4DR3I

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr3I00
4OX9E 1NHIA 2UU9I 4OX9I 1ZM4A 4NXME 3K17A 4NXMI 4URLA 4JI3E 4LF5I 4JI7E 4MYTA 4JI7I 2V2VA 4DR3I 1N0UA 1B62A 5L3JA 4DR2I 4HACB 1KVKA 4LF6E 1Z0VA 4DV4E 4ZVIA 4DUYE 4AQYI 4DUYI 2E5LE 1PVGA 3K1JA 3J80Q 1EI1A 4KHPI 4P52A 4JI4E 4ED4A 1N0VC 3Q1QA 1NZ0A 4DU8A 3J7AM 1HNXE 4B3MI 1HNXI 2UUAE 1OJ4A 2VF3A 2X7IA 1RREA 4X64I 3ZKBA 4USMA 1UEKA 5FLXQ 4JI6E 2AJ4A 3H4LA 1ELOA 4JI6I 3D4JA 4JI8E 4DV1E 4JV5I 4DV1I 3V2UC 1QZRA 3ZZUA 2X36A 1FNMA 4FWHA 1Z59A 5A2QC 2ZM6E 3T1HI 4M1KA 1J5EE 4HYMA 5LMUI 2UUBE 1A6FA 2VQFI 2UXDI 4LFBE 4JI5E 2NPFA 4DV5E 1XMQE 4LFBI 4JI5I 1HNWE 1Z5CA 4DU7A 4X65I 1NHJA 2F4VI 5IT9C 4USKA 4DR5I 1FWLA 1NHHA 1MG7A 1Z0BA 4LF7E 1FWKA 2UXBE 4LF7I 3F0NA 2V2ZA 1FJGI 1N36E 1ZM2A 4FWDA 1Z0EA 4FN5A 1FKAE 1I94I 4JYAI 4DV7E 2HK2A 1IBKI 4GKJI 2DEIA 4Z7CA 1N33E 3LPSA 4X62E 2R42A 2HFUA 4JI3I 4LF4E 4NXNE 4LF4I 3PYGA 2GS8A 4YY3E 3LTOA 4FWGA 4DXLA 4YY3I 4B3RE 3WU4A 1HR0E 4B3RI 3PYFA 4I3HA 2R3VA 4LF6I 4XTJA 4DV4I 4HY1A 2E5LI 4UTGA 4JI2E 1IBLE 1ZXMA 4DR6E 1RR9A 4JI2I 2Q2EB 4DR6I 2UXCE 4DV2E 4JI4I 4DV2I 2UUAI 4R1FA 4KQVA 1WUUA 4DV0E 2A2CA 4DV0I 4JI1E 1KKHA 2J7KA 4JI8I 5LL6R 3M6AA 2CZ9A 4EMDA 2ZITA 3WU5A 1H72C 5GMEA 1Z0CA 1DARA 1XNQE 2XEXA 2ZM6I 1HNZE 2A2DA 3HULA 1J5EI 1HNZI 2HHHE 1MU5A 4DV3E 1N34E 3QT8A 3T1YE 2UUBI 4X66E 3B82A 5LMNE 3J7AG 1PIEA 4DV6E 4X66I 5LMNI 4DV6I 4DV5I 3B78A 1XMQI 1HNWI 1XNRE 3V5RA 4P7AA 4MYUA 1D6TA 2V34A 4WUBA 3ZZ0A 4WUDA 4K0KE 3B8HA 4DPTA 4K0KI 2UUCE 1FI4A 1BKNA 2UXBI 2UUCI 2V8PA 4RPFA 1PKPA 1H7SA 1N36I 2HFSA 3JAMC 3OTOE 4HACA 1XHKA 4DV7I 4Z7YA 1Z0GA 1N33I 4X62I 4YHHE 1K47A 3WU6A 4DR4E 2BM1A 1XMOE 1EA6A 4NXNI 2EFGA 3J81C 2BM0A 4LF5E 1HR0I 5BR8E 1H73A 5BR8I 3GONA 3QT5A 4DPUA 4DR3E 1IBLI 4DPWA 4DR2E 2UXCI 1Z0WA 2V2QA 4DR1E 4LFCE 4LF9E 4DR1I 4LFCI 4LF9I 1Z5AA 4DPYA 4AQYE 4PRXA 4WUCA 4DUZE 3PYDA 4DUZI 4JI1I 2BV3A 4KHPE 3J80C 4B3ME 1N32E 1N32I 4PRVA 4X64E 1ZM3A 5A2QQ 4JG4A 1XNQI 5FLXC 2HK3A 4JV5E 4LF8E 2HHHI 1N34I 4DV3I 4LF8I 2E1RA 3T1YI 1IBME 1H7UA 2VQEE 1MX0A 1IBMI 2VQEI 4DPXA 5IT9Q 3LNUA 1XNRI 3ZM7A 3ZKDA 3T1HE 1Z5BA 3CWVA 5LMUE 1Z0TA 1ZM9A 4B3SE 4B3SI 2VQFE 2UXDE 5IWAE 2HKJA 5IWAI 2DEJA 1S16A 1KTVA 2ZBKB 3WU3A 3QT7A 1VISA 2LJPA 4PU9A 4X65E 4JI0E 2F4VE 5GMDA 3JAMQ 4JI0I 2OI2A 3QT6A 4DR5E 4B3TE 4B3TI 1U2RA 3OTOI 1B63A 1H74A 3PYEA 1S4EA 4LFAE 4HXZA 1ZXNA 3ZZTA 4GKKE 4LFAI 1FJGE 4GKKI 2HKEA 4UT4A 2WW4A 1I94E 4JYAE 4FW9A 1IBKE 4YHHI 4DR7E 4GKJE 4DR4I 1KIJA 4DR7I 1XMOI 3J81Q 2UU9E
chains in the Genus database with same CATH superfamily
4OX9E 1NHIA 5DRRA 2UU9I 4OX9I 1ZM4A 4NXME 2PNLA 3K17A 4NXMI 4URLA 4JI3E 4LF5I 4JI7E 1UDNA 4MYTA 4JI7I 4OO1D 2V2VA 4IZJB 4DR3I 1N0UA 1B62A 3B4TA 2O1TA 5L3JA 4DR2I 5JEAE 4HACB 1KVKA 4LF6E 1Z0VA 4DV4E 4ZVIA 4DUYE 4AQYI 4DUYI 2E5LE 1PVGA 3K1JA 3CDIA 3J80Q 1EI1A 4KHPI 4LCHA 4P52A 4JI4E 4ED4A 1N0VC 3Q1QA 1NZ0A 2Z5BB 4DU8A 1HNXE 3J7AM 4B3MI 3M85G 1HNXI 2UUAE 1OJ4A 3GMEA 2VF3A 2X7IA 1RREA 4X64I 3ZKBA 4USMA 1UEKA 5FLXQ 4JI6E 2AE8A 2AJ4A 3H4LA 1ELOA 4JI6I 3D4JA 4JI8E 5DROA 4MU3A 3J81Q 3P06A 4OO1F 4IS9A 2PO2B 4IZKB 4MQYA 4DV1E 4JV5I 4DV1I 4OO1E 3V2UC 2IERA 1QZRA 3ZZUA 2NN6B 2X36A 4IFDB 1OYRA 1FNMA 2JT2A 4FWHA 1Z59A 5A2QC 2ZM6E 3T1HI 2JEBB 3M7ND 3L7ZB 4M1KA 1J5EE 4HYMA 2Z5CB 5LMUI 2UUBE 1A6FA 3HJCA 1Y4UA 2VQFI 2UXDI 4LFBE 4JI5E 2JEAA 2NPFA 5C0XB 4DV5E 1XMQE 4LFBI 4JI5I 1HNWE 4BA2A 1Z5CA 4DU7A 4X65I 1NHJA 2F4VI 5IT9C 4USKA 2WP8B 1Y60A 4DR5I 1FWLA 1Y5YA 1NHHA 1MG7A 1Z0BA 4LF7E 4FW4A 1FWKA 2UXBE 4LF7I 4FW6A 3PS1A 3F0NA 2V2ZA 1FJGI 5K36B 2O1WA 4FW7A 1N36E 5FWKA 1ZM2A 1YH8A 4FWDA 1Z0EA 4FN5A 3M85D 1FKAE 1I94I 4JYAI 4DV7E 2HK2A 1IBKI 4GKJI 2DEIA 1VI7A 4Z7CA 1N33E 3M7NG 1R6MA 3LPSA 4X62E 2R42A 3HKMA 3GCMA 2HFUA 4JI3I 2J65A 2Z5BA 1R6LA 4LF4E 2NN6C 2O3ZA 4NXNE 4IFDC 4LF4I 5JEAF 3PYGA 2GS8A 4YY3E 1Y4SA 3LTOA 4FWGA 4DXLA 2CGEA 4YY3I 4B3RE 3WU4A 3H1CA 5JEAB 1HR0E 4B3RI 3PYFA 4I3HA 1E3PA 2R3VA 2PO2A 4IZKA 2GQ0A 4LF6I 1UDQA 4XTJA 4DV4I 1E3HA 5C0XC 4GQUA 4HY1A 4UTGA 2E5LI 4FW5A 4JI2E 1IBLE 1ZXMA 4DR6E 1RR9A 4JI2I 2Q2EB 4DR6I 2NN6A 2UXCE 4BA1A 4DV2E 4JI4I 4DV2I 2PO1A 2JE6A 3L7ZA 2UUAI 4R1FA 2C37A 4KQVA 3KRNA 1OYSA 2BR2B 1YHCA 2C38B 1WUUA 4DV0E 2CVEA 1XMOI 2A2CA 4DV0I 4JI1E 1KKHA 2J7KA 5K36C 2C39B 4LOMA 4JI8I 2IOPA 3PS3A 5LL6R 3M6AA 2CZ9A 4EMDA 4OO1B 2ZITA 2PNZA 3WU5A 1H72C 5GMEA 1Z0CA 2IOQA 1DARA 1XNQE 2XEXA 4U3BA 2ZM6I 1HNZE 4J3DA 2A2DA 3HULA 1J5EI 1HNZI 2HHHE 1MU5A 4DV3E 1N34E 3QT8A 3T1YE 2UUBI 4X66E 3B82A 4OZEA 5LMNE 3J7AG 1PIEA 4DV6E 2GO4A 4X66I 2BA0D 5LMNI 4DV6I 4DV5I 3B78A 1XMQI 1HNWI 1XNRE 1USVA 3V5RA 4NBQA 4P7AA 4MYUA 3CDJA 4QNJA 1D6TA 2V34A 5JEAC 2PO0B 4WUBA 3ZZ0A 4WUDA 4K0KE 3B8HA 4DPTA 4K0KI 3Q6MA 2WNRB 2UUCE 2O1UA 1FI4A 1BKNA 2UXBI 3K85A 2UUCI 2Z5EA 2V8PA 4RPFA 1PKPA 4MU4A 1H7SA 3NZKA 4IZJA 1N36I 2HFSA 4IZJD 3JAMC 3OTOE 4HACA 1OYPA 1XHKA 3Q6NA 5EKWA 4DV7I 4Z7YA 1Z0GA 4AIDA 1N33I 4QNKA 4X62I 4OO1C 2JEAB 2F1DA 2BA0G 4YHHE 1K47A 3WU6A 2BA1D 4DR4E 2BM1A 1XMOE 2PNMA 4ISAA 1EA6A 4NXNI 2EFGA 3J81C 2BM0A 4LF5E 2C39A 2CG9A 5BR8E 1HR0I 1H73A 5BR8I 3U1KA 3PS2A 3GONA 4MU1A 4OO1A 3QT5A 2GO3A 4DPUA 4DR3E 1IBLI 1HK7A 2O1VA 4AIMA 4IFDA 5DRQA 4DPWA 1UDSA 4DR2E 1UDOA 2NN6D 4IFDD 2UXCI 1Z0WA 2V2QA 4DR1E 4LFCE 4LF9E 2JEBA 4LFCI 4DR1I 4LF9I 1Z5AA 2Z5CA 4DPYA 4AQYE 1XXEA 4PRXA 4WUCA 4DUZE 3PYDA 4DUZI 5C0XA 4JI1I 2BV3A 4KHPE 5C0XD 4AM3A 3J80C 4B3ME 1N32E 3P3GA 1N32I 2PO0A 2WP8A 4PRVA 4LCGA 4X64E 1ZM3A 2BA1G 5ELWA 5A2QQ 3UHMA 4JG4A 4N3OA 2WNRA 1XNQI 5EL9A 5DNXA 5FLXC 2HK3A 5K36A 4JV5E 3P3EA 4LF8E 2IESA 2HHHI 1N34I 4DV3I 4LF8I 5K36D 2E1RA 3T1YI 2NN6F 3PRYA 4IFDF 1USUA 1IBME 1H7UA 2VQEE 1MX0A 1IBMI 2VQEI 2NN6E 4DPXA 4IFDE 5IT9Q 3LNUA 1XNRI 3ZM7A 4BA1B 3ZKDA 3T1HE 1Z5BA 3CWVA 2PO1B 2JE6B 5LMUE 1Z0TA 1ZM9A 5DRPA 2C37B 4B3SE 5C0XF 4B3SI 2VQFE 2UXDE 5IWAE 3P76A 2HKJA 5IWAI 5C0XE 2DEJA 1S16A 1KTVA 2ZBKB 3WU3A 3QT7A 1VISA 2LJPA 4PU9A 4X65E 2VESA 4JI0E 2F4VE 5GMDA 3JAMQ 4JI0I 2OI2A 3QT6A 2PNZB 4DR5E 1Y6ZA 4B3TE 5JEAA 4B3TI 1U2RA 4LPFA 3OTOI 3U1YA 5JEAD 1B63A 1H74A 3PYEA 1S4EA 5K36F 4LFAE 4HXZA 1ZXNA 3ZZTA 4GKKE 4LFAI 1FJGE 5DNLA 4GKKI 4U3DA 5K36E 4MU0A 4FW3A 2HKEA 3DD6A 4UT4A 2WW4A 4BA2B 4OKGA 1I94E 4JYAE 4FW9A 3GLLA 1IBKE 1RHYA 4YHHI 4DR7E 4GKJE 3P3CA 4DR4I 1KIJA 4MDTA 1P42A 2C38A 2BR2A 4DR7I 2UU9E 4LCFA
chains in the Genus database with same CATH topology
4OX9E 1NHIA 2UU9I 4OX9I 1ZM4A 4NXME 2PNLA 3K17A 4NXMI 4URLA 4JI3E 4LF5I 4JI7E 4MYTA 4JI7I 2V2VA 4IZJB 4DR3I 1N0UA 1B62A 2O1TA 5L3JA 4DR2I 4HACB 1KVKA 4LF6E 1Z0VA 4DV4E 4ZVIA 4DUYE 4AQYI 4DUYI 2E5LE 1PVGA 3K1JA 3J80Q 1EI1A 4KHPI 4P52A 4JI4E 4ED4A 1N0VC 3Q1QA 1NZ0A 2Z5BB 4DU8A 1HNXE 3J7AM 4B3MI 1HNXI 2UUAE 1OJ4A 2VF3A 2X7IA 1RREA 4X64I 3ZKBA 4USMA 1UEKA 5FLXQ 4JI6E 2AJ4A 3H4LA 1ELOA 4JI6I 3D4JA 4JI8E 3P06A 4IZKB 4DV1E 4JV5I 4DV1I 3V2UC 1QZRA 3ZZUA 2X36A 1FNMA 4FWHA 1Z59A 5A2QC 2ZM6E 3T1HI 4M1KA 1J5EE 4HYMA 2Z5CB 5LMUI 2UUBE 1A6FA 3HJCA 1Y4UA 2VQFI 2UXDI 4LFBE 4JI5E 2NPFA 4DV5E 1XMQE 4LFBI 4JI5I 1HNWE 1Z5CA 4DU7A 4X65I 1NHJA 2F4VI 5IT9C 4USKA 4DR5I 1FWLA 1NHHA 1MG7A 1Z0BA 4LF7E 1FWKA 2UXBE 4LF7I 3F0NA 2V2ZA 1FJGI 2O1WA 1N36E 5FWKA 1ZM2A 4FWDA 1Z0EA 4FN5A 1FKAE 1I94I 4JYAI 4DV7E 2HK2A 1IBKI 4GKJI 2DEIA 4Z7CA 1N33E 3LPSA 4X62E 2R42A 2HFUA 4JI3I 2Z5BA 4LF4E 4NXNE 4LF4I 3PYGA 2GS8A 4YY3E 1Y4SA 3LTOA 4FWGA 4YY3I 2CGEA 4DXLA 4B3RE 3WU4A 1HR0E 4B3RI 3PYFA 4I3HA 2R3VA 4IZKA 2GQ0A 4LF6I 4XTJA 4DV4I 4HY1A 4UTGA 2E5LI 4JI2E 1IBLE 1ZXMA 4DR6E 1RR9A 4JI2I 2Q2EB 4DR6I 2UXCE 4DV2E 4JI4I 4DV2I 2UUAI 4R1FA 4KQVA 1WUUA 4DV0E 2A2CA 4DV0I 4JI1E 1KKHA 2J7KA 4JI8I 2IOPA 5LL6R 3M6AA 2CZ9A 4EMDA 2ZITA 3WU5A 1H72C 5GMEA 1Z0CA 2IOQA 1DARA 1XNQE 2XEXA 2ZM6I 1HNZE 2A2DA 3HULA 1J5EI 1HNZI 2HHHE 1MU5A 4DV3E 1N34E 3QT8A 3T1YE 2UUBI 4X66E 3B82A 5LMNE 3J7AG 1PIEA 4DV6E 4X66I 5LMNI 4DV6I 4DV5I 3B78A 1XMQI 1HNWI 1XNRE 1USVA 3V5RA 4P7AA 4MYUA 1D6TA 2V34A 4WUBA 3ZZ0A 4WUDA 4K0KE 3B8HA 4DPTA 4K0KI 3Q6MA 2UUCE 2O1UA 1FI4A 1BKNA 2UXBI 3K85A 2UUCI 2Z5EA 2V8PA 4RPFA 1PKPA 1H7SA 4IZJA 1N36I 2HFSA 4IZJD 3JAMC 3OTOE 4HACA 1XHKA 3Q6NA 4DV7I 4Z7YA 1Z0GA 1N33I 4X62I 4YHHE 1K47A 3WU6A 4DR4E 2BM1A 1XMOE 2PNMA 1EA6A 4NXNI 2EFGA 3J81C 2BM0A 4LF5E 2CG9A 5BR8E 1HR0I 1H73A 5BR8I 3GONA 3QT5A 4DPUA 4DR3E 1IBLI 1HK7A 2O1VA 4DPWA 4DR2E 2UXCI 1Z0WA 2V2QA 4DR1E 4LFCE 4LF9E 4DR1I 4LFCI 4LF9I 1Z5AA 2Z5CA 4DPYA 4AQYE 4PRXA 4WUCA 4DUZE 3PYDA 4DUZI 4JI1I 2BV3A 4KHPE 3J80C 4B3ME 1N32E 1N32I 4PRVA 4X64E 1ZM3A 5A2QQ 4JG4A 4N3OA 1XNQI 5FLXC 2HK3A 4JV5E 4LF8E 2HHHI 1N34I 4DV3I 4LF8I 2E1RA 3T1YI 3PRYA 1USUA 1IBME 1H7UA 2VQEE 1MX0A 1IBMI 2VQEI 4DPXA 5IT9Q 3LNUA 1XNRI 3ZM7A 3ZKDA 3T1HE 1Z5BA 3CWVA 5LMUE 1Z0TA 1ZM9A 4B3SE 4B3SI 2VQFE 2UXDE 5IWAE 2HKJA 5IWAI 2DEJA 1S16A 1KTVA 2ZBKB 3WU3A 3QT7A 1VISA 2LJPA 4PU9A 4X65E 4JI0E 2F4VE 5GMDA 3JAMQ 4JI0I 2OI2A 3QT6A 4DR5E 1Y6ZA 4B3TE 4B3TI 1U2RA 3OTOI 1B63A 1H74A 3PYEA 1S4EA 4LFAE 4HXZA 1ZXNA 3ZZTA 4GKKE 4LFAI 1FJGE 4GKKI 2HKEA 4UT4A 2WW4A 1I94E 4JYAE 4FW9A 1IBKE 4YHHI 4DR7E 4GKJE 4DR4I 1KIJA 4DR7I 1XMOI 3J81Q 2UU9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 E;  1NHI A;  2UU9 I;  4OX9 I;  1ZM4 A;  4NXM E;  3K17 A;  4NXM I;  4URL A;  4JI3 E;  4LF5 I;  4JI7 E;  4MYT A;  4JI7 I;  2V2V A;  4DR3 I;  1N0U A;  1B62 A;  5L3J A;  4DR2 I;  4HAC B;  1KVK A;  4LF6 E;  1Z0V A;  4DV4 E;  4ZVI A;  4DUY E;  4AQY I;  4DUY I;  2E5L E;  1PVG A;  3K1J A;  3J80 Q;  1EI1 A;  4KHP I;  4P52 A;  4JI4 E;  4ED4 A;  1N0V C;  3Q1Q A;  1NZ0 A;  4DU8 A;  3J7A M;  1HNX E;  4B3M I;  1HNX I;  2UUA E;  1OJ4 A;  2VF3 A;  2X7I A;  1RRE A;  4X64 I;  3ZKB A;  4USM A;  1UEK A;  5FLX Q;  4JI6 E;  2AJ4 A;  3H4L A;  1ELO A;  4JI6 I;  3D4J A;  4JI8 E;  4DV1 E;  4JV5 I;  4DV1 I;  3V2U C;  1QZR A;  3ZZU A;  2X36 A;  1FNM A;  4FWH A;  1Z59 A;  5A2Q C;  2ZM6 E;  3T1H I;  4M1K A;  1J5E E;  4HYM A;  5LMU I;  2UUB E;  1A6F A;  2VQF I;  2UXD I;  4LFB E;  4JI5 E;  2NPF A;  4DV5 E;  1XMQ E;  4LFB I;  4JI5 I;  1HNW E;  1Z5C A;  4DU7 A;  4X65 I;  1NHJ A;  2F4V I;  5IT9 C;  4USK A;  4DR5 I;  1FWL A;  1NHH A;  1MG7 A;  1Z0B A;  4LF7 E;  1FWK A;  2UXB E;  4LF7 I;  3F0N A;  2V2Z A;  1FJG I;  1N36 E;  1ZM2 A;  4FWD A;  1Z0E A;  4FN5 A;  1FKA E;  1I94 I;  4JYA I;  4DV7 E;  2HK2 A;  1IBK I;  4GKJ I;  2DEI A;  4Z7C A;  1N33 E;  3LPS A;  4X62 E;  2R42 A;  2HFU A;  4JI3 I;  4LF4 E;  4NXN E;  4LF4 I;  3PYG A;  2GS8 A;  4YY3 E;  3LTO A;  4FWG A;  4DXL A;  4YY3 I;  4B3R E;  3WU4 A;  1HR0 E;  4B3R I;  3PYF A;  4I3H A;  2R3V A;  4LF6 I;  4XTJ A;  4DV4 I;  4HY1 A;  2E5L I;  4UTG A;  4JI2 E;  1IBL E;  1ZXM A;  4DR6 E;  1RR9 A;  4JI2 I;  2Q2E B;  4DR6 I;  2UXC E;  4DV2 E;  4JI4 I;  4DV2 I;  2UUA I;  4R1F A;  4KQV A;  1WUU A;  4DV0 E;  2A2C A;  4DV0 I;  4JI1 E;  1KKH A;  2J7K A;  4JI8 I;  5LL6 R;  3M6A A;  2CZ9 A;  4EMD A;  2ZIT A;  3WU5 A;  1H72 C;  5GME A;  1Z0C A;  1DAR A;  1XNQ E;  2XEX A;  2ZM6 I;  1HNZ E;  2A2D A;  3HUL A;  1J5E I;  1HNZ I;  2HHH E;  1MU5 A;  4DV3 E;  1N34 E;  3QT8 A;  3T1Y E;  2UUB I;  4X66 E;  3B82 A;  5LMN E;  3J7A G;  1PIE A;  4DV6 E;  4X66 I;  5LMN I;  4DV6 I;  4DV5 I;  3B78 A;  1XMQ I;  1HNW I;  1XNR E;  3V5R A;  4P7A A;  4MYU A;  1D6T A;  2V34 A;  4WUB A;  3ZZ0 A;  4WUD A;  4K0K E;  3B8H A;  4DPT A;  4K0K I;  2UUC E;  1FI4 A;  1BKN A;  2UXB I;  2UUC I;  2V8P A;  4RPF A;  1PKP A;  1H7S A;  1N36 I;  2HFS A;  3JAM C;  3OTO E;  4HAC A;  1XHK A;  4DV7 I;  4Z7Y A;  1Z0G A;  1N33 I;  4X62 I;  4YHH E;  1K47 A;  3WU6 A;  4DR4 E;  2BM1 A;  1XMO E;  1EA6 A;  4NXN I;  2EFG A;  3J81 C;  2BM0 A;  4LF5 E;  1HR0 I;  5BR8 E;  1H73 A;  5BR8 I;  3GON A;  3QT5 A;  4DPU A;  4DR3 E;  1IBL I;  4DPW A;  4DR2 E;  2UXC I;  1Z0W A;  2V2Q A;  4DR1 E;  4LFC E;  4LF9 E;  4DR1 I;  4LFC I;  4LF9 I;  1Z5A A;  4DPY A;  4AQY E;  4PRX A;  4WUC A;  4DUZ E;  3PYD A;  4DUZ I;  4JI1 I;  2BV3 A;  4KHP E;  3J80 C;  4B3M E;  1N32 E;  1N32 I;  4PRV A;  4X64 E;  1ZM3 A;  5A2Q Q;  4JG4 A;  1XNQ I;  5FLX C;  2HK3 A;  4JV5 E;  4LF8 E;  2HHH I;  1N34 I;  4DV3 I;  4LF8 I;  2E1R A;  3T1Y I;  1IBM E;  1H7U A;  2VQE E;  1MX0 A;  1IBM I;  2VQE I;  4DPX A;  5IT9 Q;  3LNU A;  1XNR I;  3ZM7 A;  3ZKD A;  3T1H E;  1Z5B A;  3CWV A;  5LMU E;  1Z0T A;  1ZM9 A;  4B3S E;  4B3S I;  2VQF E;  2UXD E;  5IWA E;  2HKJ A;  5IWA I;  2DEJ A;  1S16 A;  1KTV A;  2ZBK B;  3WU3 A;  3QT7 A;  1VIS A;  2LJP A;  4PU9 A;  4X65 E;  4JI0 E;  2F4V E;  5GMD A;  3JAM Q;  4JI0 I;  2OI2 A;  3QT6 A;  4DR5 E;  4B3T E;  4B3T I;  1U2R A;  3OTO I;  1B63 A;  1H74 A;  3PYE A;  1S4E A;  4LFA E;  4HXZ A;  1ZXN A;  3ZZT A;  4GKK E;  4LFA I;  1FJG E;  4GKK I;  2HKE A;  4UT4 A;  2WW4 A;  1I94 E;  4JYA E;  4FW9 A;  1IBK E;  4YHH I;  4DR7 E;  4GKJ E;  4DR4 I;  1KIJ A;  4DR7 I;  1XMO I;  3J81 Q;  2UU9 E; 
#chains in the Genus database with same CATH topology
 4OX9 E;  1NHI A;  5DRR A;  2UU9 I;  4OX9 I;  1ZM4 A;  4NXM E;  2PNL A;  3K17 A;  4NXM I;  4URL A;  4JI3 E;  4LF5 I;  4JI7 E;  1UDN A;  4MYT A;  4JI7 I;  4OO1 D;  2V2V A;  4IZJ B;  4DR3 I;  1N0U A;  1B62 A;  3B4T A;  2O1T A;  5L3J A;  4DR2 I;  5JEA E;  4HAC B;  1KVK A;  4LF6 E;  1Z0V A;  4DV4 E;  4ZVI A;  4DUY E;  4AQY I;  4DUY I;  2E5L E;  1PVG A;  3K1J A;  3CDI A;  3J80 Q;  1EI1 A;  4KHP I;  4LCH A;  4P52 A;  4JI4 E;  4ED4 A;  1N0V C;  3Q1Q A;  1NZ0 A;  2Z5B B;  4DU8 A;  1HNX E;  3J7A M;  4B3M I;  3M85 G;  1HNX I;  2UUA E;  1OJ4 A;  3GME A;  2VF3 A;  2X7I A;  1RRE A;  4X64 I;  3ZKB A;  4USM A;  1UEK A;  5FLX Q;  4JI6 E;  2AE8 A;  2AJ4 A;  3H4L A;  1ELO A;  4JI6 I;  3D4J A;  4JI8 E;  5DRO A;  4MU3 A;  3J81 Q;  3P06 A;  4OO1 F;  4IS9 A;  2PO2 B;  4IZK B;  4MQY A;  4DV1 E;  4JV5 I;  4DV1 I;  4OO1 E;  3V2U C;  2IER A;  1QZR A;  3ZZU A;  2NN6 B;  2X36 A;  4IFD B;  1OYR A;  1FNM A;  2JT2 A;  4FWH A;  1Z59 A;  5A2Q C;  2ZM6 E;  3T1H I;  2JEB B;  3M7N D;  3L7Z B;  4M1K A;  1J5E E;  4HYM A;  2Z5C B;  5LMU I;  2UUB E;  1A6F A;  3HJC A;  1Y4U A;  2VQF I;  2UXD I;  4LFB E;  4JI5 E;  2JEA A;  2NPF A;  5C0X B;  4DV5 E;  1XMQ E;  4LFB I;  4JI5 I;  1HNW E;  4BA2 A;  1Z5C A;  4DU7 A;  4X65 I;  1NHJ A;  2F4V I;  5IT9 C;  4USK A;  2WP8 B;  1Y60 A;  4DR5 I;  1FWL A;  1Y5Y A;  1NHH A;  1MG7 A;  1Z0B A;  4LF7 E;  4FW4 A;  1FWK A;  2UXB E;  4LF7 I;  4FW6 A;  3PS1 A;  3F0N A;  2V2Z A;  1FJG I;  5K36 B;  2O1W A;  4FW7 A;  1N36 E;  5FWK A;  1ZM2 A;  1YH8 A;  4FWD A;  1Z0E A;  4FN5 A;  3M85 D;  1FKA E;  1I94 I;  4JYA I;  4DV7 E;  2HK2 A;  1IBK I;  4GKJ I;  2DEI A;  1VI7 A;  4Z7C A;  1N33 E;  3M7N G;  1R6M A;  3LPS A;  4X62 E;  2R42 A;  3HKM A;  3GCM A;  2HFU A;  4JI3 I;  2J65 A;  2Z5B A;  1R6L A;  4LF4 E;  2NN6 C;  2O3Z A;  4NXN E;  4IFD C;  4LF4 I;  5JEA F;  3PYG A;  2GS8 A;  4YY3 E;  1Y4S A;  3LTO A;  4FWG A;  4DXL A;  2CGE A;  4YY3 I;  4B3R E;  3WU4 A;  3H1C A;  5JEA B;  1HR0 E;  4B3R I;  3PYF A;  4I3H A;  1E3P A;  2R3V A;  2PO2 A;  4IZK A;  2GQ0 A;  4LF6 I;  1UDQ A;  4XTJ A;  4DV4 I;  1E3H A;  5C0X C;  4GQU A;  4HY1 A;  4UTG A;  2E5L I;  4FW5 A;  4JI2 E;  1IBL E;  1ZXM A;  4DR6 E;  1RR9 A;  4JI2 I;  2Q2E B;  4DR6 I;  2NN6 A;  2UXC E;  4BA1 A;  4DV2 E;  4JI4 I;  4DV2 I;  2PO1 A;  2JE6 A;  3L7Z A;  2UUA I;  4R1F A;  2C37 A;  4KQV A;  3KRN A;  1OYS A;  2BR2 B;  1YHC A;  2C38 B;  1WUU A;  4DV0 E;  2CVE A;  1XMO I;  2A2C A;  4DV0 I;  4JI1 E;  1KKH A;  2J7K A;  5K36 C;  2C39 B;  4LOM A;  4JI8 I;  2IOP A;  3PS3 A;  5LL6 R;  3M6A A;  2CZ9 A;  4EMD A;  4OO1 B;  2ZIT A;  2PNZ A;  3WU5 A;  1H72 C;  5GME A;  1Z0C A;  2IOQ A;  1DAR A;  1XNQ E;  2XEX A;  4U3B A;  2ZM6 I;  1HNZ E;  4J3D A;  2A2D A;  3HUL A;  1J5E I;  1HNZ I;  2HHH E;  1MU5 A;  4DV3 E;  1N34 E;  3QT8 A;  3T1Y E;  2UUB I;  4X66 E;  3B82 A;  4OZE A;  5LMN E;  3J7A G;  1PIE A;  4DV6 E;  2GO4 A;  4X66 I;  2BA0 D;  5LMN I;  4DV6 I;  4DV5 I;  3B78 A;  1XMQ I;  1HNW I;  1XNR E;  1USV A;  3V5R A;  4NBQ A;  4P7A A;  4MYU A;  3CDJ A;  4QNJ A;  1D6T A;  2V34 A;  5JEA C;  2PO0 B;  4WUB A;  3ZZ0 A;  4WUD A;  4K0K E;  3B8H A;  4DPT A;  4K0K I;  3Q6M A;  2WNR B;  2UUC E;  2O1U A;  1FI4 A;  1BKN A;  2UXB I;  3K85 A;  2UUC I;  2Z5E A;  2V8P A;  4RPF A;  1PKP A;  4MU4 A;  1H7S A;  3NZK A;  4IZJ A;  1N36 I;  2HFS A;  4IZJ D;  3JAM C;  3OTO E;  4HAC A;  1OYP A;  1XHK A;  3Q6N A;  5EKW A;  4DV7 I;  4Z7Y A;  1Z0G A;  4AID A;  1N33 I;  4QNK A;  4X62 I;  4OO1 C;  2JEA B;  2F1D A;  2BA0 G;  4YHH E;  1K47 A;  3WU6 A;  2BA1 D;  4DR4 E;  2BM1 A;  1XMO E;  2PNM A;  4ISA A;  1EA6 A;  4NXN I;  2EFG A;  3J81 C;  2BM0 A;  4LF5 E;  2C39 A;  2CG9 A;  5BR8 E;  1HR0 I;  1H73 A;  5BR8 I;  3U1K A;  3PS2 A;  3GON A;  4MU1 A;  4OO1 A;  3QT5 A;  2GO3 A;  4DPU A;  4DR3 E;  1IBL I;  1HK7 A;  2O1V A;  4AIM A;  4IFD A;  5DRQ A;  4DPW A;  1UDS A;  4DR2 E;  1UDO A;  2NN6 D;  4IFD D;  2UXC I;  1Z0W A;  2V2Q A;  4DR1 E;  4LFC E;  4LF9 E;  2JEB A;  4LFC I;  4DR1 I;  4LF9 I;  1Z5A A;  2Z5C A;  4DPY A;  4AQY E;  1XXE A;  4PRX A;  4WUC A;  4DUZ E;  3PYD A;  4DUZ I;  5C0X A;  4JI1 I;  2BV3 A;  4KHP E;  5C0X D;  4AM3 A;  3J80 C;  4B3M E;  1N32 E;  3P3G A;  1N32 I;  2PO0 A;  2WP8 A;  4PRV A;  4LCG A;  4X64 E;  1ZM3 A;  2BA1 G;  5ELW A;  5A2Q Q;  3UHM A;  4JG4 A;  4N3O A;  2WNR A;  1XNQ I;  5EL9 A;  5DNX A;  5FLX C;  2HK3 A;  5K36 A;  4JV5 E;  3P3E A;  4LF8 E;  2IES A;  2HHH I;  1N34 I;  4DV3 I;  4LF8 I;  5K36 D;  2E1R A;  3T1Y I;  2NN6 F;  3PRY A;  4IFD F;  1USU A;  1IBM E;  1H7U A;  2VQE E;  1MX0 A;  1IBM I;  2VQE I;  2NN6 E;  4DPX A;  4IFD E;  5IT9 Q;  3LNU A;  1XNR I;  3ZM7 A;  4BA1 B;  3ZKD A;  3T1H E;  1Z5B A;  3CWV A;  2PO1 B;  2JE6 B;  5LMU E;  1Z0T A;  1ZM9 A;  5DRP A;  2C37 B;  4B3S E;  5C0X F;  4B3S I;  2VQF E;  2UXD E;  5IWA E;  3P76 A;  2HKJ A;  5IWA I;  5C0X E;  2DEJ A;  1S16 A;  1KTV A;  2ZBK B;  3WU3 A;  3QT7 A;  1VIS A;  2LJP A;  4PU9 A;  4X65 E;  2VES A;  4JI0 E;  2F4V E;  5GMD A;  3JAM Q;  4JI0 I;  2OI2 A;  3QT6 A;  2PNZ B;  4DR5 E;  1Y6Z A;  4B3T E;  5JEA A;  4B3T I;  1U2R A;  4LPF A;  3OTO I;  3U1Y A;  5JEA D;  1B63 A;  1H74 A;  3PYE A;  1S4E A;  5K36 F;  4LFA E;  4HXZ A;  1ZXN A;  3ZZT A;  4GKK E;  4LFA I;  1FJG E;  5DNL A;  4GKK I;  4U3D A;  5K36 E;  4MU0 A;  4FW3 A;  2HKE A;  3DD6 A;  4UT4 A;  2WW4 A;  4BA2 B;  4OKG A;  1I94 E;  4JYA E;  4FW9 A;  3GLL A;  1IBK E;  1RHY A;  4YHH I;  4DR7 E;  4GKJ E;  3P3C A;  4DR4 I;  1KIJ A;  4MDT A;  1P42 A;  2C38 A;  2BR2 A;  4DR7 I;  2UU9 E;  4LCF A; 
#chains in the Genus database with same CATH homology
 4OX9 E;  1NHI A;  2UU9 I;  4OX9 I;  1ZM4 A;  4NXM E;  2PNL A;  3K17 A;  4NXM I;  4URL A;  4JI3 E;  4LF5 I;  4JI7 E;  4MYT A;  4JI7 I;  2V2V A;  4IZJ B;  4DR3 I;  1N0U A;  1B62 A;  2O1T A;  5L3J A;  4DR2 I;  4HAC B;  1KVK A;  4LF6 E;  1Z0V A;  4DV4 E;  4ZVI A;  4DUY E;  4AQY I;  4DUY I;  2E5L E;  1PVG A;  3K1J A;  3J80 Q;  1EI1 A;  4KHP I;  4P52 A;  4JI4 E;  4ED4 A;  1N0V C;  3Q1Q A;  1NZ0 A;  2Z5B B;  4DU8 A;  1HNX E;  3J7A M;  4B3M I;  1HNX I;  2UUA E;  1OJ4 A;  2VF3 A;  2X7I A;  1RRE A;  4X64 I;  3ZKB A;  4USM A;  1UEK A;  5FLX Q;  4JI6 E;  2AJ4 A;  3H4L A;  1ELO A;  4JI6 I;  3D4J A;  4JI8 E;  3P06 A;  4IZK B;  4DV1 E;  4JV5 I;  4DV1 I;  3V2U C;  1QZR A;  3ZZU A;  2X36 A;  1FNM A;  4FWH A;  1Z59 A;  5A2Q C;  2ZM6 E;  3T1H I;  4M1K A;  1J5E E;  4HYM A;  2Z5C B;  5LMU I;  2UUB E;  1A6F A;  3HJC A;  1Y4U A;  2VQF I;  2UXD I;  4LFB E;  4JI5 E;  2NPF A;  4DV5 E;  1XMQ E;  4LFB I;  4JI5 I;  1HNW E;  1Z5C A;  4DU7 A;  4X65 I;  1NHJ A;  2F4V I;  5IT9 C;  4USK A;  4DR5 I;  1FWL A;  1NHH A;  1MG7 A;  1Z0B A;  4LF7 E;  1FWK A;  2UXB E;  4LF7 I;  3F0N A;  2V2Z A;  1FJG I;  2O1W A;  1N36 E;  5FWK A;  1ZM2 A;  4FWD A;  1Z0E A;  4FN5 A;  1FKA E;  1I94 I;  4JYA I;  4DV7 E;  2HK2 A;  1IBK I;  4GKJ I;  2DEI A;  4Z7C A;  1N33 E;  3LPS A;  4X62 E;  2R42 A;  2HFU A;  4JI3 I;  2Z5B A;  4LF4 E;  4NXN E;  4LF4 I;  3PYG A;  2GS8 A;  4YY3 E;  1Y4S A;  3LTO A;  4FWG A;  4YY3 I;  2CGE A;  4DXL A;  4B3R E;  3WU4 A;  1HR0 E;  4B3R I;  3PYF A;  4I3H A;  2R3V A;  4IZK A;  2GQ0 A;  4LF6 I;  4XTJ A;  4DV4 I;  4HY1 A;  4UTG A;  2E5L I;  4JI2 E;  1IBL E;  1ZXM A;  4DR6 E;  1RR9 A;  4JI2 I;  2Q2E B;  4DR6 I;  2UXC E;  4DV2 E;  4JI4 I;  4DV2 I;  2UUA I;  4R1F A;  4KQV A;  1WUU A;  4DV0 E;  2A2C A;  4DV0 I;  4JI1 E;  1KKH A;  2J7K A;  4JI8 I;  2IOP A;  5LL6 R;  3M6A A;  2CZ9 A;  4EMD A;  2ZIT A;  3WU5 A;  1H72 C;  5GME A;  1Z0C A;  2IOQ A;  1DAR A;  1XNQ E;  2XEX A;  2ZM6 I;  1HNZ E;  2A2D A;  3HUL A;  1J5E I;  1HNZ I;  2HHH E;  1MU5 A;  4DV3 E;  1N34 E;  3QT8 A;  3T1Y E;  2UUB I;  4X66 E;  3B82 A;  5LMN E;  3J7A G;  1PIE A;  4DV6 E;  4X66 I;  5LMN I;  4DV6 I;  4DV5 I;  3B78 A;  1XMQ I;  1HNW I;  1XNR E;  1USV A;  3V5R A;  4P7A A;  4MYU A;  1D6T A;  2V34 A;  4WUB A;  3ZZ0 A;  4WUD A;  4K0K E;  3B8H A;  4DPT A;  4K0K I;  3Q6M A;  2UUC E;  2O1U A;  1FI4 A;  1BKN A;  2UXB I;  3K85 A;  2UUC I;  2Z5E A;  2V8P A;  4RPF A;  1PKP A;  1H7S A;  4IZJ A;  1N36 I;  2HFS A;  4IZJ D;  3JAM C;  3OTO E;  4HAC A;  1XHK A;  3Q6N A;  4DV7 I;  4Z7Y A;  1Z0G A;  1N33 I;  4X62 I;  4YHH E;  1K47 A;  3WU6 A;  4DR4 E;  2BM1 A;  1XMO E;  2PNM A;  1EA6 A;  4NXN I;  2EFG A;  3J81 C;  2BM0 A;  4LF5 E;  2CG9 A;  5BR8 E;  1HR0 I;  1H73 A;  5BR8 I;  3GON A;  3QT5 A;  4DPU A;  4DR3 E;  1IBL I;  1HK7 A;  2O1V A;  4DPW A;  4DR2 E;  2UXC I;  1Z0W A;  2V2Q A;  4DR1 E;  4LFC E;  4LF9 E;  4DR1 I;  4LFC I;  4LF9 I;  1Z5A A;  2Z5C A;  4DPY A;  4AQY E;  4PRX A;  4WUC A;  4DUZ E;  3PYD A;  4DUZ I;  4JI1 I;  2BV3 A;  4KHP E;  3J80 C;  4B3M E;  1N32 E;  1N32 I;  4PRV A;  4X64 E;  1ZM3 A;  5A2Q Q;  4JG4 A;  4N3O A;  1XNQ I;  5FLX C;  2HK3 A;  4JV5 E;  4LF8 E;  2HHH I;  1N34 I;  4DV3 I;  4LF8 I;  2E1R A;  3T1Y I;  3PRY A;  1USU A;  1IBM E;  1H7U A;  2VQE E;  1MX0 A;  1IBM I;  2VQE I;  4DPX A;  5IT9 Q;  3LNU A;  1XNR I;  3ZM7 A;  3ZKD A;  3T1H E;  1Z5B A;  3CWV A;  5LMU E;  1Z0T A;  1ZM9 A;  4B3S E;  4B3S I;  2VQF E;  2UXD E;  5IWA E;  2HKJ A;  5IWA I;  2DEJ A;  1S16 A;  1KTV A;  2ZBK B;  3WU3 A;  3QT7 A;  1VIS A;  2LJP A;  4PU9 A;  4X65 E;  4JI0 E;  2F4V E;  5GMD A;  3JAM Q;  4JI0 I;  2OI2 A;  3QT6 A;  4DR5 E;  1Y6Z A;  4B3T E;  4B3T I;  1U2R A;  3OTO I;  1B63 A;  1H74 A;  3PYE A;  1S4E A;  4LFA E;  4HXZ A;  1ZXN A;  3ZZT A;  4GKK E;  4LFA I;  1FJG E;  4GKK I;  2HKE A;  4UT4 A;  2WW4 A;  1I94 E;  4JYA E;  4FW9 A;  1IBK E;  4YHH I;  4DR7 E;  4GKJ E;  4DR4 I;  1KIJ A;  4DR7 I;  1XMO I;  3J81 Q;  2UU9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...