3WU4A

Oxidized-form structure of e.coli lon proteolytic domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
GQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Lon protease
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 178
sequence length 178
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu4A01
1Z0GA 3B8HA 4DR5E 1N0UA 5GMDA 4B3MI 1IBME 1HNWI 2X36A 4DV0E 1KIJA 1H72C 4JI7E 4DR7E 1Z5CA 1Z0TA 3ZM7A 4YY3E 1Z0CA 3PYFA 1K47A 1ZM9A 3WU5A 1FKAE 2HKEA 2ZITA 3T1HE 4JI6I 4DV7E 1FJGI 1MG7A 3K17A 3PYEA 5IWAE 4MYUA 5A2QC 2E5LI 4JI1E 4LF6I 2UXDI 3B82A 1EA6A 3WU6A 2UXBE 4DR1I 4DV6I 1A6FA 4DR6I 2V2VA 4KHPE 4AQYE 2DEJA 1HNZE 4LF7I 1B63A 4JI8E 4X64E 2HHHE 1NHIA 4JV5E 5LMUE 1HNXE 3J80Q 3PYGA 3GONA 1U2RA 3QT5A 4DV0I 4UT4A 4JI7I 1Z59A 4DR7I 3JAMC 1PIEA 4B3RI 4X65E 1HR0E 4DR2I 1IBKI 1H74A 4JI0E 1H73A 4DPUA 4HACA 4LFAE 4R1FA 2UUBI 4JI4I 5IWAI 4JI1I 3J81Q 2UUAI 5FLXC 4LF8I 1N33E 4LF4E 5IT9C 4JI3E 2UU9E 4B3SE 4DV3E 1XNQE 4WUDA 4X66I 1XNRE 1N36E 2VQEE 4JG4A 4HY1A 3V2UC 3V5RA 3D4JA 4HACB 4XTJA 2V34A 4DR3I 4KHPI 1I94E 2HK2A 3WU4A 2GS8A 4JI8I 2HHHI 4HXZA 4GKKI 5LMUI 1HNXI 3J7AM 4DV5I 1NHJA 4LFBI 1UEKA 4NXNI 2HFUA 3H4LA 4DR4E 3Q1QA 4DPTA 1Z0BA 4X65I 1BKNA 5LL6R 1NZ0A 2F4VE 2XEXA 4LFAI 4URLA 1H7UA 1WUUA 1ZXNA 4B3TI 1J5EI 2UUCI 4DUZE 2CZ9A 1PVGA 4LF4I 1H7SA 3ZKDA 4LF9I 1Z5AA 2UU9I 5A2QQ 3T1YE 4K0KI 1N36I 4GKJI 3J7AG 2VQEI 1ZM4A 1NHHA 5BR8E 4PRXA 1MX0A 1FNMA 4YHHI 1XMQI 4LFCE 4JYAI 2UXCE 1RREA 3QT7A 3QT8A 4ZVIA 4DV4E 4OX9E 4X62E 4DR4I 4FW9A 2V8PA 3OTOE 4DU8A 1Z0EA 1N34E 3B78A 4I3HA 4P7AA 2X7IA 1Z0VA 1FI4A 2V2QA 4DR5I 4DPXA 1IBMI 2HKJA 4WUBA 2R42A 5L3JA 1Z5BA 4YY3I 4UTGA 3LTOA 4NXME 1ZM3A 3T1YI 4DU7A 4JI5E 1N32E 1KKHA 1S4EA 3T1HI 5IT9Q 4DV7I 3LPSA 4ED4A 2BV3A 5BR8I 2R3VA 3HULA 3J80C 4DPWA 4FWDA 3ZKBA 2UXBI 4EMDA 3M6AA 2VQFE 2OI2A 4AQYI 2E1RA 4DPYA 1HNZI 4X64I 4DXLA 4JV5I 5LMNE 4WUCA 3PYDA 4JI6E 1OJ4A 3J81C 1MU5A 1EI1A 2E5LE 2ZM6E 2UXDE 4KQVA 1HR0I 4HYMA 2NPFA 4JI0I 1N32I 2A2DA 3ZZ0A 4DV6E 4PRVA 4DR6E 1D6TA 2WW4A 1N33I 4JI3I 4B3SI 4DV3I 1S16A 1XNQI 2BM1A 1VISA 1XNRI 1Z0WA 2Q2EB 1FWKA 4MYTA 2VQFI 1I94I 2V2ZA 4DUYE 1IBLE 4B3RE 4DV2E 5LMNI 4DR2E 1IBKE 1ELOA 1PKPA 4P52A 2UUBE 4RPFA 4FWHA 4DV1E 2HK3A 4JI4E 4USKA 2ZM6I 1ZXMA 2UUAE 4LF8E 2ZBKB 2F4VI 4X66E 3JAMQ 1N0VC 3ZZUA 1KTVA 4JI2E 4PU9A 4M1KA 1QZRA 4DR3E 4DUZI 3WU3A 4GKKE 5FLXQ 3CWVA 4USMA 4DV5E 4LF5E 3LNUA 5GMEA 4LFBE 4NXNE 4FN5A 1XMOE 4LFCI 3F0NA 1FWLA 4FWGA 2HFSA 4DUYI 1IBLI 1B62A 4DV2I 2UXCI 4B3ME 1HNWE 2LJPA 4DV4I 3ZZTA 2AJ4A 4OX9I 4X62I 1XHKA 4DV1I 4B3TE 1J5EE 2UUCE 3OTOI 4Z7YA 1N34I 4LF9E 4K0KE 3K1JA 4Z7CA 4GKJE 1FJGE 2BM0A 1DARA 1KVKA 4JI2I 4YHHE 4LF6E 2DEIA 2A2CA 1ZM2A 1XMQE 4JYAE 1RR9A 4NXMI 3QT6A 4JI5I 4DR1E 4LF5I 2J7KA 2EFGA 1XMOI 2VF3A 4LF7E
chains in the Genus database with same CATH superfamily
1Z0GA 2Z5BB 3B8HA 4FW6A 4DR5E 1N0UA 5GMDA 4B3MI 5JEAF 1IBME 1HNWI 2X36A 4DV0E 1KIJA 1H72C 4JI7E 4DR7E 1Z5CA 1Z0TA 2NN6C 3ZM7A 4IFDF 4YY3E 1Z0CA 4BA2B 3L7ZB 3PYFA 1K47A 1ZM9A 3WU5A 1FKAE 2Z5EA 3PS3A 2HKEA 2ZITA 3T1HE 4JI6I 1Y4UA 4BA1A 4DV7E 1FJGI 1MG7A 3P06A 1E3HA 3K17A 3PYEA 5IWAE 4MYUA 5A2QC 2E5LI 4JI1E 4LF6I 2UXDI 4MU0A 3B82A 1EA6A 3WU6A 4IS9A 2UXBE 4DR1I 3P76A 4DV6I 1A6FA 1USUA 2PNMA 4FW7A 4DR6I 2V2VA 3Q6MA 4KHPE 4AQYE 4IZKA 1YHCA 2DEJA 1HNZE 4LF7I 1B63A 4JI8E 4X64E 2HHHE 1NHIA 5DROA 4JV5E 5LMUE 1HNXE 3J80Q 3PYGA 3GONA 1U2RA 3QT5A 4DV0I 4UT4A 4JI7I 1Z59A 4DR7I 3GCMA 4IZJA 2PNLA 1PIEA 3JAMC 2NN6D 4B3RI 4MU1A 4X65E 1HR0E 4DR2I 1IBKI 4IZKB 1UDOA 2C38A 1H74A 2O3ZA 4JI0E 1H73A 1XXEA 4DPUA 4HACA 4LFAE 3P3EA 4R1FA 2UUBI 4JI4I 5IWAI 4JI1I 4U3DA 3J81Q 2UUAI 5FLXC 1R6LA 4LF8I 3P3CA 4LF4E 1Y5YA 2BA1G 3HJCA 1N33E 5IT9C 4JI3E 4ISAA 2UU9E 4B3SE 5C0XD 4IZJB 4DV3E 1XNQE 2JEBA 4WUDA 4X66I 1XNRE 4N3OA 1N36E 4JG4A 2VQEE 4HY1A 3V2UC 3V5RA 2C38B 3D4JA 4LOMA 4HACB 4XTJA 2V34A 4DR3I 4KHPI 1I94E 5K36E 2HK2A 2PO2B 3WU4A 2JE6A 3P3GA 2GS8A 4JI8I 2HHHI 4HXZA 4GKKI 5LMUI 1HNXI 3J7AM 4DV5I 1NHJA 4OO1A 1UDSA 3PS1A 4LFBI 1UEKA 2JEBB 4NXNI 2HFUA 3H4LA 1Y6ZA 2C39A 1OYSA 5ELWA 4DR4E 3Q1QA 2PNZB 1P42A 2BA0G 4DPTA 1Z0BA 2CGEA 4X65I 2IOPA 1BKNA 5LL6R 1NZ0A 2F4VE 5K36B 2O1VA 2JE6B 2XEXA 2Z5CA 4LFAI 4URLA 1H7UA 1WUUA 5K36D 1ZXNA 4B3TI 1J5EI 2UUCI 4DUZE 2CZ9A 2BR2A 2IOQA 1PVGA 3M85D 4OZEA 4AIMA 2O1UA 4LF4I 1H7SA 3M7ND 3ZKDA 4LF9I 1Z5AA 2UU9I 5A2QQ 3T1YE 4K0KI 4FW4A 1N36I 4GKJI 4LCHA 3J7AG 1RHYA 2VQEI 1ZM4A 1NHHA 2CG9A 4PRXA 5BR8E 1MX0A 1FNMA 5JEAA 4YHHI 2O1WA 4AM3A 5C0XC 1XMQI 2Z5CB 4LFCE 4OKGA 4JYAI 2NN6F 1VI7A 4MQYA 4IFDA 2C37A 2UXCE 1RREA 3QT7A 3QT8A 4ZVIA 4DV4E 4OX9E 2CVEA 3DD6A 4X62E 4BA1B 4DR4I 4FW9A 5EL9A 2V8PA 3OTOE 2AE8A 4DU8A 1Z0EA 1N34E 3B78A 5C0XF 4I3HA 1Y60A 4P7AA 2X7IA 1Z0VA 1FI4A 2V2QA 3U1KA 4DPXA 4DR5I 1IBMI 2C37B 2HKJA 4WUBA 2R42A 5L3JA 1Z5BA 4YY3I 4UTGA 3LTOA 4NXME 1ZM3A 3T1YI 5FWKA 4DU7A 4JI5E 1N32E 1KKHA 1S4EA 3T1HI 5IT9Q 4NBQA 4DV7I 5K36C 3LPSA 4ED4A 2BV3A 5BR8I 4FW3A 2R3VA 3HULA 2PO1A 3J80C 4DPWA 4FWDA 3ZKBA 3CDJA 2UXBI 3KRNA 4EMDA 2F1DA 2JT2A 5DRPA 4IZJD 3M6AA 3HKMA 2IESA 2WP8A 5K36F 2VQFE 2OI2A 4AQYI 1OYRA 2E1RA 4DPYA 1HNZI 4X64I 4AIDA 4DXLA 4JV5I 5LMNE 4WUCA 4QNJA 1UDQA 4OO1E 3PYDA 2PO1B 4JI6E 1OJ4A 3J81C 1Y4SA 5DRRA 1MU5A 1EI1A 3PRYA 2E5LE 2ZM6E 1UDNA 2UXDE 2WP8B 1HK7A 2BA1D 4KQVA 1HR0I 4HYMA 2NPFA 4JI0I 1N32I 2A2DA 3ZZ0A 4DV6E 4GQUA 4BA2A 4PRVA 4OO1B 4DR6E 1D6TA 3K85A 2WW4A 2C39B 1N33I 4JI3I 4B3SI 4OO1D 4DV3I 1S16A 1XNQI 2BM1A 1VISA 1XNRI 4MDTA 1Z0WA 2Q2EB 3B4TA 1FWKA 5JEAE 2VESA 4MYTA 3NZKA 1YH8A 2VQFI 1I94I 2V2ZA 4DUYE 4U3BA 1IBLE 4B3RE 4FW5A 4IFDE 3Q6NA 4QNKA 2BA0D 2BR2B 2IERA 4DV2E 3CDIA 4J3DA 5LMNI 4DR2E 1IBKE 3GLLA 1ELOA 2J65A 1PKPA 4P52A 2UUBE 4RPFA 4FWHA 4DV1E 2HK3A 1R6MA 4JI4E 4USKA 2ZM6I 1ZXMA 2UUAE 4LF8E 5JEAB 2ZBKB 5DNXA 2GQ0A 2NN6E 2F4VI 4X66E 2NN6A 3JAMQ 1N0VC 3ZZUA 1KTVA 4IFDB 5JEAD 4JI2E 4PU9A 4M1KA 4LCFA 1QZRA 4DR3E 4DUZI 4IFDD 2WNRA 3WU3A 4LPFA 3U1YA 4GKKE 3GMEA 5FLXQ 3CWVA 5C0XE 4USMA 4DV5E 4LF5E 3LNUA 5C0XA 2JEAA 5GMEA 4LFBE 4MU4A 4NXNE 2NN6B 5EKWA 3UHMA 4FN5A 1XMOE 4OO1C 4LFCI 3F0NA 1FWLA 4FWGA 2HFSA 4DUYI 1IBLI 2GO4A 2WNRB 1B62A 4DV2I 2UXCI 4LCGA 4B3ME 1HNWE 2LJPA 3PS2A 4DV4I 3ZZTA 2AJ4A 4OX9I 2PO0A 4X62I 5C0XB 2JEAB 1XHKA 4DV1I 2PO2A 4B3TE 1J5EE 2UUCE 5DRQA 3OTOI 4Z7YA 1E3PA 1N34I 4LF9E 2O1TA 4OO1F 4K0KE 3K1JA 3H1CA 4Z7CA 4GKJE 1FJGE 2BM0A 1DARA 1KVKA 2PNZA 2GO3A 4JI2I 1USVA 4YHHE 3M85G 4LF6E 2DEIA 2A2CA 1ZM2A 1XMQE 3M7NG 2Z5BA 5DNLA 4JYAE 2PO0B 5K36A 1RR9A 4NXMI 5JEAC 1OYPA 3QT6A 4JI5I 4DR1E 4LF5I 4IFDC 2J7KA 3L7ZA 2EFGA 1XMOI 4MU3A 2VF3A 4LF7E
chains in the Genus database with same CATH topology
1Z0GA 2Z5BB 3B8HA 4DR5E 1N0UA 5GMDA 4B3MI 1IBME 1HNWI 2X36A 4DV0E 1KIJA 1H72C 4JI7E 4DR7E 1Z5CA 1Z0TA 3ZM7A 4YY3E 1Z0CA 3PYFA 1K47A 1ZM9A 3WU5A 1FKAE 2Z5EA 2HKEA 2ZITA 3T1HE 4JI6I 1Y4UA 4DV7E 1FJGI 1MG7A 3P06A 3K17A 3PYEA 5IWAE 4MYUA 5A2QC 2E5LI 4JI1E 4LF6I 2UXDI 3B82A 1EA6A 3WU6A 2UXBE 4DR1I 4DV6I 1A6FA 1USUA 2PNMA 4DR6I 2V2VA 3Q6MA 4KHPE 4AQYE 4IZKA 2DEJA 1HNZE 4LF7I 1B63A 4JI8E 4X64E 2HHHE 1NHIA 4JV5E 5LMUE 1HNXE 3J80Q 3PYGA 3GONA 1U2RA 3QT5A 4DV0I 4UT4A 4JI7I 1Z59A 4DR7I 4IZJA 2PNLA 1PIEA 3JAMC 4B3RI 4X65E 1HR0E 4DR2I 1IBKI 4IZKB 1H74A 4JI0E 1H73A 4DPUA 4HACA 4LFAE 4R1FA 2UUBI 4JI4I 5IWAI 4JI1I 3J81Q 2UUAI 5FLXC 4LF8I 1N33E 4LF4E 3HJCA 5IT9C 4JI3E 2UU9E 4B3SE 4IZJB 4DV3E 1XNQE 4WUDA 4X66I 1XNRE 4N3OA 1N36E 2VQEE 4JG4A 4HY1A 3V2UC 3V5RA 3D4JA 4HACB 4XTJA 2V34A 4DR3I 4KHPI 1I94E 2HK2A 3WU4A 2GS8A 4JI8I 2HHHI 4HXZA 4GKKI 5LMUI 1HNXI 3J7AM 4DV5I 1NHJA 4LFBI 1UEKA 4NXNI 2HFUA 3H4LA 1Y6ZA 4DR4E 3Q1QA 4DPTA 1Z0BA 2CGEA 4X65I 2IOPA 1BKNA 5LL6R 1NZ0A 2F4VE 2O1VA 2XEXA 2Z5CA 4LFAI 4URLA 1H7UA 1WUUA 1ZXNA 4B3TI 1J5EI 2UUCI 4DUZE 2CZ9A 2IOQA 1PVGA 2O1UA 4LF4I 1H7SA 3ZKDA 4LF9I 1Z5AA 2UU9I 5A2QQ 3T1YE 4K0KI 1N36I 4GKJI 3J7AG 2VQEI 1ZM4A 1NHHA 2CG9A 4PRXA 5BR8E 1MX0A 1FNMA 4YHHI 2O1WA 1XMQI 2Z5CB 4LFCE 4JYAI 2UXCE 1RREA 3QT7A 3QT8A 4ZVIA 4DV4E 4OX9E 4X62E 4DR4I 4FW9A 2V8PA 3OTOE 4DU8A 1Z0EA 1N34E 3B78A 4I3HA 4P7AA 2X7IA 1Z0VA 1FI4A 2V2QA 4DR5I 4DPXA 1IBMI 2HKJA 4WUBA 2R42A 5L3JA 1Z5BA 4YY3I 4UTGA 3LTOA 4NXME 1ZM3A 3T1YI 5FWKA 4DU7A 4JI5E 1N32E 1KKHA 1S4EA 3T1HI 5IT9Q 4DV7I 3LPSA 4ED4A 2BV3A 5BR8I 2R3VA 3HULA 3J80C 4DPWA 4FWDA 3ZKBA 2UXBI 4EMDA 4IZJD 3M6AA 2VQFE 2OI2A 4AQYI 2E1RA 4DPYA 1HNZI 4X64I 4DXLA 4JV5I 5LMNE 4WUCA 3PYDA 4JI6E 1OJ4A 3J81C 1Y4SA 1MU5A 1EI1A 3PRYA 2E5LE 2ZM6E 2UXDE 1HK7A 4KQVA 1HR0I 4HYMA 2NPFA 4JI0I 1N32I 2A2DA 3ZZ0A 4DV6E 4PRVA 4DR6E 1D6TA 3K85A 2WW4A 1N33I 4JI3I 4B3SI 4DV3I 1S16A 1XNQI 2BM1A 1VISA 1XNRI 1Z0WA 2Q2EB 1FWKA 4MYTA 2VQFI 1I94I 2V2ZA 4DUYE 1IBLE 4B3RE 3Q6NA 4DV2E 5LMNI 4DR2E 1IBKE 1ELOA 1PKPA 4P52A 2UUBE 4RPFA 4FWHA 4DV1E 2HK3A 4JI4E 4USKA 2ZM6I 1ZXMA 2UUAE 4LF8E 2ZBKB 2GQ0A 2F4VI 4X66E 3JAMQ 1N0VC 3ZZUA 1KTVA 4JI2E 4PU9A 4M1KA 1QZRA 4DR3E 4DUZI 3WU3A 4GKKE 5FLXQ 3CWVA 4USMA 4DV5E 4LF5E 3LNUA 5GMEA 4LFBE 4NXNE 4FN5A 1XMOE 4LFCI 3F0NA 1FWLA 4FWGA 2HFSA 4DUYI 1IBLI 1B62A 4DV2I 2UXCI 4B3ME 1HNWE 2LJPA 4DV4I 3ZZTA 2AJ4A 4OX9I 4X62I 1XHKA 4DV1I 4B3TE 1J5EE 2UUCE 3OTOI 4Z7YA 1N34I 4LF9E 2O1TA 4K0KE 3K1JA 4Z7CA 4GKJE 1FJGE 2BM0A 1DARA 1KVKA 4JI2I 1USVA 4YHHE 4LF6E 2DEIA 2A2CA 1ZM2A 1XMQE 2Z5BA 4JYAE 1RR9A 4NXMI 3QT6A 4JI5I 4DR1E 4LF5I 2J7KA 2EFGA 1XMOI 2VF3A 4LF7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0G A;  3B8H A;  4DR5 E;  1N0U A;  5GMD A;  4B3M I;  1IBM E;  1HNW I;  2X36 A;  4DV0 E;  1KIJ A;  1H72 C;  4JI7 E;  4DR7 E;  1Z5C A;  1Z0T A;  3ZM7 A;  4YY3 E;  1Z0C A;  3PYF A;  1K47 A;  1ZM9 A;  3WU5 A;  1FKA E;  2HKE A;  2ZIT A;  3T1H E;  4JI6 I;  4DV7 E;  1FJG I;  1MG7 A;  3K17 A;  3PYE A;  5IWA E;  4MYU A;  5A2Q C;  2E5L I;  4JI1 E;  4LF6 I;  2UXD I;  3B82 A;  1EA6 A;  3WU6 A;  2UXB E;  4DR1 I;  4DV6 I;  1A6F A;  4DR6 I;  2V2V A;  4KHP E;  4AQY E;  2DEJ A;  1HNZ E;  4LF7 I;  1B63 A;  4JI8 E;  4X64 E;  2HHH E;  1NHI A;  4JV5 E;  5LMU E;  1HNX E;  3J80 Q;  3PYG A;  3GON A;  1U2R A;  3QT5 A;  4DV0 I;  4UT4 A;  4JI7 I;  1Z59 A;  4DR7 I;  3JAM C;  1PIE A;  4B3R I;  4X65 E;  1HR0 E;  4DR2 I;  1IBK I;  1H74 A;  4JI0 E;  1H73 A;  4DPU A;  4HAC A;  4LFA E;  4R1F A;  2UUB I;  4JI4 I;  5IWA I;  4JI1 I;  3J81 Q;  2UUA I;  5FLX C;  4LF8 I;  1N33 E;  4LF4 E;  5IT9 C;  4JI3 E;  2UU9 E;  4B3S E;  4DV3 E;  1XNQ E;  4WUD A;  4X66 I;  1XNR E;  1N36 E;  2VQE E;  4JG4 A;  4HY1 A;  3V2U C;  3V5R A;  3D4J A;  4HAC B;  4XTJ A;  2V34 A;  4DR3 I;  4KHP I;  1I94 E;  2HK2 A;  3WU4 A;  2GS8 A;  4JI8 I;  2HHH I;  4HXZ A;  4GKK I;  5LMU I;  1HNX I;  3J7A M;  4DV5 I;  1NHJ A;  4LFB I;  1UEK A;  4NXN I;  2HFU A;  3H4L A;  4DR4 E;  3Q1Q A;  4DPT A;  1Z0B A;  4X65 I;  1BKN A;  5LL6 R;  1NZ0 A;  2F4V E;  2XEX A;  4LFA I;  4URL A;  1H7U A;  1WUU A;  1ZXN A;  4B3T I;  1J5E I;  2UUC I;  4DUZ E;  2CZ9 A;  1PVG A;  4LF4 I;  1H7S A;  3ZKD A;  4LF9 I;  1Z5A A;  2UU9 I;  5A2Q Q;  3T1Y E;  4K0K I;  1N36 I;  4GKJ I;  3J7A G;  2VQE I;  1ZM4 A;  1NHH A;  5BR8 E;  4PRX A;  1MX0 A;  1FNM A;  4YHH I;  1XMQ I;  4LFC E;  4JYA I;  2UXC E;  1RRE A;  3QT7 A;  3QT8 A;  4ZVI A;  4DV4 E;  4OX9 E;  4X62 E;  4DR4 I;  4FW9 A;  2V8P A;  3OTO E;  4DU8 A;  1Z0E A;  1N34 E;  3B78 A;  4I3H A;  4P7A A;  2X7I A;  1Z0V A;  1FI4 A;  2V2Q A;  4DR5 I;  4DPX A;  1IBM I;  2HKJ A;  4WUB A;  2R42 A;  5L3J A;  1Z5B A;  4YY3 I;  4UTG A;  3LTO A;  4NXM E;  1ZM3 A;  3T1Y I;  4DU7 A;  4JI5 E;  1N32 E;  1KKH A;  1S4E A;  3T1H I;  5IT9 Q;  4DV7 I;  3LPS A;  4ED4 A;  2BV3 A;  5BR8 I;  2R3V A;  3HUL A;  3J80 C;  4DPW A;  4FWD A;  3ZKB A;  2UXB I;  4EMD A;  3M6A A;  2VQF E;  2OI2 A;  4AQY I;  2E1R A;  4DPY A;  1HNZ I;  4X64 I;  4DXL A;  4JV5 I;  5LMN E;  4WUC A;  3PYD A;  4JI6 E;  1OJ4 A;  3J81 C;  1MU5 A;  1EI1 A;  2E5L E;  2ZM6 E;  2UXD E;  4KQV A;  1HR0 I;  4HYM A;  2NPF A;  4JI0 I;  1N32 I;  2A2D A;  3ZZ0 A;  4DV6 E;  4PRV A;  4DR6 E;  1D6T A;  2WW4 A;  1N33 I;  4JI3 I;  4B3S I;  4DV3 I;  1S16 A;  1XNQ I;  2BM1 A;  1VIS A;  1XNR I;  1Z0W A;  2Q2E B;  1FWK A;  4MYT A;  2VQF I;  1I94 I;  2V2Z A;  4DUY E;  1IBL E;  4B3R E;  4DV2 E;  5LMN I;  4DR2 E;  1IBK E;  1ELO A;  1PKP A;  4P52 A;  2UUB E;  4RPF A;  4FWH A;  4DV1 E;  2HK3 A;  4JI4 E;  4USK A;  2ZM6 I;  1ZXM A;  2UUA E;  4LF8 E;  2ZBK B;  2F4V I;  4X66 E;  3JAM Q;  1N0V C;  3ZZU A;  1KTV A;  4JI2 E;  4PU9 A;  4M1K A;  1QZR A;  4DR3 E;  4DUZ I;  3WU3 A;  4GKK E;  5FLX Q;  3CWV A;  4USM A;  4DV5 E;  4LF5 E;  3LNU A;  5GME A;  4LFB E;  4NXN E;  4FN5 A;  1XMO E;  4LFC I;  3F0N A;  1FWL A;  4FWG A;  2HFS A;  4DUY I;  1IBL I;  1B62 A;  4DV2 I;  2UXC I;  4B3M E;  1HNW E;  2LJP A;  4DV4 I;  3ZZT A;  2AJ4 A;  4OX9 I;  4X62 I;  1XHK A;  4DV1 I;  4B3T E;  1J5E E;  2UUC E;  3OTO I;  4Z7Y A;  1N34 I;  4LF9 E;  4K0K E;  3K1J A;  4Z7C A;  4GKJ E;  1FJG E;  2BM0 A;  1DAR A;  1KVK A;  4JI2 I;  4YHH E;  4LF6 E;  2DEI A;  2A2C A;  1ZM2 A;  1XMQ E;  4JYA E;  1RR9 A;  4NXM I;  3QT6 A;  4JI5 I;  4DR1 E;  4LF5 I;  2J7K A;  2EFG A;  1XMO I;  2VF3 A;  4LF7 E; 
#chains in the Genus database with same CATH topology
 1Z0G A;  2Z5B B;  3B8H A;  4FW6 A;  4DR5 E;  1N0U A;  5GMD A;  4B3M I;  5JEA F;  1IBM E;  1HNW I;  2X36 A;  4DV0 E;  1KIJ A;  1H72 C;  4JI7 E;  4DR7 E;  1Z5C A;  1Z0T A;  2NN6 C;  3ZM7 A;  4IFD F;  4YY3 E;  1Z0C A;  4BA2 B;  3L7Z B;  3PYF A;  1K47 A;  1ZM9 A;  3WU5 A;  1FKA E;  2Z5E A;  3PS3 A;  2HKE A;  2ZIT A;  3T1H E;  4JI6 I;  1Y4U A;  4BA1 A;  4DV7 E;  1FJG I;  1MG7 A;  3P06 A;  1E3H A;  3K17 A;  3PYE A;  5IWA E;  4MYU A;  5A2Q C;  2E5L I;  4JI1 E;  4LF6 I;  2UXD I;  4MU0 A;  3B82 A;  1EA6 A;  3WU6 A;  4IS9 A;  2UXB E;  4DR1 I;  3P76 A;  4DV6 I;  1A6F A;  1USU A;  2PNM A;  4FW7 A;  4DR6 I;  2V2V A;  3Q6M A;  4KHP E;  4AQY E;  4IZK A;  1YHC A;  2DEJ A;  1HNZ E;  4LF7 I;  1B63 A;  4JI8 E;  4X64 E;  2HHH E;  1NHI A;  5DRO A;  4JV5 E;  5LMU E;  1HNX E;  3J80 Q;  3PYG A;  3GON A;  1U2R A;  3QT5 A;  4DV0 I;  4UT4 A;  4JI7 I;  1Z59 A;  4DR7 I;  3GCM A;  4IZJ A;  2PNL A;  1PIE A;  3JAM C;  2NN6 D;  4B3R I;  4MU1 A;  4X65 E;  1HR0 E;  4DR2 I;  1IBK I;  4IZK B;  1UDO A;  2C38 A;  1H74 A;  2O3Z A;  4JI0 E;  1H73 A;  1XXE A;  4DPU A;  4HAC A;  4LFA E;  3P3E A;  4R1F A;  2UUB I;  4JI4 I;  5IWA I;  4JI1 I;  4U3D A;  3J81 Q;  2UUA I;  5FLX C;  1R6L A;  4LF8 I;  3P3C A;  4LF4 E;  1Y5Y A;  2BA1 G;  3HJC A;  1N33 E;  5IT9 C;  4JI3 E;  4ISA A;  2UU9 E;  4B3S E;  5C0X D;  4IZJ B;  4DV3 E;  1XNQ E;  2JEB A;  4WUD A;  4X66 I;  1XNR E;  4N3O A;  1N36 E;  4JG4 A;  2VQE E;  4HY1 A;  3V2U C;  3V5R A;  2C38 B;  3D4J A;  4LOM A;  4HAC B;  4XTJ A;  2V34 A;  4DR3 I;  4KHP I;  1I94 E;  5K36 E;  2HK2 A;  2PO2 B;  3WU4 A;  2JE6 A;  3P3G A;  2GS8 A;  4JI8 I;  2HHH I;  4HXZ A;  4GKK I;  5LMU I;  1HNX I;  3J7A M;  4DV5 I;  1NHJ A;  4OO1 A;  1UDS A;  3PS1 A;  4LFB I;  1UEK A;  2JEB B;  4NXN I;  2HFU A;  3H4L A;  1Y6Z A;  2C39 A;  1OYS A;  5ELW A;  4DR4 E;  3Q1Q A;  2PNZ B;  1P42 A;  2BA0 G;  4DPT A;  1Z0B A;  2CGE A;  4X65 I;  2IOP A;  1BKN A;  5LL6 R;  1NZ0 A;  2F4V E;  5K36 B;  2O1V A;  2JE6 B;  2XEX A;  2Z5C A;  4LFA I;  4URL A;  1H7U A;  1WUU A;  5K36 D;  1ZXN A;  4B3T I;  1J5E I;  2UUC I;  4DUZ E;  2CZ9 A;  2BR2 A;  2IOQ A;  1PVG A;  3M85 D;  4OZE A;  4AIM A;  2O1U A;  4LF4 I;  1H7S A;  3M7N D;  3ZKD A;  4LF9 I;  1Z5A A;  2UU9 I;  5A2Q Q;  3T1Y E;  4K0K I;  4FW4 A;  1N36 I;  4GKJ I;  4LCH A;  3J7A G;  1RHY A;  2VQE I;  1ZM4 A;  1NHH A;  2CG9 A;  4PRX A;  5BR8 E;  1MX0 A;  1FNM A;  5JEA A;  4YHH I;  2O1W A;  4AM3 A;  5C0X C;  1XMQ I;  2Z5C B;  4LFC E;  4OKG A;  4JYA I;  2NN6 F;  1VI7 A;  4MQY A;  4IFD A;  2C37 A;  2UXC E;  1RRE A;  3QT7 A;  3QT8 A;  4ZVI A;  4DV4 E;  4OX9 E;  2CVE A;  3DD6 A;  4X62 E;  4BA1 B;  4DR4 I;  4FW9 A;  5EL9 A;  2V8P A;  3OTO E;  2AE8 A;  4DU8 A;  1Z0E A;  1N34 E;  3B78 A;  5C0X F;  4I3H A;  1Y60 A;  4P7A A;  2X7I A;  1Z0V A;  1FI4 A;  2V2Q A;  3U1K A;  4DPX A;  4DR5 I;  1IBM I;  2C37 B;  2HKJ A;  4WUB A;  2R42 A;  5L3J A;  1Z5B A;  4YY3 I;  4UTG A;  3LTO A;  4NXM E;  1ZM3 A;  3T1Y I;  5FWK A;  4DU7 A;  4JI5 E;  1N32 E;  1KKH A;  1S4E A;  3T1H I;  5IT9 Q;  4NBQ A;  4DV7 I;  5K36 C;  3LPS A;  4ED4 A;  2BV3 A;  5BR8 I;  4FW3 A;  2R3V A;  3HUL A;  2PO1 A;  3J80 C;  4DPW A;  4FWD A;  3ZKB A;  3CDJ A;  2UXB I;  3KRN A;  4EMD A;  2F1D A;  2JT2 A;  5DRP A;  4IZJ D;  3M6A A;  3HKM A;  2IES A;  2WP8 A;  5K36 F;  2VQF E;  2OI2 A;  4AQY I;  1OYR A;  2E1R A;  4DPY A;  1HNZ I;  4X64 I;  4AID A;  4DXL A;  4JV5 I;  5LMN E;  4WUC A;  4QNJ A;  1UDQ A;  4OO1 E;  3PYD A;  2PO1 B;  4JI6 E;  1OJ4 A;  3J81 C;  1Y4S A;  5DRR A;  1MU5 A;  1EI1 A;  3PRY A;  2E5L E;  2ZM6 E;  1UDN A;  2UXD E;  2WP8 B;  1HK7 A;  2BA1 D;  4KQV A;  1HR0 I;  4HYM A;  2NPF A;  4JI0 I;  1N32 I;  2A2D A;  3ZZ0 A;  4DV6 E;  4GQU A;  4BA2 A;  4PRV A;  4OO1 B;  4DR6 E;  1D6T A;  3K85 A;  2WW4 A;  2C39 B;  1N33 I;  4JI3 I;  4B3S I;  4OO1 D;  4DV3 I;  1S16 A;  1XNQ I;  2BM1 A;  1VIS A;  1XNR I;  4MDT A;  1Z0W A;  2Q2E B;  3B4T A;  1FWK A;  5JEA E;  2VES A;  4MYT A;  3NZK A;  1YH8 A;  2VQF I;  1I94 I;  2V2Z A;  4DUY E;  4U3B A;  1IBL E;  4B3R E;  4FW5 A;  4IFD E;  3Q6N A;  4QNK A;  2BA0 D;  2BR2 B;  2IER A;  4DV2 E;  3CDI A;  4J3D A;  5LMN I;  4DR2 E;  1IBK E;  3GLL A;  1ELO A;  2J65 A;  1PKP A;  4P52 A;  2UUB E;  4RPF A;  4FWH A;  4DV1 E;  2HK3 A;  1R6M A;  4JI4 E;  4USK A;  2ZM6 I;  1ZXM A;  2UUA E;  4LF8 E;  5JEA B;  2ZBK B;  5DNX A;  2GQ0 A;  2NN6 E;  2F4V I;  4X66 E;  2NN6 A;  3JAM Q;  1N0V C;  3ZZU A;  1KTV A;  4IFD B;  5JEA D;  4JI2 E;  4PU9 A;  4M1K A;  4LCF A;  1QZR A;  4DR3 E;  4DUZ I;  4IFD D;  2WNR A;  3WU3 A;  4LPF A;  3U1Y A;  4GKK E;  3GME A;  5FLX Q;  3CWV A;  5C0X E;  4USM A;  4DV5 E;  4LF5 E;  3LNU A;  5C0X A;  2JEA A;  5GME A;  4LFB E;  4MU4 A;  4NXN E;  2NN6 B;  5EKW A;  3UHM A;  4FN5 A;  1XMO E;  4OO1 C;  4LFC I;  3F0N A;  1FWL A;  4FWG A;  2HFS A;  4DUY I;  1IBL I;  2GO4 A;  2WNR B;  1B62 A;  4DV2 I;  2UXC I;  4LCG A;  4B3M E;  1HNW E;  2LJP A;  3PS2 A;  4DV4 I;  3ZZT A;  2AJ4 A;  4OX9 I;  2PO0 A;  4X62 I;  5C0X B;  2JEA B;  1XHK A;  4DV1 I;  2PO2 A;  4B3T E;  1J5E E;  2UUC E;  5DRQ A;  3OTO I;  4Z7Y A;  1E3P A;  1N34 I;  4LF9 E;  2O1T A;  4OO1 F;  4K0K E;  3K1J A;  3H1C A;  4Z7C A;  4GKJ E;  1FJG E;  2BM0 A;  1DAR A;  1KVK A;  2PNZ A;  2GO3 A;  4JI2 I;  1USV A;  4YHH E;  3M85 G;  4LF6 E;  2DEI A;  2A2C A;  1ZM2 A;  1XMQ E;  3M7N G;  2Z5B A;  5DNL A;  4JYA E;  2PO0 B;  5K36 A;  1RR9 A;  4NXM I;  5JEA C;  1OYP A;  3QT6 A;  4JI5 I;  4DR1 E;  4LF5 I;  4IFD C;  2J7K A;  3L7Z A;  2EFG A;  1XMO I;  4MU3 A;  2VF3 A;  4LF7 E; 
#chains in the Genus database with same CATH homology
 1Z0G A;  2Z5B B;  3B8H A;  4DR5 E;  1N0U A;  5GMD A;  4B3M I;  1IBM E;  1HNW I;  2X36 A;  4DV0 E;  1KIJ A;  1H72 C;  4JI7 E;  4DR7 E;  1Z5C A;  1Z0T A;  3ZM7 A;  4YY3 E;  1Z0C A;  3PYF A;  1K47 A;  1ZM9 A;  3WU5 A;  1FKA E;  2Z5E A;  2HKE A;  2ZIT A;  3T1H E;  4JI6 I;  1Y4U A;  4DV7 E;  1FJG I;  1MG7 A;  3P06 A;  3K17 A;  3PYE A;  5IWA E;  4MYU A;  5A2Q C;  2E5L I;  4JI1 E;  4LF6 I;  2UXD I;  3B82 A;  1EA6 A;  3WU6 A;  2UXB E;  4DR1 I;  4DV6 I;  1A6F A;  1USU A;  2PNM A;  4DR6 I;  2V2V A;  3Q6M A;  4KHP E;  4AQY E;  4IZK A;  2DEJ A;  1HNZ E;  4LF7 I;  1B63 A;  4JI8 E;  4X64 E;  2HHH E;  1NHI A;  4JV5 E;  5LMU E;  1HNX E;  3J80 Q;  3PYG A;  3GON A;  1U2R A;  3QT5 A;  4DV0 I;  4UT4 A;  4JI7 I;  1Z59 A;  4DR7 I;  4IZJ A;  2PNL A;  1PIE A;  3JAM C;  4B3R I;  4X65 E;  1HR0 E;  4DR2 I;  1IBK I;  4IZK B;  1H74 A;  4JI0 E;  1H73 A;  4DPU A;  4HAC A;  4LFA E;  4R1F A;  2UUB I;  4JI4 I;  5IWA I;  4JI1 I;  3J81 Q;  2UUA I;  5FLX C;  4LF8 I;  1N33 E;  4LF4 E;  3HJC A;  5IT9 C;  4JI3 E;  2UU9 E;  4B3S E;  4IZJ B;  4DV3 E;  1XNQ E;  4WUD A;  4X66 I;  1XNR E;  4N3O A;  1N36 E;  2VQE E;  4JG4 A;  4HY1 A;  3V2U C;  3V5R A;  3D4J A;  4HAC B;  4XTJ A;  2V34 A;  4DR3 I;  4KHP I;  1I94 E;  2HK2 A;  3WU4 A;  2GS8 A;  4JI8 I;  2HHH I;  4HXZ A;  4GKK I;  5LMU I;  1HNX I;  3J7A M;  4DV5 I;  1NHJ A;  4LFB I;  1UEK A;  4NXN I;  2HFU A;  3H4L A;  1Y6Z A;  4DR4 E;  3Q1Q A;  4DPT A;  1Z0B A;  2CGE A;  4X65 I;  2IOP A;  1BKN A;  5LL6 R;  1NZ0 A;  2F4V E;  2O1V A;  2XEX A;  2Z5C A;  4LFA I;  4URL A;  1H7U A;  1WUU A;  1ZXN A;  4B3T I;  1J5E I;  2UUC I;  4DUZ E;  2CZ9 A;  2IOQ A;  1PVG A;  2O1U A;  4LF4 I;  1H7S A;  3ZKD A;  4LF9 I;  1Z5A A;  2UU9 I;  5A2Q Q;  3T1Y E;  4K0K I;  1N36 I;  4GKJ I;  3J7A G;  2VQE I;  1ZM4 A;  1NHH A;  2CG9 A;  4PRX A;  5BR8 E;  1MX0 A;  1FNM A;  4YHH I;  2O1W A;  1XMQ I;  2Z5C B;  4LFC E;  4JYA I;  2UXC E;  1RRE A;  3QT7 A;  3QT8 A;  4ZVI A;  4DV4 E;  4OX9 E;  4X62 E;  4DR4 I;  4FW9 A;  2V8P A;  3OTO E;  4DU8 A;  1Z0E A;  1N34 E;  3B78 A;  4I3H A;  4P7A A;  2X7I A;  1Z0V A;  1FI4 A;  2V2Q A;  4DR5 I;  4DPX A;  1IBM I;  2HKJ A;  4WUB A;  2R42 A;  5L3J A;  1Z5B A;  4YY3 I;  4UTG A;  3LTO A;  4NXM E;  1ZM3 A;  3T1Y I;  5FWK A;  4DU7 A;  4JI5 E;  1N32 E;  1KKH A;  1S4E A;  3T1H I;  5IT9 Q;  4DV7 I;  3LPS A;  4ED4 A;  2BV3 A;  5BR8 I;  2R3V A;  3HUL A;  3J80 C;  4DPW A;  4FWD A;  3ZKB A;  2UXB I;  4EMD A;  4IZJ D;  3M6A A;  2VQF E;  2OI2 A;  4AQY I;  2E1R A;  4DPY A;  1HNZ I;  4X64 I;  4DXL A;  4JV5 I;  5LMN E;  4WUC A;  3PYD A;  4JI6 E;  1OJ4 A;  3J81 C;  1Y4S A;  1MU5 A;  1EI1 A;  3PRY A;  2E5L E;  2ZM6 E;  2UXD E;  1HK7 A;  4KQV A;  1HR0 I;  4HYM A;  2NPF A;  4JI0 I;  1N32 I;  2A2D A;  3ZZ0 A;  4DV6 E;  4PRV A;  4DR6 E;  1D6T A;  3K85 A;  2WW4 A;  1N33 I;  4JI3 I;  4B3S I;  4DV3 I;  1S16 A;  1XNQ I;  2BM1 A;  1VIS A;  1XNR I;  1Z0W A;  2Q2E B;  1FWK A;  4MYT A;  2VQF I;  1I94 I;  2V2Z A;  4DUY E;  1IBL E;  4B3R E;  3Q6N A;  4DV2 E;  5LMN I;  4DR2 E;  1IBK E;  1ELO A;  1PKP A;  4P52 A;  2UUB E;  4RPF A;  4FWH A;  4DV1 E;  2HK3 A;  4JI4 E;  4USK A;  2ZM6 I;  1ZXM A;  2UUA E;  4LF8 E;  2ZBK B;  2GQ0 A;  2F4V I;  4X66 E;  3JAM Q;  1N0V C;  3ZZU A;  1KTV A;  4JI2 E;  4PU9 A;  4M1K A;  1QZR A;  4DR3 E;  4DUZ I;  3WU3 A;  4GKK E;  5FLX Q;  3CWV A;  4USM A;  4DV5 E;  4LF5 E;  3LNU A;  5GME A;  4LFB E;  4NXN E;  4FN5 A;  1XMO E;  4LFC I;  3F0N A;  1FWL A;  4FWG A;  2HFS A;  4DUY I;  1IBL I;  1B62 A;  4DV2 I;  2UXC I;  4B3M E;  1HNW E;  2LJP A;  4DV4 I;  3ZZT A;  2AJ4 A;  4OX9 I;  4X62 I;  1XHK A;  4DV1 I;  4B3T E;  1J5E E;  2UUC E;  3OTO I;  4Z7Y A;  1N34 I;  4LF9 E;  2O1T A;  4K0K E;  3K1J A;  4Z7C A;  4GKJ E;  1FJG E;  2BM0 A;  1DAR A;  1KVK A;  4JI2 I;  1USV A;  4YHH E;  4LF6 E;  2DEI A;  2A2C A;  1ZM2 A;  1XMQ E;  2Z5B A;  4JYA E;  1RR9 A;  4NXM I;  3QT6 A;  4JI5 I;  4DR1 E;  4LF5 I;  2J7K A;  2EFG A;  1XMO I;  2VF3 A;  4LF7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...