2E5LI

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2e5lI00
1N0VC 4DV4E 4JI4E 4DR4I 4DR5I 3WU3A 1N36E 5BR8E 3J80Q 1NHJA 1KVKA 4K0KI 1XNRE 2UUCE 4DUYI 5LMUI 2AJ4A 5FLXQ 4DR1I 4HACB 2Q2EB 4DPTA 1FNMA 4DV2E 3ZZ0A 4WUDA 4JV5I 4HYMA 4NXMI 3D4JA 1HR0I 3JAMC 1H7SA 3PYDA 4DR6E 4DUZE 4YY3I 5IT9C 2VQFI 4ZVIA 4LFAI 4X64I 3T1YI 4DV7I 4DV5I 2R3VA 2UXDI 4LF6E 4Z7CA 3LNUA 5IWAI 4MYTA 1XMOI 2DEIA 2BM0A 1KIJA 2UUBI 1XNQI 4JI7E 4LF8E 2VQEI 3CWVA 1N0UA 3WU6A 1Z0EA 4UTGA 5GMEA 5IT9Q 1MG7A 2HFSA 2HHHE 3ZKDA 4DV6I 4JI0E 1VISA 2UXBE 1Z5AA 2E1RA 1IBLI 4DXLA 4B3TI 1B62A 4DR2I 2UU9E 2BM1A 4ED4A 2V2ZA 4DPYA 4Z7YA 1XMQE 4KQVA 1NZ0A 4B3ME 4X65E 4JI5I 1ZXMA 4DU8A 2LJPA 4DR3I 4USKA 5LMNI 5FLXC 2UUAI 1EA6A 4X62I 3ZZTA 1RR9A 4LF5E 1RREA 1N34E 1IBME 1H74A 4JI5E 4JI8I 3B78A 1J5EI 2NPFA 1D6TA 2VF3A 5LMNE 2UXCE 1B63A 4I3HA 3QT8A 4LF4I 3OTOI 1IBKI 1HNZI 5A2QC 2J7KA 4WUCA 4JG4A 4B3SE 1XNQE 4JI1I 2ZBKB 2E5LI 5LL6R 4WUBA 1QZRA 2BV3A 3QT7A 3WU4A 4GKKI 4P7AA 4JI8E 1FJGI 2EFGA 4GKJI 4PRXA 4JYAI 4DR4E 4AQYI 4DR5E 4DR7I 4LF7I 1PVGA 1OJ4A 4JI2I 1IBKE 2ZM6I 4K0KE 4DUYE 5LMUE 4DR1E 1MX0A 3QT5A 4X66I 1Z5CA 5A2QQ 1DARA 3M6AA 2R42A 4JV5E 4NXME 1HR0E 2HK2A 1I94I 1ZXNA 4DV0I 4URLA 4JI6I 3GONA 4DV1I 3PYFA 4OX9I 4LFBI 3K1JA 4YY3E 2VQFE 1FKAE 4LFAE 4X64E 3T1YE 3PYGA 2X7IA 5L3JA 4DV7E 4DV5E 4P52A 4KHPI 2UXDE 4FN5A 4M1KA 5IWAE 1XMOE 2UUBE 1PIEA 4R1FA 3J81Q 1Z5BA 2HK3A 2VQEE 4LFCI 3ZKBA 3HULA 3T1HI 4DV6E 3B8HA 3ZM7A 4YHHI 1Z0CA 1ELOA 4NXNI 2F4VI 1IBLE 4B3TE 1N33I 1Z59A 4FWDA 4B3RI 4DR2E 1HNWI 5GMDA 4DPXA 2XEXA 3V5RA 4EMDA 1N32I 4DV4I 4DV3I 4FWGA 1NHIA 1ZM3A 4DR3E 4JI4I 2V2VA 1N36I 1FWKA 1WUUA 5BR8I 2HKJA 2UUAE 4XTJA 4X62E 1Z0VA 1XNRI 2UUCI 3J7AM 2OI2A 1S16A 1N32E 4DV3E 3H4LA 1J5EE 1H73A 4DV2I 4DPWA 2V8PA 1H72C 4DR6I 1ZM4A 4LF4E 3OTOE 1KTVA 1HNZE 1H7UA 4UT4A 3LTOA 1KKHA 4JI1E 4DUZI 2E5LE 4GKKE 1A6FA 1FJGE 3V2UC 2A2DA 4GKJE 4JYAE 4AQYE 4DR7E 1XHKA 2GS8A 4LF6I 3J81C 2ZITA 4MYUA 4LF7E 4JI3I 4JI2E 3PYEA 2ZM6E 4HACA 3ZZUA 4LF9I 4JI7I 4LF8I 4X66E 4RPFA 4HY1A 4PU9A 1PKPA 1K47A 2HHHI 1I94E 1BKNA 4HXZA 4JI0I 4JI3E 1NHHA 2UXBI 4LF9E 3JAMQ 1Z0BA 4DV0E 4FWHA 4JI6E 4OX9E 4DV1E 1EI1A 4LFBE 3K17A 1S4EA 1HNXI 1Z0WA 2X36A 2A2CA 2UU9I 1U2RA 1XMQI 3QT6A 4USMA 4KHPE 4B3MI 3LPSA 4X65I 4PRVA 2V34A 4LFCE 1FWLA 2HFUA 3B82A 1MU5A 2CZ9A 1UEKA 1HNXE 1ZM9A 3F0NA 4LF5I 1N34I 1IBMI 2HKEA 3T1HE 3J7AG 1Z0TA 3Q1QA 4YHHE 3WU5A 3J80C 4NXNE 2F4VE 1FI4A 1Z0GA 1N33E 2V2QA 4DU7A 4B3RE 2UXCI 4DPUA 1HNWE 2DEJA 2WW4A 1ZM2A 4FW9A 4B3SI
chains in the Genus database with same CATH superfamily
2JT2A 1N0VC 4DV4E 3P06A 4OKGA 1UDOA 2Z5CB 2BR2A 3M85G 4BA1A 2PO1A 1Y4UA 4JI4E 4DR4I 4DR5I 3WU3A 1N36E 4OO1D 5BR8E 3J80Q 1NHJA 1Y5YA 1KVKA 4K0KI 1XNRE 2UUCE 4DUYI 3NZKA 5LMUI 1OYSA 4OO1C 2AJ4A 5FLXQ 4DR1I 2WP8B 4HACB 1OYPA 2Q2EB 4IFDA 1VI7A 4DPTA 4U3DA 1FNMA 4DV2E 5K36B 3ZZ0A 4IS9A 4WUDA 2NN6B 4JV5I 4HYMA 2O3ZA 4NXMI 3D4JA 3Q6MA 1HR0I 2PO0B 3JAMC 1H7SA 3PYDA 2O1UA 4LCGA 4DR6E 5DNLA 4BA2B 3DD6A 1P42A 4DUZE 2C38B 4YY3I 5IT9C 3P3EA 2CGEA 2VQFI 5C0XF 4ZVIA 4LFAI 4MU3A 1R6MA 4X64I 3T1YI 4AM3A 4LCFA 4DV7I 4DV5I 4ISAA 4OO1B 3HJCA 4FW7A 2R3VA 2UXDI 4LF6E 4Z7CA 1HK7A 3LNUA 5IWAI 4MYTA 1XMOI 2DEIA 2BM0A 1KIJA 2UUBI 3Q6NA 1XNQI 4MU1A 4JI7E 4LF8E 2VQEI 3CWVA 3M7ND 1N0UA 3WU6A 1Z0EA 3HKMA 4OO1A 4IFDE 4UTGA 2J65A 5GMEA 5IT9Q 1MG7A 2CVEA 2HFSA 4QNJA 2HHHE 3ZKDA 4DV6I 4JI0E 1VISA 2UXBE 1Z5AA 1UDNA 2E1RA 2PO2B 3U1YA 4DXLA 1IBLI 4B3TI 4IFDD 1OYRA 1B62A 5JEAF 4MU4A 2PNZB 3M7NG 4DR2I 4IFDC 3P76A 2BM1A 2UU9E 2V2ZA 4ED4A 5K36E 4DPYA 4Z7YA 1XMQE 2NN6E 5DNXA 1UDQA 4KQVA 1NZ0A 4B3ME 4X65E 4JI5I 3M85D 3GCMA 1ZXMA 4DU8A 2LJPA 4DR3I 2BR2B 4USKA 4BA1B 5LMNI 5FLXC 2UUAI 1EA6A 4X62I 3ZZTA 1RR9A 4LF5E 2O1TA 1RREA 3GMEA 1N34E 1IBME 4OO1E 4OZEA 2JEBA 1H74A 4JI5E 4JI8I 3B78A 3P3GA 1J5EI 2NPFA 1D6TA 2VF3A 4IFDB 5LMNE 2UXCE 1B63A 4I3HA 3QT8A 4LPFA 4LF4I 3OTOI 4AIMA 1IBKI 1HNZI 5A2QC 2J7KA 4WUCA 4JG4A 4B3SE 1XNQE 4JI1I 2ZBKB 2E5LI 5LL6R 4QNKA 4WUBA 1QZRA 2BV3A 3QT7A 3WU4A 4GKKI 2GO3A 4P7AA 4U3BA 4JI8E 2JEAB 3B4TA 1FJGI 2EFGA 2WNRA 4IZKA 4GKJI 4PRXA 4JYAI 4DR4E 4AQYI 4DR5E 4DR7I 3PS3A 4LF7I 5C0XA 1PVGA 1OJ4A 4JI2I 1IBKE 2ZM6I 4K0KE 4DUYE 2C39A 5LMUE 3CDJA 1E3PA 3GLLA 4DR1E 1MX0A 5EKWA 1USVA 2JEAA 3QT5A 4X66I 1Z5CA 3UHMA 5A2QQ 1DARA 3M6AA 2R42A 2O1WA 4JV5E 2GQ0A 4NXME 2CG9A 1HR0E 2HK2A 1I94I 1ZXNA 4FW4A 1Y6ZA 4FW6A 2GO4A 4DV0I 4URLA 4JI6I 3GONA 4DV1I 3PYFA 5ELWA 4OX9I 4LFBI 3K1JA 4YY3E 2VQFE 4N3OA 1FKAE 4LFAE 4X64E 3T1YE 3PYGA 2X7IA 5L3JA 4DV7E 4DV5E 5JEAA 4P52A 4KHPI 2UXDE 4FN5A 4M1KA 5IWAE 2PNMA 1XMOE 2PNLA 5K36F 2IERA 2UUBE 3CDIA 1PIEA 2NN6F 4R1FA 3J81Q 2Z5BA 1Z5BA 1E3HA 2HK3A 2VQEE 4LFCI 4IZJA 1XXEA 3ZKBA 5C0XD 3HULA 3T1HI 4DV6E 3U1KA 3B8HA 3ZM7A 5C0XC 4YHHI 1USUA 1ELOA 1Z0CA 2JEBB 4NXNI 2F4VI 1IBLE 4B3TE 4OO1F 1N33I 1Z59A 1RHYA 4FWDA 4B3RI 4DR2E 1HNWI 5DRRA 5GMDA 4DPXA 3L7ZA 2XEXA 3V5RA 2Z5EA 4AIDA 3H1CA 1UDSA 4EMDA 1N32I 4DV4I 5JEAE 4DV3I 2F1DA 4FWGA 1NHIA 1ZM3A 4DR3E 3PS2A 4JI4I 1Y4SA 2V2VA 2WNRB 4IZKB 1N36I 1FWKA 1WUUA 2AE8A 5BR8I 2HKJA 1YH8A 2UUAE 4XTJA 5JEAD 2IESA 4X62E 1Z0VA 5C0XB 1XNRI 2UUCI 3J7AM 4LOMA 2OI2A 2VESA 5DRQA 1S16A 2C39B 2BA0G 1N32E 5JEAC 4DV3E 4LCHA 3H4LA 1J5EE 1H73A 4DV2I 4DPWA 2JE6B 2BA1G 4IZJD 2V8PA 1H72C 4DR6I 1ZM4A 4LF4E 3OTOE 1KTVA 1HNZE 2IOQA 1H7UA 4UT4A 3LTOA 1KKHA 4JI1E 5EL9A 4DUZI 2E5LE 2Z5CA 4GKKE 1A6FA 5FWKA 2JE6A 1FJGE 3V2UC 2A2DA 4GKJE 4JYAE 4AQYE 4DR7E 1Y60A 1XHKA 2GS8A 4LF6I 3J81C 2ZITA 4MYUA 4LF7E 4GQUA 5JEAB 4JI3I 4JI2E 3PYEA 2ZM6E 4IFDF 2WP8A 4HACA 3ZZUA 4LF9I 4JI7I 4LF8I 4X66E 4FW5A 5K36A 3KRNA 2Z5BB 2O1VA 2NN6A 4RPFA 4IZJB 4HY1A 4PU9A 1R6LA 1PKPA 2PO0A 3PS1A 4BA2A 1K47A 2HHHI 1I94E 1BKNA 4HXZA 4JI0I 4JI3E 1NHHA 4MDTA 2UXBI 4NBQA 5C0XE 2C38A 4LF9E 3JAMQ 1Z0BA 4DV0E 4FWHA 4JI6E 4OX9E 4DV1E 1EI1A 4LFBE 2C37B 3K17A 1S4EA 1Z0WA 1HNXI 2X36A 2A2CA 2UU9I 1U2RA 1XMQI 3QT6A 4USMA 4KHPE 3L7ZB 4B3MI 2IOPA 3LPSA 4X65I 4PRVA 4MU0A 2V34A 2C37A 4MQYA 4LFCE 1FWLA 2HFUA 3B82A 1MU5A 2CZ9A 3PRYA 1UEKA 1HNXE 3P3CA 1ZM9A 3F0NA 4FW3A 4LF5I 1N34I 1IBMI 2BA0D 2HKEA 3T1HE 3J7AG 2PO2A 1Z0TA 3Q1QA 4YHHE 3WU5A 3J80C 4NXNE 2F4VE 2BA1D 5K36D 1FI4A 1Z0GA 2PNZA 1N33E 2PO1B 2NN6D 3K85A 2V2QA 1YHCA 4DU7A 4B3RE 5DRPA 2UXCI 4DPUA 4J3DA 5K36C 1HNWE 2DEJA 2NN6C 2WW4A 1ZM2A 4FW9A 4B3SI 5DROA
chains in the Genus database with same CATH topology
1N0VC 4DV4E 3P06A 2Z5CB 1Y4UA 4JI4E 4DR4I 4DR5I 3WU3A 1N36E 5BR8E 3J80Q 1NHJA 1KVKA 4K0KI 1XNRE 2UUCE 4DUYI 5LMUI 2AJ4A 5FLXQ 4DR1I 4HACB 2Q2EB 4DPTA 1FNMA 4DV2E 3ZZ0A 4WUDA 4JV5I 4HYMA 4NXMI 3D4JA 3Q6MA 1HR0I 3JAMC 1H7SA 3PYDA 2O1UA 4DR6E 4DUZE 5IT9C 4YY3I 2CGEA 2VQFI 4ZVIA 4LFAI 4X64I 3T1YI 4DV7I 4DV5I 3HJCA 2R3VA 2UXDI 4LF6E 4Z7CA 1HK7A 3LNUA 5IWAI 4MYTA 1XMOI 2DEIA 2BM0A 1KIJA 2UUBI 3Q6NA 1XNQI 4JI7E 4LF8E 2VQEI 3CWVA 1N0UA 3WU6A 1Z0EA 4UTGA 5GMEA 5IT9Q 1MG7A 2HFSA 2HHHE 3ZKDA 4DV6I 4JI0E 1VISA 2UXBE 1Z5AA 2E1RA 1IBLI 4DXLA 4B3TI 1B62A 4DR2I 2BM1A 2UU9E 4ED4A 2V2ZA 4DPYA 4Z7YA 1XMQE 4KQVA 1NZ0A 4B3ME 4X65E 4JI5I 1ZXMA 4DU8A 2LJPA 4DR3I 4USKA 5LMNI 5FLXC 2UUAI 1EA6A 4X62I 3ZZTA 1RR9A 4LF5E 2O1TA 1RREA 1N34E 1IBME 1H74A 4JI5E 4JI8I 3B78A 1J5EI 2NPFA 1D6TA 2VF3A 5LMNE 2UXCE 1B63A 4I3HA 3QT8A 4LF4I 3OTOI 1IBKI 1HNZI 5A2QC 2J7KA 4WUCA 4JG4A 4B3SE 1XNQE 4JI1I 2ZBKB 2E5LI 5LL6R 4WUBA 1QZRA 2BV3A 3QT7A 3WU4A 4GKKI 4P7AA 4JI8E 1FJGI 2EFGA 4IZKA 4GKJI 4PRXA 4JYAI 4DR4E 4AQYI 4DR5E 4DR7I 4LF7I 1PVGA 1OJ4A 4JI2I 1IBKE 2ZM6I 4K0KE 4DUYE 5LMUE 4DR1E 1MX0A 1USVA 3QT5A 4X66I 1Z5CA 5A2QQ 1DARA 3M6AA 2R42A 2O1WA 4JV5E 2GQ0A 4NXME 2CG9A 1HR0E 2HK2A 1I94I 1ZXNA 1Y6ZA 4DV0I 4URLA 4JI6I 3GONA 4DV1I 3PYFA 4OX9I 4LFBI 3K1JA 4YY3E 2VQFE 4N3OA 1FKAE 4LFAE 4X64E 3T1YE 3PYGA 2X7IA 5L3JA 4DV7E 4DV5E 4P52A 4KHPI 2UXDE 4FN5A 4M1KA 5IWAE 2PNMA 1XMOE 2PNLA 2UUBE 1PIEA 4R1FA 3J81Q 2Z5BA 1Z5BA 2HK3A 2VQEE 4LFCI 4IZJA 3ZKBA 3HULA 3T1HI 4DV6E 3B8HA 3ZM7A 4YHHI 1USUA 1ELOA 1Z0CA 4NXNI 2F4VI 1IBLE 4B3TE 1N33I 1Z59A 4FWDA 4B3RI 4DR2E 1HNWI 5GMDA 4DPXA 2XEXA 3V5RA 2Z5EA 4EMDA 1N32I 4DV4I 4DV3I 4FWGA 1NHIA 1ZM3A 4DR3E 4JI4I 1Y4SA 2V2VA 4IZKB 1N36I 1FWKA 1WUUA 5BR8I 2HKJA 2UUAE 4XTJA 4X62E 1Z0VA 1XNRI 2UUCI 3J7AM 2OI2A 1S16A 1N32E 4DV3E 3H4LA 1J5EE 1H73A 4DV2I 4DPWA 4IZJD 2V8PA 1H72C 4DR6I 1ZM4A 4LF4E 3OTOE 1KTVA 1HNZE 2IOQA 1H7UA 4UT4A 3LTOA 1KKHA 4JI1E 4DUZI 2E5LE 2Z5CA 4GKKE 1A6FA 5FWKA 1FJGE 3V2UC 2A2DA 4GKJE 4JYAE 4AQYE 4DR7E 1XHKA 2GS8A 4LF6I 3J81C 2ZITA 4MYUA 4LF7E 4JI3I 4JI2E 3PYEA 2ZM6E 4HACA 3ZZUA 4LF9I 4JI7I 4LF8I 4X66E 2Z5BB 2O1VA 4RPFA 4IZJB 4HY1A 4PU9A 1PKPA 1K47A 2HHHI 1I94E 1BKNA 4HXZA 4JI0I 4JI3E 1NHHA 2UXBI 4LF9E 3JAMQ 1Z0BA 4DV0E 4FWHA 4JI6E 4OX9E 4DV1E 1EI1A 4LFBE 3K17A 1S4EA 1Z0WA 1HNXI 2X36A 2A2CA 2UU9I 1U2RA 1XMQI 3QT6A 4USMA 4KHPE 4B3MI 2IOPA 3LPSA 4X65I 4PRVA 2V34A 4LFCE 1FWLA 2HFUA 3B82A 1MU5A 2CZ9A 3PRYA 1UEKA 1HNXE 1ZM9A 3F0NA 4LF5I 1N34I 1IBMI 2HKEA 3T1HE 3J7AG 1Z0TA 3Q1QA 4YHHE 3WU5A 3J80C 4NXNE 2F4VE 1FI4A 1Z0GA 1N33E 3K85A 2V2QA 4DU7A 4B3RE 2UXCI 4DPUA 1HNWE 2DEJA 2WW4A 1ZM2A 4FW9A 4B3SI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0V C;  4DV4 E;  4JI4 E;  4DR4 I;  4DR5 I;  3WU3 A;  1N36 E;  5BR8 E;  3J80 Q;  1NHJ A;  1KVK A;  4K0K I;  1XNR E;  2UUC E;  4DUY I;  5LMU I;  2AJ4 A;  5FLX Q;  4DR1 I;  4HAC B;  2Q2E B;  4DPT A;  1FNM A;  4DV2 E;  3ZZ0 A;  4WUD A;  4JV5 I;  4HYM A;  4NXM I;  3D4J A;  1HR0 I;  3JAM C;  1H7S A;  3PYD A;  4DR6 E;  4DUZ E;  4YY3 I;  5IT9 C;  2VQF I;  4ZVI A;  4LFA I;  4X64 I;  3T1Y I;  4DV7 I;  4DV5 I;  2R3V A;  2UXD I;  4LF6 E;  4Z7C A;  3LNU A;  5IWA I;  4MYT A;  1XMO I;  2DEI A;  2BM0 A;  1KIJ A;  2UUB I;  1XNQ I;  4JI7 E;  4LF8 E;  2VQE I;  3CWV A;  1N0U A;  3WU6 A;  1Z0E A;  4UTG A;  5GME A;  5IT9 Q;  1MG7 A;  2HFS A;  2HHH E;  3ZKD A;  4DV6 I;  4JI0 E;  1VIS A;  2UXB E;  1Z5A A;  2E1R A;  1IBL I;  4DXL A;  4B3T I;  1B62 A;  4DR2 I;  2UU9 E;  2BM1 A;  4ED4 A;  2V2Z A;  4DPY A;  4Z7Y A;  1XMQ E;  4KQV A;  1NZ0 A;  4B3M E;  4X65 E;  4JI5 I;  1ZXM A;  4DU8 A;  2LJP A;  4DR3 I;  4USK A;  5LMN I;  5FLX C;  2UUA I;  1EA6 A;  4X62 I;  3ZZT A;  1RR9 A;  4LF5 E;  1RRE A;  1N34 E;  1IBM E;  1H74 A;  4JI5 E;  4JI8 I;  3B78 A;  1J5E I;  2NPF A;  1D6T A;  2VF3 A;  5LMN E;  2UXC E;  1B63 A;  4I3H A;  3QT8 A;  4LF4 I;  3OTO I;  1IBK I;  1HNZ I;  5A2Q C;  2J7K A;  4WUC A;  4JG4 A;  4B3S E;  1XNQ E;  4JI1 I;  2ZBK B;  2E5L I;  5LL6 R;  4WUB A;  1QZR A;  2BV3 A;  3QT7 A;  3WU4 A;  4GKK I;  4P7A A;  4JI8 E;  1FJG I;  2EFG A;  4GKJ I;  4PRX A;  4JYA I;  4DR4 E;  4AQY I;  4DR5 E;  4DR7 I;  4LF7 I;  1PVG A;  1OJ4 A;  4JI2 I;  1IBK E;  2ZM6 I;  4K0K E;  4DUY E;  5LMU E;  4DR1 E;  1MX0 A;  3QT5 A;  4X66 I;  1Z5C A;  5A2Q Q;  1DAR A;  3M6A A;  2R42 A;  4JV5 E;  4NXM E;  1HR0 E;  2HK2 A;  1I94 I;  1ZXN A;  4DV0 I;  4URL A;  4JI6 I;  3GON A;  4DV1 I;  3PYF A;  4OX9 I;  4LFB I;  3K1J A;  4YY3 E;  2VQF E;  1FKA E;  4LFA E;  4X64 E;  3T1Y E;  3PYG A;  2X7I A;  5L3J A;  4DV7 E;  4DV5 E;  4P52 A;  4KHP I;  2UXD E;  4FN5 A;  4M1K A;  5IWA E;  1XMO E;  2UUB E;  1PIE A;  4R1F A;  3J81 Q;  1Z5B A;  2HK3 A;  2VQE E;  4LFC I;  3ZKB A;  3HUL A;  3T1H I;  4DV6 E;  3B8H A;  3ZM7 A;  4YHH I;  1Z0C A;  1ELO A;  4NXN I;  2F4V I;  1IBL E;  4B3T E;  1N33 I;  1Z59 A;  4FWD A;  4B3R I;  4DR2 E;  1HNW I;  5GMD A;  4DPX A;  2XEX A;  3V5R A;  4EMD A;  1N32 I;  4DV4 I;  4DV3 I;  4FWG A;  1NHI A;  1ZM3 A;  4DR3 E;  4JI4 I;  2V2V A;  1N36 I;  1FWK A;  1WUU A;  5BR8 I;  2HKJ A;  2UUA E;  4XTJ A;  4X62 E;  1Z0V A;  1XNR I;  2UUC I;  3J7A M;  2OI2 A;  1S16 A;  1N32 E;  4DV3 E;  3H4L A;  1J5E E;  1H73 A;  4DV2 I;  4DPW A;  2V8P A;  1H72 C;  4DR6 I;  1ZM4 A;  4LF4 E;  3OTO E;  1KTV A;  1HNZ E;  1H7U A;  4UT4 A;  3LTO A;  1KKH A;  4JI1 E;  4DUZ I;  2E5L E;  4GKK E;  1A6F A;  1FJG E;  3V2U C;  2A2D A;  4GKJ E;  4JYA E;  4AQY E;  4DR7 E;  1XHK A;  2GS8 A;  4LF6 I;  3J81 C;  2ZIT A;  4MYU A;  4LF7 E;  4JI3 I;  4JI2 E;  3PYE A;  2ZM6 E;  4HAC A;  3ZZU A;  4LF9 I;  4JI7 I;  4LF8 I;  4X66 E;  4RPF A;  4HY1 A;  4PU9 A;  1PKP A;  1K47 A;  2HHH I;  1I94 E;  1BKN A;  4HXZ A;  4JI0 I;  4JI3 E;  1NHH A;  2UXB I;  4LF9 E;  3JAM Q;  1Z0B A;  4DV0 E;  4FWH A;  4JI6 E;  4OX9 E;  4DV1 E;  1EI1 A;  4LFB E;  3K17 A;  1S4E A;  1HNX I;  1Z0W A;  2X36 A;  2A2C A;  2UU9 I;  1U2R A;  1XMQ I;  3QT6 A;  4USM A;  4KHP E;  4B3M I;  3LPS A;  4X65 I;  4PRV A;  2V34 A;  4LFC E;  1FWL A;  2HFU A;  3B82 A;  1MU5 A;  2CZ9 A;  1UEK A;  1HNX E;  1ZM9 A;  3F0N A;  4LF5 I;  1N34 I;  1IBM I;  2HKE A;  3T1H E;  3J7A G;  1Z0T A;  3Q1Q A;  4YHH E;  3WU5 A;  3J80 C;  4NXN E;  2F4V E;  1FI4 A;  1Z0G A;  1N33 E;  2V2Q A;  4DU7 A;  4B3R E;  2UXC I;  4DPU A;  1HNW E;  2DEJ A;  2WW4 A;  1ZM2 A;  4FW9 A;  4B3S I; 
#chains in the Genus database with same CATH topology
 2JT2 A;  1N0V C;  4DV4 E;  3P06 A;  4OKG A;  1UDO A;  2Z5C B;  2BR2 A;  3M85 G;  4BA1 A;  2PO1 A;  1Y4U A;  4JI4 E;  4DR4 I;  4DR5 I;  3WU3 A;  1N36 E;  4OO1 D;  5BR8 E;  3J80 Q;  1NHJ A;  1Y5Y A;  1KVK A;  4K0K I;  1XNR E;  2UUC E;  4DUY I;  3NZK A;  5LMU I;  1OYS A;  4OO1 C;  2AJ4 A;  5FLX Q;  4DR1 I;  2WP8 B;  4HAC B;  1OYP A;  2Q2E B;  4IFD A;  1VI7 A;  4DPT A;  4U3D A;  1FNM A;  4DV2 E;  5K36 B;  3ZZ0 A;  4IS9 A;  4WUD A;  2NN6 B;  4JV5 I;  4HYM A;  2O3Z A;  4NXM I;  3D4J A;  3Q6M A;  1HR0 I;  2PO0 B;  3JAM C;  1H7S A;  3PYD A;  2O1U A;  4LCG A;  4DR6 E;  5DNL A;  4BA2 B;  3DD6 A;  1P42 A;  4DUZ E;  2C38 B;  4YY3 I;  5IT9 C;  3P3E A;  2CGE A;  2VQF I;  5C0X F;  4ZVI A;  4LFA I;  4MU3 A;  1R6M A;  4X64 I;  3T1Y I;  4AM3 A;  4LCF A;  4DV7 I;  4DV5 I;  4ISA A;  4OO1 B;  3HJC A;  4FW7 A;  2R3V A;  2UXD I;  4LF6 E;  4Z7C A;  1HK7 A;  3LNU A;  5IWA I;  4MYT A;  1XMO I;  2DEI A;  2BM0 A;  1KIJ A;  2UUB I;  3Q6N A;  1XNQ I;  4MU1 A;  4JI7 E;  4LF8 E;  2VQE I;  3CWV A;  3M7N D;  1N0U A;  3WU6 A;  1Z0E A;  3HKM A;  4OO1 A;  4IFD E;  4UTG A;  2J65 A;  5GME A;  5IT9 Q;  1MG7 A;  2CVE A;  2HFS A;  4QNJ A;  2HHH E;  3ZKD A;  4DV6 I;  4JI0 E;  1VIS A;  2UXB E;  1Z5A A;  1UDN A;  2E1R A;  2PO2 B;  3U1Y A;  4DXL A;  1IBL I;  4B3T I;  4IFD D;  1OYR A;  1B62 A;  5JEA F;  4MU4 A;  2PNZ B;  3M7N G;  4DR2 I;  4IFD C;  3P76 A;  2BM1 A;  2UU9 E;  2V2Z A;  4ED4 A;  5K36 E;  4DPY A;  4Z7Y A;  1XMQ E;  2NN6 E;  5DNX A;  1UDQ A;  4KQV A;  1NZ0 A;  4B3M E;  4X65 E;  4JI5 I;  3M85 D;  3GCM A;  1ZXM A;  4DU8 A;  2LJP A;  4DR3 I;  2BR2 B;  4USK A;  4BA1 B;  5LMN I;  5FLX C;  2UUA I;  1EA6 A;  4X62 I;  3ZZT A;  1RR9 A;  4LF5 E;  2O1T A;  1RRE A;  3GME A;  1N34 E;  1IBM E;  4OO1 E;  4OZE A;  2JEB A;  1H74 A;  4JI5 E;  4JI8 I;  3B78 A;  3P3G A;  1J5E I;  2NPF A;  1D6T A;  2VF3 A;  4IFD B;  5LMN E;  2UXC E;  1B63 A;  4I3H A;  3QT8 A;  4LPF A;  4LF4 I;  3OTO I;  4AIM A;  1IBK I;  1HNZ I;  5A2Q C;  2J7K A;  4WUC A;  4JG4 A;  4B3S E;  1XNQ E;  4JI1 I;  2ZBK B;  2E5L I;  5LL6 R;  4QNK A;  4WUB A;  1QZR A;  2BV3 A;  3QT7 A;  3WU4 A;  4GKK I;  2GO3 A;  4P7A A;  4U3B A;  4JI8 E;  2JEA B;  3B4T A;  1FJG I;  2EFG A;  2WNR A;  4IZK A;  4GKJ I;  4PRX A;  4JYA I;  4DR4 E;  4AQY I;  4DR5 E;  4DR7 I;  3PS3 A;  4LF7 I;  5C0X A;  1PVG A;  1OJ4 A;  4JI2 I;  1IBK E;  2ZM6 I;  4K0K E;  4DUY E;  2C39 A;  5LMU E;  3CDJ A;  1E3P A;  3GLL A;  4DR1 E;  1MX0 A;  5EKW A;  1USV A;  2JEA A;  3QT5 A;  4X66 I;  1Z5C A;  3UHM A;  5A2Q Q;  1DAR A;  3M6A A;  2R42 A;  2O1W A;  4JV5 E;  2GQ0 A;  4NXM E;  2CG9 A;  1HR0 E;  2HK2 A;  1I94 I;  1ZXN A;  4FW4 A;  1Y6Z A;  4FW6 A;  2GO4 A;  4DV0 I;  4URL A;  4JI6 I;  3GON A;  4DV1 I;  3PYF A;  5ELW A;  4OX9 I;  4LFB I;  3K1J A;  4YY3 E;  2VQF E;  4N3O A;  1FKA E;  4LFA E;  4X64 E;  3T1Y E;  3PYG A;  2X7I A;  5L3J A;  4DV7 E;  4DV5 E;  5JEA A;  4P52 A;  4KHP I;  2UXD E;  4FN5 A;  4M1K A;  5IWA E;  2PNM A;  1XMO E;  2PNL A;  5K36 F;  2IER A;  2UUB E;  3CDI A;  1PIE A;  2NN6 F;  4R1F A;  3J81 Q;  2Z5B A;  1Z5B A;  1E3H A;  2HK3 A;  2VQE E;  4LFC I;  4IZJ A;  1XXE A;  3ZKB A;  5C0X D;  3HUL A;  3T1H I;  4DV6 E;  3U1K A;  3B8H A;  3ZM7 A;  5C0X C;  4YHH I;  1USU A;  1ELO A;  1Z0C A;  2JEB B;  4NXN I;  2F4V I;  1IBL E;  4B3T E;  4OO1 F;  1N33 I;  1Z59 A;  1RHY A;  4FWD A;  4B3R I;  4DR2 E;  1HNW I;  5DRR A;  5GMD A;  4DPX A;  3L7Z A;  2XEX A;  3V5R A;  2Z5E A;  4AID A;  3H1C A;  1UDS A;  4EMD A;  1N32 I;  4DV4 I;  5JEA E;  4DV3 I;  2F1D A;  4FWG A;  1NHI A;  1ZM3 A;  4DR3 E;  3PS2 A;  4JI4 I;  1Y4S A;  2V2V A;  2WNR B;  4IZK B;  1N36 I;  1FWK A;  1WUU A;  2AE8 A;  5BR8 I;  2HKJ A;  1YH8 A;  2UUA E;  4XTJ A;  5JEA D;  2IES A;  4X62 E;  1Z0V A;  5C0X B;  1XNR I;  2UUC I;  3J7A M;  4LOM A;  2OI2 A;  2VES A;  5DRQ A;  1S16 A;  2C39 B;  2BA0 G;  1N32 E;  5JEA C;  4DV3 E;  4LCH A;  3H4L A;  1J5E E;  1H73 A;  4DV2 I;  4DPW A;  2JE6 B;  2BA1 G;  4IZJ D;  2V8P A;  1H72 C;  4DR6 I;  1ZM4 A;  4LF4 E;  3OTO E;  1KTV A;  1HNZ E;  2IOQ A;  1H7U A;  4UT4 A;  3LTO A;  1KKH A;  4JI1 E;  5EL9 A;  4DUZ I;  2E5L E;  2Z5C A;  4GKK E;  1A6F A;  5FWK A;  2JE6 A;  1FJG E;  3V2U C;  2A2D A;  4GKJ E;  4JYA E;  4AQY E;  4DR7 E;  1Y60 A;  1XHK A;  2GS8 A;  4LF6 I;  3J81 C;  2ZIT A;  4MYU A;  4LF7 E;  4GQU A;  5JEA B;  4JI3 I;  4JI2 E;  3PYE A;  2ZM6 E;  4IFD F;  2WP8 A;  4HAC A;  3ZZU A;  4LF9 I;  4JI7 I;  4LF8 I;  4X66 E;  4FW5 A;  5K36 A;  3KRN A;  2Z5B B;  2O1V A;  2NN6 A;  4RPF A;  4IZJ B;  4HY1 A;  4PU9 A;  1R6L A;  1PKP A;  2PO0 A;  3PS1 A;  4BA2 A;  1K47 A;  2HHH I;  1I94 E;  1BKN A;  4HXZ A;  4JI0 I;  4JI3 E;  1NHH A;  4MDT A;  2UXB I;  4NBQ A;  5C0X E;  2C38 A;  4LF9 E;  3JAM Q;  1Z0B A;  4DV0 E;  4FWH A;  4JI6 E;  4OX9 E;  4DV1 E;  1EI1 A;  4LFB E;  2C37 B;  3K17 A;  1S4E A;  1Z0W A;  1HNX I;  2X36 A;  2A2C A;  2UU9 I;  1U2R A;  1XMQ I;  3QT6 A;  4USM A;  4KHP E;  3L7Z B;  4B3M I;  2IOP A;  3LPS A;  4X65 I;  4PRV A;  4MU0 A;  2V34 A;  2C37 A;  4MQY A;  4LFC E;  1FWL A;  2HFU A;  3B82 A;  1MU5 A;  2CZ9 A;  3PRY A;  1UEK A;  1HNX E;  3P3C A;  1ZM9 A;  3F0N A;  4FW3 A;  4LF5 I;  1N34 I;  1IBM I;  2BA0 D;  2HKE A;  3T1H E;  3J7A G;  2PO2 A;  1Z0T A;  3Q1Q A;  4YHH E;  3WU5 A;  3J80 C;  4NXN E;  2F4V E;  2BA1 D;  5K36 D;  1FI4 A;  1Z0G A;  2PNZ A;  1N33 E;  2PO1 B;  2NN6 D;  3K85 A;  2V2Q A;  1YHC A;  4DU7 A;  4B3R E;  5DRP A;  2UXC I;  4DPU A;  4J3D A;  5K36 C;  1HNW E;  2DEJ A;  2NN6 C;  2WW4 A;  1ZM2 A;  4FW9 A;  4B3S I;  5DRO A; 
#chains in the Genus database with same CATH homology
 1N0V C;  4DV4 E;  3P06 A;  2Z5C B;  1Y4U A;  4JI4 E;  4DR4 I;  4DR5 I;  3WU3 A;  1N36 E;  5BR8 E;  3J80 Q;  1NHJ A;  1KVK A;  4K0K I;  1XNR E;  2UUC E;  4DUY I;  5LMU I;  2AJ4 A;  5FLX Q;  4DR1 I;  4HAC B;  2Q2E B;  4DPT A;  1FNM A;  4DV2 E;  3ZZ0 A;  4WUD A;  4JV5 I;  4HYM A;  4NXM I;  3D4J A;  3Q6M A;  1HR0 I;  3JAM C;  1H7S A;  3PYD A;  2O1U A;  4DR6 E;  4DUZ E;  5IT9 C;  4YY3 I;  2CGE A;  2VQF I;  4ZVI A;  4LFA I;  4X64 I;  3T1Y I;  4DV7 I;  4DV5 I;  3HJC A;  2R3V A;  2UXD I;  4LF6 E;  4Z7C A;  1HK7 A;  3LNU A;  5IWA I;  4MYT A;  1XMO I;  2DEI A;  2BM0 A;  1KIJ A;  2UUB I;  3Q6N A;  1XNQ I;  4JI7 E;  4LF8 E;  2VQE I;  3CWV A;  1N0U A;  3WU6 A;  1Z0E A;  4UTG A;  5GME A;  5IT9 Q;  1MG7 A;  2HFS A;  2HHH E;  3ZKD A;  4DV6 I;  4JI0 E;  1VIS A;  2UXB E;  1Z5A A;  2E1R A;  1IBL I;  4DXL A;  4B3T I;  1B62 A;  4DR2 I;  2BM1 A;  2UU9 E;  4ED4 A;  2V2Z A;  4DPY A;  4Z7Y A;  1XMQ E;  4KQV A;  1NZ0 A;  4B3M E;  4X65 E;  4JI5 I;  1ZXM A;  4DU8 A;  2LJP A;  4DR3 I;  4USK A;  5LMN I;  5FLX C;  2UUA I;  1EA6 A;  4X62 I;  3ZZT A;  1RR9 A;  4LF5 E;  2O1T A;  1RRE A;  1N34 E;  1IBM E;  1H74 A;  4JI5 E;  4JI8 I;  3B78 A;  1J5E I;  2NPF A;  1D6T A;  2VF3 A;  5LMN E;  2UXC E;  1B63 A;  4I3H A;  3QT8 A;  4LF4 I;  3OTO I;  1IBK I;  1HNZ I;  5A2Q C;  2J7K A;  4WUC A;  4JG4 A;  4B3S E;  1XNQ E;  4JI1 I;  2ZBK B;  2E5L I;  5LL6 R;  4WUB A;  1QZR A;  2BV3 A;  3QT7 A;  3WU4 A;  4GKK I;  4P7A A;  4JI8 E;  1FJG I;  2EFG A;  4IZK A;  4GKJ I;  4PRX A;  4JYA I;  4DR4 E;  4AQY I;  4DR5 E;  4DR7 I;  4LF7 I;  1PVG A;  1OJ4 A;  4JI2 I;  1IBK E;  2ZM6 I;  4K0K E;  4DUY E;  5LMU E;  4DR1 E;  1MX0 A;  1USV A;  3QT5 A;  4X66 I;  1Z5C A;  5A2Q Q;  1DAR A;  3M6A A;  2R42 A;  2O1W A;  4JV5 E;  2GQ0 A;  4NXM E;  2CG9 A;  1HR0 E;  2HK2 A;  1I94 I;  1ZXN A;  1Y6Z A;  4DV0 I;  4URL A;  4JI6 I;  3GON A;  4DV1 I;  3PYF A;  4OX9 I;  4LFB I;  3K1J A;  4YY3 E;  2VQF E;  4N3O A;  1FKA E;  4LFA E;  4X64 E;  3T1Y E;  3PYG A;  2X7I A;  5L3J A;  4DV7 E;  4DV5 E;  4P52 A;  4KHP I;  2UXD E;  4FN5 A;  4M1K A;  5IWA E;  2PNM A;  1XMO E;  2PNL A;  2UUB E;  1PIE A;  4R1F A;  3J81 Q;  2Z5B A;  1Z5B A;  2HK3 A;  2VQE E;  4LFC I;  4IZJ A;  3ZKB A;  3HUL A;  3T1H I;  4DV6 E;  3B8H A;  3ZM7 A;  4YHH I;  1USU A;  1ELO A;  1Z0C A;  4NXN I;  2F4V I;  1IBL E;  4B3T E;  1N33 I;  1Z59 A;  4FWD A;  4B3R I;  4DR2 E;  1HNW I;  5GMD A;  4DPX A;  2XEX A;  3V5R A;  2Z5E A;  4EMD A;  1N32 I;  4DV4 I;  4DV3 I;  4FWG A;  1NHI A;  1ZM3 A;  4DR3 E;  4JI4 I;  1Y4S A;  2V2V A;  4IZK B;  1N36 I;  1FWK A;  1WUU A;  5BR8 I;  2HKJ A;  2UUA E;  4XTJ A;  4X62 E;  1Z0V A;  1XNR I;  2UUC I;  3J7A M;  2OI2 A;  1S16 A;  1N32 E;  4DV3 E;  3H4L A;  1J5E E;  1H73 A;  4DV2 I;  4DPW A;  4IZJ D;  2V8P A;  1H72 C;  4DR6 I;  1ZM4 A;  4LF4 E;  3OTO E;  1KTV A;  1HNZ E;  2IOQ A;  1H7U A;  4UT4 A;  3LTO A;  1KKH A;  4JI1 E;  4DUZ I;  2E5L E;  2Z5C A;  4GKK E;  1A6F A;  5FWK A;  1FJG E;  3V2U C;  2A2D A;  4GKJ E;  4JYA E;  4AQY E;  4DR7 E;  1XHK A;  2GS8 A;  4LF6 I;  3J81 C;  2ZIT A;  4MYU A;  4LF7 E;  4JI3 I;  4JI2 E;  3PYE A;  2ZM6 E;  4HAC A;  3ZZU A;  4LF9 I;  4JI7 I;  4LF8 I;  4X66 E;  2Z5B B;  2O1V A;  4RPF A;  4IZJ B;  4HY1 A;  4PU9 A;  1PKP A;  1K47 A;  2HHH I;  1I94 E;  1BKN A;  4HXZ A;  4JI0 I;  4JI3 E;  1NHH A;  2UXB I;  4LF9 E;  3JAM Q;  1Z0B A;  4DV0 E;  4FWH A;  4JI6 E;  4OX9 E;  4DV1 E;  1EI1 A;  4LFB E;  3K17 A;  1S4E A;  1Z0W A;  1HNX I;  2X36 A;  2A2C A;  2UU9 I;  1U2R A;  1XMQ I;  3QT6 A;  4USM A;  4KHP E;  4B3M I;  2IOP A;  3LPS A;  4X65 I;  4PRV A;  2V34 A;  4LFC E;  1FWL A;  2HFU A;  3B82 A;  1MU5 A;  2CZ9 A;  3PRY A;  1UEK A;  1HNX E;  1ZM9 A;  3F0N A;  4LF5 I;  1N34 I;  1IBM I;  2HKE A;  3T1H E;  3J7A G;  1Z0T A;  3Q1Q A;  4YHH E;  3WU5 A;  3J80 C;  4NXN E;  2F4V E;  1FI4 A;  1Z0G A;  1N33 E;  3K85 A;  2V2Q A;  4DU7 A;  4B3R E;  2UXC I;  4DPU A;  1HNW E;  2DEJ A;  2WW4 A;  1ZM2 A;  4FW9 A;  4B3S I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...