3WU4A

Oxidized-form structure of e.coli lon proteolytic domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
GQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 59
structure length 178
sequence length 178
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu4A01
2A2DA 1XMQE 5BR8I 1N0VC 1EA6A 4JI6E 4JG4A 4NXNI 4X65E 4LF7I 4AQYI 4B3TE 1XNRI 4WUCA 4DR2I 2F4VI 2VQFE 3PYDA 2VQEI 1Z0TA 1Z5CA 4X64E 4WUBA 4DR5E 1KIJA 3OTOE 1XMOI 1B63A 5A2QC 4KHPI 4DV6E 3HULA 3J81C 4JYAE 2UXDI 4NXME 1PVGA 1FJGI 1Z0GA 2X7IA 2ZITA 4B3MI 4DV4I 4ZVIA 4DR1I 4Z7YA 1J5EE 1ZM2A 2A2CA 4OX9I 4P52A 1ZM4A 5LMUI 4DV1I 1HR0I 4KQVA 1KKHA 1N34I 2UXBE 4LF6I 4JI1I 2GS8A 5FLXQ 2R3VA 1ZM3A 4JI4I 2UU9I 5LMNE 4FN5A 2ZM6E 1HNXI 1NHHA 4HACA 4DUYI 4DV7I 1FWLA 3T1HE 1HNWI 2V2QA 1FI4A 4DR3E 5IT9C 1Z0BA 3WU4A 2R42A 1ELOA 3PYEA 4DUZI 1VISA 3WU6A 2HHHE 1XNQE 2UUCE 3V2UC 1N33I 1KTVA 4B3SI 4GKKI 4MYTA 4YHHE 1N0UA 4MYUA 4X62I 3M6AA 1PIEA 2E5LI 4GKJI 4X66I 4DU8A 1ZM9A 4DV5E 1I94E 4DR6E 4FWHA 4JI0E 2DEIA 4LF8E 2HKJA 2V2ZA 4DR7I 2UUAE 4JI7I 4YY3E 2J7KA 4JI8I 4DR4E 1RREA 2E1RA 3J80Q 4DPWA 2V2VA 4LF9E 2EFGA 3ZZUA 1HNZE 4URLA 1IBMI 4JV5I 3T1YI 2XEXA 5BR8E 1Z0WA 1IBLI 3ZKBA 5IWAI 2VQFI 4JI3I 4NXNE 2LJPA 4LF7E 2UUBI 4AQYE 3CWVA 4DV3I 1N32I 1XNRE 4PRVA 4K0KI 1ZXNA 2F4VE 3OTOI 4FWDA 1IBKE 2BM0A 1OJ4A 4DV0E 1NHJA 4LF4I 3QT6A 4LFBE 4EMDA 2HFSA 1XMOE 1H7UA 3JAMQ 3Q1QA 4KHPE 3ZKDA 2WW4A 4PRXA 3ZM7A 2UXDE 3LPSA 1H74A 1FJGE 3D4JA 1FKAE 3K17A 4B3RI 4DR1E 5LL6R 4OX9E 2DEJA 4LF5I 1Z0EA 4DV1E 2OI2A 2BV3A 1N34E 3H4LA 4JI5E 4LF6E 4JI1E 3T1HI 4JI4E 1HNXE 3WU5A 3B78A 4DUYE 4P7AA 4WUDA 4DV7E 5L3JA 1Z5BA 1HNWE 5A2QQ 3QT7A 2HK3A 3K1JA 3PYFA 4DUZE 3J81Q 4DPTA 2Q2EB 4DPYA 4HY1A 1ZXMA 1Z5AA 1N36I 2NPFA 1BKNA 4DV2I 1NZ0A 3LTOA 1N33E 4DR6I 4LFAE 4GKKE 3J7AG 4LFCI 1NHIA 1UEKA 2E5LE 4GKJE 1XHKA 4X66E 4JI2I 2ZBKB 1XMQI 1EI1A 4DR7E 2UXCE 4JI7E 4JI6I 2CZ9A 5FLXC 4JI8E 4X65I 4B3TI 1H72C 2HKEA 4XTJA 1DARA 4FWGA 2VF3A 4Z7CA 1A6FA 4HACB 5IT9Q 1FWKA 4X64I 4DR2E 2AJ4A 1QZRA 4DR5I 4USMA 1IBME 4JV5E 3T1YE 4DV6I 3B82A 1IBKI 4UT4A 1IBLE 2VQEE 3LNUA 5IWAE 4JI3E 4DV0I 4JYAI 4M1KA 4NXMI 4RPFA 2UUBE 2HK2A 4DV3E 1N32E 4LFBI 3J7AM 4ED4A 4K0KE 3QT8A 2V34A 5GMEA 1MG7A 1J5EI 4PU9A 2V8PA 4LF4E 3ZZTA 3B8HA 2UXBI 3V5RA 4B3ME 5GMDA 4DV4E 2X36A 1U2RA 5LMUE 1HR0E 5LMNI 2ZM6I 4HYMA 1D6TA 3QT5A 4FW9A 1WUUA 4JI5I 3J80C 4B3RE 4DR3I 4LF5E 2UU9E 4USKA 2HFUA 1K47A 1Z0CA 4DXLA 1S4EA 2BM1A 3PYGA 2HHHI 1XNQI 2UUCI 1KVKA 3WU3A 4DPUA 4YHHI 1FNMA 4DV5I 1I94I 1MX0A 4JI0I 4LF8I 4B3SE 2UUAI 4I3HA 3ZZ0A 3JAMC 3F0NA 4YY3I 4LFAI 4X62E 1Z59A 1B62A 4DU7A 4DR4I 1RR9A 1N36E 4DV2E 4UTGA 2UXCI 3GONA 4LFCE 1S16A 1H7SA 4LF9I 1Z0VA 4HXZA 1MU5A 1H73A 4R1FA 1HNZI 4JI2E 4DPXA 1PKPA
chains in the Genus database with same CATH superfamily
2A2DA 1XMQE 2JT2A 5BR8I 1N0VC 1EA6A 2C39A 3PS1A 4JI6E 4JG4A 2F1DA 3NZKA 1OYSA 3GLLA 4NXNI 4X65E 4LF7I 4AQYI 4B3TE 1XNRI 4WUCA 4DR2I 3PS2A 2F4VI 4BA1A 2VQFE 2Z5BB 3PYDA 2VQEI 4IFDC 1Z0TA 1Z5CA 2PO1A 4X64E 4WUBA 4DR5E 1KIJA 3OTOE 1XMOI 1B63A 5C0XB 5A2QC 4KHPI 4DV6E 3HULA 2CGEA 4IFDE 1E3PA 3J81C 4JYAE 2UXDI 2Z5CA 4NXME 2BA0G 1PVGA 1FJGI 1Z0GA 2X7IA 4IFDA 2ZITA 4B3MI 4DV4I 4ZVIA 4DR1I 4IZJA 3L7ZA 5EL9A 4Z7YA 1J5EE 1Y5YA 1ZM2A 2A2CA 4OX9I 4P52A 1ZM4A 2J65A 2JEBB 5LMUI 4DV1I 1HR0I 4KQVA 1KKHA 2NN6B 1N34I 2BA1G 2UXBE 4LF6I 4JI1I 2GS8A 5FLXQ 1Y4UA 4AIDA 2R3VA 4IZKB 1ZM3A 4JI4I 2UU9I 5LMNE 4FN5A 2ZM6E 1HNXI 1NHHA 4HACA 2IOPA 3P76A 2O3ZA 4DUYI 4DV7I 4IZJD 5C0XC 1FWLA 1UDQA 3T1HE 1HNWI 2V2QA 1FI4A 4FW5A 4DR3E 5IT9C 4BA2B 1Z0BA 4MDTA 3WU4A 2R42A 2IOQA 1ELOA 4LOMA 2PNMA 3PYEA 4DUZI 5C0XE 1VISA 2WP8B 1UDSA 3DD6A 3WU6A 2HHHE 1XNQE 3HJCA 5C0XA 2UUCE 3V2UC 1N33I 2JEAB 1KTVA 4B3SI 4GKKI 4MYTA 3P3CA 4YHHE 1N0UA 2NN6C 4MYUA 2GO4A 4LCHA 4X62I 3M6AA 1PIEA 2E5LI 4GKJI 4X66I 4DU8A 1ZM9A 4DV5E 1I94E 4DR6E 4FWHA 4JI0E 2DEIA 4LF8E 2HKJA 1UDNA 2V2ZA 4DR7I 2UUAE 2NN6E 4JI7I 4YY3E 5FWKA 2J7KA 4J3DA 4JI8I 4FW7A 1HK7A 4DR4E 5C0XD 2NN6A 2GQ0A 1RREA 2E1RA 3J80Q 4DPWA 2BA1D 2V2VA 4LF9E 2EFGA 5EKWA 3ZZUA 5DRPA 1HNZE 4URLA 4OO1C 1IBMI 4JV5I 3M7NG 4FW4A 3T1YI 2XEXA 5BR8E 1Z0WA 2O1VA 1IBLI 3ZKBA 3Q6NA 5K36D 5IWAI 2VQFI 4JI3I 2C37B 4NXNE 2LJPA 5JEAC 2NN6D 4LF7E 2UUBI 4AQYE 3CWVA 4DV3I 1N32I 1XNRE 4PRVA 4OO1E 4K0KI 1ZXNA 2F4VE 3OTOI 4FWDA 2PO0A 5DRQA 2BM0A 1IBKE 2WNRB 4OO1A 1OJ4A 4DV0E 1NHJA 4LF4I 5JEAE 3QT6A 4LFBE 4MU4A 4EMDA 2HFSA 1XMOE 2JEAA 1H7UA 3JAMQ 3Q1QA 5JEAA 4KHPE 3ZKDA 4QNKA 2WW4A 2PNZB 4PRXA 3ZM7A 2UXDE 3LPSA 1H74A 2CVEA 1FJGE 3D4JA 3K85A 1FKAE 5DNLA 4OO1D 3K17A 4B3RI 4DR1E 5LL6R 4OX9E 2DEJA 4LF5I 2PNLA 4LCFA 4IFDD 3CDJA 1Z0EA 4DV1E 2OI2A 2BV3A 5JEAD 1N34E 3H4LA 4JI5E 1OYPA 2BR2B 4LF6E 4JI1E 2C38B 4AM3A 4MU1A 4AIMA 2C39B 3T1HI 2O1TA 4JI4E 3M85G 1HNXE 3WU5A 3B78A 2Z5BA 4DUYE 4P7AA 4WUDA 4DV7E 5K36F 3M7ND 1Y60A 5L3JA 1Z5BA 1HNWE 4BA1B 5A2QQ 3QT7A 3P3EA 2HK3A 2PO1B 3K1JA 3PYFA 4DUZE 4U3DA 3J81Q 4DPTA 1UDOA 2Q2EB 3UHMA 4DPYA 4HY1A 4U3BA 1ZXMA 1Z5AA 1N36I 3P3GA 3U1YA 2NPFA 1BKNA 4DV2I 1NZ0A 4ISAA 2O1WA 2Z5CB 3LTOA 4DR6I 1N33E 2IERA 2PNZA 4LFAE 3CDIA 4GKKE 2PO2B 5DROA 2JE6B 3J7AG 4LFCI 2JEBA 1NHIA 1UEKA 4MU3A 2E5LE 1YHCA 4GKJE 1XHKA 2O1UA 4X66E 3L7ZB 4JI2I 1RHYA 1XXEA 2ZBKB 1XMQI 5ELWA 1EI1A 1Y6ZA 4DR7E 4OO1F 2UXCE 4IZKA 4JI7E 3GMEA 3KRNA 4GQUA 2CZ9A 4JI6I 5FLXC 4JI8E 4X65I 3GCMA 4B3TI 4IFDF 1H72C 2HKEA 2Z5EA 2CG9A 5JEAF 4XTJA 2BR2A 1DARA 4FWGA 2VF3A 4Z7CA 1A6FA 4HACB 4BA2A 5IT9Q 1FWKA 4X64I 4DR2E 2AJ4A 1QZRA 4NBQA 4DR5I 4USMA 4FW6A 1IBME 4JV5E 3T1YE 2WP8A 4DV6I 3M85D 3B82A 2AE8A 1IBKI 4LCGA 4UT4A 2VQEE 1IBLE 3LNUA 3U1KA 5IWAE 4JI3E 4DV0I 4JYAI 4M1KA 4NXMI 4RPFA 2UUBE 2HK2A 2VESA 4DV3E 1N32E 4LFBI 3J7AM 4ED4A 4K0KE 3QT8A 2V34A 5GMEA 4OKGA 1MG7A 1J5EI 4PU9A 2V8PA 4QNJA 4LF4E 3Q6MA 4N3OA 3ZZTA 4LPFA 2PO2A 3B8HA 2JE6A 3V5RA 2UXBI 4B3ME 5GMDA 4DV4E 1Y4SA 2X36A 1U2RA 5C0XF 1E3HA 1R6MA 5LMUE 1HR0E 4MQYA 5DRRA 5K36B 5LMNI 2ZM6I 4HYMA 1D6TA 3QT5A 1YH8A 4FW9A 1USUA 1WUUA 4JI5I 4IS9A 3J80C 4B3RE 4DR3I 4LF5E 2UU9E 4USKA 2HFUA 1K47A 3B4TA 2C37A 1Z0CA 4DXLA 2NN6F 1S4EA 2BM1A 3PYGA 2GO3A 2HHHI 1XNQI 2UUCI 5DNXA 1KVKA 2WNRA 3WU3A 4DPUA 1P42A 4YHHI 2PO0B 3HKMA 4OO1B 1FNMA 4DV5I 1I94I 1MX0A 1OYRA 4JI0I 2IESA 4LF8I 4B3SE 3P06A 2UUAI 4IFDB 4I3HA 1VI7A 3ZZ0A 3JAMC 3F0NA 4YY3I 4LFAI 5K36C 4X62E 1Z59A 3PRYA 1USVA 1B62A 5JEAB 4DU7A 4IZJB 1R6LA 4DR4I 1RR9A 1N36E 4DV2E 4UTGA 3H1CA 5K36E 2BA0D 2UXCI 3GONA 4LFCE 1S16A 1H7SA 4LF9I 1Z0VA 4HXZA 5K36A 4MU0A 1MU5A 1H73A 4FW3A 4R1FA 1HNZI 4JI2E 4OZEA 4DPXA 3PS3A 2C38A 1PKPA
chains in the Genus database with same CATH topology
2A2DA 1XMQE 5BR8I 1N0VC 1EA6A 4JI6E 4JG4A 4NXNI 4X65E 4LF7I 4AQYI 4B3TE 1XNRI 4WUCA 4DR2I 2F4VI 2VQFE 2Z5BB 3PYDA 2VQEI 1Z0TA 1Z5CA 4X64E 4WUBA 4DR5E 1KIJA 3OTOE 1XMOI 1B63A 5A2QC 4KHPI 4DV6E 3HULA 2CGEA 3J81C 4JYAE 2UXDI 2Z5CA 4NXME 1PVGA 1FJGI 1Z0GA 2X7IA 2ZITA 4B3MI 4DV4I 4ZVIA 4DR1I 4IZJA 4Z7YA 1J5EE 1ZM2A 2A2CA 4OX9I 4P52A 1ZM4A 5LMUI 4DV1I 1HR0I 4KQVA 1KKHA 1N34I 2UXBE 4LF6I 4JI1I 2GS8A 5FLXQ 1Y4UA 2R3VA 4IZKB 1ZM3A 4JI4I 2UU9I 5LMNE 4FN5A 2ZM6E 1HNXI 1NHHA 4HACA 2IOPA 4DUYI 4DV7I 4IZJD 1FWLA 3T1HE 1HNWI 2V2QA 1FI4A 4DR3E 5IT9C 1Z0BA 3WU4A 2R42A 2IOQA 1ELOA 2PNMA 3PYEA 4DUZI 1VISA 3WU6A 2HHHE 1XNQE 3HJCA 2UUCE 3V2UC 1N33I 1KTVA 4B3SI 4GKKI 4MYTA 4YHHE 1N0UA 4MYUA 4X62I 3M6AA 1PIEA 2E5LI 4GKJI 4X66I 4DU8A 1ZM9A 4DV5E 1I94E 4DR6E 4FWHA 4JI0E 2DEIA 4LF8E 2HKJA 2V2ZA 4DR7I 2UUAE 4JI7I 4YY3E 5FWKA 2J7KA 4JI8I 1HK7A 4DR4E 2GQ0A 1RREA 2E1RA 3J80Q 4DPWA 2V2VA 4LF9E 2EFGA 3ZZUA 1HNZE 4URLA 1IBMI 4JV5I 3T1YI 2XEXA 5BR8E 1Z0WA 2O1VA 1IBLI 3ZKBA 3Q6NA 5IWAI 2VQFI 4JI3I 4NXNE 2LJPA 4LF7E 2UUBI 4AQYE 3CWVA 4DV3I 1N32I 1XNRE 4PRVA 4K0KI 1ZXNA 2F4VE 3OTOI 4FWDA 1IBKE 2BM0A 1OJ4A 4DV0E 1NHJA 4LF4I 3QT6A 4LFBE 4EMDA 2HFSA 1XMOE 1H7UA 3JAMQ 3Q1QA 4KHPE 3ZKDA 2WW4A 4PRXA 3ZM7A 2UXDE 3LPSA 1H74A 1FJGE 3D4JA 3K85A 1FKAE 3K17A 4B3RI 4DR1E 5LL6R 4OX9E 2DEJA 4LF5I 2PNLA 1Z0EA 4DV1E 2OI2A 2BV3A 1N34E 3H4LA 4JI5E 4LF6E 4JI1E 3T1HI 2O1TA 4JI4E 1HNXE 3WU5A 3B78A 2Z5BA 4DUYE 4P7AA 4WUDA 4DV7E 5L3JA 1Z5BA 1HNWE 5A2QQ 3QT7A 2HK3A 3K1JA 3PYFA 4DUZE 3J81Q 4DPTA 2Q2EB 4DPYA 4HY1A 1ZXMA 1Z5AA 1N36I 2NPFA 1BKNA 4DV2I 1NZ0A 2O1WA 2Z5CB 3LTOA 4DR6I 1N33E 4LFAE 4GKKE 3J7AG 4LFCI 1NHIA 1UEKA 2E5LE 4GKJE 1XHKA 2O1UA 4X66E 4JI2I 2ZBKB 1XMQI 1EI1A 1Y6ZA 4DR7E 2UXCE 4IZKA 4JI7E 4JI6I 2CZ9A 5FLXC 4JI8E 4X65I 4B3TI 1H72C 2HKEA 2Z5EA 2CG9A 4XTJA 1DARA 4FWGA 2VF3A 4Z7CA 1A6FA 4HACB 5IT9Q 1FWKA 4X64I 4DR2E 2AJ4A 1QZRA 4DR5I 4USMA 1IBME 4JV5E 3T1YE 4DV6I 3B82A 1IBKI 4UT4A 1IBLE 2VQEE 3LNUA 5IWAE 4JI3E 4DV0I 4JYAI 4M1KA 4NXMI 4RPFA 2UUBE 2HK2A 4DV3E 1N32E 4LFBI 3J7AM 4ED4A 4K0KE 3QT8A 2V34A 5GMEA 1MG7A 1J5EI 4PU9A 2V8PA 4LF4E 3Q6MA 4N3OA 3ZZTA 3B8HA 2UXBI 3V5RA 4B3ME 5GMDA 4DV4E 1Y4SA 2X36A 1U2RA 5LMUE 1HR0E 5LMNI 2ZM6I 4HYMA 1D6TA 3QT5A 4FW9A 1USUA 1WUUA 4JI5I 3J80C 4B3RE 4DR3I 4LF5E 2UU9E 4USKA 2HFUA 1K47A 1Z0CA 4DXLA 1S4EA 2BM1A 3PYGA 2HHHI 1XNQI 2UUCI 1KVKA 3WU3A 4DPUA 4YHHI 1FNMA 4DV5I 1I94I 1MX0A 4JI0I 4LF8I 4B3SE 3P06A 2UUAI 4I3HA 3ZZ0A 3JAMC 3F0NA 4YY3I 4LFAI 4X62E 1Z59A 3PRYA 1USVA 1B62A 4DU7A 4IZJB 4DR4I 1RR9A 1N36E 4DV2E 4UTGA 2UXCI 3GONA 4LFCE 1S16A 1H7SA 4LF9I 1Z0VA 4HXZA 1MU5A 1H73A 4R1FA 1HNZI 4JI2E 4DPXA 1PKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2D A;  1XMQ E;  5BR8 I;  1N0V C;  1EA6 A;  4JI6 E;  4JG4 A;  4NXN I;  4X65 E;  4LF7 I;  4AQY I;  4B3T E;  1XNR I;  4WUC A;  4DR2 I;  2F4V I;  2VQF E;  3PYD A;  2VQE I;  1Z0T A;  1Z5C A;  4X64 E;  4WUB A;  4DR5 E;  1KIJ A;  3OTO E;  1XMO I;  1B63 A;  5A2Q C;  4KHP I;  4DV6 E;  3HUL A;  3J81 C;  4JYA E;  2UXD I;  4NXM E;  1PVG A;  1FJG I;  1Z0G A;  2X7I A;  2ZIT A;  4B3M I;  4DV4 I;  4ZVI A;  4DR1 I;  4Z7Y A;  1J5E E;  1ZM2 A;  2A2C A;  4OX9 I;  4P52 A;  1ZM4 A;  5LMU I;  4DV1 I;  1HR0 I;  4KQV A;  1KKH A;  1N34 I;  2UXB E;  4LF6 I;  4JI1 I;  2GS8 A;  5FLX Q;  2R3V A;  1ZM3 A;  4JI4 I;  2UU9 I;  5LMN E;  4FN5 A;  2ZM6 E;  1HNX I;  1NHH A;  4HAC A;  4DUY I;  4DV7 I;  1FWL A;  3T1H E;  1HNW I;  2V2Q A;  1FI4 A;  4DR3 E;  5IT9 C;  1Z0B A;  3WU4 A;  2R42 A;  1ELO A;  3PYE A;  4DUZ I;  1VIS A;  3WU6 A;  2HHH E;  1XNQ E;  2UUC E;  3V2U C;  1N33 I;  1KTV A;  4B3S I;  4GKK I;  4MYT A;  4YHH E;  1N0U A;  4MYU A;  4X62 I;  3M6A A;  1PIE A;  2E5L I;  4GKJ I;  4X66 I;  4DU8 A;  1ZM9 A;  4DV5 E;  1I94 E;  4DR6 E;  4FWH A;  4JI0 E;  2DEI A;  4LF8 E;  2HKJ A;  2V2Z A;  4DR7 I;  2UUA E;  4JI7 I;  4YY3 E;  2J7K A;  4JI8 I;  4DR4 E;  1RRE A;  2E1R A;  3J80 Q;  4DPW A;  2V2V A;  4LF9 E;  2EFG A;  3ZZU A;  1HNZ E;  4URL A;  1IBM I;  4JV5 I;  3T1Y I;  2XEX A;  5BR8 E;  1Z0W A;  1IBL I;  3ZKB A;  5IWA I;  2VQF I;  4JI3 I;  4NXN E;  2LJP A;  4LF7 E;  2UUB I;  4AQY E;  3CWV A;  4DV3 I;  1N32 I;  1XNR E;  4PRV A;  4K0K I;  1ZXN A;  2F4V E;  3OTO I;  4FWD A;  1IBK E;  2BM0 A;  1OJ4 A;  4DV0 E;  1NHJ A;  4LF4 I;  3QT6 A;  4LFB E;  4EMD A;  2HFS A;  1XMO E;  1H7U A;  3JAM Q;  3Q1Q A;  4KHP E;  3ZKD A;  2WW4 A;  4PRX A;  3ZM7 A;  2UXD E;  3LPS A;  1H74 A;  1FJG E;  3D4J A;  1FKA E;  3K17 A;  4B3R I;  4DR1 E;  5LL6 R;  4OX9 E;  2DEJ A;  4LF5 I;  1Z0E A;  4DV1 E;  2OI2 A;  2BV3 A;  1N34 E;  3H4L A;  4JI5 E;  4LF6 E;  4JI1 E;  3T1H I;  4JI4 E;  1HNX E;  3WU5 A;  3B78 A;  4DUY E;  4P7A A;  4WUD A;  4DV7 E;  5L3J A;  1Z5B A;  1HNW E;  5A2Q Q;  3QT7 A;  2HK3 A;  3K1J A;  3PYF A;  4DUZ E;  3J81 Q;  4DPT A;  2Q2E B;  4DPY A;  4HY1 A;  1ZXM A;  1Z5A A;  1N36 I;  2NPF A;  1BKN A;  4DV2 I;  1NZ0 A;  3LTO A;  1N33 E;  4DR6 I;  4LFA E;  4GKK E;  3J7A G;  4LFC I;  1NHI A;  1UEK A;  2E5L E;  4GKJ E;  1XHK A;  4X66 E;  4JI2 I;  2ZBK B;  1XMQ I;  1EI1 A;  4DR7 E;  2UXC E;  4JI7 E;  4JI6 I;  2CZ9 A;  5FLX C;  4JI8 E;  4X65 I;  4B3T I;  1H72 C;  2HKE A;  4XTJ A;  1DAR A;  4FWG A;  2VF3 A;  4Z7C A;  1A6F A;  4HAC B;  5IT9 Q;  1FWK A;  4X64 I;  4DR2 E;  2AJ4 A;  1QZR A;  4DR5 I;  4USM A;  1IBM E;  4JV5 E;  3T1Y E;  4DV6 I;  3B82 A;  1IBK I;  4UT4 A;  1IBL E;  2VQE E;  3LNU A;  5IWA E;  4JI3 E;  4DV0 I;  4JYA I;  4M1K A;  4NXM I;  4RPF A;  2UUB E;  2HK2 A;  4DV3 E;  1N32 E;  4LFB I;  3J7A M;  4ED4 A;  4K0K E;  3QT8 A;  2V34 A;  5GME A;  1MG7 A;  1J5E I;  4PU9 A;  2V8P A;  4LF4 E;  3ZZT A;  3B8H A;  2UXB I;  3V5R A;  4B3M E;  5GMD A;  4DV4 E;  2X36 A;  1U2R A;  5LMU E;  1HR0 E;  5LMN I;  2ZM6 I;  4HYM A;  1D6T A;  3QT5 A;  4FW9 A;  1WUU A;  4JI5 I;  3J80 C;  4B3R E;  4DR3 I;  4LF5 E;  2UU9 E;  4USK A;  2HFU A;  1K47 A;  1Z0C A;  4DXL A;  1S4E A;  2BM1 A;  3PYG A;  2HHH I;  1XNQ I;  2UUC I;  1KVK A;  3WU3 A;  4DPU A;  4YHH I;  1FNM A;  4DV5 I;  1I94 I;  1MX0 A;  4JI0 I;  4LF8 I;  4B3S E;  2UUA I;  4I3H A;  3ZZ0 A;  3JAM C;  3F0N A;  4YY3 I;  4LFA I;  4X62 E;  1Z59 A;  1B62 A;  4DU7 A;  4DR4 I;  1RR9 A;  1N36 E;  4DV2 E;  4UTG A;  2UXC I;  3GON A;  4LFC E;  1S16 A;  1H7S A;  4LF9 I;  1Z0V A;  4HXZ A;  1MU5 A;  1H73 A;  4R1F A;  1HNZ I;  4JI2 E;  4DPX A;  1PKP A; 
#chains in the Genus database with same CATH topology
 2A2D A;  1XMQ E;  2JT2 A;  5BR8 I;  1N0V C;  1EA6 A;  2C39 A;  3PS1 A;  4JI6 E;  4JG4 A;  2F1D A;  3NZK A;  1OYS A;  3GLL A;  4NXN I;  4X65 E;  4LF7 I;  4AQY I;  4B3T E;  1XNR I;  4WUC A;  4DR2 I;  3PS2 A;  2F4V I;  4BA1 A;  2VQF E;  2Z5B B;  3PYD A;  2VQE I;  4IFD C;  1Z0T A;  1Z5C A;  2PO1 A;  4X64 E;  4WUB A;  4DR5 E;  1KIJ A;  3OTO E;  1XMO I;  1B63 A;  5C0X B;  5A2Q C;  4KHP I;  4DV6 E;  3HUL A;  2CGE A;  4IFD E;  1E3P A;  3J81 C;  4JYA E;  2UXD I;  2Z5C A;  4NXM E;  2BA0 G;  1PVG A;  1FJG I;  1Z0G A;  2X7I A;  4IFD A;  2ZIT A;  4B3M I;  4DV4 I;  4ZVI A;  4DR1 I;  4IZJ A;  3L7Z A;  5EL9 A;  4Z7Y A;  1J5E E;  1Y5Y A;  1ZM2 A;  2A2C A;  4OX9 I;  4P52 A;  1ZM4 A;  2J65 A;  2JEB B;  5LMU I;  4DV1 I;  1HR0 I;  4KQV A;  1KKH A;  2NN6 B;  1N34 I;  2BA1 G;  2UXB E;  4LF6 I;  4JI1 I;  2GS8 A;  5FLX Q;  1Y4U A;  4AID A;  2R3V A;  4IZK B;  1ZM3 A;  4JI4 I;  2UU9 I;  5LMN E;  4FN5 A;  2ZM6 E;  1HNX I;  1NHH A;  4HAC A;  2IOP A;  3P76 A;  2O3Z A;  4DUY I;  4DV7 I;  4IZJ D;  5C0X C;  1FWL A;  1UDQ A;  3T1H E;  1HNW I;  2V2Q A;  1FI4 A;  4FW5 A;  4DR3 E;  5IT9 C;  4BA2 B;  1Z0B A;  4MDT A;  3WU4 A;  2R42 A;  2IOQ A;  1ELO A;  4LOM A;  2PNM A;  3PYE A;  4DUZ I;  5C0X E;  1VIS A;  2WP8 B;  1UDS A;  3DD6 A;  3WU6 A;  2HHH E;  1XNQ E;  3HJC A;  5C0X A;  2UUC E;  3V2U C;  1N33 I;  2JEA B;  1KTV A;  4B3S I;  4GKK I;  4MYT A;  3P3C A;  4YHH E;  1N0U A;  2NN6 C;  4MYU A;  2GO4 A;  4LCH A;  4X62 I;  3M6A A;  1PIE A;  2E5L I;  4GKJ I;  4X66 I;  4DU8 A;  1ZM9 A;  4DV5 E;  1I94 E;  4DR6 E;  4FWH A;  4JI0 E;  2DEI A;  4LF8 E;  2HKJ A;  1UDN A;  2V2Z A;  4DR7 I;  2UUA E;  2NN6 E;  4JI7 I;  4YY3 E;  5FWK A;  2J7K A;  4J3D A;  4JI8 I;  4FW7 A;  1HK7 A;  4DR4 E;  5C0X D;  2NN6 A;  2GQ0 A;  1RRE A;  2E1R A;  3J80 Q;  4DPW A;  2BA1 D;  2V2V A;  4LF9 E;  2EFG A;  5EKW A;  3ZZU A;  5DRP A;  1HNZ E;  4URL A;  4OO1 C;  1IBM I;  4JV5 I;  3M7N G;  4FW4 A;  3T1Y I;  2XEX A;  5BR8 E;  1Z0W A;  2O1V A;  1IBL I;  3ZKB A;  3Q6N A;  5K36 D;  5IWA I;  2VQF I;  4JI3 I;  2C37 B;  4NXN E;  2LJP A;  5JEA C;  2NN6 D;  4LF7 E;  2UUB I;  4AQY E;  3CWV A;  4DV3 I;  1N32 I;  1XNR E;  4PRV A;  4OO1 E;  4K0K I;  1ZXN A;  2F4V E;  3OTO I;  4FWD A;  2PO0 A;  5DRQ A;  2BM0 A;  1IBK E;  2WNR B;  4OO1 A;  1OJ4 A;  4DV0 E;  1NHJ A;  4LF4 I;  5JEA E;  3QT6 A;  4LFB E;  4MU4 A;  4EMD A;  2HFS A;  1XMO E;  2JEA A;  1H7U A;  3JAM Q;  3Q1Q A;  5JEA A;  4KHP E;  3ZKD A;  4QNK A;  2WW4 A;  2PNZ B;  4PRX A;  3ZM7 A;  2UXD E;  3LPS A;  1H74 A;  2CVE A;  1FJG E;  3D4J A;  3K85 A;  1FKA E;  5DNL A;  4OO1 D;  3K17 A;  4B3R I;  4DR1 E;  5LL6 R;  4OX9 E;  2DEJ A;  4LF5 I;  2PNL A;  4LCF A;  4IFD D;  3CDJ A;  1Z0E A;  4DV1 E;  2OI2 A;  2BV3 A;  5JEA D;  1N34 E;  3H4L A;  4JI5 E;  1OYP A;  2BR2 B;  4LF6 E;  4JI1 E;  2C38 B;  4AM3 A;  4MU1 A;  4AIM A;  2C39 B;  3T1H I;  2O1T A;  4JI4 E;  3M85 G;  1HNX E;  3WU5 A;  3B78 A;  2Z5B A;  4DUY E;  4P7A A;  4WUD A;  4DV7 E;  5K36 F;  3M7N D;  1Y60 A;  5L3J A;  1Z5B A;  1HNW E;  4BA1 B;  5A2Q Q;  3QT7 A;  3P3E A;  2HK3 A;  2PO1 B;  3K1J A;  3PYF A;  4DUZ E;  4U3D A;  3J81 Q;  4DPT A;  1UDO A;  2Q2E B;  3UHM A;  4DPY A;  4HY1 A;  4U3B A;  1ZXM A;  1Z5A A;  1N36 I;  3P3G A;  3U1Y A;  2NPF A;  1BKN A;  4DV2 I;  1NZ0 A;  4ISA A;  2O1W A;  2Z5C B;  3LTO A;  4DR6 I;  1N33 E;  2IER A;  2PNZ A;  4LFA E;  3CDI A;  4GKK E;  2PO2 B;  5DRO A;  2JE6 B;  3J7A G;  4LFC I;  2JEB A;  1NHI A;  1UEK A;  4MU3 A;  2E5L E;  1YHC A;  4GKJ E;  1XHK A;  2O1U A;  4X66 E;  3L7Z B;  4JI2 I;  1RHY A;  1XXE A;  2ZBK B;  1XMQ I;  5ELW A;  1EI1 A;  1Y6Z A;  4DR7 E;  4OO1 F;  2UXC E;  4IZK A;  4JI7 E;  3GME A;  3KRN A;  4GQU A;  2CZ9 A;  4JI6 I;  5FLX C;  4JI8 E;  4X65 I;  3GCM A;  4B3T I;  4IFD F;  1H72 C;  2HKE A;  2Z5E A;  2CG9 A;  5JEA F;  4XTJ A;  2BR2 A;  1DAR A;  4FWG A;  2VF3 A;  4Z7C A;  1A6F A;  4HAC B;  4BA2 A;  5IT9 Q;  1FWK A;  4X64 I;  4DR2 E;  2AJ4 A;  1QZR A;  4NBQ A;  4DR5 I;  4USM A;  4FW6 A;  1IBM E;  4JV5 E;  3T1Y E;  2WP8 A;  4DV6 I;  3M85 D;  3B82 A;  2AE8 A;  1IBK I;  4LCG A;  4UT4 A;  2VQE E;  1IBL E;  3LNU A;  3U1K A;  5IWA E;  4JI3 E;  4DV0 I;  4JYA I;  4M1K A;  4NXM I;  4RPF A;  2UUB E;  2HK2 A;  2VES A;  4DV3 E;  1N32 E;  4LFB I;  3J7A M;  4ED4 A;  4K0K E;  3QT8 A;  2V34 A;  5GME A;  4OKG A;  1MG7 A;  1J5E I;  4PU9 A;  2V8P A;  4QNJ A;  4LF4 E;  3Q6M A;  4N3O A;  3ZZT A;  4LPF A;  2PO2 A;  3B8H A;  2JE6 A;  3V5R A;  2UXB I;  4B3M E;  5GMD A;  4DV4 E;  1Y4S A;  2X36 A;  1U2R A;  5C0X F;  1E3H A;  1R6M A;  5LMU E;  1HR0 E;  4MQY A;  5DRR A;  5K36 B;  5LMN I;  2ZM6 I;  4HYM A;  1D6T A;  3QT5 A;  1YH8 A;  4FW9 A;  1USU A;  1WUU A;  4JI5 I;  4IS9 A;  3J80 C;  4B3R E;  4DR3 I;  4LF5 E;  2UU9 E;  4USK A;  2HFU A;  1K47 A;  3B4T A;  2C37 A;  1Z0C A;  4DXL A;  2NN6 F;  1S4E A;  2BM1 A;  3PYG A;  2GO3 A;  2HHH I;  1XNQ I;  2UUC I;  5DNX A;  1KVK A;  2WNR A;  3WU3 A;  4DPU A;  1P42 A;  4YHH I;  2PO0 B;  3HKM A;  4OO1 B;  1FNM A;  4DV5 I;  1I94 I;  1MX0 A;  1OYR A;  4JI0 I;  2IES A;  4LF8 I;  4B3S E;  3P06 A;  2UUA I;  4IFD B;  4I3H A;  1VI7 A;  3ZZ0 A;  3JAM C;  3F0N A;  4YY3 I;  4LFA I;  5K36 C;  4X62 E;  1Z59 A;  3PRY A;  1USV A;  1B62 A;  5JEA B;  4DU7 A;  4IZJ B;  1R6L A;  4DR4 I;  1RR9 A;  1N36 E;  4DV2 E;  4UTG A;  3H1C A;  5K36 E;  2BA0 D;  2UXC I;  3GON A;  4LFC E;  1S16 A;  1H7S A;  4LF9 I;  1Z0V A;  4HXZ A;  5K36 A;  4MU0 A;  1MU5 A;  1H73 A;  4FW3 A;  4R1F A;  1HNZ I;  4JI2 E;  4OZE A;  4DPX A;  3PS3 A;  2C38 A;  1PKP A; 
#chains in the Genus database with same CATH homology
 2A2D A;  1XMQ E;  5BR8 I;  1N0V C;  1EA6 A;  4JI6 E;  4JG4 A;  4NXN I;  4X65 E;  4LF7 I;  4AQY I;  4B3T E;  1XNR I;  4WUC A;  4DR2 I;  2F4V I;  2VQF E;  2Z5B B;  3PYD A;  2VQE I;  1Z0T A;  1Z5C A;  4X64 E;  4WUB A;  4DR5 E;  1KIJ A;  3OTO E;  1XMO I;  1B63 A;  5A2Q C;  4KHP I;  4DV6 E;  3HUL A;  2CGE A;  3J81 C;  4JYA E;  2UXD I;  2Z5C A;  4NXM E;  1PVG A;  1FJG I;  1Z0G A;  2X7I A;  2ZIT A;  4B3M I;  4DV4 I;  4ZVI A;  4DR1 I;  4IZJ A;  4Z7Y A;  1J5E E;  1ZM2 A;  2A2C A;  4OX9 I;  4P52 A;  1ZM4 A;  5LMU I;  4DV1 I;  1HR0 I;  4KQV A;  1KKH A;  1N34 I;  2UXB E;  4LF6 I;  4JI1 I;  2GS8 A;  5FLX Q;  1Y4U A;  2R3V A;  4IZK B;  1ZM3 A;  4JI4 I;  2UU9 I;  5LMN E;  4FN5 A;  2ZM6 E;  1HNX I;  1NHH A;  4HAC A;  2IOP A;  4DUY I;  4DV7 I;  4IZJ D;  1FWL A;  3T1H E;  1HNW I;  2V2Q A;  1FI4 A;  4DR3 E;  5IT9 C;  1Z0B A;  3WU4 A;  2R42 A;  2IOQ A;  1ELO A;  2PNM A;  3PYE A;  4DUZ I;  1VIS A;  3WU6 A;  2HHH E;  1XNQ E;  3HJC A;  2UUC E;  3V2U C;  1N33 I;  1KTV A;  4B3S I;  4GKK I;  4MYT A;  4YHH E;  1N0U A;  4MYU A;  4X62 I;  3M6A A;  1PIE A;  2E5L I;  4GKJ I;  4X66 I;  4DU8 A;  1ZM9 A;  4DV5 E;  1I94 E;  4DR6 E;  4FWH A;  4JI0 E;  2DEI A;  4LF8 E;  2HKJ A;  2V2Z A;  4DR7 I;  2UUA E;  4JI7 I;  4YY3 E;  5FWK A;  2J7K A;  4JI8 I;  1HK7 A;  4DR4 E;  2GQ0 A;  1RRE A;  2E1R A;  3J80 Q;  4DPW A;  2V2V A;  4LF9 E;  2EFG A;  3ZZU A;  1HNZ E;  4URL A;  1IBM I;  4JV5 I;  3T1Y I;  2XEX A;  5BR8 E;  1Z0W A;  2O1V A;  1IBL I;  3ZKB A;  3Q6N A;  5IWA I;  2VQF I;  4JI3 I;  4NXN E;  2LJP A;  4LF7 E;  2UUB I;  4AQY E;  3CWV A;  4DV3 I;  1N32 I;  1XNR E;  4PRV A;  4K0K I;  1ZXN A;  2F4V E;  3OTO I;  4FWD A;  1IBK E;  2BM0 A;  1OJ4 A;  4DV0 E;  1NHJ A;  4LF4 I;  3QT6 A;  4LFB E;  4EMD A;  2HFS A;  1XMO E;  1H7U A;  3JAM Q;  3Q1Q A;  4KHP E;  3ZKD A;  2WW4 A;  4PRX A;  3ZM7 A;  2UXD E;  3LPS A;  1H74 A;  1FJG E;  3D4J A;  3K85 A;  1FKA E;  3K17 A;  4B3R I;  4DR1 E;  5LL6 R;  4OX9 E;  2DEJ A;  4LF5 I;  2PNL A;  1Z0E A;  4DV1 E;  2OI2 A;  2BV3 A;  1N34 E;  3H4L A;  4JI5 E;  4LF6 E;  4JI1 E;  3T1H I;  2O1T A;  4JI4 E;  1HNX E;  3WU5 A;  3B78 A;  2Z5B A;  4DUY E;  4P7A A;  4WUD A;  4DV7 E;  5L3J A;  1Z5B A;  1HNW E;  5A2Q Q;  3QT7 A;  2HK3 A;  3K1J A;  3PYF A;  4DUZ E;  3J81 Q;  4DPT A;  2Q2E B;  4DPY A;  4HY1 A;  1ZXM A;  1Z5A A;  1N36 I;  2NPF A;  1BKN A;  4DV2 I;  1NZ0 A;  2O1W A;  2Z5C B;  3LTO A;  4DR6 I;  1N33 E;  4LFA E;  4GKK E;  3J7A G;  4LFC I;  1NHI A;  1UEK A;  2E5L E;  4GKJ E;  1XHK A;  2O1U A;  4X66 E;  4JI2 I;  2ZBK B;  1XMQ I;  1EI1 A;  1Y6Z A;  4DR7 E;  2UXC E;  4IZK A;  4JI7 E;  4JI6 I;  2CZ9 A;  5FLX C;  4JI8 E;  4X65 I;  4B3T I;  1H72 C;  2HKE A;  2Z5E A;  2CG9 A;  4XTJ A;  1DAR A;  4FWG A;  2VF3 A;  4Z7C A;  1A6F A;  4HAC B;  5IT9 Q;  1FWK A;  4X64 I;  4DR2 E;  2AJ4 A;  1QZR A;  4DR5 I;  4USM A;  1IBM E;  4JV5 E;  3T1Y E;  4DV6 I;  3B82 A;  1IBK I;  4UT4 A;  1IBL E;  2VQE E;  3LNU A;  5IWA E;  4JI3 E;  4DV0 I;  4JYA I;  4M1K A;  4NXM I;  4RPF A;  2UUB E;  2HK2 A;  4DV3 E;  1N32 E;  4LFB I;  3J7A M;  4ED4 A;  4K0K E;  3QT8 A;  2V34 A;  5GME A;  1MG7 A;  1J5E I;  4PU9 A;  2V8P A;  4LF4 E;  3Q6M A;  4N3O A;  3ZZT A;  3B8H A;  2UXB I;  3V5R A;  4B3M E;  5GMD A;  4DV4 E;  1Y4S A;  2X36 A;  1U2R A;  5LMU E;  1HR0 E;  5LMN I;  2ZM6 I;  4HYM A;  1D6T A;  3QT5 A;  4FW9 A;  1USU A;  1WUU A;  4JI5 I;  3J80 C;  4B3R E;  4DR3 I;  4LF5 E;  2UU9 E;  4USK A;  2HFU A;  1K47 A;  1Z0C A;  4DXL A;  1S4E A;  2BM1 A;  3PYG A;  2HHH I;  1XNQ I;  2UUC I;  1KVK A;  3WU3 A;  4DPU A;  4YHH I;  1FNM A;  4DV5 I;  1I94 I;  1MX0 A;  4JI0 I;  4LF8 I;  4B3S E;  3P06 A;  2UUA I;  4I3H A;  3ZZ0 A;  3JAM C;  3F0N A;  4YY3 I;  4LFA I;  4X62 E;  1Z59 A;  3PRY A;  1USV A;  1B62 A;  4DU7 A;  4IZJ B;  4DR4 I;  1RR9 A;  1N36 E;  4DV2 E;  4UTG A;  2UXC I;  3GON A;  4LFC E;  1S16 A;  1H7S A;  4LF9 I;  1Z0V A;  4HXZ A;  1MU5 A;  1H73 A;  4R1F A;  1HNZ I;  4JI2 E;  4DPX A;  1PKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...