5K36F

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
215
Chain Sequence
RLLGPAAAKPMAFSNTTTHSEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 51
structure length 215
sequence length 241
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36F00
5JEAB 2PNZA 5JEAF 2BA0G 2NN6F 4IFDE 2C37A 3U1KA 2PO0B 5C0XC 4AM3A 1OYSA 3M85D 3GCMA 3HKMA 2JEBB 2C39B 5K36E 3M7NG 2JE6B 2NN6A 5C0XD 1E3PA 5K36A 4BA2B 2WP8B 2WNRB 5JEAD 2C38B 1R6MA 3GLLA 3GMEA 2PO1B 3H1CA 4AIDA 2WP8A 2NN6B 3B4TA 4IFDA 4IFDF 1OYRA 4OO1A 4BA1B 5C0XF 3CDIA 5JEAE 1UDOA 2BA1D 1UDNA 2JEAA 2BA0D 2PO0A 4BA1A 2JEBA 4OO1B 5JEAC 1UDQA 2JEAB 1R6LA 3DD6A 5K36F 5K36B 5K36D 2WNRA 5JEAA 2PO1A 2NN6E 2C38A 2BR2A 4OO1E 2PNZB 3CDJA 3M85G 2NN6C 2PO2B 4IFDD 1E3HA 3M7ND 4OO1D 1OYPA 4OO1F 2JE6A 2BR2B 3KRNA 2PO2A 2NN6D 3L7ZB 5C0XA 4NBQA 4BA2A 4AIMA 4OO1C 2C37B 5K36C 4IFDC 3L7ZA 5C0XB 2BA1G 4IFDB 1UDSA 5C0XE 2C39A
chains in the Genus database with same CATH superfamily
4DUYI 1FWLA 1EA6A 2BA0G 2NN6F 1HR0I 1USVA 2A2DA 4AQYI 3Q1QA 3J81C 1KIJA 1A6FA 4LF9I 3T1HE 4RPFA 3T1HI 4MU4A 5DNLA 4DV0I 1J5EI 4JI7E 4FW6A 1J5EE 3HULA 4QNJA 4DR1I 3WU3A 5C0XD 4DU7A 4BA2B 4LF5E 2WNRB 1ZM3A 2VQFE 1R6MA 1WUUA 4DUZI 5LMNI 4JI6E 4NXNE 3H1CA 1ELOA 2R42A 4GKJI 2X36A 5GMDA 1ZXNA 4JI1I 4X65I 1NHJA 2Z5CA 4OO1A 2VESA 3Q6NA 4BA1B 4YY3E 2UUCE 4DV3E 1FJGI 3CDIA 4YY3I 2UUCI 4KHPE 2PNLA 4X66I 1I94E 1H7UA 2UXBI 4BA1A 2LJPA 2Z5BA 1Z5AA 4LOMA 5DRQA 3LPSA 4GQUA 2IESA 3DD6A 3PYGA 3K17A 4UT4A 1N34I 1NHHA 2X7IA 1PIEA 1N32I 4DV5I 1HNXI 4X64E 2CZ9A 4DPUA 2V8PA 1IBKI 2PO1A 4MYTA 2PNZB 2ZITA 3JAMC 4X62I 3GONA 5DROA 4JG4A 4LCGA 4LF7I 1OJ4A 4DV1E 2J65A 1OYPA 1KTVA 2CG9A 3J80C 2BR2B 5C0XA 4NBQA 4B3MI 2HHHI 4OX9I 4MYUA 1IBLE 4JI0E 1QZRA 3WU4A 4OX9E 4FW5A 4HYMA 2C37B 1FKAE 3PS1A 3J81Q 4JV5I 4HY1A 4JI2I 1FWKA 4MDTA 2O3ZA 4DV2I 4JI2E 1Z0GA 1Y4UA 4IFDB 1ZM4A 2PNZA 4GKKI 4DU8A 4DPTA 4IFDE 3U1KA 2PO0B 5FLXC 1UEKA 5C0XC 3QT7A 3M85D 2Q2EB 1Z0VA 4DV0E 1Y60A 4JI7I 2JEBB 4K0KI 5FWKA 2VF3A 4PRVA 4IZJB 2R3VA 3PYFA 2UUBE 5K36E 2UUAI 3F0NA 1N33E 2J7KA 5K36A 4P52A 2VQEI 2BM1A 4FWGA 5JEAD 2C38B 2ZBKB 2HK2A 4UTGA 1H7SA 4IS9A 4URLA 5EL9A 4JI1E 4XTJA 4FWHA 2O1TA 3P3CA 4OKGA 5A2QQ 1RREA 4IFDA 1U2RA 1Z5CA 4LFBI 4JI3E 5C0XF 5JEAE 4LPFA 1UDOA 2BA1D 1IBME 1I94I 1N0VC 4LFCE 1HNWE 2JEAA 2GO4A 3WU5A 2UXBE 5LMNE 1N36I 2V2QA 4JYAI 3NZKA 4JYAE 5IT9Q 5JEAC 4IZJA 4DR6I 2JEAB 3PRYA 3B78A 3OTOI 4HACA 3OTOE 2IOPA 4DV5E 4DR7I 1IBKE 2HFSA 1YH8A 4DV3I 1FJGE 2O1VA 4FW3A 4DPWA 2C38A 2BR2A 2E5LI 3M6AA 2UU9E 5DRRA 3CDJA 3M85G 3P76A 5LL6R 1E3HA 4B3RE 1PVGA 4JI5E 2CGEA 1RHYA 2JE6A 2NPFA 4FW9A 1MU5A 1HNXE 5IWAI 3L7ZB 2ZM6E 2Z5EA 2HHHE 4Z7YA 4BA2A 3B82A 2GQ0A 4LCHA 1MX0A 4LF8E 4OO1C 4LF7E 5K36C 3T1YE 3ZKBA 3PS3A 1Y6ZA 3J7AM 4WUCA 1BKNA 4DR1E 1UDSA 1VI7A 4YHHI 2C37A 5ELWA 1XNQE 5LMUI 2CVEA 1XMQI 2UXDE 2EFGA 5LMUE 4AM3A 4MU0A 2Z5BB 1K47A 4JI0I 3J7AG 5GMEA 4MU3A 3GCMA 3J80Q 4LF4E 4FW7A 1Y4SA 1XMOI 2C39B 2UUAE 3M7NG 1FI4A 1H74A 2JE6B 2NN6A 1FNMA 1E3PA 1RR9A 4KHPI 1S4EA 3P3EA 2F4VE 2OI2A 4DR2E 4PRXA 2BV3A 3GLLA 1KVKA 3ZZTA 1Z0WA 3JAMQ 1HR0E 2PO1B 4LF6E 4B3TI 4LF9E 4NXMI 4AIDA 4J3DA 1NZ0A 1HNZE 1EI1A 4IFDF 3V2UC 4WUDA 1Z0EA 3U1YA 2VQEE 4DPYA 1P42A 1UDNA 3D4JA 4DV7I 2BA0D 4IZKB 2JT2A 4USMA 3P3GA 1NHIA 2WW4A 3PS2A 4N3OA 4GKJE 1UDQA 3QT6A 4X65E 1YHCA 1ZM2A 5K36F 5K36D 2WNRA 4LFBE 5JEAA 1ZM9A 5C0XE 2HKEA 4B3ME 4LFCI 2NN6E 4QNKA 4U3BA 1KKHA 4B3SE 4OO1E 4ED4A 1N36E 2UXCE 1Y5YA 5DRPA 4DR4E 2PO2B 3HJCA 4EMDA 4IFDD 3M7ND 2HKJA 4DV2E 1Z0TA 4DR3I 1PKPA 4KQVA 2ZM6I 2PO2A 4I3HA 2NN6D 5BR8E 4AQYE 4FN5A 5BR8I 2E5LE 1VISA 4P7AA 4X62E 3Q6MA 2PNMA 4IZJD 5EKWA 2IOQA 4K0KE 4HXZA 5DNXA 2GS8A 3L7ZA 2E1RA 1MG7A 3PYDA 4MU1A 3K85A 2BA1G 1ZXMA 2C39A 5JEAB 4JI8I 5FLXQ 5JEAF 2VQFI 4DUZE 4JI8E 1N0UA 4NXNI 4JI6I 4LCFA 5IT9C 1OYSA 4FWDA 4LF8I 1XHKA 3HKMA 1XMOE 1S16A 4PU9A 4R1FA 3QT5A 3ZZUA 3LNUA 2AE8A 2V2VA 2WP8B 1HNWI 2DEJA 4LF5I 1Z59A 5A2QC 4LF6I 3GMEA 1XNQI 2UXDI 4FW4A 2XEXA 3B8HA 2WP8A 1HNZI 2NN6B 4IZKA 3B4TA 1D6TA 1N34E 4ISAA 1H73A 1OYRA 1USUA 2UUBI 4DR7E 1N32E 3CWVA 1N33I 2A2CA 4DR2I 2UU9I 4X66E 2PO0A 2V34A 4B3TE 2JEBA 3LTOA 4NXME 5L3JA 4DV4E 4OO1B 2DEIA 4DPXA 4DV4I 4B3RI 4JI5I 1R6LA 1Z5BA 4MQYA 4DV6I 5K36B 4DV6E 2F1DA 4USKA 1Z0BA 4JI3I 5IWAE 4X64I 3ZZ0A 1IBMI 4WUBA 1DARA 1XXEA 2HK3A 4DV7E 1IBLI 2UXCI 1HK7A 2NN6C 2IERA 3K1JA 2BM0A 3T1YI 1H72C 4JV5E 4DR6E 3ZKDA 4U3DA 3PYEA 2O1UA 4OO1D 4LFAE 4OO1F 3ZM7A 4DV1I 4DR3E 4LFAI 2V2ZA 3KRNA 3V5RA 2GO3A 3WU6A 4YHHE 2O1WA 3P06A 4GKKE 4Z7CA 1XNRE 1XNRI 3QT8A 1XMQE 4B3SI 4DXLA 4AIMA 4ZVIA 4OZEA 4DR5E 4DR4I 4LF4I 4JI4E 4IFDC 4DR5I 3UHMA 2AJ4A 4JI4I 5C0XB 4M1KA 4HACB 1Z0CA 1B62A 2HFUA 2Z5CB 4DUYE 1B63A 2F4VI 3H4LA
chains in the Genus database with same CATH topology
5JEAB 2PNZA 5JEAF 2BA0G 2NN6F 4IFDE 2C37A 3U1KA 2PO0B 5C0XC 4AM3A 1OYSA 3M85D 3GCMA 3HKMA 2JEBB 2C39B 5K36E 3M7NG 2JE6B 2NN6A 5C0XD 1E3PA 5K36A 4BA2B 2WP8B 2WNRB 5JEAD 2C38B 1R6MA 3GLLA 3GMEA 2PO1B 3H1CA 4AIDA 2WP8A 2NN6B 3B4TA 4IFDA 4IFDF 1OYRA 4OO1A 4BA1B 5C0XF 3CDIA 5JEAE 1UDOA 2BA1D 1UDNA 2JEAA 2BA0D 2PO0A 4BA1A 2JEBA 4OO1B 5JEAC 1UDQA 2JEAB 1R6LA 3DD6A 5K36F 5K36B 5K36D 2WNRA 5JEAA 2PO1A 2NN6E 2C38A 2BR2A 4OO1E 2PNZB 3CDJA 3M85G 2NN6C 2PO2B 4IFDD 1E3HA 3M7ND 4OO1D 1OYPA 4OO1F 2JE6A 2BR2B 3KRNA 2PO2A 2NN6D 3L7ZB 5C0XA 4NBQA 4BA2A 4AIMA 4OO1C 2C37B 5K36C 4IFDC 3L7ZA 5C0XB 2BA1G 4IFDB 1UDSA 5C0XE 2C39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA B;  2PNZ A;  5JEA F;  2BA0 G;  2NN6 F;  4IFD E;  2C37 A;  3U1K A;  2PO0 B;  5C0X C;  4AM3 A;  1OYS A;  3M85 D;  3GCM A;  3HKM A;  2JEB B;  2C39 B;  5K36 E;  3M7N G;  2JE6 B;  2NN6 A;  5C0X D;  1E3P A;  5K36 A;  4BA2 B;  2WP8 B;  2WNR B;  5JEA D;  2C38 B;  1R6M A;  3GLL A;  3GME A;  2PO1 B;  3H1C A;  4AID A;  2WP8 A;  2NN6 B;  3B4T A;  4IFD A;  4IFD F;  1OYR A;  4OO1 A;  4BA1 B;  5C0X F;  3CDI A;  5JEA E;  1UDO A;  2BA1 D;  1UDN A;  2JEA A;  2BA0 D;  2PO0 A;  4BA1 A;  2JEB A;  4OO1 B;  5JEA C;  1UDQ A;  2JEA B;  1R6L A;  3DD6 A;  5K36 F;  5K36 B;  5K36 D;  2WNR A;  5JEA A;  2PO1 A;  2NN6 E;  2C38 A;  2BR2 A;  4OO1 E;  2PNZ B;  3CDJ A;  3M85 G;  2NN6 C;  2PO2 B;  4IFD D;  1E3H A;  3M7N D;  4OO1 D;  1OYP A;  4OO1 F;  2JE6 A;  2BR2 B;  3KRN A;  2PO2 A;  2NN6 D;  3L7Z B;  5C0X A;  4NBQ A;  4BA2 A;  4AIM A;  4OO1 C;  2C37 B;  5K36 C;  4IFD C;  3L7Z A;  5C0X B;  2BA1 G;  4IFD B;  1UDS A;  5C0X E;  2C39 A; 
#chains in the Genus database with same CATH topology
 4DUY I;  1FWL A;  1EA6 A;  2BA0 G;  2NN6 F;  1HR0 I;  1USV A;  2A2D A;  4AQY I;  3Q1Q A;  3J81 C;  1KIJ A;  1A6F A;  4LF9 I;  3T1H E;  4RPF A;  3T1H I;  4MU4 A;  5DNL A;  4DV0 I;  1J5E I;  4JI7 E;  4FW6 A;  1J5E E;  3HUL A;  4QNJ A;  4DR1 I;  3WU3 A;  5C0X D;  4DU7 A;  4BA2 B;  4LF5 E;  2WNR B;  1ZM3 A;  2VQF E;  1R6M A;  1WUU A;  4DUZ I;  5LMN I;  4JI6 E;  4NXN E;  3H1C A;  1ELO A;  2R42 A;  4GKJ I;  2X36 A;  5GMD A;  1ZXN A;  4JI1 I;  4X65 I;  1NHJ A;  2Z5C A;  4OO1 A;  2VES A;  3Q6N A;  4BA1 B;  4YY3 E;  2UUC E;  4DV3 E;  1FJG I;  3CDI A;  4YY3 I;  2UUC I;  4KHP E;  2PNL A;  4X66 I;  1I94 E;  1H7U A;  2UXB I;  4BA1 A;  2LJP A;  2Z5B A;  1Z5A A;  4LOM A;  5DRQ A;  3LPS A;  4GQU A;  2IES A;  3DD6 A;  3PYG A;  3K17 A;  4UT4 A;  1N34 I;  1NHH A;  2X7I A;  1PIE A;  1N32 I;  4DV5 I;  1HNX I;  4X64 E;  2CZ9 A;  4DPU A;  2V8P A;  1IBK I;  2PO1 A;  4MYT A;  2PNZ B;  2ZIT A;  3JAM C;  4X62 I;  3GON A;  5DRO A;  4JG4 A;  4LCG A;  4LF7 I;  1OJ4 A;  4DV1 E;  2J65 A;  1OYP A;  1KTV A;  2CG9 A;  3J80 C;  2BR2 B;  5C0X A;  4NBQ A;  4B3M I;  2HHH I;  4OX9 I;  4MYU A;  1IBL E;  4JI0 E;  1QZR A;  3WU4 A;  4OX9 E;  4FW5 A;  4HYM A;  2C37 B;  1FKA E;  3PS1 A;  3J81 Q;  4JV5 I;  4HY1 A;  4JI2 I;  1FWK A;  4MDT A;  2O3Z A;  4DV2 I;  4JI2 E;  1Z0G A;  1Y4U A;  4IFD B;  1ZM4 A;  2PNZ A;  4GKK I;  4DU8 A;  4DPT A;  4IFD E;  3U1K A;  2PO0 B;  5FLX C;  1UEK A;  5C0X C;  3QT7 A;  3M85 D;  2Q2E B;  1Z0V A;  4DV0 E;  1Y60 A;  4JI7 I;  2JEB B;  4K0K I;  5FWK A;  2VF3 A;  4PRV A;  4IZJ B;  2R3V A;  3PYF A;  2UUB E;  5K36 E;  2UUA I;  3F0N A;  1N33 E;  2J7K A;  5K36 A;  4P52 A;  2VQE I;  2BM1 A;  4FWG A;  5JEA D;  2C38 B;  2ZBK B;  2HK2 A;  4UTG A;  1H7S A;  4IS9 A;  4URL A;  5EL9 A;  4JI1 E;  4XTJ A;  4FWH A;  2O1T A;  3P3C A;  4OKG A;  5A2Q Q;  1RRE A;  4IFD A;  1U2R A;  1Z5C A;  4LFB I;  4JI3 E;  5C0X F;  5JEA E;  4LPF A;  1UDO A;  2BA1 D;  1IBM E;  1I94 I;  1N0V C;  4LFC E;  1HNW E;  2JEA A;  2GO4 A;  3WU5 A;  2UXB E;  5LMN E;  1N36 I;  2V2Q A;  4JYA I;  3NZK A;  4JYA E;  5IT9 Q;  5JEA C;  4IZJ A;  4DR6 I;  2JEA B;  3PRY A;  3B78 A;  3OTO I;  4HAC A;  3OTO E;  2IOP A;  4DV5 E;  4DR7 I;  1IBK E;  2HFS A;  1YH8 A;  4DV3 I;  1FJG E;  2O1V A;  4FW3 A;  4DPW A;  2C38 A;  2BR2 A;  2E5L I;  3M6A A;  2UU9 E;  5DRR A;  3CDJ A;  3M85 G;  3P76 A;  5LL6 R;  1E3H A;  4B3R E;  1PVG A;  4JI5 E;  2CGE A;  1RHY A;  2JE6 A;  2NPF A;  4FW9 A;  1MU5 A;  1HNX E;  5IWA I;  3L7Z B;  2ZM6 E;  2Z5E A;  2HHH E;  4Z7Y A;  4BA2 A;  3B82 A;  2GQ0 A;  4LCH A;  1MX0 A;  4LF8 E;  4OO1 C;  4LF7 E;  5K36 C;  3T1Y E;  3ZKB A;  3PS3 A;  1Y6Z A;  3J7A M;  4WUC A;  1BKN A;  4DR1 E;  1UDS A;  1VI7 A;  4YHH I;  2C37 A;  5ELW A;  1XNQ E;  5LMU I;  2CVE A;  1XMQ I;  2UXD E;  2EFG A;  5LMU E;  4AM3 A;  4MU0 A;  2Z5B B;  1K47 A;  4JI0 I;  3J7A G;  5GME A;  4MU3 A;  3GCM A;  3J80 Q;  4LF4 E;  4FW7 A;  1Y4S A;  1XMO I;  2C39 B;  2UUA E;  3M7N G;  1FI4 A;  1H74 A;  2JE6 B;  2NN6 A;  1FNM A;  1E3P A;  1RR9 A;  4KHP I;  1S4E A;  3P3E A;  2F4V E;  2OI2 A;  4DR2 E;  4PRX A;  2BV3 A;  3GLL A;  1KVK A;  3ZZT A;  1Z0W A;  3JAM Q;  1HR0 E;  2PO1 B;  4LF6 E;  4B3T I;  4LF9 E;  4NXM I;  4AID A;  4J3D A;  1NZ0 A;  1HNZ E;  1EI1 A;  4IFD F;  3V2U C;  4WUD A;  1Z0E A;  3U1Y A;  2VQE E;  4DPY A;  1P42 A;  1UDN A;  3D4J A;  4DV7 I;  2BA0 D;  4IZK B;  2JT2 A;  4USM A;  3P3G A;  1NHI A;  2WW4 A;  3PS2 A;  4N3O A;  4GKJ E;  1UDQ A;  3QT6 A;  4X65 E;  1YHC A;  1ZM2 A;  5K36 F;  5K36 D;  2WNR A;  4LFB E;  5JEA A;  1ZM9 A;  5C0X E;  2HKE A;  4B3M E;  4LFC I;  2NN6 E;  4QNK A;  4U3B A;  1KKH A;  4B3S E;  4OO1 E;  4ED4 A;  1N36 E;  2UXC E;  1Y5Y A;  5DRP A;  4DR4 E;  2PO2 B;  3HJC A;  4EMD A;  4IFD D;  3M7N D;  2HKJ A;  4DV2 E;  1Z0T A;  4DR3 I;  1PKP A;  4KQV A;  2ZM6 I;  2PO2 A;  4I3H A;  2NN6 D;  5BR8 E;  4AQY E;  4FN5 A;  5BR8 I;  2E5L E;  1VIS A;  4P7A A;  4X62 E;  3Q6M A;  2PNM A;  4IZJ D;  5EKW A;  2IOQ A;  4K0K E;  4HXZ A;  5DNX A;  2GS8 A;  3L7Z A;  2E1R A;  1MG7 A;  3PYD A;  4MU1 A;  3K85 A;  2BA1 G;  1ZXM A;  2C39 A;  5JEA B;  4JI8 I;  5FLX Q;  5JEA F;  2VQF I;  4DUZ E;  4JI8 E;  1N0U A;  4NXN I;  4JI6 I;  4LCF A;  5IT9 C;  1OYS A;  4FWD A;  4LF8 I;  1XHK A;  3HKM A;  1XMO E;  1S16 A;  4PU9 A;  4R1F A;  3QT5 A;  3ZZU A;  3LNU A;  2AE8 A;  2V2V A;  2WP8 B;  1HNW I;  2DEJ A;  4LF5 I;  1Z59 A;  5A2Q C;  4LF6 I;  3GME A;  1XNQ I;  2UXD I;  4FW4 A;  2XEX A;  3B8H A;  2WP8 A;  1HNZ I;  2NN6 B;  4IZK A;  3B4T A;  1D6T A;  1N34 E;  4ISA A;  1H73 A;  1OYR A;  1USU A;  2UUB I;  4DR7 E;  1N32 E;  3CWV A;  1N33 I;  2A2C A;  4DR2 I;  2UU9 I;  4X66 E;  2PO0 A;  2V34 A;  4B3T E;  2JEB A;  3LTO A;  4NXM E;  5L3J A;  4DV4 E;  4OO1 B;  2DEI A;  4DPX A;  4DV4 I;  4B3R I;  4JI5 I;  1R6L A;  1Z5B A;  4MQY A;  4DV6 I;  5K36 B;  4DV6 E;  2F1D A;  4USK A;  1Z0B A;  4JI3 I;  5IWA E;  4X64 I;  3ZZ0 A;  1IBM I;  4WUB A;  1DAR A;  1XXE A;  2HK3 A;  4DV7 E;  1IBL I;  2UXC I;  1HK7 A;  2NN6 C;  2IER A;  3K1J A;  2BM0 A;  3T1Y I;  1H72 C;  4JV5 E;  4DR6 E;  3ZKD A;  4U3D A;  3PYE A;  2O1U A;  4OO1 D;  4LFA E;  4OO1 F;  3ZM7 A;  4DV1 I;  4DR3 E;  4LFA I;  2V2Z A;  3KRN A;  3V5R A;  2GO3 A;  3WU6 A;  4YHH E;  2O1W A;  3P06 A;  4GKK E;  4Z7C A;  1XNR E;  1XNR I;  3QT8 A;  1XMQ E;  4B3S I;  4DXL A;  4AIM A;  4ZVI A;  4OZE A;  4DR5 E;  4DR4 I;  4LF4 I;  4JI4 E;  4IFD C;  4DR5 I;  3UHM A;  2AJ4 A;  4JI4 I;  5C0X B;  4M1K A;  4HAC B;  1Z0C A;  1B62 A;  2HFU A;  2Z5C B;  4DUY E;  1B63 A;  2F4V I;  3H4L A; 
#chains in the Genus database with same CATH homology
 5JEA B;  2PNZ A;  5JEA F;  2BA0 G;  2NN6 F;  4IFD E;  2C37 A;  3U1K A;  2PO0 B;  5C0X C;  4AM3 A;  1OYS A;  3M85 D;  3GCM A;  3HKM A;  2JEB B;  2C39 B;  5K36 E;  3M7N G;  2JE6 B;  2NN6 A;  5C0X D;  1E3P A;  5K36 A;  4BA2 B;  2WP8 B;  2WNR B;  5JEA D;  2C38 B;  1R6M A;  3GLL A;  3GME A;  2PO1 B;  3H1C A;  4AID A;  2WP8 A;  2NN6 B;  3B4T A;  4IFD A;  4IFD F;  1OYR A;  4OO1 A;  4BA1 B;  5C0X F;  3CDI A;  5JEA E;  1UDO A;  2BA1 D;  1UDN A;  2JEA A;  2BA0 D;  2PO0 A;  4BA1 A;  2JEB A;  4OO1 B;  5JEA C;  1UDQ A;  2JEA B;  1R6L A;  3DD6 A;  5K36 F;  5K36 B;  5K36 D;  2WNR A;  5JEA A;  2PO1 A;  2NN6 E;  2C38 A;  2BR2 A;  4OO1 E;  2PNZ B;  3CDJ A;  3M85 G;  2NN6 C;  2PO2 B;  4IFD D;  1E3H A;  3M7N D;  4OO1 D;  1OYP A;  4OO1 F;  2JE6 A;  2BR2 B;  3KRN A;  2PO2 A;  2NN6 D;  3L7Z B;  5C0X A;  4NBQ A;  4BA2 A;  4AIM A;  4OO1 C;  2C37 B;  5K36 C;  4IFD C;  3L7Z A;  5C0X B;  2BA1 G;  4IFD B;  1UDS A;  5C0X E;  2C39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...