3WU4A

Oxidized-form structure of e.coli lon proteolytic domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
b'GQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 59
structure length 178
sequence length 178
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu4A01
4EMDA 4LF7I 3LNUA 1I94E 3ZZTA 3GONA 1Z0EA 2F4VE 1IBKE 1Z0GA 4DR5E 4JI1E 4P52A 1D6TA 4HY1A 3CWVA 2UXCE 4DV0I 2BM0A 3M6AA 2V2VA 1MX0A 1IBME 2HHHI 1PIEA 3J7AM 3H4LA 3WU4A 4DV6E 4X65I 4WUBA 4LFAE 1QZRA 2A2DA 4B3SI 5LMNI 2CZ9A 4I3HA 1XNQI 3T1YI 4P7AA 1N36E 4UTGA 4JI4E 1IBLE 4LFCI 4GKJI 2J7KA 1XMQI 4JYAI 4AQYI 4FWHA 2VQFE 4LF8E 1NZ0A 2V8PA 2R3VA 4DR2E 2WW4A 4DPYA 4LF6E 2E5LE 3J80Q 1XMOE 4LF5I 4X62E 4DR3E 1FKAE 2X36A 1H72C 4HXZA 4DR1I 4DUYI 3WU5A 3ZKDA 4LF4I 4YY3E 2ZM6I 1HNWE 4LF9I 4DR4E 4DV3E 1BKNA 3PYFA 1HNZI 3LTOA 2UU9I 1UEKA 1Z5BA 4ZVIA 4PRVA 1NHIA 4KHPE 2AJ4A 3ZKBA 4B3RI 2UUAE 1NHHA 4DR5I 1Z5AA 4WUDA 2LJPA 4X64I 4B3TI 2UXCI 4XTJA 4NXME 2UXDE 4JI8I 1IBMI 3K17A 3F0NA 3J80C 3K1JA 4DV6I 4YHHE 1J5EI 4DR6E 4DR7I 4KQVA 4B3ME 4ED4A 4GKKE 2UXBI 4X66I 1KIJA 1H73A 4DPTA 1N36I 1IBLI 2V2ZA 5FLXQ 1FI4A 1Z0CA 4DV2I 3WU6A 4JI7E 4JV5E 1Z0TA 1FWLA 2VF3A 4DR2I 4OX9E 4LF6I 2E5LI 3J81Q 1N32E 4HACA 1ZM2A 4X62I 4HACB 4JI6E 4FWGA 1H7UA 1U2RA 4LFBI 1N34E 2VQEI 1ZM4A 3PYEA 4FW9A 1WUUA 4JI2I 1S16A 4DV1I 2HK3A 3J7AG 1HNWI 3OTOI 1XNRE 4DXLA 4UT4A 3B82A 4DPXA 4R1FA 1B62A 4LF7E 1ZM3A 4JI5E 1FNMA 1ZXNA 4DUZE 5LMUI 3LPSA 5FLXC 1KVKA 2HFSA 4DV4E 5GMDA 2X7IA 3QT8A 3V2UC 5IT9Q 4Z7YA 4K0KI 1S4EA 1PVGA 4WUCA 3ZZ0A 2UXDI 3T1HI 4MYTA 2HHHE 5IWAE 3HULA 3J81C 4Z7CA 2HKJA 1HR0E 2A2CA 4FN5A 4B3MI 1I94I 4B3SE 4RPFA 1XNQE 2HFUA 1Z59A 1KKHA 3T1YE 1RREA 2F4VI 1HNXE 1IBKI 2UUCE 4LFCE 4GKJE 1ZM9A 4JI1I 4AQYE 5L3JA 5LL6R 3ZM7A 2GS8A 2ZITA 4PRXA 4OX9I 4NXNE 1N32I 4FWDA 3B8HA 1FWKA 2Q2EB 4LF5E 4JI6I 1N0VC 4LFAI 4MYUA 4HYMA 4DR1E 1Z0BA 5IT9C 5A2QQ 4JI4I 4DV5E 2EFGA 3PYGA 2VQFI 1NHJA 4LF8I 1EA6A 1H7SA 1N0UA 4JI0E 1N33E 2UU9E 2R42A 4JI5I 1Z0WA 1XMOI 1Z5CA 1MG7A 2V34A 2HK2A 4DUZI 4B3RE 2UUBE 4DR3I 4PU9A 5GMEA 1A6FA 4JI3E 4DV4I 4X64E 4B3TE 4M1KA 4YY3I 2XEXA 4DR4I 4JI8E 5BR8E 1EI1A 4DV3I 4DV7E 5IWAI 1FJGE 4DPUA 1J5EE 1HR0I 1PKPA 4DR7E 2UXBE 4X66E 1KTVA 1ZXMA 4KHPI 1HNXI 2UUCI 5A2QC 2UUAI 4URLA 4DV2E 2NPFA 1OJ4A 4DV0E 2ZBKB 1ELOA 4NXMI 4NXNI 3JAMQ 3QT6A 3V5RA 2V2QA 4YHHI 4X65E 1VISA 4LFBE 4DR6I 1DARA 2VQEE 4GKKI 5LMNE 1RR9A 4DU8A 4JI2E 4DV1E 2E1RA 4DV5I 1XHKA 3OTOE 1K47A 1XMQE 2BV3A 4JYAE 3QT5A 4JI0I 2OI2A 4JI7I 4JV5I 2HKEA 1N33I 2BM1A 4USMA 3QT7A 1MU5A 1H74A 4USKA 4DU7A 3WU3A 1B63A 4DPWA 2UUBI 5LMUE 4JG4A 1N34I 2DEIA 4JI3I 4K0KE 3D4JA 4DUYE 3B78A 4LF4E 2ZM6E 2DEJA 4LF9E 1XNRI 5BR8I 3T1HE 4DV7I 1FJGI 3ZZUA 1HNZE 3JAMC 1Z0VA 3PYDA 3Q1QA
chains in the Genus database with same CATH superfamily
4EMDA 2Z5CA 4LF7I 3LNUA 1I94E 2Z5CB 4NBQA 3ZZTA 3GONA 3M85G 5K36F 1Z0EA 2F4VE 1IBKE 3KRNA 1UDSA 1Z0GA 4DR5E 4JI1E 3L7ZA 4P52A 1D6TA 2C38A 4HY1A 2C38B 3CWVA 2UXCE 4DV0I 3P3EA 2BM0A 4MU3A 3M6AA 2V2VA 1MX0A 4MQYA 1IBME 2HHHI 4IZJD 1PIEA 3M85D 3J7AM 3H4LA 2PO2A 2PO2B 1R6MA 3WU4A 4DV6E 4X65I 2Z5EA 4IZJB 5K36E 3Q6NA 4WUBA 4LFAE 1QZRA 2A2DA 4B3SI 5LMNI 4MU0A 2CZ9A 2CGEA 4I3HA 1XNQI 3T1YI 4P7AA 1N36E 4UTGA 4JI4E 1IBLE 1RHYA 4LFCI 2O1WA 4GKJI 2J7KA 1XMQI 4JYAI 3PRYA 4AQYI 4FWHA 2VQFE 4LF8E 1NZ0A 1USUA 3PS3A 4LCFA 2JEBA 2V8PA 3PS2A 2JEBB 2R3VA 5JEAD 4DR2E 2WW4A 4DPYA 4IZKA 2E5LE 3J80Q 4LF6E 4LCGA 4IZKB 5DROA 1USVA 1XMOE 5JEAA 5JEAB 4LF5I 4X62E 2IESA 4DR3E 1FKAE 2X36A 1H72C 4HXZA 4DR1I 2BA0G 4DUYI 3WU5A 3ZKDA 4LF4I 4YY3E 2ZM6I 1HNWE 4LF9I 2F1DA 2IOQA 4DR4E 2O3ZA 4DV3E 1BKNA 3PYFA 1P42A 1HNZI 1UDQA 3LTOA 5DNXA 2AE8A 2C39A 4U3DA 2UU9I 2C39B 2BA0D 1UEKA 1Z5BA 4ZVIA 4PRVA 5DRRA 1NHIA 4KHPE 2AJ4A 2C37A 3ZKBA 4MU4A 2C37B 4B3RI 1YH8A 2UUAE 1NHHA 5C0XC 4DR5I 1Z5AA 4WUDA 2LJPA 4X64I 4B3TI 2UXCI 5K36D 4XTJA 5ELWA 4NXME 5DRPA 4JI8I 2UXDE 5K36A 1IBMI 3K17A 5K36B 3F0NA 3J80C 3K1JA 4OO1F 4DV6I 4YHHE 3M7NG 1J5EI 2JE6A 3HJCA 4DR6E 4AIMA 4DR7I 2JE6B 4KQVA 4B3ME 4ED4A 4GKKE 2UXBI 4X66I 1KIJA 1H73A 2BR2A 3Q6MA 4DPTA 1N36I 2BR2B 1E3PA 1IBLI 2V2ZA 3HKMA 5FLXQ 1Y5YA 3M7ND 5EKWA 1FI4A 1Z0CA 4DV2I 3L7ZB 3WU6A 4JI7E 4JV5E 1Z0TA 1FWLA 4OO1E 2VF3A 3P06A 4DR2I 1UDNA 4OX9E 4FW4A 4LF6I 2E5LI 4OZEA 3J81Q 1N32E 3CDJA 4HACA 1YHCA 1ZM2A 4X62I 4HACB 4JI6E 4FWGA 1H7UA 1U2RA 4LFBI 4FW7A 1N34E 2VQEI 4QNKA 2WNRA 1ZM4A 2PO0A 2CVEA 2WNRB 3PYEA 4FW9A 1WUUA 2PO0B 4JI2I 1S16A 4DV1I 2HK3A 4LPFA 3GLLA 3J7AG 1HNWI 5JEAC 3OTOI 1XNRE 4DXLA 4UT4A 3B82A 1XXEA 4DPXA 3CDIA 4R1FA 1B62A 4LOMA 4LF7E 1ZM3A 4JI5E 1FNMA 1ZXNA 1Y60A 4DUZE 5EL9A 5LMUI 3LPSA 5FLXC 1KVKA 2HFSA 2X7IA 5GMDA 4DV4E 3QT8A 3V2UC 5IT9Q 5DNLA 4Z7YA 4K0KI 1S4EA 1PVGA 2CG9A 4WUCA 2GQ0A 3ZZ0A 2UXDI 3T1HI 4MYTA 2HHHE 5IWAE 3B4TA 3HULA 3J81C 4J3DA 4FW6A 4Z7CA 3UHMA 2HKJA 5FWKA 1HR0E 2A2CA 2Z5BA 4FN5A 2Z5BB 4B3MI 2VESA 1I94I 4B3SE 2GO3A 4RPFA 4OO1D 1XNQE 5K36C 2HFUA 1Z59A 1KKHA 3T1YE 1RREA 4OO1A 2F4VI 1HNXE 1IBKI 2UUCE 4LFCE 4OO1B 4GKJE 1ZM9A 4JI1I 4AQYE 4MU1A 4BA2A 5L3JA 4BA2B 5LL6R 2IOPA 3ZM7A 2GS8A 4GQUA 2ZITA 4PRXA 3U1KA 4OX9I 4IFDA 4NXNE 1N32I 4FWDA 3B8HA 1FWKA 4IS9A 2NN6F 2Q2EB 4LF5E 4N3OA 4JI6I 2GO4A 4OKGA 1N0VC 4LFAI 2JT2A 4MYUA 3NZKA 4HYMA 4DR1E 2BA1G 2PNMA 1Z0BA 4QNJA 2J65A 5IT9C 4FW3A 3GMEA 3P3CA 4IFDF 5A2QQ 3U1YA 4JI4I 4DV5E 2WP8A 2EFGA 3PYGA 1OYRA 2VQFI 1NHJA 4LF8I 1EA6A 1H7SA 1N0UA 4AM3A 2NN6E 4JI0E 1N33E 2UU9E 2BA1D 4BA1A 3GCMA 2R42A 4BA1B 4JI5I 3K85A 1Z0WA 1OYSA 1XMOI 1Z5CA 1MG7A 2V34A 2HK2A 4DUZI 5DRQA 4B3RE 2UUBE 4IFDE 4DR3I 4PU9A 5GMEA 2O1UA 1A6FA 4JI3E 3P3GA 4DV4I 4X64E 2PNZA 5C0XF 4B3TE 2PNZB 3H1CA 4M1KA 4YY3I 4ISAA 2XEXA 4DR4I 1EI1A 2PNLA 4JI8E 5BR8E 4DV3I 4DV7E 5IWAI 1FJGE 4DPUA 4IZJA 1J5EE 1HR0I 1PKPA 1R6LA 1Y4UA 4DR7E 2O1TA 2UXBE 4X66E 1KTVA 1ZXMA 4KHPI 5C0XE 4U3BA 1HNXI 2UUCI 5A2QC 1Y4SA 2UUAI 4URLA 2PO1A 4DV2E 2PO1B 2NPFA 1UDOA 1OJ4A 4DV0E 3PS1A 2ZBKB 1ELOA 3P76A 4NXMI 2NN6C 4NXNI 1OYPA 4OO1C 3JAMQ 3QT6A 3V5RA 2V2QA 4YHHI 4X65E 1VISA 4LFBE 4DR6I 1HK7A 1DARA 2VQEE 4GKKI 2NN6D 5LMNE 4IFDC 1RR9A 4DU8A 4JI2E 4DV1E 2NN6A 2E1RA 4DV5I 1XHKA 2NN6B 3OTOE 5JEAF 1K47A 1XMQE 4LCHA 2BV3A 4JYAE 1Y6ZA 3QT5A 4JI0I 2OI2A 4JI7I 4IFDD 2HKEA 4JV5I 1N33I 2BM1A 4USMA 3QT7A 4IFDB 1MU5A 1H74A 4USKA 4DU7A 3WU3A 1B63A 4DPWA 2UUBI 4MDTA 5LMUE 4JG4A 1N34I 2DEIA 4JI3I 4AIDA 5JEAE 4FW5A 4K0KE 3D4JA 4DUYE 3B78A 4LF4E 1VI7A 2ZM6E 2DEJA 4LF9E 1XNRI 5BR8I 3T1HE 4DV7I 1FJGI 2WP8B 3DD6A 5C0XD 3ZZUA 1HNZE 3JAMC 1Z0VA 3PYDA 2O1VA 2IERA 5C0XA 3Q1QA 1E3HA 2JEAA 5C0XB 2JEAB
chains in the Genus database with same CATH topology
4EMDA 2Z5CA 4LF7I 3LNUA 1I94E 2Z5CB 3ZZTA 3GONA 1Z0EA 2F4VE 1IBKE 1Z0GA 4DR5E 4JI1E 4P52A 1D6TA 4HY1A 3CWVA 2UXCE 4DV0I 2BM0A 3M6AA 2V2VA 1MX0A 1IBME 2HHHI 4IZJD 1PIEA 3J7AM 3H4LA 3WU4A 4DV6E 4X65I 2Z5EA 4IZJB 3Q6NA 4WUBA 4LFAE 1QZRA 2A2DA 4B3SI 5LMNI 2CZ9A 2CGEA 4I3HA 1XNQI 3T1YI 4P7AA 1N36E 4UTGA 4JI4E 1IBLE 2O1WA 4LFCI 4GKJI 2J7KA 1XMQI 4JYAI 3PRYA 4AQYI 4FWHA 2VQFE 4LF8E 1NZ0A 1USUA 2V8PA 2R3VA 4DR2E 2WW4A 4DPYA 4IZKA 2E5LE 3J80Q 4LF6E 4IZKB 1USVA 1XMOE 4LF5I 4X62E 4DR3E 1FKAE 2X36A 1H72C 4HXZA 4DR1I 4DUYI 3WU5A 3ZKDA 4LF4I 4YY3E 2ZM6I 1HNWE 4LF9I 2IOQA 4DR4E 4DV3E 1BKNA 3PYFA 1HNZI 3LTOA 2UU9I 1UEKA 1Z5BA 4ZVIA 4PRVA 1NHIA 4KHPE 2AJ4A 3ZKBA 4B3RI 2UUAE 1NHHA 4DR5I 1Z5AA 4WUDA 2LJPA 4X64I 4B3TI 2UXCI 4XTJA 4NXME 2UXDE 4JI8I 1IBMI 3K17A 3F0NA 3J80C 3K1JA 4DV6I 4YHHE 1J5EI 3HJCA 4DR6E 4DR7I 4KQVA 4B3ME 4ED4A 4GKKE 2UXBI 4X66I 1KIJA 1H73A 3Q6MA 4DPTA 1N36I 1IBLI 2V2ZA 5FLXQ 1FI4A 1Z0CA 4DV2I 3WU6A 4JI7E 4JV5E 1Z0TA 1FWLA 2VF3A 3P06A 4DR2I 4OX9E 4LF6I 2E5LI 3J81Q 1N32E 4HACA 1ZM2A 4X62I 4HACB 4JI6E 4FWGA 1H7UA 1U2RA 4LFBI 1N34E 2VQEI 1ZM4A 3PYEA 4FW9A 1WUUA 4JI2I 1S16A 4DV1I 2HK3A 3J7AG 1HNWI 3OTOI 1XNRE 4DXLA 4UT4A 3B82A 4DPXA 4R1FA 1B62A 4LF7E 1ZM3A 4JI5E 1FNMA 1ZXNA 4DUZE 5LMUI 3LPSA 5FLXC 1KVKA 2HFSA 4DV4E 5GMDA 2X7IA 3QT8A 3V2UC 5IT9Q 4Z7YA 4K0KI 1S4EA 1PVGA 2CG9A 4WUCA 2GQ0A 3ZZ0A 2UXDI 3T1HI 4MYTA 2HHHE 5IWAE 3HULA 3J81C 4Z7CA 2HKJA 5FWKA 1HR0E 2A2CA 2Z5BA 4FN5A 2Z5BB 4B3MI 1I94I 4B3SE 4RPFA 1XNQE 2HFUA 1Z59A 1KKHA 3T1YE 1RREA 2F4VI 1HNXE 1IBKI 2UUCE 4LFCE 4GKJE 1ZM9A 4JI1I 4AQYE 5L3JA 5LL6R 2IOPA 3ZM7A 2GS8A 2ZITA 4PRXA 4OX9I 4NXNE 1N32I 4FWDA 3B8HA 1FWKA 2Q2EB 4LF5E 4N3OA 4JI6I 1N0VC 4LFAI 4MYUA 4HYMA 4DR1E 2PNMA 1Z0BA 5IT9C 5A2QQ 4JI4I 4DV5E 2EFGA 3PYGA 2VQFI 1NHJA 4LF8I 1EA6A 1H7SA 1N0UA 4JI0E 1N33E 2UU9E 2R42A 4JI5I 3K85A 1Z0WA 1XMOI 1Z5CA 1MG7A 2V34A 2HK2A 4DUZI 4B3RE 2UUBE 4DR3I 4PU9A 5GMEA 2O1UA 1A6FA 4JI3E 4DV4I 4X64E 4B3TE 4M1KA 4YY3I 2XEXA 4DR4I 4JI8E 2PNLA 5BR8E 1EI1A 4DV3I 4DV7E 5IWAI 1FJGE 4DPUA 4IZJA 1J5EE 1HR0I 1PKPA 1Y4UA 4DR7E 2O1TA 2UXBE 4X66E 1KTVA 1ZXMA 4KHPI 1HNXI 2UUCI 5A2QC 1Y4SA 2UUAI 4URLA 4DV2E 2NPFA 1OJ4A 4DV0E 2ZBKB 1ELOA 4NXMI 4NXNI 3JAMQ 3QT6A 3V5RA 2V2QA 4YHHI 4X65E 1VISA 4LFBE 4DR6I 1HK7A 1DARA 2VQEE 4GKKI 5LMNE 1RR9A 4DU8A 4JI2E 4DV1E 2E1RA 4DV5I 1XHKA 3OTOE 1K47A 1XMQE 2BV3A 4JYAE 1Y6ZA 3QT5A 4JI0I 2OI2A 4JI7I 4JV5I 2HKEA 1N33I 2BM1A 4USMA 3QT7A 1MU5A 1H74A 4USKA 4DU7A 3WU3A 1B63A 4DPWA 2UUBI 5LMUE 4JG4A 1N34I 2DEIA 4JI3I 4K0KE 3D4JA 4DUYE 3B78A 4LF4E 2ZM6E 2DEJA 4LF9E 1XNRI 5BR8I 3T1HE 4DV7I 1FJGI 3ZZUA 1HNZE 3JAMC 1Z0VA 3PYDA 2O1VA 3Q1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMD A;  4LF7 I;  3LNU A;  1I94 E;  3ZZT A;  3GON A;  1Z0E A;  2F4V E;  1IBK E;  1Z0G A;  4DR5 E;  4JI1 E;  4P52 A;  1D6T A;  4HY1 A;  3CWV A;  2UXC E;  4DV0 I;  2BM0 A;  3M6A A;  2V2V A;  1MX0 A;  1IBM E;  2HHH I;  1PIE A;  3J7A M;  3H4L A;  3WU4 A;  4DV6 E;  4X65 I;  4WUB A;  4LFA E;  1QZR A;  2A2D A;  4B3S I;  5LMN I;  2CZ9 A;  4I3H A;  1XNQ I;  3T1Y I;  4P7A A;  1N36 E;  4UTG A;  4JI4 E;  1IBL E;  4LFC I;  4GKJ I;  2J7K A;  1XMQ I;  4JYA I;  4AQY I;  4FWH A;  2VQF E;  4LF8 E;  1NZ0 A;  2V8P A;  2R3V A;  4DR2 E;  2WW4 A;  4DPY A;  4LF6 E;  2E5L E;  3J80 Q;  1XMO E;  4LF5 I;  4X62 E;  4DR3 E;  1FKA E;  2X36 A;  1H72 C;  4HXZ A;  4DR1 I;  4DUY I;  3WU5 A;  3ZKD A;  4LF4 I;  4YY3 E;  2ZM6 I;  1HNW E;  4LF9 I;  4DR4 E;  4DV3 E;  1BKN A;  3PYF A;  1HNZ I;  3LTO A;  2UU9 I;  1UEK A;  1Z5B A;  4ZVI A;  4PRV A;  1NHI A;  4KHP E;  2AJ4 A;  3ZKB A;  4B3R I;  2UUA E;  1NHH A;  4DR5 I;  1Z5A A;  4WUD A;  2LJP A;  4X64 I;  4B3T I;  2UXC I;  4XTJ A;  4NXM E;  2UXD E;  4JI8 I;  1IBM I;  3K17 A;  3F0N A;  3J80 C;  3K1J A;  4DV6 I;  4YHH E;  1J5E I;  4DR6 E;  4DR7 I;  4KQV A;  4B3M E;  4ED4 A;  4GKK E;  2UXB I;  4X66 I;  1KIJ A;  1H73 A;  4DPT A;  1N36 I;  1IBL I;  2V2Z A;  5FLX Q;  1FI4 A;  1Z0C A;  4DV2 I;  3WU6 A;  4JI7 E;  4JV5 E;  1Z0T A;  1FWL A;  2VF3 A;  4DR2 I;  4OX9 E;  4LF6 I;  2E5L I;  3J81 Q;  1N32 E;  4HAC A;  1ZM2 A;  4X62 I;  4HAC B;  4JI6 E;  4FWG A;  1H7U A;  1U2R A;  4LFB I;  1N34 E;  2VQE I;  1ZM4 A;  3PYE A;  4FW9 A;  1WUU A;  4JI2 I;  1S16 A;  4DV1 I;  2HK3 A;  3J7A G;  1HNW I;  3OTO I;  1XNR E;  4DXL A;  4UT4 A;  3B82 A;  4DPX A;  4R1F A;  1B62 A;  4LF7 E;  1ZM3 A;  4JI5 E;  1FNM A;  1ZXN A;  4DUZ E;  5LMU I;  3LPS A;  5FLX C;  1KVK A;  2HFS A;  4DV4 E;  5GMD A;  2X7I A;  3QT8 A;  3V2U C;  5IT9 Q;  4Z7Y A;  4K0K I;  1S4E A;  1PVG A;  4WUC A;  3ZZ0 A;  2UXD I;  3T1H I;  4MYT A;  2HHH E;  5IWA E;  3HUL A;  3J81 C;  4Z7C A;  2HKJ A;  1HR0 E;  2A2C A;  4FN5 A;  4B3M I;  1I94 I;  4B3S E;  4RPF A;  1XNQ E;  2HFU A;  1Z59 A;  1KKH A;  3T1Y E;  1RRE A;  2F4V I;  1HNX E;  1IBK I;  2UUC E;  4LFC E;  4GKJ E;  1ZM9 A;  4JI1 I;  4AQY E;  5L3J A;  5LL6 R;  3ZM7 A;  2GS8 A;  2ZIT A;  4PRX A;  4OX9 I;  4NXN E;  1N32 I;  4FWD A;  3B8H A;  1FWK A;  2Q2E B;  4LF5 E;  4JI6 I;  1N0V C;  4LFA I;  4MYU A;  4HYM A;  4DR1 E;  1Z0B A;  5IT9 C;  5A2Q Q;  4JI4 I;  4DV5 E;  2EFG A;  3PYG A;  2VQF I;  1NHJ A;  4LF8 I;  1EA6 A;  1H7S A;  1N0U A;  4JI0 E;  1N33 E;  2UU9 E;  2R42 A;  4JI5 I;  1Z0W A;  1XMO I;  1Z5C A;  1MG7 A;  2V34 A;  2HK2 A;  4DUZ I;  4B3R E;  2UUB E;  4DR3 I;  4PU9 A;  5GME A;  1A6F A;  4JI3 E;  4DV4 I;  4X64 E;  4B3T E;  4M1K A;  4YY3 I;  2XEX A;  4DR4 I;  4JI8 E;  5BR8 E;  1EI1 A;  4DV3 I;  4DV7 E;  5IWA I;  1FJG E;  4DPU A;  1J5E E;  1HR0 I;  1PKP A;  4DR7 E;  2UXB E;  4X66 E;  1KTV A;  1ZXM A;  4KHP I;  1HNX I;  2UUC I;  5A2Q C;  2UUA I;  4URL A;  4DV2 E;  2NPF A;  1OJ4 A;  4DV0 E;  2ZBK B;  1ELO A;  4NXM I;  4NXN I;  3JAM Q;  3QT6 A;  3V5R A;  2V2Q A;  4YHH I;  4X65 E;  1VIS A;  4LFB E;  4DR6 I;  1DAR A;  2VQE E;  4GKK I;  5LMN E;  1RR9 A;  4DU8 A;  4JI2 E;  4DV1 E;  2E1R A;  4DV5 I;  1XHK A;  3OTO E;  1K47 A;  1XMQ E;  2BV3 A;  4JYA E;  3QT5 A;  4JI0 I;  2OI2 A;  4JI7 I;  4JV5 I;  2HKE A;  1N33 I;  2BM1 A;  4USM A;  3QT7 A;  1MU5 A;  1H74 A;  4USK A;  4DU7 A;  3WU3 A;  1B63 A;  4DPW A;  2UUB I;  5LMU E;  4JG4 A;  1N34 I;  2DEI A;  4JI3 I;  4K0K E;  3D4J A;  4DUY E;  3B78 A;  4LF4 E;  2ZM6 E;  2DEJ A;  4LF9 E;  1XNR I;  5BR8 I;  3T1H E;  4DV7 I;  1FJG I;  3ZZU A;  1HNZ E;  3JAM C;  1Z0V A;  3PYD A;  3Q1Q A; 
#chains in the Genus database with same CATH topology
 4EMD A;  2Z5C A;  4LF7 I;  3LNU A;  1I94 E;  2Z5C B;  4NBQ A;  3ZZT A;  3GON A;  3M85 G;  5K36 F;  1Z0E A;  2F4V E;  1IBK E;  3KRN A;  1UDS A;  1Z0G A;  4DR5 E;  4JI1 E;  3L7Z A;  4P52 A;  1D6T A;  2C38 A;  4HY1 A;  2C38 B;  3CWV A;  2UXC E;  4DV0 I;  3P3E A;  2BM0 A;  4MU3 A;  3M6A A;  2V2V A;  1MX0 A;  4MQY A;  1IBM E;  2HHH I;  4IZJ D;  1PIE A;  3M85 D;  3J7A M;  3H4L A;  2PO2 A;  2PO2 B;  1R6M A;  3WU4 A;  4DV6 E;  4X65 I;  2Z5E A;  4IZJ B;  5K36 E;  3Q6N A;  4WUB A;  4LFA E;  1QZR A;  2A2D A;  4B3S I;  5LMN I;  4MU0 A;  2CZ9 A;  2CGE A;  4I3H A;  1XNQ I;  3T1Y I;  4P7A A;  1N36 E;  4UTG A;  4JI4 E;  1IBL E;  1RHY A;  4LFC I;  2O1W A;  4GKJ I;  2J7K A;  1XMQ I;  4JYA I;  3PRY A;  4AQY I;  4FWH A;  2VQF E;  4LF8 E;  1NZ0 A;  1USU A;  3PS3 A;  4LCF A;  2JEB A;  2V8P A;  3PS2 A;  2JEB B;  2R3V A;  5JEA D;  4DR2 E;  2WW4 A;  4DPY A;  4IZK A;  2E5L E;  3J80 Q;  4LF6 E;  4LCG A;  4IZK B;  5DRO A;  1USV A;  1XMO E;  5JEA A;  5JEA B;  4LF5 I;  4X62 E;  2IES A;  4DR3 E;  1FKA E;  2X36 A;  1H72 C;  4HXZ A;  4DR1 I;  2BA0 G;  4DUY I;  3WU5 A;  3ZKD A;  4LF4 I;  4YY3 E;  2ZM6 I;  1HNW E;  4LF9 I;  2F1D A;  2IOQ A;  4DR4 E;  2O3Z A;  4DV3 E;  1BKN A;  3PYF A;  1P42 A;  1HNZ I;  1UDQ A;  3LTO A;  5DNX A;  2AE8 A;  2C39 A;  4U3D A;  2UU9 I;  2C39 B;  2BA0 D;  1UEK A;  1Z5B A;  4ZVI A;  4PRV A;  5DRR A;  1NHI A;  4KHP E;  2AJ4 A;  2C37 A;  3ZKB A;  4MU4 A;  2C37 B;  4B3R I;  1YH8 A;  2UUA E;  1NHH A;  5C0X C;  4DR5 I;  1Z5A A;  4WUD A;  2LJP A;  4X64 I;  4B3T I;  2UXC I;  5K36 D;  4XTJ A;  5ELW A;  4NXM E;  5DRP A;  4JI8 I;  2UXD E;  5K36 A;  1IBM I;  3K17 A;  5K36 B;  3F0N A;  3J80 C;  3K1J A;  4OO1 F;  4DV6 I;  4YHH E;  3M7N G;  1J5E I;  2JE6 A;  3HJC A;  4DR6 E;  4AIM A;  4DR7 I;  2JE6 B;  4KQV A;  4B3M E;  4ED4 A;  4GKK E;  2UXB I;  4X66 I;  1KIJ A;  1H73 A;  2BR2 A;  3Q6M A;  4DPT A;  1N36 I;  2BR2 B;  1E3P A;  1IBL I;  2V2Z A;  3HKM A;  5FLX Q;  1Y5Y A;  3M7N D;  5EKW A;  1FI4 A;  1Z0C A;  4DV2 I;  3L7Z B;  3WU6 A;  4JI7 E;  4JV5 E;  1Z0T A;  1FWL A;  4OO1 E;  2VF3 A;  3P06 A;  4DR2 I;  1UDN A;  4OX9 E;  4FW4 A;  4LF6 I;  2E5L I;  4OZE A;  3J81 Q;  1N32 E;  3CDJ A;  4HAC A;  1YHC A;  1ZM2 A;  4X62 I;  4HAC B;  4JI6 E;  4FWG A;  1H7U A;  1U2R A;  4LFB I;  4FW7 A;  1N34 E;  2VQE I;  4QNK A;  2WNR A;  1ZM4 A;  2PO0 A;  2CVE A;  2WNR B;  3PYE A;  4FW9 A;  1WUU A;  2PO0 B;  4JI2 I;  1S16 A;  4DV1 I;  2HK3 A;  4LPF A;  3GLL A;  3J7A G;  1HNW I;  5JEA C;  3OTO I;  1XNR E;  4DXL A;  4UT4 A;  3B82 A;  1XXE A;  4DPX A;  3CDI A;  4R1F A;  1B62 A;  4LOM A;  4LF7 E;  1ZM3 A;  4JI5 E;  1FNM A;  1ZXN A;  1Y60 A;  4DUZ E;  5EL9 A;  5LMU I;  3LPS A;  5FLX C;  1KVK A;  2HFS A;  2X7I A;  5GMD A;  4DV4 E;  3QT8 A;  3V2U C;  5IT9 Q;  5DNL A;  4Z7Y A;  4K0K I;  1S4E A;  1PVG A;  2CG9 A;  4WUC A;  2GQ0 A;  3ZZ0 A;  2UXD I;  3T1H I;  4MYT A;  2HHH E;  5IWA E;  3B4T A;  3HUL A;  3J81 C;  4J3D A;  4FW6 A;  4Z7C A;  3UHM A;  2HKJ A;  5FWK A;  1HR0 E;  2A2C A;  2Z5B A;  4FN5 A;  2Z5B B;  4B3M I;  2VES A;  1I94 I;  4B3S E;  2GO3 A;  4RPF A;  4OO1 D;  1XNQ E;  5K36 C;  2HFU A;  1Z59 A;  1KKH A;  3T1Y E;  1RRE A;  4OO1 A;  2F4V I;  1HNX E;  1IBK I;  2UUC E;  4LFC E;  4OO1 B;  4GKJ E;  1ZM9 A;  4JI1 I;  4AQY E;  4MU1 A;  4BA2 A;  5L3J A;  4BA2 B;  5LL6 R;  2IOP A;  3ZM7 A;  2GS8 A;  4GQU A;  2ZIT A;  4PRX A;  3U1K A;  4OX9 I;  4IFD A;  4NXN E;  1N32 I;  4FWD A;  3B8H A;  1FWK A;  4IS9 A;  2NN6 F;  2Q2E B;  4LF5 E;  4N3O A;  4JI6 I;  2GO4 A;  4OKG A;  1N0V C;  4LFA I;  2JT2 A;  4MYU A;  3NZK A;  4HYM A;  4DR1 E;  2BA1 G;  2PNM A;  1Z0B A;  4QNJ A;  2J65 A;  5IT9 C;  4FW3 A;  3GME A;  3P3C A;  4IFD F;  5A2Q Q;  3U1Y A;  4JI4 I;  4DV5 E;  2WP8 A;  2EFG A;  3PYG A;  1OYR A;  2VQF I;  1NHJ A;  4LF8 I;  1EA6 A;  1H7S A;  1N0U A;  4AM3 A;  2NN6 E;  4JI0 E;  1N33 E;  2UU9 E;  2BA1 D;  4BA1 A;  3GCM A;  2R42 A;  4BA1 B;  4JI5 I;  3K85 A;  1Z0W A;  1OYS A;  1XMO I;  1Z5C A;  1MG7 A;  2V34 A;  2HK2 A;  4DUZ I;  5DRQ A;  4B3R E;  2UUB E;  4IFD E;  4DR3 I;  4PU9 A;  5GME A;  2O1U A;  1A6F A;  4JI3 E;  3P3G A;  4DV4 I;  4X64 E;  2PNZ A;  5C0X F;  4B3T E;  2PNZ B;  3H1C A;  4M1K A;  4YY3 I;  4ISA A;  2XEX A;  4DR4 I;  1EI1 A;  2PNL A;  4JI8 E;  5BR8 E;  4DV3 I;  4DV7 E;  5IWA I;  1FJG E;  4DPU A;  4IZJ A;  1J5E E;  1HR0 I;  1PKP A;  1R6L A;  1Y4U A;  4DR7 E;  2O1T A;  2UXB E;  4X66 E;  1KTV A;  1ZXM A;  4KHP I;  5C0X E;  4U3B A;  1HNX I;  2UUC I;  5A2Q C;  1Y4S A;  2UUA I;  4URL A;  2PO1 A;  4DV2 E;  2PO1 B;  2NPF A;  1UDO A;  1OJ4 A;  4DV0 E;  3PS1 A;  2ZBK B;  1ELO A;  3P76 A;  4NXM I;  2NN6 C;  4NXN I;  1OYP A;  4OO1 C;  3JAM Q;  3QT6 A;  3V5R A;  2V2Q A;  4YHH I;  4X65 E;  1VIS A;  4LFB E;  4DR6 I;  1HK7 A;  1DAR A;  2VQE E;  4GKK I;  2NN6 D;  5LMN E;  4IFD C;  1RR9 A;  4DU8 A;  4JI2 E;  4DV1 E;  2NN6 A;  2E1R A;  4DV5 I;  1XHK A;  2NN6 B;  3OTO E;  5JEA F;  1K47 A;  1XMQ E;  4LCH A;  2BV3 A;  4JYA E;  1Y6Z A;  3QT5 A;  4JI0 I;  2OI2 A;  4JI7 I;  4IFD D;  2HKE A;  4JV5 I;  1N33 I;  2BM1 A;  4USM A;  3QT7 A;  4IFD B;  1MU5 A;  1H74 A;  4USK A;  4DU7 A;  3WU3 A;  1B63 A;  4DPW A;  2UUB I;  4MDT A;  5LMU E;  4JG4 A;  1N34 I;  2DEI A;  4JI3 I;  4AID A;  5JEA E;  4FW5 A;  4K0K E;  3D4J A;  4DUY E;  3B78 A;  4LF4 E;  1VI7 A;  2ZM6 E;  2DEJ A;  4LF9 E;  1XNR I;  5BR8 I;  3T1H E;  4DV7 I;  1FJG I;  2WP8 B;  3DD6 A;  5C0X D;  3ZZU A;  1HNZ E;  3JAM C;  1Z0V A;  3PYD A;  2O1V A;  2IER A;  5C0X A;  3Q1Q A;  1E3H A;  2JEA A;  5C0X B;  2JEA B; 
#chains in the Genus database with same CATH homology
 4EMD A;  2Z5C A;  4LF7 I;  3LNU A;  1I94 E;  2Z5C B;  3ZZT A;  3GON A;  1Z0E A;  2F4V E;  1IBK E;  1Z0G A;  4DR5 E;  4JI1 E;  4P52 A;  1D6T A;  4HY1 A;  3CWV A;  2UXC E;  4DV0 I;  2BM0 A;  3M6A A;  2V2V A;  1MX0 A;  1IBM E;  2HHH I;  4IZJ D;  1PIE A;  3J7A M;  3H4L A;  3WU4 A;  4DV6 E;  4X65 I;  2Z5E A;  4IZJ B;  3Q6N A;  4WUB A;  4LFA E;  1QZR A;  2A2D A;  4B3S I;  5LMN I;  2CZ9 A;  2CGE A;  4I3H A;  1XNQ I;  3T1Y I;  4P7A A;  1N36 E;  4UTG A;  4JI4 E;  1IBL E;  2O1W A;  4LFC I;  4GKJ I;  2J7K A;  1XMQ I;  4JYA I;  3PRY A;  4AQY I;  4FWH A;  2VQF E;  4LF8 E;  1NZ0 A;  1USU A;  2V8P A;  2R3V A;  4DR2 E;  2WW4 A;  4DPY A;  4IZK A;  2E5L E;  3J80 Q;  4LF6 E;  4IZK B;  1USV A;  1XMO E;  4LF5 I;  4X62 E;  4DR3 E;  1FKA E;  2X36 A;  1H72 C;  4HXZ A;  4DR1 I;  4DUY I;  3WU5 A;  3ZKD A;  4LF4 I;  4YY3 E;  2ZM6 I;  1HNW E;  4LF9 I;  2IOQ A;  4DR4 E;  4DV3 E;  1BKN A;  3PYF A;  1HNZ I;  3LTO A;  2UU9 I;  1UEK A;  1Z5B A;  4ZVI A;  4PRV A;  1NHI A;  4KHP E;  2AJ4 A;  3ZKB A;  4B3R I;  2UUA E;  1NHH A;  4DR5 I;  1Z5A A;  4WUD A;  2LJP A;  4X64 I;  4B3T I;  2UXC I;  4XTJ A;  4NXM E;  2UXD E;  4JI8 I;  1IBM I;  3K17 A;  3F0N A;  3J80 C;  3K1J A;  4DV6 I;  4YHH E;  1J5E I;  3HJC A;  4DR6 E;  4DR7 I;  4KQV A;  4B3M E;  4ED4 A;  4GKK E;  2UXB I;  4X66 I;  1KIJ A;  1H73 A;  3Q6M A;  4DPT A;  1N36 I;  1IBL I;  2V2Z A;  5FLX Q;  1FI4 A;  1Z0C A;  4DV2 I;  3WU6 A;  4JI7 E;  4JV5 E;  1Z0T A;  1FWL A;  2VF3 A;  3P06 A;  4DR2 I;  4OX9 E;  4LF6 I;  2E5L I;  3J81 Q;  1N32 E;  4HAC A;  1ZM2 A;  4X62 I;  4HAC B;  4JI6 E;  4FWG A;  1H7U A;  1U2R A;  4LFB I;  1N34 E;  2VQE I;  1ZM4 A;  3PYE A;  4FW9 A;  1WUU A;  4JI2 I;  1S16 A;  4DV1 I;  2HK3 A;  3J7A G;  1HNW I;  3OTO I;  1XNR E;  4DXL A;  4UT4 A;  3B82 A;  4DPX A;  4R1F A;  1B62 A;  4LF7 E;  1ZM3 A;  4JI5 E;  1FNM A;  1ZXN A;  4DUZ E;  5LMU I;  3LPS A;  5FLX C;  1KVK A;  2HFS A;  4DV4 E;  5GMD A;  2X7I A;  3QT8 A;  3V2U C;  5IT9 Q;  4Z7Y A;  4K0K I;  1S4E A;  1PVG A;  2CG9 A;  4WUC A;  2GQ0 A;  3ZZ0 A;  2UXD I;  3T1H I;  4MYT A;  2HHH E;  5IWA E;  3HUL A;  3J81 C;  4Z7C A;  2HKJ A;  5FWK A;  1HR0 E;  2A2C A;  2Z5B A;  4FN5 A;  2Z5B B;  4B3M I;  1I94 I;  4B3S E;  4RPF A;  1XNQ E;  2HFU A;  1Z59 A;  1KKH A;  3T1Y E;  1RRE A;  2F4V I;  1HNX E;  1IBK I;  2UUC E;  4LFC E;  4GKJ E;  1ZM9 A;  4JI1 I;  4AQY E;  5L3J A;  5LL6 R;  2IOP A;  3ZM7 A;  2GS8 A;  2ZIT A;  4PRX A;  4OX9 I;  4NXN E;  1N32 I;  4FWD A;  3B8H A;  1FWK A;  2Q2E B;  4LF5 E;  4N3O A;  4JI6 I;  1N0V C;  4LFA I;  4MYU A;  4HYM A;  4DR1 E;  2PNM A;  1Z0B A;  5IT9 C;  5A2Q Q;  4JI4 I;  4DV5 E;  2EFG A;  3PYG A;  2VQF I;  1NHJ A;  4LF8 I;  1EA6 A;  1H7S A;  1N0U A;  4JI0 E;  1N33 E;  2UU9 E;  2R42 A;  4JI5 I;  3K85 A;  1Z0W A;  1XMO I;  1Z5C A;  1MG7 A;  2V34 A;  2HK2 A;  4DUZ I;  4B3R E;  2UUB E;  4DR3 I;  4PU9 A;  5GME A;  2O1U A;  1A6F A;  4JI3 E;  4DV4 I;  4X64 E;  4B3T E;  4M1K A;  4YY3 I;  2XEX A;  4DR4 I;  4JI8 E;  2PNL A;  5BR8 E;  1EI1 A;  4DV3 I;  4DV7 E;  5IWA I;  1FJG E;  4DPU A;  4IZJ A;  1J5E E;  1HR0 I;  1PKP A;  1Y4U A;  4DR7 E;  2O1T A;  2UXB E;  4X66 E;  1KTV A;  1ZXM A;  4KHP I;  1HNX I;  2UUC I;  5A2Q C;  1Y4S A;  2UUA I;  4URL A;  4DV2 E;  2NPF A;  1OJ4 A;  4DV0 E;  2ZBK B;  1ELO A;  4NXM I;  4NXN I;  3JAM Q;  3QT6 A;  3V5R A;  2V2Q A;  4YHH I;  4X65 E;  1VIS A;  4LFB E;  4DR6 I;  1HK7 A;  1DAR A;  2VQE E;  4GKK I;  5LMN E;  1RR9 A;  4DU8 A;  4JI2 E;  4DV1 E;  2E1R A;  4DV5 I;  1XHK A;  3OTO E;  1K47 A;  1XMQ E;  2BV3 A;  4JYA E;  1Y6Z A;  3QT5 A;  4JI0 I;  2OI2 A;  4JI7 I;  4JV5 I;  2HKE A;  1N33 I;  2BM1 A;  4USM A;  3QT7 A;  1MU5 A;  1H74 A;  4USK A;  4DU7 A;  3WU3 A;  1B63 A;  4DPW A;  2UUB I;  5LMU E;  4JG4 A;  1N34 I;  2DEI A;  4JI3 I;  4K0K E;  3D4J A;  4DUY E;  3B78 A;  4LF4 E;  2ZM6 E;  2DEJ A;  4LF9 E;  1XNR I;  5BR8 I;  3T1H E;  4DV7 I;  1FJG I;  3ZZU A;  1HNZ E;  3JAM C;  1Z0V A;  3PYD A;  2O1V A;  3Q1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...