5K36F

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
215
Chain Sequence
b'RLLGPAAAKPMAFSNTTTHSEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 51
structure length 215
sequence length 241
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36F00
2C39A 3M7NG 2PNZB 2JEAA 3M85D 4IFDB 1R6MA 3KRNA 5JEAA 4OO1E 2C38B 5JEAD 2JEBB 3L7ZB 2BA0G 2BR2A 4IFDC 4BA1A 4BA2B 1UDSA 4IFDA 4OO1A 1OYSA 4OO1D 4IFDF 2BA1G 3GCMA 2WNRB 5C0XB 3GLLA 2PO0B 5K36B 2JE6B 3CDIA 1OYPA 4IFDE 5C0XC 4AIDA 2PO2A 3M85G 2PNZA 2NN6B 5C0XF 2C38A 4IFDD 3GMEA 2JEBA 2NN6C 3L7ZA 1OYRA 2C37B 3H1CA 4BA2A 3HKMA 5C0XE 2WP8B 5K36E 2NN6F 4NBQA 2PO1B 5K36C 2C39B 1UDOA 2JEAB 2WNRA 5C0XA 1E3HA 2PO0A 5K36A 4AIMA 5C0XD 2JE6A 5JEAB 3M7ND 1UDNA 2NN6E 5K36F 1R6LA 2BR2B 5JEAC 1UDQA 4AM3A 4BA1B 2BA0D 2NN6A 4OO1B 2NN6D 3B4TA 5JEAF 4OO1C 2C37A 2BA1D 3CDJA 2WP8A 5K36D 3U1KA 5JEAE 4OO1F 3DD6A 2PO2B 2PO1A 1E3PA
chains in the Genus database with same CATH superfamily
3V5RA 4JI8I 1R6MA 4DR6E 1H7SA 1KTVA 5DRPA 1IBMI 2VQFI 4B3MI 2ZITA 4X65E 4FW3A 3L7ZB 4JI7E 2BA0G 2O1UA 4KHPI 4JV5I 4HYMA 4BA1A 4BA2B 1J5EE 1HNWE 1Y4SA 4DV4E 2UXBE 4B3RI 1QZRA 4MDTA 4OO1D 4K0KE 1H7UA 4FWHA 4IZJB 4MYUA 2HHHE 3K1JA 1XNQI 1Z0CA 3GCMA 2WNRB 4DXLA 1B63A 3GLLA 5DROA 4DV5E 2AE8A 3HULA 1FI4A 4B3SE 4DR2I 3PS1A 4DR4I 3T1YE 4X64I 4JI3E 5LMNE 1U2RA 4PRVA 3P06A 4PRXA 4IFDD 2JEBA 3B8HA 4JI2E 2PNLA 4GKKE 1OYRA 1KKHA 5LMUI 2C37B 3H1CA 2CZ9A 4DV3E 4JG4A 2NPFA 2UXCE 4B3TE 1N32I 2UUBI 3HKMA 4M1KA 3K17A 2VQFE 4JI6E 1Y4UA 3PYEA 4USKA 5K36C 3B82A 3LPSA 1UDOA 4MU3A 5FLXC 3J80Q 4DV2E 5C0XA 4LF6I 5K36A 1N0VC 1HNXI 4B3RE 5IT9Q 1ELOA 4YHHI 1A6FA 4HY1A 4QNJA 4YY3I 2UUAE 1K47A 4LF7E 1RREA 3PYDA 4ZVIA 1UDQA 4BA1B 2VESA 2J7KA 2NN6D 2V2QA 4DR6I 1ZM2A 4URLA 1B62A 2EFGA 4OO1C 1Z0EA 4X65I 2O1TA 4DV6E 4JI7I 4MQYA 4FN5A 1BKNA 1J5EI 1HNWI 4DV4I 2UXBI 3U1KA 4K0KI 1Y6ZA 2BM0A 1DARA 2HHHI 2LJPA 2IOPA 2HK3A 2UUBE 2F4VE 3ZKDA 2CGEA 5A2QC 4DV5I 5JEAD 2JEBB 4OZEA 1ZM3A 2BV3A 1ZXNA 2VF3A 1XNRE 1FWLA 2BR2A 4B3SI 4IFDC 4DR5E 4OX9E 4DV0E 4DPUA 4IFDA 1MG7A 4JYAE 2Q2EB 3T1YI 4JI3I 2UXDE 2O1VA 3JAMQ 1OYSA 1ZM9A 3J80C 5LMNI 1Z5AA 1MX0A 1Y60A 3B78A 4JI2I 5IT9C 4GKKI 5C0XB 5K36B 4DV3I 2UXCI 4XTJA 4B3TI 3QT6A 1WUUA 1OYPA 3V2UC 4JI6I 2X7IA 1H72C 2PNZA 2Z5CA 4DV2I 1Y5YA 2V34A 5C0XF 1USVA 2C38A 4DUYE 2X36A 3GMEA 2NN6C 1H73A 2UUAI 4LF4E 3K85A 4LF7I 1KVKA 4LFAI 4DR1E 4UT4A 4HACA 5C0XE 5K36E 4WUBA 1Z59A 5DRRA 3UHMA 4DUZE 3Q6MA 4MU0A 4IZJD 3ZM7A 4DPTA 4DV6I 1E3HA 1XHKA 2PO0A 2Z5EA 4IZKA 2AJ4A 2JE6A 3M7ND 4LCGA 4JI5I 4LOMA 1Z5CA 2R3VA 1R6LA 2BR2B 4QNKA 3OTOE 5JEAC 3JAMC 1NHHA 4NXNI 1N34E 3P3EA 2F4VI 4U3BA 1N0UA 4LF5E 2OI2A 4UTGA 4JI0E 3CWVA 1XNRI 2GO3A 4DR5I 4OX9I 4DV0I 2V2VA 2BA1D 2WP8A 4LF9E 3GONA 4JYAI 2UXDI 2DEJA 3DD6A 1RR9A 5BR8I 1E3PA 5ELWA 4LFAE 4NXME 2HFUA 2PNZB 2Z5CB 4LFBI 2GO4A 4R1FA 4X62E 3M85D 3KRNA 2C38B 2E5LI 3WU6A 1I94E 2WW4A 4DPWA 1HNZI 1UDSA 1IBLI 4HACB 4OO1A 4JI5E 4AQYE 2O1WA 2HK2A 4I3HA 4DR3E 4LCFA 4DR7E 4DUYI 3QT5A 2UUCE 4LF4I 5DNXA 2GS8A 1NHJA 2IERA 4RPFA 3P3GA 2PO0B 3P3CA 3QT7A 4IZKB 4DR1I 2JE6B 4DU8A 3PYFA 4NXNE 4DU7A 1Z0TA 2VQEE 4FW5A 4GKJE 1XXEA 1VISA 4DUZI 2PO2A 1VI7A 1D6TA 1N36E 1YH8A 4LF8E 1Z5BA 4JI1E 1Z0WA 4HXZA 4JI4E 1S4EA 5DNLA 3ZZUA 5BR8E 2E1RA 4LFBE 3OTOI 3HJCA 3LTOA 1Z0GA 3T1HE 2WP8B 2XEXA 3WU4A 1N34I 3NZKA 2E5LE 2Z5BA 2A2CA 3PS3A 4LF5I 2IESA 2HFSA 2J65A 4JI0I 1RHYA 1HNZE 2V2ZA 1IBLE 4AIMA 2V8PA 5C0XD 1XMOE 5IWAE 1UDNA 4MU1A 4X66I 2IOQA 3PYGA 4LF9I 4FW4A 5K36F 2CVEA 4USMA 4DPXA 2A2DA 1XMQE 4AM3A 3QT8A 2ZBKB 1Z0BA 5GMEA 1IBKE 4NXMI 4LCHA 1NHIA 2BA0D 2NN6A 4FWDA 5FLXQ 4OO1B 4X62I 2DEIA 3Q1QA 1OJ4A 3D4JA 1MU5A 1ZM4A 1HK7A 4DPYA 1I94I 4WUDA 3WU3A 4DV7E 1S16A 2PNMA 3ZZ0A 3ZZTA 3CDJA 5GMDA 1PVGA 4U3DA 4J3DA 4AQYI 4OO1F 4DR3I 2PO2B 4PU9A 4DR7I 1FWKA 2JT2A 4WUCA 2PO1A 2UUCI 2C39A 3M7NG 4LFCE 2JEAA 1N33I 4GQUA 4IFDB 4FW9A 1PIEA 5JEAA 3Q6NA 4OO1E 2VQEI 3U1YA 4GKJI 2CG9A 4FW7A 1HR0E 4EMDA 2ZM6E 1N36I 4DV1E 4LF8I 5LL6R 4X66E 4JI1I 4ED4A 2UU9E 1USUA 2Z5BB 4IFDF 5A2QQ 2HKJA 4JI4I 1ZXMA 2BA1G 1EA6A 2F1DA 1FJGI 2R42A 4JI8E 4FW6A 3CDIA 3T1HI 4P52A 1IBME 3J7AM 4B3ME 5EKWA 4Z7CA 4IFDE 5C0XC 4AIDA 4KHPE 4JV5E 3PS2A 3M85G 3J81Q 2NN6B 4OKGA 1XMOI 5L3JA 5IWAI 1XNQE 5EL9A 3P76A 3L7ZA 1N33E 1XMQI 4BA2A 1P42A 1IBKI 2O3ZA 3J7AG 2NN6F 4NBQA 4DR2E 1KIJA 4IZJA 1PKPA 2PO1B 3WU5A 1YHCA 2C39B 2HKEA 4FWGA 2JEAB 2WNRA 4DR4E 4X64E 4DV7I 1Z0VA 3ZKBA 5JEAB 2NN6E 1FNMA 4P7AA 1EI1A 5LMUE 4IS9A 3M6AA 1FJGE 1N32E 4KQVA 4LFCI 3LNUA 4LPFA 3PRYA 1FKAE 5FWKA 2BM1A 4MYTA 3B4TA 3H4LA 5JEAF 5DRQA 1NZ0A 4MU4A 4LF6E 2C37A 1H74A 3F0NA 1HNXE 1HR0I 2ZM6I 4DV1I 1UEKA 4YHHE 3J81C 4YY3E 5K36D 4N3OA 2GQ0A 5JEAE 2UU9I 4Z7YA 4ISAA
chains in the Genus database with same CATH topology
2C39A 3M7NG 2PNZB 2JEAA 3M85D 4IFDB 1R6MA 3KRNA 5JEAA 4OO1E 2C38B 5JEAD 2JEBB 3L7ZB 2BA0G 2BR2A 4IFDC 4BA1A 4BA2B 1UDSA 4IFDA 4OO1A 1OYSA 4OO1D 4IFDF 2BA1G 3GCMA 2WNRB 5C0XB 3GLLA 2PO0B 5K36B 2JE6B 3CDIA 1OYPA 4IFDE 5C0XC 4AIDA 2PO2A 3M85G 2PNZA 2NN6B 5C0XF 2C38A 4IFDD 3GMEA 2JEBA 2NN6C 3L7ZA 1OYRA 2C37B 3H1CA 4BA2A 3HKMA 5C0XE 2WP8B 5K36E 2NN6F 4NBQA 2PO1B 5K36C 2C39B 1UDOA 2JEAB 2WNRA 5C0XA 1E3HA 2PO0A 5K36A 4AIMA 5C0XD 2JE6A 5JEAB 3M7ND 1UDNA 2NN6E 5K36F 1R6LA 2BR2B 5JEAC 1UDQA 4AM3A 4BA1B 2BA0D 2NN6A 4OO1B 2NN6D 3B4TA 5JEAF 4OO1C 2C37A 2BA1D 3CDJA 2WP8A 5K36D 3U1KA 5JEAE 4OO1F 3DD6A 2PO2B 2PO1A 1E3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C39 A;  3M7N G;  2PNZ B;  2JEA A;  3M85 D;  4IFD B;  1R6M A;  3KRN A;  5JEA A;  4OO1 E;  2C38 B;  5JEA D;  2JEB B;  3L7Z B;  2BA0 G;  2BR2 A;  4IFD C;  4BA1 A;  4BA2 B;  1UDS A;  4IFD A;  4OO1 A;  1OYS A;  4OO1 D;  4IFD F;  2BA1 G;  3GCM A;  2WNR B;  5C0X B;  3GLL A;  2PO0 B;  5K36 B;  2JE6 B;  3CDI A;  1OYP A;  4IFD E;  5C0X C;  4AID A;  2PO2 A;  3M85 G;  2PNZ A;  2NN6 B;  5C0X F;  2C38 A;  4IFD D;  3GME A;  2JEB A;  2NN6 C;  3L7Z A;  1OYR A;  2C37 B;  3H1C A;  4BA2 A;  3HKM A;  5C0X E;  2WP8 B;  5K36 E;  2NN6 F;  4NBQ A;  2PO1 B;  5K36 C;  2C39 B;  1UDO A;  2JEA B;  2WNR A;  5C0X A;  1E3H A;  2PO0 A;  5K36 A;  4AIM A;  5C0X D;  2JE6 A;  5JEA B;  3M7N D;  1UDN A;  2NN6 E;  5K36 F;  1R6L A;  2BR2 B;  5JEA C;  1UDQ A;  4AM3 A;  4BA1 B;  2BA0 D;  2NN6 A;  4OO1 B;  2NN6 D;  3B4T A;  5JEA F;  4OO1 C;  2C37 A;  2BA1 D;  3CDJ A;  2WP8 A;  5K36 D;  3U1K A;  5JEA E;  4OO1 F;  3DD6 A;  2PO2 B;  2PO1 A;  1E3P A; 
#chains in the Genus database with same CATH topology
 3V5R A;  4JI8 I;  1R6M A;  4DR6 E;  1H7S A;  1KTV A;  5DRP A;  1IBM I;  2VQF I;  4B3M I;  2ZIT A;  4X65 E;  4FW3 A;  3L7Z B;  4JI7 E;  2BA0 G;  2O1U A;  4KHP I;  4JV5 I;  4HYM A;  4BA1 A;  4BA2 B;  1J5E E;  1HNW E;  1Y4S A;  4DV4 E;  2UXB E;  4B3R I;  1QZR A;  4MDT A;  4OO1 D;  4K0K E;  1H7U A;  4FWH A;  4IZJ B;  4MYU A;  2HHH E;  3K1J A;  1XNQ I;  1Z0C A;  3GCM A;  2WNR B;  4DXL A;  1B63 A;  3GLL A;  5DRO A;  4DV5 E;  2AE8 A;  3HUL A;  1FI4 A;  4B3S E;  4DR2 I;  3PS1 A;  4DR4 I;  3T1Y E;  4X64 I;  4JI3 E;  5LMN E;  1U2R A;  4PRV A;  3P06 A;  4PRX A;  4IFD D;  2JEB A;  3B8H A;  4JI2 E;  2PNL A;  4GKK E;  1OYR A;  1KKH A;  5LMU I;  2C37 B;  3H1C A;  2CZ9 A;  4DV3 E;  4JG4 A;  2NPF A;  2UXC E;  4B3T E;  1N32 I;  2UUB I;  3HKM A;  4M1K A;  3K17 A;  2VQF E;  4JI6 E;  1Y4U A;  3PYE A;  4USK A;  5K36 C;  3B82 A;  3LPS A;  1UDO A;  4MU3 A;  5FLX C;  3J80 Q;  4DV2 E;  5C0X A;  4LF6 I;  5K36 A;  1N0V C;  1HNX I;  4B3R E;  5IT9 Q;  1ELO A;  4YHH I;  1A6F A;  4HY1 A;  4QNJ A;  4YY3 I;  2UUA E;  1K47 A;  4LF7 E;  1RRE A;  3PYD A;  4ZVI A;  1UDQ A;  4BA1 B;  2VES A;  2J7K A;  2NN6 D;  2V2Q A;  4DR6 I;  1ZM2 A;  4URL A;  1B62 A;  2EFG A;  4OO1 C;  1Z0E A;  4X65 I;  2O1T A;  4DV6 E;  4JI7 I;  4MQY A;  4FN5 A;  1BKN A;  1J5E I;  1HNW I;  4DV4 I;  2UXB I;  3U1K A;  4K0K I;  1Y6Z A;  2BM0 A;  1DAR A;  2HHH I;  2LJP A;  2IOP A;  2HK3 A;  2UUB E;  2F4V E;  3ZKD A;  2CGE A;  5A2Q C;  4DV5 I;  5JEA D;  2JEB B;  4OZE A;  1ZM3 A;  2BV3 A;  1ZXN A;  2VF3 A;  1XNR E;  1FWL A;  2BR2 A;  4B3S I;  4IFD C;  4DR5 E;  4OX9 E;  4DV0 E;  4DPU A;  4IFD A;  1MG7 A;  4JYA E;  2Q2E B;  3T1Y I;  4JI3 I;  2UXD E;  2O1V A;  3JAM Q;  1OYS A;  1ZM9 A;  3J80 C;  5LMN I;  1Z5A A;  1MX0 A;  1Y60 A;  3B78 A;  4JI2 I;  5IT9 C;  4GKK I;  5C0X B;  5K36 B;  4DV3 I;  2UXC I;  4XTJ A;  4B3T I;  3QT6 A;  1WUU A;  1OYP A;  3V2U C;  4JI6 I;  2X7I A;  1H72 C;  2PNZ A;  2Z5C A;  4DV2 I;  1Y5Y A;  2V34 A;  5C0X F;  1USV A;  2C38 A;  4DUY E;  2X36 A;  3GME A;  2NN6 C;  1H73 A;  2UUA I;  4LF4 E;  3K85 A;  4LF7 I;  1KVK A;  4LFA I;  4DR1 E;  4UT4 A;  4HAC A;  5C0X E;  5K36 E;  4WUB A;  1Z59 A;  5DRR A;  3UHM A;  4DUZ E;  3Q6M A;  4MU0 A;  4IZJ D;  3ZM7 A;  4DPT A;  4DV6 I;  1E3H A;  1XHK A;  2PO0 A;  2Z5E A;  4IZK A;  2AJ4 A;  2JE6 A;  3M7N D;  4LCG A;  4JI5 I;  4LOM A;  1Z5C A;  2R3V A;  1R6L A;  2BR2 B;  4QNK A;  3OTO E;  5JEA C;  3JAM C;  1NHH A;  4NXN I;  1N34 E;  3P3E A;  2F4V I;  4U3B A;  1N0U A;  4LF5 E;  2OI2 A;  4UTG A;  4JI0 E;  3CWV A;  1XNR I;  2GO3 A;  4DR5 I;  4OX9 I;  4DV0 I;  2V2V A;  2BA1 D;  2WP8 A;  4LF9 E;  3GON A;  4JYA I;  2UXD I;  2DEJ A;  3DD6 A;  1RR9 A;  5BR8 I;  1E3P A;  5ELW A;  4LFA E;  4NXM E;  2HFU A;  2PNZ B;  2Z5C B;  4LFB I;  2GO4 A;  4R1F A;  4X62 E;  3M85 D;  3KRN A;  2C38 B;  2E5L I;  3WU6 A;  1I94 E;  2WW4 A;  4DPW A;  1HNZ I;  1UDS A;  1IBL I;  4HAC B;  4OO1 A;  4JI5 E;  4AQY E;  2O1W A;  2HK2 A;  4I3H A;  4DR3 E;  4LCF A;  4DR7 E;  4DUY I;  3QT5 A;  2UUC E;  4LF4 I;  5DNX A;  2GS8 A;  1NHJ A;  2IER A;  4RPF A;  3P3G A;  2PO0 B;  3P3C A;  3QT7 A;  4IZK B;  4DR1 I;  2JE6 B;  4DU8 A;  3PYF A;  4NXN E;  4DU7 A;  1Z0T A;  2VQE E;  4FW5 A;  4GKJ E;  1XXE A;  1VIS A;  4DUZ I;  2PO2 A;  1VI7 A;  1D6T A;  1N36 E;  1YH8 A;  4LF8 E;  1Z5B A;  4JI1 E;  1Z0W A;  4HXZ A;  4JI4 E;  1S4E A;  5DNL A;  3ZZU A;  5BR8 E;  2E1R A;  4LFB E;  3OTO I;  3HJC A;  3LTO A;  1Z0G A;  3T1H E;  2WP8 B;  2XEX A;  3WU4 A;  1N34 I;  3NZK A;  2E5L E;  2Z5B A;  2A2C A;  3PS3 A;  4LF5 I;  2IES A;  2HFS A;  2J65 A;  4JI0 I;  1RHY A;  1HNZ E;  2V2Z A;  1IBL E;  4AIM A;  2V8P A;  5C0X D;  1XMO E;  5IWA E;  1UDN A;  4MU1 A;  4X66 I;  2IOQ A;  3PYG A;  4LF9 I;  4FW4 A;  5K36 F;  2CVE A;  4USM A;  4DPX A;  2A2D A;  1XMQ E;  4AM3 A;  3QT8 A;  2ZBK B;  1Z0B A;  5GME A;  1IBK E;  4NXM I;  4LCH A;  1NHI A;  2BA0 D;  2NN6 A;  4FWD A;  5FLX Q;  4OO1 B;  4X62 I;  2DEI A;  3Q1Q A;  1OJ4 A;  3D4J A;  1MU5 A;  1ZM4 A;  1HK7 A;  4DPY A;  1I94 I;  4WUD A;  3WU3 A;  4DV7 E;  1S16 A;  2PNM A;  3ZZ0 A;  3ZZT A;  3CDJ A;  5GMD A;  1PVG A;  4U3D A;  4J3D A;  4AQY I;  4OO1 F;  4DR3 I;  2PO2 B;  4PU9 A;  4DR7 I;  1FWK A;  2JT2 A;  4WUC A;  2PO1 A;  2UUC I;  2C39 A;  3M7N G;  4LFC E;  2JEA A;  1N33 I;  4GQU A;  4IFD B;  4FW9 A;  1PIE A;  5JEA A;  3Q6N A;  4OO1 E;  2VQE I;  3U1Y A;  4GKJ I;  2CG9 A;  4FW7 A;  1HR0 E;  4EMD A;  2ZM6 E;  1N36 I;  4DV1 E;  4LF8 I;  5LL6 R;  4X66 E;  4JI1 I;  4ED4 A;  2UU9 E;  1USU A;  2Z5B B;  4IFD F;  5A2Q Q;  2HKJ A;  4JI4 I;  1ZXM A;  2BA1 G;  1EA6 A;  2F1D A;  1FJG I;  2R42 A;  4JI8 E;  4FW6 A;  3CDI A;  3T1H I;  4P52 A;  1IBM E;  3J7A M;  4B3M E;  5EKW A;  4Z7C A;  4IFD E;  5C0X C;  4AID A;  4KHP E;  4JV5 E;  3PS2 A;  3M85 G;  3J81 Q;  2NN6 B;  4OKG A;  1XMO I;  5L3J A;  5IWA I;  1XNQ E;  5EL9 A;  3P76 A;  3L7Z A;  1N33 E;  1XMQ I;  4BA2 A;  1P42 A;  1IBK I;  2O3Z A;  3J7A G;  2NN6 F;  4NBQ A;  4DR2 E;  1KIJ A;  4IZJ A;  1PKP A;  2PO1 B;  3WU5 A;  1YHC A;  2C39 B;  2HKE A;  4FWG A;  2JEA B;  2WNR A;  4DR4 E;  4X64 E;  4DV7 I;  1Z0V A;  3ZKB A;  5JEA B;  2NN6 E;  1FNM A;  4P7A A;  1EI1 A;  5LMU E;  4IS9 A;  3M6A A;  1FJG E;  1N32 E;  4KQV A;  4LFC I;  3LNU A;  4LPF A;  3PRY A;  1FKA E;  5FWK A;  2BM1 A;  4MYT A;  3B4T A;  3H4L A;  5JEA F;  5DRQ A;  1NZ0 A;  4MU4 A;  4LF6 E;  2C37 A;  1H74 A;  3F0N A;  1HNX E;  1HR0 I;  2ZM6 I;  4DV1 I;  1UEK A;  4YHH E;  3J81 C;  4YY3 E;  5K36 D;  4N3O A;  2GQ0 A;  5JEA E;  2UU9 I;  4Z7Y A;  4ISA A; 
#chains in the Genus database with same CATH homology
 2C39 A;  3M7N G;  2PNZ B;  2JEA A;  3M85 D;  4IFD B;  1R6M A;  3KRN A;  5JEA A;  4OO1 E;  2C38 B;  5JEA D;  2JEB B;  3L7Z B;  2BA0 G;  2BR2 A;  4IFD C;  4BA1 A;  4BA2 B;  1UDS A;  4IFD A;  4OO1 A;  1OYS A;  4OO1 D;  4IFD F;  2BA1 G;  3GCM A;  2WNR B;  5C0X B;  3GLL A;  2PO0 B;  5K36 B;  2JE6 B;  3CDI A;  1OYP A;  4IFD E;  5C0X C;  4AID A;  2PO2 A;  3M85 G;  2PNZ A;  2NN6 B;  5C0X F;  2C38 A;  4IFD D;  3GME A;  2JEB A;  2NN6 C;  3L7Z A;  1OYR A;  2C37 B;  3H1C A;  4BA2 A;  3HKM A;  5C0X E;  2WP8 B;  5K36 E;  2NN6 F;  4NBQ A;  2PO1 B;  5K36 C;  2C39 B;  1UDO A;  2JEA B;  2WNR A;  5C0X A;  1E3H A;  2PO0 A;  5K36 A;  4AIM A;  5C0X D;  2JE6 A;  5JEA B;  3M7N D;  1UDN A;  2NN6 E;  5K36 F;  1R6L A;  2BR2 B;  5JEA C;  1UDQ A;  4AM3 A;  4BA1 B;  2BA0 D;  2NN6 A;  4OO1 B;  2NN6 D;  3B4T A;  5JEA F;  4OO1 C;  2C37 A;  2BA1 D;  3CDJ A;  2WP8 A;  5K36 D;  3U1K A;  5JEA E;  4OO1 F;  3DD6 A;  2PO2 B;  2PO1 A;  1E3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...