4DR5I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr5I00
3QT8A 2UUAE 3WU6A 4LF6I 1UEKA 3JAMC 4DR2E 4AQYI 4URLA 2UXCI 2R42A 5GMDA 4LF9I 4FWDA 3JAMQ 1EA6A 1XMOE 2ZBKB 4KQVA 5LMNI 1XNQI 2A2CA 2UXBE 4FWGA 2OI2A 4GKKE 1KIJA 4X65I 4LF8I 4AQYE 1N36E 4DV6I 4EMDA 2UXCE 1A6FA 5BR8I 3PYFA 4DV1I 1HNWE 1B62A 4DR1I 1H74A 1N0UA 1XNQE 1IBKI 1ZM3A 4DUYE 2HHHE 4DR3I 4Z7CA 1HNZI 4DV2I 1IBMI 4B3TI 1NHIA 4WUDA 1Z5AA 2BV3A 4YY3I 2UXDI 3PYGA 4DXLA 4ED4A 2UU9E 4HACB 1ZXNA 4NXNI 4DV1E 3ZZ0A 4DPTA 4LF5I 3B78A 5LMUI 4DV4E 4FW9A 4DR3E 4LFCI 1FWKA 1HNZE 1N34I 1Z0BA 2VF3A 1HR0I 4YY3E 4X64E 4B3RE 4DPUA 3V5RA 1J5EE 2AJ4A 3K1JA 1Z0CA 1N33I 1Z5BA 4JG4A 1NHHA 2HKEA 4P52A 1ELOA 1Z59A 4R1FA 2HFUA 1VISA 4UTGA 5IWAI 4DR5E 1XNRI 2HFSA 3CWVA 3LTOA 4KHPE 3QT7A 3D4JA 2V2ZA 4OX9I 4FN5A 4JI1I 4K0KE 4B3SE 4LF7I 4JI5E 4JI6I 5IWAE 1XNRE 1B63A 1HNXI 4JI0E 2HK2A 3QT5A 4FWHA 4MYTA 1RR9A 2E1RA 2UUBI 3OTOI 4DU8A 1KVKA 1MX0A 4JI4I 1ZXMA 4HACA 2LJPA 2VQEI 2A2DA 1DARA 4JV5I 3HULA 1QZRA 4JI2I 4LF6E 4LFBI 1ZM2A 4DUZI 4DPWA 1KTVA 2XEXA 4LF9E 1Z0VA 2V2QA 2NPFA 3GONA 3ZZUA 1N0VC 3M6AA 5LMNE 4DV5I 5A2QC 4WUCA 2VQEE 4ZVIA 2DEJA 4X65E 5A2QQ 4P7AA 1N32I 1WUUA 4LF8E 4DV6E 1I94I 2HKJA 5BR8E 4LFAI 4DR1E 2F4VI 4X62I 1IBKE 1XMQI 4DR4I 1S16A 1ZM4A 1IBME 4DV2E 4B3TE 1FI4A 4X66I 2UXDE 4XTJA 4HXZA 2X7IA 3H4LA 4NXNE 3ZKDA 3F0NA 1XHKA 4DPXA 4JI7I 4LF5E 1H73A 3B8HA 5LMUE 4DV3I 4JI8I 4DR7I 3QT6A 4LFCE 4B3MI 4NXMI 1RREA 1N34E 3J7AM 4PU9A 1HR0E 4HYMA 2UUCI 1K47A 4DV7I 2E5LI 3J7AG 4DU7A 1FWLA 4DV0I 5IT9C 3ZKBA 2VQFI 1NZ0A 1N33E 4JI3I 1OJ4A 3T1HI 5IT9Q 4JYAI 2ZM6I 1MU5A 1Z0WA 4YHHI 1FJGI 4USMA 3T1YI 4GKJI 1H72C 4DPYA 3T1HE 2UUAI 1EI1A 3LNUA 4DR2I 4OX9E 2GS8A 2Q2EB 1FKAE 4JI1E 2ZITA 1XMOI 4LF7E 3V2UC 4PRVA 1BKNA 4JI6E 2UXBI 1KKHA 4GKKI 1HNXE 2CZ9A 4WUBA 1U2RA 1N36I 2UUBE 1MG7A 3OTOE 1HNWI 4JI4E 2BM1A 4DUYI 4PRXA 2HHHI 2HK3A 1Z5CA 4JV5E 4USKA 5L3JA 4JI2E 4LFBE 4DUZE 1PIEA 1PKPA 2UU9I 2V34A 1Z0TA 4LF4I 1IBLI 4I3HA 4M1KA 4DV5E 4DV4I 2BM0A 3PYEA 2WW4A 3WU4A 2J7KA 4Z7YA 3B82A 1N32E 4X64I 4B3RI 1I94E 1J5EI 4LF4E 4LFAE 1IBLE 2F4VE 1FNMA 4X62E 2V8PA 2X36A 1XMQE 4MYUA 4DR6I 4UT4A 4DR4E 2DEIA 3J80C 3ZZTA 1S4EA 4X66E 3K17A 3J80Q 1ZM9A 5GMEA 4DR5I 2R3VA 4JI7E 4DV3E 3Q1QA 4JI8E 4DR7E 4KHPI 4DR6E 3J81C 4B3ME 4NXME 5LL6R 2UUCE 4DV7E 1D6TA 3J81Q 4K0KI 4B3SI 2V2VA 2E5LE 4RPFA 4JI5I 4DV0E 2VQFE 1Z0EA 4JI3E 4JI0I 3PYDA 4JYAE 1H7SA 1PVGA 3LPSA 1Z0GA 2ZM6E 1H7UA 5FLXC 4YHHE 4HY1A 3WU3A 1FJGE 3ZM7A 3WU5A 1NHJA 3T1YE 5FLXQ 2EFGA 4GKJE
chains in the Genus database with same CATH superfamily
5DRQA 5JEAC 2BR2A 3QT8A 2UUAE 3WU6A 4LF6I 1UEKA 3P76A 3JAMC 5JEAB 4DR2E 4AQYI 4URLA 2UXCI 3GLLA 3KRNA 2R42A 5GMDA 2Z5CB 4FWDA 3JAMQ 4LF9I 1EA6A 1XMOE 2ZBKB 5JEAF 4KQVA 4ISAA 5LMNI 1XNQI 2A2CA 2UXBE 4FWGA 1OYPA 2C37A 2OI2A 4OO1F 4GKKE 1KIJA 4X65I 4LF8I 4GQUA 4AQYE 1N36E 4DV6I 4EMDA 2UXCE 1A6FA 5BR8I 3PYFA 4DV1I 1HNWE 1B62A 4DR1I 1H74A 2BR2B 3P06A 1N0UA 1XNQE 1UDQA 2PNZB 1IBKI 1ZM3A 4DUYE 1XXEA 2HHHE 4DR3I 2J65A 4Z7CA 1HNZI 4DV2I 1IBMI 4B3TI 3K85A 1NHIA 4WUDA 1Z5AA 2BV3A 4YY3I 2UXDI 5C0XD 3PYGA 4AIDA 4DXLA 4ED4A 2UU9E 4HACB 4MU3A 1ZXNA 3CDIA 4NXNI 2C37B 2O1WA 4MU4A 4DV1E 2NN6C 4OO1D 3ZZ0A 4DPTA 2GO3A 3B4TA 4LF5I 3B78A 5LMUI 2NN6B 4DV4E 1R6MA 2C38A 4FW9A 4DR3E 4LFCI 1FWKA 1HNZE 1N34I 1Z0BA 2VF3A 1HR0I 4FW5A 2NN6F 4YY3E 4X64E 4B3RE 2PO2B 4DPUA 4OKGA 3V5RA 3U1YA 1J5EE 2AJ4A 3K1JA 1Z0CA 5DROA 5JEAE 4AM3A 1N33I 2WNRA 4MDTA 1Z5BA 4JG4A 1NHHA 4IZJA 2HKEA 4LCGA 2WP8A 4P52A 1ELOA 1Z59A 3DD6A 1E3PA 4R1FA 5JEAA 2HFUA 1VISA 4UTGA 5IWAI 4DR5E 1XNRI 2PNMA 2HFSA 3CWVA 4OO1A 2IOQA 3LTOA 2O1UA 2O1VA 4KHPE 1E3HA 3QT7A 3D4JA 2V2ZA 4IFDD 5DRRA 4OX9I 4FW7A 2IESA 4FN5A 3U1KA 4JI1I 4K0KE 1VI7A 4B3SE 4LF7I 5K36D 4JI5E 3UHMA 4JI6I 5IWAE 1XNRE 1B63A 2BA0G 1HNXI 4JI0E 2PNZA 2HK2A 3QT5A 2BA1D 5C0XB 4FWHA 2CG9A 4MYTA 1RR9A 2NN6E 2E1RA 2UUBI 4OO1C 3OTOI 2CGEA 1Y4SA 4OO1B 4DU8A 1KVKA 1MX0A 5C0XF 4JI4I 1ZXMA 4HACA 2LJPA 2VQEI 2A2DA 1DARA 4JV5I 3HULA 1QZRA 3P3CA 4JI2I 4LF6E 4LFBI 1ZM2A 2NN6A 4N3OA 4DUZI 4DPWA 1KTVA 2Z5BB 2XEXA 5DNLA 3P3GA 4LF9E 1Z0VA 2V2QA 2NPFA 3GONA 3ZZUA 5DRPA 1N0VC 3M6AA 5LMNE 5DNXA 4DV5I 2PO2A 5A2QC 4WUCA 2PNLA 2VQEE 4ZVIA 2DEJA 4FW3A 4X65E 5A2QQ 4P7AA 4BA2A 1N32I 1WUUA 4LF8E 1Y6ZA 4DV6E 1I94I 1UDOA 2HKJA 5EKWA 5BR8E 4LFAI 4DR1E 2F4VI 3GCMA 4X62I 1UDSA 1IBKE 1XMQI 4DR4I 1S16A 1ZM4A 2BA1G 2BA0D 1IBME 4DV2E 4B3TE 1FI4A 3Q6MA 3M7ND 2JEBB 4X66I 2UXDE 4XTJA 2IERA 4HXZA 5K36B 2CVEA 2X7IA 3H4LA 2AE8A 3H1CA 4NXNE 4IFDF 5C0XE 3ZKDA 3F0NA 1XHKA 1Y60A 3PS1A 1USVA 4OZEA 4DPXA 4JI7I 4LF5E 1HK7A 1H73A 3B8HA 5LMUE 4DV3I 5K36F 3L7ZA 4JI8I 4BA2B 4DR7I 4OO1E 3QT6A 4LFCE 4BA1A 4B3MI 4NXMI 1RREA 1N34E 3J7AM 4PU9A 4QNJA 4HYMA 1HR0E 4U3BA 2UUCI 1K47A 4DV7I 2JT2A 2JEAA 1OYSA 4FW4A 5C0XA 2E5LI 3J7AG 4DU7A 1FWLA 4DV0I 4MQYA 5IT9C 1R6LA 3ZKBA 2VQFI 1NZ0A 1N33E 3HJCA 1P42A 4JI3I 1OJ4A 3T1HI 1YHCA 5IT9Q 4JYAI 2O1TA 4LOMA 4LPFA 2ZM6I 1MU5A 1Z0WA 4LCHA 4YHHI 2Z5EA 1FJGI 4USMA 2PO1A 3T1YI 1RHYA 3L7ZB 2Z5BA 4GKJI 4BA1B 1H72C 2F1DA 1OYRA 4J3DA 4DPYA 2O3ZA 5C0XC 3T1HE 2UUAI 1EI1A 3M7NG 2JEAB 3LNUA 4DR2I 3CDJA 4OX9E 2GS8A 2Q2EB 1FKAE 1YH8A 2C39A 4JI1E 4IFDE 2ZITA 1XMOI 4NBQA 3V2UC 4LF7E 4PRVA 1BKNA 4JI6E 2UXBI 5K36E 1KKHA 4GKKI 1HNXE 2CZ9A 2GO4A 2PO1B 4WUBA 1U2RA 1N36I 3HKMA 2UUBE 1MG7A 4IFDA 3OTOE 2JE6A 2JEBA 3GMEA 4IZKA 4FW6A 1HNWI 4JI4E 2BM1A 5K36A 4DUYI 4PRXA 2HHHI 2HK3A 1Z5CA 4JV5E 4USKA 5L3JA 2C39B 4JI2E 4LFBE 1UDNA 4DUZE 1PIEA 1PKPA 2UU9I 3NZKA 5ELWA 3PS3A 2V34A 1Z0TA 4LF4I 4IZJD 1IBLI 4I3HA 4M1KA 4DV5E 4DV4I 2BM0A 4IFDC 3PYEA 2WW4A 3WU4A 4IFDB 3Q6NA 2J7KA 4Z7YA 3B82A 2JE6B 5K36C 1Y4UA 4IZKB 5JEAD 1N32E 4LCFA 4X64I 4B3RI 3M85D 1I94E 1J5EI 4U3DA 4LF4E 4LFAE 1IBLE 2F4VE 1FNMA 4X62E 2V8PA 2GQ0A 2X36A 1XMQE 4MYUA 4DR6I 2VESA 4UT4A 4DR4E 2DEIA 3J80C 2PO0A 3ZZTA 1S4EA 4X66E 3K17A 3PS2A 1ZM9A 3J80Q 4QNKA 5GMEA 4DR5I 2R3VA 4MU0A 3P3EA 4JI7E 4DV3E 3Q1QA 4JI8E 4DR7E 4KHPI 4DR6E 3J81C 4AIMA 4B3ME 4NXME 5LL6R 2UUCE 4DV7E 1D6TA 3J81Q 4K0KI 4B3SI 2V2VA 2E5LE 4RPFA 2C38B 4JI5I 4DV0E 3PRYA 4IS9A 2VQFE 1Z0EA 2Z5CA 2PO0B 4JI3E 2NN6D 4JI0I 3PYDA 4JYAE 1H7SA 1PVGA 2IOPA 3LPSA 4MU1A 1Z0GA 2ZM6E 5EL9A 3M85G 1H7UA 5FLXC 4YHHE 4HY1A 2WNRB 3WU3A 1FJGE 3ZM7A 4IZJB 3WU5A 1NHJA 1USUA 3T1YE 1Y5YA 5FLXQ 5FWKA 2EFGA 2WP8B 4GKJE
chains in the Genus database with same CATH topology
3QT8A 2UUAE 3WU6A 4LF6I 1UEKA 3JAMC 4DR2E 4AQYI 4URLA 2UXCI 2R42A 5GMDA 2Z5CB 4FWDA 3JAMQ 4LF9I 1EA6A 1XMOE 2ZBKB 4KQVA 5LMNI 1XNQI 2A2CA 2UXBE 4FWGA 2OI2A 4GKKE 1KIJA 4X65I 4LF8I 4AQYE 1N36E 4DV6I 4EMDA 2UXCE 1A6FA 5BR8I 3PYFA 4DV1I 1HNWE 1B62A 4DR1I 1H74A 3P06A 1N0UA 1XNQE 1IBKI 1ZM3A 4DUYE 2HHHE 4DR3I 4Z7CA 1HNZI 4DV2I 1IBMI 4B3TI 3K85A 1NHIA 4WUDA 1Z5AA 2BV3A 4YY3I 2UXDI 3PYGA 4DXLA 4ED4A 2UU9E 4HACB 1ZXNA 4NXNI 2O1WA 4DV1E 3ZZ0A 4DPTA 4LF5I 3B78A 5LMUI 4DV4E 4FW9A 4DR3E 4LFCI 1FWKA 1HNZE 1N34I 1Z0BA 2VF3A 1HR0I 4YY3E 4X64E 4B3RE 4DPUA 3V5RA 1J5EE 2AJ4A 3K1JA 1Z0CA 1N33I 1Z5BA 4JG4A 1NHHA 4IZJA 2HKEA 4P52A 1ELOA 1Z59A 4R1FA 2HFUA 1VISA 4UTGA 5IWAI 4DR5E 1XNRI 2PNMA 2HFSA 3CWVA 2IOQA 3LTOA 2O1UA 2O1VA 4KHPE 3QT7A 3D4JA 2V2ZA 4OX9I 4FN5A 4JI1I 4K0KE 4B3SE 4LF7I 4JI5E 4JI6I 5IWAE 1XNRE 1B63A 1HNXI 4JI0E 2HK2A 3QT5A 4FWHA 2CG9A 4MYTA 1RR9A 2E1RA 2UUBI 3OTOI 2CGEA 1Y4SA 4DU8A 1KVKA 1MX0A 4JI4I 1ZXMA 4HACA 2LJPA 2VQEI 2A2DA 1DARA 4JV5I 3HULA 1QZRA 4JI2I 4LF6E 4LFBI 1ZM2A 4N3OA 4DUZI 4DPWA 1KTVA 2Z5BB 2XEXA 4LF9E 1Z0VA 2V2QA 2NPFA 3GONA 3ZZUA 1N0VC 3M6AA 5LMNE 4DV5I 5A2QC 4WUCA 2PNLA 2VQEE 4ZVIA 2DEJA 4X65E 5A2QQ 4P7AA 1N32I 1WUUA 4LF8E 1Y6ZA 4DV6E 1I94I 2HKJA 5BR8E 4LFAI 4DR1E 2F4VI 4X62I 1IBKE 1XMQI 4DR4I 1S16A 1ZM4A 1IBME 4DV2E 4B3TE 1FI4A 3Q6MA 4X66I 2UXDE 4XTJA 4HXZA 2X7IA 3H4LA 4NXNE 3ZKDA 3F0NA 1XHKA 1USVA 4DPXA 4JI7I 4LF5E 1HK7A 1H73A 3B8HA 5LMUE 4DV3I 4JI8I 4DR7I 3QT6A 4LFCE 4B3MI 4NXMI 1RREA 1N34E 3J7AM 4PU9A 1HR0E 4HYMA 2UUCI 1K47A 4DV7I 2E5LI 3J7AG 4DU7A 1FWLA 4DV0I 5IT9C 3ZKBA 2VQFI 1NZ0A 1N33E 3HJCA 4JI3I 1OJ4A 3T1HI 5IT9Q 4JYAI 2O1TA 2ZM6I 1MU5A 1Z0WA 4YHHI 2Z5EA 1FJGI 4USMA 3T1YI 2Z5BA 4GKJI 1H72C 4DPYA 3T1HE 2UUAI 1EI1A 3LNUA 4DR2I 4OX9E 2GS8A 2Q2EB 1FKAE 4JI1E 2ZITA 1XMOI 4LF7E 3V2UC 4PRVA 1BKNA 4JI6E 2UXBI 1KKHA 4GKKI 1HNXE 2CZ9A 4WUBA 1U2RA 1N36I 2UUBE 1MG7A 3OTOE 1HNWI 4IZKA 4JI4E 2BM1A 4DUYI 4PRXA 2HHHI 2HK3A 1Z5CA 4JV5E 4USKA 5L3JA 4JI2E 4LFBE 4DUZE 1PIEA 1PKPA 2UU9I 2V34A 1Z0TA 4LF4I 4IZJD 1IBLI 4I3HA 4M1KA 4DV5E 4DV4I 2BM0A 3PYEA 2WW4A 3WU4A 3Q6NA 2J7KA 4Z7YA 3B82A 1Y4UA 4IZKB 1N32E 4X64I 4B3RI 1I94E 1J5EI 4LF4E 4LFAE 1IBLE 2F4VE 1FNMA 4X62E 2V8PA 2GQ0A 2X36A 1XMQE 4MYUA 4DR6I 4UT4A 4DR4E 2DEIA 3J80C 3ZZTA 1S4EA 4X66E 3K17A 3J80Q 1ZM9A 5GMEA 4DR5I 2R3VA 4JI7E 4DV3E 3Q1QA 4JI8E 4DR7E 4KHPI 4DR6E 3J81C 4B3ME 4NXME 5LL6R 2UUCE 4DV7E 1D6TA 3J81Q 4K0KI 4B3SI 2V2VA 2E5LE 4RPFA 4JI5I 4DV0E 3PRYA 2VQFE 1Z0EA 2Z5CA 4JI3E 4JI0I 3PYDA 4JYAE 1H7SA 1PVGA 2IOPA 3LPSA 1Z0GA 2ZM6E 1H7UA 5FLXC 4YHHE 4HY1A 3WU3A 1FJGE 3ZM7A 4IZJB 3WU5A 1NHJA 1USUA 3T1YE 5FLXQ 5FWKA 2EFGA 4GKJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT8 A;  2UUA E;  3WU6 A;  4LF6 I;  1UEK A;  3JAM C;  4DR2 E;  4AQY I;  4URL A;  2UXC I;  2R42 A;  5GMD A;  4LF9 I;  4FWD A;  3JAM Q;  1EA6 A;  1XMO E;  2ZBK B;  4KQV A;  5LMN I;  1XNQ I;  2A2C A;  2UXB E;  4FWG A;  2OI2 A;  4GKK E;  1KIJ A;  4X65 I;  4LF8 I;  4AQY E;  1N36 E;  4DV6 I;  4EMD A;  2UXC E;  1A6F A;  5BR8 I;  3PYF A;  4DV1 I;  1HNW E;  1B62 A;  4DR1 I;  1H74 A;  1N0U A;  1XNQ E;  1IBK I;  1ZM3 A;  4DUY E;  2HHH E;  4DR3 I;  4Z7C A;  1HNZ I;  4DV2 I;  1IBM I;  4B3T I;  1NHI A;  4WUD A;  1Z5A A;  2BV3 A;  4YY3 I;  2UXD I;  3PYG A;  4DXL A;  4ED4 A;  2UU9 E;  4HAC B;  1ZXN A;  4NXN I;  4DV1 E;  3ZZ0 A;  4DPT A;  4LF5 I;  3B78 A;  5LMU I;  4DV4 E;  4FW9 A;  4DR3 E;  4LFC I;  1FWK A;  1HNZ E;  1N34 I;  1Z0B A;  2VF3 A;  1HR0 I;  4YY3 E;  4X64 E;  4B3R E;  4DPU A;  3V5R A;  1J5E E;  2AJ4 A;  3K1J A;  1Z0C A;  1N33 I;  1Z5B A;  4JG4 A;  1NHH A;  2HKE A;  4P52 A;  1ELO A;  1Z59 A;  4R1F A;  2HFU A;  1VIS A;  4UTG A;  5IWA I;  4DR5 E;  1XNR I;  2HFS A;  3CWV A;  3LTO A;  4KHP E;  3QT7 A;  3D4J A;  2V2Z A;  4OX9 I;  4FN5 A;  4JI1 I;  4K0K E;  4B3S E;  4LF7 I;  4JI5 E;  4JI6 I;  5IWA E;  1XNR E;  1B63 A;  1HNX I;  4JI0 E;  2HK2 A;  3QT5 A;  4FWH A;  4MYT A;  1RR9 A;  2E1R A;  2UUB I;  3OTO I;  4DU8 A;  1KVK A;  1MX0 A;  4JI4 I;  1ZXM A;  4HAC A;  2LJP A;  2VQE I;  2A2D A;  1DAR A;  4JV5 I;  3HUL A;  1QZR A;  4JI2 I;  4LF6 E;  4LFB I;  1ZM2 A;  4DUZ I;  4DPW A;  1KTV A;  2XEX A;  4LF9 E;  1Z0V A;  2V2Q A;  2NPF A;  3GON A;  3ZZU A;  1N0V C;  3M6A A;  5LMN E;  4DV5 I;  5A2Q C;  4WUC A;  2VQE E;  4ZVI A;  2DEJ A;  4X65 E;  5A2Q Q;  4P7A A;  1N32 I;  1WUU A;  4LF8 E;  4DV6 E;  1I94 I;  2HKJ A;  5BR8 E;  4LFA I;  4DR1 E;  2F4V I;  4X62 I;  1IBK E;  1XMQ I;  4DR4 I;  1S16 A;  1ZM4 A;  1IBM E;  4DV2 E;  4B3T E;  1FI4 A;  4X66 I;  2UXD E;  4XTJ A;  4HXZ A;  2X7I A;  3H4L A;  4NXN E;  3ZKD A;  3F0N A;  1XHK A;  4DPX A;  4JI7 I;  4LF5 E;  1H73 A;  3B8H A;  5LMU E;  4DV3 I;  4JI8 I;  4DR7 I;  3QT6 A;  4LFC E;  4B3M I;  4NXM I;  1RRE A;  1N34 E;  3J7A M;  4PU9 A;  1HR0 E;  4HYM A;  2UUC I;  1K47 A;  4DV7 I;  2E5L I;  3J7A G;  4DU7 A;  1FWL A;  4DV0 I;  5IT9 C;  3ZKB A;  2VQF I;  1NZ0 A;  1N33 E;  4JI3 I;  1OJ4 A;  3T1H I;  5IT9 Q;  4JYA I;  2ZM6 I;  1MU5 A;  1Z0W A;  4YHH I;  1FJG I;  4USM A;  3T1Y I;  4GKJ I;  1H72 C;  4DPY A;  3T1H E;  2UUA I;  1EI1 A;  3LNU A;  4DR2 I;  4OX9 E;  2GS8 A;  2Q2E B;  1FKA E;  4JI1 E;  2ZIT A;  1XMO I;  4LF7 E;  3V2U C;  4PRV A;  1BKN A;  4JI6 E;  2UXB I;  1KKH A;  4GKK I;  1HNX E;  2CZ9 A;  4WUB A;  1U2R A;  1N36 I;  2UUB E;  1MG7 A;  3OTO E;  1HNW I;  4JI4 E;  2BM1 A;  4DUY I;  4PRX A;  2HHH I;  2HK3 A;  1Z5C A;  4JV5 E;  4USK A;  5L3J A;  4JI2 E;  4LFB E;  4DUZ E;  1PIE A;  1PKP A;  2UU9 I;  2V34 A;  1Z0T A;  4LF4 I;  1IBL I;  4I3H A;  4M1K A;  4DV5 E;  4DV4 I;  2BM0 A;  3PYE A;  2WW4 A;  3WU4 A;  2J7K A;  4Z7Y A;  3B82 A;  1N32 E;  4X64 I;  4B3R I;  1I94 E;  1J5E I;  4LF4 E;  4LFA E;  1IBL E;  2F4V E;  1FNM A;  4X62 E;  2V8P A;  2X36 A;  1XMQ E;  4MYU A;  4DR6 I;  4UT4 A;  4DR4 E;  2DEI A;  3J80 C;  3ZZT A;  1S4E A;  4X66 E;  3K17 A;  3J80 Q;  1ZM9 A;  5GME A;  4DR5 I;  2R3V A;  4JI7 E;  4DV3 E;  3Q1Q A;  4JI8 E;  4DR7 E;  4KHP I;  4DR6 E;  3J81 C;  4B3M E;  4NXM E;  5LL6 R;  2UUC E;  4DV7 E;  1D6T A;  3J81 Q;  4K0K I;  4B3S I;  2V2V A;  2E5L E;  4RPF A;  4JI5 I;  4DV0 E;  2VQF E;  1Z0E A;  4JI3 E;  4JI0 I;  3PYD A;  4JYA E;  1H7S A;  1PVG A;  3LPS A;  1Z0G A;  2ZM6 E;  1H7U A;  5FLX C;  4YHH E;  4HY1 A;  3WU3 A;  1FJG E;  3ZM7 A;  3WU5 A;  1NHJ A;  3T1Y E;  5FLX Q;  2EFG A;  4GKJ E; 
#chains in the Genus database with same CATH topology
 5DRQ A;  5JEA C;  2BR2 A;  3QT8 A;  2UUA E;  3WU6 A;  4LF6 I;  1UEK A;  3P76 A;  3JAM C;  5JEA B;  4DR2 E;  4AQY I;  4URL A;  2UXC I;  3GLL A;  3KRN A;  2R42 A;  5GMD A;  2Z5C B;  4FWD A;  3JAM Q;  4LF9 I;  1EA6 A;  1XMO E;  2ZBK B;  5JEA F;  4KQV A;  4ISA A;  5LMN I;  1XNQ I;  2A2C A;  2UXB E;  4FWG A;  1OYP A;  2C37 A;  2OI2 A;  4OO1 F;  4GKK E;  1KIJ A;  4X65 I;  4LF8 I;  4GQU A;  4AQY E;  1N36 E;  4DV6 I;  4EMD A;  2UXC E;  1A6F A;  5BR8 I;  3PYF A;  4DV1 I;  1HNW E;  1B62 A;  4DR1 I;  1H74 A;  2BR2 B;  3P06 A;  1N0U A;  1XNQ E;  1UDQ A;  2PNZ B;  1IBK I;  1ZM3 A;  4DUY E;  1XXE A;  2HHH E;  4DR3 I;  2J65 A;  4Z7C A;  1HNZ I;  4DV2 I;  1IBM I;  4B3T I;  3K85 A;  1NHI A;  4WUD A;  1Z5A A;  2BV3 A;  4YY3 I;  2UXD I;  5C0X D;  3PYG A;  4AID A;  4DXL A;  4ED4 A;  2UU9 E;  4HAC B;  4MU3 A;  1ZXN A;  3CDI A;  4NXN I;  2C37 B;  2O1W A;  4MU4 A;  4DV1 E;  2NN6 C;  4OO1 D;  3ZZ0 A;  4DPT A;  2GO3 A;  3B4T A;  4LF5 I;  3B78 A;  5LMU I;  2NN6 B;  4DV4 E;  1R6M A;  2C38 A;  4FW9 A;  4DR3 E;  4LFC I;  1FWK A;  1HNZ E;  1N34 I;  1Z0B A;  2VF3 A;  1HR0 I;  4FW5 A;  2NN6 F;  4YY3 E;  4X64 E;  4B3R E;  2PO2 B;  4DPU A;  4OKG A;  3V5R A;  3U1Y A;  1J5E E;  2AJ4 A;  3K1J A;  1Z0C A;  5DRO A;  5JEA E;  4AM3 A;  1N33 I;  2WNR A;  4MDT A;  1Z5B A;  4JG4 A;  1NHH A;  4IZJ A;  2HKE A;  4LCG A;  2WP8 A;  4P52 A;  1ELO A;  1Z59 A;  3DD6 A;  1E3P A;  4R1F A;  5JEA A;  2HFU A;  1VIS A;  4UTG A;  5IWA I;  4DR5 E;  1XNR I;  2PNM A;  2HFS A;  3CWV A;  4OO1 A;  2IOQ A;  3LTO A;  2O1U A;  2O1V A;  4KHP E;  1E3H A;  3QT7 A;  3D4J A;  2V2Z A;  4IFD D;  5DRR A;  4OX9 I;  4FW7 A;  2IES A;  4FN5 A;  3U1K A;  4JI1 I;  4K0K E;  1VI7 A;  4B3S E;  4LF7 I;  5K36 D;  4JI5 E;  3UHM A;  4JI6 I;  5IWA E;  1XNR E;  1B63 A;  2BA0 G;  1HNX I;  4JI0 E;  2PNZ A;  2HK2 A;  3QT5 A;  2BA1 D;  5C0X B;  4FWH A;  2CG9 A;  4MYT A;  1RR9 A;  2NN6 E;  2E1R A;  2UUB I;  4OO1 C;  3OTO I;  2CGE A;  1Y4S A;  4OO1 B;  4DU8 A;  1KVK A;  1MX0 A;  5C0X F;  4JI4 I;  1ZXM A;  4HAC A;  2LJP A;  2VQE I;  2A2D A;  1DAR A;  4JV5 I;  3HUL A;  1QZR A;  3P3C A;  4JI2 I;  4LF6 E;  4LFB I;  1ZM2 A;  2NN6 A;  4N3O A;  4DUZ I;  4DPW A;  1KTV A;  2Z5B B;  2XEX A;  5DNL A;  3P3G A;  4LF9 E;  1Z0V A;  2V2Q A;  2NPF A;  3GON A;  3ZZU A;  5DRP A;  1N0V C;  3M6A A;  5LMN E;  5DNX A;  4DV5 I;  2PO2 A;  5A2Q C;  4WUC A;  2PNL A;  2VQE E;  4ZVI A;  2DEJ A;  4FW3 A;  4X65 E;  5A2Q Q;  4P7A A;  4BA2 A;  1N32 I;  1WUU A;  4LF8 E;  1Y6Z A;  4DV6 E;  1I94 I;  1UDO A;  2HKJ A;  5EKW A;  5BR8 E;  4LFA I;  4DR1 E;  2F4V I;  3GCM A;  4X62 I;  1UDS A;  1IBK E;  1XMQ I;  4DR4 I;  1S16 A;  1ZM4 A;  2BA1 G;  2BA0 D;  1IBM E;  4DV2 E;  4B3T E;  1FI4 A;  3Q6M A;  3M7N D;  2JEB B;  4X66 I;  2UXD E;  4XTJ A;  2IER A;  4HXZ A;  5K36 B;  2CVE A;  2X7I A;  3H4L A;  2AE8 A;  3H1C A;  4NXN E;  4IFD F;  5C0X E;  3ZKD A;  3F0N A;  1XHK A;  1Y60 A;  3PS1 A;  1USV A;  4OZE A;  4DPX A;  4JI7 I;  4LF5 E;  1HK7 A;  1H73 A;  3B8H A;  5LMU E;  4DV3 I;  5K36 F;  3L7Z A;  4JI8 I;  4BA2 B;  4DR7 I;  4OO1 E;  3QT6 A;  4LFC E;  4BA1 A;  4B3M I;  4NXM I;  1RRE A;  1N34 E;  3J7A M;  4PU9 A;  4QNJ A;  4HYM A;  1HR0 E;  4U3B A;  2UUC I;  1K47 A;  4DV7 I;  2JT2 A;  2JEA A;  1OYS A;  4FW4 A;  5C0X A;  2E5L I;  3J7A G;  4DU7 A;  1FWL A;  4DV0 I;  4MQY A;  5IT9 C;  1R6L A;  3ZKB A;  2VQF I;  1NZ0 A;  1N33 E;  3HJC A;  1P42 A;  4JI3 I;  1OJ4 A;  3T1H I;  1YHC A;  5IT9 Q;  4JYA I;  2O1T A;  4LOM A;  4LPF A;  2ZM6 I;  1MU5 A;  1Z0W A;  4LCH A;  4YHH I;  2Z5E A;  1FJG I;  4USM A;  2PO1 A;  3T1Y I;  1RHY A;  3L7Z B;  2Z5B A;  4GKJ I;  4BA1 B;  1H72 C;  2F1D A;  1OYR A;  4J3D A;  4DPY A;  2O3Z A;  5C0X C;  3T1H E;  2UUA I;  1EI1 A;  3M7N G;  2JEA B;  3LNU A;  4DR2 I;  3CDJ A;  4OX9 E;  2GS8 A;  2Q2E B;  1FKA E;  1YH8 A;  2C39 A;  4JI1 E;  4IFD E;  2ZIT A;  1XMO I;  4NBQ A;  3V2U C;  4LF7 E;  4PRV A;  1BKN A;  4JI6 E;  2UXB I;  5K36 E;  1KKH A;  4GKK I;  1HNX E;  2CZ9 A;  2GO4 A;  2PO1 B;  4WUB A;  1U2R A;  1N36 I;  3HKM A;  2UUB E;  1MG7 A;  4IFD A;  3OTO E;  2JE6 A;  2JEB A;  3GME A;  4IZK A;  4FW6 A;  1HNW I;  4JI4 E;  2BM1 A;  5K36 A;  4DUY I;  4PRX A;  2HHH I;  2HK3 A;  1Z5C A;  4JV5 E;  4USK A;  5L3J A;  2C39 B;  4JI2 E;  4LFB E;  1UDN A;  4DUZ E;  1PIE A;  1PKP A;  2UU9 I;  3NZK A;  5ELW A;  3PS3 A;  2V34 A;  1Z0T A;  4LF4 I;  4IZJ D;  1IBL I;  4I3H A;  4M1K A;  4DV5 E;  4DV4 I;  2BM0 A;  4IFD C;  3PYE A;  2WW4 A;  3WU4 A;  4IFD B;  3Q6N A;  2J7K A;  4Z7Y A;  3B82 A;  2JE6 B;  5K36 C;  1Y4U A;  4IZK B;  5JEA D;  1N32 E;  4LCF A;  4X64 I;  4B3R I;  3M85 D;  1I94 E;  1J5E I;  4U3D A;  4LF4 E;  4LFA E;  1IBL E;  2F4V E;  1FNM A;  4X62 E;  2V8P A;  2GQ0 A;  2X36 A;  1XMQ E;  4MYU A;  4DR6 I;  2VES A;  4UT4 A;  4DR4 E;  2DEI A;  3J80 C;  2PO0 A;  3ZZT A;  1S4E A;  4X66 E;  3K17 A;  3PS2 A;  1ZM9 A;  3J80 Q;  4QNK A;  5GME A;  4DR5 I;  2R3V A;  4MU0 A;  3P3E A;  4JI7 E;  4DV3 E;  3Q1Q A;  4JI8 E;  4DR7 E;  4KHP I;  4DR6 E;  3J81 C;  4AIM A;  4B3M E;  4NXM E;  5LL6 R;  2UUC E;  4DV7 E;  1D6T A;  3J81 Q;  4K0K I;  4B3S I;  2V2V A;  2E5L E;  4RPF A;  2C38 B;  4JI5 I;  4DV0 E;  3PRY A;  4IS9 A;  2VQF E;  1Z0E A;  2Z5C A;  2PO0 B;  4JI3 E;  2NN6 D;  4JI0 I;  3PYD A;  4JYA E;  1H7S A;  1PVG A;  2IOP A;  3LPS A;  4MU1 A;  1Z0G A;  2ZM6 E;  5EL9 A;  3M85 G;  1H7U A;  5FLX C;  4YHH E;  4HY1 A;  2WNR B;  3WU3 A;  1FJG E;  3ZM7 A;  4IZJ B;  3WU5 A;  1NHJ A;  1USU A;  3T1Y E;  1Y5Y A;  5FLX Q;  5FWK A;  2EFG A;  2WP8 B;  4GKJ E; 
#chains in the Genus database with same CATH homology
 3QT8 A;  2UUA E;  3WU6 A;  4LF6 I;  1UEK A;  3JAM C;  4DR2 E;  4AQY I;  4URL A;  2UXC I;  2R42 A;  5GMD A;  2Z5C B;  4FWD A;  3JAM Q;  4LF9 I;  1EA6 A;  1XMO E;  2ZBK B;  4KQV A;  5LMN I;  1XNQ I;  2A2C A;  2UXB E;  4FWG A;  2OI2 A;  4GKK E;  1KIJ A;  4X65 I;  4LF8 I;  4AQY E;  1N36 E;  4DV6 I;  4EMD A;  2UXC E;  1A6F A;  5BR8 I;  3PYF A;  4DV1 I;  1HNW E;  1B62 A;  4DR1 I;  1H74 A;  3P06 A;  1N0U A;  1XNQ E;  1IBK I;  1ZM3 A;  4DUY E;  2HHH E;  4DR3 I;  4Z7C A;  1HNZ I;  4DV2 I;  1IBM I;  4B3T I;  3K85 A;  1NHI A;  4WUD A;  1Z5A A;  2BV3 A;  4YY3 I;  2UXD I;  3PYG A;  4DXL A;  4ED4 A;  2UU9 E;  4HAC B;  1ZXN A;  4NXN I;  2O1W A;  4DV1 E;  3ZZ0 A;  4DPT A;  4LF5 I;  3B78 A;  5LMU I;  4DV4 E;  4FW9 A;  4DR3 E;  4LFC I;  1FWK A;  1HNZ E;  1N34 I;  1Z0B A;  2VF3 A;  1HR0 I;  4YY3 E;  4X64 E;  4B3R E;  4DPU A;  3V5R A;  1J5E E;  2AJ4 A;  3K1J A;  1Z0C A;  1N33 I;  1Z5B A;  4JG4 A;  1NHH A;  4IZJ A;  2HKE A;  4P52 A;  1ELO A;  1Z59 A;  4R1F A;  2HFU A;  1VIS A;  4UTG A;  5IWA I;  4DR5 E;  1XNR I;  2PNM A;  2HFS A;  3CWV A;  2IOQ A;  3LTO A;  2O1U A;  2O1V A;  4KHP E;  3QT7 A;  3D4J A;  2V2Z A;  4OX9 I;  4FN5 A;  4JI1 I;  4K0K E;  4B3S E;  4LF7 I;  4JI5 E;  4JI6 I;  5IWA E;  1XNR E;  1B63 A;  1HNX I;  4JI0 E;  2HK2 A;  3QT5 A;  4FWH A;  2CG9 A;  4MYT A;  1RR9 A;  2E1R A;  2UUB I;  3OTO I;  2CGE A;  1Y4S A;  4DU8 A;  1KVK A;  1MX0 A;  4JI4 I;  1ZXM A;  4HAC A;  2LJP A;  2VQE I;  2A2D A;  1DAR A;  4JV5 I;  3HUL A;  1QZR A;  4JI2 I;  4LF6 E;  4LFB I;  1ZM2 A;  4N3O A;  4DUZ I;  4DPW A;  1KTV A;  2Z5B B;  2XEX A;  4LF9 E;  1Z0V A;  2V2Q A;  2NPF A;  3GON A;  3ZZU A;  1N0V C;  3M6A A;  5LMN E;  4DV5 I;  5A2Q C;  4WUC A;  2PNL A;  2VQE E;  4ZVI A;  2DEJ A;  4X65 E;  5A2Q Q;  4P7A A;  1N32 I;  1WUU A;  4LF8 E;  1Y6Z A;  4DV6 E;  1I94 I;  2HKJ A;  5BR8 E;  4LFA I;  4DR1 E;  2F4V I;  4X62 I;  1IBK E;  1XMQ I;  4DR4 I;  1S16 A;  1ZM4 A;  1IBM E;  4DV2 E;  4B3T E;  1FI4 A;  3Q6M A;  4X66 I;  2UXD E;  4XTJ A;  4HXZ A;  2X7I A;  3H4L A;  4NXN E;  3ZKD A;  3F0N A;  1XHK A;  1USV A;  4DPX A;  4JI7 I;  4LF5 E;  1HK7 A;  1H73 A;  3B8H A;  5LMU E;  4DV3 I;  4JI8 I;  4DR7 I;  3QT6 A;  4LFC E;  4B3M I;  4NXM I;  1RRE A;  1N34 E;  3J7A M;  4PU9 A;  1HR0 E;  4HYM A;  2UUC I;  1K47 A;  4DV7 I;  2E5L I;  3J7A G;  4DU7 A;  1FWL A;  4DV0 I;  5IT9 C;  3ZKB A;  2VQF I;  1NZ0 A;  1N33 E;  3HJC A;  4JI3 I;  1OJ4 A;  3T1H I;  5IT9 Q;  4JYA I;  2O1T A;  2ZM6 I;  1MU5 A;  1Z0W A;  4YHH I;  2Z5E A;  1FJG I;  4USM A;  3T1Y I;  2Z5B A;  4GKJ I;  1H72 C;  4DPY A;  3T1H E;  2UUA I;  1EI1 A;  3LNU A;  4DR2 I;  4OX9 E;  2GS8 A;  2Q2E B;  1FKA E;  4JI1 E;  2ZIT A;  1XMO I;  4LF7 E;  3V2U C;  4PRV A;  1BKN A;  4JI6 E;  2UXB I;  1KKH A;  4GKK I;  1HNX E;  2CZ9 A;  4WUB A;  1U2R A;  1N36 I;  2UUB E;  1MG7 A;  3OTO E;  1HNW I;  4IZK A;  4JI4 E;  2BM1 A;  4DUY I;  4PRX A;  2HHH I;  2HK3 A;  1Z5C A;  4JV5 E;  4USK A;  5L3J A;  4JI2 E;  4LFB E;  4DUZ E;  1PIE A;  1PKP A;  2UU9 I;  2V34 A;  1Z0T A;  4LF4 I;  4IZJ D;  1IBL I;  4I3H A;  4M1K A;  4DV5 E;  4DV4 I;  2BM0 A;  3PYE A;  2WW4 A;  3WU4 A;  3Q6N A;  2J7K A;  4Z7Y A;  3B82 A;  1Y4U A;  4IZK B;  1N32 E;  4X64 I;  4B3R I;  1I94 E;  1J5E I;  4LF4 E;  4LFA E;  1IBL E;  2F4V E;  1FNM A;  4X62 E;  2V8P A;  2GQ0 A;  2X36 A;  1XMQ E;  4MYU A;  4DR6 I;  4UT4 A;  4DR4 E;  2DEI A;  3J80 C;  3ZZT A;  1S4E A;  4X66 E;  3K17 A;  3J80 Q;  1ZM9 A;  5GME A;  4DR5 I;  2R3V A;  4JI7 E;  4DV3 E;  3Q1Q A;  4JI8 E;  4DR7 E;  4KHP I;  4DR6 E;  3J81 C;  4B3M E;  4NXM E;  5LL6 R;  2UUC E;  4DV7 E;  1D6T A;  3J81 Q;  4K0K I;  4B3S I;  2V2V A;  2E5L E;  4RPF A;  4JI5 I;  4DV0 E;  3PRY A;  2VQF E;  1Z0E A;  2Z5C A;  4JI3 E;  4JI0 I;  3PYD A;  4JYA E;  1H7S A;  1PVG A;  2IOP A;  3LPS A;  1Z0G A;  2ZM6 E;  1H7U A;  5FLX C;  4YHH E;  4HY1 A;  3WU3 A;  1FJG E;  3ZM7 A;  4IZJ B;  3WU5 A;  1NHJ A;  1USU A;  3T1Y E;  5FLX Q;  5FWK A;  2EFG A;  4GKJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...