5K36F

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
215
Chain Sequence
RLLGPAAAKPMAFSNTTTHSEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 51
structure length 215
sequence length 241
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36F00
5JEAC 4BA1A 1UDNA 2C37A 5K36D 4OO1A 2C37B 4OO1B 3M85D 2C39A 5C0XD 4BA2A 2NN6E 2BA1D 2BR2A 4BA2B 3H1CA 3U1KA 2BR2B 3B4TA 2NN6D 2PO1A 2JE6B 2PO2A 4OO1F 1OYSA 2BA0G 3KRNA 1R6LA 5K36E 4IFDC 3L7ZB 2NN6B 4AIDA 2PO0B 5C0XE 5JEAD 1OYPA 3GMEA 3M85G 2BA1G 5K36B 1OYRA 5JEAB 2JE6A 4OO1C 4NBQA 5C0XA 5C0XB 4IFDE 2JEBA 3M7ND 2NN6A 3L7ZA 2JEBB 5K36F 5JEAE 4IFDD 2PO0A 1UDSA 5C0XF 1E3PA 1E3HA 3CDIA 2C38B 2PNZB 4IFDB 2NN6F 5K36A 5JEAA 2BA0D 1UDQA 1UDOA 2JEAB 4OO1D 3DD6A 5K36C 3M7NG 2WP8B 5JEAF 4BA1B 2WNRA 5C0XC 2WNRB 2C38A 3GLLA 2C39B 2PNZA 4IFDA 3HKMA 2NN6C 4AM3A 3CDJA 4OO1E 3GCMA 2PO1B 1R6MA 2PO2B 2JEAA 4AIMA 4IFDF 2WP8A
chains in the Genus database with same CATH superfamily
4M1KA 4GKJE 4LF7I 2C37A 4DV6E 1XNRI 2GQ0A 3M85D 2NN6E 4X66I 4BA2B 1J5EI 1P42A 3P3EA 1Y60A 1KVKA 4P7AA 2JE6B 3WU6A 5IWAI 1ELOA 2HHHI 3WU5A 3KRNA 4B3SE 2LJPA 4DV5E 1XMOE 3LNUA 1N36I 1FJGE 4JYAI 4MDTA 5K36E 3L7ZB 2V8PA 4JI2I 4LCFA 3P3CA 4MYTA 4N3OA 4LF4E 4DV2I 5IT9C 3PYEA 2HKJA 4LPFA 4DR1I 1Z59A 4JG4A 1HNXE 2UUAE 3U1YA 4FN5A 2E1RA 3QT6A 4DR3E 2BA1G 4JI5I 1XNQE 1EI1A 1N32E 4DUZE 1OYRA 2X36A 4LFCI 4OO1C 2BM1A 2CZ9A 4OZEA 4NBQA 5C0XA 2ZM6I 1H7SA 4DR5E 4UTGA 4IFDE 4LCGA 4FW5A 1I94E 3M7ND 2NN6A 4MU1A 4JI8I 4JI3I 4JI0E 2JEBB 5JEAE 4NXNI 2Z5BB 4YY3E 3GONA 3JAMC 4ISAA 1E3PA 2R42A 1MU5A 2IERA 4DV3I 5K36A 4U3DA 1XHKA 3M6AA 2V34A 3HULA 1Z0BA 4B3RI 4OO1D 4KHPE 1NHHA 1YH8A 1QZRA 1RREA 4J3DA 1N0UA 2CVEA 1BKNA 5K36C 1XMQI 4PRVA 1KKHA 2UXCI 4LFAE 4K0KI 4IS9A 2HFSA 2PNLA 4B3ME 4DR7I 4LFBI 4JI4E 2PNZA 4IFDA 1ZM4A 2J7KA 2R3VA 5DNLA 2VQEI 4DV7E 4QNJA 3V2UC 3GCMA 2PO1B 4XTJA 1PIEA 2JEAA 2UXDE 4X64I 2O1WA 2UUBI 5GMDA 4X62E 3OTOI 2HHHE 1DARA 4B3TE 5JEAC 3Q1QA 1UDNA 4FW4A 5K36D 4WUCA 4RPFA 1FNMA 1FWLA 1A6FA 5A2QC 2O1TA 3ZKDA 2C39A 4BA2A 2Z5CB 2E5LE 4DV2E 2BA1D 3H1CA 3U1KA 4DR2E 1N33E 1UEKA 4DV4E 4ZVIA 1IBMI 4OO1F 1N34I 4DUYE 4JI5E 1HR0I 3ZZUA 1KIJA 4LCHA 4JV5I 1MX0A 2IOPA 4I3HA 2ZM6E 4HACA 2ZITA 4KQVA 1RHYA 3PYFA 5C0XE 5JEAD 1Z0CA 2CG9A 4IZJB 4DV1I 4DV0E 3PYGA 4DR6I 1KTVA 1Z0GA 4UT4A 5JEAB 1Z0VA 5LL6R 4LF9E 5LMUE 4OX9E 4MU0A 1IBLI 1HK7A 4FW3A 2JEBA 5EL9A 1FI4A 1NHJA 3T1YE 2UXBI 4DU8A 5K36F 2PO0A 4HYMA 4IZKA 5GMEA 5LMNI 4AQYI 4WUBA 1ZM2A 4HY1A 3B82A 5DNXA 2C38B 1Y4UA 2VF3A 1HNWE 3J80Q 4DPUA 4LF5I 4LOMA 1Z0TA 1H7UA 1Z0EA 2A2CA 3WU4A 5BR8E 2VQFI 2F4VE 4YHHI 4LF8E 2WP8B 1ZXNA 5JEAF 1Z5CA 2UUBE 4DPTA 5C0XC 2WNRB 1S4EA 1IBKI 3ZZTA 2NN6C 2O1VA 1FKAE 2V2VA 4JI6I 4LF6E 3CDJA 1HNZI 4DPXA 4GKJI 4ED4A 4AIMA 4GKKE 4DV6I 2OI2A 3NZKA 1IBME 1N34E 3K85A 4JI1I 2A2DA 3WU3A 4BA1A 2GO3A 3JAMQ 4JV5E 4OO1B 2UUCE 1ZM9A 1H73A 2CGEA 5C0XD 4NXMI 4X65I 2HK2A 4LF7E 4URLA 1XNRE 3K17A 5ELWA 4B3SI 2BR2B 1XMOI 2NN6D 2PO2A 4DR6E 1USUA 1OYSA 4X66E 3K1JA 2VESA 1Y6ZA 4LF4I 1J5EE 1HNXI 2UUAI 4IFDC 2NN6B 2EFGA 1N0VC 5IWAE 1USVA 4DR3I 4IZJA 1XNQI 4Z7CA 1N36E 4JYAE 4DUZI 1OYPA 2BM0A 3D4JA 3GMEA 4JI2E 5FLXQ 4DR5I 1EA6A 2IOQA 3Q6MA 4DR1E 3P3GA 5K36B 1MG7A 2JE6A 3P06A 4JI0I 2XEXA 4OKGA 4FWDA 4YY3I 4MU4A 4LFCE 3L7ZA 2DEJA 2UU9I 3V5RA 1NHIA 4IFDD 1K47A 4PU9A 1FWKA 1U2RA 5A2QQ 5C0XF 4JI7I 4JI8E 4JI3E 2X7IA 3Q6NA 3CDIA 2O3ZA 4NXNE 4DU7A 1D6TA 2Q2EB 2PNZB 4IFDB 1PKPA 2NN6F 3J7AG 3J81Q 2BA0D 1UDQA 3ZZ0A 4DV3E 2JEAB 5EKWA 4MU3A 3DD6A 4B3MI 4MYUA 2IESA 4B3RE 2Z5BA 4FW9A 4JI4I 4DPWA 1Y4SA 5DRPA 5DRRA 2WNRA 4JI1E 3F0NA 4USKA 1XMQE 4DV7I 2NPFA 2UXCE 2C39B 4K0KE 3UHMA 2UXDI 3J80C 3HKMA 3HJCA 1Z5BA 4AM3A 4DR7E 4NXME 4X65E 2HKEA 3QT8A 4LFBE 4X62I 1R6MA 4B3TI 3CWVA 3ZKBA 4DXLA 2VQEE 4PRXA 1B63A 4IFDF 1Z0WA 4X64E 2E5LI 4HACB 3T1HI 4OO1A 1Z5AA 1RR9A 2C37B 5IT9Q 4DR2I 1N33I 5DROA 4DV4I 3OTOE 1VISA 4DUYI 2BR2A 4GQUA 3QT5A 4DR4I 3B4TA 2PO1A 1B62A 1YHCA 2BA0G 4FW7A 5DRQA 3LPSA 2AJ4A 1R6LA 4DPYA 1NZ0A 1H72C 3PS3A 1ZM3A 4DV0I 2GO4A 1ZXMA 4AIDA 1HR0E 2PO0B 4USMA 4Z7YA 4IZKB 2UU9E 4U3BA 2Z5CA 2DEIA 4LF9I 3M85G 4FW6A 5LMUI 2HFUA 4OX9I 4JI7E 3PS2A 3B78A 4DV5I 3T1YI 1FJGI 4DV1E 3B8HA 1H74A 5C0XB 4EMDA 1PVGA 2WW4A 3ZM7A 1IBLE 1HNWI 2PNMA 5FWKA 1UDSA 1E3HA 2UXBE 3PS1A 1N32I 3P76A 5FLXC 2O1UA 5L3JA 2V2ZA 3J7AM 4AQYE 5LMNE 5JEAA 5BR8I 2F4VI 1I94I 1XXEA 2ZBKB 4R1FA 1UDOA 4LF8I 2HK3A 3LTOA 4LF5E 2GS8A 3M7NG 3PYDA 4MQYA 4BA1B 2J65A 2BV3A 2Z5EA 3PRYA 4LF6I 4P52A 4QNKA 2VQFE 4YHHE 3T1HE 2C38A 3GLLA 2AE8A 4FWGA 2V2QA 3J81C 4GKKI 3QT7A 4KHPI 1Y5YA 4OO1E 4FWHA 3H4LA 1OJ4A 2F1DA 1IBKE 1WUUA 2PO2B 1VI7A 4HXZA 1S16A 4IZJD 4LFAI 4JI6E 4DR4E 4WUDA 2JT2A 1HNZE 2UUCI 2WP8A
chains in the Genus database with same CATH topology
5JEAC 4BA1A 1UDNA 2C37A 5K36D 4OO1A 2C37B 4OO1B 3M85D 2C39A 5C0XD 4BA2A 2NN6E 2BA1D 2BR2A 4BA2B 3H1CA 3U1KA 2BR2B 3B4TA 2NN6D 2PO1A 2JE6B 2PO2A 4OO1F 1OYSA 2BA0G 3KRNA 1R6LA 5K36E 4IFDC 3L7ZB 2NN6B 4AIDA 2PO0B 5C0XE 5JEAD 1OYPA 3GMEA 3M85G 2BA1G 5K36B 1OYRA 5JEAB 2JE6A 4OO1C 4NBQA 5C0XA 5C0XB 4IFDE 2JEBA 3M7ND 2NN6A 3L7ZA 2JEBB 5K36F 5JEAE 4IFDD 2PO0A 1UDSA 5C0XF 1E3PA 1E3HA 3CDIA 2C38B 2PNZB 4IFDB 2NN6F 5K36A 5JEAA 2BA0D 1UDQA 1UDOA 2JEAB 4OO1D 3DD6A 5K36C 3M7NG 2WP8B 5JEAF 4BA1B 2WNRA 5C0XC 2WNRB 2C38A 3GLLA 2C39B 2PNZA 4IFDA 3HKMA 2NN6C 4AM3A 3CDJA 4OO1E 3GCMA 2PO1B 1R6MA 2PO2B 2JEAA 4AIMA 4IFDF 2WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA C;  4BA1 A;  1UDN A;  2C37 A;  5K36 D;  4OO1 A;  2C37 B;  4OO1 B;  3M85 D;  2C39 A;  5C0X D;  4BA2 A;  2NN6 E;  2BA1 D;  2BR2 A;  4BA2 B;  3H1C A;  3U1K A;  2BR2 B;  3B4T A;  2NN6 D;  2PO1 A;  2JE6 B;  2PO2 A;  4OO1 F;  1OYS A;  2BA0 G;  3KRN A;  1R6L A;  5K36 E;  4IFD C;  3L7Z B;  2NN6 B;  4AID A;  2PO0 B;  5C0X E;  5JEA D;  1OYP A;  3GME A;  3M85 G;  2BA1 G;  5K36 B;  1OYR A;  5JEA B;  2JE6 A;  4OO1 C;  4NBQ A;  5C0X A;  5C0X B;  4IFD E;  2JEB A;  3M7N D;  2NN6 A;  3L7Z A;  2JEB B;  5K36 F;  5JEA E;  4IFD D;  2PO0 A;  1UDS A;  5C0X F;  1E3P A;  1E3H A;  3CDI A;  2C38 B;  2PNZ B;  4IFD B;  2NN6 F;  5K36 A;  5JEA A;  2BA0 D;  1UDQ A;  1UDO A;  2JEA B;  4OO1 D;  3DD6 A;  5K36 C;  3M7N G;  2WP8 B;  5JEA F;  4BA1 B;  2WNR A;  5C0X C;  2WNR B;  2C38 A;  3GLL A;  2C39 B;  2PNZ A;  4IFD A;  3HKM A;  2NN6 C;  4AM3 A;  3CDJ A;  4OO1 E;  3GCM A;  2PO1 B;  1R6M A;  2PO2 B;  2JEA A;  4AIM A;  4IFD F;  2WP8 A; 
#chains in the Genus database with same CATH topology
 4M1K A;  4GKJ E;  4LF7 I;  2C37 A;  4DV6 E;  1XNR I;  2GQ0 A;  3M85 D;  2NN6 E;  4X66 I;  4BA2 B;  1J5E I;  1P42 A;  3P3E A;  1Y60 A;  1KVK A;  4P7A A;  2JE6 B;  3WU6 A;  5IWA I;  1ELO A;  2HHH I;  3WU5 A;  3KRN A;  4B3S E;  2LJP A;  4DV5 E;  1XMO E;  3LNU A;  1N36 I;  1FJG E;  4JYA I;  4MDT A;  5K36 E;  3L7Z B;  2V8P A;  4JI2 I;  4LCF A;  3P3C A;  4MYT A;  4N3O A;  4LF4 E;  4DV2 I;  5IT9 C;  3PYE A;  2HKJ A;  4LPF A;  4DR1 I;  1Z59 A;  4JG4 A;  1HNX E;  2UUA E;  3U1Y A;  4FN5 A;  2E1R A;  3QT6 A;  4DR3 E;  2BA1 G;  4JI5 I;  1XNQ E;  1EI1 A;  1N32 E;  4DUZ E;  1OYR A;  2X36 A;  4LFC I;  4OO1 C;  2BM1 A;  2CZ9 A;  4OZE A;  4NBQ A;  5C0X A;  2ZM6 I;  1H7S A;  4DR5 E;  4UTG A;  4IFD E;  4LCG A;  4FW5 A;  1I94 E;  3M7N D;  2NN6 A;  4MU1 A;  4JI8 I;  4JI3 I;  4JI0 E;  2JEB B;  5JEA E;  4NXN I;  2Z5B B;  4YY3 E;  3GON A;  3JAM C;  4ISA A;  1E3P A;  2R42 A;  1MU5 A;  2IER A;  4DV3 I;  5K36 A;  4U3D A;  1XHK A;  3M6A A;  2V34 A;  3HUL A;  1Z0B A;  4B3R I;  4OO1 D;  4KHP E;  1NHH A;  1YH8 A;  1QZR A;  1RRE A;  4J3D A;  1N0U A;  2CVE A;  1BKN A;  5K36 C;  1XMQ I;  4PRV A;  1KKH A;  2UXC I;  4LFA E;  4K0K I;  4IS9 A;  2HFS A;  2PNL A;  4B3M E;  4DR7 I;  4LFB I;  4JI4 E;  2PNZ A;  4IFD A;  1ZM4 A;  2J7K A;  2R3V A;  5DNL A;  2VQE I;  4DV7 E;  4QNJ A;  3V2U C;  3GCM A;  2PO1 B;  4XTJ A;  1PIE A;  2JEA A;  2UXD E;  4X64 I;  2O1W A;  2UUB I;  5GMD A;  4X62 E;  3OTO I;  2HHH E;  1DAR A;  4B3T E;  5JEA C;  3Q1Q A;  1UDN A;  4FW4 A;  5K36 D;  4WUC A;  4RPF A;  1FNM A;  1FWL A;  1A6F A;  5A2Q C;  2O1T A;  3ZKD A;  2C39 A;  4BA2 A;  2Z5C B;  2E5L E;  4DV2 E;  2BA1 D;  3H1C A;  3U1K A;  4DR2 E;  1N33 E;  1UEK A;  4DV4 E;  4ZVI A;  1IBM I;  4OO1 F;  1N34 I;  4DUY E;  4JI5 E;  1HR0 I;  3ZZU A;  1KIJ A;  4LCH A;  4JV5 I;  1MX0 A;  2IOP A;  4I3H A;  2ZM6 E;  4HAC A;  2ZIT A;  4KQV A;  1RHY A;  3PYF A;  5C0X E;  5JEA D;  1Z0C A;  2CG9 A;  4IZJ B;  4DV1 I;  4DV0 E;  3PYG A;  4DR6 I;  1KTV A;  1Z0G A;  4UT4 A;  5JEA B;  1Z0V A;  5LL6 R;  4LF9 E;  5LMU E;  4OX9 E;  4MU0 A;  1IBL I;  1HK7 A;  4FW3 A;  2JEB A;  5EL9 A;  1FI4 A;  1NHJ A;  3T1Y E;  2UXB I;  4DU8 A;  5K36 F;  2PO0 A;  4HYM A;  4IZK A;  5GME A;  5LMN I;  4AQY I;  4WUB A;  1ZM2 A;  4HY1 A;  3B82 A;  5DNX A;  2C38 B;  1Y4U A;  2VF3 A;  1HNW E;  3J80 Q;  4DPU A;  4LF5 I;  4LOM A;  1Z0T A;  1H7U A;  1Z0E A;  2A2C A;  3WU4 A;  5BR8 E;  2VQF I;  2F4V E;  4YHH I;  4LF8 E;  2WP8 B;  1ZXN A;  5JEA F;  1Z5C A;  2UUB E;  4DPT A;  5C0X C;  2WNR B;  1S4E A;  1IBK I;  3ZZT A;  2NN6 C;  2O1V A;  1FKA E;  2V2V A;  4JI6 I;  4LF6 E;  3CDJ A;  1HNZ I;  4DPX A;  4GKJ I;  4ED4 A;  4AIM A;  4GKK E;  4DV6 I;  2OI2 A;  3NZK A;  1IBM E;  1N34 E;  3K85 A;  4JI1 I;  2A2D A;  3WU3 A;  4BA1 A;  2GO3 A;  3JAM Q;  4JV5 E;  4OO1 B;  2UUC E;  1ZM9 A;  1H73 A;  2CGE A;  5C0X D;  4NXM I;  4X65 I;  2HK2 A;  4LF7 E;  4URL A;  1XNR E;  3K17 A;  5ELW A;  4B3S I;  2BR2 B;  1XMO I;  2NN6 D;  2PO2 A;  4DR6 E;  1USU A;  1OYS A;  4X66 E;  3K1J A;  2VES A;  1Y6Z A;  4LF4 I;  1J5E E;  1HNX I;  2UUA I;  4IFD C;  2NN6 B;  2EFG A;  1N0V C;  5IWA E;  1USV A;  4DR3 I;  4IZJ A;  1XNQ I;  4Z7C A;  1N36 E;  4JYA E;  4DUZ I;  1OYP A;  2BM0 A;  3D4J A;  3GME A;  4JI2 E;  5FLX Q;  4DR5 I;  1EA6 A;  2IOQ A;  3Q6M A;  4DR1 E;  3P3G A;  5K36 B;  1MG7 A;  2JE6 A;  3P06 A;  4JI0 I;  2XEX A;  4OKG A;  4FWD A;  4YY3 I;  4MU4 A;  4LFC E;  3L7Z A;  2DEJ A;  2UU9 I;  3V5R A;  1NHI A;  4IFD D;  1K47 A;  4PU9 A;  1FWK A;  1U2R A;  5A2Q Q;  5C0X F;  4JI7 I;  4JI8 E;  4JI3 E;  2X7I A;  3Q6N A;  3CDI A;  2O3Z A;  4NXN E;  4DU7 A;  1D6T A;  2Q2E B;  2PNZ B;  4IFD B;  1PKP A;  2NN6 F;  3J7A G;  3J81 Q;  2BA0 D;  1UDQ A;  3ZZ0 A;  4DV3 E;  2JEA B;  5EKW A;  4MU3 A;  3DD6 A;  4B3M I;  4MYU A;  2IES A;  4B3R E;  2Z5B A;  4FW9 A;  4JI4 I;  4DPW A;  1Y4S A;  5DRP A;  5DRR A;  2WNR A;  4JI1 E;  3F0N A;  4USK A;  1XMQ E;  4DV7 I;  2NPF A;  2UXC E;  2C39 B;  4K0K E;  3UHM A;  2UXD I;  3J80 C;  3HKM A;  3HJC A;  1Z5B A;  4AM3 A;  4DR7 E;  4NXM E;  4X65 E;  2HKE A;  3QT8 A;  4LFB E;  4X62 I;  1R6M A;  4B3T I;  3CWV A;  3ZKB A;  4DXL A;  2VQE E;  4PRX A;  1B63 A;  4IFD F;  1Z0W A;  4X64 E;  2E5L I;  4HAC B;  3T1H I;  4OO1 A;  1Z5A A;  1RR9 A;  2C37 B;  5IT9 Q;  4DR2 I;  1N33 I;  5DRO A;  4DV4 I;  3OTO E;  1VIS A;  4DUY I;  2BR2 A;  4GQU A;  3QT5 A;  4DR4 I;  3B4T A;  2PO1 A;  1B62 A;  1YHC A;  2BA0 G;  4FW7 A;  5DRQ A;  3LPS A;  2AJ4 A;  1R6L A;  4DPY A;  1NZ0 A;  1H72 C;  3PS3 A;  1ZM3 A;  4DV0 I;  2GO4 A;  1ZXM A;  4AID A;  1HR0 E;  2PO0 B;  4USM A;  4Z7Y A;  4IZK B;  2UU9 E;  4U3B A;  2Z5C A;  2DEI A;  4LF9 I;  3M85 G;  4FW6 A;  5LMU I;  2HFU A;  4OX9 I;  4JI7 E;  3PS2 A;  3B78 A;  4DV5 I;  3T1Y I;  1FJG I;  4DV1 E;  3B8H A;  1H74 A;  5C0X B;  4EMD A;  1PVG A;  2WW4 A;  3ZM7 A;  1IBL E;  1HNW I;  2PNM A;  5FWK A;  1UDS A;  1E3H A;  2UXB E;  3PS1 A;  1N32 I;  3P76 A;  5FLX C;  2O1U A;  5L3J A;  2V2Z A;  3J7A M;  4AQY E;  5LMN E;  5JEA A;  5BR8 I;  2F4V I;  1I94 I;  1XXE A;  2ZBK B;  4R1F A;  1UDO A;  4LF8 I;  2HK3 A;  3LTO A;  4LF5 E;  2GS8 A;  3M7N G;  3PYD A;  4MQY A;  4BA1 B;  2J65 A;  2BV3 A;  2Z5E A;  3PRY A;  4LF6 I;  4P52 A;  4QNK A;  2VQF E;  4YHH E;  3T1H E;  2C38 A;  3GLL A;  2AE8 A;  4FWG A;  2V2Q A;  3J81 C;  4GKK I;  3QT7 A;  4KHP I;  1Y5Y A;  4OO1 E;  4FWH A;  3H4L A;  1OJ4 A;  2F1D A;  1IBK E;  1WUU A;  2PO2 B;  1VI7 A;  4HXZ A;  1S16 A;  4IZJ D;  4LFA I;  4JI6 E;  4DR4 E;  4WUD A;  2JT2 A;  1HNZ E;  2UUC I;  2WP8 A; 
#chains in the Genus database with same CATH homology
 5JEA C;  4BA1 A;  1UDN A;  2C37 A;  5K36 D;  4OO1 A;  2C37 B;  4OO1 B;  3M85 D;  2C39 A;  5C0X D;  4BA2 A;  2NN6 E;  2BA1 D;  2BR2 A;  4BA2 B;  3H1C A;  3U1K A;  2BR2 B;  3B4T A;  2NN6 D;  2PO1 A;  2JE6 B;  2PO2 A;  4OO1 F;  1OYS A;  2BA0 G;  3KRN A;  1R6L A;  5K36 E;  4IFD C;  3L7Z B;  2NN6 B;  4AID A;  2PO0 B;  5C0X E;  5JEA D;  1OYP A;  3GME A;  3M85 G;  2BA1 G;  5K36 B;  1OYR A;  5JEA B;  2JE6 A;  4OO1 C;  4NBQ A;  5C0X A;  5C0X B;  4IFD E;  2JEB A;  3M7N D;  2NN6 A;  3L7Z A;  2JEB B;  5K36 F;  5JEA E;  4IFD D;  2PO0 A;  1UDS A;  5C0X F;  1E3P A;  1E3H A;  3CDI A;  2C38 B;  2PNZ B;  4IFD B;  2NN6 F;  5K36 A;  5JEA A;  2BA0 D;  1UDQ A;  1UDO A;  2JEA B;  4OO1 D;  3DD6 A;  5K36 C;  3M7N G;  2WP8 B;  5JEA F;  4BA1 B;  2WNR A;  5C0X C;  2WNR B;  2C38 A;  3GLL A;  2C39 B;  2PNZ A;  4IFD A;  3HKM A;  2NN6 C;  4AM3 A;  3CDJ A;  4OO1 E;  3GCM A;  2PO1 B;  1R6M A;  2PO2 B;  2JEA A;  4AIM A;  4IFD F;  2WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...