2E5LI

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2e5lI00
2A2CA 4P52A 1N0UA 2DEJA 4JV5I 2UUAE 4EMDA 3ZKBA 3D4JA 4DUZI 1ZXNA 1Z0EA 3T1HI 1XNRE 1EI1A 4DR1I 3OTOE 1EA6A 1H72C 1J5EI 2UUBE 1S4EA 3F0NA 2V2VA 3QT7A 1PKPA 4YY3I 3B8HA 2BM1A 3QT8A 2ZBKB 4DV0I 4DV4I 3K17A 3HULA 4JI7I 4NXNI 1HNXI 3J80C 3LTOA 2UXBE 1FWKA 1MX0A 4DR6I 3J80Q 4KQVA 1XMOE 1Z0CA 1KIJA 1PIEA 1IBKI 4LF8I 4DV2I 1J5EE 5LMUI 4YHHI 2E1RA 2X7IA 4B3RI 4X64I 2HKJA 3JAMC 1ZM4A 1HNZE 4R1FA 4P7AA 4DV5I 2EFGA 3ZZTA 4DV1I 3JAMQ 3J81Q 4DV4E 4JI7E 1Z0GA 3PYDA 4WUDA 4NXNE 2UXDI 1IBMI 1IBLI 2LJPA 4FWDA 1FKAE 4LF5I 1Z0VA 4FWHA 1N34I 4B3TE 4DR5I 1IBKE 4LF8E 4DV2E 4FW9A 5LMUE 4YHHE 2OI2A 1HNWI 5IWAE 3V5RA 5LL6R 2AJ4A 2UU9I 1U2RA 1OJ4A 2UXCI 4PU9A 1HR0E 4DV1E 1H7SA 4ED4A 4AQYI 2UUCE 4B3SI 1H73A 5LMNI 4JI2I 2UXDE 1XMQI 3PYFA 1XNQI 3Q1QA 2ZM6I 4X65I 5GMDA 3ZKDA 1IBLE 3ZZ0A 4DR4I 4LF5E 4WUBA 1N34E 4DR5E 4JG4A 4M1KA 3M6AA 2XEXA 4KHPI 4JI6I 2V2ZA 1ZM2A 4DV3E 3WU5A 4X62I 3PYEA 4HYMA 1VISA 1ELOA 4K0KI 4Z7YA 1Z59A 1NHIA 1H7UA 2UXCE 4I3HA 4AQYE 2V2QA 1FJGI 4B3MI 4JYAI 4B3SE 2HK2A 1WUUA 1XMQE 4JV5E 4MYTA 1XNQE 2BM0A 2E5LI 4OX9I 2ZM6E 4X65E 4DPWA 3B78A 4LF9I 4JI5I 4LF6I 4LFCI 4DR4E 4USMA 1N33I 2R3VA 1KTVA 1RREA 4DUZE 4DXLA 1FWLA 3T1HE 4KHPE 4HY1A 1DARA 4DR1E 4DV6I 1KKHA 3K1JA 4USKA 2NPFA 3T1YI 4X62E 3QT6A 4K0KE 1K47A 1H74A 3J81C 4PRXA 4JI0I 3J7AG 4YY3E 1FJGE 4B3ME 4JYAE 2VQFI 4JI8I 4DV0E 2HHHI 4X66I 3PYGA 1KVKA 1MU5A 2V8PA 2X36A 5BR8I 2E5LE 1HNXE 4OX9E 4GKJI 4FN5A 4Z7CA 1N33E 5FLXQ 4DR6E 2HFSA 4LF4I 3WU4A 1I94I 4DPTA 4DV6E 3T1YE 1B62A 2BV3A 3ZM7A 4WUCA 2DEIA 4B3RE 4X64E 3CWVA 4DPUA 4LF7I 2V34A 5L3JA 4JI0E 1Z5AA 4DUYI 4DV5E 2HHHE 2VF3A 4FWGA 1FI4A 4GKJE 4DR3I 2ZITA 1IBME 4RPFA 4JI1I 2VQEI 4DR2I 4LF4E 1I94E 1NZ0A 4GKKI 4LFBI 1HNWE 1N32I 4NXMI 4ZVIA 1RR9A 1UEKA 4LF7E 4MYUA 2UU9E 1NHJA 4DUYE 4JI3I 2UXBI 1XMOI 1BKNA 3J7AM 5LMNE 4JI2E 1B63A 4DR3E 2J7KA 4JI1E 2VQEE 2CZ9A 4DR2E 1Z0BA 4UTGA 3ZZUA 2Q2EB 3H4LA 4DPYA 4DV7I 2HKEA 1HNZI 4GKKE 2HFUA 1PVGA 4DU8A 4LFAI 2F4VI 1MG7A 1Z0WA 4JI6E 4LFBE 1N32E 4NXME 3LNUA 3GONA 1N36I 4DPXA 4JI3E 4DR7I 1D6TA 1A6FA 5IT9C 3QT5A 4HXZA 1S16A 4B3TI 1Z0TA 5FLXC 5IT9Q 4JI4I 4HACB 4LF9E 5IWAI 4JI5E 1NHHA 4LF6E 4LFCE 1XHKA 4DV7E 4URLA 4LFAE 4PRVA 2F4VE 1HR0I 3V2UC 2UUCI 4UT4A 1Z5BA 2GS8A 5GMEA 1ZXMA 1N0VC 1N36E 4DR7E 2HK3A 2A2DA 2UUAI 1FNMA 2VQFE 4JI8E 4XTJA 4X66E 3WU3A 4HACA 5A2QC 1ZM3A 1XNRI 2WW4A 4JI4E 5BR8E 1QZRA 4DV3I 3OTOI 3B82A 3LPSA 5A2QQ 2UUBI 2R42A 4DU7A 3WU6A 1ZM9A 1Z5CA
chains in the Genus database with same CATH superfamily
2A2CA 4P52A 2JE6A 3M7ND 3K85A 1YH8A 4OZEA 1N0UA 2DEJA 1OYSA 3HKMA 4JV5I 2UUAE 4EMDA 3Q6MA 3ZKBA 4U3DA 5FWKA 5EKWA 5DROA 3D4JA 4DUZI 1ZXNA 1Z0EA 2O1TA 3T1HI 1XNRE 3P06A 1EI1A 4DR1I 1UDSA 3OTOE 1EA6A 1H72C 1Y4UA 1J5EI 2UUBE 1S4EA 3F0NA 2V2VA 3QT7A 4U3BA 2O3ZA 2NN6E 1PKPA 2NN6B 1Y6ZA 3P3GA 4YY3I 3B8HA 2BM1A 2WP8B 3QT8A 4BA2B 2ZBKB 4DV0I 4DV4I 3K17A 5DNXA 3HULA 4JI7I 2AE8A 3P3EA 2Z5CB 4NXNI 1HNXI 3J80C 2C37B 2JEAB 3LTOA 2UXBE 1FWKA 1MX0A 4DR6I 3J80Q 4KQVA 5DNLA 1XMOE 2BR2B 1Z0CA 1E3PA 4IFDB 1KIJA 1PIEA 2BA0D 1IBKI 4LF8I 5C0XF 4DV2I 2BA1D 1J5EE 3P3CA 4YHHI 2E1RA 5LMUI 2NN6C 4ISAA 1USUA 2X7IA 2NN6A 4B3RI 3U1KA 4X64I 2HKJA 3JAMC 1ZM4A 5DRRA 1HNZE 2WP8A 4R1FA 4P7AA 4DV5I 2EFGA 3ZZTA 4DV1I 3JAMQ 3J81Q 4DV4E 2Z5CA 4JI7E 2C37A 2JEAA 1Z0GA 3PYDA 4WUDA 4NXNE 2UXDI 3Q6NA 1IBMI 5JEAD 1IBLI 2LJPA 4FWDA 4IFDC 2BR2A 5JEAC 1FKAE 4IFDA 2IESA 4LF5I 2JEBB 5K36F 1Z0VA 4FWHA 1N34I 3U1YA 4DR5I 4B3TE 4MU1A 1IBKE 4IZJD 4LF8E 4DV2E 4FW9A 5LMUE 4YHHE 2OI2A 1HNWI 5IWAE 3V5RA 5LL6R 1HK7A 1R6MA 2AJ4A 2UU9I 1U2RA 1OJ4A 2UXCI 4PU9A 1HR0E 4DV1E 1H7SA 1RHYA 4ED4A 4AQYI 2UUCE 4LCGA 4B3SI 1H73A 4MU3A 5LMNI 4JI2I 4MQYA 2UXDE 1XMQI 5ELWA 3PYFA 1XNQI 3Q1QA 2ZM6I 4X65I 5GMDA 3ZKDA 1IBLE 3ZZ0A 2JEBA 4OO1D 4DR4I 4LF5E 4WUBA 4LCHA 1N34E 4DR5E 4JG4A 4M1KA 3M6AA 2XEXA 4KHPI 4FW4A 4MDTA 4JI6I 2V2ZA 1ZM2A 4DV3E 4LCFA 3WU5A 3PYEA 4X62I 4HYMA 1VISA 1ELOA 4K0KI 4Z7YA 1Z59A 1NHIA 4BA1B 1H7UA 2UXCE 3HJCA 3NZKA 4I3HA 4AQYE 2V2QA 5C0XD 1FJGI 4B3MI 4JYAI 4OO1F 4B3SE 2HK2A 1WUUA 1UDQA 1XMQE 4JV5E 4MYTA 1XNQE 2BM0A 2E5LI 4OX9I 2ZM6E 4X65E 4DPWA 3B78A 4LF9I 1XXEA 4JI5I 1E3HA 4LF6I 2IOQA 4LFCI 4IZKB 4USMA 4DR4E 1N33I 2R3VA 1KTVA 1RREA 4DUZE 4DXLA 1OYPA 1FWLA 3T1HE 4N3OA 2GO3A 4IFDE 4KHPE 5JEAE 4HY1A 1DARA 5JEAB 4DR1E 4DV6I 1KKHA 3K1JA 4USKA 2NPFA 3T1YI 3CDJA 4X62E 3QT6A 5DRQA 4BA1A 4MU0A 4OKGA 4K0KE 1K47A 5K36D 1Y5YA 4J3DA 1H74A 1R6LA 3PRYA 5K36C 3J81C 4PRXA 4JI0I 3J7AG 4IZJB 3GLLA 4BA2A 4YY3E 1FJGE 5EL9A 4B3ME 4JYAE 3H1CA 2VQFI 4JI8I 4DV0E 2HHHI 4X66I 3PYGA 3P76A 1KVKA 1MU5A 2V8PA 2X36A 5BR8I 2E5LE 1HNXE 4IZKA 3GMEA 1YHCA 4OX9E 4GKJI 4FN5A 4Z7CA 4AM3A 1N33E 5FLXQ 4DR6E 2HFSA 4LF4I 2C39B 2O1WA 3WU4A 5JEAA 4FW7A 3M85G 1I94I 4DPTA 4DV6E 3T1YE 1UDOA 3L7ZB 1B62A 4OO1B 2BV3A 3ZM7A 3KRNA 4WUCA 4IZJA 2DEIA 4B3RE 4X64E 3CWVA 2Z5BB 4DPUA 4LF7I 2V34A 5L3JA 4JI0E 2NN6F 1Z5AA 4DUYI 4DV5E 2IERA 2HHHE 2VF3A 4AIMA 4FWGA 1FI4A 2PO2B 4QNKA 4GKJE 4DR3I 2ZITA 2IOPA 5C0XE 1IBME 2C39A 4RPFA 4JI1I 2VQEI 4DR2I 5C0XB 4LF4E 3PS3A 2PNZB 4OO1C 1OYRA 3L7ZA 1I94E 1NZ0A 4IS9A 4OO1A 4GKKI 3UHMA 2PO1B 2VESA 4LFBI 1HNWE 1N32I 2Z5BA 4NXMI 4ZVIA 1RR9A 1UEKA 2CG9A 4LF7E 4MYUA 2CVEA 1NHJA 2UU9E 2C38B 4DUYE 4JI3I 4MU4A 2GQ0A 2GO4A 2UXBI 3CDIA 2PO2A 1XMOI 5K36E 1BKNA 3J7AM 5C0XC 5K36B 5LMNE 4JI2E 2J65A 5C0XA 1B63A 4DR3E 2J7KA 4JI1E 2VQEE 2CZ9A 4DR2E 1Z0BA 4UTGA 2PNZA 3ZZUA 1UDNA 2Q2EB 3H4LA 4DPYA 4NBQA 3M7NG 4DV7I 2HKEA 1HNZI 4GKKE 2PO1A 2HFUA 1PVGA 4DU8A 3PS1A 4LFAI 2F4VI 1MG7A 1Z0WA 4JI6E 4LFBE 1N32E 4NXME 3PS2A 4LOMA 2C38A 3LNUA 3M85D 5DRPA 3GONA 1N36I 4DPXA 4QNJA 3DD6A 4JI3E 4DR7I 1D6TA 1A6FA 4LPFA 5K36A 5IT9C 3QT5A 4HXZA 1S16A 4B3TI 1Z0TA 1Y4SA 5FLXC 5IT9Q 2NN6D 2WNRB 4JI4I 2PO0B 4HACB 4LF9E 5IWAI 4JI5E 1NHHA 1USVA 4LF6E 4LFCE 1XHKA 4DV7E 3GCMA 4IFDF 4URLA 4LFAE 4PRVA 2F4VE 1HR0I 3V2UC 2UUCI 4FW6A 4UT4A 4FW3A 2PNLA 1Z5BA 1P42A 4OO1E 1VI7A 2GS8A 5GMEA 2JE6B 4AIDA 2PNMA 4GQUA 1ZXMA 1N0VC 2Z5EA 1N36E 4IFDD 4DR7E 2HK3A 2O1VA 1Y60A 2A2DA 2UUAI 2BA0G 1FNMA 2CGEA 2BA1G 2VQFE 4JI8E 4XTJA 2WNRA 2PO0A 4X66E 2F1DA 3WU3A 4HACA 5A2QC 1ZM3A 1XNRI 2WW4A 4JI4E 5BR8E 2JT2A 1QZRA 4DV3I 3OTOI 3B82A 3LPSA 5A2QQ 2UUBI 3B4TA 2R42A 4DU7A 4FW5A 3WU6A 1ZM9A 1Z5CA 2O1UA 5JEAF
chains in the Genus database with same CATH topology
2A2CA 4P52A 3K85A 1N0UA 2DEJA 4JV5I 2UUAE 4EMDA 3Q6MA 3ZKBA 5FWKA 3D4JA 4DUZI 1ZXNA 1Z0EA 2O1TA 3T1HI 1XNRE 3P06A 1EI1A 4DR1I 3OTOE 1EA6A 1H72C 1Y4UA 1J5EI 2UUBE 1S4EA 3F0NA 2V2VA 3QT7A 1PKPA 1Y6ZA 4YY3I 3B8HA 2BM1A 3QT8A 2ZBKB 4DV0I 4DV4I 3K17A 3HULA 4JI7I 2Z5CB 4NXNI 1HNXI 3J80C 3LTOA 2UXBE 1FWKA 1MX0A 4DR6I 3J80Q 4KQVA 1XMOE 1Z0CA 1KIJA 1PIEA 1IBKI 4LF8I 4DV2I 1J5EE 5LMUI 4YHHI 2E1RA 1USUA 2X7IA 4B3RI 4X64I 2HKJA 3JAMC 1ZM4A 1HNZE 4R1FA 4P7AA 4DV5I 2EFGA 3ZZTA 4DV1I 3JAMQ 3J81Q 4DV4E 2Z5CA 4JI7E 1Z0GA 3PYDA 4WUDA 4NXNE 2UXDI 3Q6NA 1IBMI 1IBLI 2LJPA 4FWDA 1FKAE 4LF5I 1Z0VA 4FWHA 1N34I 4B3TE 4DR5I 1IBKE 4IZJD 4LF8E 4DV2E 4FW9A 5LMUE 4YHHE 2OI2A 1HNWI 5IWAE 3V5RA 5LL6R 1HK7A 2AJ4A 2UU9I 1U2RA 1OJ4A 2UXCI 4PU9A 1HR0E 4DV1E 1H7SA 4ED4A 4AQYI 2UUCE 4B3SI 1H73A 5LMNI 4JI2I 2UXDE 1XMQI 3PYFA 1XNQI 3Q1QA 2ZM6I 4X65I 5GMDA 3ZKDA 1IBLE 3ZZ0A 4DR4I 4LF5E 4WUBA 1N34E 4DR5E 4JG4A 4M1KA 3M6AA 2XEXA 4KHPI 4JI6I 2V2ZA 1ZM2A 4DV3E 3WU5A 4X62I 3PYEA 4HYMA 1VISA 1ELOA 4K0KI 4Z7YA 1Z59A 1NHIA 1H7UA 2UXCE 3HJCA 4I3HA 4AQYE 2V2QA 1FJGI 4B3MI 4JYAI 4B3SE 2HK2A 1WUUA 1XMQE 4JV5E 4MYTA 1XNQE 2BM0A 2E5LI 4OX9I 2ZM6E 4X65E 4DPWA 3B78A 4LF9I 4JI5I 4LF6I 2IOQA 4LFCI 4IZKB 4USMA 4DR4E 1N33I 2R3VA 1KTVA 1RREA 4DUZE 4DXLA 1FWLA 3T1HE 4N3OA 4KHPE 4HY1A 1DARA 4DR1E 4DV6I 1KKHA 3K1JA 4USKA 2NPFA 3T1YI 4X62E 3QT6A 4K0KE 1K47A 1H74A 3PRYA 3J81C 4PRXA 4JI0I 3J7AG 4IZJB 4YY3E 1FJGE 4B3ME 4JYAE 2VQFI 4JI8I 4DV0E 2HHHI 4X66I 3PYGA 1KVKA 1MU5A 2V8PA 2X36A 5BR8I 2E5LE 1HNXE 4IZKA 4OX9E 4GKJI 4FN5A 4Z7CA 1N33E 5FLXQ 4DR6E 2HFSA 4LF4I 2O1WA 3WU4A 1I94I 4DPTA 4DV6E 3T1YE 1B62A 2BV3A 3ZM7A 4WUCA 4IZJA 2DEIA 4B3RE 4X64E 3CWVA 2Z5BB 4DPUA 4LF7I 2V34A 5L3JA 4JI0E 1Z5AA 4DUYI 4DV5E 2HHHE 2VF3A 4FWGA 1FI4A 4GKJE 4DR3I 2ZITA 2IOPA 1IBME 4RPFA 4JI1I 2VQEI 4DR2I 4LF4E 1I94E 1NZ0A 4GKKI 4LFBI 1HNWE 1N32I 2Z5BA 4NXMI 4ZVIA 1RR9A 1UEKA 2CG9A 4LF7E 4MYUA 2UU9E 1NHJA 4DUYE 4JI3I 2GQ0A 2UXBI 1XMOI 1BKNA 3J7AM 5LMNE 4JI2E 1B63A 4DR3E 2J7KA 4JI1E 2VQEE 2CZ9A 4DR2E 1Z0BA 4UTGA 3ZZUA 2Q2EB 3H4LA 4DPYA 4DV7I 2HKEA 1HNZI 4GKKE 2HFUA 1PVGA 4DU8A 4LFAI 2F4VI 1MG7A 1Z0WA 4JI6E 4LFBE 1N32E 4NXME 3LNUA 3GONA 1N36I 4DPXA 4JI3E 4DR7I 1D6TA 1A6FA 5IT9C 3QT5A 4HXZA 1S16A 4B3TI 1Z0TA 1Y4SA 5FLXC 5IT9Q 4JI4I 4HACB 4LF9E 5IWAI 4JI5E 1NHHA 1USVA 4LF6E 4LFCE 1XHKA 4DV7E 4URLA 4LFAE 4PRVA 2F4VE 1HR0I 3V2UC 2UUCI 4UT4A 2PNLA 1Z5BA 2GS8A 5GMEA 2PNMA 1ZXMA 1N0VC 2Z5EA 1N36E 4DR7E 2HK3A 2O1VA 2A2DA 2UUAI 1FNMA 2CGEA 2VQFE 4JI8E 4XTJA 4X66E 3WU3A 5A2QC 4HACA 1ZM3A 1XNRI 2WW4A 4JI4E 5BR8E 1QZRA 4DV3I 3OTOI 3B82A 3LPSA 5A2QQ 2UUBI 2R42A 4DU7A 3WU6A 1ZM9A 1Z5CA 2O1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2C A;  4P52 A;  1N0U A;  2DEJ A;  4JV5 I;  2UUA E;  4EMD A;  3ZKB A;  3D4J A;  4DUZ I;  1ZXN A;  1Z0E A;  3T1H I;  1XNR E;  1EI1 A;  4DR1 I;  3OTO E;  1EA6 A;  1H72 C;  1J5E I;  2UUB E;  1S4E A;  3F0N A;  2V2V A;  3QT7 A;  1PKP A;  4YY3 I;  3B8H A;  2BM1 A;  3QT8 A;  2ZBK B;  4DV0 I;  4DV4 I;  3K17 A;  3HUL A;  4JI7 I;  4NXN I;  1HNX I;  3J80 C;  3LTO A;  2UXB E;  1FWK A;  1MX0 A;  4DR6 I;  3J80 Q;  4KQV A;  1XMO E;  1Z0C A;  1KIJ A;  1PIE A;  1IBK I;  4LF8 I;  4DV2 I;  1J5E E;  5LMU I;  4YHH I;  2E1R A;  2X7I A;  4B3R I;  4X64 I;  2HKJ A;  3JAM C;  1ZM4 A;  1HNZ E;  4R1F A;  4P7A A;  4DV5 I;  2EFG A;  3ZZT A;  4DV1 I;  3JAM Q;  3J81 Q;  4DV4 E;  4JI7 E;  1Z0G A;  3PYD A;  4WUD A;  4NXN E;  2UXD I;  1IBM I;  1IBL I;  2LJP A;  4FWD A;  1FKA E;  4LF5 I;  1Z0V A;  4FWH A;  1N34 I;  4B3T E;  4DR5 I;  1IBK E;  4LF8 E;  4DV2 E;  4FW9 A;  5LMU E;  4YHH E;  2OI2 A;  1HNW I;  5IWA E;  3V5R A;  5LL6 R;  2AJ4 A;  2UU9 I;  1U2R A;  1OJ4 A;  2UXC I;  4PU9 A;  1HR0 E;  4DV1 E;  1H7S A;  4ED4 A;  4AQY I;  2UUC E;  4B3S I;  1H73 A;  5LMN I;  4JI2 I;  2UXD E;  1XMQ I;  3PYF A;  1XNQ I;  3Q1Q A;  2ZM6 I;  4X65 I;  5GMD A;  3ZKD A;  1IBL E;  3ZZ0 A;  4DR4 I;  4LF5 E;  4WUB A;  1N34 E;  4DR5 E;  4JG4 A;  4M1K A;  3M6A A;  2XEX A;  4KHP I;  4JI6 I;  2V2Z A;  1ZM2 A;  4DV3 E;  3WU5 A;  4X62 I;  3PYE A;  4HYM A;  1VIS A;  1ELO A;  4K0K I;  4Z7Y A;  1Z59 A;  1NHI A;  1H7U A;  2UXC E;  4I3H A;  4AQY E;  2V2Q A;  1FJG I;  4B3M I;  4JYA I;  4B3S E;  2HK2 A;  1WUU A;  1XMQ E;  4JV5 E;  4MYT A;  1XNQ E;  2BM0 A;  2E5L I;  4OX9 I;  2ZM6 E;  4X65 E;  4DPW A;  3B78 A;  4LF9 I;  4JI5 I;  4LF6 I;  4LFC I;  4DR4 E;  4USM A;  1N33 I;  2R3V A;  1KTV A;  1RRE A;  4DUZ E;  4DXL A;  1FWL A;  3T1H E;  4KHP E;  4HY1 A;  1DAR A;  4DR1 E;  4DV6 I;  1KKH A;  3K1J A;  4USK A;  2NPF A;  3T1Y I;  4X62 E;  3QT6 A;  4K0K E;  1K47 A;  1H74 A;  3J81 C;  4PRX A;  4JI0 I;  3J7A G;  4YY3 E;  1FJG E;  4B3M E;  4JYA E;  2VQF I;  4JI8 I;  4DV0 E;  2HHH I;  4X66 I;  3PYG A;  1KVK A;  1MU5 A;  2V8P A;  2X36 A;  5BR8 I;  2E5L E;  1HNX E;  4OX9 E;  4GKJ I;  4FN5 A;  4Z7C A;  1N33 E;  5FLX Q;  4DR6 E;  2HFS A;  4LF4 I;  3WU4 A;  1I94 I;  4DPT A;  4DV6 E;  3T1Y E;  1B62 A;  2BV3 A;  3ZM7 A;  4WUC A;  2DEI A;  4B3R E;  4X64 E;  3CWV A;  4DPU A;  4LF7 I;  2V34 A;  5L3J A;  4JI0 E;  1Z5A A;  4DUY I;  4DV5 E;  2HHH E;  2VF3 A;  4FWG A;  1FI4 A;  4GKJ E;  4DR3 I;  2ZIT A;  1IBM E;  4RPF A;  4JI1 I;  2VQE I;  4DR2 I;  4LF4 E;  1I94 E;  1NZ0 A;  4GKK I;  4LFB I;  1HNW E;  1N32 I;  4NXM I;  4ZVI A;  1RR9 A;  1UEK A;  4LF7 E;  4MYU A;  2UU9 E;  1NHJ A;  4DUY E;  4JI3 I;  2UXB I;  1XMO I;  1BKN A;  3J7A M;  5LMN E;  4JI2 E;  1B63 A;  4DR3 E;  2J7K A;  4JI1 E;  2VQE E;  2CZ9 A;  4DR2 E;  1Z0B A;  4UTG A;  3ZZU A;  2Q2E B;  3H4L A;  4DPY A;  4DV7 I;  2HKE A;  1HNZ I;  4GKK E;  2HFU A;  1PVG A;  4DU8 A;  4LFA I;  2F4V I;  1MG7 A;  1Z0W A;  4JI6 E;  4LFB E;  1N32 E;  4NXM E;  3LNU A;  3GON A;  1N36 I;  4DPX A;  4JI3 E;  4DR7 I;  1D6T A;  1A6F A;  5IT9 C;  3QT5 A;  4HXZ A;  1S16 A;  4B3T I;  1Z0T A;  5FLX C;  5IT9 Q;  4JI4 I;  4HAC B;  4LF9 E;  5IWA I;  4JI5 E;  1NHH A;  4LF6 E;  4LFC E;  1XHK A;  4DV7 E;  4URL A;  4LFA E;  4PRV A;  2F4V E;  1HR0 I;  3V2U C;  2UUC I;  4UT4 A;  1Z5B A;  2GS8 A;  5GME A;  1ZXM A;  1N0V C;  1N36 E;  4DR7 E;  2HK3 A;  2A2D A;  2UUA I;  1FNM A;  2VQF E;  4JI8 E;  4XTJ A;  4X66 E;  3WU3 A;  4HAC A;  5A2Q C;  1ZM3 A;  1XNR I;  2WW4 A;  4JI4 E;  5BR8 E;  1QZR A;  4DV3 I;  3OTO I;  3B82 A;  3LPS A;  5A2Q Q;  2UUB I;  2R42 A;  4DU7 A;  3WU6 A;  1ZM9 A;  1Z5C A; 
#chains in the Genus database with same CATH topology
 2A2C A;  4P52 A;  2JE6 A;  3M7N D;  3K85 A;  1YH8 A;  4OZE A;  1N0U A;  2DEJ A;  1OYS A;  3HKM A;  4JV5 I;  2UUA E;  4EMD A;  3Q6M A;  3ZKB A;  4U3D A;  5FWK A;  5EKW A;  5DRO A;  3D4J A;  4DUZ I;  1ZXN A;  1Z0E A;  2O1T A;  3T1H I;  1XNR E;  3P06 A;  1EI1 A;  4DR1 I;  1UDS A;  3OTO E;  1EA6 A;  1H72 C;  1Y4U A;  1J5E I;  2UUB E;  1S4E A;  3F0N A;  2V2V A;  3QT7 A;  4U3B A;  2O3Z A;  2NN6 E;  1PKP A;  2NN6 B;  1Y6Z A;  3P3G A;  4YY3 I;  3B8H A;  2BM1 A;  2WP8 B;  3QT8 A;  4BA2 B;  2ZBK B;  4DV0 I;  4DV4 I;  3K17 A;  5DNX A;  3HUL A;  4JI7 I;  2AE8 A;  3P3E A;  2Z5C B;  4NXN I;  1HNX I;  3J80 C;  2C37 B;  2JEA B;  3LTO A;  2UXB E;  1FWK A;  1MX0 A;  4DR6 I;  3J80 Q;  4KQV A;  5DNL A;  1XMO E;  2BR2 B;  1Z0C A;  1E3P A;  4IFD B;  1KIJ A;  1PIE A;  2BA0 D;  1IBK I;  4LF8 I;  5C0X F;  4DV2 I;  2BA1 D;  1J5E E;  3P3C A;  4YHH I;  2E1R A;  5LMU I;  2NN6 C;  4ISA A;  1USU A;  2X7I A;  2NN6 A;  4B3R I;  3U1K A;  4X64 I;  2HKJ A;  3JAM C;  1ZM4 A;  5DRR A;  1HNZ E;  2WP8 A;  4R1F A;  4P7A A;  4DV5 I;  2EFG A;  3ZZT A;  4DV1 I;  3JAM Q;  3J81 Q;  4DV4 E;  2Z5C A;  4JI7 E;  2C37 A;  2JEA A;  1Z0G A;  3PYD A;  4WUD A;  4NXN E;  2UXD I;  3Q6N A;  1IBM I;  5JEA D;  1IBL I;  2LJP A;  4FWD A;  4IFD C;  2BR2 A;  5JEA C;  1FKA E;  4IFD A;  2IES A;  4LF5 I;  2JEB B;  5K36 F;  1Z0V A;  4FWH A;  1N34 I;  3U1Y A;  4DR5 I;  4B3T E;  4MU1 A;  1IBK E;  4IZJ D;  4LF8 E;  4DV2 E;  4FW9 A;  5LMU E;  4YHH E;  2OI2 A;  1HNW I;  5IWA E;  3V5R A;  5LL6 R;  1HK7 A;  1R6M A;  2AJ4 A;  2UU9 I;  1U2R A;  1OJ4 A;  2UXC I;  4PU9 A;  1HR0 E;  4DV1 E;  1H7S A;  1RHY A;  4ED4 A;  4AQY I;  2UUC E;  4LCG A;  4B3S I;  1H73 A;  4MU3 A;  5LMN I;  4JI2 I;  4MQY A;  2UXD E;  1XMQ I;  5ELW A;  3PYF A;  1XNQ I;  3Q1Q A;  2ZM6 I;  4X65 I;  5GMD A;  3ZKD A;  1IBL E;  3ZZ0 A;  2JEB A;  4OO1 D;  4DR4 I;  4LF5 E;  4WUB A;  4LCH A;  1N34 E;  4DR5 E;  4JG4 A;  4M1K A;  3M6A A;  2XEX A;  4KHP I;  4FW4 A;  4MDT A;  4JI6 I;  2V2Z A;  1ZM2 A;  4DV3 E;  4LCF A;  3WU5 A;  3PYE A;  4X62 I;  4HYM A;  1VIS A;  1ELO A;  4K0K I;  4Z7Y A;  1Z59 A;  1NHI A;  4BA1 B;  1H7U A;  2UXC E;  3HJC A;  3NZK A;  4I3H A;  4AQY E;  2V2Q A;  5C0X D;  1FJG I;  4B3M I;  4JYA I;  4OO1 F;  4B3S E;  2HK2 A;  1WUU A;  1UDQ A;  1XMQ E;  4JV5 E;  4MYT A;  1XNQ E;  2BM0 A;  2E5L I;  4OX9 I;  2ZM6 E;  4X65 E;  4DPW A;  3B78 A;  4LF9 I;  1XXE A;  4JI5 I;  1E3H A;  4LF6 I;  2IOQ A;  4LFC I;  4IZK B;  4USM A;  4DR4 E;  1N33 I;  2R3V A;  1KTV A;  1RRE A;  4DUZ E;  4DXL A;  1OYP A;  1FWL A;  3T1H E;  4N3O A;  2GO3 A;  4IFD E;  4KHP E;  5JEA E;  4HY1 A;  1DAR A;  5JEA B;  4DR1 E;  4DV6 I;  1KKH A;  3K1J A;  4USK A;  2NPF A;  3T1Y I;  3CDJ A;  4X62 E;  3QT6 A;  5DRQ A;  4BA1 A;  4MU0 A;  4OKG A;  4K0K E;  1K47 A;  5K36 D;  1Y5Y A;  4J3D A;  1H74 A;  1R6L A;  3PRY A;  5K36 C;  3J81 C;  4PRX A;  4JI0 I;  3J7A G;  4IZJ B;  3GLL A;  4BA2 A;  4YY3 E;  1FJG E;  5EL9 A;  4B3M E;  4JYA E;  3H1C A;  2VQF I;  4JI8 I;  4DV0 E;  2HHH I;  4X66 I;  3PYG A;  3P76 A;  1KVK A;  1MU5 A;  2V8P A;  2X36 A;  5BR8 I;  2E5L E;  1HNX E;  4IZK A;  3GME A;  1YHC A;  4OX9 E;  4GKJ I;  4FN5 A;  4Z7C A;  4AM3 A;  1N33 E;  5FLX Q;  4DR6 E;  2HFS A;  4LF4 I;  2C39 B;  2O1W A;  3WU4 A;  5JEA A;  4FW7 A;  3M85 G;  1I94 I;  4DPT A;  4DV6 E;  3T1Y E;  1UDO A;  3L7Z B;  1B62 A;  4OO1 B;  2BV3 A;  3ZM7 A;  3KRN A;  4WUC A;  4IZJ A;  2DEI A;  4B3R E;  4X64 E;  3CWV A;  2Z5B B;  4DPU A;  4LF7 I;  2V34 A;  5L3J A;  4JI0 E;  2NN6 F;  1Z5A A;  4DUY I;  4DV5 E;  2IER A;  2HHH E;  2VF3 A;  4AIM A;  4FWG A;  1FI4 A;  2PO2 B;  4QNK A;  4GKJ E;  4DR3 I;  2ZIT A;  2IOP A;  5C0X E;  1IBM E;  2C39 A;  4RPF A;  4JI1 I;  2VQE I;  4DR2 I;  5C0X B;  4LF4 E;  3PS3 A;  2PNZ B;  4OO1 C;  1OYR A;  3L7Z A;  1I94 E;  1NZ0 A;  4IS9 A;  4OO1 A;  4GKK I;  3UHM A;  2PO1 B;  2VES A;  4LFB I;  1HNW E;  1N32 I;  2Z5B A;  4NXM I;  4ZVI A;  1RR9 A;  1UEK A;  2CG9 A;  4LF7 E;  4MYU A;  2CVE A;  1NHJ A;  2UU9 E;  2C38 B;  4DUY E;  4JI3 I;  4MU4 A;  2GQ0 A;  2GO4 A;  2UXB I;  3CDI A;  2PO2 A;  1XMO I;  5K36 E;  1BKN A;  3J7A M;  5C0X C;  5K36 B;  5LMN E;  4JI2 E;  2J65 A;  5C0X A;  1B63 A;  4DR3 E;  2J7K A;  4JI1 E;  2VQE E;  2CZ9 A;  4DR2 E;  1Z0B A;  4UTG A;  2PNZ A;  3ZZU A;  1UDN A;  2Q2E B;  3H4L A;  4DPY A;  4NBQ A;  3M7N G;  4DV7 I;  2HKE A;  1HNZ I;  4GKK E;  2PO1 A;  2HFU A;  1PVG A;  4DU8 A;  3PS1 A;  4LFA I;  2F4V I;  1MG7 A;  1Z0W A;  4JI6 E;  4LFB E;  1N32 E;  4NXM E;  3PS2 A;  4LOM A;  2C38 A;  3LNU A;  3M85 D;  5DRP A;  3GON A;  1N36 I;  4DPX A;  4QNJ A;  3DD6 A;  4JI3 E;  4DR7 I;  1D6T A;  1A6F A;  4LPF A;  5K36 A;  5IT9 C;  3QT5 A;  4HXZ A;  1S16 A;  4B3T I;  1Z0T A;  1Y4S A;  5FLX C;  5IT9 Q;  2NN6 D;  2WNR B;  4JI4 I;  2PO0 B;  4HAC B;  4LF9 E;  5IWA I;  4JI5 E;  1NHH A;  1USV A;  4LF6 E;  4LFC E;  1XHK A;  4DV7 E;  3GCM A;  4IFD F;  4URL A;  4LFA E;  4PRV A;  2F4V E;  1HR0 I;  3V2U C;  2UUC I;  4FW6 A;  4UT4 A;  4FW3 A;  2PNL A;  1Z5B A;  1P42 A;  4OO1 E;  1VI7 A;  2GS8 A;  5GME A;  2JE6 B;  4AID A;  2PNM A;  4GQU A;  1ZXM A;  1N0V C;  2Z5E A;  1N36 E;  4IFD D;  4DR7 E;  2HK3 A;  2O1V A;  1Y60 A;  2A2D A;  2UUA I;  2BA0 G;  1FNM A;  2CGE A;  2BA1 G;  2VQF E;  4JI8 E;  4XTJ A;  2WNR A;  2PO0 A;  4X66 E;  2F1D A;  3WU3 A;  4HAC A;  5A2Q C;  1ZM3 A;  1XNR I;  2WW4 A;  4JI4 E;  5BR8 E;  2JT2 A;  1QZR A;  4DV3 I;  3OTO I;  3B82 A;  3LPS A;  5A2Q Q;  2UUB I;  3B4T A;  2R42 A;  4DU7 A;  4FW5 A;  3WU6 A;  1ZM9 A;  1Z5C A;  2O1U A;  5JEA F; 
#chains in the Genus database with same CATH homology
 2A2C A;  4P52 A;  3K85 A;  1N0U A;  2DEJ A;  4JV5 I;  2UUA E;  4EMD A;  3Q6M A;  3ZKB A;  5FWK A;  3D4J A;  4DUZ I;  1ZXN A;  1Z0E A;  2O1T A;  3T1H I;  1XNR E;  3P06 A;  1EI1 A;  4DR1 I;  3OTO E;  1EA6 A;  1H72 C;  1Y4U A;  1J5E I;  2UUB E;  1S4E A;  3F0N A;  2V2V A;  3QT7 A;  1PKP A;  1Y6Z A;  4YY3 I;  3B8H A;  2BM1 A;  3QT8 A;  2ZBK B;  4DV0 I;  4DV4 I;  3K17 A;  3HUL A;  4JI7 I;  2Z5C B;  4NXN I;  1HNX I;  3J80 C;  3LTO A;  2UXB E;  1FWK A;  1MX0 A;  4DR6 I;  3J80 Q;  4KQV A;  1XMO E;  1Z0C A;  1KIJ A;  1PIE A;  1IBK I;  4LF8 I;  4DV2 I;  1J5E E;  5LMU I;  4YHH I;  2E1R A;  1USU A;  2X7I A;  4B3R I;  4X64 I;  2HKJ A;  3JAM C;  1ZM4 A;  1HNZ E;  4R1F A;  4P7A A;  4DV5 I;  2EFG A;  3ZZT A;  4DV1 I;  3JAM Q;  3J81 Q;  4DV4 E;  2Z5C A;  4JI7 E;  1Z0G A;  3PYD A;  4WUD A;  4NXN E;  2UXD I;  3Q6N A;  1IBM I;  1IBL I;  2LJP A;  4FWD A;  1FKA E;  4LF5 I;  1Z0V A;  4FWH A;  1N34 I;  4B3T E;  4DR5 I;  1IBK E;  4IZJ D;  4LF8 E;  4DV2 E;  4FW9 A;  5LMU E;  4YHH E;  2OI2 A;  1HNW I;  5IWA E;  3V5R A;  5LL6 R;  1HK7 A;  2AJ4 A;  2UU9 I;  1U2R A;  1OJ4 A;  2UXC I;  4PU9 A;  1HR0 E;  4DV1 E;  1H7S A;  4ED4 A;  4AQY I;  2UUC E;  4B3S I;  1H73 A;  5LMN I;  4JI2 I;  2UXD E;  1XMQ I;  3PYF A;  1XNQ I;  3Q1Q A;  2ZM6 I;  4X65 I;  5GMD A;  3ZKD A;  1IBL E;  3ZZ0 A;  4DR4 I;  4LF5 E;  4WUB A;  1N34 E;  4DR5 E;  4JG4 A;  4M1K A;  3M6A A;  2XEX A;  4KHP I;  4JI6 I;  2V2Z A;  1ZM2 A;  4DV3 E;  3WU5 A;  4X62 I;  3PYE A;  4HYM A;  1VIS A;  1ELO A;  4K0K I;  4Z7Y A;  1Z59 A;  1NHI A;  1H7U A;  2UXC E;  3HJC A;  4I3H A;  4AQY E;  2V2Q A;  1FJG I;  4B3M I;  4JYA I;  4B3S E;  2HK2 A;  1WUU A;  1XMQ E;  4JV5 E;  4MYT A;  1XNQ E;  2BM0 A;  2E5L I;  4OX9 I;  2ZM6 E;  4X65 E;  4DPW A;  3B78 A;  4LF9 I;  4JI5 I;  4LF6 I;  2IOQ A;  4LFC I;  4IZK B;  4USM A;  4DR4 E;  1N33 I;  2R3V A;  1KTV A;  1RRE A;  4DUZ E;  4DXL A;  1FWL A;  3T1H E;  4N3O A;  4KHP E;  4HY1 A;  1DAR A;  4DR1 E;  4DV6 I;  1KKH A;  3K1J A;  4USK A;  2NPF A;  3T1Y I;  4X62 E;  3QT6 A;  4K0K E;  1K47 A;  1H74 A;  3PRY A;  3J81 C;  4PRX A;  4JI0 I;  3J7A G;  4IZJ B;  4YY3 E;  1FJG E;  4B3M E;  4JYA E;  2VQF I;  4JI8 I;  4DV0 E;  2HHH I;  4X66 I;  3PYG A;  1KVK A;  1MU5 A;  2V8P A;  2X36 A;  5BR8 I;  2E5L E;  1HNX E;  4IZK A;  4OX9 E;  4GKJ I;  4FN5 A;  4Z7C A;  1N33 E;  5FLX Q;  4DR6 E;  2HFS A;  4LF4 I;  2O1W A;  3WU4 A;  1I94 I;  4DPT A;  4DV6 E;  3T1Y E;  1B62 A;  2BV3 A;  3ZM7 A;  4WUC A;  4IZJ A;  2DEI A;  4B3R E;  4X64 E;  3CWV A;  2Z5B B;  4DPU A;  4LF7 I;  2V34 A;  5L3J A;  4JI0 E;  1Z5A A;  4DUY I;  4DV5 E;  2HHH E;  2VF3 A;  4FWG A;  1FI4 A;  4GKJ E;  4DR3 I;  2ZIT A;  2IOP A;  1IBM E;  4RPF A;  4JI1 I;  2VQE I;  4DR2 I;  4LF4 E;  1I94 E;  1NZ0 A;  4GKK I;  4LFB I;  1HNW E;  1N32 I;  2Z5B A;  4NXM I;  4ZVI A;  1RR9 A;  1UEK A;  2CG9 A;  4LF7 E;  4MYU A;  2UU9 E;  1NHJ A;  4DUY E;  4JI3 I;  2GQ0 A;  2UXB I;  1XMO I;  1BKN A;  3J7A M;  5LMN E;  4JI2 E;  1B63 A;  4DR3 E;  2J7K A;  4JI1 E;  2VQE E;  2CZ9 A;  4DR2 E;  1Z0B A;  4UTG A;  3ZZU A;  2Q2E B;  3H4L A;  4DPY A;  4DV7 I;  2HKE A;  1HNZ I;  4GKK E;  2HFU A;  1PVG A;  4DU8 A;  4LFA I;  2F4V I;  1MG7 A;  1Z0W A;  4JI6 E;  4LFB E;  1N32 E;  4NXM E;  3LNU A;  3GON A;  1N36 I;  4DPX A;  4JI3 E;  4DR7 I;  1D6T A;  1A6F A;  5IT9 C;  3QT5 A;  4HXZ A;  1S16 A;  4B3T I;  1Z0T A;  1Y4S A;  5FLX C;  5IT9 Q;  4JI4 I;  4HAC B;  4LF9 E;  5IWA I;  4JI5 E;  1NHH A;  1USV A;  4LF6 E;  4LFC E;  1XHK A;  4DV7 E;  4URL A;  4LFA E;  4PRV A;  2F4V E;  1HR0 I;  3V2U C;  2UUC I;  4UT4 A;  2PNL A;  1Z5B A;  2GS8 A;  5GME A;  2PNM A;  1ZXM A;  1N0V C;  2Z5E A;  1N36 E;  4DR7 E;  2HK3 A;  2O1V A;  2A2D A;  2UUA I;  1FNM A;  2CGE A;  2VQF E;  4JI8 E;  4XTJ A;  4X66 E;  3WU3 A;  5A2Q C;  4HAC A;  1ZM3 A;  1XNR I;  2WW4 A;  4JI4 E;  5BR8 E;  1QZR A;  4DV3 I;  3OTO I;  3B82 A;  3LPS A;  5A2Q Q;  2UUB I;  2R42 A;  4DU7 A;  3WU6 A;  1ZM9 A;  1Z5C A;  2O1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...