 2VQFI 2BV3A 2UXDE 3B82A 4DPTA 4LF8E 4LFAI 3LPSA 3ZZTA 1HNXI 4JI4I 4DR4E 3T1HI 1ZXMA 1EA6A 1A6FA 4B3TE 1ZM2A 4DPYA 4B3MI 1N0UA 4P7AA 4DV6E 4MYUA 5LMUE 3QT6A 4M1KA
chains in the Genus database with same CATH superfamily
4JI6I 1R6LA 2IOQA 1HNWE 2BA1D 4MU4A 4BA1A 4JI2I 4AQYE 5L3JA 1N32I 4JI5E 3J80Q 2WP8A 2C39B 5A2QC 1HNWI 1Z0VA 2O1UA 3QT8A 4U3BA 4DV2I 1Z5BA 2JEAB 2PO1A 1XNRE 2WP8B 4B3TI 4MU1A 2XEXA 2JT2A 2GO4A 2J7KA 2ZITA 2CGEA 4ZVIA 4KHPE 1Y6ZA 4JI7E 3K1JA 4DV0I 3ZKBA 4QNKA 2C38A 2PO0B 4LCHA 2R3VA 1S4EA 4URLA 5DRPA 4BA2B 2A2CA 2DEIA 2X7IA 3CDJA 3CDIA 4IS9A 1ZM3A 2NN6F 1I94E 2OI2A 5K36D 1YHCA 4DR5E 4DUZI 4MU0A 4MQYA 5FLXC 2UUAI 4LF5I 1XXEA 4DR7I 3M85D 4AQYI 5K36A 4LCFA 4U3DA 4B3RE 4YY3E 4LF9E 4JI1I 4JI1E 2Z5BB 2EFGA 2CZ9A 5EL9A 5IT9Q 3OTOE 5LMUI 3WU4A 3PYFA 4DPXA 2Z5CB 2PO2B 4JI2E 4RPFA 2IESA 1R6MA 2HFUA 3T1YE 3T1HE 4YHHI 2ZM6E 5FWKA 1KVKA 2A2DA 2UU9I 1UDOA 1FWLA 1MG7A 4JI8I 5K36E 1KKHA 4Z7CA 4LF7I 2J65A 4DV3I 3D4JA 4OKGA 2CVEA 4LFAE 2VF3A 2PO2A 5BR8E 1HNZI 1MX0A 3J7AM 4MYTA 4USKA 1N36E 4JYAE 2O1WA 2O1VA 3PS2A 2JEBA 3QT5A 2Z5EA 1Y5YA 3JAMQ 2PO1B 1FWKA 4K0KE 1B63A 5JEAF 1Z5AA 3ZZ0A 3L7ZB 3ZM7A 4P52A 2JEBB 1D6TA 5JEAA 2PNLA 4LCGA 1B62A 2JEAA 1Y4SA 5IWAI 2Q2EB 3M7NG 4JI5I 1XNQE 4MU3A 2C37B 4DU8A 2HKJA 5DNLA 3HKMA 3J7AG 1H72C 3WU5A 4EMDA 1ZM9A 3HULA 1HR0E 3PS3A 1N33I 1XMOI 4JI6E 1E3HA 5EKWA 3QT7A 3PYDA 4I3HA 4DR1E 1XMQE 4DV5I 3P06A 1NHJA 1YH8A 1USUA 2GS8A 4X65I 1IBLI 3M6AA 2X36A 4FW4A 2UU9E 4DV7E 1IBKE 4LFBE 5JEAE 5LMNE 1Z0GA 4X65E 4DV4E 5DRQA 1H73A 4DR1I 3K85A 2V2QA 3J80C 2UUBE 4NXMI 4LFCE 1FNMA 4JI0I 4JV5E 4DUYE 3GMEA 3B4TA 3WU3A 4DR3I 2VESA 4FW3A 4X62E 4OO1E 4DU7A 1N0VC 1H7UA 1PVGA 2JE6A 3B78A 4DR2E 4LF5E 2E1RA 1QZRA 4JI3I 1DARA 4PU9A 5C0XF 1UDQA 4NXME 1I94I 2ZBKB 4BA1B 2NN6D 3PS1A 4FW9A 3J81Q 1FKAE 2E5LE 3H4LA 3Q6NA 1KTVA 5BR8I 4LF7E 2VQEI 4LF6E 4X66I 5LMNI 4KHPI 1Z0EA 4PRXA 4LOMA 1ZM4A 5IT9C 4NBQA 4AIMA 1IBLE 4AIDA 3ZZUA 4X64E 4IFDF 1FJGI 4XTJA 4BA2A 4FW6A 2WNRB 1ZXNA 1XMQI 2PO0A 4QNJA 4LF4E 2GQ0A 1VI7A 2R42A 4GKJE 3KRNA 3M7ND 1IBME 3J81C 4WUDA 1RR9A 1H7SA 5FLXQ 1N32E 2BM1A 5DRRA 1K47A 5GMEA 5JEAB 5C0XB 3OTOI 2HHHI 4DV1I 4FW5A 4HXZA 1OYPA 1H74A 4GKJI 2UXCE 4WUBA 2UUAE 4YY3I 4LF9I 4DR5I 4IZKB 4IFDC 4UT4A 2NPFA 2PNZA 2DEJA 3PYGA 1HK7A 1FI4A 2V34A 1Z0BA 1RHYA 1N36I 4JYAI 4OO1C 3PYEA 4DUZE 2V2ZA 2VQFE 5DNXA 4X66E 4IFDA 4KQVA 4N3OA 4PRVA 2V2VA 2VQEE 4JI7I 1OJ4A 4LF6I 3WU6A 4GQUA 4DPWA 3Q1QA 1USVA 1OYRA 4DV3E 2CG9A 2HFSA 5A2QQ 5K36C 4IZJD 4HACB 4DV0E 2JE6B 2NN6B 2IERA 1NHHA 2WNRA 3LTOA 2O3ZA 3PRYA 3T1YI 4MDTA 3P3GA 5DROA 1Z0CA 2HHHE 4IZJA 1WUUA 1NZ0A 1UEKA 4IFDE 1VISA 2UUBI 3P3EA 4OX9I 4NXNI 2LJPA 4NXNE 4LF4I 4DV1E 4OO1B 4HYMA 2C38B 5LL6R 4DV6I 1XHKA 4IFDD 4J3DA 3HJCA 1IBMI 4DR7E 3B8HA 3JAMC 4JI4E 4DV7I 4DR4I 1HNXE 3GONA 2UXDI 3DD6A 4B3ME 3ZKDA 3LNUA 3V5RA 5JEAC 3F0NA 2WW4A 4OO1A 1XMOE 2Z5BA 5C0XE 4B3SI 2UXBE 2F4VI 1XNQI 4DR6E 1BKNA 3V2UC 3Q6MA 4FW7A 4OO1F 4DR2I 2HK3A 3U1YA 1Z5CA 1N34I 4DXLA 2HK2A 4HY1A 5C0XA 1XNRI 4FN5A 4LFCI 4DV2E 1N34E 3K17A 2UXCI 5C0XD 3P3CA 4IZKA 2F1DA 2O1TA 5GMDA 4USMA 4DR6I 1Y60A 1Z0WA 2UXBI 2NN6E 5ELWA 2V8PA 4FWDA 4GKKE 1IBKI 1OYSA 1KIJA 4HACA 2C39A 4DV4I 1P42A 4OO1D 2NN6A 2BR2A 4X64I 1PKPA 1FJGE 2HKEA 3L7ZA 3UHMA 2BM0A 4DV5E 4UTGA 2BA0D 4LFBI 4YHHE 2ZM6I 4LF8I 1EI1A 4LPFA 2BR2B 2BA1G 4R1FA 1MU5A 2IOPA 3H1CA 4JG4A 3U1KA 2UUCE 4Z7YA 1S16A 5IWAE 4FWGA 4ED4A 2C37A 1PIEA 1HR0I 1N33E 2AE8A 4IZJB 4OX9E 2E5LI 4GKKI 4B3RI 1J5EE 4WUCA 4FWHA 1RREA 1E3PA 3GLLA 1Z0TA 1NHIA 5C0XC 4JI3E 2GO3A 1Z59A 4K0KI 4X62I 4AM3A 1U2RA 4DR3E 4OZEA 3P76A 5K36F 4DUYI 2NN6C 4JI0E 4JV5I 2Z5CA 4DPUA 3NZKA 2BA0G 1J5EI 1ELOA 2AJ4A 5K36B 3CWVA 2F4VE 2PNZB 1HNZE 4B3SE 2UUCI 4JI8E 1UDSA 2VQFI 2BV3A 2PNMA 3GCMA 2UXDE 3B82A 4DPTA 4LF8E 4LFAI 3LPSA 3ZZTA 1HNXI 4JI4I 5JEAD 3T1HI 4DR4E 1ZXMA 3M85G 1EA6A 1A6FA 4B3TE 1ZM2A 4DPYA 4B3MI 1N0UA 4P7AA 4DV6E 4MYUA 4ISAA 5LMUE 4IFDB 1UDNA 3QT6A 4M1KA 1Y4UA
chains in the Genus database with same CATH topology
4JI6I 2IOQA 1HNWE 4JI2I 4AQYE 5L3JA 1N32I 4JI5E 3J80Q 5A2QC 1HNWI 1Z0VA 2O1UA 3QT8A 4DV2I 1Z5BA 1XNRE 4B3TI 2XEXA 2J7KA 2ZITA 2CGEA 4ZVIA 4KHPE 1Y6ZA 4JI7E 3K1JA 4DV0I 3ZKBA 2R3VA 1S4EA 4URLA 2A2CA 2DEIA 2X7IA 1ZM3A 1I94E 2OI2A 4DR5E 4DUZI 5FLXC 2UUAI 4LF5I 4DR7I 4AQYI 4B3RE 4YY3E 4LF9E 4JI1I 4JI1E 2Z5BB 2EFGA 2CZ9A 5IT9Q 3OTOE 5LMUI 3WU4A 3PYFA 4DPXA 2Z5CB 4JI2E 4RPFA 2HFUA 3T1YE 3T1HE 4YHHI 2ZM6E 5FWKA 1KVKA 2A2DA 2UU9I 1FWLA 1MG7A 4JI8I 1KKHA 4Z7CA 4LF7I 4DV3I 3D4JA 4LFAE 2VF3A 5BR8E 1HNZI 1MX0A 3J7AM 4MYTA 4USKA 1N36E 4JYAE 2O1WA 2O1VA 2Z5EA 3QT5A 3JAMQ 4K0KE 1FWKA 1B63A 1Z5AA 3ZZ0A 3ZM7A 4P52A 1D6TA 2PNLA 1B62A 1Y4SA 5IWAI 2Q2EB 4JI5I 1XNQE 4DU8A 2HKJA 3J7AG 1H72C 3WU5A 4EMDA 1ZM9A 3HULA 1HR0E 1N33I 1XMOI 4JI6E 3QT7A 3PYDA 4I3HA 4DR1E 1XMQE 4DV5I 3P06A 1NHJA 1USUA 2GS8A 4X65I 1IBLI 3M6AA 2X36A 2UU9E 4DV7E 1IBKE 4LFBE 5LMNE 1Z0GA 4X65E 4DV4E 1H73A 4DR1I 3K85A 2V2QA 3J80C 2UUBE 4NXMI 4LFCE 1FNMA 4JI0I 4JV5E 4DUYE 3WU3A 4DR3I 4X62E 4DU7A 1N0VC 1H7UA 1PVGA 3B78A 4DR2E 4LF5E 2E1RA 1QZRA 4JI3I 1DARA 4PU9A 4NXME 1I94I 2ZBKB 4FW9A 2E5LE 3J81Q 1FKAE 3H4LA 3Q6NA 1KTVA 5BR8I 4LF7E 2VQEI 4LF6E 4X66I 5LMNI 4KHPI 1Z0EA 4PRXA 1ZM4A 5IT9C 1IBLE 3ZZUA 4X64E 1FJGI 4XTJA 1ZXNA 1XMQI 4LF4E 2GQ0A 2R42A 4GKJE 1IBME 3J81C 4WUDA 1RR9A 1H7SA 5FLXQ 1N32E 2BM1A 1K47A 5GMEA 3OTOI 2HHHI 4DV1I 4HXZA 1H74A 4GKJI 2UXCE 4WUBA 2UUAE 4YY3I 4LF9I 4DR5I 4IZKB 4UT4A 2NPFA 2DEJA 3PYGA 1HK7A 1FI4A 2V34A 1Z0BA 1N36I 4JYAI 3PYEA 4DUZE 2V2ZA 2VQFE 4X66E 4KQVA 4N3OA 2V2VA 2VQEE 4PRVA 4JI7I 1OJ4A 4LF6I 3WU6A 4DPWA 3Q1QA 1USVA 4DV3E 2CG9A 2HFSA 5A2QQ 4IZJD 4HACB 4DV0E 1NHHA 3LTOA 3PRYA 3T1YI 1Z0CA 2HHHE 4IZJA 1WUUA 1NZ0A 1UEKA 1VISA 2UUBI 4OX9I 4NXNI 2LJPA 4NXNE 4LF4I 4DV1E 4HYMA 5LL6R 4DV6I 1XHKA 3HJCA 1IBMI 4DR7E 3B8HA 3JAMC 4JI4E 4DV7I 4DR4I 1HNXE 3GONA 2UXDI 4B3ME 3ZKDA 3LNUA 3V5RA 3F0NA 2WW4A 1XMOE 2Z5BA 4B3SI 2UXBE 2F4VI 1XNQI 4DR6E 1BKNA 3V2UC 3Q6MA 4DR2I 2HK3A 1Z5CA 1N34I 4DXLA 2HK2A 4HY1A 1XNRI 4FN5A 4LFCI 4DV2E 1N34E 3K17A 2UXCI 4IZKA 2O1TA 4USMA 5GMDA 4DR6I 1Z0WA 2UXBI 2V8PA 4FWDA 4GKKE 1IBKI 1KIJA 4HACA 4DV4I 4X64I 1PKPA 1FJGE 2HKEA 2BM0A 4DV5E 4UTGA 4LFBI 4YHHE 2ZM6I 4LF8I 1EI1A 4R1FA 1MU5A 2IOPA 4JG4A 2UUCE 4Z7YA 1S16A 5IWAE 4FWGA 4ED4A 1PIEA 1HR0I 1N33E 4IZJB 4OX9E 2E5LI 4GKKI 4B3RI 1J5EE 4WUCA 4FWHA 1RREA 1Z0TA 1NHIA 4JI3E 1Z59A 4K0KI 4X62I 1U2RA 4DR3E 4DUYI 4JI0E 4JV5I 2Z5CA 4DPUA 1J5EI 1ELOA 2AJ4A 3CWVA 2F4VE 1HNZE 4B3SE 2UUCI 4JI8E 2VQFI 2BV3A 2PNMA 2UXDE 3B82A 4DPTA 4LF8E 4LFAI 3LPSA 3ZZTA 1HNXI 4JI4I 4DR4E 3T1HI 1ZXMA 1EA6A 1A6FA 4B3TE 1ZM2A 4DPYA 4B3MI 1N0UA 4P7AA 4DV6E 4MYUA 5LMUE 3QT6A 4M1KA 1Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 I;  1HNW E;  4JI2 I;  4AQY E;  5L3J A;  1N32 I;  4JI5 E;  3J80 Q;  5A2Q C;  1HNW I;  1Z0V A;  3QT8 A;  4DV2 I;  1Z5B A;  1XNR E;  4B3T I;  2XEX A;  2J7K A;  2ZIT A;  4ZVI A;  4KHP E;  4DV0 I;  4JI7 E;  3K1J A;  3ZKB A;  2R3V A;  1S4E A;  4URL A;  2A2C A;  2DEI A;  2X7I A;  1ZM3 A;  1I94 E;  2OI2 A;  4DR5 E;  4DUZ I;  5FLX C;  2UUA I;  4LF5 I;  4DR7 I;  4AQY I;  4B3R E;  4YY3 E;  4LF9 E;  4JI1 I;  4JI1 E;  2EFG A;  2CZ9 A;  5IT9 Q;  3OTO E;  5LMU I;  3WU4 A;  3PYF A;  4DPX A;  4JI2 E;  4RPF A;  2HFU A;  3T1Y E;  3T1H E;  4YHH I;  2ZM6 E;  1KVK A;  2A2D A;  2UU9 I;  1FWL A;  1MG7 A;  4JI8 I;  1KKH A;  4Z7C A;  4LF7 I;  4DV3 I;  3D4J A;  4LFA E;  2VF3 A;  5BR8 E;  1HNZ I;  1MX0 A;  3J7A M;  4MYT A;  4USK A;  1N36 E;  4JYA E;  3QT5 A;  3JAM Q;  4K0K E;  1FWK A;  1B63 A;  1Z5A A;  3ZZ0 A;  3ZM7 A;  4P52 A;  1D6T A;  1B62 A;  5IWA I;  2Q2E B;  4JI5 I;  1XNQ E;  4DU8 A;  2HKJ A;  3J7A G;  1H72 C;  3WU5 A;  4EMD A;  1ZM9 A;  3HUL A;  1HR0 E;  1N33 I;  1XMO I;  4JI6 E;  3QT7 A;  3PYD A;  4I3H A;  4DR1 E;  1XMQ E;  4DV5 I;  1NHJ A;  2GS8 A;  4X65 I;  1IBL I;  3M6A A;  2X36 A;  2UU9 E;  4DV7 E;  1IBK E;  4LFB E;  5LMN E;  1Z0G A;  4X65 E;  4DV4 E;  1H73 A;  4DR1 I;  2V2Q A;  3J80 C;  2UUB E;  4NXM I;  4LFC E;  1FNM A;  4JI0 I;  4JV5 E;  4DUY E;  3WU3 A;  4DR3 I;  4X62 E;  4DU7 A;  1N0V C;  1H7U A;  1PVG A;  3B78 A;  4DR2 E;  4LF5 E;  2E1R A;  1QZR A;  4JI3 I;  1DAR A;  4PU9 A;  4NXM E;  1I94 I;  2ZBK B;  4FW9 A;  1FKA E;  3J81 Q;  2E5L E;  3H4L A;  1KTV A;  5BR8 I;  4LF7 E;  2VQE I;  4LF6 E;  4X66 I;  5LMN I;  4KHP I;  1Z0E A;  4PRX A;  1ZM4 A;  5IT9 C;  1IBL E;  3ZZU A;  4X64 E;  1FJG I;  4XTJ A;  1ZXN A;  1XMQ I;  4LF4 E;  2R42 A;  4GKJ E;  1IBM E;  3J81 C;  4WUD A;  1RR9 A;  1H7S A;  1N32 E;  5FLX Q;  2BM1 A;  1K47 A;  5GME A;  3OTO I;  2HHH I;  4DV1 I;  4HXZ A;  1H74 A;  4GKJ I;  2UXC E;  4WUB A;  2UUA E;  4YY3 I;  4LF9 I;  4DR5 I;  4UT4 A;  2NPF A;  2DEJ A;  3PYG A;  1FI4 A;  2V34 A;  1Z0B A;  1N36 I;  4JYA I;  3PYE A;  4DUZ E;  2V2Z A;  2VQF E;  4X66 E;  4KQV A;  4JI7 I;  2V2V A;  4PRV A;  2VQE E;  4LF6 I;  1OJ4 A;  3WU6 A;  4DPW A;  3Q1Q A;  4DV3 E;  2HFS A;  5A2Q Q;  4HAC B;  4DV0 E;  1NHH A;  3LTO A;  3T1Y I;  1Z0C A;  2HHH E;  1WUU A;  1NZ0 A;  1UEK A;  1VIS A;  2UUB I;  4OX9 I;  4NXN I;  4NXN E;  2LJP A;  4LF4 I;  4DV1 E;  4HYM A;  5LL6 R;  4DV6 I;  1XHK A;  1IBM I;  4DR7 E;  3B8H A;  3JAM C;  4JI4 E;  4DV7 I;  4DR4 I;  1HNX E;  3GON A;  2UXD I;  4B3M E;  3ZKD A;  3LNU A;  3V5R A;  3F0N A;  2WW4 A;  1XMO E;  4B3S I;  2UXB E;  2F4V I;  1XNQ I;  4DR6 E;  1BKN A;  3V2U C;  4DR2 I;  2HK3 A;  1Z5C A;  1N34 I;  4DXL A;  2HK2 A;  4HY1 A;  1XNR I;  4FN5 A;  4LFC I;  4DV2 E;  1N34 E;  3K17 A;  2UXC I;  4DR6 I;  4USM A;  5GMD A;  1Z0W A;  2UXB I;  2V8P A;  4FWD A;  4GKK E;  1IBK I;  1KIJ A;  4HAC A;  4DV4 I;  4X64 I;  1PKP A;  1FJG E;  2HKE A;  2BM0 A;  4DV5 E;  4UTG A;  4LFB I;  4YHH E;  2ZM6 I;  4LF8 I;  1EI1 A;  4R1F A;  1MU5 A;  4JG4 A;  2UUC E;  4Z7Y A;  1S16 A;  5IWA E;  4FWG A;  4ED4 A;  1PIE A;  1HR0 I;  1N33 E;  4OX9 E;  2E5L I;  4GKK I;  4B3R I;  1J5E E;  4WUC A;  4FWH A;  1RRE A;  1Z0T A;  1NHI A;  4JI3 E;  1Z59 A;  4K0K I;  4X62 I;  1U2R A;  4DR3 E;  4DUY I;  4JI0 E;  4JV5 I;  4DPU A;  1J5E I;  1ELO A;  2AJ4 A;  3CWV A;  2F4V E;  1HNZ E;  4B3S E;  2UUC I;  4JI8 E;  2VQF I;  2BV3 A;  2UXD E;  3B82 A;  4DPT A;  4LF8 E;  4LFA I;  3LPS A;  3ZZT A;  1HNX I;  4JI4 I;  4DR4 E;  3T1H I;  1ZXM A;  1EA6 A;  1A6F A;  4B3T E;  1ZM2 A;  4DPY A;  4B3M I;  1N0U A;  4P7A A;  4DV6 E;  4MYU A;  5LMU E;  3QT6 A;  4M1K A; 
#chains in the Genus database with same CATH topology
 4JI6 I;  1R6L A;  2IOQ A;  1HNW E;  2BA1 D;  4MU4 A;  4BA1 A;  4JI2 I;  4AQY E;  5L3J A;  1N32 I;  4JI5 E;  3J80 Q;  2WP8 A;  2C39 B;  5A2Q C;  1HNW I;  1Z0V A;  2O1U A;  3QT8 A;  4U3B A;  4DV2 I;  1Z5B A;  2JEA B;  2PO1 A;  1XNR E;  2WP8 B;  4B3T I;  4MU1 A;  2XEX A;  2JT2 A;  2GO4 A;  2J7K A;  2ZIT A;  2CGE A;  4ZVI A;  4KHP E;  1Y6Z A;  4JI7 E;  3K1J A;  4DV0 I;  3ZKB A;  4QNK A;  2C38 A;  2PO0 B;  4LCH A;  2R3V A;  1S4E A;  4URL A;  5DRP A;  4BA2 B;  2A2C A;  2DEI A;  2X7I A;  3CDJ A;  3CDI A;  4IS9 A;  1ZM3 A;  2NN6 F;  1I94 E;  2OI2 A;  5K36 D;  1YHC A;  4DR5 E;  4DUZ I;  4MU0 A;  4MQY A;  5FLX C;  2UUA I;  4LF5 I;  1XXE A;  4DR7 I;  3M85 D;  4AQY I;  5K36 A;  4LCF A;  4U3D A;  4B3R E;  4YY3 E;  4LF9 E;  4JI1 I;  4JI1 E;  2Z5B B;  2EFG A;  2CZ9 A;  5EL9 A;  5IT9 Q;  3OTO E;  5LMU I;  3WU4 A;  3PYF A;  4DPX A;  2Z5C B;  2PO2 B;  4JI2 E;  4RPF A;  2IES A;  1R6M A;  2HFU A;  3T1Y E;  3T1H E;  4YHH I;  2ZM6 E;  5FWK A;  1KVK A;  2A2D A;  2UU9 I;  1UDO A;  1FWL A;  1MG7 A;  4JI8 I;  5K36 E;  1KKH A;  4Z7C A;  4LF7 I;  2J65 A;  4DV3 I;  3D4J A;  4OKG A;  2CVE A;  4LFA E;  2VF3 A;  2PO2 A;  5BR8 E;  1HNZ I;  1MX0 A;  3J7A M;  4MYT A;  4USK A;  1N36 E;  4JYA E;  2O1W A;  2O1V A;  3PS2 A;  2JEB A;  3QT5 A;  2Z5E A;  1Y5Y A;  3JAM Q;  2PO1 B;  1FWK A;  4K0K E;  1B63 A;  5JEA F;  1Z5A A;  3ZZ0 A;  3L7Z B;  3ZM7 A;  4P52 A;  2JEB B;  1D6T A;  5JEA A;  2PNL A;  4LCG A;  1B62 A;  2JEA A;  1Y4S A;  5IWA I;  2Q2E B;  3M7N G;  4JI5 I;  1XNQ E;  4MU3 A;  2C37 B;  4DU8 A;  2HKJ A;  5DNL A;  3HKM A;  3J7A G;  1H72 C;  3WU5 A;  4EMD A;  1ZM9 A;  3HUL A;  1HR0 E;  3PS3 A;  1N33 I;  1XMO I;  4JI6 E;  1E3H A;  5EKW A;  3QT7 A;  3PYD A;  4I3H A;  4DR1 E;  1XMQ E;  4DV5 I;  3P06 A;  1NHJ A;  1YH8 A;  1USU A;  2GS8 A;  4X65 I;  1IBL I;  3M6A A;  2X36 A;  4FW4 A;  2UU9 E;  4DV7 E;  1IBK E;  4LFB E;  5JEA E;  5LMN E;  1Z0G A;  4X65 E;  4DV4 E;  5DRQ A;  1H73 A;  4DR1 I;  3K85 A;  2V2Q A;  3J80 C;  2UUB E;  4NXM I;  4LFC E;  1FNM A;  4JI0 I;  4JV5 E;  4DUY E;  3GME A;  3B4T A;  3WU3 A;  4DR3 I;  2VES A;  4FW3 A;  4X62 E;  4OO1 E;  4DU7 A;  1N0V C;  1H7U A;  1PVG A;  2JE6 A;  3B78 A;  4DR2 E;  4LF5 E;  2E1R A;  1QZR A;  4JI3 I;  1DAR A;  4PU9 A;  5C0X F;  1UDQ A;  4NXM E;  1I94 I;  2ZBK B;  4BA1 B;  2NN6 D;  3PS1 A;  4FW9 A;  3J81 Q;  1FKA E;  2E5L E;  3H4L A;  3Q6N A;  1KTV A;  5BR8 I;  4LF7 E;  2VQE I;  4LF6 E;  4X66 I;  5LMN I;  4KHP I;  1Z0E A;  4PRX A;  4LOM A;  1ZM4 A;  5IT9 C;  4NBQ A;  4AIM A;  1IBL E;  4AID A;  3ZZU A;  4X64 E;  4IFD F;  1FJG I;  4XTJ A;  4BA2 A;  4FW6 A;  2WNR B;  1ZXN A;  1XMQ I;  2PO0 A;  4QNJ A;  4LF4 E;  2GQ0 A;  1VI7 A;  2R42 A;  4GKJ E;  3KRN A;  3M7N D;  1IBM E;  3J81 C;  4WUD A;  1RR9 A;  1H7S A;  5FLX Q;  1N32 E;  2BM1 A;  5DRR A;  1K47 A;  5GME A;  5JEA B;  5C0X B;  3OTO I;  2HHH I;  4DV1 I;  4FW5 A;  4HXZ A;  1OYP A;  1H74 A;  4GKJ I;  2UXC E;  4WUB A;  2UUA E;  4YY3 I;  4LF9 I;  4DR5 I;  4IZK B;  4IFD C;  4UT4 A;  2NPF A;  2PNZ A;  2DEJ A;  3PYG A;  1HK7 A;  1FI4 A;  2V34 A;  1Z0B A;  1RHY A;  1N36 I;  4JYA I;  4OO1 C;  3PYE A;  4DUZ E;  2V2Z A;  2VQF E;  5DNX A;  4X66 E;  4IFD A;  4KQV A;  4N3O A;  4PRV A;  2V2V A;  2VQE E;  4JI7 I;  1OJ4 A;  4LF6 I;  3WU6 A;  4GQU A;  4DPW A;  3Q1Q A;  1USV A;  1OYR A;  4DV3 E;  2CG9 A;  2HFS A;  5A2Q Q;  5K36 C;  4IZJ D;  4HAC B;  4DV0 E;  2JE6 B;  2NN6 B;  2IER A;  1NHH A;  2WNR A;  3LTO A;  2O3Z A;  3PRY A;  3T1Y I;  4MDT A;  3P3G A;  5DRO A;  1Z0C A;  2HHH E;  4IZJ A;  1WUU A;  1NZ0 A;  1UEK A;  4IFD E;  1VIS A;  2UUB I;  3P3E A;  4OX9 I;  4NXN I;  2LJP A;  4NXN E;  4LF4 I;  4DV1 E;  4OO1 B;  4HYM A;  2C38 B;  5LL6 R;  4DV6 I;  1XHK A;  4IFD D;  4J3D A;  3HJC A;  1IBM I;  4DR7 E;  3B8H A;  3JAM C;  4JI4 E;  4DV7 I;  4DR4 I;  1HNX E;  3GON A;  2UXD I;  3DD6 A;  4B3M E;  3ZKD A;  3LNU A;  3V5R A;  5JEA C;  3F0N A;  2WW4 A;  4OO1 A;  1XMO E;  2Z5B A;  5C0X E;  4B3S I;  2UXB E;  2F4V I;  1XNQ I;  4DR6 E;  1BKN A;  3V2U C;  3Q6M A;  4FW7 A;  4OO1 F;  4DR2 I;  2HK3 A;  3U1Y A;  1Z5C A;  1N34 I;  4DXL A;  2HK2 A;  4HY1 A;  5C0X A;  1XNR I;  4FN5 A;  4LFC I;  4DV2 E;  1N34 E;  3K17 A;  2UXC I;  5C0X D;  3P3C A;  4IZK A;  2F1D A;  2O1T A;  5GMD A;  4USM A;  4DR6 I;  1Y60 A;  1Z0W A;  2UXB I;  2NN6 E;  5ELW A;  2V8P A;  4FWD A;  4GKK E;  1IBK I;  1OYS A;  1KIJ A;  4HAC A;  2C39 A;  4DV4 I;  1P42 A;  4OO1 D;  2NN6 A;  2BR2 A;  4X64 I;  1PKP A;  1FJG E;  2HKE A;  3L7Z A;  3UHM A;  2BM0 A;  4DV5 E;  4UTG A;  2BA0 D;  4LFB I;  4YHH E;  2ZM6 I;  4LF8 I;  1EI1 A;  4LPF A;  2BR2 B;  2BA1 G;  4R1F A;  1MU5 A;  2IOP A;  3H1C A;  4JG4 A;  3U1K A;  2UUC E;  4Z7Y A;  1S16 A;  5IWA E;  4FWG A;  4ED4 A;  2C37 A;  1PIE A;  1HR0 I;  1N33 E;  2AE8 A;  4IZJ B;  4OX9 E;  2E5L I;  4GKK I;  4B3R I;  1J5E E;  4WUC A;  4FWH A;  1RRE A;  1E3P A;  3GLL A;  1Z0T A;  1NHI A;  5C0X C;  4JI3 E;  2GO3 A;  1Z59 A;  4K0K I;  4X62 I;  4AM3 A;  1U2R A;  4DR3 E;  4OZE A;  3P76 A;  5K36 F;  4DUY I;  2NN6 C;  4JI0 E;  4JV5 I;  2Z5C A;  4DPU A;  3NZK A;  2BA0 G;  1J5E I;  1ELO A;  2AJ4 A;  5K36 B;  3CWV A;  2F4V E;  2PNZ B;  1HNZ E;  4B3S E;  2UUC I;  4JI8 E;  1UDS A;  2VQF I;  2BV3 A;  2PNM A;  3GCM A;  2UXD E;  3B82 A;  4DPT A;  4LF8 E;  4LFA I;  3LPS A;  3ZZT A;  1HNX I;  4JI4 I;  5JEA D;  3T1H I;  4DR4 E;  1ZXM A;  3M85 G;  1EA6 A;  1A6F A;  4B3T E;  1ZM2 A;  4DPY A;  4B3M I;  1N0U A;  4P7A A;  4DV6 E;  4MYU A;  4ISA A;  5LMU E;  4IFD B;  1UDN A;  3QT6 A;  4M1K A;  1Y4U A; 
#chains in the Genus database with same CATH homology
 4JI6 I;  2IOQ A;  1HNW E;  4JI2 I;  4AQY E;  5L3J A;  1N32 I;  4JI5 E;  3J80 Q;  5A2Q C;  1HNW I;  1Z0V A;  2O1U A;  3QT8 A;  4DV2 I;  1Z5B A;  1XNR E;  4B3T I;  2XEX A;  2J7K A;  2ZIT A;  2CGE A;  4ZVI A;  4KHP E;  1Y6Z A;  4JI7 E;  3K1J A;  4DV0 I;  3ZKB A;  2R3V A;  1S4E A;  4URL A;  2A2C A;  2DEI A;  2X7I A;  1ZM3 A;  1I94 E;  2OI2 A;  4DR5 E;  4DUZ I;  5FLX C;  2UUA I;  4LF5 I;  4DR7 I;  4AQY I;  4B3R E;  4YY3 E;  4LF9 E;  4JI1 I;  4JI1 E;  2Z5B B;  2EFG A;  2CZ9 A;  5IT9 Q;  3OTO E;  5LMU I;  3WU4 A;  3PYF A;  4DPX A;  2Z5C B;  4JI2 E;  4RPF A;  2HFU A;  3T1Y E;  3T1H E;  4YHH I;  2ZM6 E;  5FWK A;  1KVK A;  2A2D A;  2UU9 I;  1FWL A;  1MG7 A;  4JI8 I;  1KKH A;  4Z7C A;  4LF7 I;  4DV3 I;  3D4J A;  4LFA E;  2VF3 A;  5BR8 E;  1HNZ I;  1MX0 A;  3J7A M;  4MYT A;  4USK A;  1N36 E;  4JYA E;  2O1W A;  2O1V A;  2Z5E A;  3QT5 A;  3JAM Q;  4K0K E;  1FWK A;  1B63 A;  1Z5A A;  3ZZ0 A;  3ZM7 A;  4P52 A;  1D6T A;  2PNL A;  1B62 A;  1Y4S A;  5IWA I;  2Q2E B;  4JI5 I;  1XNQ E;  4DU8 A;  2HKJ A;  3J7A G;  1H72 C;  3WU5 A;  4EMD A;  1ZM9 A;  3HUL A;  1HR0 E;  1N33 I;  1XMO I;  4JI6 E;  3QT7 A;  3PYD A;  4I3H A;  4DR1 E;  1XMQ E;  4DV5 I;  3P06 A;  1NHJ A;  1USU A;  2GS8 A;  4X65 I;  1IBL I;  3M6A A;  2X36 A;  2UU9 E;  4DV7 E;  1IBK E;  4LFB E;  5LMN E;  1Z0G A;  4X65 E;  4DV4 E;  1H73 A;  4DR1 I;  3K85 A;  2V2Q A;  3J80 C;  2UUB E;  4NXM I;  4LFC E;  1FNM A;  4JI0 I;  4JV5 E;  4DUY E;  3WU3 A;  4DR3 I;  4X62 E;  4DU7 A;  1N0V C;  1H7U A;  1PVG A;  3B78 A;  4DR2 E;  4LF5 E;  2E1R A;  1QZR A;  4JI3 I;  1DAR A;  4PU9 A;  4NXM E;  1I94 I;  2ZBK B;  4FW9 A;  2E5L E;  3J81 Q;  1FKA E;  3H4L A;  3Q6N A;  1KTV A;  5BR8 I;  4LF7 E;  2VQE I;  4LF6 E;  4X66 I;  5LMN I;  4KHP I;  1Z0E A;  4PRX A;  1ZM4 A;  5IT9 C;  1IBL E;  3ZZU A;  4X64 E;  1FJG I;  4XTJ A;  1ZXN A;  1XMQ I;  4LF4 E;  2GQ0 A;  2R42 A;  4GKJ E;  1IBM E;  3J81 C;  4WUD A;  1RR9 A;  1H7S A;  5FLX Q;  1N32 E;  2BM1 A;  1K47 A;  5GME A;  3OTO I;  2HHH I;  4DV1 I;  4HXZ A;  1H74 A;  4GKJ I;  2UXC E;  4WUB A;  2UUA E;  4YY3 I;  4LF9 I;  4DR5 I;  4IZK B;  4UT4 A;  2NPF A;  2DEJ A;  3PYG A;  1HK7 A;  1FI4 A;  2V34 A;  1Z0B A;  1N36 I;  4JYA I;  3PYE A;  4DUZ E;  2V2Z A;  2VQF E;  4X66 E;  4KQV A;  4N3O A;  2V2V A;  2VQE E;  4PRV A;  4JI7 I;  1OJ4 A;  4LF6 I;  3WU6 A;  4DPW A;  3Q1Q A;  1USV A;  4DV3 E;  2CG9 A;  2HFS A;  5A2Q Q;  4IZJ D;  4HAC B;  4DV0 E;  1NHH A;  3LTO A;  3PRY A;  3T1Y I;  1Z0C A;  2HHH E;  4IZJ A;  1WUU A;  1NZ0 A;  1UEK A;  1VIS A;  2UUB I;  4OX9 I;  4NXN I;  2LJP A;  4NXN E;  4LF4 I;  4DV1 E;  4HYM A;  5LL6 R;  4DV6 I;  1XHK A;  3HJC A;  1IBM I;  4DR7 E;  3B8H A;  3JAM C;  4JI4 E;  4DV7 I;  4DR4 I;  1HNX E;  3GON A;  2UXD I;  4B3M E;  3ZKD A;  3LNU A;  3V5R A;  3F0N A;  2WW4 A;  1XMO E;  2Z5B A;  4B3S I;  2UXB E;  2F4V I;  1XNQ I;  4DR6 E;  1BKN A;  3V2U C;  3Q6M A;  4DR2 I;  2HK3 A;  1Z5C A;  1N34 I;  4DXL A;  2HK2 A;  4HY1 A;  1XNR I;  4FN5 A;  4LFC I;  4DV2 E;  1N34 E;  3K17 A;  2UXC I;  4IZK A;  2O1T A;  4USM A;  5GMD A;  4DR6 I;  1Z0W A;  2UXB I;  2V8P A;  4FWD A;  4GKK E;  1IBK I;  1KIJ A;  4HAC A;  4DV4 I;  4X64 I;  1PKP A;  1FJG E;  2HKE A;  2BM0 A;  4DV5 E;  4UTG A;  4LFB I;  4YHH E;  2ZM6 I;  4LF8 I;  1EI1 A;  4R1F A;  1MU5 A;  2IOP A;  4JG4 A;  2UUC E;  4Z7Y A;  1S16 A;  5IWA E;  4FWG A;  4ED4 A;  1PIE A;  1HR0 I;  1N33 E;  4IZJ B;  4OX9 E;  2E5L I;  4GKK I;  4B3R I;  1J5E E;  4WUC A;  4FWH A;  1RRE A;  1Z0T A;  1NHI A;  4JI3 E;  1Z59 A;  4K0K I;  4X62 I;  1U2R A;  4DR3 E;  4DUY I;  4JI0 E;  4JV5 I;  2Z5C A;  4DPU A;  1J5E I;  1ELO A;  2AJ4 A;  3CWV A;  2F4V E;  1HNZ E;  4B3S E;  2UUC I;  4JI8 E;  2VQF I;  2BV3 A;  2PNM A;  2UXD E;  3B82 A;  4DPT A;  4LF8 E;  4LFA I;  3LPS A;  3ZZT A;  1HNX I;  4JI4 I;  4DR4 E;  3T1H I;  1ZXM A;  1EA6 A;  1A6F A;  4B3T E;  1ZM2 A;  4DPY A;  4B3M I;  1N0U A;  4P7A A;  4DV6 E;  4MYU A;  5LMU E;  3QT6 A;  4M1K A;  1Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...