4DR3I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr3I00
3LNUA 4JYAE 4FN5A 1KVKA 4LFCI 4GKKE 1MX0A 4DR1I 1Z5AA 5GMDA 3PYGA 3LPSA 3M6AA 4B3TI 1HNXI 1PKPA 3H4LA 4X66I 1N36I 1HNWE 4LF8I 4X64I 1NZ0A 4FWDA 4HACB 4LF7I 4DV3I 4JI7E 3LTOA 4JI0E 4B3SI 3F0NA 1N0VC 4Z7CA 5IT9Q 2VF3A 4X65I 1FI4A 1QZRA 4LFAI 4HACA 4DR7E 1KKHA 1IBLE 1Z5CA 2UXCI 4DU8A 1HR0I 3OTOI 2HHHE 5BR8E 4NXME 1S16A 1XMOE 1A6FA 4RPFA 2E1RA 2A2CA 1N34E 1Z0WA 4DU7A 4B3RI 2E5LI 4GKJE 1ZM3A 1XNQE 4XTJA 1VISA 5IWAI 4DR6E 4LF4I 4JI3E 1FNMA 4DV6E 1FJGI 3WU3A 3JAMC 4DR5I 3WU5A 4NXNE 3V5RA 4DR4E 1IBKI 1IBME 4AQYE 1FKAE 2HKEA 1NHHA 3D4JA 3T1HI 4K0KI 4DV5I 4DXLA 1ZXMA 2ZITA 4JV5E 3T1YI 4MYTA 2BM0A 4DV0I 1B63A 1KTVA 3QT6A 4P7AA 1B62A 1HNZI 2HK2A 2ZM6I 4MYUA 3QT7A 2A2DA 4DUYE 4LF9E 1ZM4A 4LFBE 4KHPI 4JI4E 4DPWA 1Z0TA 2GS8A 1EI1A 4JI5E 1N0UA 5GMEA 3K1JA 4I3HA 2LJPA 1ZM9A 4DR3I 2UXDI 5A2QQ 2X36A 2VQFI 4DR2I 3B82A 3GONA 4OX9E 1Z59A 1MG7A 1D6TA 4X62E 1MU5A 1XHKA 4EMDA 4LFCE 3CWVA 4DPXA 1RR9A 4DR1E 1OJ4A 1Z0GA 2HHHI 1XMOI 3Q1QA 4DUZI 4B3TE 3PYFA 4PRXA 1HNXE 1J5EI 1WUUA 4GKJI 5LMUI 1I94I 2UUAI 3QT5A 4ZVIA 4DV4I 4LF7E 4DV3E 3ZZTA 3PYEA 4B3SE 4JI1E 3ZKDA 4JI8E 4DV2E 4X65E 2VQEE 1ELOA 4DV7I 1XNRI 2V2VA 1XMQE 2UXCE 4JI6I 1HR0E 4FWGA 3OTOE 3J81C 4ED4A 4KQVA 2F4VI 2UU9I 4PU9A 2V8PA 1IBMI 4DPUA 4AQYI 1PIEA 4LF5E 1FWLA 1RREA 4HXZA 4JG4A 4DV1I 3ZZUA 2HKJA 5IWAE 1ZM2A 4LF4E 1N33I 1S4EA 4Z7YA 4YY3I 1Z0BA 4B3MI 2UUCI 4YHHE 4JI2I 1K47A 5FLXC 1N32E 1FJGE 3J80C 5LMNE 2UXBI 4DR5E 1H7SA 2DEJA 5LL6R 4LF6I 3JAMQ 2NPFA 1IBKE 4JYAI 4GKKI 4PRVA 4HY1A 1ZXNA 2XEXA 4JI5I 1Z0VA 4WUBA 3WU4A 2OI2A 2HFUA 3T1HE 4K0KE 2J7KA 4R1FA 3WU6A 4DV5E 4USMA 2UUBE 3T1YE 1H72C 4DV0E 3ZM7A 2EFGA 1HNZE 3PYDA 4DPTA 3J7AM 1HNWI 2ZM6E 5IT9C 2HFSA 1Z0EA 2AJ4A 4JI0I 4JI7I 1H73A 4USKA 3ZKBA 2WW4A 4KHPE 4DR7I 1IBLI 3J7AG 5BR8I 4DR3E 4NXMI 2UXDE 4DPYA 2V2ZA 2V34A 1N34I 2VQFE 1BKNA 4DR2E 3HULA 1UEKA 4FW9A 4X66E 1XNQI 1N36E 4LF8E 1Z5BA 4JI1I 4X64E 4JI8I 4DV2I 2VQEI 4WUDA 2X7IA 4DR6I 3ZZ0A 2R3VA 1XMQI 2ZBKB 2BV3A 4LFAE 4JI3I 4DV6I 4DUZE 2R42A 1H7UA 1PVGA 2DEIA 3V2UC 1J5EE 4NXNI 5LMUE 4DR4I 3K17A 4LF5I 4B3RE 1I94E 2E5LE 2UUAE 2HK3A 4DV4E 1Z0CA 4WUCA 4YHHI 1NHIA 4DV7E 1N32I 1EA6A 1XNRE 4JV5I 5LMNI 1DARA 4JI6E 3QT8A 2F4VE 2UU9E 4FWHA 1KIJA 4DUYI 3J81Q 4LF9I 4URLA 4HYMA 4UT4A 4LFBI 4JI4I 2Q2EB 3B8HA 4DV1E 2CZ9A 2V2QA 5A2QC 2UUBI 1N33E 4YY3E 4B3ME 2UUCE 4JI2E 1NHJA 1U2RA 5L3JA 4P52A 2UXBE 4OX9I 2BM1A 5FLXQ 4M1KA 3J80Q 4UTGA 1H74A 1FWKA 4X62I 4LF6E 3B78A
chains in the Genus database with same CATH superfamily
3LNUA 4JYAE 4FN5A 1KVKA 4LFCI 4GKKE 1MX0A 3K85A 4DR1I 2GO4A 1OYSA 2PO0A 5K36D 1Z5AA 5GMDA 3PYGA 2PO2B 3P76A 3LPSA 3M6AA 5DRPA 4B3TI 1UDQA 1YHCA 5EKWA 1HNXI 1PKPA 3H4LA 4X66I 1OYPA 1N36I 1HNWE 4LF8I 4OKGA 4LCGA 2O1TA 5FWKA 4X64I 1NZ0A 2BR2B 3PS3A 4FWDA 4HACB 5C0XD 4U3DA 4LF7I 4DV3I 4JI7E 3LTOA 4JI0E 4B3SI 3F0NA 1N0VC 4FW6A 4GQUA 4Z7CA 5IT9Q 2PNLA 1OYRA 5DRQA 2WNRB 2VF3A 4X65I 1FI4A 1QZRA 4LFAI 4HACA 2BR2A 4DR7E 1KKHA 1IBLE 1Z5CA 2UXCI 1P42A 5JEAC 4DU8A 1Y6ZA 1HR0I 3OTOI 2C37B 2WNRA 5BR8E 2HHHE 4NXME 1S16A 1XMOE 2Z5CB 3M7NG 1A6FA 4RPFA 2E1RA 2A2CA 1N34E 1Z0WA 4DU7A 4B3RI 4BA1B 2E5LI 4GKJE 1ZM3A 1XNQE 3UHMA 2Z5CA 4QNKA 5K36B 4XTJA 1VISA 4BA1A 2Z5EA 5IWAI 4DR6E 4LF4I 4JI3E 1FNMA 2IESA 2Z5BB 4DV6E 1FJGI 3GMEA 3DD6A 3WU3A 3JAMC 4DR5I 5C0XB 3WU5A 3B4TA 4NXNE 2Z5BA 3V5RA 4DR4E 1IBKI 2IOPA 1XXEA 5JEAD 1IBME 4AQYE 5C0XA 2BA0G 1FKAE 2HKEA 4NBQA 1NHHA 1R6LA 3D4JA 4BA2B 3T1HI 4K0KI 4DV5I 4DXLA 1ZXMA 2ZITA 4JV5E 3T1YI 3KRNA 4MYTA 2BM0A 4DV0I 1B63A 1KTVA 4BA2A 3QT6A 2O1WA 5DROA 4P7AA 2NN6D 1B62A 1HNZI 4MU4A 4IFDC 2HK2A 2ZM6I 4MYUA 3QT7A 2A2DA 4DUYE 4LF9E 1VI7A 1ZM4A 2BA0D 4LFBE 4KHPI 4JI4E 4DPWA 1Y4UA 2GO3A 1Z0TA 2O1UA 2JE6B 2GS8A 1EI1A 4AM3A 4JI5E 1N0UA 5GMEA 3K1JA 4I3HA 2LJPA 1ZM9A 4IZJD 4DR3I 2UXDI 5A2QQ 2JE6A 2X36A 2VQFI 4DR2I 3B82A 3GONA 4OX9E 5JEAB 1Z59A 2PO2A 1MG7A 1D6TA 4X62E 1MU5A 1XHKA 2C38B 4EMDA 3M85G 2JEAB 3L7ZB 4LFCE 3CWVA 4DPXA 1RR9A 4DR1E 4N3OA 5JEAA 4MU1A 1OJ4A 1Z0GA 4IFDD 1Y5YA 2C38A 3P3CA 2JEBB 2HHHI 2JEAA 3L7ZA 5EL9A 1XMOI 3Q1QA 4MU0A 2NN6B 4DUZI 2BA1D 4B3TE 3PYFA 4OO1D 4FW3A 4PRXA 1HNXE 1J5EI 3HJCA 1WUUA 3Q6MA 4GKJI 5K36E 2NN6F 2JEBA 5LMUI 2NN6A 3PS1A 3CDIA 4MU3A 1I94I 2PO1B 2UUAI 3QT5A 4ZVIA 2C37A 4DV4I 3M85D 4LF7E 4DV3E 3ZZTA 3PYEA 4B3SE 4JI1E 4IZJB 3ZKDA 4JI8E 4DV2E 4X65E 2VQEE 1UDSA 1ELOA 4DV7I 1XNRI 2V2VA 5K36F 5C0XE 4OZEA 5K36A 1XMQE 2UXCE 4JI6I 1HR0E 4FWGA 4IZJA 3OTOE 3J81C 4ED4A 4KQVA 2F4VI 2UU9I 4PU9A 2PNZB 2V8PA 3PS2A 1IBMI 4DPUA 4AQYI 1PIEA 2O3ZA 4IFDB 4LF5E 5C0XF 1FWLA 1RREA 4FW4A 4HXZA 2PNZA 4JG4A 4AIDA 5DRRA 4DV1I 3ZZUA 2HKJA 5IWAE 4OO1B 3P3EA 1ZM2A 4LF4E 1N33I 1S4EA 4Z7YA 4YY3I 4IFDA 2IOQA 1Z0BA 4B3MI 2UUCI 4YHHE 4JI2I 1K47A 5FLXC 4OO1F 1N32E 2CG9A 1FJGE 3J80C 4AIMA 5LMNE 2UXBI 4OO1A 4DR5E 1H7SA 2DEJA 2JT2A 1R6MA 5LL6R 4LF6I 3JAMQ 2NPFA 1IBKE 4JYAI 4GKKI 4ISAA 4PRVA 4HY1A 1ZXNA 2XEXA 4LOMA 4JI5I 4IZKB 1Z0VA 4WUBA 3WU4A 2OI2A 1UDOA 2HFUA 3T1HE 1Y4SA 4K0KE 2J7KA 4R1FA 3WU6A 4DV5E 5JEAE 2C39B 4USMA 2UUBE 3T1YE 1YH8A 1H72C 2BA1G 2IERA 4DV0E 3ZM7A 2EFGA 2PO0B 1HNZE 3PYDA 4DPTA 3J7AM 1HNWI 2ZM6E 2C39A 3HKMA 5IT9C 2HFSA 1Z0EA 2AJ4A 2VESA 4JI0I 4JI7I 1UDNA 1H73A 4USKA 1HK7A 3ZKBA 4QNJA 5JEAF 2WW4A 2NN6E 4KHPE 2GQ0A 4DR7I 2F1DA 1IBLI 1E3PA 3J7AG 1Y60A 5BR8I 4LPFA 4DR3E 4NXMI 4DPYA 2UXDE 2V2ZA 2V34A 4U3BA 1N34I 1BKNA 2VQFE 4DR2E 3HULA 2PNMA 3GCMA 1UEKA 3P3GA 4FW9A 2WP8B 4X66E 5ELWA 1XNQI 1N36E 4LF8E 1Z5BA 2CVEA 4JI1I 4X64E 4JI8I 3U1KA 3Q6NA 4J3DA 2VQEI 4DV2I 3PRYA 1USUA 4WUDA 2WP8A 2X7IA 4DR6I 2AE8A 3ZZ0A 2R3VA 1XMQI 2ZBKB 2PO1A 2BV3A 4LFAE 4JI3I 5DNXA 4DV6I 4DUZE 3H1CA 2R42A 2J65A 1H7UA 1PVGA 2DEIA 3V2UC 1J5EE 4IFDE 4NXNI 3GLLA 5LMUE 4DR4I 3K17A 4LF5I 4B3RE 1I94E 2E5LE 4OO1E 2UUAE 2HK3A 4DV4E 2NN6C 1RHYA 5DNLA 1Z0CA 3NZKA 4FW5A 4WUCA 4YHHI 1NHIA 4DV7E 4IFDF 1EA6A 1XNRE 1N32I 4JV5I 5LMNI 2CGEA 1DARA 4MQYA 4LCHA 4LCFA 4JI6E 3M7ND 3QT8A 4FW7A 2F4VE 2UU9E 5K36C 4FWHA 1KIJA 4DUYI 1USVA 3J81Q 4LF9I 4IS9A 4URLA 4HYMA 4MDTA 4UT4A 4LFBI 4JI4I 2Q2EB 3B8HA 4DV1E 2CZ9A 2V2QA 5A2QC 2UUBI 1N33E 4YY3E 5C0XC 4B3ME 2UUCE 4JI2E 1NHJA 1U2RA 5L3JA 3P06A 4P52A 4IZKA 2UXBE 4OX9I 2BM1A 5FLXQ 4M1KA 3J80Q 4UTGA 1E3HA 1H74A 3CDJA 1FWKA 3U1YA 4X62I 4OO1C 2O1VA 4LF6E 3B78A
chains in the Genus database with same CATH topology
3LNUA 4JYAE 4FN5A 1KVKA 4LFCI 4GKKE 1MX0A 3K85A 4DR1I 1Z5AA 5GMDA 3PYGA 3LPSA 3M6AA 4B3TI 1HNXI 1PKPA 3H4LA 4X66I 1N36I 1HNWE 4LF8I 2O1TA 5FWKA 4X64I 1NZ0A 4FWDA 4HACB 4LF7I 4DV3I 4JI7E 3LTOA 4JI0E 4B3SI 3F0NA 1N0VC 4Z7CA 5IT9Q 2PNLA 2VF3A 4X65I 1FI4A 1QZRA 4LFAI 4HACA 4DR7E 1KKHA 1IBLE 1Z5CA 2UXCI 4DU8A 1Y6ZA 1HR0I 3OTOI 2HHHE 5BR8E 4NXME 1S16A 1XMOE 2Z5CB 1A6FA 4RPFA 2E1RA 2A2CA 1N34E 1Z0WA 4DU7A 4B3RI 2E5LI 4GKJE 1ZM3A 1XNQE 2Z5CA 4XTJA 1VISA 2Z5EA 5IWAI 4DR6E 4LF4I 4JI3E 1FNMA 2Z5BB 4DV6E 1FJGI 3WU3A 3JAMC 4DR5I 3WU5A 4NXNE 2Z5BA 3V5RA 4DR4E 1IBKI 2IOPA 1IBME 4AQYE 1FKAE 2HKEA 1NHHA 3D4JA 3T1HI 4K0KI 4DV5I 4DXLA 1ZXMA 2ZITA 4JV5E 3T1YI 4MYTA 2BM0A 4DV0I 1B63A 1KTVA 3QT6A 2O1WA 4P7AA 1B62A 1HNZI 2HK2A 2ZM6I 4MYUA 3QT7A 2A2DA 4DUYE 4LF9E 1ZM4A 4LFBE 4KHPI 4JI4E 4DPWA 1Y4UA 1Z0TA 2O1UA 2GS8A 1EI1A 4JI5E 1N0UA 5GMEA 3K1JA 4I3HA 2LJPA 1ZM9A 4IZJD 4DR3I 2UXDI 5A2QQ 2X36A 2VQFI 4DR2I 3B82A 3GONA 4OX9E 1Z59A 1MG7A 1D6TA 4X62E 1MU5A 1XHKA 4EMDA 4LFCE 3CWVA 4DPXA 1RR9A 4DR1E 4N3OA 1OJ4A 1Z0GA 2HHHI 1XMOI 3Q1QA 4DUZI 4B3TE 3PYFA 4PRXA 1HNXE 1J5EI 3HJCA 1WUUA 3Q6MA 4GKJI 5LMUI 1I94I 2UUAI 3QT5A 4ZVIA 4DV4I 4LF7E 4DV3E 3ZZTA 3PYEA 4B3SE 4JI1E 4IZJB 3ZKDA 4JI8E 4DV2E 4X65E 2VQEE 1ELOA 4DV7I 1XNRI 2V2VA 1XMQE 2UXCE 4JI6I 1HR0E 4FWGA 4IZJA 3OTOE 3J81C 4ED4A 4KQVA 2F4VI 2UU9I 4PU9A 2V8PA 1IBMI 4DPUA 4AQYI 1PIEA 4LF5E 1FWLA 1RREA 4HXZA 4JG4A 4DV1I 3ZZUA 2HKJA 5IWAE 1ZM2A 4LF4E 1N33I 1S4EA 4Z7YA 4YY3I 2IOQA 1Z0BA 4B3MI 2UUCI 4YHHE 4JI2I 1K47A 5FLXC 1N32E 2CG9A 1FJGE 3J80C 5LMNE 2UXBI 4DR5E 1H7SA 2DEJA 5LL6R 4LF6I 3JAMQ 2NPFA 1IBKE 4JYAI 4GKKI 4PRVA 4HY1A 1ZXNA 2XEXA 4JI5I 4IZKB 1Z0VA 4WUBA 3WU4A 2OI2A 2HFUA 3T1HE 1Y4SA 4K0KE 2J7KA 4R1FA 3WU6A 4DV5E 4USMA 2UUBE 3T1YE 1H72C 4DV0E 3ZM7A 2EFGA 1HNZE 3PYDA 4DPTA 3J7AM 1HNWI 2ZM6E 5IT9C 2HFSA 1Z0EA 2AJ4A 4JI0I 4JI7I 1H73A 4USKA 1HK7A 3ZKBA 2WW4A 4KHPE 2GQ0A 4DR7I 1IBLI 3J7AG 5BR8I 4DR3E 4NXMI 2UXDE 4DPYA 2V2ZA 2V34A 1N34I 2VQFE 1BKNA 4DR2E 3HULA 2PNMA 1UEKA 4FW9A 4X66E 1XNQI 1N36E 4LF8E 1Z5BA 4JI1I 4X64E 4JI8I 3Q6NA 4DV2I 2VQEI 3PRYA 1USUA 4WUDA 2X7IA 4DR6I 3ZZ0A 2R3VA 1XMQI 2ZBKB 2BV3A 4LFAE 4JI3I 4DV6I 4DUZE 2R42A 1H7UA 1PVGA 2DEIA 3V2UC 1J5EE 4NXNI 5LMUE 4DR4I 3K17A 4LF5I 4B3RE 1I94E 2E5LE 2UUAE 2HK3A 4DV4E 1Z0CA 4WUCA 4YHHI 1NHIA 4DV7E 1N32I 1EA6A 1XNRE 4JV5I 5LMNI 2CGEA 1DARA 4JI6E 3QT8A 2F4VE 2UU9E 4FWHA 1KIJA 4DUYI 1USVA 3J81Q 4LF9I 4URLA 4HYMA 4UT4A 4LFBI 4JI4I 2Q2EB 3B8HA 4DV1E 2CZ9A 2V2QA 5A2QC 2UUBI 1N33E 4YY3E 4B3ME 2UUCE 4JI2E 1NHJA 1U2RA 5L3JA 3P06A 4P52A 4IZKA 2UXBE 4OX9I 2BM1A 5FLXQ 4M1KA 3J80Q 4UTGA 1H74A 1FWKA 4X62I 2O1VA 4LF6E 3B78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNU A;  4JYA E;  4FN5 A;  1KVK A;  4LFC I;  4GKK E;  1MX0 A;  4DR1 I;  1Z5A A;  5GMD A;  3PYG A;  3LPS A;  3M6A A;  4B3T I;  1HNX I;  1PKP A;  3H4L A;  4X66 I;  1N36 I;  1HNW E;  4LF8 I;  4X64 I;  1NZ0 A;  4FWD A;  4HAC B;  4LF7 I;  4DV3 I;  4JI7 E;  3LTO A;  4JI0 E;  4B3S I;  3F0N A;  1N0V C;  4Z7C A;  5IT9 Q;  2VF3 A;  4X65 I;  1FI4 A;  1QZR A;  4LFA I;  4HAC A;  4DR7 E;  1KKH A;  1IBL E;  1Z5C A;  2UXC I;  4DU8 A;  1HR0 I;  3OTO I;  2HHH E;  5BR8 E;  4NXM E;  1S16 A;  1XMO E;  1A6F A;  4RPF A;  2E1R A;  2A2C A;  1N34 E;  1Z0W A;  4DU7 A;  4B3R I;  2E5L I;  4GKJ E;  1ZM3 A;  1XNQ E;  4XTJ A;  1VIS A;  5IWA I;  4DR6 E;  4LF4 I;  4JI3 E;  1FNM A;  4DV6 E;  1FJG I;  3WU3 A;  3JAM C;  4DR5 I;  3WU5 A;  4NXN E;  3V5R A;  4DR4 E;  1IBK I;  1IBM E;  4AQY E;  1FKA E;  2HKE A;  1NHH A;  3D4J A;  3T1H I;  4K0K I;  4DV5 I;  4DXL A;  1ZXM A;  2ZIT A;  4JV5 E;  3T1Y I;  4MYT A;  2BM0 A;  4DV0 I;  1B63 A;  1KTV A;  3QT6 A;  4P7A A;  1B62 A;  1HNZ I;  2HK2 A;  2ZM6 I;  4MYU A;  3QT7 A;  2A2D A;  4DUY E;  4LF9 E;  1ZM4 A;  4LFB E;  4KHP I;  4JI4 E;  4DPW A;  1Z0T A;  2GS8 A;  1EI1 A;  4JI5 E;  1N0U A;  5GME A;  3K1J A;  4I3H A;  2LJP A;  1ZM9 A;  4DR3 I;  2UXD I;  5A2Q Q;  2X36 A;  2VQF I;  4DR2 I;  3B82 A;  3GON A;  4OX9 E;  1Z59 A;  1MG7 A;  1D6T A;  4X62 E;  1MU5 A;  1XHK A;  4EMD A;  4LFC E;  3CWV A;  4DPX A;  1RR9 A;  4DR1 E;  1OJ4 A;  1Z0G A;  2HHH I;  1XMO I;  3Q1Q A;  4DUZ I;  4B3T E;  3PYF A;  4PRX A;  1HNX E;  1J5E I;  1WUU A;  4GKJ I;  5LMU I;  1I94 I;  2UUA I;  3QT5 A;  4ZVI A;  4DV4 I;  4LF7 E;  4DV3 E;  3ZZT A;  3PYE A;  4B3S E;  4JI1 E;  3ZKD A;  4JI8 E;  4DV2 E;  4X65 E;  2VQE E;  1ELO A;  4DV7 I;  1XNR I;  2V2V A;  1XMQ E;  2UXC E;  4JI6 I;  1HR0 E;  4FWG A;  3OTO E;  3J81 C;  4ED4 A;  4KQV A;  2F4V I;  2UU9 I;  4PU9 A;  2V8P A;  1IBM I;  4DPU A;  4AQY I;  1PIE A;  4LF5 E;  1FWL A;  1RRE A;  4HXZ A;  4JG4 A;  4DV1 I;  3ZZU A;  2HKJ A;  5IWA E;  1ZM2 A;  4LF4 E;  1N33 I;  1S4E A;  4Z7Y A;  4YY3 I;  1Z0B A;  4B3M I;  2UUC I;  4YHH E;  4JI2 I;  1K47 A;  5FLX C;  1N32 E;  1FJG E;  3J80 C;  5LMN E;  2UXB I;  4DR5 E;  1H7S A;  2DEJ A;  5LL6 R;  4LF6 I;  3JAM Q;  2NPF A;  1IBK E;  4JYA I;  4GKK I;  4PRV A;  4HY1 A;  1ZXN A;  2XEX A;  4JI5 I;  1Z0V A;  4WUB A;  3WU4 A;  2OI2 A;  2HFU A;  3T1H E;  4K0K E;  2J7K A;  4R1F A;  3WU6 A;  4DV5 E;  4USM A;  2UUB E;  3T1Y E;  1H72 C;  4DV0 E;  3ZM7 A;  2EFG A;  1HNZ E;  3PYD A;  4DPT A;  3J7A M;  1HNW I;  2ZM6 E;  5IT9 C;  2HFS A;  1Z0E A;  2AJ4 A;  4JI0 I;  4JI7 I;  1H73 A;  4USK A;  3ZKB A;  2WW4 A;  4KHP E;  4DR7 I;  1IBL I;  3J7A G;  5BR8 I;  4DR3 E;  4NXM I;  2UXD E;  4DPY A;  2V2Z A;  2V34 A;  1N34 I;  2VQF E;  1BKN A;  4DR2 E;  3HUL A;  1UEK A;  4FW9 A;  4X66 E;  1XNQ I;  1N36 E;  4LF8 E;  1Z5B A;  4JI1 I;  4X64 E;  4JI8 I;  4DV2 I;  2VQE I;  4WUD A;  2X7I A;  4DR6 I;  3ZZ0 A;  2R3V A;  1XMQ I;  2ZBK B;  2BV3 A;  4LFA E;  4JI3 I;  4DV6 I;  4DUZ E;  2R42 A;  1H7U A;  1PVG A;  2DEI A;  3V2U C;  1J5E E;  4NXN I;  5LMU E;  4DR4 I;  3K17 A;  4LF5 I;  4B3R E;  1I94 E;  2E5L E;  2UUA E;  2HK3 A;  4DV4 E;  1Z0C A;  4WUC A;  4YHH I;  1NHI A;  4DV7 E;  1N32 I;  1EA6 A;  1XNR E;  4JV5 I;  5LMN I;  1DAR A;  4JI6 E;  3QT8 A;  2F4V E;  2UU9 E;  4FWH A;  1KIJ A;  4DUY I;  3J81 Q;  4LF9 I;  4URL A;  4HYM A;  4UT4 A;  4LFB I;  4JI4 I;  2Q2E B;  3B8H A;  4DV1 E;  2CZ9 A;  2V2Q A;  5A2Q C;  2UUB I;  1N33 E;  4YY3 E;  4B3M E;  2UUC E;  4JI2 E;  1NHJ A;  1U2R A;  5L3J A;  4P52 A;  2UXB E;  4OX9 I;  2BM1 A;  5FLX Q;  4M1K A;  3J80 Q;  4UTG A;  1H74 A;  1FWK A;  4X62 I;  4LF6 E;  3B78 A; 
#chains in the Genus database with same CATH topology
 3LNU A;  4JYA E;  4FN5 A;  1KVK A;  4LFC I;  4GKK E;  1MX0 A;  3K85 A;  4DR1 I;  2GO4 A;  1OYS A;  2PO0 A;  5K36 D;  1Z5A A;  5GMD A;  3PYG A;  2PO2 B;  3P76 A;  3LPS A;  3M6A A;  5DRP A;  4B3T I;  1UDQ A;  1YHC A;  5EKW A;  1HNX I;  1PKP A;  3H4L A;  4X66 I;  1OYP A;  1N36 I;  1HNW E;  4LF8 I;  4OKG A;  4LCG A;  2O1T A;  5FWK A;  4X64 I;  1NZ0 A;  2BR2 B;  3PS3 A;  4FWD A;  4HAC B;  5C0X D;  4U3D A;  4LF7 I;  4DV3 I;  4JI7 E;  3LTO A;  4JI0 E;  4B3S I;  3F0N A;  1N0V C;  4FW6 A;  4GQU A;  4Z7C A;  5IT9 Q;  2PNL A;  1OYR A;  5DRQ A;  2WNR B;  2VF3 A;  4X65 I;  1FI4 A;  1QZR A;  4LFA I;  4HAC A;  2BR2 A;  4DR7 E;  1KKH A;  1IBL E;  1Z5C A;  2UXC I;  1P42 A;  5JEA C;  4DU8 A;  1Y6Z A;  1HR0 I;  3OTO I;  2C37 B;  2WNR A;  5BR8 E;  2HHH E;  4NXM E;  1S16 A;  1XMO E;  2Z5C B;  3M7N G;  1A6F A;  4RPF A;  2E1R A;  2A2C A;  1N34 E;  1Z0W A;  4DU7 A;  4B3R I;  4BA1 B;  2E5L I;  4GKJ E;  1ZM3 A;  1XNQ E;  3UHM A;  2Z5C A;  4QNK A;  5K36 B;  4XTJ A;  1VIS A;  4BA1 A;  2Z5E A;  5IWA I;  4DR6 E;  4LF4 I;  4JI3 E;  1FNM A;  2IES A;  2Z5B B;  4DV6 E;  1FJG I;  3GME A;  3DD6 A;  3WU3 A;  3JAM C;  4DR5 I;  5C0X B;  3WU5 A;  3B4T A;  4NXN E;  2Z5B A;  3V5R A;  4DR4 E;  1IBK I;  2IOP A;  1XXE A;  5JEA D;  1IBM E;  4AQY E;  5C0X A;  2BA0 G;  1FKA E;  2HKE A;  4NBQ A;  1NHH A;  1R6L A;  3D4J A;  4BA2 B;  3T1H I;  4K0K I;  4DV5 I;  4DXL A;  1ZXM A;  2ZIT A;  4JV5 E;  3T1Y I;  3KRN A;  4MYT A;  2BM0 A;  4DV0 I;  1B63 A;  1KTV A;  4BA2 A;  3QT6 A;  2O1W A;  5DRO A;  4P7A A;  2NN6 D;  1B62 A;  1HNZ I;  4MU4 A;  4IFD C;  2HK2 A;  2ZM6 I;  4MYU A;  3QT7 A;  2A2D A;  4DUY E;  4LF9 E;  1VI7 A;  1ZM4 A;  2BA0 D;  4LFB E;  4KHP I;  4JI4 E;  4DPW A;  1Y4U A;  2GO3 A;  1Z0T A;  2O1U A;  2JE6 B;  2GS8 A;  1EI1 A;  4AM3 A;  4JI5 E;  1N0U A;  5GME A;  3K1J A;  4I3H A;  2LJP A;  1ZM9 A;  4IZJ D;  4DR3 I;  2UXD I;  5A2Q Q;  2JE6 A;  2X36 A;  2VQF I;  4DR2 I;  3B82 A;  3GON A;  4OX9 E;  5JEA B;  1Z59 A;  2PO2 A;  1MG7 A;  1D6T A;  4X62 E;  1MU5 A;  1XHK A;  2C38 B;  4EMD A;  3M85 G;  2JEA B;  3L7Z B;  4LFC E;  3CWV A;  4DPX A;  1RR9 A;  4DR1 E;  4N3O A;  5JEA A;  4MU1 A;  1OJ4 A;  1Z0G A;  4IFD D;  1Y5Y A;  2C38 A;  3P3C A;  2JEB B;  2HHH I;  2JEA A;  3L7Z A;  5EL9 A;  1XMO I;  3Q1Q A;  4MU0 A;  2NN6 B;  4DUZ I;  2BA1 D;  4B3T E;  3PYF A;  4OO1 D;  4FW3 A;  4PRX A;  1HNX E;  1J5E I;  3HJC A;  1WUU A;  3Q6M A;  4GKJ I;  5K36 E;  2NN6 F;  2JEB A;  5LMU I;  2NN6 A;  3PS1 A;  3CDI A;  4MU3 A;  1I94 I;  2PO1 B;  2UUA I;  3QT5 A;  4ZVI A;  2C37 A;  4DV4 I;  3M85 D;  4LF7 E;  4DV3 E;  3ZZT A;  3PYE A;  4B3S E;  4JI1 E;  4IZJ B;  3ZKD A;  4JI8 E;  4DV2 E;  4X65 E;  2VQE E;  1UDS A;  1ELO A;  4DV7 I;  1XNR I;  2V2V A;  5K36 F;  5C0X E;  4OZE A;  5K36 A;  1XMQ E;  2UXC E;  4JI6 I;  1HR0 E;  4FWG A;  4IZJ A;  3OTO E;  3J81 C;  4ED4 A;  4KQV A;  2F4V I;  2UU9 I;  4PU9 A;  2PNZ B;  2V8P A;  3PS2 A;  1IBM I;  4DPU A;  4AQY I;  1PIE A;  2O3Z A;  4IFD B;  4LF5 E;  5C0X F;  1FWL A;  1RRE A;  4FW4 A;  4HXZ A;  2PNZ A;  4JG4 A;  4AID A;  5DRR A;  4DV1 I;  3ZZU A;  2HKJ A;  5IWA E;  4OO1 B;  3P3E A;  1ZM2 A;  4LF4 E;  1N33 I;  1S4E A;  4Z7Y A;  4YY3 I;  4IFD A;  2IOQ A;  1Z0B A;  4B3M I;  2UUC I;  4YHH E;  4JI2 I;  1K47 A;  5FLX C;  4OO1 F;  1N32 E;  2CG9 A;  1FJG E;  3J80 C;  4AIM A;  5LMN E;  2UXB I;  4OO1 A;  4DR5 E;  1H7S A;  2DEJ A;  2JT2 A;  1R6M A;  5LL6 R;  4LF6 I;  3JAM Q;  2NPF A;  1IBK E;  4JYA I;  4GKK I;  4ISA A;  4PRV A;  4HY1 A;  1ZXN A;  2XEX A;  4LOM A;  4JI5 I;  4IZK B;  1Z0V A;  4WUB A;  3WU4 A;  2OI2 A;  1UDO A;  2HFU A;  3T1H E;  1Y4S A;  4K0K E;  2J7K A;  4R1F A;  3WU6 A;  4DV5 E;  5JEA E;  2C39 B;  4USM A;  2UUB E;  3T1Y E;  1YH8 A;  1H72 C;  2BA1 G;  2IER A;  4DV0 E;  3ZM7 A;  2EFG A;  2PO0 B;  1HNZ E;  3PYD A;  4DPT A;  3J7A M;  1HNW I;  2ZM6 E;  2C39 A;  3HKM A;  5IT9 C;  2HFS A;  1Z0E A;  2AJ4 A;  2VES A;  4JI0 I;  4JI7 I;  1UDN A;  1H73 A;  4USK A;  1HK7 A;  3ZKB A;  4QNJ A;  5JEA F;  2WW4 A;  2NN6 E;  4KHP E;  2GQ0 A;  4DR7 I;  2F1D A;  1IBL I;  1E3P A;  3J7A G;  1Y60 A;  5BR8 I;  4LPF A;  4DR3 E;  4NXM I;  4DPY A;  2UXD E;  2V2Z A;  2V34 A;  4U3B A;  1N34 I;  1BKN A;  2VQF E;  4DR2 E;  3HUL A;  2PNM A;  3GCM A;  1UEK A;  3P3G A;  4FW9 A;  2WP8 B;  4X66 E;  5ELW A;  1XNQ I;  1N36 E;  4LF8 E;  1Z5B A;  2CVE A;  4JI1 I;  4X64 E;  4JI8 I;  3U1K A;  3Q6N A;  4J3D A;  2VQE I;  4DV2 I;  3PRY A;  1USU A;  4WUD A;  2WP8 A;  2X7I A;  4DR6 I;  2AE8 A;  3ZZ0 A;  2R3V A;  1XMQ I;  2ZBK B;  2PO1 A;  2BV3 A;  4LFA E;  4JI3 I;  5DNX A;  4DV6 I;  4DUZ E;  3H1C A;  2R42 A;  2J65 A;  1H7U A;  1PVG A;  2DEI A;  3V2U C;  1J5E E;  4IFD E;  4NXN I;  3GLL A;  5LMU E;  4DR4 I;  3K17 A;  4LF5 I;  4B3R E;  1I94 E;  2E5L E;  4OO1 E;  2UUA E;  2HK3 A;  4DV4 E;  2NN6 C;  1RHY A;  5DNL A;  1Z0C A;  3NZK A;  4FW5 A;  4WUC A;  4YHH I;  1NHI A;  4DV7 E;  4IFD F;  1EA6 A;  1XNR E;  1N32 I;  4JV5 I;  5LMN I;  2CGE A;  1DAR A;  4MQY A;  4LCH A;  4LCF A;  4JI6 E;  3M7N D;  3QT8 A;  4FW7 A;  2F4V E;  2UU9 E;  5K36 C;  4FWH A;  1KIJ A;  4DUY I;  1USV A;  3J81 Q;  4LF9 I;  4IS9 A;  4URL A;  4HYM A;  4MDT A;  4UT4 A;  4LFB I;  4JI4 I;  2Q2E B;  3B8H A;  4DV1 E;  2CZ9 A;  2V2Q A;  5A2Q C;  2UUB I;  1N33 E;  4YY3 E;  5C0X C;  4B3M E;  2UUC E;  4JI2 E;  1NHJ A;  1U2R A;  5L3J A;  3P06 A;  4P52 A;  4IZK A;  2UXB E;  4OX9 I;  2BM1 A;  5FLX Q;  4M1K A;  3J80 Q;  4UTG A;  1E3H A;  1H74 A;  3CDJ A;  1FWK A;  3U1Y A;  4X62 I;  4OO1 C;  2O1V A;  4LF6 E;  3B78 A; 
#chains in the Genus database with same CATH homology
 3LNU A;  4JYA E;  4FN5 A;  1KVK A;  4LFC I;  4GKK E;  1MX0 A;  3K85 A;  4DR1 I;  1Z5A A;  5GMD A;  3PYG A;  3LPS A;  3M6A A;  4B3T I;  1HNX I;  1PKP A;  3H4L A;  4X66 I;  1N36 I;  1HNW E;  4LF8 I;  2O1T A;  5FWK A;  4X64 I;  1NZ0 A;  4FWD A;  4HAC B;  4LF7 I;  4DV3 I;  4JI7 E;  3LTO A;  4JI0 E;  4B3S I;  3F0N A;  1N0V C;  4Z7C A;  5IT9 Q;  2PNL A;  2VF3 A;  4X65 I;  1FI4 A;  1QZR A;  4LFA I;  4HAC A;  4DR7 E;  1KKH A;  1IBL E;  1Z5C A;  2UXC I;  4DU8 A;  1Y6Z A;  1HR0 I;  3OTO I;  2HHH E;  5BR8 E;  4NXM E;  1S16 A;  1XMO E;  2Z5C B;  1A6F A;  4RPF A;  2E1R A;  2A2C A;  1N34 E;  1Z0W A;  4DU7 A;  4B3R I;  2E5L I;  4GKJ E;  1ZM3 A;  1XNQ E;  2Z5C A;  4XTJ A;  1VIS A;  2Z5E A;  5IWA I;  4DR6 E;  4LF4 I;  4JI3 E;  1FNM A;  2Z5B B;  4DV6 E;  1FJG I;  3WU3 A;  3JAM C;  4DR5 I;  3WU5 A;  4NXN E;  2Z5B A;  3V5R A;  4DR4 E;  1IBK I;  2IOP A;  1IBM E;  4AQY E;  1FKA E;  2HKE A;  1NHH A;  3D4J A;  3T1H I;  4K0K I;  4DV5 I;  4DXL A;  1ZXM A;  2ZIT A;  4JV5 E;  3T1Y I;  4MYT A;  2BM0 A;  4DV0 I;  1B63 A;  1KTV A;  3QT6 A;  2O1W A;  4P7A A;  1B62 A;  1HNZ I;  2HK2 A;  2ZM6 I;  4MYU A;  3QT7 A;  2A2D A;  4DUY E;  4LF9 E;  1ZM4 A;  4LFB E;  4KHP I;  4JI4 E;  4DPW A;  1Y4U A;  1Z0T A;  2O1U A;  2GS8 A;  1EI1 A;  4JI5 E;  1N0U A;  5GME A;  3K1J A;  4I3H A;  2LJP A;  1ZM9 A;  4IZJ D;  4DR3 I;  2UXD I;  5A2Q Q;  2X36 A;  2VQF I;  4DR2 I;  3B82 A;  3GON A;  4OX9 E;  1Z59 A;  1MG7 A;  1D6T A;  4X62 E;  1MU5 A;  1XHK A;  4EMD A;  4LFC E;  3CWV A;  4DPX A;  1RR9 A;  4DR1 E;  4N3O A;  1OJ4 A;  1Z0G A;  2HHH I;  1XMO I;  3Q1Q A;  4DUZ I;  4B3T E;  3PYF A;  4PRX A;  1HNX E;  1J5E I;  3HJC A;  1WUU A;  3Q6M A;  4GKJ I;  5LMU I;  1I94 I;  2UUA I;  3QT5 A;  4ZVI A;  4DV4 I;  4LF7 E;  4DV3 E;  3ZZT A;  3PYE A;  4B3S E;  4JI1 E;  4IZJ B;  3ZKD A;  4JI8 E;  4DV2 E;  4X65 E;  2VQE E;  1ELO A;  4DV7 I;  1XNR I;  2V2V A;  1XMQ E;  2UXC E;  4JI6 I;  1HR0 E;  4FWG A;  4IZJ A;  3OTO E;  3J81 C;  4ED4 A;  4KQV A;  2F4V I;  2UU9 I;  4PU9 A;  2V8P A;  1IBM I;  4DPU A;  4AQY I;  1PIE A;  4LF5 E;  1FWL A;  1RRE A;  4HXZ A;  4JG4 A;  4DV1 I;  3ZZU A;  2HKJ A;  5IWA E;  1ZM2 A;  4LF4 E;  1N33 I;  1S4E A;  4Z7Y A;  4YY3 I;  2IOQ A;  1Z0B A;  4B3M I;  2UUC I;  4YHH E;  4JI2 I;  1K47 A;  5FLX C;  1N32 E;  2CG9 A;  1FJG E;  3J80 C;  5LMN E;  2UXB I;  4DR5 E;  1H7S A;  2DEJ A;  5LL6 R;  4LF6 I;  3JAM Q;  2NPF A;  1IBK E;  4JYA I;  4GKK I;  4PRV A;  4HY1 A;  1ZXN A;  2XEX A;  4JI5 I;  4IZK B;  1Z0V A;  4WUB A;  3WU4 A;  2OI2 A;  2HFU A;  3T1H E;  1Y4S A;  4K0K E;  2J7K A;  4R1F A;  3WU6 A;  4DV5 E;  4USM A;  2UUB E;  3T1Y E;  1H72 C;  4DV0 E;  3ZM7 A;  2EFG A;  1HNZ E;  3PYD A;  4DPT A;  3J7A M;  1HNW I;  2ZM6 E;  5IT9 C;  2HFS A;  1Z0E A;  2AJ4 A;  4JI0 I;  4JI7 I;  1H73 A;  4USK A;  1HK7 A;  3ZKB A;  2WW4 A;  4KHP E;  2GQ0 A;  4DR7 I;  1IBL I;  3J7A G;  5BR8 I;  4DR3 E;  4NXM I;  2UXD E;  4DPY A;  2V2Z A;  2V34 A;  1N34 I;  2VQF E;  1BKN A;  4DR2 E;  3HUL A;  2PNM A;  1UEK A;  4FW9 A;  4X66 E;  1XNQ I;  1N36 E;  4LF8 E;  1Z5B A;  4JI1 I;  4X64 E;  4JI8 I;  3Q6N A;  4DV2 I;  2VQE I;  3PRY A;  1USU A;  4WUD A;  2X7I A;  4DR6 I;  3ZZ0 A;  2R3V A;  1XMQ I;  2ZBK B;  2BV3 A;  4LFA E;  4JI3 I;  4DV6 I;  4DUZ E;  2R42 A;  1H7U A;  1PVG A;  2DEI A;  3V2U C;  1J5E E;  4NXN I;  5LMU E;  4DR4 I;  3K17 A;  4LF5 I;  4B3R E;  1I94 E;  2E5L E;  2UUA E;  2HK3 A;  4DV4 E;  1Z0C A;  4WUC A;  4YHH I;  1NHI A;  4DV7 E;  1N32 I;  1EA6 A;  1XNR E;  4JV5 I;  5LMN I;  2CGE A;  1DAR A;  4JI6 E;  3QT8 A;  2F4V E;  2UU9 E;  4FWH A;  1KIJ A;  4DUY I;  1USV A;  3J81 Q;  4LF9 I;  4URL A;  4HYM A;  4UT4 A;  4LFB I;  4JI4 I;  2Q2E B;  3B8H A;  4DV1 E;  2CZ9 A;  2V2Q A;  5A2Q C;  2UUB I;  1N33 E;  4YY3 E;  4B3M E;  2UUC E;  4JI2 E;  1NHJ A;  1U2R A;  5L3J A;  3P06 A;  4P52 A;  4IZK A;  2UXB E;  4OX9 I;  2BM1 A;  5FLX Q;  4M1K A;  3J80 Q;  4UTG A;  1H74 A;  1FWK A;  4X62 I;  2O1V A;  4LF6 E;  3B78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...