2E5LI

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2e5lI00
2HK3A 4JI0E 2XEXA 1XHKA 1Z0TA 5LMNI 4HYMA 4LF9E 4XTJA 4LF5E 4DR1E 1Z5BA 3Q1QA 4JI8E 4DV6E 1FWLA 3B78A 2UUAI 2UUCE 4AQYE 2Q2EB 3V5RA 1QZRA 2ZITA 4I3HA 4X65E 4DU7A 1FNMA 1MX0A 2V8PA 1HR0I 3F0NA 4JI3I 1IBLE 1NZ0A 3H4LA 4USMA 4X62I 1N33I 2VQFE 3T1YE 4B3MI 1KKHA 4JV5I 1WUUA 4JI4I 2UXBI 1H72C 1HNXI 4JYAI 5GMDA 2DEJA 4DR7E 1XMOI 4HY1A 4B3TI 4X64E 4FWDA 1HNZE 4DR2I 3PYFA 1PVGA 3GONA 1Z0GA 4Z7YA 5FLXC 1IBME 1Z0CA 4JI5E 4DUZI 1N32I 2UXDE 1FJGI 4LF4E 2BM0A 3J80C 4B3SE 2HKEA 4DV1E 4PU9A 3ZZUA 3LTOA 2A2DA 4DXLA 5LL6R 1N34I 4DV7E 4WUBA 2UU9E 1DARA 4JI6E 1B62A 4K0KE 1Z0BA 4DV4I 4FWGA 4WUCA 4DU8A 1IBKE 1ZXNA 3PYDA 4DUYE 3QT5A 1VISA 1S4EA 1Z0VA 2HHHI 5IT9C 1IBLI 1UEKA 2DEIA 4URLA 3T1YI 4LFAE 1RREA 4NXNE 1N36I 1B63A 1J5EI 2E5LI 1PKPA 4GKKE 4DV2I 2E1RA 4JI1E 1EA6A 2UUBI 4DR5E 4YHHE 4DR7I 1EI1A 1N0VC 2EFGA 4JI2I 3J7AG 4GKJE 4WUDA 4MYTA 3JAMQ 4JI5I 2UXDI 5BR8E 4B3SI 4LF7I 4DV3I 4DR3I 2WW4A 2OI2A 4DPUA 4PRXA 3WU4A 1XMQI 4DR4E 2HFSA 4DV7I 5GMEA 3B8HA 5IT9Q 4NXME 3J7AM 2ZBKB 4R1FA 4LFCE 3WU5A 2V2QA 5A2QC 3OTOI 1KVKA 5LMUI 3J81C 4LF6E 3HULA 2UXCI 4YY3I 2HK2A 3T1HI 4LFBE 4DR6E 4X66E 1XNRE 1I94E 2R42A 1ELOA 1H7UA 3WU3A 2VQEE 4DPWA 1XNQE 2F4VE 4EMDA 1HNWE 4FWHA 5LMNE 1MG7A 1U2RA 2LJPA 1FKAE 4KHPE 2UUAE 4JI0I 4UT4A 1D6TA 4GKJI 4LF9I 1Z5CA 4LF5I 1FI4A 4DR1I 4RPFA 1HR0E 4JI7E 4JI8I 4DV6I 1KIJA 2UUCI 1NHIA 2J7KA 3J81Q 4AQYI 4USKA 5BR8I 4X65I 4X62E 1N33E 2ZM6E 4B3ME 4DPTA 4JV5E 5FLXQ 2V34A 1HNXE 4JYAE 4FN5A 2VQFI 1XMOE 1ZM3A 3J80Q 4DR2E 4KQVA 4P52A 1MU5A 4LF6I 1N0UA 2X7IA 4ED4A 1H7SA 1N32E 4X64I 1HNZI 4DV5E 2BV3A 4LFBI 1IBMI 3WU6A 1I94I 2VQEI 4JG4A 5IWAE 4LF8E 4DV0E 4LF4I 3PYGA 4DV1I 1K47A 1FWKA 4OX9E 3D4JA 4HACB 4MYUA 4UTGA 2HFUA 2UU9I 4KHPI 2R3VA 4DV4E 4JI6I 4ZVIA 4K0KI 4JI7I 3ZZ0A 1NHHA 3V2UC 2A2CA 1H74A 1ZM9A 4M1KA 2HHHE 4DPXA 1IBKI 4Z7CA 4DUYI 1H73A 1ZXMA 1Z59A 2HKJA 2VF3A 2ZM6I 1N36E 1J5EE 4B3RE 2E5LE 4DV2E 1RR9A 1ZM2A 2UUBE 1Z5AA 4LFAI 4NXNI 4JI2E 3K17A 4FW9A 4GKKI 1OJ4A 4JI1I 1S16A 4DR5I 4YHHI 3QT7A 3ZM7A 4DV5I 3PYEA 3QT6A 3CWVA 2GS8A 4PRVA 1A6FA 4P7AA 4LF7E 4DV3E 4DR3E 5A2QQ 1Z0EA 2AJ4A 1XMQE 5IWAI 1ZM4A 3ZKBA 4JI3E 2NPFA 4LF8I 4DV0I 4HXZA 2V2VA 3JAMC 4OX9I 4DR4I 4JI4E 3OTOE 2UXBE 5LMUE 2BM1A 5L3JA 4NXMI 4LFCI 4B3TE 2UXCE 4YY3E 3K1JA 3T1HE 2X36A 4DUZE 3ZKDA 3LPSA 2CZ9A 1KTVA 2V2ZA 1Z0WA 1FJGE 4DR6I 4HACA 4X66I 1XNRI 3LNUA 1NHJA 1PIEA 4B3RI 3B82A 4DPYA 3ZZTA 1N34E 1BKNA 1XNQI 2F4VI 3M6AA 1HNWI 3QT8A
chains in the Genus database with same CATH superfamily
2HK3A 4FW3A 2XEXA 4FW4A 4JI0E 1XHKA 1Z0TA 5LMNI 2O1TA 4HYMA 4LF9E 4XTJA 1OYPA 4LF5E 4DR1E 1Z5BA 3Q1QA 4MDTA 4JI8E 4DV6E 1FWLA 3Q6MA 2WNRA 3B78A 2UUAI 2UUCE 4AQYE 2Q2EB 3V5RA 1QZRA 5EKWA 2ZITA 4I3HA 4X65E 4DU7A 4IZJB 1FNMA 1MX0A 2V8PA 1HR0I 3F0NA 2C38A 4JI3I 1IBLE 1NZ0A 2WNRB 3H4LA 4USMA 4X62I 2IOQA 1N33I 2O1VA 2VQFE 3T1YE 4B3MI 1KKHA 4OO1E 4JV5I 1WUUA 3GCMA 4JI4I 1OYRA 2UXBI 1H72C 2C38B 1HNXI 4JYAI 5GMDA 2DEJA 4DR7E 1XMOI 4HY1A 2JT2A 1HK7A 4X64E 4FWDA 4IZKA 1HNZE 4B3TI 4DR2I 3PYFA 1PVGA 4LPFA 3GONA 1Z0GA 4Z7YA 5FLXC 1IBME 1Z0CA 4JI5E 2VESA 4DUZI 1N32I 2JEBA 3QT8A 2UXDE 1R6LA 1FJGI 4LF4E 2BM0A 1UDNA 3J80C 4B3SE 2HKEA 4IZKB 4DV1E 4MQYA 4QNKA 4PU9A 3ZZUA 3LTOA 2GQ0A 2A2DA 3H1CA 4DXLA 5LL6R 1N34I 4DV7E 4WUBA 2JEBB 2UU9E 2O1UA 1USUA 2GO3A 1DARA 4JI6E 1B62A 4K0KE 1Z0BA 4DV4I 4WUCA 4FWGA 2CVEA 1Y5YA 1ZXNA 4DU8A 1IBKE 4OO1D 3PYDA 2BR2A 4DUYE 3QT5A 1VISA 3UHMA 1S4EA 1Z0VA 3M7NG 2HHHI 5IT9C 1IBLI 1UEKA 2DEIA 3CDIA 5EL9A 4URLA 3T1YI 4LFAE 4BA2A 1RREA 3M7ND 4NXNE 1N36I 1B63A 3P76A 1J5EI 2E5LI 2BR2B 4OKGA 1PKPA 4GKKE 4DV2I 2E1RA 4JI1E 1EA6A 2UUBI 4DR5E 4YHHE 4DR7I 1EI1A 1N0VC 4AIDA 4IZJD 4LCHA 2EFGA 4JI2I 3J7AG 4GKJE 4WUDA 4MYTA 2WP8A 3JAMQ 4JI5I 4BA2B 2UXDI 4IFDF 2PNLA 5DNXA 5BR8E 4B3SI 4LF7I 4DV3I 4DR3I 5JEAF 2WW4A 2OI2A 4DPUA 4PRXA 3WU4A 1XMQI 4LCFA 4DR4E 3L7ZA 5FWKA 2HFSA 3B4TA 2WP8B 4DV7I 5GMEA 3B8HA 5IT9Q 1P42A 4NXME 4LCGA 3J7AM 2ZBKB 4R1FA 3PS3A 4LFCE 3WU5A 2BA0G 4NBQA 2O3ZA 2V2QA 5A2QC 3OTOI 1KVKA 5LMUI 3J81C 5DRQA 3PS1A 4LF6E 3L7ZB 3HULA 2UXCI 2BA0D 4YY3I 2NN6F 2HK2A 5K36F 3T1HI 4LFBE 4DR6E 4X66E 5C0XF 1XNRE 1I94E 2R42A 1ELOA 1H7UA 3PS2A 3WU3A 2VQEE 4MU4A 4DPWA 1XNQE 2F4VE 4EMDA 1HNWE 1OYSA 4IS9A 4FWHA 5LMNE 1MG7A 1UDOA 5ELWA 5DRPA 1U2RA 2PO1A 2LJPA 1FKAE 1E3HA 3U1YA 4KHPE 2UUAE 4JI0I 4UT4A 1D6TA 2BA1G 4GKJI 2NN6C 4LF9I 1Z5CA 2JE6A 5K36C 4ISAA 4LF5I 1FI4A 4DR1I 4RPFA 1HR0E 4JI7E 4JI8I 5C0XC 4DV6I 1KIJA 2UUCI 1NHIA 2J7KA 2O1WA 3J81Q 4AQYI 2BA1D 4USKA 5BR8I 3M85D 2JEAA 2PO1B 4X65I 2PNZA 2NN6A 4X62E 1N33E 5K36A 1Y60A 2ZM6E 4B3ME 4DPTA 4JV5E 5FLXQ 2JE6B 3HJCA 5C0XA 4OZEA 2V34A 3KRNA 1HNXE 4JYAE 4FN5A 4BA1A 2VQFI 1XMOE 2JEAB 1ZM3A 4MU1A 2IOPA 3J80Q 4DR2E 2GO4A 4KQVA 4P52A 2PNZB 2NN6B 1YH8A 1MU5A 5K36B 4LF6I 1N0UA 2X7IA 4ED4A 1H7SA 1N32E 5C0XB 4X64I 2IERA 1HNZI 4DV5E 2BV3A 1Y4SA 4LFBI 2PO2A 4IFDE 4J3DA 1IBMI 4BA1B 3WU6A 1I94I 2CG9A 1VI7A 3PRYA 5JEAE 2VQEI 4JG4A 5IWAE 3P3EA 2IESA 4LF8E 4DV0E 4LF4I 3PYGA 4DV1I 1K47A 2PO2B 1FWKA 2Z5BA 4OX9E 3D4JA 4HACB 4MYUA 4UTGA 2F1DA 2HFUA 2UU9I 4KHPI 2R3VA 4DV4E 4JI6I 4ZVIA 2NN6E 4K0KI 3GMEA 2PNMA 4JI7I 5K36E 4FW6A 3U1KA 1NHHA 3ZZ0A 3P3CA 4MU3A 3V2UC 2A2CA 1H74A 1ZM9A 2Z5BB 5C0XE 4GQUA 4M1KA 2HHHE 4DPXA 1IBKI 4IFDC 4Z7CA 4DUYI 1H73A 1ZXMA 1Z59A 3GLLA 4FW5A 2HKJA 2VF3A 2ZM6I 5JEAC 1N36E 1J5EE 4B3RE 2E5LE 4DV2E 1RR9A 1ZM2A 2UUBE 4IFDA 4OO1F 1Z5AA 4LFAI 1RHYA 4IFDD 4MU0A 4NXNI 3CDJA 4JI2E 3K17A 4FW9A 4GKKI 5JEAA 1R6MA 1OJ4A 2C39A 4JI1I 5JEAD 3P3GA 1S16A 4DR5I 4YHHI 3NZKA 3QT7A 3ZM7A 4DV5I 3PYEA 1E3PA 4AM3A 3QT6A 3CWVA 2GS8A 4PRVA 1A6FA 1XXEA 1UDSA 4IFDB 4P7AA 4LF7E 4DV3E 4DR3E 3P06A 5A2QQ 1Z0EA 2AJ4A 1XMQE 5JEAB 5IWAI 1ZM4A 2C39B 2AE8A 5DROA 3ZKBA 4JI3E 2NPFA 4LF8I 4DV0I 1USVA 2Z5CA 4HXZA 4OO1C 1YHCA 2NN6D 2V2VA 4U3DA 3JAMC 5K36D 3HKMA 4U3BA 4OX9I 4DR4I 4JI4E 3OTOE 2UXBE 5C0XD 4AIMA 2CGEA 2BM1A 5LMUE 3Q6NA 5L3JA 4NXMI 4LFCI 5DRRA 2PO0A 3DD6A 4B3TE 2UXCE 4YY3E 3K1JA 4OO1A 2Z5CB 3T1HE 2X36A 4LOMA 4DUZE 3ZKDA 3LPSA 2CZ9A 2C37A 1KTVA 2V2ZA 4FW7A 1Z0WA 1FJGE 4DR6I 4HACA 4X66I 1XNRI 1UDQA 4QNJA 2PO0B 3LNUA 1NHJA 3M85G 1PIEA 4N3OA 3K85A 4OO1B 4B3RI 1Y6ZA 3B82A 4DPYA 3ZZTA 2J65A 1N34E 2Z5EA 1BKNA 1XNQI 2F4VI 3M6AA 1HNWI 4IZJA 1Y4UA 5DNLA 2C37B
chains in the Genus database with same CATH topology
2HK3A 4JI0E 2XEXA 1XHKA 1Z0TA 5LMNI 2O1TA 4HYMA 4LF9E 4XTJA 4LF5E 4DR1E 1Z5BA 3Q1QA 4JI8E 4DV6E 1FWLA 3Q6MA 3B78A 2UUAI 2UUCE 4AQYE 2Q2EB 3V5RA 1QZRA 2ZITA 4I3HA 4X65E 4DU7A 4IZJB 1FNMA 1MX0A 2V8PA 1HR0I 3F0NA 4JI3I 1IBLE 1NZ0A 3H4LA 4USMA 4X62I 2IOQA 1N33I 2O1VA 2VQFE 3T1YE 4B3MI 1KKHA 4JV5I 1WUUA 4JI4I 2UXBI 1H72C 1HNXI 4JYAI 5GMDA 2DEJA 4DR7E 1XMOI 4HY1A 1HK7A 4X64E 4FWDA 4IZKA 1HNZE 4B3TI 4DR2I 3PYFA 1PVGA 3GONA 1Z0GA 4Z7YA 5FLXC 1IBME 1Z0CA 4JI5E 4DUZI 1N32I 2UXDE 1FJGI 4LF4E 2BM0A 3J80C 4B3SE 2HKEA 4IZKB 4DV1E 4PU9A 3ZZUA 3LTOA 2GQ0A 2A2DA 4DXLA 5LL6R 1N34I 4DV7E 4WUBA 2UU9E 2O1UA 1USUA 1DARA 4JI6E 1B62A 4K0KE 1Z0BA 4DV4I 4FWGA 4WUCA 4DU8A 1IBKE 1ZXNA 3PYDA 4DUYE 3QT5A 1VISA 1S4EA 1Z0VA 2HHHI 5IT9C 1IBLI 1UEKA 2DEIA 4URLA 3T1YI 4LFAE 1RREA 4NXNE 1N36I 1B63A 1J5EI 2E5LI 1PKPA 4GKKE 4DV2I 2E1RA 4JI1E 1EA6A 2UUBI 4DR5E 4YHHE 4DR7I 1EI1A 1N0VC 4IZJD 2EFGA 4JI2I 3J7AG 4GKJE 4WUDA 4MYTA 3JAMQ 4JI5I 2UXDI 2PNLA 5BR8E 4B3SI 4LF7I 4DV3I 4DR3I 2WW4A 2OI2A 4DPUA 4PRXA 3WU4A 1XMQI 4DR4E 5FWKA 2HFSA 4DV7I 5GMEA 3B8HA 5IT9Q 4NXME 3J7AM 2ZBKB 4R1FA 4LFCE 3WU5A 2V2QA 5A2QC 3OTOI 1KVKA 5LMUI 3J81C 4LF6E 3HULA 2UXCI 4YY3I 2HK2A 3T1HI 4LFBE 4DR6E 4X66E 1XNRE 1I94E 2R42A 1ELOA 1H7UA 3WU3A 2VQEE 4DPWA 1XNQE 2F4VE 4EMDA 1HNWE 4FWHA 5LMNE 1MG7A 1U2RA 2LJPA 1FKAE 4KHPE 2UUAE 4JI0I 4UT4A 1D6TA 4GKJI 4LF9I 1Z5CA 4LF5I 1FI4A 4DR1I 4RPFA 1HR0E 4JI7E 4JI8I 4DV6I 1KIJA 2UUCI 1NHIA 3J81Q 2J7KA 2O1WA 4AQYI 4USKA 5BR8I 4X65I 4X62E 1N33E 2ZM6E 4B3ME 4DPTA 4JV5E 5FLXQ 3HJCA 2V34A 1HNXE 4JYAE 4FN5A 2VQFI 1XMOE 1ZM3A 2IOPA 3J80Q 4DR2E 4KQVA 4P52A 1MU5A 4LF6I 1N0UA 2X7IA 4ED4A 1H7SA 1N32E 4X64I 1HNZI 4DV5E 2BV3A 1Y4SA 4LFBI 1IBMI 3WU6A 1I94I 2CG9A 3PRYA 2VQEI 4JG4A 5IWAE 4LF8E 4DV0E 4LF4I 3PYGA 4DV1I 1K47A 1FWKA 2Z5BA 4OX9E 3D4JA 4HACB 4MYUA 4UTGA 2HFUA 2UU9I 4KHPI 2R3VA 4DV4E 4JI6I 4ZVIA 4K0KI 2PNMA 4JI7I 3ZZ0A 1NHHA 3V2UC 2A2CA 1H74A 1ZM9A 2Z5BB 4M1KA 2HHHE 4DPXA 1IBKI 4Z7CA 4DUYI 1H73A 1ZXMA 1Z59A 2HKJA 2VF3A 2ZM6I 1N36E 1J5EE 4B3RE 2E5LE 4DV2E 1RR9A 1ZM2A 2UUBE 1Z5AA 4LFAI 4NXNI 4JI2E 3K17A 4FW9A 4GKKI 1OJ4A 4JI1I 1S16A 4DR5I 4YHHI 3QT7A 3ZM7A 4DV5I 3PYEA 3QT6A 3CWVA 2GS8A 4PRVA 1A6FA 4P7AA 4LF7E 4DV3E 4DR3E 3P06A 5A2QQ 1Z0EA 2AJ4A 1XMQE 5IWAI 1ZM4A 3ZKBA 4JI3E 2NPFA 4LF8I 4DV0I 1USVA 2Z5CA 4HXZA 2V2VA 3JAMC 4OX9I 4DR4I 4JI4E 3OTOE 2UXBE 2CGEA 2BM1A 5LMUE 3Q6NA 5L3JA 4NXMI 4LFCI 4B3TE 2UXCE 4YY3E 3K1JA 2Z5CB 3T1HE 2X36A 4DUZE 3ZKDA 3LPSA 2CZ9A 1KTVA 2V2ZA 1Z0WA 1FJGE 4DR6I 4HACA 4X66I 1XNRI 3LNUA 1NHJA 1PIEA 4N3OA 3K85A 4B3RI 1Y6ZA 3B82A 4DPYA 3ZZTA 1N34E 2Z5EA 1BKNA 1XNQI 2F4VI 3M6AA 1HNWI 4IZJA 1Y4UA 3QT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  4JI0 E;  2XEX A;  1XHK A;  1Z0T A;  5LMN I;  4HYM A;  4LF9 E;  4XTJ A;  4LF5 E;  4DR1 E;  1Z5B A;  3Q1Q A;  4JI8 E;  4DV6 E;  1FWL A;  3B78 A;  2UUA I;  2UUC E;  4AQY E;  2Q2E B;  3V5R A;  1QZR A;  2ZIT A;  4I3H A;  4X65 E;  4DU7 A;  1FNM A;  1MX0 A;  2V8P A;  1HR0 I;  3F0N A;  4JI3 I;  1IBL E;  1NZ0 A;  3H4L A;  4USM A;  4X62 I;  1N33 I;  2VQF E;  3T1Y E;  4B3M I;  1KKH A;  4JV5 I;  1WUU A;  4JI4 I;  2UXB I;  1H72 C;  1HNX I;  4JYA I;  5GMD A;  2DEJ A;  4DR7 E;  1XMO I;  4HY1 A;  4B3T I;  4X64 E;  4FWD A;  1HNZ E;  4DR2 I;  3PYF A;  1PVG A;  3GON A;  1Z0G A;  4Z7Y A;  5FLX C;  1IBM E;  1Z0C A;  4JI5 E;  4DUZ I;  1N32 I;  2UXD E;  1FJG I;  4LF4 E;  2BM0 A;  3J80 C;  4B3S E;  2HKE A;  4DV1 E;  4PU9 A;  3ZZU A;  3LTO A;  2A2D A;  4DXL A;  5LL6 R;  1N34 I;  4DV7 E;  4WUB A;  2UU9 E;  1DAR A;  4JI6 E;  1B62 A;  4K0K E;  1Z0B A;  4DV4 I;  4FWG A;  4WUC A;  4DU8 A;  1IBK E;  1ZXN A;  3PYD A;  4DUY E;  3QT5 A;  1VIS A;  1S4E A;  1Z0V A;  2HHH I;  5IT9 C;  1IBL I;  1UEK A;  2DEI A;  4URL A;  3T1Y I;  4LFA E;  1RRE A;  4NXN E;  1N36 I;  1B63 A;  1J5E I;  2E5L I;  1PKP A;  4GKK E;  4DV2 I;  2E1R A;  4JI1 E;  1EA6 A;  2UUB I;  4DR5 E;  4YHH E;  4DR7 I;  1EI1 A;  1N0V C;  2EFG A;  4JI2 I;  3J7A G;  4GKJ E;  4WUD A;  4MYT A;  3JAM Q;  4JI5 I;  2UXD I;  5BR8 E;  4B3S I;  4LF7 I;  4DV3 I;  4DR3 I;  2WW4 A;  2OI2 A;  4DPU A;  4PRX A;  3WU4 A;  1XMQ I;  4DR4 E;  2HFS A;  4DV7 I;  5GME A;  3B8H A;  5IT9 Q;  4NXM E;  3J7A M;  2ZBK B;  4R1F A;  4LFC E;  3WU5 A;  2V2Q A;  5A2Q C;  3OTO I;  1KVK A;  5LMU I;  3J81 C;  4LF6 E;  3HUL A;  2UXC I;  4YY3 I;  2HK2 A;  3T1H I;  4LFB E;  4DR6 E;  4X66 E;  1XNR E;  1I94 E;  2R42 A;  1ELO A;  1H7U A;  3WU3 A;  2VQE E;  4DPW A;  1XNQ E;  2F4V E;  4EMD A;  1HNW E;  4FWH A;  5LMN E;  1MG7 A;  1U2R A;  2LJP A;  1FKA E;  4KHP E;  2UUA E;  4JI0 I;  4UT4 A;  1D6T A;  4GKJ I;  4LF9 I;  1Z5C A;  4LF5 I;  1FI4 A;  4DR1 I;  4RPF A;  1HR0 E;  4JI7 E;  4JI8 I;  4DV6 I;  1KIJ A;  2UUC I;  1NHI A;  2J7K A;  3J81 Q;  4AQY I;  4USK A;  5BR8 I;  4X65 I;  4X62 E;  1N33 E;  2ZM6 E;  4B3M E;  4DPT A;  4JV5 E;  5FLX Q;  2V34 A;  1HNX E;  4JYA E;  4FN5 A;  2VQF I;  1XMO E;  1ZM3 A;  3J80 Q;  4DR2 E;  4KQV A;  4P52 A;  1MU5 A;  4LF6 I;  1N0U A;  2X7I A;  4ED4 A;  1H7S A;  1N32 E;  4X64 I;  1HNZ I;  4DV5 E;  2BV3 A;  4LFB I;  1IBM I;  3WU6 A;  1I94 I;  2VQE I;  4JG4 A;  5IWA E;  4LF8 E;  4DV0 E;  4LF4 I;  3PYG A;  4DV1 I;  1K47 A;  1FWK A;  4OX9 E;  3D4J A;  4HAC B;  4MYU A;  4UTG A;  2HFU A;  2UU9 I;  4KHP I;  2R3V A;  4DV4 E;  4JI6 I;  4ZVI A;  4K0K I;  4JI7 I;  3ZZ0 A;  1NHH A;  3V2U C;  2A2C A;  1H74 A;  1ZM9 A;  4M1K A;  2HHH E;  4DPX A;  1IBK I;  4Z7C A;  4DUY I;  1H73 A;  1ZXM A;  1Z59 A;  2HKJ A;  2VF3 A;  2ZM6 I;  1N36 E;  1J5E E;  4B3R E;  2E5L E;  4DV2 E;  1RR9 A;  1ZM2 A;  2UUB E;  1Z5A A;  4LFA I;  4NXN I;  4JI2 E;  3K17 A;  4FW9 A;  4GKK I;  1OJ4 A;  4JI1 I;  1S16 A;  4DR5 I;  4YHH I;  3QT7 A;  3ZM7 A;  4DV5 I;  3PYE A;  3QT6 A;  3CWV A;  2GS8 A;  4PRV A;  1A6F A;  4P7A A;  4LF7 E;  4DV3 E;  4DR3 E;  5A2Q Q;  1Z0E A;  2AJ4 A;  1XMQ E;  5IWA I;  1ZM4 A;  3ZKB A;  4JI3 E;  2NPF A;  4LF8 I;  4DV0 I;  4HXZ A;  2V2V A;  3JAM C;  4OX9 I;  4DR4 I;  4JI4 E;  3OTO E;  2UXB E;  5LMU E;  2BM1 A;  5L3J A;  4NXM I;  4LFC I;  4B3T E;  2UXC E;  4YY3 E;  3K1J A;  3T1H E;  2X36 A;  4DUZ E;  3ZKD A;  3LPS A;  2CZ9 A;  1KTV A;  2V2Z A;  1Z0W A;  1FJG E;  4DR6 I;  4HAC A;  4X66 I;  1XNR I;  3LNU A;  1NHJ A;  1PIE A;  4B3R I;  3B82 A;  4DPY A;  3ZZT A;  1N34 E;  1BKN A;  1XNQ I;  2F4V I;  3M6A A;  1HNW I;  3QT8 A; 
#chains in the Genus database with same CATH topology
 2HK3 A;  4FW3 A;  2XEX A;  4FW4 A;  4JI0 E;  1XHK A;  1Z0T A;  5LMN I;  2O1T A;  4HYM A;  4LF9 E;  4XTJ A;  1OYP A;  4LF5 E;  4DR1 E;  1Z5B A;  3Q1Q A;  4MDT A;  4JI8 E;  4DV6 E;  1FWL A;  3Q6M A;  2WNR A;  3B78 A;  2UUA I;  2UUC E;  4AQY E;  2Q2E B;  3V5R A;  1QZR A;  5EKW A;  2ZIT A;  4I3H A;  4X65 E;  4DU7 A;  4IZJ B;  1FNM A;  1MX0 A;  2V8P A;  1HR0 I;  3F0N A;  2C38 A;  4JI3 I;  1IBL E;  1NZ0 A;  2WNR B;  3H4L A;  4USM A;  4X62 I;  2IOQ A;  1N33 I;  2O1V A;  2VQF E;  3T1Y E;  4B3M I;  1KKH A;  4OO1 E;  4JV5 I;  1WUU A;  3GCM A;  4JI4 I;  1OYR A;  2UXB I;  1H72 C;  2C38 B;  1HNX I;  4JYA I;  5GMD A;  2DEJ A;  4DR7 E;  1XMO I;  4HY1 A;  2JT2 A;  1HK7 A;  4X64 E;  4FWD A;  4IZK A;  1HNZ E;  4B3T I;  4DR2 I;  3PYF A;  1PVG A;  4LPF A;  3GON A;  1Z0G A;  4Z7Y A;  5FLX C;  1IBM E;  1Z0C A;  4JI5 E;  2VES A;  4DUZ I;  1N32 I;  2JEB A;  3QT8 A;  2UXD E;  1R6L A;  1FJG I;  4LF4 E;  2BM0 A;  1UDN A;  3J80 C;  4B3S E;  2HKE A;  4IZK B;  4DV1 E;  4MQY A;  4QNK A;  4PU9 A;  3ZZU A;  3LTO A;  2GQ0 A;  2A2D A;  3H1C A;  4DXL A;  5LL6 R;  1N34 I;  4DV7 E;  4WUB A;  2JEB B;  2UU9 E;  2O1U A;  1USU A;  2GO3 A;  1DAR A;  4JI6 E;  1B62 A;  4K0K E;  1Z0B A;  4DV4 I;  4WUC A;  4FWG A;  2CVE A;  1Y5Y A;  1ZXN A;  4DU8 A;  1IBK E;  4OO1 D;  3PYD A;  2BR2 A;  4DUY E;  3QT5 A;  1VIS A;  3UHM A;  1S4E A;  1Z0V A;  3M7N G;  2HHH I;  5IT9 C;  1IBL I;  1UEK A;  2DEI A;  3CDI A;  5EL9 A;  4URL A;  3T1Y I;  4LFA E;  4BA2 A;  1RRE A;  3M7N D;  4NXN E;  1N36 I;  1B63 A;  3P76 A;  1J5E I;  2E5L I;  2BR2 B;  4OKG A;  1PKP A;  4GKK E;  4DV2 I;  2E1R A;  4JI1 E;  1EA6 A;  2UUB I;  4DR5 E;  4YHH E;  4DR7 I;  1EI1 A;  1N0V C;  4AID A;  4IZJ D;  4LCH A;  2EFG A;  4JI2 I;  3J7A G;  4GKJ E;  4WUD A;  4MYT A;  2WP8 A;  3JAM Q;  4JI5 I;  4BA2 B;  2UXD I;  4IFD F;  2PNL A;  5DNX A;  5BR8 E;  4B3S I;  4LF7 I;  4DV3 I;  4DR3 I;  5JEA F;  2WW4 A;  2OI2 A;  4DPU A;  4PRX A;  3WU4 A;  1XMQ I;  4LCF A;  4DR4 E;  3L7Z A;  5FWK A;  2HFS A;  3B4T A;  2WP8 B;  4DV7 I;  5GME A;  3B8H A;  5IT9 Q;  1P42 A;  4NXM E;  4LCG A;  3J7A M;  2ZBK B;  4R1F A;  3PS3 A;  4LFC E;  3WU5 A;  2BA0 G;  4NBQ A;  2O3Z A;  2V2Q A;  5A2Q C;  3OTO I;  1KVK A;  5LMU I;  3J81 C;  5DRQ A;  3PS1 A;  4LF6 E;  3L7Z B;  3HUL A;  2UXC I;  2BA0 D;  4YY3 I;  2NN6 F;  2HK2 A;  5K36 F;  3T1H I;  4LFB E;  4DR6 E;  4X66 E;  5C0X F;  1XNR E;  1I94 E;  2R42 A;  1ELO A;  1H7U A;  3PS2 A;  3WU3 A;  2VQE E;  4MU4 A;  4DPW A;  1XNQ E;  2F4V E;  4EMD A;  1HNW E;  1OYS A;  4IS9 A;  4FWH A;  5LMN E;  1MG7 A;  1UDO A;  5ELW A;  5DRP A;  1U2R A;  2PO1 A;  2LJP A;  1FKA E;  1E3H A;  3U1Y A;  4KHP E;  2UUA E;  4JI0 I;  4UT4 A;  1D6T A;  2BA1 G;  4GKJ I;  2NN6 C;  4LF9 I;  1Z5C A;  2JE6 A;  5K36 C;  4ISA A;  4LF5 I;  1FI4 A;  4DR1 I;  4RPF A;  1HR0 E;  4JI7 E;  4JI8 I;  5C0X C;  4DV6 I;  1KIJ A;  2UUC I;  1NHI A;  2J7K A;  2O1W A;  3J81 Q;  4AQY I;  2BA1 D;  4USK A;  5BR8 I;  3M85 D;  2JEA A;  2PO1 B;  4X65 I;  2PNZ A;  2NN6 A;  4X62 E;  1N33 E;  5K36 A;  1Y60 A;  2ZM6 E;  4B3M E;  4DPT A;  4JV5 E;  5FLX Q;  2JE6 B;  3HJC A;  5C0X A;  4OZE A;  2V34 A;  3KRN A;  1HNX E;  4JYA E;  4FN5 A;  4BA1 A;  2VQF I;  1XMO E;  2JEA B;  1ZM3 A;  4MU1 A;  2IOP A;  3J80 Q;  4DR2 E;  2GO4 A;  4KQV A;  4P52 A;  2PNZ B;  2NN6 B;  1YH8 A;  1MU5 A;  5K36 B;  4LF6 I;  1N0U A;  2X7I A;  4ED4 A;  1H7S A;  1N32 E;  5C0X B;  4X64 I;  2IER A;  1HNZ I;  4DV5 E;  2BV3 A;  1Y4S A;  4LFB I;  2PO2 A;  4IFD E;  4J3D A;  1IBM I;  4BA1 B;  3WU6 A;  1I94 I;  2CG9 A;  1VI7 A;  3PRY A;  5JEA E;  2VQE I;  4JG4 A;  5IWA E;  3P3E A;  2IES A;  4LF8 E;  4DV0 E;  4LF4 I;  3PYG A;  4DV1 I;  1K47 A;  2PO2 B;  1FWK A;  2Z5B A;  4OX9 E;  3D4J A;  4HAC B;  4MYU A;  4UTG A;  2F1D A;  2HFU A;  2UU9 I;  4KHP I;  2R3V A;  4DV4 E;  4JI6 I;  4ZVI A;  2NN6 E;  4K0K I;  3GME A;  2PNM A;  4JI7 I;  5K36 E;  4FW6 A;  3U1K A;  1NHH A;  3ZZ0 A;  3P3C A;  4MU3 A;  3V2U C;  2A2C A;  1H74 A;  1ZM9 A;  2Z5B B;  5C0X E;  4GQU A;  4M1K A;  2HHH E;  4DPX A;  1IBK I;  4IFD C;  4Z7C A;  4DUY I;  1H73 A;  1ZXM A;  1Z59 A;  3GLL A;  4FW5 A;  2HKJ A;  2VF3 A;  2ZM6 I;  5JEA C;  1N36 E;  1J5E E;  4B3R E;  2E5L E;  4DV2 E;  1RR9 A;  1ZM2 A;  2UUB E;  4IFD A;  4OO1 F;  1Z5A A;  4LFA I;  1RHY A;  4IFD D;  4MU0 A;  4NXN I;  3CDJ A;  4JI2 E;  3K17 A;  4FW9 A;  4GKK I;  5JEA A;  1R6M A;  1OJ4 A;  2C39 A;  4JI1 I;  5JEA D;  3P3G A;  1S16 A;  4DR5 I;  4YHH I;  3NZK A;  3QT7 A;  3ZM7 A;  4DV5 I;  3PYE A;  1E3P A;  4AM3 A;  3QT6 A;  3CWV A;  2GS8 A;  4PRV A;  1A6F A;  1XXE A;  1UDS A;  4IFD B;  4P7A A;  4LF7 E;  4DV3 E;  4DR3 E;  3P06 A;  5A2Q Q;  1Z0E A;  2AJ4 A;  1XMQ E;  5JEA B;  5IWA I;  1ZM4 A;  2C39 B;  2AE8 A;  5DRO A;  3ZKB A;  4JI3 E;  2NPF A;  4LF8 I;  4DV0 I;  1USV A;  2Z5C A;  4HXZ A;  4OO1 C;  1YHC A;  2NN6 D;  2V2V A;  4U3D A;  3JAM C;  5K36 D;  3HKM A;  4U3B A;  4OX9 I;  4DR4 I;  4JI4 E;  3OTO E;  2UXB E;  5C0X D;  4AIM A;  2CGE A;  2BM1 A;  5LMU E;  3Q6N A;  5L3J A;  4NXM I;  4LFC I;  5DRR A;  2PO0 A;  3DD6 A;  4B3T E;  2UXC E;  4YY3 E;  3K1J A;  4OO1 A;  2Z5C B;  3T1H E;  2X36 A;  4LOM A;  4DUZ E;  3ZKD A;  3LPS A;  2CZ9 A;  2C37 A;  1KTV A;  2V2Z A;  4FW7 A;  1Z0W A;  1FJG E;  4DR6 I;  4HAC A;  4X66 I;  1XNR I;  1UDQ A;  4QNJ A;  2PO0 B;  3LNU A;  1NHJ A;  3M85 G;  1PIE A;  4N3O A;  3K85 A;  4OO1 B;  4B3R I;  1Y6Z A;  3B82 A;  4DPY A;  3ZZT A;  2J65 A;  1N34 E;  2Z5E A;  1BKN A;  1XNQ I;  2F4V I;  3M6A A;  1HNW I;  4IZJ A;  1Y4U A;  5DNL A;  2C37 B; 
#chains in the Genus database with same CATH homology
 2HK3 A;  4JI0 E;  2XEX A;  1XHK A;  1Z0T A;  5LMN I;  2O1T A;  4HYM A;  4LF9 E;  4XTJ A;  4LF5 E;  4DR1 E;  1Z5B A;  3Q1Q A;  4JI8 E;  4DV6 E;  1FWL A;  3Q6M A;  3B78 A;  2UUA I;  2UUC E;  4AQY E;  2Q2E B;  3V5R A;  1QZR A;  2ZIT A;  4I3H A;  4X65 E;  4DU7 A;  4IZJ B;  1FNM A;  1MX0 A;  2V8P A;  1HR0 I;  3F0N A;  4JI3 I;  1IBL E;  1NZ0 A;  3H4L A;  4USM A;  4X62 I;  2IOQ A;  1N33 I;  2O1V A;  2VQF E;  3T1Y E;  4B3M I;  1KKH A;  4JV5 I;  1WUU A;  4JI4 I;  2UXB I;  1H72 C;  1HNX I;  4JYA I;  5GMD A;  2DEJ A;  4DR7 E;  1XMO I;  4HY1 A;  1HK7 A;  4X64 E;  4FWD A;  4IZK A;  1HNZ E;  4B3T I;  4DR2 I;  3PYF A;  1PVG A;  3GON A;  1Z0G A;  4Z7Y A;  5FLX C;  1IBM E;  1Z0C A;  4JI5 E;  4DUZ I;  1N32 I;  2UXD E;  1FJG I;  4LF4 E;  2BM0 A;  3J80 C;  4B3S E;  2HKE A;  4IZK B;  4DV1 E;  4PU9 A;  3ZZU A;  3LTO A;  2GQ0 A;  2A2D A;  4DXL A;  5LL6 R;  1N34 I;  4DV7 E;  4WUB A;  2UU9 E;  2O1U A;  1USU A;  1DAR A;  4JI6 E;  1B62 A;  4K0K E;  1Z0B A;  4DV4 I;  4FWG A;  4WUC A;  4DU8 A;  1IBK E;  1ZXN A;  3PYD A;  4DUY E;  3QT5 A;  1VIS A;  1S4E A;  1Z0V A;  2HHH I;  5IT9 C;  1IBL I;  1UEK A;  2DEI A;  4URL A;  3T1Y I;  4LFA E;  1RRE A;  4NXN E;  1N36 I;  1B63 A;  1J5E I;  2E5L I;  1PKP A;  4GKK E;  4DV2 I;  2E1R A;  4JI1 E;  1EA6 A;  2UUB I;  4DR5 E;  4YHH E;  4DR7 I;  1EI1 A;  1N0V C;  4IZJ D;  2EFG A;  4JI2 I;  3J7A G;  4GKJ E;  4WUD A;  4MYT A;  3JAM Q;  4JI5 I;  2UXD I;  2PNL A;  5BR8 E;  4B3S I;  4LF7 I;  4DV3 I;  4DR3 I;  2WW4 A;  2OI2 A;  4DPU A;  4PRX A;  3WU4 A;  1XMQ I;  4DR4 E;  5FWK A;  2HFS A;  4DV7 I;  5GME A;  3B8H A;  5IT9 Q;  4NXM E;  3J7A M;  2ZBK B;  4R1F A;  4LFC E;  3WU5 A;  2V2Q A;  5A2Q C;  3OTO I;  1KVK A;  5LMU I;  3J81 C;  4LF6 E;  3HUL A;  2UXC I;  4YY3 I;  2HK2 A;  3T1H I;  4LFB E;  4DR6 E;  4X66 E;  1XNR E;  1I94 E;  2R42 A;  1ELO A;  1H7U A;  3WU3 A;  2VQE E;  4DPW A;  1XNQ E;  2F4V E;  4EMD A;  1HNW E;  4FWH A;  5LMN E;  1MG7 A;  1U2R A;  2LJP A;  1FKA E;  4KHP E;  2UUA E;  4JI0 I;  4UT4 A;  1D6T A;  4GKJ I;  4LF9 I;  1Z5C A;  4LF5 I;  1FI4 A;  4DR1 I;  4RPF A;  1HR0 E;  4JI7 E;  4JI8 I;  4DV6 I;  1KIJ A;  2UUC I;  1NHI A;  3J81 Q;  2J7K A;  2O1W A;  4AQY I;  4USK A;  5BR8 I;  4X65 I;  4X62 E;  1N33 E;  2ZM6 E;  4B3M E;  4DPT A;  4JV5 E;  5FLX Q;  3HJC A;  2V34 A;  1HNX E;  4JYA E;  4FN5 A;  2VQF I;  1XMO E;  1ZM3 A;  2IOP A;  3J80 Q;  4DR2 E;  4KQV A;  4P52 A;  1MU5 A;  4LF6 I;  1N0U A;  2X7I A;  4ED4 A;  1H7S A;  1N32 E;  4X64 I;  1HNZ I;  4DV5 E;  2BV3 A;  1Y4S A;  4LFB I;  1IBM I;  3WU6 A;  1I94 I;  2CG9 A;  3PRY A;  2VQE I;  4JG4 A;  5IWA E;  4LF8 E;  4DV0 E;  4LF4 I;  3PYG A;  4DV1 I;  1K47 A;  1FWK A;  2Z5B A;  4OX9 E;  3D4J A;  4HAC B;  4MYU A;  4UTG A;  2HFU A;  2UU9 I;  4KHP I;  2R3V A;  4DV4 E;  4JI6 I;  4ZVI A;  4K0K I;  2PNM A;  4JI7 I;  3ZZ0 A;  1NHH A;  3V2U C;  2A2C A;  1H74 A;  1ZM9 A;  2Z5B B;  4M1K A;  2HHH E;  4DPX A;  1IBK I;  4Z7C A;  4DUY I;  1H73 A;  1ZXM A;  1Z59 A;  2HKJ A;  2VF3 A;  2ZM6 I;  1N36 E;  1J5E E;  4B3R E;  2E5L E;  4DV2 E;  1RR9 A;  1ZM2 A;  2UUB E;  1Z5A A;  4LFA I;  4NXN I;  4JI2 E;  3K17 A;  4FW9 A;  4GKK I;  1OJ4 A;  4JI1 I;  1S16 A;  4DR5 I;  4YHH I;  3QT7 A;  3ZM7 A;  4DV5 I;  3PYE A;  3QT6 A;  3CWV A;  2GS8 A;  4PRV A;  1A6F A;  4P7A A;  4LF7 E;  4DV3 E;  4DR3 E;  3P06 A;  5A2Q Q;  1Z0E A;  2AJ4 A;  1XMQ E;  5IWA I;  1ZM4 A;  3ZKB A;  4JI3 E;  2NPF A;  4LF8 I;  4DV0 I;  1USV A;  2Z5C A;  4HXZ A;  2V2V A;  3JAM C;  4OX9 I;  4DR4 I;  4JI4 E;  3OTO E;  2UXB E;  2CGE A;  2BM1 A;  5LMU E;  3Q6N A;  5L3J A;  4NXM I;  4LFC I;  4B3T E;  2UXC E;  4YY3 E;  3K1J A;  2Z5C B;  3T1H E;  2X36 A;  4DUZ E;  3ZKD A;  3LPS A;  2CZ9 A;  1KTV A;  2V2Z A;  1Z0W A;  1FJG E;  4DR6 I;  4HAC A;  4X66 I;  1XNR I;  3LNU A;  1NHJ A;  1PIE A;  4N3O A;  3K85 A;  4B3R I;  1Y6Z A;  3B82 A;  4DPY A;  3ZZT A;  1N34 E;  2Z5E A;  1BKN A;  1XNQ I;  2F4V I;  3M6A A;  1HNW I;  4IZJ A;  1Y4U A;  3QT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...