4DR3I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr3I00
1Z0TA 4USMA 1FWKA 4DV6E 1H7UA 4KHPI 4JI8E 3ZKBA 2LJPA 4NXNI 1D6TA 4JYAE 3ZM7A 1FI4A 3J81Q 4LF6E 4JV5I 4NXMI 1XNQI 2VQFE 4DV0E 3T1HE 1EA6A 4JI6I 3V2UC 4X66I 4DR7I 4XTJA 4DPUA 2UXCI 2UXDE 2R42A 4DV4I 1FJGE 2VF3A 4JI3I 1HR0I 4LF4E 4LFAI 3WU5A 4JI5E 4DR2I 4EMDA 2GS8A 1N34I 2E5LI 5BR8E 3QT8A 2HKEA 2J7KA 1IBKI 4DV1I 4DR1E 4DV3E 4GKJI 4LFCE 2UUAI 3WU3A 1HNZI 5A2QQ 4AQYI 2V2ZA 2E1RA 3HULA 2OI2A 4DV5E 4JI1E 3B8HA 4JYAI 1H73A 1WUUA 1Z0CA 2VQFI 1N33E 4DV0I 1ELOA 1A6FA 1IBME 4FWHA 5L3JA 4LFBI 3V5RA 4P52A 1KTVA 1OJ4A 1H7SA 4KHPE 4B3TI 4M1KA 3K17A 3WU6A 1Z0WA 1Z0BA 5IWAI 2HFSA 4NXME 4YHHE 1XNQE 1N36E 4JI4I 5BR8I 1N0UA 2F4VI 1XMOE 4DR1I 4JI6E 4DR7E 4DV4E 4JI3E 1B62A 4LFAE 4HACB 3B78A 4I3HA 2WW4A 4JI1I 4DV5I 1N34E 3J7AM 2E5LE 1ZM3A 1H74A 1IBKE 1KIJA 1NHIA 2BM0A 4DV1E 4HY1A 2ZM6I 2DEJA 2V2VA 1HNZE 4GKKI 1IBMI 1MG7A 4AQYE 1HNXI 3PYEA 2V34A 3QT6A 3QT5A 2UU9E 4DR5E 2ZBKB 4DR6I 4YHHI 1N36I 1ZM4A 1XMOI 4LFBE 4B3MI 1MX0A 3J80C 4DR4I 2X36A 1RREA 3PYGA 5GMEA 4B3TE 3T1YE 4Z7YA 5IWAE 5IT9C 4B3SI 4JI4E 5IT9Q 3GONA 2F4VE 4DV7E 1NHHA 1U2RA 1EI1A 3CWVA 4WUDA 2A2DA 1Z5BA 2UXBE 2X7IA 3J7AG 3PYDA 4LF8I 4DUYI 4LF5I 4X62I 4X64E 5LMUE 2NPFA 4MYTA 5LMNI 2UU9I 4DR5I 3JAMC 1IBLE 1FWLA 2ZM6E 2XEXA 5FLXC 4GKKE 4FN5A 3ZZ0A 1HNXE 1ZM2A 2HFUA 1XNRE 4DUZE 2HK2A 3T1YI 4DU8A 3K1JA 4FWDA 4DPYA 4Z7CA 3Q1QA 3LPSA 4DR6E 3F0NA 4DV7I 4HACA 1XMQI 4DR3I 4LF9E 4B3ME 4DR4E 2UXBI 1H72C 1KKHA 3PYFA 4DPTA 1J5EI 1KVKA 4MYUA 4URLA 4WUCA 5LMUI 4X64I 4B3SE 4KQVA 1IBLI 1Z0EA 2UUCI 1ZM9A 2Q2EB 4LF8E 1N0VC 5GMDA 4P7AA 4DUYE 4DU7A 4LF5E 4JI7I 4X62E 1XNRI 4DUZI 4FW9A 5LMNE 4UTGA 1MU5A 1PKPA 4X65E 2HK3A 4JI2I 1Z0GA 4YY3I 5LL6R 4LF9I 4LF7I 3ZKDA 4K0KI 1QZRA 2VQEE 3B82A 1FKAE 3J80Q 4ED4A 1XHKA 4UT4A 4HXZA 1K47A 3J81C 2HKJA 4PU9A 2UUBI 4B3RI 4OX9E 4FWGA 3M6AA 1NHJA 1XMQE 4DR3E 1RR9A 3WU4A 4PRXA 2CZ9A 1HNWI 4DPWA 1J5EE 1N32I 3ZZUA 1VISA 1I94E 4DV2E 1NZ0A 3ZZTA 4JI0I 1S16A 3JAMQ 2UUCE 4X65I 3OTOI 2AJ4A 5A2QC 2A2CA 1ZXMA 5FLXQ 2R3VA 4WUBA 1Z5CA 2VQEI 4DV6I 4JI7E 1Z0VA 1DARA 3LNUA 4JI8I 2V8PA 4LF6I 1S4EA 2HHHE 3T1HI 4OX9I 1B63A 4JI2E 4YY3E 4HYMA 4LF7E 2EFGA 4K0KE 4DXLA 3QT7A 2UXDI 2DEIA 1FJGI 4ZVIA 1UEKA 4LF4I 3LTOA 4USKA 4JI5I 4NXNE 4R1FA 4JV5E 4RPFA 2UUBE 4B3RE 1PIEA 4PRVA 1I94I 4DV2I 3D4JA 4DV3I 4LFCI 1BKNA 1Z5AA 4X66E 2UXCE 4DPXA 4JG4A 2V2QA 1PVGA 1HNWE 1HR0E 1ZXNA 2BM1A 3H4LA 4DR2E 1N32E 1FNMA 1Z59A 4JI0E 4GKJE 2UUAE 2HHHI 1N33I 3OTOE 2ZITA 2BV3A
chains in the Genus database with same CATH superfamily
2CGEA 3M7NG 2J65A 4IFDF 1UDSA 1Z0TA 4USMA 1FWKA 4DV6E 4OO1B 1H7UA 4OKGA 5DRQA 4BA2B 4KHPI 4JI8E 5DRPA 3ZKBA 2LJPA 2Z5EA 4NXNI 1D6TA 4FW7A 4JYAE 3ZM7A 1FI4A 2JEAB 3J81Q 4LF6E 4JV5I 4NXMI 1XNQI 2VQFE 4DV0E 2IOPA 3T1HE 2Z5BB 1EA6A 1YHCA 4JI6I 3V2UC 4X66I 2WNRA 4XTJA 4DR7I 4DPUA 2UXCI 1E3PA 3K85A 2R42A 4DV4I 1E3HA 2UXDE 1FJGE 2VF3A 4JI3I 1HR0I 4LF4E 4LFAI 3WU5A 4JI5E 3UHMA 4DR2I 4EMDA 1R6LA 2GS8A 5K36B 1N34I 2E5LI 4LPFA 5BR8E 3QT8A 5EL9A 2HKEA 2J7KA 1IBKI 4DV1I 4DR1E 4DV3E 4GKJI 4LFCE 2PO1A 1UDOA 2UUAI 3P3CA 3WU3A 1HNZI 2PNZA 3P3GA 4N3OA 5A2QQ 4AQYI 5DNLA 2V2ZA 2E1RA 3HULA 2OI2A 2WP8A 4DV5E 4JI1E 3B8HA 2Z5CB 3Q6MA 2O1VA 4MDTA 4IZJB 4JYAI 1H73A 1WUUA 1Z0CA 1P42A 2VQFI 1N33E 4DV0I 2JT2A 3GLLA 1OYPA 1ELOA 1A6FA 1IBME 1USUA 4FWHA 5L3JA 2C38A 4LFBI 3V5RA 2NN6A 4P52A 1KTVA 1OJ4A 2C39B 4BA1B 4MU4A 1H7SA 1XXEA 4KHPE 1Y5YA 4B3TI 4M1KA 3K17A 3WU6A 4IZJD 1Z0WA 1Z0BA 5IWAI 2C37B 2HFSA 1Y4UA 4YHHE 4NXME 1N36E 2PO0B 4JI4I 1XNQE 2O1TA 5BR8I 4AM3A 1N0UA 2F4VI 1XMOE 4DR1I 4JI6E 4DR7E 4J3DA 4DV4E 4JI3E 1B62A 4LFAE 2IOQA 5JEAA 4HACB 3B78A 4I3HA 2WW4A 4JI1I 4DV5I 1N34E 3J7AM 2E5LE 1ZM3A 3HJCA 1H74A 1IBKE 4LOMA 1KIJA 1NHIA 2BM0A 4DV1E 1UDNA 4OO1A 4HY1A 4BA2A 2ZM6I 2DEJA 2V2VA 2NN6F 2GQ0A 1HNZE 4GKKI 1IBMI 1MG7A 5K36C 2JEAA 4AQYE 1HNXI 3PYEA 1HK7A 5EKWA 2Z5BA 2V34A 3QT6A 3QT5A 2UU9E 4DR5E 4NBQA 2ZBKB 3KRNA 4DR6I 4IFDD 2PO2B 3PS2A 5C0XA 4YHHI 1N36I 1ZM4A 4OZEA 4QNKA 2BR2B 1XMOI 4LFBE 4B3MI 5K36A 1MX0A 3J80C 2PNLA 3P06A 4DR4I 2BA1D 2X36A 5JEAF 5DNXA 4IFDE 1RREA 3PYGA 5GMEA 4B3TE 3T1YE 4Z7YA 1OYRA 5IWAE 4OO1F 5IT9C 4B3SI 4JI4E 5IT9Q 3GONA 2F4VE 4DV7E 1NHHA 4GQUA 1U2RA 1EI1A 2Z5CA 3CWVA 4WUDA 2A2DA 1Z5BA 2UXBE 4IZJA 2X7IA 3J7AG 4IZKA 3PYDA 2PNMA 4DUYI 4LF5I 4LF8I 4U3DA 4X62I 4X64E 5LMUE 2CVEA 4MYTA 2NPFA 5LMNI 2UU9I 4DR5I 5C0XF 3JAMC 1IBLE 2C39A 1FWLA 1R6MA 4BA1A 3CDIA 2ZM6E 2XEXA 2JE6B 3DD6A 3Q6NA 5FWKA 5FLXC 1OYSA 4GKKE 2F1DA 4FN5A 3ZZ0A 2C37A 1HNXE 2PO0A 1ZM2A 2HFUA 4FW4A 3U1YA 3NZKA 1XNRE 4IFDC 4DUZE 2HK2A 5ELWA 3T1YI 4DU8A 3CDJA 3K1JA 2JEBB 4FWDA 4DPYA 4Z7CA 3LPSA 3Q1QA 4DR6E 2O1UA 3F0NA 2WP8B 2BA1G 4DV7I 4HACA 2IESA 1XMQI 4DR3I 3P76A 4LF9E 4B3ME 4DR4E 4AIDA 2UXBI 1H72C 1KKHA 3M85D 3PYFA 4DPTA 1J5EI 1KVKA 4MYUA 2CG9A 2AE8A 1VI7A 4FW3A 4WUCA 4URLA 2NN6B 3PRYA 4X64I 5LMUI 4B3SE 3B4TA 2GO3A 4KQVA 1IBLI 4IFDB 1Z0EA 2UUCI 1ZM9A 2Q2EB 2PO2A 4FW6A 4LF8E 1N0VC 5GMDA 4P7AA 4DUYE 4DU7A 4LF5E 4JI7I 2BR2A 4X62E 1XNRI 2VESA 2NN6D 4DUZI 4FW9A 2O1WA 3L7ZB 4UTGA 1MU5A 5LMNE 4IS9A 1Y6ZA 1PKPA 4X65E 2HK3A 4FW5A 4ISAA 2NN6E 4JI2I 4U3BA 1Z0GA 4YY3I 5DROA 5LL6R 4LF9I 4LF7I 3ZKDA 4K0KI 1QZRA 2VQEE 3B82A 1FKAE 4LCGA 3J80Q 4ED4A 1XHKA 4UT4A 4MQYA 4HXZA 1K47A 3PS1A 3J81C 2HKJA 4PU9A 2UUBI 4B3RI 4MU3A 4OX9E 4FWGA 5JEAD 3M6AA 1NHJA 1XMQE 4DR3E 4LCFA 1RR9A 3WU4A 3M85G 3P3EA 4PRXA 4OO1D 2CZ9A 2BA0D 1HNWI 4DPWA 5C0XB 5JEAE 3U1KA 1J5EE 2JE6A 1N32I 3ZZUA 1VISA 2WNRB 1I94E 4LCHA 4DV2E 1NZ0A 3ZZTA 4OO1E 4JI0I 1S16A 3JAMQ 2UUCE 5K36F 4X65I 3OTOI 2AJ4A 3H1CA 5A2QC 2A2CA 1Y4SA 2IERA 2NN6C 1ZXMA 2JEBA 5FLXQ 5C0XD 2R3VA 4WUBA 1Z5CA 5DRRA 1UDQA 2VQEI 4DV6I 4JI7E 2PO1B 5K36D 1Z0VA 1DARA 3M7ND 3LNUA 4AIMA 4JI8I 2V8PA 2PNZB 5C0XE 4LF6I 4IZKB 1S4EA 2HHHE 4MU0A 3T1HI 4OX9I 1B63A 5K36E 4JI2E 1USVA 4YY3E 4HYMA 4LF7E 2EFGA 4K0KE 4DXLA 3QT7A 2UXDI 1Y60A 2DEIA 1FJGI 4ZVIA 1UEKA 4LF4I 4IFDA 3LTOA 2O3ZA 5JEAC 4USKA 4JI5I 4NXNE 4R1FA 2C38B 1RHYA 4JV5E 4RPFA 2UUBE 4B3RE 1PIEA 4PRVA 1I94I 4DV2I 3D4JA 4OO1C 4DV3I 2BA0G 4LFCI 1BKNA 4QNJA 1Z5AA 4X66E 2UXCE 3L7ZA 4DPXA 4JG4A 2V2QA 3GCMA 1PVGA 1HNWE 4MU1A 1HR0E 1ZXNA 2BM1A 2GO4A 3GMEA 3H4LA 4DR2E 3PS3A 1N32E 1FNMA 3HKMA 1YH8A 1Z59A 4JI0E 4GKJE 5C0XC 2UUAE 2HHHI 1N33I 3OTOE 5JEAB 2ZITA 2BV3A
chains in the Genus database with same CATH topology
2CGEA 1Z0TA 4USMA 1FWKA 4DV6E 1H7UA 4KHPI 4JI8E 3ZKBA 2LJPA 2Z5EA 4NXNI 1D6TA 4JYAE 3ZM7A 1FI4A 3J81Q 4LF6E 4JV5I 4NXMI 1XNQI 2VQFE 4DV0E 2IOPA 3T1HE 2Z5BB 1EA6A 4JI6I 3V2UC 4X66I 4DR7I 4XTJA 4DPUA 2UXCI 3K85A 2R42A 4DV4I 2UXDE 1FJGE 2VF3A 4JI3I 1HR0I 4LF4E 4LFAI 3WU5A 4JI5E 4DR2I 4EMDA 2GS8A 1N34I 2E5LI 5BR8E 3QT8A 2HKEA 2J7KA 1IBKI 4DV1I 4DR1E 4DV3E 4GKJI 4LFCE 2UUAI 3WU3A 1HNZI 4N3OA 5A2QQ 4AQYI 2V2ZA 2E1RA 3HULA 2OI2A 4DV5E 4JI1E 3B8HA 2Z5CB 3Q6MA 2O1VA 4IZJB 4JYAI 1H73A 1WUUA 1Z0CA 2VQFI 1N33E 4DV0I 1ELOA 1A6FA 1IBME 1USUA 4FWHA 5L3JA 4LFBI 3V5RA 4P52A 1KTVA 1OJ4A 1H7SA 4KHPE 4B3TI 4M1KA 3K17A 3WU6A 4IZJD 1Z0WA 1Z0BA 5IWAI 2HFSA 1Y4UA 4YHHE 4NXME 1N36E 4JI4I 1XNQE 2O1TA 5BR8I 1N0UA 2F4VI 1XMOE 4DR1I 4JI6E 4DR7E 4DV4E 4JI3E 1B62A 4LFAE 2IOQA 4HACB 3B78A 4I3HA 2WW4A 4JI1I 4DV5I 1N34E 3J7AM 2E5LE 1ZM3A 3HJCA 1H74A 1IBKE 1KIJA 1NHIA 2BM0A 4DV1E 4HY1A 2ZM6I 2DEJA 2V2VA 2GQ0A 1HNZE 4GKKI 1IBMI 1MG7A 4AQYE 1HNXI 3PYEA 1HK7A 2Z5BA 2V34A 3QT6A 3QT5A 2UU9E 4DR5E 2ZBKB 4DR6I 4YHHI 1N36I 1ZM4A 1XMOI 4LFBE 4B3MI 1MX0A 3J80C 2PNLA 3P06A 4DR4I 2X36A 1RREA 3PYGA 5GMEA 4B3TE 3T1YE 4Z7YA 5IWAE 5IT9C 4B3SI 4JI4E 5IT9Q 3GONA 2F4VE 4DV7E 1NHHA 1U2RA 1EI1A 2Z5CA 3CWVA 4WUDA 2A2DA 1Z5BA 2UXBE 4IZJA 2X7IA 3J7AG 4IZKA 3PYDA 2PNMA 4DUYI 4LF5I 4LF8I 4X62I 4X64E 5LMUE 2NPFA 4MYTA 5LMNI 2UU9I 4DR5I 3JAMC 1IBLE 1FWLA 2ZM6E 2XEXA 3Q6NA 5FWKA 5FLXC 4GKKE 4FN5A 3ZZ0A 1HNXE 1ZM2A 2HFUA 1XNRE 4DUZE 2HK2A 3T1YI 4DU8A 3K1JA 4FWDA 4DPYA 4Z7CA 3Q1QA 3LPSA 4DR6E 2O1UA 3F0NA 4DV7I 4HACA 1XMQI 4DR3I 4LF9E 4B3ME 4DR4E 2UXBI 1H72C 1KKHA 3PYFA 4DPTA 1J5EI 1KVKA 4MYUA 2CG9A 4URLA 4WUCA 3PRYA 4X64I 5LMUI 4B3SE 4KQVA 1IBLI 1Z0EA 2UUCI 1ZM9A 2Q2EB 4LF8E 1N0VC 5GMDA 4P7AA 4DUYE 4DU7A 4LF5E 4JI7I 4X62E 1XNRI 4DUZI 4FW9A 2O1WA 5LMNE 4UTGA 1MU5A 1Y6ZA 1PKPA 4X65E 2HK3A 4JI2I 1Z0GA 4YY3I 5LL6R 4LF9I 4LF7I 3ZKDA 4K0KI 1QZRA 2VQEE 3B82A 1FKAE 3J80Q 4ED4A 1XHKA 4UT4A 4HXZA 1K47A 3J81C 2HKJA 4PU9A 2UUBI 4B3RI 4OX9E 4FWGA 3M6AA 1NHJA 1XMQE 4DR3E 1RR9A 3WU4A 4PRXA 2CZ9A 1HNWI 4DPWA 1J5EE 1N32I 3ZZUA 1VISA 1I94E 4DV2E 1NZ0A 3ZZTA 4JI0I 1S16A 3JAMQ 2UUCE 4X65I 3OTOI 2AJ4A 5A2QC 2A2CA 1Y4SA 1ZXMA 5FLXQ 2R3VA 4WUBA 1Z5CA 2VQEI 4DV6I 4JI7E 1Z0VA 1DARA 3LNUA 4JI8I 2V8PA 4LF6I 4IZKB 1S4EA 2HHHE 3T1HI 4OX9I 1B63A 4JI2E 1USVA 4YY3E 4HYMA 4LF7E 2EFGA 4K0KE 4DXLA 3QT7A 2UXDI 2DEIA 1FJGI 4ZVIA 1UEKA 4LF4I 3LTOA 4USKA 4JI5I 4NXNE 4R1FA 4JV5E 4RPFA 2UUBE 4B3RE 1PIEA 4PRVA 1I94I 4DV2I 3D4JA 4DV3I 4LFCI 1BKNA 1Z5AA 4X66E 2UXCE 4DPXA 4JG4A 2V2QA 1PVGA 1HNWE 1HR0E 1ZXNA 2BM1A 3H4LA 4DR2E 1N32E 1FNMA 1Z59A 4JI0E 4GKJE 2UUAE 2HHHI 1N33I 3OTOE 2ZITA 2BV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0T A;  4USM A;  1FWK A;  4DV6 E;  1H7U A;  4KHP I;  4JI8 E;  3ZKB A;  2LJP A;  4NXN I;  1D6T A;  4JYA E;  3ZM7 A;  1FI4 A;  3J81 Q;  4LF6 E;  4JV5 I;  4NXM I;  1XNQ I;  2VQF E;  4DV0 E;  3T1H E;  1EA6 A;  4JI6 I;  3V2U C;  4X66 I;  4DR7 I;  4XTJ A;  4DPU A;  2UXC I;  2UXD E;  2R42 A;  4DV4 I;  1FJG E;  2VF3 A;  4JI3 I;  1HR0 I;  4LF4 E;  4LFA I;  3WU5 A;  4JI5 E;  4DR2 I;  4EMD A;  2GS8 A;  1N34 I;  2E5L I;  5BR8 E;  3QT8 A;  2HKE A;  2J7K A;  1IBK I;  4DV1 I;  4DR1 E;  4DV3 E;  4GKJ I;  4LFC E;  2UUA I;  3WU3 A;  1HNZ I;  5A2Q Q;  4AQY I;  2V2Z A;  2E1R A;  3HUL A;  2OI2 A;  4DV5 E;  4JI1 E;  3B8H A;  4JYA I;  1H73 A;  1WUU A;  1Z0C A;  2VQF I;  1N33 E;  4DV0 I;  1ELO A;  1A6F A;  1IBM E;  4FWH A;  5L3J A;  4LFB I;  3V5R A;  4P52 A;  1KTV A;  1OJ4 A;  1H7S A;  4KHP E;  4B3T I;  4M1K A;  3K17 A;  3WU6 A;  1Z0W A;  1Z0B A;  5IWA I;  2HFS A;  4NXM E;  4YHH E;  1XNQ E;  1N36 E;  4JI4 I;  5BR8 I;  1N0U A;  2F4V I;  1XMO E;  4DR1 I;  4JI6 E;  4DR7 E;  4DV4 E;  4JI3 E;  1B62 A;  4LFA E;  4HAC B;  3B78 A;  4I3H A;  2WW4 A;  4JI1 I;  4DV5 I;  1N34 E;  3J7A M;  2E5L E;  1ZM3 A;  1H74 A;  1IBK E;  1KIJ A;  1NHI A;  2BM0 A;  4DV1 E;  4HY1 A;  2ZM6 I;  2DEJ A;  2V2V A;  1HNZ E;  4GKK I;  1IBM I;  1MG7 A;  4AQY E;  1HNX I;  3PYE A;  2V34 A;  3QT6 A;  3QT5 A;  2UU9 E;  4DR5 E;  2ZBK B;  4DR6 I;  4YHH I;  1N36 I;  1ZM4 A;  1XMO I;  4LFB E;  4B3M I;  1MX0 A;  3J80 C;  4DR4 I;  2X36 A;  1RRE A;  3PYG A;  5GME A;  4B3T E;  3T1Y E;  4Z7Y A;  5IWA E;  5IT9 C;  4B3S I;  4JI4 E;  5IT9 Q;  3GON A;  2F4V E;  4DV7 E;  1NHH A;  1U2R A;  1EI1 A;  3CWV A;  4WUD A;  2A2D A;  1Z5B A;  2UXB E;  2X7I A;  3J7A G;  3PYD A;  4LF8 I;  4DUY I;  4LF5 I;  4X62 I;  4X64 E;  5LMU E;  2NPF A;  4MYT A;  5LMN I;  2UU9 I;  4DR5 I;  3JAM C;  1IBL E;  1FWL A;  2ZM6 E;  2XEX A;  5FLX C;  4GKK E;  4FN5 A;  3ZZ0 A;  1HNX E;  1ZM2 A;  2HFU A;  1XNR E;  4DUZ E;  2HK2 A;  3T1Y I;  4DU8 A;  3K1J A;  4FWD A;  4DPY A;  4Z7C A;  3Q1Q A;  3LPS A;  4DR6 E;  3F0N A;  4DV7 I;  4HAC A;  1XMQ I;  4DR3 I;  4LF9 E;  4B3M E;  4DR4 E;  2UXB I;  1H72 C;  1KKH A;  3PYF A;  4DPT A;  1J5E I;  1KVK A;  4MYU A;  4URL A;  4WUC A;  5LMU I;  4X64 I;  4B3S E;  4KQV A;  1IBL I;  1Z0E A;  2UUC I;  1ZM9 A;  2Q2E B;  4LF8 E;  1N0V C;  5GMD A;  4P7A A;  4DUY E;  4DU7 A;  4LF5 E;  4JI7 I;  4X62 E;  1XNR I;  4DUZ I;  4FW9 A;  5LMN E;  4UTG A;  1MU5 A;  1PKP A;  4X65 E;  2HK3 A;  4JI2 I;  1Z0G A;  4YY3 I;  5LL6 R;  4LF9 I;  4LF7 I;  3ZKD A;  4K0K I;  1QZR A;  2VQE E;  3B82 A;  1FKA E;  3J80 Q;  4ED4 A;  1XHK A;  4UT4 A;  4HXZ A;  1K47 A;  3J81 C;  2HKJ A;  4PU9 A;  2UUB I;  4B3R I;  4OX9 E;  4FWG A;  3M6A A;  1NHJ A;  1XMQ E;  4DR3 E;  1RR9 A;  3WU4 A;  4PRX A;  2CZ9 A;  1HNW I;  4DPW A;  1J5E E;  1N32 I;  3ZZU A;  1VIS A;  1I94 E;  4DV2 E;  1NZ0 A;  3ZZT A;  4JI0 I;  1S16 A;  3JAM Q;  2UUC E;  4X65 I;  3OTO I;  2AJ4 A;  5A2Q C;  2A2C A;  1ZXM A;  5FLX Q;  2R3V A;  4WUB A;  1Z5C A;  2VQE I;  4DV6 I;  4JI7 E;  1Z0V A;  1DAR A;  3LNU A;  4JI8 I;  2V8P A;  4LF6 I;  1S4E A;  2HHH E;  3T1H I;  4OX9 I;  1B63 A;  4JI2 E;  4YY3 E;  4HYM A;  4LF7 E;  2EFG A;  4K0K E;  4DXL A;  3QT7 A;  2UXD I;  2DEI A;  1FJG I;  4ZVI A;  1UEK A;  4LF4 I;  3LTO A;  4USK A;  4JI5 I;  4NXN E;  4R1F A;  4JV5 E;  4RPF A;  2UUB E;  4B3R E;  1PIE A;  4PRV A;  1I94 I;  4DV2 I;  3D4J A;  4DV3 I;  4LFC I;  1BKN A;  1Z5A A;  4X66 E;  2UXC E;  4DPX A;  4JG4 A;  2V2Q A;  1PVG A;  1HNW E;  1HR0 E;  1ZXN A;  2BM1 A;  3H4L A;  4DR2 E;  1N32 E;  1FNM A;  1Z59 A;  4JI0 E;  4GKJ E;  2UUA E;  2HHH I;  1N33 I;  3OTO E;  2ZIT A;  2BV3 A; 
#chains in the Genus database with same CATH topology
 2CGE A;  3M7N G;  2J65 A;  4IFD F;  1UDS A;  1Z0T A;  4USM A;  1FWK A;  4DV6 E;  4OO1 B;  1H7U A;  4OKG A;  5DRQ A;  4BA2 B;  4KHP I;  4JI8 E;  5DRP A;  3ZKB A;  2LJP A;  2Z5E A;  4NXN I;  1D6T A;  4FW7 A;  4JYA E;  3ZM7 A;  1FI4 A;  2JEA B;  3J81 Q;  4LF6 E;  4JV5 I;  4NXM I;  1XNQ I;  2VQF E;  4DV0 E;  2IOP A;  3T1H E;  2Z5B B;  1EA6 A;  1YHC A;  4JI6 I;  3V2U C;  4X66 I;  2WNR A;  4XTJ A;  4DR7 I;  4DPU A;  2UXC I;  1E3P A;  3K85 A;  2R42 A;  4DV4 I;  1E3H A;  2UXD E;  1FJG E;  2VF3 A;  4JI3 I;  1HR0 I;  4LF4 E;  4LFA I;  3WU5 A;  4JI5 E;  3UHM A;  4DR2 I;  4EMD A;  1R6L A;  2GS8 A;  5K36 B;  1N34 I;  2E5L I;  4LPF A;  5BR8 E;  3QT8 A;  5EL9 A;  2HKE A;  2J7K A;  1IBK I;  4DV1 I;  4DR1 E;  4DV3 E;  4GKJ I;  4LFC E;  2PO1 A;  1UDO A;  2UUA I;  3P3C A;  3WU3 A;  1HNZ I;  2PNZ A;  3P3G A;  4N3O A;  5A2Q Q;  4AQY I;  5DNL A;  2V2Z A;  2E1R A;  3HUL A;  2OI2 A;  2WP8 A;  4DV5 E;  4JI1 E;  3B8H A;  2Z5C B;  3Q6M A;  2O1V A;  4MDT A;  4IZJ B;  4JYA I;  1H73 A;  1WUU A;  1Z0C A;  1P42 A;  2VQF I;  1N33 E;  4DV0 I;  2JT2 A;  3GLL A;  1OYP A;  1ELO A;  1A6F A;  1IBM E;  1USU A;  4FWH A;  5L3J A;  2C38 A;  4LFB I;  3V5R A;  2NN6 A;  4P52 A;  1KTV A;  1OJ4 A;  2C39 B;  4BA1 B;  4MU4 A;  1H7S A;  1XXE A;  4KHP E;  1Y5Y A;  4B3T I;  4M1K A;  3K17 A;  3WU6 A;  4IZJ D;  1Z0W A;  1Z0B A;  5IWA I;  2C37 B;  2HFS A;  1Y4U A;  4YHH E;  4NXM E;  1N36 E;  2PO0 B;  4JI4 I;  1XNQ E;  2O1T A;  5BR8 I;  4AM3 A;  1N0U A;  2F4V I;  1XMO E;  4DR1 I;  4JI6 E;  4DR7 E;  4J3D A;  4DV4 E;  4JI3 E;  1B62 A;  4LFA E;  2IOQ A;  5JEA A;  4HAC B;  3B78 A;  4I3H A;  2WW4 A;  4JI1 I;  4DV5 I;  1N34 E;  3J7A M;  2E5L E;  1ZM3 A;  3HJC A;  1H74 A;  1IBK E;  4LOM A;  1KIJ A;  1NHI A;  2BM0 A;  4DV1 E;  1UDN A;  4OO1 A;  4HY1 A;  4BA2 A;  2ZM6 I;  2DEJ A;  2V2V A;  2NN6 F;  2GQ0 A;  1HNZ E;  4GKK I;  1IBM I;  1MG7 A;  5K36 C;  2JEA A;  4AQY E;  1HNX I;  3PYE A;  1HK7 A;  5EKW A;  2Z5B A;  2V34 A;  3QT6 A;  3QT5 A;  2UU9 E;  4DR5 E;  4NBQ A;  2ZBK B;  3KRN A;  4DR6 I;  4IFD D;  2PO2 B;  3PS2 A;  5C0X A;  4YHH I;  1N36 I;  1ZM4 A;  4OZE A;  4QNK A;  2BR2 B;  1XMO I;  4LFB E;  4B3M I;  5K36 A;  1MX0 A;  3J80 C;  2PNL A;  3P06 A;  4DR4 I;  2BA1 D;  2X36 A;  5JEA F;  5DNX A;  4IFD E;  1RRE A;  3PYG A;  5GME A;  4B3T E;  3T1Y E;  4Z7Y A;  1OYR A;  5IWA E;  4OO1 F;  5IT9 C;  4B3S I;  4JI4 E;  5IT9 Q;  3GON A;  2F4V E;  4DV7 E;  1NHH A;  4GQU A;  1U2R A;  1EI1 A;  2Z5C A;  3CWV A;  4WUD A;  2A2D A;  1Z5B A;  2UXB E;  4IZJ A;  2X7I A;  3J7A G;  4IZK A;  3PYD A;  2PNM A;  4DUY I;  4LF5 I;  4LF8 I;  4U3D A;  4X62 I;  4X64 E;  5LMU E;  2CVE A;  4MYT A;  2NPF A;  5LMN I;  2UU9 I;  4DR5 I;  5C0X F;  3JAM C;  1IBL E;  2C39 A;  1FWL A;  1R6M A;  4BA1 A;  3CDI A;  2ZM6 E;  2XEX A;  2JE6 B;  3DD6 A;  3Q6N A;  5FWK A;  5FLX C;  1OYS A;  4GKK E;  2F1D A;  4FN5 A;  3ZZ0 A;  2C37 A;  1HNX E;  2PO0 A;  1ZM2 A;  2HFU A;  4FW4 A;  3U1Y A;  3NZK A;  1XNR E;  4IFD C;  4DUZ E;  2HK2 A;  5ELW A;  3T1Y I;  4DU8 A;  3CDJ A;  3K1J A;  2JEB B;  4FWD A;  4DPY A;  4Z7C A;  3LPS A;  3Q1Q A;  4DR6 E;  2O1U A;  3F0N A;  2WP8 B;  2BA1 G;  4DV7 I;  4HAC A;  2IES A;  1XMQ I;  4DR3 I;  3P76 A;  4LF9 E;  4B3M E;  4DR4 E;  4AID A;  2UXB I;  1H72 C;  1KKH A;  3M85 D;  3PYF A;  4DPT A;  1J5E I;  1KVK A;  4MYU A;  2CG9 A;  2AE8 A;  1VI7 A;  4FW3 A;  4WUC A;  4URL A;  2NN6 B;  3PRY A;  4X64 I;  5LMU I;  4B3S E;  3B4T A;  2GO3 A;  4KQV A;  1IBL I;  4IFD B;  1Z0E A;  2UUC I;  1ZM9 A;  2Q2E B;  2PO2 A;  4FW6 A;  4LF8 E;  1N0V C;  5GMD A;  4P7A A;  4DUY E;  4DU7 A;  4LF5 E;  4JI7 I;  2BR2 A;  4X62 E;  1XNR I;  2VES A;  2NN6 D;  4DUZ I;  4FW9 A;  2O1W A;  3L7Z B;  4UTG A;  1MU5 A;  5LMN E;  4IS9 A;  1Y6Z A;  1PKP A;  4X65 E;  2HK3 A;  4FW5 A;  4ISA A;  2NN6 E;  4JI2 I;  4U3B A;  1Z0G A;  4YY3 I;  5DRO A;  5LL6 R;  4LF9 I;  4LF7 I;  3ZKD A;  4K0K I;  1QZR A;  2VQE E;  3B82 A;  1FKA E;  4LCG A;  3J80 Q;  4ED4 A;  1XHK A;  4UT4 A;  4MQY A;  4HXZ A;  1K47 A;  3PS1 A;  3J81 C;  2HKJ A;  4PU9 A;  2UUB I;  4B3R I;  4MU3 A;  4OX9 E;  4FWG A;  5JEA D;  3M6A A;  1NHJ A;  1XMQ E;  4DR3 E;  4LCF A;  1RR9 A;  3WU4 A;  3M85 G;  3P3E A;  4PRX A;  4OO1 D;  2CZ9 A;  2BA0 D;  1HNW I;  4DPW A;  5C0X B;  5JEA E;  3U1K A;  1J5E E;  2JE6 A;  1N32 I;  3ZZU A;  1VIS A;  2WNR B;  1I94 E;  4LCH A;  4DV2 E;  1NZ0 A;  3ZZT A;  4OO1 E;  4JI0 I;  1S16 A;  3JAM Q;  2UUC E;  5K36 F;  4X65 I;  3OTO I;  2AJ4 A;  3H1C A;  5A2Q C;  2A2C A;  1Y4S A;  2IER A;  2NN6 C;  1ZXM A;  2JEB A;  5FLX Q;  5C0X D;  2R3V A;  4WUB A;  1Z5C A;  5DRR A;  1UDQ A;  2VQE I;  4DV6 I;  4JI7 E;  2PO1 B;  5K36 D;  1Z0V A;  1DAR A;  3M7N D;  3LNU A;  4AIM A;  4JI8 I;  2V8P A;  2PNZ B;  5C0X E;  4LF6 I;  4IZK B;  1S4E A;  2HHH E;  4MU0 A;  3T1H I;  4OX9 I;  1B63 A;  5K36 E;  4JI2 E;  1USV A;  4YY3 E;  4HYM A;  4LF7 E;  2EFG A;  4K0K E;  4DXL A;  3QT7 A;  2UXD I;  1Y60 A;  2DEI A;  1FJG I;  4ZVI A;  1UEK A;  4LF4 I;  4IFD A;  3LTO A;  2O3Z A;  5JEA C;  4USK A;  4JI5 I;  4NXN E;  4R1F A;  2C38 B;  1RHY A;  4JV5 E;  4RPF A;  2UUB E;  4B3R E;  1PIE A;  4PRV A;  1I94 I;  4DV2 I;  3D4J A;  4OO1 C;  4DV3 I;  2BA0 G;  4LFC I;  1BKN A;  4QNJ A;  1Z5A A;  4X66 E;  2UXC E;  3L7Z A;  4DPX A;  4JG4 A;  2V2Q A;  3GCM A;  1PVG A;  1HNW E;  4MU1 A;  1HR0 E;  1ZXN A;  2BM1 A;  2GO4 A;  3GME A;  3H4L A;  4DR2 E;  3PS3 A;  1N32 E;  1FNM A;  3HKM A;  1YH8 A;  1Z59 A;  4JI0 E;  4GKJ E;  5C0X C;  2UUA E;  2HHH I;  1N33 I;  3OTO E;  5JEA B;  2ZIT A;  2BV3 A; 
#chains in the Genus database with same CATH homology
 2CGE A;  1Z0T A;  4USM A;  1FWK A;  4DV6 E;  1H7U A;  4KHP I;  4JI8 E;  3ZKB A;  2LJP A;  2Z5E A;  4NXN I;  1D6T A;  4JYA E;  3ZM7 A;  1FI4 A;  3J81 Q;  4LF6 E;  4JV5 I;  4NXM I;  1XNQ I;  2VQF E;  4DV0 E;  2IOP A;  3T1H E;  2Z5B B;  1EA6 A;  4JI6 I;  3V2U C;  4X66 I;  4DR7 I;  4XTJ A;  4DPU A;  2UXC I;  3K85 A;  2R42 A;  4DV4 I;  2UXD E;  1FJG E;  2VF3 A;  4JI3 I;  1HR0 I;  4LF4 E;  4LFA I;  3WU5 A;  4JI5 E;  4DR2 I;  4EMD A;  2GS8 A;  1N34 I;  2E5L I;  5BR8 E;  3QT8 A;  2HKE A;  2J7K A;  1IBK I;  4DV1 I;  4DR1 E;  4DV3 E;  4GKJ I;  4LFC E;  2UUA I;  3WU3 A;  1HNZ I;  4N3O A;  5A2Q Q;  4AQY I;  2V2Z A;  2E1R A;  3HUL A;  2OI2 A;  4DV5 E;  4JI1 E;  3B8H A;  2Z5C B;  3Q6M A;  2O1V A;  4IZJ B;  4JYA I;  1H73 A;  1WUU A;  1Z0C A;  2VQF I;  1N33 E;  4DV0 I;  1ELO A;  1A6F A;  1IBM E;  1USU A;  4FWH A;  5L3J A;  4LFB I;  3V5R A;  4P52 A;  1KTV A;  1OJ4 A;  1H7S A;  4KHP E;  4B3T I;  4M1K A;  3K17 A;  3WU6 A;  4IZJ D;  1Z0W A;  1Z0B A;  5IWA I;  2HFS A;  1Y4U A;  4YHH E;  4NXM E;  1N36 E;  4JI4 I;  1XNQ E;  2O1T A;  5BR8 I;  1N0U A;  2F4V I;  1XMO E;  4DR1 I;  4JI6 E;  4DR7 E;  4DV4 E;  4JI3 E;  1B62 A;  4LFA E;  2IOQ A;  4HAC B;  3B78 A;  4I3H A;  2WW4 A;  4JI1 I;  4DV5 I;  1N34 E;  3J7A M;  2E5L E;  1ZM3 A;  3HJC A;  1H74 A;  1IBK E;  1KIJ A;  1NHI A;  2BM0 A;  4DV1 E;  4HY1 A;  2ZM6 I;  2DEJ A;  2V2V A;  2GQ0 A;  1HNZ E;  4GKK I;  1IBM I;  1MG7 A;  4AQY E;  1HNX I;  3PYE A;  1HK7 A;  2Z5B A;  2V34 A;  3QT6 A;  3QT5 A;  2UU9 E;  4DR5 E;  2ZBK B;  4DR6 I;  4YHH I;  1N36 I;  1ZM4 A;  1XMO I;  4LFB E;  4B3M I;  1MX0 A;  3J80 C;  2PNL A;  3P06 A;  4DR4 I;  2X36 A;  1RRE A;  3PYG A;  5GME A;  4B3T E;  3T1Y E;  4Z7Y A;  5IWA E;  5IT9 C;  4B3S I;  4JI4 E;  5IT9 Q;  3GON A;  2F4V E;  4DV7 E;  1NHH A;  1U2R A;  1EI1 A;  2Z5C A;  3CWV A;  4WUD A;  2A2D A;  1Z5B A;  2UXB E;  4IZJ A;  2X7I A;  3J7A G;  4IZK A;  3PYD A;  2PNM A;  4DUY I;  4LF5 I;  4LF8 I;  4X62 I;  4X64 E;  5LMU E;  2NPF A;  4MYT A;  5LMN I;  2UU9 I;  4DR5 I;  3JAM C;  1IBL E;  1FWL A;  2ZM6 E;  2XEX A;  3Q6N A;  5FWK A;  5FLX C;  4GKK E;  4FN5 A;  3ZZ0 A;  1HNX E;  1ZM2 A;  2HFU A;  1XNR E;  4DUZ E;  2HK2 A;  3T1Y I;  4DU8 A;  3K1J A;  4FWD A;  4DPY A;  4Z7C A;  3Q1Q A;  3LPS A;  4DR6 E;  2O1U A;  3F0N A;  4DV7 I;  4HAC A;  1XMQ I;  4DR3 I;  4LF9 E;  4B3M E;  4DR4 E;  2UXB I;  1H72 C;  1KKH A;  3PYF A;  4DPT A;  1J5E I;  1KVK A;  4MYU A;  2CG9 A;  4URL A;  4WUC A;  3PRY A;  4X64 I;  5LMU I;  4B3S E;  4KQV A;  1IBL I;  1Z0E A;  2UUC I;  1ZM9 A;  2Q2E B;  4LF8 E;  1N0V C;  5GMD A;  4P7A A;  4DUY E;  4DU7 A;  4LF5 E;  4JI7 I;  4X62 E;  1XNR I;  4DUZ I;  4FW9 A;  2O1W A;  5LMN E;  4UTG A;  1MU5 A;  1Y6Z A;  1PKP A;  4X65 E;  2HK3 A;  4JI2 I;  1Z0G A;  4YY3 I;  5LL6 R;  4LF9 I;  4LF7 I;  3ZKD A;  4K0K I;  1QZR A;  2VQE E;  3B82 A;  1FKA E;  3J80 Q;  4ED4 A;  1XHK A;  4UT4 A;  4HXZ A;  1K47 A;  3J81 C;  2HKJ A;  4PU9 A;  2UUB I;  4B3R I;  4OX9 E;  4FWG A;  3M6A A;  1NHJ A;  1XMQ E;  4DR3 E;  1RR9 A;  3WU4 A;  4PRX A;  2CZ9 A;  1HNW I;  4DPW A;  1J5E E;  1N32 I;  3ZZU A;  1VIS A;  1I94 E;  4DV2 E;  1NZ0 A;  3ZZT A;  4JI0 I;  1S16 A;  3JAM Q;  2UUC E;  4X65 I;  3OTO I;  2AJ4 A;  5A2Q C;  2A2C A;  1Y4S A;  1ZXM A;  5FLX Q;  2R3V A;  4WUB A;  1Z5C A;  2VQE I;  4DV6 I;  4JI7 E;  1Z0V A;  1DAR A;  3LNU A;  4JI8 I;  2V8P A;  4LF6 I;  4IZK B;  1S4E A;  2HHH E;  3T1H I;  4OX9 I;  1B63 A;  4JI2 E;  1USV A;  4YY3 E;  4HYM A;  4LF7 E;  2EFG A;  4K0K E;  4DXL A;  3QT7 A;  2UXD I;  2DEI A;  1FJG I;  4ZVI A;  1UEK A;  4LF4 I;  3LTO A;  4USK A;  4JI5 I;  4NXN E;  4R1F A;  4JV5 E;  4RPF A;  2UUB E;  4B3R E;  1PIE A;  4PRV A;  1I94 I;  4DV2 I;  3D4J A;  4DV3 I;  4LFC I;  1BKN A;  1Z5A A;  4X66 E;  2UXC E;  4DPX A;  4JG4 A;  2V2Q A;  1PVG A;  1HNW E;  1HR0 E;  1ZXN A;  2BM1 A;  3H4L A;  4DR2 E;  1N32 E;  1FNM A;  1Z59 A;  4JI0 E;  4GKJ E;  2UUA E;  2HHH I;  1N33 I;  3OTO E;  2ZIT A;  2BV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...