5K36F

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
215
Chain Sequence
RLLGPAAAKPMAFSNTTTHSEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 51
structure length 215
sequence length 241
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5k36F00
3B4TA 5JEAE 1E3HA 5K36F 4BA1A 2BR2B 5K36C 5C0XD 5JEAA 2C38B 3M85G 2PO1B 5K36B 2WNRB 4IFDC 2BR2A 1UDNA 4OO1F 2JEBB 4OO1C 1UDQA 3L7ZB 1OYRA 2NN6F 3GMEA 4IFDB 2BA0G 2PO1A 5K36A 1R6MA 1E3PA 2WNRA 4IFDE 4OO1B 4AIDA 5JEAD 2JEBA 3DD6A 1R6LA 5C0XF 3L7ZA 4BA2B 3M85D 4IFDA 2C37B 4OO1A 5K36E 3M7NG 4NBQA 5K36D 3GLLA 2JEAB 4BA2A 2PNZB 1OYPA 2C38A 2C37A 2BA1G 2NN6C 3GCMA 2WP8B 2JE6B 2PO0B 1OYSA 3CDIA 5JEAF 4IFDD 4OO1E 2JEAA 2NN6B 5C0XC 2PNZA 4OO1D 2PO2B 2NN6E 2WP8A 2JE6A 2PO0A 3M7ND 5JEAB 5C0XB 3H1CA 2NN6A 2BA1D 2BA0D 5C0XE 2PO2A 1UDOA 4AIMA 2C39B 5C0XA 5JEAC 4IFDF 4AM3A 3KRNA 4BA1B 3U1KA 1UDSA 3HKMA 3CDJA 2C39A 2NN6D
chains in the Genus database with same CATH superfamily
3F0NA 1EI1A 5K36F 4BA1A 1XMQE 4UTGA 3M6AA 4JYAE 4KHPI 3PYGA 4MYTA 4KHPE 3M85G 4GKJI 4GKJE 2BR2A 2ZITA 1UDNA 4GKKI 4JV5I 2UUCE 1HR0I 2UU9I 2PNMA 1H7UA 1HR0E 2UU9E 2AE8A 2O1VA 2Z5BB 3GMEA 4I3HA 4IFDB 3JAMC 1Z5CA 2BA0G 1HNWE 4RPFA 1U2RA 4OO1B 5JEAD 1BKNA 2JEBA 4B3ME 3ZM7A 4LFAI 1R6LA 4FWGA 2F1DA 1H7SA 3M85D 2J7KA 2C37B 4OZEA 3QT5A 1MU5A 4JI3I 4HY1A 1FJGI 3B8HA 3GONA 3LPSA 1OYPA 4HACB 4PU9A 2UUBI 4DR2I 4JI6E 4U3DA 4JI2I 1OYSA 4JI2E 5JEAF 4IFDD 3HJCA 3WU5A 4AQYI 5DNLA 4AQYE 4LOMA 4OO1D 4P7AA 3H4LA 2NN6E 4LFBI 2WP8A 4LFBE 1ZM2A 2F4VI 2F4VE 2Z5CB 3P3CA 4B3RI 4DV0I 1NHJA 5C0XE 4DV6I 1NHHA 1OJ4A 4DUYI 1YHCA 4R1FA 4DUYE 4DPWA 4DV5E 4FWHA 4IFDF 2CZ9A 3KRNA 1PKPA 2UXDI 4BA1B 2UXDE 4FW3A 4IZJA 3J81Q 2GQ0A 3K85A 3B82A 4JI8E 1E3HA 4FW4A 4UT4A 5DROA 4YY3E 2BR2B 5K36C 2E1RA 1Z0CA 4DR6I 3K17A 2CGEA 2UXBI 4DPTA 1KIJA 5IWAE 4OX9E 1FNMA 1Z0BA 4MU1A 4LF9I 5IT9C 1ELOA 2O1UA 4LF9E 1RREA 4JI0I 4DR7E 5EL9A 4N3OA 4JI0E 4DV1E 2JEBB 4JI7I 4JI7E 4DU7A 1HNXI 4X64I 1OYRA 3Q1QA 1MX0A 5K36A 1N33E 3P06A 4FN5A 4OKGA 4X66I 1H72C 1XMQI 4X66E 2Q2EB 4DPYA 2VESA 3L7ZA 4JYAI 1A6FA 4YHHE 5IT9Q 1K47A 4GQUA 4DR3I 4DR3E 5K36E 1WUUA 3U1YA 2UUCI 1XMOI 1XMOE 2UXCE 1KVKA 1S16A 4NBQA 3V2UC 2ZM6I 3HULA 2ZM6E 5LL6R 2BM0A 1XNQI 1XNQE 4FW6A 2NN6C 1HNWI 1KTVA 2CG9A 2ZBKB 2HFUA 4MU3A 2WP8B 1J5EI 4JI1I 1J5EE 4JI1E 4B3MI 4LF6I 4LF6E 3K1JA 1PVGA 4B3TI 4B3TE 5C0XC 2PNZA 4DU8A 3UHMA 3PS1A 2JE6A 2IOQA 3PYDA 3T1HI 4MU4A 3T1HE 5GMDA 4XTJA 2E5LE 2NN6A 2BA0D 2PO2A 1FWKA 4IZJB 4PRVA 2OI2A 4JI6I 2IERA 1Y4UA 5C0XA 3PYFA 1RR9A 1RHYA 1ZM4A 5DNXA 2IESA 4AM3A 1XXEA 2LJPA 3J7AG 4WUCA 2R3VA 4DR5I 1ZM9A 4DR5E 2O3ZA 4JG4A 3J81C 4U3BA 4NXNI 3WU3A 4X62E 4NXNE 4LCGA 2V34A 3B4TA 1Z59A 5JEAE 2JT2A 5GMEA 4DV5I 2J65A 4QNJA 1USVA 1Y5YA 2C38B 4IZJD 3WU4A 5K36B 2O1TA 1NHIA 3OTOI 3OTOE 4IZKA 4OO1F 3P3GA 1PIEA 4B3SE 1UDQA 3D4JA 2VF3A 3L7ZB 4MQYA 4LFCE 1N32I 1N32E 4JI8I 1YH8A 2PO1A 1E3PA 2CVEA 2WNRA 4MDTA 3CWVA 3LTOA 4YY3I 4IFDE 4USKA 4AIDA 1FKAE 3DD6A 5DRPA 4NXMI 3PS3A 2V2ZA 1N34E 4NXME 4JI5I 4JI5E 2X7IA 3P3EA 4URLA 2HKEA 2UUAE 2V2QA 5IWAI 5DRRA 4Z7CA 4OX9I 5A2QC 5FLXQ 2V2VA 4DR7I 4LF5I 4DV1I 4LF5E 3ZZ0A 5FWKA 1Z0VA 4J3DA 3QT6A 4DUZI 2A2CA 1B62A 3GLLA 4DUZE 4BA2A 5K36D 2PNZB 2C38A 2BA1G 1N33I 4LCFA 4ED4A 2JE6B 3CDIA 2VQEI 1UEKA 2VQEE 4QNKA 2O1WA 1NZ0A 5BR8I 2HFSA 5BR8E 2JEAA 3PS2A 2IOPA 4JI4E 2NN6B 5A2QQ 3QT8A 3Q6NA 4DV3I 4YHHI 4DV3E 2PO2B 1XHKA 2PO0A 1DARA 5JEAB 4DV7E 3B78A 2DEJA 1ZXNA 1Y6ZA 5C0XB 2UXCI 4P52A 4X65I 4X65E 1VI7A 2BA1D 4FW5A 4HYMA 4MYUA 4PRXA 2BV3A 1UDOA 4LCHA 2HK3A 4ZVIA 1Y4SA 1N0VC 5JEAC 1Z0EA 2HKJA 3U1KA 3PRYA 2XEXA 3T1YI 4GKKE 4JV5E 3T1YE 3J80C 1Z0WA 3V5RA 2C39A 4LPFA 2NN6D 1XNRI 1XNRE 5L3JA 2E5LI 2VQFI 1HK7A 2VQFE 1N0UA 4IZKB 4DV2I 4DV2E 5C0XD 4LFAE 4DPXA 5JEAA 4HXZA 4LF4I 4LF4E 1H73A 4DV4I 2HK2A 4JI3E 4DV4E 1USUA 2PO1B 3PYEA 2WNRB 1B63A 4IFDC 1ZXMA 3J80Q 3LNUA 4OO1C 4WUBA 3P76A 1FJGE 3JAMQ 2WW4A 4X62I 2NN6F 1IBMI 1IBME 1IBLI 1IBKI 1IBLE 1IBKE 4M1KA 2UUBE 1R6MA 5LMNI 4DR2E 5LMNE 1Z5AA 4Z7YA 3ZKBA 1Z0GA 4LF7I 2EFGA 4LF7E 1FI4A 3QT7A 3ZKDA 5C0XF 4BA2B 2Z5BA 4IFDA 2BM1A 4KQVA 3ZZUA 1KKHA 1H74A 5FLXC 4OO1A 1D6TA 4B3SI 2GS8A 4B3RE 3M7NG 4WUDA 2AJ4A 2GO4A 1N36I 1Y60A 4DV0E 1N36E 2JEAB 4LFCI 2C37A 4DV6E 1S4EA 4FW7A 3GCMA 1P42A 4FWDA 1I94I 1I94E 2PO0B 1N34I 4IS9A 4OO1E 1ZM3A 3ZZTA 2UUAI 3J7AM 4HACA 1VISA 1MG7A 4DXLA 2NPFA 1HNZI 3NZKA 1HNZE 2HHHI 2HHHE 3WU6A 3M7ND 5EKWA 2GO3A 2DEIA 4DR4I 4DR4E 3H1CA 5ELWA 2A2DA 2V8PA 2R42A 2PNLA 1FWLA 4FW9A 4AIMA 2C39B 4DPUA 4DR6E 4K0KI 2X36A 4K0KE 4EMDA 2Z5CA 4USMA 2UXBE 4JI4I 5LMUI 5LMUE 4DR1I 1Z5BA 4DR1E 1UDSA 3HKMA 4ISAA 5DRQA 3CDJA 1Z0TA 2Z5EA 1HNXE 4LF8I 1QZRA 3Q6MA 4X64E 4DV7I 4LF8E 4MU0A 1EA6A
chains in the Genus database with same CATH topology
3B4TA 5JEAE 1E3HA 5K36F 4BA1A 2BR2B 5K36C 5C0XD 5JEAA 2C38B 3M85G 2PO1B 5K36B 2WNRB 4IFDC 2BR2A 1UDNA 4OO1F 2JEBB 4OO1C 1UDQA 3L7ZB 1OYRA 2NN6F 3GMEA 4IFDB 2BA0G 2PO1A 5K36A 1R6MA 1E3PA 2WNRA 4IFDE 4OO1B 4AIDA 5JEAD 2JEBA 3DD6A 1R6LA 5C0XF 3L7ZA 4BA2B 3M85D 4IFDA 2C37B 4OO1A 5K36E 3M7NG 4NBQA 5K36D 3GLLA 2JEAB 4BA2A 2PNZB 1OYPA 2C38A 2C37A 2BA1G 2NN6C 3GCMA 2WP8B 2JE6B 2PO0B 1OYSA 3CDIA 5JEAF 4IFDD 4OO1E 2JEAA 2NN6B 5C0XC 2PNZA 4OO1D 2PO2B 2NN6E 2WP8A 2JE6A 2PO0A 3M7ND 5JEAB 5C0XB 3H1CA 2NN6A 2BA1D 2BA0D 5C0XE 2PO2A 1UDOA 4AIMA 2C39B 5C0XA 5JEAC 4IFDF 4AM3A 3KRNA 4BA1B 3U1KA 1UDSA 3HKMA 3CDJA 2C39A 2NN6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4T A;  5JEA E;  1E3H A;  5K36 F;  4BA1 A;  2BR2 B;  5K36 C;  5C0X D;  5JEA A;  2C38 B;  3M85 G;  2PO1 B;  5K36 B;  2WNR B;  4IFD C;  2BR2 A;  1UDN A;  4OO1 F;  2JEB B;  4OO1 C;  1UDQ A;  3L7Z B;  1OYR A;  2NN6 F;  3GME A;  4IFD B;  2BA0 G;  2PO1 A;  5K36 A;  1R6M A;  1E3P A;  2WNR A;  4IFD E;  4OO1 B;  4AID A;  5JEA D;  2JEB A;  3DD6 A;  1R6L A;  5C0X F;  3L7Z A;  4BA2 B;  3M85 D;  4IFD A;  2C37 B;  4OO1 A;  5K36 E;  3M7N G;  4NBQ A;  5K36 D;  3GLL A;  2JEA B;  4BA2 A;  2PNZ B;  1OYP A;  2C38 A;  2C37 A;  2BA1 G;  2NN6 C;  3GCM A;  2WP8 B;  2JE6 B;  2PO0 B;  1OYS A;  3CDI A;  5JEA F;  4IFD D;  4OO1 E;  2JEA A;  2NN6 B;  5C0X C;  2PNZ A;  4OO1 D;  2PO2 B;  2NN6 E;  2WP8 A;  2JE6 A;  2PO0 A;  3M7N D;  5JEA B;  5C0X B;  3H1C A;  2NN6 A;  2BA1 D;  2BA0 D;  5C0X E;  2PO2 A;  1UDO A;  4AIM A;  2C39 B;  5C0X A;  5JEA C;  4IFD F;  4AM3 A;  3KRN A;  4BA1 B;  3U1K A;  1UDS A;  3HKM A;  3CDJ A;  2C39 A;  2NN6 D; 
#chains in the Genus database with same CATH topology
 3F0N A;  1EI1 A;  5K36 F;  4BA1 A;  1XMQ E;  4UTG A;  3M6A A;  4JYA E;  4KHP I;  3PYG A;  4MYT A;  4KHP E;  3M85 G;  4GKJ I;  4GKJ E;  2BR2 A;  2ZIT A;  1UDN A;  4GKK I;  4JV5 I;  2UUC E;  1HR0 I;  2UU9 I;  2PNM A;  1H7U A;  1HR0 E;  2UU9 E;  2AE8 A;  2O1V A;  2Z5B B;  3GME A;  4I3H A;  4IFD B;  3JAM C;  1Z5C A;  2BA0 G;  1HNW E;  4RPF A;  1U2R A;  4OO1 B;  5JEA D;  1BKN A;  2JEB A;  4B3M E;  3ZM7 A;  4LFA I;  1R6L A;  4FWG A;  2F1D A;  1H7S A;  3M85 D;  2J7K A;  2C37 B;  4OZE A;  3QT5 A;  1MU5 A;  4JI3 I;  4HY1 A;  1FJG I;  3B8H A;  3GON A;  3LPS A;  1OYP A;  4HAC B;  4PU9 A;  2UUB I;  4DR2 I;  4JI6 E;  4U3D A;  4JI2 I;  1OYS A;  4JI2 E;  5JEA F;  4IFD D;  3HJC A;  3WU5 A;  4AQY I;  5DNL A;  4AQY E;  4LOM A;  4OO1 D;  4P7A A;  3H4L A;  2NN6 E;  4LFB I;  2WP8 A;  4LFB E;  1ZM2 A;  2F4V I;  2F4V E;  2Z5C B;  3P3C A;  4B3R I;  4DV0 I;  1NHJ A;  5C0X E;  4DV6 I;  1NHH A;  1OJ4 A;  4DUY I;  1YHC A;  4R1F A;  4DUY E;  4DPW A;  4DV5 E;  4FWH A;  4IFD F;  2CZ9 A;  3KRN A;  1PKP A;  2UXD I;  4BA1 B;  2UXD E;  4FW3 A;  4IZJ A;  3J81 Q;  2GQ0 A;  3K85 A;  3B82 A;  4JI8 E;  1E3H A;  4FW4 A;  4UT4 A;  5DRO A;  4YY3 E;  2BR2 B;  5K36 C;  2E1R A;  1Z0C A;  4DR6 I;  3K17 A;  2CGE A;  2UXB I;  4DPT A;  1KIJ A;  5IWA E;  4OX9 E;  1FNM A;  1Z0B A;  4MU1 A;  4LF9 I;  5IT9 C;  1ELO A;  2O1U A;  4LF9 E;  1RRE A;  4JI0 I;  4DR7 E;  5EL9 A;  4N3O A;  4JI0 E;  4DV1 E;  2JEB B;  4JI7 I;  4JI7 E;  4DU7 A;  1HNX I;  4X64 I;  1OYR A;  3Q1Q A;  1MX0 A;  5K36 A;  1N33 E;  3P06 A;  4FN5 A;  4OKG A;  4X66 I;  1H72 C;  1XMQ I;  4X66 E;  2Q2E B;  4DPY A;  2VES A;  3L7Z A;  4JYA I;  1A6F A;  4YHH E;  5IT9 Q;  1K47 A;  4GQU A;  4DR3 I;  4DR3 E;  5K36 E;  1WUU A;  3U1Y A;  2UUC I;  1XMO I;  1XMO E;  2UXC E;  1KVK A;  1S16 A;  4NBQ A;  3V2U C;  2ZM6 I;  3HUL A;  2ZM6 E;  5LL6 R;  2BM0 A;  1XNQ I;  1XNQ E;  4FW6 A;  2NN6 C;  1HNW I;  1KTV A;  2CG9 A;  2ZBK B;  2HFU A;  4MU3 A;  2WP8 B;  1J5E I;  4JI1 I;  1J5E E;  4JI1 E;  4B3M I;  4LF6 I;  4LF6 E;  3K1J A;  1PVG A;  4B3T I;  4B3T E;  5C0X C;  2PNZ A;  4DU8 A;  3UHM A;  3PS1 A;  2JE6 A;  2IOQ A;  3PYD A;  3T1H I;  4MU4 A;  3T1H E;  5GMD A;  4XTJ A;  2E5L E;  2NN6 A;  2BA0 D;  2PO2 A;  1FWK A;  4IZJ B;  4PRV A;  2OI2 A;  4JI6 I;  2IER A;  1Y4U A;  5C0X A;  3PYF A;  1RR9 A;  1RHY A;  1ZM4 A;  5DNX A;  2IES A;  4AM3 A;  1XXE A;  2LJP A;  3J7A G;  4WUC A;  2R3V A;  4DR5 I;  1ZM9 A;  4DR5 E;  2O3Z A;  4JG4 A;  3J81 C;  4U3B A;  4NXN I;  3WU3 A;  4X62 E;  4NXN E;  4LCG A;  2V34 A;  3B4T A;  1Z59 A;  5JEA E;  2JT2 A;  5GME A;  4DV5 I;  2J65 A;  4QNJ A;  1USV A;  1Y5Y A;  2C38 B;  4IZJ D;  3WU4 A;  5K36 B;  2O1T A;  1NHI A;  3OTO I;  3OTO E;  4IZK A;  4OO1 F;  3P3G A;  1PIE A;  4B3S E;  1UDQ A;  3D4J A;  2VF3 A;  3L7Z B;  4MQY A;  4LFC E;  1N32 I;  1N32 E;  4JI8 I;  1YH8 A;  2PO1 A;  1E3P A;  2CVE A;  2WNR A;  4MDT A;  3CWV A;  3LTO A;  4YY3 I;  4IFD E;  4USK A;  4AID A;  1FKA E;  3DD6 A;  5DRP A;  4NXM I;  3PS3 A;  2V2Z A;  1N34 E;  4NXM E;  4JI5 I;  4JI5 E;  2X7I A;  3P3E A;  4URL A;  2HKE A;  2UUA E;  2V2Q A;  5IWA I;  5DRR A;  4Z7C A;  4OX9 I;  5A2Q C;  5FLX Q;  2V2V A;  4DR7 I;  4LF5 I;  4DV1 I;  4LF5 E;  3ZZ0 A;  5FWK A;  1Z0V A;  4J3D A;  3QT6 A;  4DUZ I;  2A2C A;  1B62 A;  3GLL A;  4DUZ E;  4BA2 A;  5K36 D;  2PNZ B;  2C38 A;  2BA1 G;  1N33 I;  4LCF A;  4ED4 A;  2JE6 B;  3CDI A;  2VQE I;  1UEK A;  2VQE E;  4QNK A;  2O1W A;  1NZ0 A;  5BR8 I;  2HFS A;  5BR8 E;  2JEA A;  3PS2 A;  2IOP A;  4JI4 E;  2NN6 B;  5A2Q Q;  3QT8 A;  3Q6N A;  4DV3 I;  4YHH I;  4DV3 E;  2PO2 B;  1XHK A;  2PO0 A;  1DAR A;  5JEA B;  4DV7 E;  3B78 A;  2DEJ A;  1ZXN A;  1Y6Z A;  5C0X B;  2UXC I;  4P52 A;  4X65 I;  4X65 E;  1VI7 A;  2BA1 D;  4FW5 A;  4HYM A;  4MYU A;  4PRX A;  2BV3 A;  1UDO A;  4LCH A;  2HK3 A;  4ZVI A;  1Y4S A;  1N0V C;  5JEA C;  1Z0E A;  2HKJ A;  3U1K A;  3PRY A;  2XEX A;  3T1Y I;  4GKK E;  4JV5 E;  3T1Y E;  3J80 C;  1Z0W A;  3V5R A;  2C39 A;  4LPF A;  2NN6 D;  1XNR I;  1XNR E;  5L3J A;  2E5L I;  2VQF I;  1HK7 A;  2VQF E;  1N0U A;  4IZK B;  4DV2 I;  4DV2 E;  5C0X D;  4LFA E;  4DPX A;  5JEA A;  4HXZ A;  4LF4 I;  4LF4 E;  1H73 A;  4DV4 I;  2HK2 A;  4JI3 E;  4DV4 E;  1USU A;  2PO1 B;  3PYE A;  2WNR B;  1B63 A;  4IFD C;  1ZXM A;  3J80 Q;  3LNU A;  4OO1 C;  4WUB A;  3P76 A;  1FJG E;  3JAM Q;  2WW4 A;  4X62 I;  2NN6 F;  1IBM I;  1IBM E;  1IBL I;  1IBK I;  1IBL E;  1IBK E;  4M1K A;  2UUB E;  1R6M A;  5LMN I;  4DR2 E;  5LMN E;  1Z5A A;  4Z7Y A;  3ZKB A;  1Z0G A;  4LF7 I;  2EFG A;  4LF7 E;  1FI4 A;  3QT7 A;  3ZKD A;  5C0X F;  4BA2 B;  2Z5B A;  4IFD A;  2BM1 A;  4KQV A;  3ZZU A;  1KKH A;  1H74 A;  5FLX C;  4OO1 A;  1D6T A;  4B3S I;  2GS8 A;  4B3R E;  3M7N G;  4WUD A;  2AJ4 A;  2GO4 A;  1N36 I;  1Y60 A;  4DV0 E;  1N36 E;  2JEA B;  4LFC I;  2C37 A;  4DV6 E;  1S4E A;  4FW7 A;  3GCM A;  1P42 A;  4FWD A;  1I94 I;  1I94 E;  2PO0 B;  1N34 I;  4IS9 A;  4OO1 E;  1ZM3 A;  3ZZT A;  2UUA I;  3J7A M;  4HAC A;  1VIS A;  1MG7 A;  4DXL A;  2NPF A;  1HNZ I;  3NZK A;  1HNZ E;  2HHH I;  2HHH E;  3WU6 A;  3M7N D;  5EKW A;  2GO3 A;  2DEI A;  4DR4 I;  4DR4 E;  3H1C A;  5ELW A;  2A2D A;  2V8P A;  2R42 A;  2PNL A;  1FWL A;  4FW9 A;  4AIM A;  2C39 B;  4DPU A;  4DR6 E;  4K0K I;  2X36 A;  4K0K E;  4EMD A;  2Z5C A;  4USM A;  2UXB E;  4JI4 I;  5LMU I;  5LMU E;  4DR1 I;  1Z5B A;  4DR1 E;  1UDS A;  3HKM A;  4ISA A;  5DRQ A;  3CDJ A;  1Z0T A;  2Z5E A;  1HNX E;  4LF8 I;  1QZR A;  3Q6M A;  4X64 E;  4DV7 I;  4LF8 E;  4MU0 A;  1EA6 A; 
#chains in the Genus database with same CATH homology
 3B4T A;  5JEA E;  1E3H A;  5K36 F;  4BA1 A;  2BR2 B;  5K36 C;  5C0X D;  5JEA A;  2C38 B;  3M85 G;  2PO1 B;  5K36 B;  2WNR B;  4IFD C;  2BR2 A;  1UDN A;  4OO1 F;  2JEB B;  4OO1 C;  1UDQ A;  3L7Z B;  1OYR A;  2NN6 F;  3GME A;  4IFD B;  2BA0 G;  2PO1 A;  5K36 A;  1R6M A;  1E3P A;  2WNR A;  4IFD E;  4OO1 B;  4AID A;  5JEA D;  2JEB A;  3DD6 A;  1R6L A;  5C0X F;  3L7Z A;  4BA2 B;  3M85 D;  4IFD A;  2C37 B;  4OO1 A;  5K36 E;  3M7N G;  4NBQ A;  5K36 D;  3GLL A;  2JEA B;  4BA2 A;  2PNZ B;  1OYP A;  2C38 A;  2C37 A;  2BA1 G;  2NN6 C;  3GCM A;  2WP8 B;  2JE6 B;  2PO0 B;  1OYS A;  3CDI A;  5JEA F;  4IFD D;  4OO1 E;  2JEA A;  2NN6 B;  5C0X C;  2PNZ A;  4OO1 D;  2PO2 B;  2NN6 E;  2WP8 A;  2JE6 A;  2PO0 A;  3M7N D;  5JEA B;  5C0X B;  3H1C A;  2NN6 A;  2BA1 D;  2BA0 D;  5C0X E;  2PO2 A;  1UDO A;  4AIM A;  2C39 B;  5C0X A;  5JEA C;  4IFD F;  4AM3 A;  3KRN A;  4BA1 B;  3U1K A;  1UDS A;  3HKM A;  3CDJ A;  2C39 A;  2NN6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...