4DR5I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr5I00
1XMOI 2X36A 4DV1I 1NZ0A 2R42A 2X7IA 1ZM9A 4K0KE 4UT4A 4OX9E 3J7AG 4JI7E 1H7UA 3PYEA 1B63A 1RR9A 3JAMC 4DR6E 1NHHA 1PIEA 1XMQI 4X66I 1HNXI 4R1FA 1ZM4A 1N0VC 1J5EE 2UUBE 4GKJI 4Z7CA 4X62I 4DUYE 5GMDA 1Z5AA 3B78A 4B3ME 4DV2E 4LF4I 4DPTA 5IWAI 4LFAI 1BKNA 2XEXA 3T1HI 4DV4I 1N34E 1K47A 3D4JA 1ZXMA 4YHHI 4DR5I 1UEKA 1N0UA 4AQYE 4B3TI 4DR2I 4LF6E 4LF8I 4DR3I 4NXNI 4WUBA 4LF7I 1Z0BA 4DV7E 1Z0VA 1KVKA 4DV3E 1H74A 4X64I 3ZZUA 2NPFA 3J80C 4MYUA 1Z0EA 4JI0E 1KIJA 1HNZI 4JI6I 1DARA 2ZITA 2EFGA 1IBLI 3PYGA 4MYTA 4KHPE 2F4VI 5LMNI 4DV0I 4YY3I 3ZZTA 1IBMI 5LMUI 4DV1E 2V34A 4DR1I 4JI5I 1Z5CA 3Q1QA 1FWLA 4WUCA 1H73A 4JI3I 2UXBE 3OTOI 4B3RE 2DEJA 2UXCE 2E1RA 2V2QA 3PYFA 2LJPA 1MU5A 4DPWA 5FLXC 2UUAI 4JV5I 4KQVA 3J81Q 4GKJE 1EI1A 1HNWI 1FNMA 5L3JA 4DUZE 1A6FA 4GKKE 4NXMI 1H7SA 4LF4E 5IWAE 4LFAE 3T1HE 3V2UC 5A2QC 4DV4E 1I94I 1D6TA 4YHHE 4DR5E 2BV3A 3PYDA 4I3HA 4B3TE 4DR2E 2V8PA 1HR0E 4DR3E 4NXNE 1IBKI 4PRXA 4LF7E 4JG4A 3ZKBA 4LF5I 3WU4A 2HK3A 4PRVA 3LPSA 1FWKA 1Z0GA 4X64E 3ZM7A 4DPXA 4JYAI 3HULA 3WU6A 1N36E 1HNZE 4JI6E 1N33I 4USKA 1ZXNA 1Z5BA 2VQEI 1IBLE 2F4VE 4PU9A 4B3SI 2HK2A 2V2VA 5LMNE 4DV0E 2UXDI 4YY3E 3ZKDA 4DR7I 2HFUA 1IBME 1PKPA 3LNUA 2CZ9A 4LFCE 2BM1A 5IT9C 4ED4A 5FLXQ 4JI5E 1N32I 3QT8A 4HACA 1XNQI 4DV5I 4JI3E 3LTOA 3OTOE 1NHIA 1KKHA 1FJGE 2OI2A 3F0NA 2UUBI 2UUAE 1XMOE 3JAMQ 1HNWE 1H72C 4DPUA 4LFBI 4HYMA 2E5LI 3QT7A 1KTVA 4NXME 2HKJA 4JI1I 4Z7YA 1MX0A 3H4LA 1I94E 4X65I 3T1YI 4DXLA 3WU3A 4DV6I 4JI8I 4WUDA 3K1JA 2J7KA 4P52A 1Z59A 4LF5E 1XMQE 4X66E 3QT6A 1HNXE 5GMEA 1Z0WA 2R3VA 1FI4A 1NHJA 4JYAE 4URLA 4FWGA 4X62E 4JI0I 5LL6R 2ZM6I 4DR4I 1ELOA 1EA6A 2VQFI 1FKAE 3J80Q 4B3SE 2UUCI 4LF8E 3V5RA 2UXDE 4USMA 2WW4A 4DR7E 1QZRA 2HHHI 1OJ4A 3B82A 1WUUA 1N32E 2HFSA 1XNRI 5BR8I 2UXBI 4JI4I 1XNQE 4B3RI 4DV5E 4LF9I 2UXCI 4RPFA 2UU9I 1S4EA 4JI2I 3J7AM 4HY1A 1Z0CA 2HKEA 4HXZA 4ZVIA 4XTJA 1PVGA 4UTGA 1U2RA 5LMUE 4LFBE 4DUZI 4GKKI 2E5LE 4DR1E 4K0KI 4OX9I 4DU7A 1MG7A 4M1KA 4JI1E 2V2ZA 4X65E 4JI7I 3T1YE 2ZBKB 2AJ4A 4FW9A 3CWVA 4DR6I 1HR0I 4DPYA 3J81C 4DV6E 3GONA 4JI8E 4FWHA 4FWDA 4EMDA 5A2QQ 2GS8A 3K17A 3M6AA 2VF3A 1J5EI 3QT5A 4JV5E 4DUYI 4B3MI 3B8HA 2ZM6E 4DV2I 4DR4E 1N36I 1N34I 3WU5A 2VQFE 1VISA 1Z0TA 4AQYI 1XHKA 2Q2EB 4LF6I 2UUCE 4DV7I 1IBKE 1B62A 4DV3I 2HHHE 4LFCI 1ZM2A 3ZZ0A 1RREA 2DEIA 1XNRE 5BR8E 2BM0A 4FN5A 4JI4E 1ZM3A 4LF9E 1S16A 1FJGI 2UU9E 5IT9Q 4P7AA 4JI2E 2A2DA 1N33E 4DU8A 4KHPI 2A2CA 2VQEE 4HACB
chains in the Genus database with same CATH superfamily
1XMOI 2PNZB 2X36A 5DROA 4DV1I 1NZ0A 2C37B 2R42A 2X7IA 2F1DA 5FWKA 1ZM9A 3P3EA 4K0KE 4UT4A 4OX9E 3J7AG 4JI7E 1H7UA 2C38A 3KRNA 1B63A 3PYEA 5C0XB 1RR9A 1UDOA 3JAMC 4DR6E 1RHYA 1NHHA 4ISAA 4N3OA 3PS3A 4MU4A 1PIEA 1XMQI 4X66I 1HNXI 4R1FA 3U1YA 1ZM4A 1N0VC 1J5EE 2UUBE 1R6LA 3M85G 4GKJI 4Z7CA 4X62I 4DUYE 5GMDA 2NN6F 3M85D 1Z5AA 3B78A 4QNJA 1UDSA 4B3ME 2IESA 1Y5YA 4DV2E 4LF4I 4DPTA 5IWAI 4LFAI 1BKNA 2XEXA 3T1HI 4LPFA 4DV4I 1K47A 1N34E 3D4JA 1ZXMA 4YHHI 4DR5I 1UEKA 1N0UA 5K36D 2GO4A 4AQYE 4B3TI 4DR2I 5JEAE 4FW7A 4LF6E 4LF8I 4DR3I 4NXNI 4IFDD 1OYSA 4BA2B 4WUBA 4LF7I 1Z0BA 4DV7E 4OO1F 4OKGA 1Z0VA 1KVKA 2NN6B 4MU3A 4DV3E 1H74A 4X64I 3ZZUA 2NPFA 2PO0B 2NN6E 3J80C 3GCMA 4MYUA 1Y4UA 1Z0EA 4JI0E 2PNZA 1KIJA 1Y60A 1HNZI 4JI6I 1DARA 4IZJB 2ZITA 3GMEA 2EFGA 1IBLI 3PYGA 4MYTA 4KHPE 3P06A 2F4VI 1YHCA 4OO1B 4LCGA 5LMNI 4DV0I 4YY3I 3ZZTA 2PO1B 1IBMI 5LMUI 4DV1E 2V34A 4DR1I 4AM3A 4JI5I 1Z5CA 3Q1QA 1P42A 4FW5A 5DRQA 2BR2B 1FWLA 4WUCA 1H73A 4JI3I 2UXBE 3OTOI 4B3RE 2DEJA 2UXCE 4AIMA 2E1RA 2V2QA 3PYFA 4IS9A 3HJCA 2LJPA 2Z5EA 1MU5A 1USUA 4DPWA 5FLXC 2UUAI 4JV5I 4IFDC 4KQVA 3J81Q 4GKJE 1EI1A 1HNWI 5EKWA 1FNMA 3GLLA 1E3PA 5L3JA 3PRYA 4DUZE 1A6FA 4GKKE 4NXMI 1H7SA 2GO3A 4LF4E 5IWAE 4LFAE 3Q6NA 4IZKB 3T1HE 3V2UC 5A2QC 4DV4E 1I94I 5ELWA 1D6TA 1E3HA 4YHHE 4DR5E 2BV3A 2IERA 3PYDA 4I3HA 4B3TE 4DR2E 2V8PA 5JEAF 1HR0E 4DR3E 4NXNE 1USVA 1IBKI 3B4TA 4PRXA 4LF7E 4JG4A 3ZKBA 4LF5I 3WU4A 2PNLA 2HK3A 4PRVA 3LPSA 1FWKA 1Z0GA 4X64E 3ZM7A 4DPXA 4JYAI 5K36E 3HULA 3K85A 4IZJA 2Z5CB 4IFDE 3WU6A 5EL9A 2PO2A 5DRRA 1N36E 1HNZE 2PO1A 4JI6E 1N33I 4USKA 3Q6MA 1ZXNA 5JEAB 1Z5BA 2VESA 2VQEI 1IBLE 2JEBB 2F4VE 4PU9A 4B3SI 2HK2A 2C39B 2V2VA 5LMNE 4DV0E 2UXDI 4YY3E 2BR2A 3ZKDA 4DR7I 2HFUA 1IBME 4MDTA 1PKPA 3LNUA 5C0XD 3P76A 4MQYA 2CZ9A 4LFCE 2BM1A 2O1UA 4ED4A 5IT9C 5FLXQ 4JI5E 2BA1G 1N32I 2IOPA 1Y4SA 2BA1D 4BA1B 2J65A 3QT8A 4HACA 1XNQI 3CDIA 4DV5I 4JI3E 3LTOA 2O1TA 3OTOE 1NHIA 1KKHA 3M7NG 2AE8A 1FJGE 3M7ND 1VI7A 2C37A 2OI2A 3F0NA 2UUBI 2UUAE 1XMOE 4IZKA 5DNXA 3JAMQ 4U3BA 1HNWE 5JEAD 1OYRA 1H72C 4DPUA 2O3ZA 4LFBI 5C0XA 4HYMA 2JE6B 3QT7A 2E5LI 1KTVA 4NXME 2HKJA 4JI1I 4Z7YA 1MX0A 3H4LA 1I94E 4X65I 3T1YI 4DXLA 2NN6D 3WU3A 4DV6I 4JI8I 4WUDA 2Z5CA 3K1JA 2J7KA 4P52A 1Z59A 4LF5E 1XMQE 4X66E 3NZKA 3HKMA 2CG9A 3QT6A 1HNXE 5GMEA 1UDQA 5DNLA 1Z0WA 2R3VA 1FI4A 4OZEA 1NHJA 1Y6ZA 4JYAE 4URLA 5K36F 5JEAA 4FWGA 4IZJD 4X62E 2WP8B 2JEBA 4IFDF 4JI0I 5LL6R 5C0XC 2ZM6I 4DR4I 3PS2A 2C39A 4OO1D 5DRPA 4BA2A 1ELOA 1EA6A 2VQFI 3U1KA 1FKAE 2WNRB 3J80Q 2NN6A 4B3SE 2UUCI 4LCHA 4LF8E 2PO0A 3V5RA 2IOQA 2UXDE 4USMA 2WW4A 4MU0A 4BA1A 4DR7E 1QZRA 5K36B 2BA0G 2HHHI 1OJ4A 2BA0D 4IFDB 2Z5BB 3B82A 4AIDA 1WUUA 1N32E 2HFSA 3L7ZB 1XNRI 5BR8I 5JEAC 3H1CA 3UHMA 4JI4I 1XNQE 2UXBI 4B3RI 4DV5E 4LF9I 2UXCI 4MU1A 4OO1A 4RPFA 3CDJA 5C0XE 2UU9I 4QNKA 1S4EA 4JI2I 3J7AM 1UDNA 4HY1A 3P3GA 2JEAB 1HK7A 1Z0CA 2JE6A 2HKEA 4HXZA 2NN6C 4ZVIA 4XTJA 4J3DA 1PVGA 2O1WA 4UTGA 1U2RA 5LMUE 2JT2A 4FW3A 4LFBE 4DUZI 4GKKI 2E5LE 4DR1E 4K0KI 4OX9I 4DU7A 1MG7A 4FW4A 2GQ0A 4M1KA 4JI1E 2V2ZA 4X65E 4JI7I 3T1YE 1YH8A 2ZBKB 2AJ4A 2CVEA 4FW9A 3CWVA 4DR6I 1HR0I 4DPYA 3J81C 4DV6E 4OO1C 3GONA 4JI8E 4FWHA 2CGEA 1OYPA 2WP8A 4FWDA 4EMDA 5A2QQ 2C38B 2GS8A 3K17A 3P3CA 3M6AA 2VF3A 1J5EI 3QT5A 4JV5E 4DUYI 2WNRA 4GQUA 4B3MI 3B8HA 2ZM6E 4DV2I 4DR4E 1N36I 4LOMA 1N34I 3PS1A 1XXEA 3WU5A 2VQFE 5K36A 1VISA 1Z0TA 4AQYI 1XHKA 2Q2EB 4LF6I 4IFDA 2Z5BA 2UUCE 2PO2B 1R6MA 3L7ZA 4DV7I 1IBKE 4OO1E 1B62A 2O1VA 4DV3I 2HHHE 4LFCI 4U3DA 1ZM2A 3ZZ0A 4FW6A 1RREA 2DEIA 2PNMA 2JEAA 1XNRE 5BR8E 2BM0A 4FN5A 4JI4E 3DD6A 1ZM3A 4LF9E 1S16A 1FJGI 2UU9E 5C0XF 4NBQA 5IT9Q 4P7AA 4JI2E 2A2DA 1N33E 4DU8A 4KHPI 2A2CA 2VQEE 4HACB 4LCFA 5K36C
chains in the Genus database with same CATH topology
1XMOI 2X36A 4DV1I 1NZ0A 2R42A 2X7IA 5FWKA 1ZM9A 4K0KE 4UT4A 4OX9E 3J7AG 4JI7E 1H7UA 3PYEA 1B63A 1RR9A 3JAMC 4DR6E 1NHHA 4N3OA 1PIEA 1XMQI 4X66I 1HNXI 4R1FA 1ZM4A 1N0VC 1J5EE 2UUBE 4GKJI 4Z7CA 4X62I 4DUYE 5GMDA 1Z5AA 3B78A 4B3ME 4DV2E 4LF4I 4DPTA 5IWAI 4LFAI 1BKNA 2XEXA 3T1HI 4DV4I 1N34E 1K47A 3D4JA 1ZXMA 4YHHI 4DR5I 1UEKA 1N0UA 4AQYE 4B3TI 4DR2I 4LF6E 4LF8I 4DR3I 4NXNI 4WUBA 4LF7I 1Z0BA 4DV7E 1Z0VA 1KVKA 4DV3E 1H74A 4X64I 3ZZUA 2NPFA 3J80C 4MYUA 1Y4UA 1Z0EA 4JI0E 1KIJA 1HNZI 4JI6I 1DARA 4IZJB 2ZITA 2EFGA 1IBLI 3PYGA 4MYTA 4KHPE 3P06A 2F4VI 5LMNI 4DV0I 4YY3I 3ZZTA 1IBMI 5LMUI 4DV1E 2V34A 4DR1I 4JI5I 1Z5CA 3Q1QA 1FWLA 4WUCA 1H73A 4JI3I 2UXBE 3OTOI 4B3RE 2DEJA 2UXCE 2E1RA 2V2QA 3PYFA 3HJCA 2LJPA 2Z5EA 1MU5A 1USUA 4DPWA 5FLXC 2UUAI 4JV5I 4KQVA 3J81Q 4GKJE 1EI1A 1HNWI 1FNMA 5L3JA 3PRYA 4DUZE 1A6FA 4GKKE 4NXMI 1H7SA 4LF4E 5IWAE 4LFAE 3Q6NA 4IZKB 3T1HE 3V2UC 5A2QC 4DV4E 1I94I 1D6TA 4YHHE 4DR5E 2BV3A 3PYDA 4I3HA 4B3TE 4DR2E 2V8PA 1HR0E 4DR3E 4NXNE 1USVA 1IBKI 4PRXA 4LF7E 4JG4A 3ZKBA 4LF5I 3WU4A 2PNLA 2HK3A 4PRVA 3LPSA 1FWKA 1Z0GA 4X64E 3ZM7A 4DPXA 4JYAI 3HULA 3K85A 4IZJA 2Z5CB 3WU6A 1N36E 1HNZE 4JI6E 1N33I 4USKA 3Q6MA 1ZXNA 1Z5BA 2VQEI 1IBLE 2F4VE 4PU9A 4B3SI 2HK2A 2V2VA 5LMNE 4DV0E 2UXDI 4YY3E 3ZKDA 4DR7I 2HFUA 1IBME 1PKPA 3LNUA 2CZ9A 4LFCE 2BM1A 2O1UA 5IT9C 4ED4A 5FLXQ 4JI5E 1N32I 2IOPA 1Y4SA 3QT8A 4HACA 1XNQI 4DV5I 4JI3E 3LTOA 2O1TA 3OTOE 1NHIA 1KKHA 1FJGE 2OI2A 3F0NA 2UUBI 2UUAE 1XMOE 4IZKA 3JAMQ 1HNWE 1H72C 4DPUA 4LFBI 4HYMA 2E5LI 3QT7A 1KTVA 4NXME 2HKJA 4JI1I 4Z7YA 1MX0A 3H4LA 1I94E 4X65I 3T1YI 4DXLA 3WU3A 4DV6I 4JI8I 4WUDA 2Z5CA 3K1JA 2J7KA 4P52A 1Z59A 4LF5E 1XMQE 4X66E 2CG9A 3QT6A 1HNXE 5GMEA 1Z0WA 2R3VA 1FI4A 1NHJA 1Y6ZA 4JYAE 4URLA 4FWGA 4IZJD 4X62E 4JI0I 5LL6R 2ZM6I 4DR4I 1ELOA 1EA6A 2VQFI 1FKAE 3J80Q 4B3SE 2UUCI 4LF8E 3V5RA 2IOQA 2UXDE 4USMA 2WW4A 4DR7E 1QZRA 2HHHI 1OJ4A 2Z5BB 3B82A 1WUUA 1N32E 2HFSA 1XNRI 5BR8I 2UXBI 4JI4I 1XNQE 4B3RI 4DV5E 4LF9I 2UXCI 4RPFA 2UU9I 1S4EA 4JI2I 3J7AM 4HY1A 1HK7A 1Z0CA 2HKEA 4HXZA 4ZVIA 4XTJA 1PVGA 2O1WA 4UTGA 1U2RA 5LMUE 4LFBE 4DUZI 4GKKI 2E5LE 4DR1E 4K0KI 4OX9I 4DU7A 1MG7A 4M1KA 2GQ0A 4JI1E 2V2ZA 4X65E 4JI7I 3T1YE 2ZBKB 2AJ4A 4FW9A 3CWVA 4DR6I 1HR0I 4DPYA 3J81C 4DV6E 3GONA 4JI8E 4FWHA 2CGEA 4FWDA 4EMDA 5A2QQ 2GS8A 3K17A 3M6AA 2VF3A 1J5EI 3QT5A 4JV5E 4DUYI 4B3MI 3B8HA 2ZM6E 4DV2I 4DR4E 1N36I 1N34I 3WU5A 2VQFE 1VISA 1Z0TA 4AQYI 1XHKA 2Q2EB 4LF6I 2Z5BA 2UUCE 4DV7I 1IBKE 1B62A 2O1VA 4DV3I 2HHHE 4LFCI 1ZM2A 3ZZ0A 1RREA 2DEIA 2PNMA 1XNRE 5BR8E 2BM0A 4FN5A 4JI4E 1ZM3A 4LF9E 1S16A 1FJGI 2UU9E 5IT9Q 4P7AA 4JI2E 2A2DA 1N33E 4DU8A 4KHPI 2A2CA 2VQEE 4HACB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO I;  2X36 A;  4DV1 I;  1NZ0 A;  2R42 A;  2X7I A;  1ZM9 A;  4K0K E;  4UT4 A;  4OX9 E;  3J7A G;  4JI7 E;  1H7U A;  3PYE A;  1B63 A;  1RR9 A;  3JAM C;  4DR6 E;  1NHH A;  1PIE A;  1XMQ I;  4X66 I;  1HNX I;  4R1F A;  1ZM4 A;  1N0V C;  1J5E E;  2UUB E;  4GKJ I;  4Z7C A;  4X62 I;  4DUY E;  5GMD A;  1Z5A A;  3B78 A;  4B3M E;  4DV2 E;  4LF4 I;  4DPT A;  5IWA I;  4LFA I;  1BKN A;  2XEX A;  3T1H I;  4DV4 I;  1N34 E;  1K47 A;  3D4J A;  1ZXM A;  4YHH I;  4DR5 I;  1UEK A;  1N0U A;  4AQY E;  4B3T I;  4DR2 I;  4LF6 E;  4LF8 I;  4DR3 I;  4NXN I;  4WUB A;  4LF7 I;  1Z0B A;  4DV7 E;  1Z0V A;  1KVK A;  4DV3 E;  1H74 A;  4X64 I;  3ZZU A;  2NPF A;  3J80 C;  4MYU A;  1Z0E A;  4JI0 E;  1KIJ A;  1HNZ I;  4JI6 I;  1DAR A;  2ZIT A;  2EFG A;  1IBL I;  3PYG A;  4MYT A;  4KHP E;  2F4V I;  5LMN I;  4DV0 I;  4YY3 I;  3ZZT A;  1IBM I;  5LMU I;  4DV1 E;  2V34 A;  4DR1 I;  4JI5 I;  1Z5C A;  3Q1Q A;  1FWL A;  4WUC A;  1H73 A;  4JI3 I;  2UXB E;  3OTO I;  4B3R E;  2DEJ A;  2UXC E;  2E1R A;  2V2Q A;  3PYF A;  2LJP A;  1MU5 A;  4DPW A;  5FLX C;  2UUA I;  4JV5 I;  4KQV A;  3J81 Q;  4GKJ E;  1EI1 A;  1HNW I;  1FNM A;  5L3J A;  4DUZ E;  1A6F A;  4GKK E;  4NXM I;  1H7S A;  4LF4 E;  5IWA E;  4LFA E;  3T1H E;  3V2U C;  5A2Q C;  4DV4 E;  1I94 I;  1D6T A;  4YHH E;  4DR5 E;  2BV3 A;  3PYD A;  4I3H A;  4B3T E;  4DR2 E;  2V8P A;  1HR0 E;  4DR3 E;  4NXN E;  1IBK I;  4PRX A;  4LF7 E;  4JG4 A;  3ZKB A;  4LF5 I;  3WU4 A;  2HK3 A;  4PRV A;  3LPS A;  1FWK A;  1Z0G A;  4X64 E;  3ZM7 A;  4DPX A;  4JYA I;  3HUL A;  3WU6 A;  1N36 E;  1HNZ E;  4JI6 E;  1N33 I;  4USK A;  1ZXN A;  1Z5B A;  2VQE I;  1IBL E;  2F4V E;  4PU9 A;  4B3S I;  2HK2 A;  2V2V A;  5LMN E;  4DV0 E;  2UXD I;  4YY3 E;  3ZKD A;  4DR7 I;  2HFU A;  1IBM E;  1PKP A;  3LNU A;  2CZ9 A;  4LFC E;  2BM1 A;  5IT9 C;  4ED4 A;  5FLX Q;  4JI5 E;  1N32 I;  3QT8 A;  4HAC A;  1XNQ I;  4DV5 I;  4JI3 E;  3LTO A;  3OTO E;  1NHI A;  1KKH A;  1FJG E;  2OI2 A;  3F0N A;  2UUB I;  2UUA E;  1XMO E;  3JAM Q;  1HNW E;  1H72 C;  4DPU A;  4LFB I;  4HYM A;  2E5L I;  3QT7 A;  1KTV A;  4NXM E;  2HKJ A;  4JI1 I;  4Z7Y A;  1MX0 A;  3H4L A;  1I94 E;  4X65 I;  3T1Y I;  4DXL A;  3WU3 A;  4DV6 I;  4JI8 I;  4WUD A;  3K1J A;  2J7K A;  4P52 A;  1Z59 A;  4LF5 E;  1XMQ E;  4X66 E;  3QT6 A;  1HNX E;  5GME A;  1Z0W A;  2R3V A;  1FI4 A;  1NHJ A;  4JYA E;  4URL A;  4FWG A;  4X62 E;  4JI0 I;  5LL6 R;  2ZM6 I;  4DR4 I;  1ELO A;  1EA6 A;  2VQF I;  1FKA E;  3J80 Q;  4B3S E;  2UUC I;  4LF8 E;  3V5R A;  2UXD E;  4USM A;  2WW4 A;  4DR7 E;  1QZR A;  2HHH I;  1OJ4 A;  3B82 A;  1WUU A;  1N32 E;  2HFS A;  1XNR I;  5BR8 I;  2UXB I;  4JI4 I;  1XNQ E;  4B3R I;  4DV5 E;  4LF9 I;  2UXC I;  4RPF A;  2UU9 I;  1S4E A;  4JI2 I;  3J7A M;  4HY1 A;  1Z0C A;  2HKE A;  4HXZ A;  4ZVI A;  4XTJ A;  1PVG A;  4UTG A;  1U2R A;  5LMU E;  4LFB E;  4DUZ I;  4GKK I;  2E5L E;  4DR1 E;  4K0K I;  4OX9 I;  4DU7 A;  1MG7 A;  4M1K A;  4JI1 E;  2V2Z A;  4X65 E;  4JI7 I;  3T1Y E;  2ZBK B;  2AJ4 A;  4FW9 A;  3CWV A;  4DR6 I;  1HR0 I;  4DPY A;  3J81 C;  4DV6 E;  3GON A;  4JI8 E;  4FWH A;  4FWD A;  4EMD A;  5A2Q Q;  2GS8 A;  3K17 A;  3M6A A;  2VF3 A;  1J5E I;  3QT5 A;  4JV5 E;  4DUY I;  4B3M I;  3B8H A;  2ZM6 E;  4DV2 I;  4DR4 E;  1N36 I;  1N34 I;  3WU5 A;  2VQF E;  1VIS A;  1Z0T A;  4AQY I;  1XHK A;  2Q2E B;  4LF6 I;  2UUC E;  4DV7 I;  1IBK E;  1B62 A;  4DV3 I;  2HHH E;  4LFC I;  1ZM2 A;  3ZZ0 A;  1RRE A;  2DEI A;  1XNR E;  5BR8 E;  2BM0 A;  4FN5 A;  4JI4 E;  1ZM3 A;  4LF9 E;  1S16 A;  1FJG I;  2UU9 E;  5IT9 Q;  4P7A A;  4JI2 E;  2A2D A;  1N33 E;  4DU8 A;  4KHP I;  2A2C A;  2VQE E;  4HAC B; 
#chains in the Genus database with same CATH topology
 1XMO I;  2PNZ B;  2X36 A;  5DRO A;  4DV1 I;  1NZ0 A;  2C37 B;  2R42 A;  2X7I A;  2F1D A;  5FWK A;  1ZM9 A;  3P3E A;  4K0K E;  4UT4 A;  4OX9 E;  3J7A G;  4JI7 E;  1H7U A;  2C38 A;  3KRN A;  1B63 A;  3PYE A;  5C0X B;  1RR9 A;  1UDO A;  3JAM C;  4DR6 E;  1RHY A;  1NHH A;  4ISA A;  4N3O A;  3PS3 A;  4MU4 A;  1PIE A;  1XMQ I;  4X66 I;  1HNX I;  4R1F A;  3U1Y A;  1ZM4 A;  1N0V C;  1J5E E;  2UUB E;  1R6L A;  3M85 G;  4GKJ I;  4Z7C A;  4X62 I;  4DUY E;  5GMD A;  2NN6 F;  3M85 D;  1Z5A A;  3B78 A;  4QNJ A;  1UDS A;  4B3M E;  2IES A;  1Y5Y A;  4DV2 E;  4LF4 I;  4DPT A;  5IWA I;  4LFA I;  1BKN A;  2XEX A;  3T1H I;  4LPF A;  4DV4 I;  1K47 A;  1N34 E;  3D4J A;  1ZXM A;  4YHH I;  4DR5 I;  1UEK A;  1N0U A;  5K36 D;  2GO4 A;  4AQY E;  4B3T I;  4DR2 I;  5JEA E;  4FW7 A;  4LF6 E;  4LF8 I;  4DR3 I;  4NXN I;  4IFD D;  1OYS A;  4BA2 B;  4WUB A;  4LF7 I;  1Z0B A;  4DV7 E;  4OO1 F;  4OKG A;  1Z0V A;  1KVK A;  2NN6 B;  4MU3 A;  4DV3 E;  1H74 A;  4X64 I;  3ZZU A;  2NPF A;  2PO0 B;  2NN6 E;  3J80 C;  3GCM A;  4MYU A;  1Y4U A;  1Z0E A;  4JI0 E;  2PNZ A;  1KIJ A;  1Y60 A;  1HNZ I;  4JI6 I;  1DAR A;  4IZJ B;  2ZIT A;  3GME A;  2EFG A;  1IBL I;  3PYG A;  4MYT A;  4KHP E;  3P06 A;  2F4V I;  1YHC A;  4OO1 B;  4LCG A;  5LMN I;  4DV0 I;  4YY3 I;  3ZZT A;  2PO1 B;  1IBM I;  5LMU I;  4DV1 E;  2V34 A;  4DR1 I;  4AM3 A;  4JI5 I;  1Z5C A;  3Q1Q A;  1P42 A;  4FW5 A;  5DRQ A;  2BR2 B;  1FWL A;  4WUC A;  1H73 A;  4JI3 I;  2UXB E;  3OTO I;  4B3R E;  2DEJ A;  2UXC E;  4AIM A;  2E1R A;  2V2Q A;  3PYF A;  4IS9 A;  3HJC A;  2LJP A;  2Z5E A;  1MU5 A;  1USU A;  4DPW A;  5FLX C;  2UUA I;  4JV5 I;  4IFD C;  4KQV A;  3J81 Q;  4GKJ E;  1EI1 A;  1HNW I;  5EKW A;  1FNM A;  3GLL A;  1E3P A;  5L3J A;  3PRY A;  4DUZ E;  1A6F A;  4GKK E;  4NXM I;  1H7S A;  2GO3 A;  4LF4 E;  5IWA E;  4LFA E;  3Q6N A;  4IZK B;  3T1H E;  3V2U C;  5A2Q C;  4DV4 E;  1I94 I;  5ELW A;  1D6T A;  1E3H A;  4YHH E;  4DR5 E;  2BV3 A;  2IER A;  3PYD A;  4I3H A;  4B3T E;  4DR2 E;  2V8P A;  5JEA F;  1HR0 E;  4DR3 E;  4NXN E;  1USV A;  1IBK I;  3B4T A;  4PRX A;  4LF7 E;  4JG4 A;  3ZKB A;  4LF5 I;  3WU4 A;  2PNL A;  2HK3 A;  4PRV A;  3LPS A;  1FWK A;  1Z0G A;  4X64 E;  3ZM7 A;  4DPX A;  4JYA I;  5K36 E;  3HUL A;  3K85 A;  4IZJ A;  2Z5C B;  4IFD E;  3WU6 A;  5EL9 A;  2PO2 A;  5DRR A;  1N36 E;  1HNZ E;  2PO1 A;  4JI6 E;  1N33 I;  4USK A;  3Q6M A;  1ZXN A;  5JEA B;  1Z5B A;  2VES A;  2VQE I;  1IBL E;  2JEB B;  2F4V E;  4PU9 A;  4B3S I;  2HK2 A;  2C39 B;  2V2V A;  5LMN E;  4DV0 E;  2UXD I;  4YY3 E;  2BR2 A;  3ZKD A;  4DR7 I;  2HFU A;  1IBM E;  4MDT A;  1PKP A;  3LNU A;  5C0X D;  3P76 A;  4MQY A;  2CZ9 A;  4LFC E;  2BM1 A;  2O1U A;  4ED4 A;  5IT9 C;  5FLX Q;  4JI5 E;  2BA1 G;  1N32 I;  2IOP A;  1Y4S A;  2BA1 D;  4BA1 B;  2J65 A;  3QT8 A;  4HAC A;  1XNQ I;  3CDI A;  4DV5 I;  4JI3 E;  3LTO A;  2O1T A;  3OTO E;  1NHI A;  1KKH A;  3M7N G;  2AE8 A;  1FJG E;  3M7N D;  1VI7 A;  2C37 A;  2OI2 A;  3F0N A;  2UUB I;  2UUA E;  1XMO E;  4IZK A;  5DNX A;  3JAM Q;  4U3B A;  1HNW E;  5JEA D;  1OYR A;  1H72 C;  4DPU A;  2O3Z A;  4LFB I;  5C0X A;  4HYM A;  2JE6 B;  3QT7 A;  2E5L I;  1KTV A;  4NXM E;  2HKJ A;  4JI1 I;  4Z7Y A;  1MX0 A;  3H4L A;  1I94 E;  4X65 I;  3T1Y I;  4DXL A;  2NN6 D;  3WU3 A;  4DV6 I;  4JI8 I;  4WUD A;  2Z5C A;  3K1J A;  2J7K A;  4P52 A;  1Z59 A;  4LF5 E;  1XMQ E;  4X66 E;  3NZK A;  3HKM A;  2CG9 A;  3QT6 A;  1HNX E;  5GME A;  1UDQ A;  5DNL A;  1Z0W A;  2R3V A;  1FI4 A;  4OZE A;  1NHJ A;  1Y6Z A;  4JYA E;  4URL A;  5K36 F;  5JEA A;  4FWG A;  4IZJ D;  4X62 E;  2WP8 B;  2JEB A;  4IFD F;  4JI0 I;  5LL6 R;  5C0X C;  2ZM6 I;  4DR4 I;  3PS2 A;  2C39 A;  4OO1 D;  5DRP A;  4BA2 A;  1ELO A;  1EA6 A;  2VQF I;  3U1K A;  1FKA E;  2WNR B;  3J80 Q;  2NN6 A;  4B3S E;  2UUC I;  4LCH A;  4LF8 E;  2PO0 A;  3V5R A;  2IOQ A;  2UXD E;  4USM A;  2WW4 A;  4MU0 A;  4BA1 A;  4DR7 E;  1QZR A;  5K36 B;  2BA0 G;  2HHH I;  1OJ4 A;  2BA0 D;  4IFD B;  2Z5B B;  3B82 A;  4AID A;  1WUU A;  1N32 E;  2HFS A;  3L7Z B;  1XNR I;  5BR8 I;  5JEA C;  3H1C A;  3UHM A;  4JI4 I;  1XNQ E;  2UXB I;  4B3R I;  4DV5 E;  4LF9 I;  2UXC I;  4MU1 A;  4OO1 A;  4RPF A;  3CDJ A;  5C0X E;  2UU9 I;  4QNK A;  1S4E A;  4JI2 I;  3J7A M;  1UDN A;  4HY1 A;  3P3G A;  2JEA B;  1HK7 A;  1Z0C A;  2JE6 A;  2HKE A;  4HXZ A;  2NN6 C;  4ZVI A;  4XTJ A;  4J3D A;  1PVG A;  2O1W A;  4UTG A;  1U2R A;  5LMU E;  2JT2 A;  4FW3 A;  4LFB E;  4DUZ I;  4GKK I;  2E5L E;  4DR1 E;  4K0K I;  4OX9 I;  4DU7 A;  1MG7 A;  4FW4 A;  2GQ0 A;  4M1K A;  4JI1 E;  2V2Z A;  4X65 E;  4JI7 I;  3T1Y E;  1YH8 A;  2ZBK B;  2AJ4 A;  2CVE A;  4FW9 A;  3CWV A;  4DR6 I;  1HR0 I;  4DPY A;  3J81 C;  4DV6 E;  4OO1 C;  3GON A;  4JI8 E;  4FWH A;  2CGE A;  1OYP A;  2WP8 A;  4FWD A;  4EMD A;  5A2Q Q;  2C38 B;  2GS8 A;  3K17 A;  3P3C A;  3M6A A;  2VF3 A;  1J5E I;  3QT5 A;  4JV5 E;  4DUY I;  2WNR A;  4GQU A;  4B3M I;  3B8H A;  2ZM6 E;  4DV2 I;  4DR4 E;  1N36 I;  4LOM A;  1N34 I;  3PS1 A;  1XXE A;  3WU5 A;  2VQF E;  5K36 A;  1VIS A;  1Z0T A;  4AQY I;  1XHK A;  2Q2E B;  4LF6 I;  4IFD A;  2Z5B A;  2UUC E;  2PO2 B;  1R6M A;  3L7Z A;  4DV7 I;  1IBK E;  4OO1 E;  1B62 A;  2O1V A;  4DV3 I;  2HHH E;  4LFC I;  4U3D A;  1ZM2 A;  3ZZ0 A;  4FW6 A;  1RRE A;  2DEI A;  2PNM A;  2JEA A;  1XNR E;  5BR8 E;  2BM0 A;  4FN5 A;  4JI4 E;  3DD6 A;  1ZM3 A;  4LF9 E;  1S16 A;  1FJG I;  2UU9 E;  5C0X F;  4NBQ A;  5IT9 Q;  4P7A A;  4JI2 E;  2A2D A;  1N33 E;  4DU8 A;  4KHP I;  2A2C A;  2VQE E;  4HAC B;  4LCF A;  5K36 C; 
#chains in the Genus database with same CATH homology
 1XMO I;  2X36 A;  4DV1 I;  1NZ0 A;  2R42 A;  2X7I A;  5FWK A;  1ZM9 A;  4K0K E;  4UT4 A;  4OX9 E;  3J7A G;  4JI7 E;  1H7U A;  3PYE A;  1B63 A;  1RR9 A;  3JAM C;  4DR6 E;  1NHH A;  4N3O A;  1PIE A;  1XMQ I;  4X66 I;  1HNX I;  4R1F A;  1ZM4 A;  1N0V C;  1J5E E;  2UUB E;  4GKJ I;  4Z7C A;  4X62 I;  4DUY E;  5GMD A;  1Z5A A;  3B78 A;  4B3M E;  4DV2 E;  4LF4 I;  4DPT A;  5IWA I;  4LFA I;  1BKN A;  2XEX A;  3T1H I;  4DV4 I;  1N34 E;  1K47 A;  3D4J A;  1ZXM A;  4YHH I;  4DR5 I;  1UEK A;  1N0U A;  4AQY E;  4B3T I;  4DR2 I;  4LF6 E;  4LF8 I;  4DR3 I;  4NXN I;  4WUB A;  4LF7 I;  1Z0B A;  4DV7 E;  1Z0V A;  1KVK A;  4DV3 E;  1H74 A;  4X64 I;  3ZZU A;  2NPF A;  3J80 C;  4MYU A;  1Y4U A;  1Z0E A;  4JI0 E;  1KIJ A;  1HNZ I;  4JI6 I;  1DAR A;  4IZJ B;  2ZIT A;  2EFG A;  1IBL I;  3PYG A;  4MYT A;  4KHP E;  3P06 A;  2F4V I;  5LMN I;  4DV0 I;  4YY3 I;  3ZZT A;  1IBM I;  5LMU I;  4DV1 E;  2V34 A;  4DR1 I;  4JI5 I;  1Z5C A;  3Q1Q A;  1FWL A;  4WUC A;  1H73 A;  4JI3 I;  2UXB E;  3OTO I;  4B3R E;  2DEJ A;  2UXC E;  2E1R A;  2V2Q A;  3PYF A;  3HJC A;  2LJP A;  2Z5E A;  1MU5 A;  1USU A;  4DPW A;  5FLX C;  2UUA I;  4JV5 I;  4KQV A;  3J81 Q;  4GKJ E;  1EI1 A;  1HNW I;  1FNM A;  5L3J A;  3PRY A;  4DUZ E;  1A6F A;  4GKK E;  4NXM I;  1H7S A;  4LF4 E;  5IWA E;  4LFA E;  3Q6N A;  4IZK B;  3T1H E;  3V2U C;  5A2Q C;  4DV4 E;  1I94 I;  1D6T A;  4YHH E;  4DR5 E;  2BV3 A;  3PYD A;  4I3H A;  4B3T E;  4DR2 E;  2V8P A;  1HR0 E;  4DR3 E;  4NXN E;  1USV A;  1IBK I;  4PRX A;  4LF7 E;  4JG4 A;  3ZKB A;  4LF5 I;  3WU4 A;  2PNL A;  2HK3 A;  4PRV A;  3LPS A;  1FWK A;  1Z0G A;  4X64 E;  3ZM7 A;  4DPX A;  4JYA I;  3HUL A;  3K85 A;  4IZJ A;  2Z5C B;  3WU6 A;  1N36 E;  1HNZ E;  4JI6 E;  1N33 I;  4USK A;  3Q6M A;  1ZXN A;  1Z5B A;  2VQE I;  1IBL E;  2F4V E;  4PU9 A;  4B3S I;  2HK2 A;  2V2V A;  5LMN E;  4DV0 E;  2UXD I;  4YY3 E;  3ZKD A;  4DR7 I;  2HFU A;  1IBM E;  1PKP A;  3LNU A;  2CZ9 A;  4LFC E;  2BM1 A;  2O1U A;  5IT9 C;  4ED4 A;  5FLX Q;  4JI5 E;  1N32 I;  2IOP A;  1Y4S A;  3QT8 A;  4HAC A;  1XNQ I;  4DV5 I;  4JI3 E;  3LTO A;  2O1T A;  3OTO E;  1NHI A;  1KKH A;  1FJG E;  2OI2 A;  3F0N A;  2UUB I;  2UUA E;  1XMO E;  4IZK A;  3JAM Q;  1HNW E;  1H72 C;  4DPU A;  4LFB I;  4HYM A;  2E5L I;  3QT7 A;  1KTV A;  4NXM E;  2HKJ A;  4JI1 I;  4Z7Y A;  1MX0 A;  3H4L A;  1I94 E;  4X65 I;  3T1Y I;  4DXL A;  3WU3 A;  4DV6 I;  4JI8 I;  4WUD A;  2Z5C A;  3K1J A;  2J7K A;  4P52 A;  1Z59 A;  4LF5 E;  1XMQ E;  4X66 E;  2CG9 A;  3QT6 A;  1HNX E;  5GME A;  1Z0W A;  2R3V A;  1FI4 A;  1NHJ A;  1Y6Z A;  4JYA E;  4URL A;  4FWG A;  4IZJ D;  4X62 E;  4JI0 I;  5LL6 R;  2ZM6 I;  4DR4 I;  1ELO A;  1EA6 A;  2VQF I;  1FKA E;  3J80 Q;  4B3S E;  2UUC I;  4LF8 E;  3V5R A;  2IOQ A;  2UXD E;  4USM A;  2WW4 A;  4DR7 E;  1QZR A;  2HHH I;  1OJ4 A;  2Z5B B;  3B82 A;  1WUU A;  1N32 E;  2HFS A;  1XNR I;  5BR8 I;  2UXB I;  4JI4 I;  1XNQ E;  4B3R I;  4DV5 E;  4LF9 I;  2UXC I;  4RPF A;  2UU9 I;  1S4E A;  4JI2 I;  3J7A M;  4HY1 A;  1HK7 A;  1Z0C A;  2HKE A;  4HXZ A;  4ZVI A;  4XTJ A;  1PVG A;  2O1W A;  4UTG A;  1U2R A;  5LMU E;  4LFB E;  4DUZ I;  4GKK I;  2E5L E;  4DR1 E;  4K0K I;  4OX9 I;  4DU7 A;  1MG7 A;  4M1K A;  2GQ0 A;  4JI1 E;  2V2Z A;  4X65 E;  4JI7 I;  3T1Y E;  2ZBK B;  2AJ4 A;  4FW9 A;  3CWV A;  4DR6 I;  1HR0 I;  4DPY A;  3J81 C;  4DV6 E;  3GON A;  4JI8 E;  4FWH A;  2CGE A;  4FWD A;  4EMD A;  5A2Q Q;  2GS8 A;  3K17 A;  3M6A A;  2VF3 A;  1J5E I;  3QT5 A;  4JV5 E;  4DUY I;  4B3M I;  3B8H A;  2ZM6 E;  4DV2 I;  4DR4 E;  1N36 I;  1N34 I;  3WU5 A;  2VQF E;  1VIS A;  1Z0T A;  4AQY I;  1XHK A;  2Q2E B;  4LF6 I;  2Z5B A;  2UUC E;  4DV7 I;  1IBK E;  1B62 A;  2O1V A;  4DV3 I;  2HHH E;  4LFC I;  1ZM2 A;  3ZZ0 A;  1RRE A;  2DEI A;  2PNM A;  1XNR E;  5BR8 E;  2BM0 A;  4FN5 A;  4JI4 E;  1ZM3 A;  4LF9 E;  1S16 A;  1FJG I;  2UU9 E;  5IT9 Q;  4P7A A;  4JI2 E;  2A2D A;  1N33 E;  4DU8 A;  4KHP I;  2A2C A;  2VQE E;  4HAC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...