2E5LI

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2e5lI00
4KQVA 4DU7A 2HFSA 2HFUA 4DUZE 1HNXI 4FW9A 1ZM9A 1MX0A 2EFGA 4GKJI 4PRVA 4LFCE 2UU9E 1UEKA 4DPWA 1HNXE 3LNUA 3QT6A 1FWLA 3PYDA 4X65I 4GKJE 3J7AG 4DR4I 5BR8I 1N34I 5GMDA 2VQEI 1N0UA 4RPFA 2X7IA 4HY1A 2ZITA 4DV0I 4X65E 4LF9I 4DR4E 5BR8E 4WUCA 1Z0WA 4FN5A 2VQEE 3T1YI 3ZM7A 4DR5I 4DV0E 4HACA 4NXNI 4DUYE 1Z0BA 4LFBE 3B8HA 3T1YE 1PKPA 1ZM2A 1HNWI 4DR5E 3V5RA 4NXNE 2J7KA 2Q2EB 4XTJA 5A2QC 1XMQE 1I94E 1ZXNA 2UXCI 1FWKA 4URLA 1Z5BA 1IBKE 1NHIA 3PYEA 3V2UC 1HR0E 2UUBI 5IWAE 2UXCE 4DR3I 3ZZTA 4JYAE 4KHPI 4JI0I 2UUBE 4B3SI 1J5EI 1ZXMA 1HNZE 4Z7CA 4DR3E 1FNMA 4LF7I 4KHPE 4JI0E 4B3SE 1J5EE 4OX9I 4X66I 2ZBKB 4JI5I 4DV2I 4LF7E 4ZVIA 1DARA 4OX9E 1KIJA 3OTOI 2NPFA 4LF4I 4DV5I 2AJ4A 4DV2E 4JI5E 3CWVA 3JAMC 1Z59A 4JI6E 3OTOE 1MG7A 4AQYI 4HXZA 4JI4I 4LF4E 1D6TA 4UTGA 4LF6I 2A2CA 2BV3A 3WU4A 5A2QQ 1A6FA 4DV3I 4WUDA 4B3MI 1FJGI 4AQYE 4JI4E 2XEXA 4DU8A 4LF6E 3QT8A 4DV4I 1H73A 4B3ME 3WU3A 2UXDI 1IBLI 2V8PA 3J7AM 4B3TI 1N34E 1RREA 1XNQI 4FWDA 2DEIA 2VF3A 4DV4E 1Z0EA 4LF9E 4JI8I 1IBLE 4B3TE 4MYTA 4X62I 4I3HA 2HKEA 2R42A 1XNQE 1ELOA 1H74A 4USKA 4DR2I 4JI8E 3QT7A 4NXMI 1IBMI 4JI3I 4YY3I 4JV5I 4DV7I 1HNWE 1Z0VA 4EMDA 3ZZ0A 3F0NA 1EA6A 3HULA 3J80C 4JI1I 4DR2E 2ZM6I 1MU5A 4USMA 4NXME 1IBME 1S4EA 4JI3E 4JV5E 1KTVA 1H72C 4DPUA 1ZM4A 3JAMQ 1H7UA 2ZM6E 3T1HI 2LJPA 3QT5A 1XMOI 1Z5AA 3PYGA 5LMUI 4GKKI 4K0KI 3LPSA 4LFAI 1U2RA 4LF8I 4B3RI 5LMUE 1FKAE 2UUAI 1Z5CA 3H4LA 1KKHA 5L3JA 4LF8E 5IT9C 1OJ4A 4DV1I 2UUAE 3GONA 3K1JA 2UUCI 4X66E 1PIEA 1S16A 1N0VC 1N36I 1KVKA 4M1KA 2HK3A 3WU5A 2WW4A 3ZKDA 4DV1E 4ED4A 1XHKA 1N33I 2BM1A 2UUCE 2V34A 4Z7YA 4DV5E 1N36E 2F4VI 1VISA 3M6AA 1N32I 2UU9I 1N33E 4X64I 3J80Q 2CZ9A 3D4JA 3WU6A 5LL6R 2F4VE 3B78A 4DV6I 1N32E 2V2ZA 4DV3E 1PVGA 4X64E 2A2DA 4FWHA 4JI2I 1FJGE 4DR1I 1ZM3A 2UXBI 1H7SA 5GMEA 5FLXQ 4DV6E 1EI1A 2V2VA 3B82A 4PU9A 2UXDE 4LF5I 4JI2E 4DR1E 1K47A 2UXBE 2BM0A 1Z0GA 2HHHI 3J81Q 4DPTA 4DUYI 4LF5E 1B62A 3ZKBA 4LFBI 2R3VA 4X62E 2HHHE 5IT9Q 1BKNA 2E1RA 4MYUA 4JI7I 4HACB 1XMQI 4FWGA 4JG4A 4YY3E 2GS8A 1I94I 3PYFA 4DV7E 2OI2A 4JI1E 4JI7E 2VQFI 2HKJA 4DR7I 1FI4A 1IBKI 1Z0TA 1HR0I 2DEJA 5FLXC 2E5LI 5IWAI 1Z0CA 2VQFE 4YHHI 4HYMA 4DXLA 4JYAI 3T1HE 4DR7E 1B63A 1XMOE 4GKKE 2E5LE 2X36A 3J81C 4K0KE 4P52A 1HNZI 4LFAE 4UT4A 4YHHE 4B3RE 1NHJA 4DPXA 1RR9A 4R1FA 4DR6I 5LMNI 1NZ0A 2V2QA 4PRXA 3K17A 1XNRI 3ZZUA 1WUUA 4DR6E 5LMNE 4DPYA 1QZRA 2HK2A 4P7AA 4DUZI 1XNRE 3Q1QA 1NHHA 4JI6I 4LFCI 4WUBA 3LTOA
chains in the Genus database with same CATH superfamily
5K36C 4KQVA 3P76A 4DU7A 2HFSA 2HFUA 4DUZE 1HNXI 4FW9A 1ZM9A 5C0XA 1MX0A 2EFGA 4GKJI 4PRVA 5JEAE 4LFCE 2UU9E 1UEKA 1UDSA 4DPWA 1HNXE 3LNUA 4LPFA 3QT6A 1FWLA 3PYDA 4X65I 4GKJE 3J7AG 4DR4I 5BR8I 4IFDC 4IS9A 1N34I 5GMDA 2VQEI 1N0UA 4RPFA 2X7IA 4HY1A 2ZITA 4DV0I 4X65E 4LF9I 4DR4E 5BR8E 4WUCA 4OKGA 1Z0WA 2WNRA 4FN5A 2VQEE 3T1YI 3U1YA 3ZM7A 1XXEA 4IZJD 4DR5I 4DV0E 5K36A 4HACA 4NXNI 4DUYE 1Z0BA 4LFBE 3B8HA 5DRRA 3T1YE 1PKPA 3B4TA 4IZJB 5K36F 2C38A 1ZM2A 1HNWI 4DR5E 3V5RA 3NZKA 4NXNE 2J7KA 1YHCA 2Q2EB 4XTJA 4IFDA 5A2QC 5JEAB 1XMQE 5JEAF 1I94E 1ZXNA 2PO1A 3M85G 2UXCI 4IZKB 1FWKA 4URLA 1Z5BA 3GCMA 1IBKE 1NHIA 3PYEA 3V2UC 1HR0E 2UUBI 1USUA 3GMEA 5IWAE 2UXCE 4J3DA 1E3PA 4ISAA 4DR3I 4BA2B 3ZZTA 4JYAE 4KHPI 2O3ZA 4JI0I 3M7ND 2UUBE 4B3SI 4GQUA 1J5EI 1ZXMA 1HNZE 4Z7CA 4DR3E 1FNMA 4LF7I 2JEAA 4KHPE 2PO2B 2JE6B 2IERA 2BR2B 4JI0E 2PNZA 2Z5CB 2PNLA 4LCFA 4B3SE 2NN6D 1J5EE 3KRNA 4NBQA 4OX9I 4X66I 2ZBKB 4JI5I 4DV2I 1OYSA 4LF7E 4LOMA 4ZVIA 1DARA 2C37A 1OYPA 4QNKA 4OX9E 1KIJA 3OTOI 2NPFA 4LF4I 4DV5I 2AJ4A 4DV2E 4JI5E 3CWVA 2IOQA 3JAMC 1Z59A 4JI6E 3OTOE 1MG7A 4AQYI 4HXZA 4JI4I 4LF4E 1D6TA 4UTGA 4LF6I 2A2CA 2BV3A 3U1KA 3WU4A 5A2QQ 1RHYA 1A6FA 3P3EA 5JEAC 4DV3I 4WUDA 4B3MI 5ELWA 1FJGI 4AQYE 4JI4E 2J65A 2XEXA 4DU8A 5C0XD 4LF6E 3QT8A 4BA1B 2Z5EA 4DV4I 1H73A 4B3ME 3WU3A 2UXDI 1IBLI 2V8PA 2VESA 4QNJA 4B3TI 3J7AM 1N34E 4OO1E 1RREA 1XNQI 4FWDA 2DEIA 2VF3A 4DV4E 3L7ZB 1Z0EA 4IZJA 4MQYA 5DNLA 4LF9E 4JI8I 1IBLE 4B3TE 4MYTA 2Z5BB 4X62I 4I3HA 2HKEA 2R42A 1XNQE 3UHMA 1UDQA 1ELOA 3HKMA 1H74A 4USKA 4DR2I 3PRYA 4JI8E 5JEAA 2NN6E 2GQ0A 3QT7A 4AIDA 4NXMI 1Y4UA 1IBMI 2BA0G 2C39B 1R6LA 4YY3I 4JI3I 4JV5I 1Y5YA 1YH8A 4DV7I 2JEBB 1HNWE 1Z0VA 4EMDA 3PS2A 4IZKA 3ZZ0A 3F0NA 1EA6A 3HULA 3J80C 4JI1I 4DR2E 2PNMA 2ZM6I 4FW4A 1MU5A 4USMA 4NXME 1IBME 1S4EA 5EL9A 4JI3E 4JV5E 1KTVA 1H72C 4DPUA 2PO0B 3CDJA 1ZM4A 3Q6MA 3JAMQ 4BA2A 1H7UA 2IESA 4MDTA 4IFDD 1OYRA 4OO1D 2ZM6E 3T1HI 4FW5A 2LJPA 3QT5A 1XMOI 1Z5AA 3PYGA 5LMUI 4GKKI 4K0KI 3LPSA 4OO1B 4LFAI 2O1UA 2PO2A 2JE6A 1U2RA 2BR2A 2Z5CA 2GO3A 4LF8I 1VI7A 4B3RI 5LMUE 1FKAE 5C0XE 2UUAI 4U3BA 1Z5CA 3H4LA 1KKHA 5L3JA 2WP8B 4LF8E 4MU1A 5IT9C 1OJ4A 4DV1I 2UUAE 2NN6B 3GONA 3K1JA 2NN6F 2UUCI 4MU4A 4X66E 1PIEA 1S16A 1R6MA 1N0VC 4M1KA 1KVKA 1N36I 2HK3A 3CDIA 3WU5A 2WW4A 3ZKDA 4DV1E 2GO4A 2O1TA 4ED4A 1XHKA 1N33I 2BM1A 4FW6A 2UUCE 2V34A 4Z7YA 4AIMA 4DV5E 1N36E 2F4VI 1VISA 3M6AA 5K36E 1N32I 2BA1G 2UU9I 1N33E 4AM3A 4X64I 3J80Q 2CZ9A 4BA1A 1USVA 3D4JA 3M7NG 3WU6A 1UDNA 5LL6R 2F4VE 2CGEA 3B78A 2JT2A 4DV6I 1N32E 2V2ZA 2BA0D 4DV3E 1PVGA 4X64E 2A2DA 3Q6NA 3P3GA 4FWHA 4JI2I 1FJGE 4DR1I 5C0XB 1ZM3A 4IFDE 2UXBI 5C0XF 1H7SA 3L7ZA 5GMEA 3M85D 5FLXQ 4DV6E 2Z5BA 1EI1A 4N3OA 2V2VA 4OO1C 3B82A 4PU9A 2UXDE 4LF5I 4JI2E 4DR1E 1K47A 2UXBE 3H1CA 2BM0A 5DROA 1Z0GA 3DD6A 2HHHI 4MU3A 3K85A 1Y60A 3J81Q 4DPTA 2C39A 4DUYI 4LF5E 1B62A 3ZKBA 2AE8A 4LFBI 2JEBA 2R3VA 4X62E 2HHHE 5IT9Q 5K36D 2WNRB 4LCGA 1E3HA 2NN6C 2PO0A 1BKNA 2E1RA 4MYUA 4JI7I 3PS3A 5K36B 4HACB 1XMQI 4FWGA 4JG4A 4YY3E 2GS8A 1I94I 3PYFA 5JEAD 4DV7E 2IOPA 2OI2A 2C38B 4JI1E 4JI7E 2VQFI 2O1VA 2HKJA 4OO1A 4DR7I 3P06A 1FI4A 4FW3A 5EKWA 1IBKI 1Z0TA 1HR0I 2DEJA 4U3DA 5FLXC 2E5LI 4MU0A 4IFDB 2CVEA 5IWAI 4IFDF 4OO1F 1Z0CA 2VQFE 4YHHI 2CG9A 4HYMA 1P42A 4DXLA 4JYAI 3T1HE 4FW7A 4DR7E 1B63A 2PO1B 1XMOE 4GKKE 2E5LE 2X36A 2WP8A 3J81C 4K0KE 4P52A 1HNZI 4LFAE 4UT4A 4YHHE 2BA1D 2NN6A 5C0XC 5DNXA 5FWKA 4B3RE 1NHJA 4DPXA 1RR9A 4R1FA 4DR6I 5LMNI 3PS1A 1NZ0A 2V2QA 4PRXA 5DRQA 1UDOA 2O1WA 3K17A 1Y6ZA 2F1DA 1XNRI 3HJCA 3ZZUA 1WUUA 3GLLA 2JEAB 4DR6E 5LMNE 4DPYA 2PNZB 1QZRA 1HK7A 2HK2A 4P7AA 3P3CA 4DUZI 4OZEA 1XNRE 3Q1QA 5DRPA 1NHHA 4JI6I 4LCHA 4LFCI 4WUBA 1Y4SA 3LTOA 2C37B
chains in the Genus database with same CATH topology
4KQVA 4DU7A 2HFSA 2HFUA 4DUZE 1HNXI 4FW9A 1ZM9A 1MX0A 2EFGA 4GKJI 4PRVA 4LFCE 2UU9E 1UEKA 4DPWA 1HNXE 3LNUA 3QT6A 1FWLA 3PYDA 4X65I 4GKJE 3J7AG 4DR4I 5BR8I 1N34I 5GMDA 2VQEI 1N0UA 4RPFA 2X7IA 4HY1A 2ZITA 4DV0I 4X65E 4LF9I 4DR4E 5BR8E 4WUCA 1Z0WA 4FN5A 2VQEE 3T1YI 3ZM7A 4IZJD 4DR5I 4DV0E 4HACA 4NXNI 4DUYE 1Z0BA 4LFBE 3B8HA 3T1YE 1PKPA 4IZJB 1ZM2A 1HNWI 4DR5E 3V5RA 4NXNE 2J7KA 2Q2EB 4XTJA 5A2QC 1XMQE 1I94E 1ZXNA 2UXCI 4IZKB 1FWKA 4URLA 1Z5BA 1IBKE 1NHIA 3PYEA 3V2UC 1HR0E 2UUBI 1USUA 5IWAE 2UXCE 4DR3I 3ZZTA 4JYAE 4KHPI 4JI0I 2UUBE 4B3SI 1J5EI 1ZXMA 1HNZE 4Z7CA 4DR3E 1FNMA 4LF7I 4KHPE 4JI0E 2Z5CB 2PNLA 4B3SE 1J5EE 4OX9I 4X66I 2ZBKB 4JI5I 4DV2I 4LF7E 4ZVIA 1DARA 4OX9E 1KIJA 3OTOI 2NPFA 4LF4I 4DV5I 2AJ4A 4DV2E 4JI5E 3CWVA 2IOQA 3JAMC 1Z59A 4JI6E 3OTOE 1MG7A 4AQYI 4HXZA 4JI4I 4LF4E 1D6TA 4UTGA 4LF6I 2A2CA 2BV3A 3WU4A 5A2QQ 1A6FA 4DV3I 4WUDA 4B3MI 1FJGI 4AQYE 4JI4E 2XEXA 4DU8A 4LF6E 3QT8A 2Z5EA 4DV4I 1H73A 4B3ME 3WU3A 2UXDI 1IBLI 2V8PA 3J7AM 4B3TI 1N34E 1RREA 1XNQI 4FWDA 2DEIA 2VF3A 4DV4E 1Z0EA 4IZJA 4LF9E 4JI8I 1IBLE 4B3TE 4MYTA 2Z5BB 4X62I 4I3HA 2HKEA 2R42A 1XNQE 1ELOA 1H74A 4USKA 4DR2I 3PRYA 4JI8E 2GQ0A 3QT7A 4NXMI 1Y4UA 1IBMI 4JI3I 4YY3I 4JV5I 4DV7I 1HNWE 1Z0VA 4EMDA 4IZKA 3ZZ0A 3F0NA 3J80C 1EA6A 3HULA 4JI1I 4DR2E 2PNMA 2ZM6I 1MU5A 4USMA 4NXME 1IBME 1S4EA 4JI3E 4JV5E 1KTVA 1H72C 4DPUA 1ZM4A 3Q6MA 3JAMQ 1H7UA 2ZM6E 3T1HI 2LJPA 3QT5A 1XMOI 1Z5AA 3PYGA 5LMUI 4GKKI 4K0KI 3LPSA 4LFAI 2O1UA 1U2RA 2Z5CA 4LF8I 4B3RI 5LMUE 1FKAE 2UUAI 1Z5CA 3H4LA 1KKHA 5L3JA 4LF8E 5IT9C 1OJ4A 4DV1I 2UUAE 3GONA 3K1JA 2UUCI 4X66E 1PIEA 1S16A 1N0VC 1N36I 1KVKA 4M1KA 2HK3A 3WU5A 2WW4A 3ZKDA 4DV1E 2O1TA 4ED4A 1XHKA 1N33I 2BM1A 2UUCE 2V34A 4Z7YA 4DV5E 1N36E 2F4VI 1VISA 3M6AA 1N32I 2UU9I 1N33E 4X64I 3J80Q 2CZ9A 1USVA 3D4JA 3WU6A 5LL6R 2F4VE 2CGEA 3B78A 4DV6I 1N32E 2V2ZA 4DV3E 1PVGA 4X64E 2A2DA 3Q6NA 4FWHA 4JI2I 1FJGE 4DR1I 1ZM3A 2UXBI 1H7SA 5GMEA 5FLXQ 4DV6E 2Z5BA 1EI1A 4N3OA 2V2VA 3B82A 4PU9A 2UXDE 4LF5I 4JI2E 4DR1E 1K47A 2UXBE 2BM0A 1Z0GA 2HHHI 3K85A 3J81Q 4DPTA 4DUYI 4LF5E 1B62A 3ZKBA 4LFBI 2R3VA 4X62E 2HHHE 5IT9Q 1BKNA 2E1RA 4MYUA 4JI7I 4HACB 1XMQI 4FWGA 4JG4A 4YY3E 2GS8A 1I94I 3PYFA 4DV7E 2IOPA 2OI2A 4JI1E 4JI7E 2VQFI 2O1VA 2HKJA 4DR7I 3P06A 1FI4A 1IBKI 1Z0TA 1HR0I 2DEJA 5FLXC 2E5LI 5IWAI 1Z0CA 2VQFE 4YHHI 2CG9A 4HYMA 4DXLA 4JYAI 3T1HE 4DR7E 1B63A 1XMOE 4GKKE 2E5LE 2X36A 3J81C 4K0KE 4P52A 1HNZI 4LFAE 4UT4A 4YHHE 4B3RE 5FWKA 1NHJA 4DPXA 1RR9A 4R1FA 4DR6I 5LMNI 1NZ0A 2V2QA 4PRXA 2O1WA 3K17A 1Y6ZA 1XNRI 3HJCA 3ZZUA 1WUUA 4DR6E 5LMNE 4DPYA 1QZRA 1HK7A 2HK2A 4P7AA 4DUZI 1XNRE 3Q1QA 1NHHA 4JI6I 4LFCI 4WUBA 1Y4SA 3LTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQV A;  4DU7 A;  2HFS A;  2HFU A;  4DUZ E;  1HNX I;  4FW9 A;  1ZM9 A;  1MX0 A;  2EFG A;  4GKJ I;  4PRV A;  4LFC E;  2UU9 E;  1UEK A;  4DPW A;  1HNX E;  3LNU A;  3QT6 A;  1FWL A;  3PYD A;  4X65 I;  4GKJ E;  3J7A G;  4DR4 I;  5BR8 I;  1N34 I;  5GMD A;  2VQE I;  1N0U A;  4RPF A;  2X7I A;  4HY1 A;  2ZIT A;  4DV0 I;  4X65 E;  4LF9 I;  4DR4 E;  5BR8 E;  4WUC A;  1Z0W A;  4FN5 A;  2VQE E;  3T1Y I;  3ZM7 A;  4DR5 I;  4DV0 E;  4HAC A;  4NXN I;  4DUY E;  1Z0B A;  4LFB E;  3B8H A;  3T1Y E;  1PKP A;  1ZM2 A;  1HNW I;  4DR5 E;  3V5R A;  4NXN E;  2J7K A;  2Q2E B;  4XTJ A;  5A2Q C;  1XMQ E;  1I94 E;  1ZXN A;  2UXC I;  1FWK A;  4URL A;  1Z5B A;  1IBK E;  1NHI A;  3PYE A;  3V2U C;  1HR0 E;  2UUB I;  5IWA E;  2UXC E;  4DR3 I;  3ZZT A;  4JYA E;  4KHP I;  4JI0 I;  2UUB E;  4B3S I;  1J5E I;  1ZXM A;  1HNZ E;  4Z7C A;  4DR3 E;  1FNM A;  4LF7 I;  4KHP E;  4JI0 E;  4B3S E;  1J5E E;  4OX9 I;  4X66 I;  2ZBK B;  4JI5 I;  4DV2 I;  4LF7 E;  4ZVI A;  1DAR A;  4OX9 E;  1KIJ A;  3OTO I;  2NPF A;  4LF4 I;  4DV5 I;  2AJ4 A;  4DV2 E;  4JI5 E;  3CWV A;  3JAM C;  1Z59 A;  4JI6 E;  3OTO E;  1MG7 A;  4AQY I;  4HXZ A;  4JI4 I;  4LF4 E;  1D6T A;  4UTG A;  4LF6 I;  2A2C A;  2BV3 A;  3WU4 A;  5A2Q Q;  1A6F A;  4DV3 I;  4WUD A;  4B3M I;  1FJG I;  4AQY E;  4JI4 E;  2XEX A;  4DU8 A;  4LF6 E;  3QT8 A;  4DV4 I;  1H73 A;  4B3M E;  3WU3 A;  2UXD I;  1IBL I;  2V8P A;  3J7A M;  4B3T I;  1N34 E;  1RRE A;  1XNQ I;  4FWD A;  2DEI A;  2VF3 A;  4DV4 E;  1Z0E A;  4LF9 E;  4JI8 I;  1IBL E;  4B3T E;  4MYT A;  4X62 I;  4I3H A;  2HKE A;  2R42 A;  1XNQ E;  1ELO A;  1H74 A;  4USK A;  4DR2 I;  4JI8 E;  3QT7 A;  4NXM I;  1IBM I;  4JI3 I;  4YY3 I;  4JV5 I;  4DV7 I;  1HNW E;  1Z0V A;  4EMD A;  3ZZ0 A;  3F0N A;  1EA6 A;  3HUL A;  3J80 C;  4JI1 I;  4DR2 E;  2ZM6 I;  1MU5 A;  4USM A;  4NXM E;  1IBM E;  1S4E A;  4JI3 E;  4JV5 E;  1KTV A;  1H72 C;  4DPU A;  1ZM4 A;  3JAM Q;  1H7U A;  2ZM6 E;  3T1H I;  2LJP A;  3QT5 A;  1XMO I;  1Z5A A;  3PYG A;  5LMU I;  4GKK I;  4K0K I;  3LPS A;  4LFA I;  1U2R A;  4LF8 I;  4B3R I;  5LMU E;  1FKA E;  2UUA I;  1Z5C A;  3H4L A;  1KKH A;  5L3J A;  4LF8 E;  5IT9 C;  1OJ4 A;  4DV1 I;  2UUA E;  3GON A;  3K1J A;  2UUC I;  4X66 E;  1PIE A;  1S16 A;  1N0V C;  1N36 I;  1KVK A;  4M1K A;  2HK3 A;  3WU5 A;  2WW4 A;  3ZKD A;  4DV1 E;  4ED4 A;  1XHK A;  1N33 I;  2BM1 A;  2UUC E;  2V34 A;  4Z7Y A;  4DV5 E;  1N36 E;  2F4V I;  1VIS A;  3M6A A;  1N32 I;  2UU9 I;  1N33 E;  4X64 I;  3J80 Q;  2CZ9 A;  3D4J A;  3WU6 A;  5LL6 R;  2F4V E;  3B78 A;  4DV6 I;  1N32 E;  2V2Z A;  4DV3 E;  1PVG A;  4X64 E;  2A2D A;  4FWH A;  4JI2 I;  1FJG E;  4DR1 I;  1ZM3 A;  2UXB I;  1H7S A;  5GME A;  5FLX Q;  4DV6 E;  1EI1 A;  2V2V A;  3B82 A;  4PU9 A;  2UXD E;  4LF5 I;  4JI2 E;  4DR1 E;  1K47 A;  2UXB E;  2BM0 A;  1Z0G A;  2HHH I;  3J81 Q;  4DPT A;  4DUY I;  4LF5 E;  1B62 A;  3ZKB A;  4LFB I;  2R3V A;  4X62 E;  2HHH E;  5IT9 Q;  1BKN A;  2E1R A;  4MYU A;  4JI7 I;  4HAC B;  1XMQ I;  4FWG A;  4JG4 A;  4YY3 E;  2GS8 A;  1I94 I;  3PYF A;  4DV7 E;  2OI2 A;  4JI1 E;  4JI7 E;  2VQF I;  2HKJ A;  4DR7 I;  1FI4 A;  1IBK I;  1Z0T A;  1HR0 I;  2DEJ A;  5FLX C;  2E5L I;  5IWA I;  1Z0C A;  2VQF E;  4YHH I;  4HYM A;  4DXL A;  4JYA I;  3T1H E;  4DR7 E;  1B63 A;  1XMO E;  4GKK E;  2E5L E;  2X36 A;  3J81 C;  4K0K E;  4P52 A;  1HNZ I;  4LFA E;  4UT4 A;  4YHH E;  4B3R E;  1NHJ A;  4DPX A;  1RR9 A;  4R1F A;  4DR6 I;  5LMN I;  1NZ0 A;  2V2Q A;  4PRX A;  3K17 A;  1XNR I;  3ZZU A;  1WUU A;  4DR6 E;  5LMN E;  4DPY A;  1QZR A;  2HK2 A;  4P7A A;  4DUZ I;  1XNR E;  3Q1Q A;  1NHH A;  4JI6 I;  4LFC I;  4WUB A;  3LTO A; 
#chains in the Genus database with same CATH topology
 5K36 C;  4KQV A;  3P76 A;  4DU7 A;  2HFS A;  2HFU A;  4DUZ E;  1HNX I;  4FW9 A;  1ZM9 A;  5C0X A;  1MX0 A;  2EFG A;  4GKJ I;  4PRV A;  5JEA E;  4LFC E;  2UU9 E;  1UEK A;  1UDS A;  4DPW A;  1HNX E;  3LNU A;  4LPF A;  3QT6 A;  1FWL A;  3PYD A;  4X65 I;  4GKJ E;  3J7A G;  4DR4 I;  5BR8 I;  4IFD C;  4IS9 A;  1N34 I;  5GMD A;  2VQE I;  1N0U A;  4RPF A;  2X7I A;  4HY1 A;  2ZIT A;  4DV0 I;  4X65 E;  4LF9 I;  4DR4 E;  5BR8 E;  4WUC A;  4OKG A;  1Z0W A;  2WNR A;  4FN5 A;  2VQE E;  3T1Y I;  3U1Y A;  3ZM7 A;  1XXE A;  4IZJ D;  4DR5 I;  4DV0 E;  5K36 A;  4HAC A;  4NXN I;  4DUY E;  1Z0B A;  4LFB E;  3B8H A;  5DRR A;  3T1Y E;  1PKP A;  3B4T A;  4IZJ B;  5K36 F;  2C38 A;  1ZM2 A;  1HNW I;  4DR5 E;  3V5R A;  3NZK A;  4NXN E;  2J7K A;  1YHC A;  2Q2E B;  4XTJ A;  4IFD A;  5A2Q C;  5JEA B;  1XMQ E;  5JEA F;  1I94 E;  1ZXN A;  2PO1 A;  3M85 G;  2UXC I;  4IZK B;  1FWK A;  4URL A;  1Z5B A;  3GCM A;  1IBK E;  1NHI A;  3PYE A;  3V2U C;  1HR0 E;  2UUB I;  1USU A;  3GME A;  5IWA E;  2UXC E;  4J3D A;  1E3P A;  4ISA A;  4DR3 I;  4BA2 B;  3ZZT A;  4JYA E;  4KHP I;  2O3Z A;  4JI0 I;  3M7N D;  2UUB E;  4B3S I;  4GQU A;  1J5E I;  1ZXM A;  1HNZ E;  4Z7C A;  4DR3 E;  1FNM A;  4LF7 I;  2JEA A;  4KHP E;  2PO2 B;  2JE6 B;  2IER A;  2BR2 B;  4JI0 E;  2PNZ A;  2Z5C B;  2PNL A;  4LCF A;  4B3S E;  2NN6 D;  1J5E E;  3KRN A;  4NBQ A;  4OX9 I;  4X66 I;  2ZBK B;  4JI5 I;  4DV2 I;  1OYS A;  4LF7 E;  4LOM A;  4ZVI A;  1DAR A;  2C37 A;  1OYP A;  4QNK A;  4OX9 E;  1KIJ A;  3OTO I;  2NPF A;  4LF4 I;  4DV5 I;  2AJ4 A;  4DV2 E;  4JI5 E;  3CWV A;  2IOQ A;  3JAM C;  1Z59 A;  4JI6 E;  3OTO E;  1MG7 A;  4AQY I;  4HXZ A;  4JI4 I;  4LF4 E;  1D6T A;  4UTG A;  4LF6 I;  2A2C A;  2BV3 A;  3U1K A;  3WU4 A;  5A2Q Q;  1RHY A;  1A6F A;  3P3E A;  5JEA C;  4DV3 I;  4WUD A;  4B3M I;  5ELW A;  1FJG I;  4AQY E;  4JI4 E;  2J65 A;  2XEX A;  4DU8 A;  5C0X D;  4LF6 E;  3QT8 A;  4BA1 B;  2Z5E A;  4DV4 I;  1H73 A;  4B3M E;  3WU3 A;  2UXD I;  1IBL I;  2V8P A;  2VES A;  4QNJ A;  4B3T I;  3J7A M;  1N34 E;  4OO1 E;  1RRE A;  1XNQ I;  4FWD A;  2DEI A;  2VF3 A;  4DV4 E;  3L7Z B;  1Z0E A;  4IZJ A;  4MQY A;  5DNL A;  4LF9 E;  4JI8 I;  1IBL E;  4B3T E;  4MYT A;  2Z5B B;  4X62 I;  4I3H A;  2HKE A;  2R42 A;  1XNQ E;  3UHM A;  1UDQ A;  1ELO A;  3HKM A;  1H74 A;  4USK A;  4DR2 I;  3PRY A;  4JI8 E;  5JEA A;  2NN6 E;  2GQ0 A;  3QT7 A;  4AID A;  4NXM I;  1Y4U A;  1IBM I;  2BA0 G;  2C39 B;  1R6L A;  4YY3 I;  4JI3 I;  4JV5 I;  1Y5Y A;  1YH8 A;  4DV7 I;  2JEB B;  1HNW E;  1Z0V A;  4EMD A;  3PS2 A;  4IZK A;  3ZZ0 A;  3F0N A;  1EA6 A;  3HUL A;  3J80 C;  4JI1 I;  4DR2 E;  2PNM A;  2ZM6 I;  4FW4 A;  1MU5 A;  4USM A;  4NXM E;  1IBM E;  1S4E A;  5EL9 A;  4JI3 E;  4JV5 E;  1KTV A;  1H72 C;  4DPU A;  2PO0 B;  3CDJ A;  1ZM4 A;  3Q6M A;  3JAM Q;  4BA2 A;  1H7U A;  2IES A;  4MDT A;  4IFD D;  1OYR A;  4OO1 D;  2ZM6 E;  3T1H I;  4FW5 A;  2LJP A;  3QT5 A;  1XMO I;  1Z5A A;  3PYG A;  5LMU I;  4GKK I;  4K0K I;  3LPS A;  4OO1 B;  4LFA I;  2O1U A;  2PO2 A;  2JE6 A;  1U2R A;  2BR2 A;  2Z5C A;  2GO3 A;  4LF8 I;  1VI7 A;  4B3R I;  5LMU E;  1FKA E;  5C0X E;  2UUA I;  4U3B A;  1Z5C A;  3H4L A;  1KKH A;  5L3J A;  2WP8 B;  4LF8 E;  4MU1 A;  5IT9 C;  1OJ4 A;  4DV1 I;  2UUA E;  2NN6 B;  3GON A;  3K1J A;  2NN6 F;  2UUC I;  4MU4 A;  4X66 E;  1PIE A;  1S16 A;  1R6M A;  1N0V C;  4M1K A;  1KVK A;  1N36 I;  2HK3 A;  3CDI A;  3WU5 A;  2WW4 A;  3ZKD A;  4DV1 E;  2GO4 A;  2O1T A;  4ED4 A;  1XHK A;  1N33 I;  2BM1 A;  4FW6 A;  2UUC E;  2V34 A;  4Z7Y A;  4AIM A;  4DV5 E;  1N36 E;  2F4V I;  1VIS A;  3M6A A;  5K36 E;  1N32 I;  2BA1 G;  2UU9 I;  1N33 E;  4AM3 A;  4X64 I;  3J80 Q;  2CZ9 A;  4BA1 A;  1USV A;  3D4J A;  3M7N G;  3WU6 A;  1UDN A;  5LL6 R;  2F4V E;  2CGE A;  3B78 A;  2JT2 A;  4DV6 I;  1N32 E;  2V2Z A;  2BA0 D;  4DV3 E;  1PVG A;  4X64 E;  2A2D A;  3Q6N A;  3P3G A;  4FWH A;  4JI2 I;  1FJG E;  4DR1 I;  5C0X B;  1ZM3 A;  4IFD E;  2UXB I;  5C0X F;  1H7S A;  3L7Z A;  5GME A;  3M85 D;  5FLX Q;  4DV6 E;  2Z5B A;  1EI1 A;  4N3O A;  2V2V A;  4OO1 C;  3B82 A;  4PU9 A;  2UXD E;  4LF5 I;  4JI2 E;  4DR1 E;  1K47 A;  2UXB E;  3H1C A;  2BM0 A;  5DRO A;  1Z0G A;  3DD6 A;  2HHH I;  4MU3 A;  3K85 A;  1Y60 A;  3J81 Q;  4DPT A;  2C39 A;  4DUY I;  4LF5 E;  1B62 A;  3ZKB A;  2AE8 A;  4LFB I;  2JEB A;  2R3V A;  4X62 E;  2HHH E;  5IT9 Q;  5K36 D;  2WNR B;  4LCG A;  1E3H A;  2NN6 C;  2PO0 A;  1BKN A;  2E1R A;  4MYU A;  4JI7 I;  3PS3 A;  5K36 B;  4HAC B;  1XMQ I;  4FWG A;  4JG4 A;  4YY3 E;  2GS8 A;  1I94 I;  3PYF A;  5JEA D;  4DV7 E;  2IOP A;  2OI2 A;  2C38 B;  4JI1 E;  4JI7 E;  2VQF I;  2O1V A;  2HKJ A;  4OO1 A;  4DR7 I;  3P06 A;  1FI4 A;  4FW3 A;  5EKW A;  1IBK I;  1Z0T A;  1HR0 I;  2DEJ A;  4U3D A;  5FLX C;  2E5L I;  4MU0 A;  4IFD B;  2CVE A;  5IWA I;  4IFD F;  4OO1 F;  1Z0C A;  2VQF E;  4YHH I;  2CG9 A;  4HYM A;  1P42 A;  4DXL A;  4JYA I;  3T1H E;  4FW7 A;  4DR7 E;  1B63 A;  2PO1 B;  1XMO E;  4GKK E;  2E5L E;  2X36 A;  2WP8 A;  3J81 C;  4K0K E;  4P52 A;  1HNZ I;  4LFA E;  4UT4 A;  4YHH E;  2BA1 D;  2NN6 A;  5C0X C;  5DNX A;  5FWK A;  4B3R E;  1NHJ A;  4DPX A;  1RR9 A;  4R1F A;  4DR6 I;  5LMN I;  3PS1 A;  1NZ0 A;  2V2Q A;  4PRX A;  5DRQ A;  1UDO A;  2O1W A;  3K17 A;  1Y6Z A;  2F1D A;  1XNR I;  3HJC A;  3ZZU A;  1WUU A;  3GLL A;  2JEA B;  4DR6 E;  5LMN E;  4DPY A;  2PNZ B;  1QZR A;  1HK7 A;  2HK2 A;  4P7A A;  3P3C A;  4DUZ I;  4OZE A;  1XNR E;  3Q1Q A;  5DRP A;  1NHH A;  4JI6 I;  4LCH A;  4LFC I;  4WUB A;  1Y4S A;  3LTO A;  2C37 B; 
#chains in the Genus database with same CATH homology
 4KQV A;  4DU7 A;  2HFS A;  2HFU A;  4DUZ E;  1HNX I;  4FW9 A;  1ZM9 A;  1MX0 A;  2EFG A;  4GKJ I;  4PRV A;  4LFC E;  2UU9 E;  1UEK A;  4DPW A;  1HNX E;  3LNU A;  3QT6 A;  1FWL A;  3PYD A;  4X65 I;  4GKJ E;  3J7A G;  4DR4 I;  5BR8 I;  1N34 I;  5GMD A;  2VQE I;  1N0U A;  4RPF A;  2X7I A;  4HY1 A;  2ZIT A;  4DV0 I;  4X65 E;  4LF9 I;  4DR4 E;  5BR8 E;  4WUC A;  1Z0W A;  4FN5 A;  2VQE E;  3T1Y I;  3ZM7 A;  4IZJ D;  4DR5 I;  4DV0 E;  4HAC A;  4NXN I;  4DUY E;  1Z0B A;  4LFB E;  3B8H A;  3T1Y E;  1PKP A;  4IZJ B;  1ZM2 A;  1HNW I;  4DR5 E;  3V5R A;  4NXN E;  2J7K A;  2Q2E B;  4XTJ A;  5A2Q C;  1XMQ E;  1I94 E;  1ZXN A;  2UXC I;  4IZK B;  1FWK A;  4URL A;  1Z5B A;  1IBK E;  1NHI A;  3PYE A;  3V2U C;  1HR0 E;  2UUB I;  1USU A;  5IWA E;  2UXC E;  4DR3 I;  3ZZT A;  4JYA E;  4KHP I;  4JI0 I;  2UUB E;  4B3S I;  1J5E I;  1ZXM A;  1HNZ E;  4Z7C A;  4DR3 E;  1FNM A;  4LF7 I;  4KHP E;  4JI0 E;  2Z5C B;  2PNL A;  4B3S E;  1J5E E;  4OX9 I;  4X66 I;  2ZBK B;  4JI5 I;  4DV2 I;  4LF7 E;  4ZVI A;  1DAR A;  4OX9 E;  1KIJ A;  3OTO I;  2NPF A;  4LF4 I;  4DV5 I;  2AJ4 A;  4DV2 E;  4JI5 E;  3CWV A;  2IOQ A;  3JAM C;  1Z59 A;  4JI6 E;  3OTO E;  1MG7 A;  4AQY I;  4HXZ A;  4JI4 I;  4LF4 E;  1D6T A;  4UTG A;  4LF6 I;  2A2C A;  2BV3 A;  3WU4 A;  5A2Q Q;  1A6F A;  4DV3 I;  4WUD A;  4B3M I;  1FJG I;  4AQY E;  4JI4 E;  2XEX A;  4DU8 A;  4LF6 E;  3QT8 A;  2Z5E A;  4DV4 I;  1H73 A;  4B3M E;  3WU3 A;  2UXD I;  1IBL I;  2V8P A;  3J7A M;  4B3T I;  1N34 E;  1RRE A;  1XNQ I;  4FWD A;  2DEI A;  2VF3 A;  4DV4 E;  1Z0E A;  4IZJ A;  4LF9 E;  4JI8 I;  1IBL E;  4B3T E;  4MYT A;  2Z5B B;  4X62 I;  4I3H A;  2HKE A;  2R42 A;  1XNQ E;  1ELO A;  1H74 A;  4USK A;  4DR2 I;  3PRY A;  4JI8 E;  2GQ0 A;  3QT7 A;  4NXM I;  1Y4U A;  1IBM I;  4JI3 I;  4YY3 I;  4JV5 I;  4DV7 I;  1HNW E;  1Z0V A;  4EMD A;  4IZK A;  3ZZ0 A;  3F0N A;  3J80 C;  1EA6 A;  3HUL A;  4JI1 I;  4DR2 E;  2PNM A;  2ZM6 I;  1MU5 A;  4USM A;  4NXM E;  1IBM E;  1S4E A;  4JI3 E;  4JV5 E;  1KTV A;  1H72 C;  4DPU A;  1ZM4 A;  3Q6M A;  3JAM Q;  1H7U A;  2ZM6 E;  3T1H I;  2LJP A;  3QT5 A;  1XMO I;  1Z5A A;  3PYG A;  5LMU I;  4GKK I;  4K0K I;  3LPS A;  4LFA I;  2O1U A;  1U2R A;  2Z5C A;  4LF8 I;  4B3R I;  5LMU E;  1FKA E;  2UUA I;  1Z5C A;  3H4L A;  1KKH A;  5L3J A;  4LF8 E;  5IT9 C;  1OJ4 A;  4DV1 I;  2UUA E;  3GON A;  3K1J A;  2UUC I;  4X66 E;  1PIE A;  1S16 A;  1N0V C;  1N36 I;  1KVK A;  4M1K A;  2HK3 A;  3WU5 A;  2WW4 A;  3ZKD A;  4DV1 E;  2O1T A;  4ED4 A;  1XHK A;  1N33 I;  2BM1 A;  2UUC E;  2V34 A;  4Z7Y A;  4DV5 E;  1N36 E;  2F4V I;  1VIS A;  3M6A A;  1N32 I;  2UU9 I;  1N33 E;  4X64 I;  3J80 Q;  2CZ9 A;  1USV A;  3D4J A;  3WU6 A;  5LL6 R;  2F4V E;  2CGE A;  3B78 A;  4DV6 I;  1N32 E;  2V2Z A;  4DV3 E;  1PVG A;  4X64 E;  2A2D A;  3Q6N A;  4FWH A;  4JI2 I;  1FJG E;  4DR1 I;  1ZM3 A;  2UXB I;  1H7S A;  5GME A;  5FLX Q;  4DV6 E;  2Z5B A;  1EI1 A;  4N3O A;  2V2V A;  3B82 A;  4PU9 A;  2UXD E;  4LF5 I;  4JI2 E;  4DR1 E;  1K47 A;  2UXB E;  2BM0 A;  1Z0G A;  2HHH I;  3K85 A;  3J81 Q;  4DPT A;  4DUY I;  4LF5 E;  1B62 A;  3ZKB A;  4LFB I;  2R3V A;  4X62 E;  2HHH E;  5IT9 Q;  1BKN A;  2E1R A;  4MYU A;  4JI7 I;  4HAC B;  1XMQ I;  4FWG A;  4JG4 A;  4YY3 E;  2GS8 A;  1I94 I;  3PYF A;  4DV7 E;  2IOP A;  2OI2 A;  4JI1 E;  4JI7 E;  2VQF I;  2O1V A;  2HKJ A;  4DR7 I;  3P06 A;  1FI4 A;  1IBK I;  1Z0T A;  1HR0 I;  2DEJ A;  5FLX C;  2E5L I;  5IWA I;  1Z0C A;  2VQF E;  4YHH I;  2CG9 A;  4HYM A;  4DXL A;  4JYA I;  3T1H E;  4DR7 E;  1B63 A;  1XMO E;  4GKK E;  2E5L E;  2X36 A;  3J81 C;  4K0K E;  4P52 A;  1HNZ I;  4LFA E;  4UT4 A;  4YHH E;  4B3R E;  5FWK A;  1NHJ A;  4DPX A;  1RR9 A;  4R1F A;  4DR6 I;  5LMN I;  1NZ0 A;  2V2Q A;  4PRX A;  2O1W A;  3K17 A;  1Y6Z A;  1XNR I;  3HJC A;  3ZZU A;  1WUU A;  4DR6 E;  5LMN E;  4DPY A;  1QZR A;  1HK7 A;  2HK2 A;  4P7A A;  4DUZ I;  1XNR E;  3Q1Q A;  1NHH A;  4JI6 I;  4LFC I;  4WUB A;  1Y4S A;  3LTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...