4DR5I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr5I00
4DPUA 1H73A 4KHPE 4LF7I 2V34A 2A2DA 4DXLA 1RR9A 1N32E 4X64I 3HULA 3PYEA 4DPYA 4DV2E 4WUDA 4RPFA 1N36I 1Z0CA 2ZITA 4DR4E 1HNXE 1XMQE 4NXNE 4HY1A 2ZBKB 1XNQE 4ED4A 4LF8E 1IBME 4UTGA 3QT5A 4LFCI 4JI3E 1K47A 4FWGA 2X7IA 4B3SI 1NHHA 2XEXA 1J5EE 3J80Q 3J81C 1FNMA 4K0KI 3ZZTA 2HKEA 4DR6E 4EMDA 1H72C 3PYGA 1ZM2A 1Z0VA 1N34I 4LF7E 2WW4A 1FWKA 4X64E 4DV4I 1VISA 3OTOI 4URLA 3J81Q 1H7SA 1KKHA 5LMNI 2VF3A 4X62I 4JI7I 1N36E 4JI4I 2UUCI 1B62A 1NZ0A 4B3MI 5LMUI 4DV5I 4JI6I 1H74A 4Z7CA 1ZM9A 4DPXA 4JV5I 4MYTA 2HK3A 2R3VA 2F4VI 1Z0WA 3F0NA 4LFCE 1OJ4A 4B3SE 3CWVA 1KIJA 1RREA 3QT7A 4DR3I 3WU6A 4K0KE 2UUAI 2UXBI 1Z0GA 2UXCI 1KTVA 2ZM6I 4WUBA 1EA6A 1N34E 5FLXC 2V2ZA 1Z0BA 4GKJI 4DV4E 1H7UA 3OTOE 1EI1A 5LMNE 1HNWI 4DU8A 2HK2A 4X62E 3QT8A 4DR5I 4JI7E 2E5LI 4JI4E 4YY3I 2UUCE 2UU9I 5FLXQ 4B3ME 1B63A 5LMUE 4DV5E 4JI6E 4FWHA 4FN5A 5GMEA 2BV3A 2V2VA 4DV0I 3K17A 3B82A 5BR8I 2UXDI 1HR0I 3J80C 4JV5E 3WU3A 2F4VE 4HACA 4PU9A 1ELOA 4WUCA 4DR2I 4NXMI 1I94I 3ZM7A 4LFBI 5L3JA 1MX0A 2A2CA 4HACB 4DR3E 4AQYI 4LF9I 1FWLA 3H4LA 1Z59A 3T1HI 2UUAE 2UXBE 4DU7A 4OX9I 2UXCE 4PRVA 4DV1I 2ZM6E 3LTOA 1WUUA 4DR7I 4FW9A 4DV6I 2X36A 4LF6I 4GKJE 4HXZA 1MG7A 3M6AA 1ZM4A 4I3HA 1HNWE 4DR1I 4DPWA 4DR5E 2E5LE 4JG4A 4JI5I 4YY3E 2UU9E 1QZRA 1ZM3A 1FI4A 3K1JA 2UUBI 4PRXA 4DV0E 2HFUA 5BR8E 2UXDE 1HR0E 1D6TA 4KQVA 4Z7YA 1S16A 4DR2E 4NXME 1I94E 4JYAI 4LFBE 1N33I 1Z0TA 4AQYE 4LF9E 4DV7I 1KVKA 4FWDA 2Q2EB 1IBLI 4HYMA 3T1HE 3V5RA 4OX9E 3LPSA 4LFAI 4DV1E 3D4JA 4DR7E 4DV6E 2OI2A 4B3TI 1FJGI 2DEIA 3WU4A 4LF6E 1PKPA 1NHIA 2VQFI 3T1YI 4DR1E 1PVGA 5IWAI 4JI5E 2HFSA 4B3RI 2LJPA 3LNUA 2UUBE 3QT6A 4R1FA 3B78A 4JI2I 4X65I 1Z5AA 2NPFA 1BKNA 3PYDA 1N0UA 2CZ9A 4ZVIA 4DV3I 4JYAE 2BM0A 1N33E 1ZXMA 4JI1I 4DPTA 1XNRI 4DV7E 1IBKI 1HNZI 1IBLE 1MU5A 1Z5CA 2EFGA 3Q1QA 4LFAE 4GKKI 4P52A 2V8PA 4YHHI 4DUZI 4JI0I 4B3TE 1FJGE 1Z0EA 5IT9C 1ZXNA 2VQEI 4LF4I 1Z5BA 2V2QA 4X66I 4LF5I 2VQFE 3T1YE 1NHJA 3ZZ0A 1DARA 5IWAE 3PYFA 4JI8I 3WU5A 2E1RA 1UEKA 3V2UC 4B3RE 2HHHI 3J7AG 3ZZUA 5IT9Q 1XHKA 4DUYI 1A6FA 4JI2E 1XMOI 4X65E 5LL6R 5GMDA 4MYUA 4KHPI 2BM1A 4M1KA 4XTJA 1PIEA 1N32I 2HKJA 2J7KA 4DV3E 3JAMC 4JI1E 4DV2I 1S4EA 1N0VC 1XNRE 1IBKE 1HNZE 4P7AA 4UT4A 4USKA 4USMA 4DR4I 1HNXI 2R42A 4GKKE 1XMQI 4NXNI 4YHHE 4DUZE 4JI0E 2AJ4A 3JAMQ 1XNQI 3J7AM 1FKAE 3GONA 2GS8A 4LF8I 2VQEE 4LF4E 1IBMI 1U2RA 4LF5E 4X66E 5A2QC 3ZKDA 4JI3I 3ZKBA 4JI8E 2DEJA 2HHHE 1J5EI 4DUYE 1XMOE 4DR6I 5A2QQ 3B8HA
chains in the Genus database with same CATH superfamily
4DPUA 4LCFA 4FW5A 4GQUA 1H73A 4IS9A 4KHPE 4LF7I 2V34A 2A2DA 4DXLA 1RR9A 1YH8A 2BA1D 1N32E 4X64I 3HULA 3PYEA 4DPYA 4DV2E 4WUDA 4AM3A 4LCGA 4RPFA 2IOPA 1N36I 1Z0CA 2ZITA 4DR4E 3K85A 1HNXE 1USUA 1XMQE 4NXNE 4HY1A 2ZBKB 1XNQE 4ED4A 4OO1B 4LF8E 4IZJB 1IBME 4UTGA 3QT5A 4LFCI 5JEAC 4JI3E 1K47A 4FWGA 3PS3A 2X7IA 4B3SI 1NHHA 2XEXA 1J5EE 2C37A 4MU0A 3J80Q 2WNRA 4QNKA 3J81C 1FNMA 4K0KI 3ZZTA 2C37B 2HKEA 2WNRB 3L7ZA 4DR6E 2NN6A 4EMDA 1H72C 5K36A 4NBQA 1RHYA 3PYGA 1ZM2A 1Z0VA 1N34I 1Y5YA 2PNLA 4LF7E 2WW4A 2NN6B 1FWKA 5K36B 4X64E 4IFDC 4DV4I 1VISA 3OTOI 4URLA 3J81Q 1H7SA 4MQYA 5C0XD 1KKHA 5LMNI 3H1CA 2VF3A 4X62I 1R6LA 2GQ0A 4JI7I 1N36E 4JI4I 5C0XF 2UUCI 1B62A 1NZ0A 4B3MI 5EL9A 2JEAA 5LMUI 2CGEA 4DV5I 5C0XA 4JI6I 1H74A 4LOMA 2BR2A 4Z7CA 1ZM9A 2JEAB 4DPXA 4JV5I 4MYTA 4IFDB 2HK3A 2R3VA 2F4VI 1Z0WA 3F0NA 2JE6A 4LFCE 5C0XE 5DRQA 1OJ4A 4B3SE 2O1UA 3CWVA 1KIJA 1USVA 2JE6B 1RREA 3P06A 3QT7A 4DR3I 3WU6A 4K0KE 2UUAI 2UXBI 1Z0GA 2UXCI 2CG9A 1KTVA 2ZM6I 4WUBA 2BA1G 4BA1B 1EA6A 1UDSA 1HK7A 1N34E 2IERA 2JEBA 4AIMA 5FLXC 2V2ZA 1Z0BA 4GKJI 3P76A 4DV4E 1H7UA 3OTOE 2JEBB 1EI1A 5LMNE 1HNWI 4DU8A 2HK2A 4X62E 4OO1D 3M7ND 3CDJA 3QT8A 4DR5I 2VESA 4IZJD 4JI7E 2E5LI 2IOQA 4JI4E 2WP8A 4YY3I 2UUCE 2UU9I 1E3HA 4OO1F 5FLXQ 4FW3A 4B3ME 5EKWA 1B63A 1UDNA 5LMUE 4DV5E 4JI6E 2WP8B 4FWHA 4FN5A 5DNLA 5GMEA 4OO1A 2BV3A 2V2VA 2CVEA 3K17A 4DV0I 3B82A 4IZJA 5BR8I 2UXDI 1HR0I 3J80C 4JV5E 3WU3A 2F4VE 4HACA 4PU9A 1ELOA 4WUCA 4OO1E 4DR2I 4NXMI 1I94I 3ZM7A 4LFBI 5L3JA 3Q6NA 2NN6D 1MX0A 2A2CA 4HACB 4DR3E 3PS2A 4AQYI 4LF9I 5K36D 1FWLA 3H4LA 4FW7A 1Z59A 2C38B 3T1HI 2UUAE 2UXBE 2NN6F 4DU7A 4OX9I 2UXCE 4PRVA 2Z5BA 2ZM6E 4DV1I 5K36F 2JT2A 4U3BA 3B4TA 1WUUA 3LTOA 4DR7I 5JEAA 4FW9A 4DV6I 3PS1A 3KRNA 2Z5BB 2X36A 4LF6I 4GKJE 4HXZA 1MG7A 1P42A 3M6AA 1E3PA 5JEAB 1ZM4A 4I3HA 2J65A 5DNXA 1HNWE 2NN6E 1Y60A 2O1WA 4DR1I 4DPWA 5K36E 4DR5E 4IFDD 2E5LE 4JG4A 4JI5I 4YY3E 2UU9E 1QZRA 1ZM3A 1FI4A 5ELWA 4IFDF 3K1JA 4LPFA 2UUBI 1R6MA 4PRXA 4DV0E 2HFUA 4IFDA 1XXEA 5BR8E 2UXDE 1HR0E 1D6TA 5C0XC 1OYPA 4FW6A 5FWKA 4KQVA 4Z7YA 2PO0A 1S16A 4DR2E 2Z5CA 4NXME 1I94E 4IFDE 4JYAI 4LFBE 1N33I 1Z0TA 4MU1A 3U1YA 4AQYE 4LF9E 2PO0B 4DV7I 1KVKA 4FWDA 2Z5CB 2Q2EB 1IBLI 4HYMA 1UDOA 3T1HE 2BA0D 3M85D 3V5RA 4OX9E 3LPSA 4LFAI 4DV1E 4BA1A 3D4JA 5DRPA 4DR7E 4DV6E 2OI2A 4B3TI 1FJGI 2DEIA 3PRYA 3WU4A 4LF6E 3M7NG 4QNJA 1PKPA 4AIDA 1NHIA 4ISAA 4LCHA 1Y4UA 2VQFI 3T1YI 3GCMA 4DR1E 4OZEA 1PVGA 5IWAI 4JI5E 1OYRA 3UHMA 2HFSA 4B3RI 2LJPA 1YHCA 3LNUA 2PNZA 3QT6A 2UUBE 4BA2A 4R1FA 3NZKA 3B78A 4JI2I 4X65I 2PNZB 1Y6ZA 4BA2B 1Z5AA 3U1KA 2NPFA 4OO1C 1BKNA 3PYDA 4OKGA 1N0UA 2CZ9A 4ZVIA 4DV3I 4JYAE 2BM0A 3P3CA 1N33E 1ZXMA 4JI1I 4DPTA 1XNRI 4DV7E 1IBKI 1HNZI 2C38A 5JEAD 1IBLE 1MU5A 2GO4A 1Z5CA 2GO3A 2EFGA 3Q1QA 4LFAE 2F1DA 4GKKI 4P52A 2V8PA 5JEAF 1Y4SA 4YHHI 4DUZI 4JI0I 3Q6MA 4IZKA 4B3TE 2IESA 1FJGE 1Z0EA 5IT9C 1ZXNA 2NN6C 4MU4A 4IZKB 2VQEI 5DROA 4LF4I 4N3OA 5K36C 1Z5BA 2V2QA 4X66I 4LF5I 2VQFE 3T1YE 1NHJA 3ZZ0A 1DARA 3HJCA 5IWAE 3PYFA 4JI8I 5JEAE 3WU5A 2E1RA 2O1TA 1UEKA 2AE8A 3V2UC 4B3RE 2HHHI 3DD6A 3J7AG 3ZZUA 5IT9Q 1XHKA 3CDIA 4DUYI 1A6FA 2O3ZA 4JI2E 1XMOI 4X65E 5LL6R 3L7ZB 5GMDA 1OYSA 3GMEA 4MYUA 4KHPI 2BM1A 4M1KA 4XTJA 1PIEA 4MU3A 2PO1A 1N32I 2HKJA 2J7KA 4DV3E 3JAMC 4JI1E 2BA0G 3M85G 1S4EA 4DV2I 1N0VC 1XNRE 1IBKE 1HNZE 2PO1B 2Z5EA 4P7AA 4UT4A 3P3EA 4USKA 4USMA 4DR4I 2C39A 1HNXI 2R42A 4GKKE 1XMQI 4NXNI 4YHHE 4DUZE 4JI0E 2AJ4A 1VI7A 3JAMQ 2PNMA 4U3DA 5C0XB 2C39B 1XNQI 3J7AM 1FKAE 3GONA 3GLLA 3HKMA 2BR2B 2GS8A 2VQEE 4LF8I 4LF4E 2PO2A 2O1VA 1U2RA 1IBMI 4LF5E 4X66E 5A2QC 3ZKDA 4JI3I 3ZKBA 3P3GA 4JI8E 2PO2B 1UDQA 2DEJA 2HHHE 1J5EI 4FW4A 4J3DA 4DUYE 1XMOE 4DR6I 5A2QQ 5DRRA 3B8HA 4MDTA
chains in the Genus database with same CATH topology
4DPUA 1H73A 4KHPE 4LF7I 2V34A 2A2DA 4DXLA 1RR9A 1N32E 4X64I 3HULA 3PYEA 4DPYA 4DV2E 4WUDA 4RPFA 2IOPA 1N36I 1Z0CA 2ZITA 4DR4E 3K85A 1HNXE 1USUA 1XMQE 4NXNE 4HY1A 2ZBKB 1XNQE 4ED4A 4LF8E 4IZJB 1IBME 4UTGA 3QT5A 4LFCI 4JI3E 1K47A 4FWGA 2X7IA 4B3SI 1NHHA 2XEXA 1J5EE 3J80Q 3J81C 1FNMA 4K0KI 3ZZTA 2HKEA 4DR6E 4EMDA 1H72C 3PYGA 1ZM2A 1Z0VA 1N34I 2PNLA 4LF7E 2WW4A 1FWKA 4X64E 4DV4I 1VISA 3OTOI 4URLA 3J81Q 1H7SA 1KKHA 5LMNI 2VF3A 4X62I 2GQ0A 4JI7I 1N36E 4JI4I 2UUCI 1B62A 1NZ0A 4B3MI 5LMUI 2CGEA 4DV5I 4JI6I 1H74A 4Z7CA 1ZM9A 4DPXA 4JV5I 4MYTA 2HK3A 2R3VA 2F4VI 1Z0WA 3F0NA 4LFCE 1OJ4A 4B3SE 2O1UA 3CWVA 1KIJA 1USVA 1RREA 3P06A 3QT7A 4DR3I 3WU6A 4K0KE 2UUAI 2UXBI 1Z0GA 2UXCI 2CG9A 1KTVA 2ZM6I 4WUBA 1EA6A 1HK7A 1N34E 5FLXC 2V2ZA 1Z0BA 4GKJI 4DV4E 1H7UA 3OTOE 1EI1A 5LMNE 1HNWI 4DU8A 2HK2A 4X62E 3QT8A 4DR5I 4JI7E 4IZJD 2E5LI 2IOQA 4JI4E 4YY3I 2UUCE 2UU9I 5FLXQ 4B3ME 1B63A 5LMUE 4DV5E 4JI6E 4FWHA 4FN5A 5GMEA 2BV3A 2V2VA 4DV0I 3K17A 3B82A 4IZJA 5BR8I 2UXDI 1HR0I 3J80C 4JV5E 3WU3A 2F4VE 4HACA 4PU9A 1ELOA 4WUCA 4DR2I 4NXMI 1I94I 3ZM7A 4LFBI 5L3JA 3Q6NA 1MX0A 2A2CA 4HACB 4DR3E 4AQYI 4LF9I 1FWLA 3H4LA 1Z59A 3T1HI 2UUAE 2UXBE 4DU7A 4OX9I 2UXCE 4PRVA 2Z5BA 2ZM6E 4DV1I 3LTOA 1WUUA 4DR7I 4FW9A 4DV6I 2Z5BB 2X36A 4LF6I 4GKJE 4HXZA 1MG7A 3M6AA 1ZM4A 4I3HA 1HNWE 2O1WA 4DR1I 4DPWA 4DR5E 2E5LE 4JG4A 4JI5I 4YY3E 2UU9E 1QZRA 1ZM3A 1FI4A 3K1JA 2UUBI 4PRXA 4DV0E 2HFUA 5BR8E 2UXDE 1HR0E 1D6TA 5FWKA 4KQVA 4Z7YA 1S16A 4DR2E 2Z5CA 4NXME 1I94E 4JYAI 4LFBE 1N33I 1Z0TA 4AQYE 4LF9E 4DV7I 1KVKA 4FWDA 2Z5CB 2Q2EB 1IBLI 4HYMA 3T1HE 3V5RA 4OX9E 3LPSA 4LFAI 4DV1E 3D4JA 4DR7E 4DV6E 2OI2A 4B3TI 1FJGI 2DEIA 3PRYA 3WU4A 4LF6E 1PKPA 1NHIA 1Y4UA 2VQFI 3T1YI 4DR1E 1PVGA 5IWAI 4JI5E 2HFSA 4B3RI 2LJPA 3LNUA 3QT6A 2UUBE 4R1FA 3B78A 4JI2I 4X65I 1Y6ZA 1Z5AA 2NPFA 1BKNA 3PYDA 1N0UA 2CZ9A 4ZVIA 4DV3I 4JYAE 2BM0A 1N33E 1ZXMA 4JI1I 4DPTA 1XNRI 4DV7E 1IBKI 1HNZI 1IBLE 1MU5A 1Z5CA 2EFGA 3Q1QA 4LFAE 4GKKI 4P52A 2V8PA 1Y4SA 4YHHI 4DUZI 4JI0I 3Q6MA 4IZKA 4B3TE 1FJGE 1Z0EA 5IT9C 1ZXNA 4IZKB 2VQEI 4LF4I 4N3OA 1Z5BA 2V2QA 4X66I 4LF5I 2VQFE 3T1YE 1NHJA 3ZZ0A 1DARA 3HJCA 5IWAE 3PYFA 4JI8I 3WU5A 2E1RA 2O1TA 1UEKA 3V2UC 4B3RE 2HHHI 3J7AG 3ZZUA 5IT9Q 1XHKA 4DUYI 1A6FA 4JI2E 1XMOI 4X65E 5LL6R 5GMDA 4MYUA 4KHPI 2BM1A 4M1KA 4XTJA 1PIEA 1N32I 2HKJA 2J7KA 4DV3E 3JAMC 4JI1E 4DV2I 1S4EA 1N0VC 1XNRE 1IBKE 1HNZE 2Z5EA 4P7AA 4UT4A 4USKA 4USMA 4DR4I 1HNXI 2R42A 4GKKE 1XMQI 4NXNI 4YHHE 4DUZE 4JI0E 2AJ4A 3JAMQ 2PNMA 1XNQI 3J7AM 1FKAE 3GONA 2GS8A 4LF8I 2VQEE 4LF4E 2O1VA 1U2RA 1IBMI 4LF5E 4X66E 5A2QC 3ZKDA 4JI3I 3ZKBA 4JI8E 2DEJA 2HHHE 1J5EI 4DUYE 1XMOE 4DR6I 5A2QQ 3B8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPU A;  1H73 A;  4KHP E;  4LF7 I;  2V34 A;  2A2D A;  4DXL A;  1RR9 A;  1N32 E;  4X64 I;  3HUL A;  3PYE A;  4DPY A;  4DV2 E;  4WUD A;  4RPF A;  1N36 I;  1Z0C A;  2ZIT A;  4DR4 E;  1HNX E;  1XMQ E;  4NXN E;  4HY1 A;  2ZBK B;  1XNQ E;  4ED4 A;  4LF8 E;  1IBM E;  4UTG A;  3QT5 A;  4LFC I;  4JI3 E;  1K47 A;  4FWG A;  2X7I A;  4B3S I;  1NHH A;  2XEX A;  1J5E E;  3J80 Q;  3J81 C;  1FNM A;  4K0K I;  3ZZT A;  2HKE A;  4DR6 E;  4EMD A;  1H72 C;  3PYG A;  1ZM2 A;  1Z0V A;  1N34 I;  4LF7 E;  2WW4 A;  1FWK A;  4X64 E;  4DV4 I;  1VIS A;  3OTO I;  4URL A;  3J81 Q;  1H7S A;  1KKH A;  5LMN I;  2VF3 A;  4X62 I;  4JI7 I;  1N36 E;  4JI4 I;  2UUC I;  1B62 A;  1NZ0 A;  4B3M I;  5LMU I;  4DV5 I;  4JI6 I;  1H74 A;  4Z7C A;  1ZM9 A;  4DPX A;  4JV5 I;  4MYT A;  2HK3 A;  2R3V A;  2F4V I;  1Z0W A;  3F0N A;  4LFC E;  1OJ4 A;  4B3S E;  3CWV A;  1KIJ A;  1RRE A;  3QT7 A;  4DR3 I;  3WU6 A;  4K0K E;  2UUA I;  2UXB I;  1Z0G A;  2UXC I;  1KTV A;  2ZM6 I;  4WUB A;  1EA6 A;  1N34 E;  5FLX C;  2V2Z A;  1Z0B A;  4GKJ I;  4DV4 E;  1H7U A;  3OTO E;  1EI1 A;  5LMN E;  1HNW I;  4DU8 A;  2HK2 A;  4X62 E;  3QT8 A;  4DR5 I;  4JI7 E;  2E5L I;  4JI4 E;  4YY3 I;  2UUC E;  2UU9 I;  5FLX Q;  4B3M E;  1B63 A;  5LMU E;  4DV5 E;  4JI6 E;  4FWH A;  4FN5 A;  5GME A;  2BV3 A;  2V2V A;  4DV0 I;  3K17 A;  3B82 A;  5BR8 I;  2UXD I;  1HR0 I;  3J80 C;  4JV5 E;  3WU3 A;  2F4V E;  4HAC A;  4PU9 A;  1ELO A;  4WUC A;  4DR2 I;  4NXM I;  1I94 I;  3ZM7 A;  4LFB I;  5L3J A;  1MX0 A;  2A2C A;  4HAC B;  4DR3 E;  4AQY I;  4LF9 I;  1FWL A;  3H4L A;  1Z59 A;  3T1H I;  2UUA E;  2UXB E;  4DU7 A;  4OX9 I;  2UXC E;  4PRV A;  4DV1 I;  2ZM6 E;  3LTO A;  1WUU A;  4DR7 I;  4FW9 A;  4DV6 I;  2X36 A;  4LF6 I;  4GKJ E;  4HXZ A;  1MG7 A;  3M6A A;  1ZM4 A;  4I3H A;  1HNW E;  4DR1 I;  4DPW A;  4DR5 E;  2E5L E;  4JG4 A;  4JI5 I;  4YY3 E;  2UU9 E;  1QZR A;  1ZM3 A;  1FI4 A;  3K1J A;  2UUB I;  4PRX A;  4DV0 E;  2HFU A;  5BR8 E;  2UXD E;  1HR0 E;  1D6T A;  4KQV A;  4Z7Y A;  1S16 A;  4DR2 E;  4NXM E;  1I94 E;  4JYA I;  4LFB E;  1N33 I;  1Z0T A;  4AQY E;  4LF9 E;  4DV7 I;  1KVK A;  4FWD A;  2Q2E B;  1IBL I;  4HYM A;  3T1H E;  3V5R A;  4OX9 E;  3LPS A;  4LFA I;  4DV1 E;  3D4J A;  4DR7 E;  4DV6 E;  2OI2 A;  4B3T I;  1FJG I;  2DEI A;  3WU4 A;  4LF6 E;  1PKP A;  1NHI A;  2VQF I;  3T1Y I;  4DR1 E;  1PVG A;  5IWA I;  4JI5 E;  2HFS A;  4B3R I;  2LJP A;  3LNU A;  2UUB E;  3QT6 A;  4R1F A;  3B78 A;  4JI2 I;  4X65 I;  1Z5A A;  2NPF A;  1BKN A;  3PYD A;  1N0U A;  2CZ9 A;  4ZVI A;  4DV3 I;  4JYA E;  2BM0 A;  1N33 E;  1ZXM A;  4JI1 I;  4DPT A;  1XNR I;  4DV7 E;  1IBK I;  1HNZ I;  1IBL E;  1MU5 A;  1Z5C A;  2EFG A;  3Q1Q A;  4LFA E;  4GKK I;  4P52 A;  2V8P A;  4YHH I;  4DUZ I;  4JI0 I;  4B3T E;  1FJG E;  1Z0E A;  5IT9 C;  1ZXN A;  2VQE I;  4LF4 I;  1Z5B A;  2V2Q A;  4X66 I;  4LF5 I;  2VQF E;  3T1Y E;  1NHJ A;  3ZZ0 A;  1DAR A;  5IWA E;  3PYF A;  4JI8 I;  3WU5 A;  2E1R A;  1UEK A;  3V2U C;  4B3R E;  2HHH I;  3J7A G;  3ZZU A;  5IT9 Q;  1XHK A;  4DUY I;  1A6F A;  4JI2 E;  1XMO I;  4X65 E;  5LL6 R;  5GMD A;  4MYU A;  4KHP I;  2BM1 A;  4M1K A;  4XTJ A;  1PIE A;  1N32 I;  2HKJ A;  2J7K A;  4DV3 E;  3JAM C;  4JI1 E;  4DV2 I;  1S4E A;  1N0V C;  1XNR E;  1IBK E;  1HNZ E;  4P7A A;  4UT4 A;  4USK A;  4USM A;  4DR4 I;  1HNX I;  2R42 A;  4GKK E;  1XMQ I;  4NXN I;  4YHH E;  4DUZ E;  4JI0 E;  2AJ4 A;  3JAM Q;  1XNQ I;  3J7A M;  1FKA E;  3GON A;  2GS8 A;  4LF8 I;  2VQE E;  4LF4 E;  1IBM I;  1U2R A;  4LF5 E;  4X66 E;  5A2Q C;  3ZKD A;  4JI3 I;  3ZKB A;  4JI8 E;  2DEJ A;  2HHH E;  1J5E I;  4DUY E;  1XMO E;  4DR6 I;  5A2Q Q;  3B8H A; 
#chains in the Genus database with same CATH topology
 4DPU A;  4LCF A;  4FW5 A;  4GQU A;  1H73 A;  4IS9 A;  4KHP E;  4LF7 I;  2V34 A;  2A2D A;  4DXL A;  1RR9 A;  1YH8 A;  2BA1 D;  1N32 E;  4X64 I;  3HUL A;  3PYE A;  4DPY A;  4DV2 E;  4WUD A;  4AM3 A;  4LCG A;  4RPF A;  2IOP A;  1N36 I;  1Z0C A;  2ZIT A;  4DR4 E;  3K85 A;  1HNX E;  1USU A;  1XMQ E;  4NXN E;  4HY1 A;  2ZBK B;  1XNQ E;  4ED4 A;  4OO1 B;  4LF8 E;  4IZJ B;  1IBM E;  4UTG A;  3QT5 A;  4LFC I;  5JEA C;  4JI3 E;  1K47 A;  4FWG A;  3PS3 A;  2X7I A;  4B3S I;  1NHH A;  2XEX A;  1J5E E;  2C37 A;  4MU0 A;  3J80 Q;  2WNR A;  4QNK A;  3J81 C;  1FNM A;  4K0K I;  3ZZT A;  2C37 B;  2HKE A;  2WNR B;  3L7Z A;  4DR6 E;  2NN6 A;  4EMD A;  1H72 C;  5K36 A;  4NBQ A;  1RHY A;  3PYG A;  1ZM2 A;  1Z0V A;  1N34 I;  1Y5Y A;  2PNL A;  4LF7 E;  2WW4 A;  2NN6 B;  1FWK A;  5K36 B;  4X64 E;  4IFD C;  4DV4 I;  1VIS A;  3OTO I;  4URL A;  3J81 Q;  1H7S A;  4MQY A;  5C0X D;  1KKH A;  5LMN I;  3H1C A;  2VF3 A;  4X62 I;  1R6L A;  2GQ0 A;  4JI7 I;  1N36 E;  4JI4 I;  5C0X F;  2UUC I;  1B62 A;  1NZ0 A;  4B3M I;  5EL9 A;  2JEA A;  5LMU I;  2CGE A;  4DV5 I;  5C0X A;  4JI6 I;  1H74 A;  4LOM A;  2BR2 A;  4Z7C A;  1ZM9 A;  2JEA B;  4DPX A;  4JV5 I;  4MYT A;  4IFD B;  2HK3 A;  2R3V A;  2F4V I;  1Z0W A;  3F0N A;  2JE6 A;  4LFC E;  5C0X E;  5DRQ A;  1OJ4 A;  4B3S E;  2O1U A;  3CWV A;  1KIJ A;  1USV A;  2JE6 B;  1RRE A;  3P06 A;  3QT7 A;  4DR3 I;  3WU6 A;  4K0K E;  2UUA I;  2UXB I;  1Z0G A;  2UXC I;  2CG9 A;  1KTV A;  2ZM6 I;  4WUB A;  2BA1 G;  4BA1 B;  1EA6 A;  1UDS A;  1HK7 A;  1N34 E;  2IER A;  2JEB A;  4AIM A;  5FLX C;  2V2Z A;  1Z0B A;  4GKJ I;  3P76 A;  4DV4 E;  1H7U A;  3OTO E;  2JEB B;  1EI1 A;  5LMN E;  1HNW I;  4DU8 A;  2HK2 A;  4X62 E;  4OO1 D;  3M7N D;  3CDJ A;  3QT8 A;  4DR5 I;  2VES A;  4IZJ D;  4JI7 E;  2E5L I;  2IOQ A;  4JI4 E;  2WP8 A;  4YY3 I;  2UUC E;  2UU9 I;  1E3H A;  4OO1 F;  5FLX Q;  4FW3 A;  4B3M E;  5EKW A;  1B63 A;  1UDN A;  5LMU E;  4DV5 E;  4JI6 E;  2WP8 B;  4FWH A;  4FN5 A;  5DNL A;  5GME A;  4OO1 A;  2BV3 A;  2V2V A;  2CVE A;  3K17 A;  4DV0 I;  3B82 A;  4IZJ A;  5BR8 I;  2UXD I;  1HR0 I;  3J80 C;  4JV5 E;  3WU3 A;  2F4V E;  4HAC A;  4PU9 A;  1ELO A;  4WUC A;  4OO1 E;  4DR2 I;  4NXM I;  1I94 I;  3ZM7 A;  4LFB I;  5L3J A;  3Q6N A;  2NN6 D;  1MX0 A;  2A2C A;  4HAC B;  4DR3 E;  3PS2 A;  4AQY I;  4LF9 I;  5K36 D;  1FWL A;  3H4L A;  4FW7 A;  1Z59 A;  2C38 B;  3T1H I;  2UUA E;  2UXB E;  2NN6 F;  4DU7 A;  4OX9 I;  2UXC E;  4PRV A;  2Z5B A;  2ZM6 E;  4DV1 I;  5K36 F;  2JT2 A;  4U3B A;  3B4T A;  1WUU A;  3LTO A;  4DR7 I;  5JEA A;  4FW9 A;  4DV6 I;  3PS1 A;  3KRN A;  2Z5B B;  2X36 A;  4LF6 I;  4GKJ E;  4HXZ A;  1MG7 A;  1P42 A;  3M6A A;  1E3P A;  5JEA B;  1ZM4 A;  4I3H A;  2J65 A;  5DNX A;  1HNW E;  2NN6 E;  1Y60 A;  2O1W A;  4DR1 I;  4DPW A;  5K36 E;  4DR5 E;  4IFD D;  2E5L E;  4JG4 A;  4JI5 I;  4YY3 E;  2UU9 E;  1QZR A;  1ZM3 A;  1FI4 A;  5ELW A;  4IFD F;  3K1J A;  4LPF A;  2UUB I;  1R6M A;  4PRX A;  4DV0 E;  2HFU A;  4IFD A;  1XXE A;  5BR8 E;  2UXD E;  1HR0 E;  1D6T A;  5C0X C;  1OYP A;  4FW6 A;  5FWK A;  4KQV A;  4Z7Y A;  2PO0 A;  1S16 A;  4DR2 E;  2Z5C A;  4NXM E;  1I94 E;  4IFD E;  4JYA I;  4LFB E;  1N33 I;  1Z0T A;  4MU1 A;  3U1Y A;  4AQY E;  4LF9 E;  2PO0 B;  4DV7 I;  1KVK A;  4FWD A;  2Z5C B;  2Q2E B;  1IBL I;  4HYM A;  1UDO A;  3T1H E;  2BA0 D;  3M85 D;  3V5R A;  4OX9 E;  3LPS A;  4LFA I;  4DV1 E;  4BA1 A;  3D4J A;  5DRP A;  4DR7 E;  4DV6 E;  2OI2 A;  4B3T I;  1FJG I;  2DEI A;  3PRY A;  3WU4 A;  4LF6 E;  3M7N G;  4QNJ A;  1PKP A;  4AID A;  1NHI A;  4ISA A;  4LCH A;  1Y4U A;  2VQF I;  3T1Y I;  3GCM A;  4DR1 E;  4OZE A;  1PVG A;  5IWA I;  4JI5 E;  1OYR A;  3UHM A;  2HFS A;  4B3R I;  2LJP A;  1YHC A;  3LNU A;  2PNZ A;  3QT6 A;  2UUB E;  4BA2 A;  4R1F A;  3NZK A;  3B78 A;  4JI2 I;  4X65 I;  2PNZ B;  1Y6Z A;  4BA2 B;  1Z5A A;  3U1K A;  2NPF A;  4OO1 C;  1BKN A;  3PYD A;  4OKG A;  1N0U A;  2CZ9 A;  4ZVI A;  4DV3 I;  4JYA E;  2BM0 A;  3P3C A;  1N33 E;  1ZXM A;  4JI1 I;  4DPT A;  1XNR I;  4DV7 E;  1IBK I;  1HNZ I;  2C38 A;  5JEA D;  1IBL E;  1MU5 A;  2GO4 A;  1Z5C A;  2GO3 A;  2EFG A;  3Q1Q A;  4LFA E;  2F1D A;  4GKK I;  4P52 A;  2V8P A;  5JEA F;  1Y4S A;  4YHH I;  4DUZ I;  4JI0 I;  3Q6M A;  4IZK A;  4B3T E;  2IES A;  1FJG E;  1Z0E A;  5IT9 C;  1ZXN A;  2NN6 C;  4MU4 A;  4IZK B;  2VQE I;  5DRO A;  4LF4 I;  4N3O A;  5K36 C;  1Z5B A;  2V2Q A;  4X66 I;  4LF5 I;  2VQF E;  3T1Y E;  1NHJ A;  3ZZ0 A;  1DAR A;  3HJC A;  5IWA E;  3PYF A;  4JI8 I;  5JEA E;  3WU5 A;  2E1R A;  2O1T A;  1UEK A;  2AE8 A;  3V2U C;  4B3R E;  2HHH I;  3DD6 A;  3J7A G;  3ZZU A;  5IT9 Q;  1XHK A;  3CDI A;  4DUY I;  1A6F A;  2O3Z A;  4JI2 E;  1XMO I;  4X65 E;  5LL6 R;  3L7Z B;  5GMD A;  1OYS A;  3GME A;  4MYU A;  4KHP I;  2BM1 A;  4M1K A;  4XTJ A;  1PIE A;  4MU3 A;  2PO1 A;  1N32 I;  2HKJ A;  2J7K A;  4DV3 E;  3JAM C;  4JI1 E;  2BA0 G;  3M85 G;  1S4E A;  4DV2 I;  1N0V C;  1XNR E;  1IBK E;  1HNZ E;  2PO1 B;  2Z5E A;  4P7A A;  4UT4 A;  3P3E A;  4USK A;  4USM A;  4DR4 I;  2C39 A;  1HNX I;  2R42 A;  4GKK E;  1XMQ I;  4NXN I;  4YHH E;  4DUZ E;  4JI0 E;  2AJ4 A;  1VI7 A;  3JAM Q;  2PNM A;  4U3D A;  5C0X B;  2C39 B;  1XNQ I;  3J7A M;  1FKA E;  3GON A;  3GLL A;  3HKM A;  2BR2 B;  2GS8 A;  2VQE E;  4LF8 I;  4LF4 E;  2PO2 A;  2O1V A;  1U2R A;  1IBM I;  4LF5 E;  4X66 E;  5A2Q C;  3ZKD A;  4JI3 I;  3ZKB A;  3P3G A;  4JI8 E;  2PO2 B;  1UDQ A;  2DEJ A;  2HHH E;  1J5E I;  4FW4 A;  4J3D A;  4DUY E;  1XMO E;  4DR6 I;  5A2Q Q;  5DRR A;  3B8H A;  4MDT A; 
#chains in the Genus database with same CATH homology
 4DPU A;  1H73 A;  4KHP E;  4LF7 I;  2V34 A;  2A2D A;  4DXL A;  1RR9 A;  1N32 E;  4X64 I;  3HUL A;  3PYE A;  4DPY A;  4DV2 E;  4WUD A;  4RPF A;  2IOP A;  1N36 I;  1Z0C A;  2ZIT A;  4DR4 E;  3K85 A;  1HNX E;  1USU A;  1XMQ E;  4NXN E;  4HY1 A;  2ZBK B;  1XNQ E;  4ED4 A;  4LF8 E;  4IZJ B;  1IBM E;  4UTG A;  3QT5 A;  4LFC I;  4JI3 E;  1K47 A;  4FWG A;  2X7I A;  4B3S I;  1NHH A;  2XEX A;  1J5E E;  3J80 Q;  3J81 C;  1FNM A;  4K0K I;  3ZZT A;  2HKE A;  4DR6 E;  4EMD A;  1H72 C;  3PYG A;  1ZM2 A;  1Z0V A;  1N34 I;  2PNL A;  4LF7 E;  2WW4 A;  1FWK A;  4X64 E;  4DV4 I;  1VIS A;  3OTO I;  4URL A;  3J81 Q;  1H7S A;  1KKH A;  5LMN I;  2VF3 A;  4X62 I;  2GQ0 A;  4JI7 I;  1N36 E;  4JI4 I;  2UUC I;  1B62 A;  1NZ0 A;  4B3M I;  5LMU I;  2CGE A;  4DV5 I;  4JI6 I;  1H74 A;  4Z7C A;  1ZM9 A;  4DPX A;  4JV5 I;  4MYT A;  2HK3 A;  2R3V A;  2F4V I;  1Z0W A;  3F0N A;  4LFC E;  1OJ4 A;  4B3S E;  2O1U A;  3CWV A;  1KIJ A;  1USV A;  1RRE A;  3P06 A;  3QT7 A;  4DR3 I;  3WU6 A;  4K0K E;  2UUA I;  2UXB I;  1Z0G A;  2UXC I;  2CG9 A;  1KTV A;  2ZM6 I;  4WUB A;  1EA6 A;  1HK7 A;  1N34 E;  5FLX C;  2V2Z A;  1Z0B A;  4GKJ I;  4DV4 E;  1H7U A;  3OTO E;  1EI1 A;  5LMN E;  1HNW I;  4DU8 A;  2HK2 A;  4X62 E;  3QT8 A;  4DR5 I;  4JI7 E;  4IZJ D;  2E5L I;  2IOQ A;  4JI4 E;  4YY3 I;  2UUC E;  2UU9 I;  5FLX Q;  4B3M E;  1B63 A;  5LMU E;  4DV5 E;  4JI6 E;  4FWH A;  4FN5 A;  5GME A;  2BV3 A;  2V2V A;  4DV0 I;  3K17 A;  3B82 A;  4IZJ A;  5BR8 I;  2UXD I;  1HR0 I;  3J80 C;  4JV5 E;  3WU3 A;  2F4V E;  4HAC A;  4PU9 A;  1ELO A;  4WUC A;  4DR2 I;  4NXM I;  1I94 I;  3ZM7 A;  4LFB I;  5L3J A;  3Q6N A;  1MX0 A;  2A2C A;  4HAC B;  4DR3 E;  4AQY I;  4LF9 I;  1FWL A;  3H4L A;  1Z59 A;  3T1H I;  2UUA E;  2UXB E;  4DU7 A;  4OX9 I;  2UXC E;  4PRV A;  2Z5B A;  2ZM6 E;  4DV1 I;  3LTO A;  1WUU A;  4DR7 I;  4FW9 A;  4DV6 I;  2Z5B B;  2X36 A;  4LF6 I;  4GKJ E;  4HXZ A;  1MG7 A;  3M6A A;  1ZM4 A;  4I3H A;  1HNW E;  2O1W A;  4DR1 I;  4DPW A;  4DR5 E;  2E5L E;  4JG4 A;  4JI5 I;  4YY3 E;  2UU9 E;  1QZR A;  1ZM3 A;  1FI4 A;  3K1J A;  2UUB I;  4PRX A;  4DV0 E;  2HFU A;  5BR8 E;  2UXD E;  1HR0 E;  1D6T A;  5FWK A;  4KQV A;  4Z7Y A;  1S16 A;  4DR2 E;  2Z5C A;  4NXM E;  1I94 E;  4JYA I;  4LFB E;  1N33 I;  1Z0T A;  4AQY E;  4LF9 E;  4DV7 I;  1KVK A;  4FWD A;  2Z5C B;  2Q2E B;  1IBL I;  4HYM A;  3T1H E;  3V5R A;  4OX9 E;  3LPS A;  4LFA I;  4DV1 E;  3D4J A;  4DR7 E;  4DV6 E;  2OI2 A;  4B3T I;  1FJG I;  2DEI A;  3PRY A;  3WU4 A;  4LF6 E;  1PKP A;  1NHI A;  1Y4U A;  2VQF I;  3T1Y I;  4DR1 E;  1PVG A;  5IWA I;  4JI5 E;  2HFS A;  4B3R I;  2LJP A;  3LNU A;  3QT6 A;  2UUB E;  4R1F A;  3B78 A;  4JI2 I;  4X65 I;  1Y6Z A;  1Z5A A;  2NPF A;  1BKN A;  3PYD A;  1N0U A;  2CZ9 A;  4ZVI A;  4DV3 I;  4JYA E;  2BM0 A;  1N33 E;  1ZXM A;  4JI1 I;  4DPT A;  1XNR I;  4DV7 E;  1IBK I;  1HNZ I;  1IBL E;  1MU5 A;  1Z5C A;  2EFG A;  3Q1Q A;  4LFA E;  4GKK I;  4P52 A;  2V8P A;  1Y4S A;  4YHH I;  4DUZ I;  4JI0 I;  3Q6M A;  4IZK A;  4B3T E;  1FJG E;  1Z0E A;  5IT9 C;  1ZXN A;  4IZK B;  2VQE I;  4LF4 I;  4N3O A;  1Z5B A;  2V2Q A;  4X66 I;  4LF5 I;  2VQF E;  3T1Y E;  1NHJ A;  3ZZ0 A;  1DAR A;  3HJC A;  5IWA E;  3PYF A;  4JI8 I;  3WU5 A;  2E1R A;  2O1T A;  1UEK A;  3V2U C;  4B3R E;  2HHH I;  3J7A G;  3ZZU A;  5IT9 Q;  1XHK A;  4DUY I;  1A6F A;  4JI2 E;  1XMO I;  4X65 E;  5LL6 R;  5GMD A;  4MYU A;  4KHP I;  2BM1 A;  4M1K A;  4XTJ A;  1PIE A;  1N32 I;  2HKJ A;  2J7K A;  4DV3 E;  3JAM C;  4JI1 E;  4DV2 I;  1S4E A;  1N0V C;  1XNR E;  1IBK E;  1HNZ E;  2Z5E A;  4P7A A;  4UT4 A;  4USK A;  4USM A;  4DR4 I;  1HNX I;  2R42 A;  4GKK E;  1XMQ I;  4NXN I;  4YHH E;  4DUZ E;  4JI0 E;  2AJ4 A;  3JAM Q;  2PNM A;  1XNQ I;  3J7A M;  1FKA E;  3GON A;  2GS8 A;  4LF8 I;  2VQE E;  4LF4 E;  2O1V A;  1U2R A;  1IBM I;  4LF5 E;  4X66 E;  5A2Q C;  3ZKD A;  4JI3 I;  3ZKB A;  4JI8 E;  2DEJ A;  2HHH E;  1J5E I;  4DUY E;  1XMO E;  4DR6 I;  5A2Q Q;  3B8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...