4JI5E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji5E02
2VQFI 4B3MI 1X48A 3WU6A 3D4JA 1FNMA 1IBKE 2UUCE 3LLHA 5LMUI 2LTSA 4HACA 1UILA 2NA2A 2X36A 1YYWA 4JV5E 2E5LE 4DV2E 1T4NA 1NHHA 1OJ4A 2ZBKB 3K1JA 1H7SA 1N34E 4LF5E 2NUEA 3V5RA 4Z7CA 3ADJA 2UXDE 4DR3E 4LFBI 1FJGE 2HFSA 1EI1A 4FWHA 1NHJA 1FWKA 4DR2I 2DIXA 1XMQI 1FWLA 1H7UA 4LF7E 1N36E 2V8PA 2VQEE 4P7AA 2EFGA 3ZKDA 1HNZI 4KHPI 2VQFE 1QZRA 1IBKI 2UUCI 4MYTA 1B62A 4DKKA 1HNXE 3JAMQ 2NUGA 3OTOI 1Z0BA 1H72C 1EA6A 2UUBI 1IBME 3J80C 4YY3E 4PRXA 2V2QA 1VISA 1Z0GA 5CFFE 3C4TA 2ZM6E 4AQYE 3VYXA 2UXCE 5L3JA 3VYYA 2RTXA 3PYDA 1ZBTA 4LF5I 4DV5I 4OOGC 1FJGI 2V2ZA 2VQEI 4FWGA 4DV3E 4DR1E 1XMOE 4M1KA 4DR2E 2E1RA 2Q2EB 2HFUA 3J7Yp 4HACB 1KTVA 1ZM4A 5IWAE 4MYUA 3ZKBA 1HNXI 4DV0E 2BM1A 4DPUA 3OTOE 1ELOA 3T1HE 1YZ9A 4P52A 4JI7I 1PVGA 4JI3E 4DPYA 3HULA 3QT5A 1I94I 4DR5I 2EZ6A 4LF9E 1ZXNA 4YY3I 4ED4A 4USKA 2V34A 1NZ0A 3QT7A 3ADIA 5GMEA 2ZM6I 4AQYI 4M2ZA 3WU3A 4KQVA 3J80Q 3ZZ0A 1N32E 4DV7E 4DV5E 4USMA 4JI5E 2LRSA 4JI1E 3PYFA 5BR8E 1D6TA 3B78A 4DUYE 2L3CA 1WUUA 4DV3I 3T1YI 1XNRI 3J81C 1XNQI 2UUAI 2CZ9A 3PYEA 4DV0I 3WU5A 1MG7A 3T1HI 1N0UA 5LMNI 4JI3I 2LTRA 4DPXA 1X49A 1YYKA 2F4VI 1N33I 1Z59A 4DV6I 2JVAA 1MU5A 1ZM2A 1Z0CA 4LF6E 2VF3A 4K0KI 4I3HA 2R3VA 1N32I 1N0VC 2MDRA 4DU8A 5A2QC 2A2CA 4DR4E 3C4BA 4OX9E 1O0WA 2L2NA 2GS8A 4JG4A 3ADGA 1HNZE 1XNQE 1KVKA 2YT4A 1RC7A 2BV3A 5GMDA 2UUAE 2BM0A 2NPFA 3J81Q 4WYQB 4JYAE 4DR6I 4JI8I 4X62E 3QT6A 1WHQA 4PU9A 2UUBE 3P1XA 4LF8I 4JI4E 4JI0I 1DARA 4R1FA 2UU9E 2UXCI 1Z0TA 1Z5CA 4YHHE 3GONA 1YYOA 2WW4A 4LFAI 1RQ0A 5FLXQ 4UTGA 4LF4I 3JAMC 2CPNA 1MX0A 4HXZA 1RREA 3CWVA 5A2QQ 3J7AG 1X47A 4DV1E 2DB2A 4DR7E 3V2UC 5IWAI 2N3HA 3LTOA 4DUZE 2LJHA 1I94E 2RSMA 4JI8E 4DV4E 4JYAI 1FKAE 1GQEA 2LBSB 2NUFA 3J7AM 1S16A 4RPFA 2HK3A 4XTJA 4NXNE 1N34I 2KHXA 4LF8E 4B3RE 4DPTA 4LF4E 4DV7I 2L3JA 4YHHI 1BKNA 4JI5I 4DR3I 2V2VA 4DPWA 1XMQE 5FLXC 4URLA 4DUYI 4KHPE 4X65I 1T4LB 1UEKA 4NXME 3ZM7A 1HR0E 1IBMI 4NXNI 2RS6A 2LUPB 2XEXA 4HY1A 3M6AA 4X64I 1ZM9A 1Z5BA 4X8WA 1EKZA 4X66I 4LFCI 1Z0VA 4FN5A 2B3TB 4FW9A 4WUCA 2B7TA 2L2MA 2UXBE 1RR9A 5IT9C 4WUBA 3ZZUA 1ZXMA 4X65E 4JI6E 3QT8A 3PYGA 4GKKI 1QU6A 5LL6R 4B3TI 2LJPA 4NXMI 1XMOI 1HR0I 2HHHI 1Z0WA 2J7KA 4B3SI 2N3GA 4HYMA 1K47A 2UU9I 4X66E 1S4EA 1KKHA 4LFCE 4JI7E 4JI1I 5BR8I 2HK2A 1HNWI 2AJ4A 2B7VA 1J26A 4JV5I 1DI2A 1B63A 4Z7YA 4WUDA 1ZM3A 5IT9Q 1U2RA 4DUZI 4JI6I 2HKJA 4DV4I 4GKJE 2ZITA 1N36I 4B3TE 4B3SE 4K0KE 2HHHE 3T1YE 2A2DA 1XNRE 1UHZA 4PRVA 4B3RI 4DXLA 1NHIA 2L2KB 5LMNE 1J5EI 3F0NA 1HNWE 1A6FA 3ZZTA 2F4VE 1N33E 4DV6E 1PKPA 2L33A 3B8HA 4LF6I 1H73A 4ZVIA 3WU4A 3B82A 4M30A 2DEJA 4JI2E 1IBLE 2X7IA 1KIJA 2DEIA 1WHNA 1PIEA 4EMDA 4GKJI 1Z0EA 4DR4I 2IHR1 4X62I 2JY9A 4OX9I 3K17A 4DR1I 2RS7A 4DU7A 2LUQA 4B3ME 3LNUA 2DMYA 4X64E 4LFAE 5LMUE 1J5EE 1FI4A 4UT4A 4DR5E 1T4OA 2HKEA 1Z5AA 4LF9I 3Q1QA 1XHKA 4DR6E 2UXBI 3LPSA 2E5LI 4DV1I 4DR7I 4JI2I 2R42A 4DV2I 1STUA 4JI0E 4JI4I 3HTXA 3H4LA 2OI2A 1IBLI 4LFBE 4WFTA 4GKKE 1H74A 4FWDA 2UXDI 3ADLA 4LF7I
chains in the Genus database with same CATH superfamily
4WXDA 2VQFI 2EN4A 2V8QB 4B3MI 1X48A 1X6EA 2PO1B 2IOPA 3WU6A 3D4JA 2YZTA 1FNMA 1PJQA 2JPAA 4MU3A 1IBKE 2UUCE 1UDNA 3PRYA 5A6KA 2I9IA 1VI7A 3LLHA 5LMUI 2LTSA 3KZYA 2EMHA 4U3DA 1YPNA 3EQ1A 4HACA 1UILA 2NA2A 2X36A 5AE3A 2O3ZA 4IZJD 1YYWA 1IMUA 4BA1B 4JV5E 3U1KA 3UHMA 4R8OA 4DV2E 1T4NA 2E5LE 1NHHA 1OJ4A 2ZBKB 3K1JA 1USUA 3K85A 4M0VA 1IQSA 1N34E 1H7SA 2GPIA 4X9JA 2JXPA 5C0XE 2YPNA 4LF5E 2EN8A 2EPMX 2NUEA 2Z5EA 1YHCA 1ZAAC 3V5RA 4Z7CA 1YUIA 2EWLA 1LLMC 3ADJA 2UXDE 4DR3E 4LFBI 1FJGE 2HFSA 1Z1BA 3IWBA 2EJ4A 1EI1A 2EQ1A 1NHJA 2LT7A 4FWHA 4MDTA 1FWKA 2M7QA 4DR2I 2DIXA 3IWDA 4F9CB 1FWLA 1H7UA 3HPZA 4LF7E 1N36E 2V8PA 2VQEE 4BS9A 2EFGA 4BHCA 1A1JA 3PS2A 4P7AA 1X5WA 2EE8A 3ZKDA 1HNZI 4KHPI 2VQFE 2YTQA 3P76A 1QZRA 1PDAA 1IBKI 2UUCI 2WP8A 4MYTA 1B62A 2DSYA 2FTXB 2M9AA 4DKKA 2E72A 4ZYDA 3EPJA 1HNXE 1Y4SA 1P47A 3CDIA 5K36F 5K36B 4R03A 1A1FA 2EMGA 3THOB 2NUGA 3JAMQ 3OTOI 4P78A 1Z0BA 3HJCA 2M1SA 4OO1E 2YSPA 1H72C 2CT1A 1EA6A 3HXLA 2C39A 1BBGA 2EL5A 2EMLA 2UUBI 2EM5A 1IBME 3J80C 4YY3E 2ENAA 5C0XC 4IFDE 2NN6F 4PRXA 2V2QA 5EKWA 1VISA 1Z0GA 5CFFE 3C4TA 2ZM6E 4TUGA 4AQYE 3VYXA 2UXCE 1BB8A 3U1YA 5L3JA 2EM2A 3HPSA 2RTXA 4R2QA 3VYYA 3PYDA 1ZBTA 4LF5I 2EM3A 3QG5C 2YTPA 2V85A 3Q6MA 2YTFA 4DV5I 4TUIA 4MU4A 4OOGC 1A1LA 1FJGI 2L6MA 2V2ZA 5T6JA 4F54A 2DLQA 3M85D 2VQEI 4FWGA 4DV3E 2EPKX 4DR1E 1XMOE 2WBUA 4DR2E 2E1RA 3PS1A 2Q2EB 2HFUA 3J7Yp 4M9VC 4M1KA 2EOQA 4HACB 2EOFA 1KTVA 1ZM4A 3M99B 4HEIA 5IWAE 2Z5CB 4MYUA 3ZKBA 1HNXI 4DV0E 1T39A 2BM1A 2NN6D 2EOHA 4N3OA 4DPUA 2DMIA 3OTOE 1ELOA 2PNMA 3T1HE 3AV0A 1YZ9A 4P52A 2YTIA 4JI7I 1PVGA 2F8BA 4OO1C 4JI3E 2EORA 2J65A 3HULA 4DPYA 3QT5A 3EPKA 4WXCA 1Y60A 4DR5I 1I94I 2VESA 2EZ6A 2PO1A 4LF9E 2JOBA 2YWQA 2GQ0A 2JYAA 1ZXNA 2R76A 4YY3I 4BMJA 2C37A 4ED4A 2V88A 4USKA 3NZKA 4R2CA 2V34A 2EPPA 4IFDF 1NZ0A 5DRQA 3QT7A 2KOUA 3ADIA 5GMEA 2ZM6I 2GHFA 3MHHC 3KWRA 2EPUA 4M2ZA 4AQYI 3WU3A 2YU5A 4L8NA 4KQVA 3J80Q 4LCGA 3ZZ0A 4O4KA 1N32E 4DV7E 1PJTA 5KL4A 5KL6A 4DV5E 4USMA 4JI5E 2LRSA 4JI1E 3PYFA 5BR8E 1YUJA 4AIMA 3ECRA 5AC5A 5K36E 1D6TA 2ELZA 3P3CA 4BHBA 2MDGA 1NCSA 3B78A 4DUYE 2L3CA 5DROA 1WUUA 4DV3I 4OO1B 3T1YI 2L92A 1A1HA 1XNRI 3J81C 5C0XB 2EOYA 1SFEA 1XNQI 2UUAI 2CZ9A 3PYEA 4DV0I 1OYSA 3KZZA 3WU5A 1A1IA 1MG7A 3T1HI 1N0UA 1P42A 5LMNI 4MLVA 4JI3I 2LTRA 2PNZB 4R2SA 4IZJA 4DPXA 1X49A 1YYKA 2F4VI 1N33I 1Z59A 4DV6I 2JVAA 1MU5A 4Q28A 1ZM2A 3H1CA 1Z0CA 1ZU1A 4LF6E 2VF3A 1EH8A 4ZYGA 2ODRD 2NN6B 4AIDA 1L4SA 4K0KI 2WNRB 3RMPA 1SR9A 4I3HA 2IOQA 2Q8UA 2R3VA 1N32I 4O24A 1N0VC 2MDRA 3JTZA 1Y6ZA 5AE1A 4DU8A 5A2QC 3M7NG 5AASA 4LCFA 4MQYA 1Y5YA 4DR4E 2YTJA 3C4BA 2A2CA 1WXRA 2C39B 4OX9E 1O0WA 2L2NA 2BA1G 2GS8A 4JG4A 2PNZA 1EH6A 4P7DA 3ADGA 1HNZE 2GLIA 5JEAB 1XNQE 3L7ZA 2LV2A 1KVKA 2O1WA 2ELYA 2YT4A 2VF1A 1RC7A 4LU9A 1JK1A 2BV3A 2GO3A 2R1FA 5GMDA 2UUAE 2HC5A 5AC4A 2BA0G 1AH5A 2BM0A 4BA2A 2NPFA 4WX9A 4AM3A 2C37B 2BA1D 3J81Q 2NN6C 4WYQB 2EN7A 4JYAE 1OYPA 4IS9A 2JEAA 2JEAB 4OO1D 2MC6A 2EMWA 4JI8I 4DR6I 4I8OA 4X62E 1WHQA 3QT6A 4PU9A 2KONA 2EPLX 2UUBE 2JE6A 4BA2B 2DLKA 1YFHA 3P1XA 4LF8I 4JI4E 4JI0I 1DARA 2EQ3A 2EM4A 2FGGA 2ODRC 3BIDA 4R1FA 5DRPA 2MKNA 2PRTA 2BB8A 2UU9E 2UXCI 3DF6A 5JEAA 1Z0TA 1Z5CA 4YHHE 5F3WA 1YYOA 2WW4A 3GONA 4LFAI 1RQ0A 5FLXQ 4UTGA 4NBQA 4LF4I 4NHRA 2NABA 3JAMC 3Q6NA 4FW4A 2CPNA 4MU1A 2EM8A 2WCC3 4FW7A 4IFDB 3MHSC 1MX0A 1RHYA 4HXZA 2B9DA 2EN2A 1X3CA 2JR1A 5A6JA 2EMKA 1RREA 3CWVA 3J7AG 1TN9A 1X47A 2GO4A 4DV1E 2DB2A 4DR7E 5A2QQ 3P3GA 5JEAF 3V2UC 3H09A 4MU0A 5IWAI 2YTNA 2NN6E 2WBTA 1R6MA 2BBGA 2WNRA 2N3HA 2EM7A 4DUZE 3LMLA 3LTOA 1GTKA 2LJHA 1ZBQA 1I94E 2EN3A 2RSMA 4JI8E 4R2DA 4DV4E 3BGHA 4JYAI 5A6BA 5DNLA 5K36D 1FKAE 1GQEA 3VK6A 2LBSB 4N4RB 2NUFA 4QNKA 3J7AM 4ZYEA 1S16A 4RPFA 2HK3A 1XMQI 4XTJA 4NXNE 2JP9A 1N34I 4BCAA 2YSOA 1BBOA 5C0XA 2KHXA 4LF8E 4B3RE 4DPTA 1NEIA 2ENCA 4LF4E 3GMEA 1GZ6A 4DV7I 1USVA 2L3JA 4IFDD 3C6MA 5TSEA 2RSIA 1BKNA 2BR2A 4YHHI 1DQ3A 1E3HA 3F6GA 4DR3I 4JI5I 2J7JA 3P3EA 2V2VA 2Z5BB 3BF2A 3B4TA 2EOJA 4DPWA 4OO1F 4BC7A 1XMQE 5FLXC 4URLA 4J3DA 4DUYI 1MEYC 2PO2A 4KHPE 2EM6A 5C0XF 2EPXA 2LO3A 1PJSA 1HK7A 2EPAA 4X65I 1T4LB 4L5NC 2YTGA 2L8TA 2O1UA 1JK2A 4LOMA 5IXMB 2WBSA 2G7HA 4FW5A 1F2IG 4IS1C 5JEAC 1UEKA 2K7IA 1X6HA 4NXME 3ZM7A 1HR0E 1IBMI 4NXNI 2MC5A 1XXEA 4O43A 2RS6A 2LUPB 2XEXA 4HY1A 5C0XD 4F2JC 2YRKA 2CVEA 4LTYA 3K6QA 3M6AA 2EOSA 4KWYA 4X64I 1ZM9A 1Z5BA 4X8WA 4GQUA 3M7ND 3C6KA 1EKZA 2PO0B 4X66I 5A69A 4LFCI 1Z0VA 4ZYHA 3CDJA 2EPOA 2DRPA 4FN5A 2B3TB 2WZOA 4FW9A 4LPFA 4WUCA 2B7TA 4BA1A 2A25A 2EL6A 2L2MA 2UXBE 4RHBB 4IZKA 2JWOA 1RR9A 5LLQA 2EN6A 5IT9C 4OKGA 5DRRA 4WUBA 2V89A 5FWKA 3ZZUA 1ZXMA 1RMDA 2LCEA 2EQ0A 1R6LA 1MGTA 1OYRA 2VRDA 1AAYA 3FIGA 2EP3A 4X65E 2O1TA 4F6NA 4JI6E 1ZR9A 3QT8A 5KL5A 3PYGA 2D9HA 2EMYA 4GEQB 1UN6B 4U3BA 4GKKI 4BC9A 3THNA 2EOIA 2E1MA 2N8XA 1QU6A 2C38A 3GLLA 5LL6R 4B3TI 2LJPA 2LVHA 2ADRA 3DD6A 1XMOI 1HR0I 2HHHI 4NXMI 4FW6A 3AUZA 2V87A 4WSGA 1Z0WA 2PNLA 2J7KA 1Y4UA 4B3SI 3L00A 5ADZA 2N3GA 4WPYA 4HYMA 1K47A 3OMLA 2UU9I 4R2RA 4X66E 1S4EA 1KKHA 1N3GA 2EM0A 4LFCE 4JI7E 4OZEA 4JI1I 4BBYA 5BR8I 2ENHA 5KL2A 4FK5C 4WSPA 2HK2A 1HNWI 2AJ4A 2V86A 1TF6A 2EMIA 4MLQA 2B7VA 1J26A 2IESA 2EPZA 2YTOA 4JV5I 1DI2A 3ZOQB 2JT2A 4HTGA 1G2FC 5KL7A 1B63A 2NN6A 4Z7YA 5A6AA 4WUDA 2Z5BA 2HJJA 1ZM3A 5JEAD 1U2RA 5IT9Q 1A1GA 4DUZI 3HQ1A 3HKMA 2HKJA 4JI6I 2AE8A 2CSHA 2EOXA 2YTDA 1QNTA 2M4IA 4F9AB 1X6FA 1YSAC 4DV4I 4FW3A 4QNJA 4GKJE 5DNXA 1KYQA 2JE6B 5A6BD 2ZITA 5K36A 2EPNA 1N36I 3PS3A 4B3TE 4B3SE 3L7ZB 4K0KE 1WRJA 2EMCA 2MKDA 2HHHE 3T1YE 4ISAA 2A2DA 1XNRE 1E3PA 1EH7A 2O1VA 1UHZA 3EPLA 4PRVA 4B3RI 2K4VA 4Q35B 4DXLA 1KJKA 2EL4A 5AE2A 2RPCA 3DJWA 3P06A 2CTDA 2JEBA 1NHIA 2L2KB 1A1KA 5LMNE 5EL9A 1J5EI 4IFDC 3F0NA 1HNWE 1A6FA 3ZZTA 2F4VE 1N33E 2EPCA 4DV6E 1IQOA 4OO1A 1PKPA 2L33A 3B8HA 2EN1A 5DNYA 1H73A 4LF6I 4ZVIA 2JEBB 3WU4A 3B82A 4NZVA 4M30A 2DEJA 4IFDA 2LMZA 4JI2E 1IBLE 5ELWA 2X7IA 4R2PA 4GZNC 3MSWA 1WJPA 3UK3C 1KIJA 1WHNA 1PIEA 2BR2B 2DEIA 4EMDA 2EOMA 1B69A 1T38A 2HGHA 4GKJI 2LE2A 1Z0EA 4DR4I 4F6MA 2IHR1 2WP8B 4X62I 1YH8A 2JY9A 4OX9I 2V83A 3K17A 3M85G 4DR1I 2RS7A 2EMFA 1UBDC 3GCMA 4RH8A 3JU0A 2EOOA 4DU7A 3VHTB 4IZJB 4R2EA 2YU8A 5JEAE 2LUQA 4KZSA 4LCHA 2H36X 2EMZA 4IJDA 4B3ME 2DMYA 4X64E 2CG9A 3LNUA 1G2DC 4DMIA 4LFAE 2EOZA 2LJUA 4O5GA 5LMUE 1J5EE 1FI4A 2C38B 2IERA 4DR5E 1T4OA 2BA0D 2PO2B 4UT4A 2I13A 2HKEA 3TQMA 2YRMA 1Z5AA 2VE7C 4LF9I 1TF3A 1UDQA 3BBGA 3Q1QA 1UDOA 1XHKA 4DR6E 2EMBA 2UXBI 3LPSA 2E5LI 4DV1I 2YTEA 2JOXA 2RQLA 4DR7I 3F6HA 4JI2I 2EMAA 2PO0A 3KRNA 2R42A 4DV2I 5KL3A 1STUA 4JI0E 2F1DA 2EPRA 3HTXA 4JI4I 5K36C 3H4LA 2OI2A 1IBLI 2EMXA 3IWCA 4R2AA 4IZKB 4LFBE 3EPHA 4WFTA 4GKKE 1DGCA 1H74A 2CGEA 4FWDA 1UDSA 2UXDI 4F9BB 2DGCA 4J8ZA 2EOEA 3ADLA 4LF7I 2FV4B 5IV8B 2EM9A 2Z5CA 2YRHA
chains in the Genus database with same CATH topology
2VQFI 2V8QB 4B3MI 1X48A 2IOPA 3WU6A 3D4JA 2YZTA 1FNMA 1IBKE 2UUCE 3PRYA 3LLHA 5LMUI 2LTSA 4HACA 2NA2A 1UILA 2X36A 5AE3A 4IZJD 1YYWA 4JV5E 4R8OA 4DV2E 1T4NA 2E5LE 1NHHA 1OJ4A 2ZBKB 3K1JA 1USUA 3K85A 4M0VA 1H7SA 1N34E 4LF5E 2Z5EA 2NUEA 3V5RA 4Z7CA 2EWLA 3ADJA 2UXDE 4DR3E 4LFBI 1FJGE 2HFSA 3IWBA 1EI1A 4FWHA 1NHJA 1FWKA 2M7QA 4DR2I 2DIXA 3IWDA 4F9CB 1FWLA 1H7UA 3HPZA 4LF7E 1N36E 2V8PA 2VQEE 4BS9A 2EFGA 4P7AA 3ZKDA 1HNZI 4KHPI 2VQFE 1QZRA 1IBKI 2UUCI 4MYTA 1B62A 2DSYA 2FTXB 4DKKA 1HNXE 1Y4SA 4R03A 3JAMQ 2NUGA 3OTOI 4P78A 1Z0BA 3HJCA 2M1SA 1H72C 1EA6A 3HXLA 2UUBI 1IBME 3J80C 4YY3E 4PRXA 2V2QA 1VISA 1Z0GA 5CFFE 3C4TA 2ZM6E 4TUGA 4AQYE 3VYXA 2UXCE 5L3JA 3HPSA 3VYYA 2RTXA 3PYDA 1ZBTA 4LF5I 2V85A 3Q6MA 4DV5I 4TUIA 4OOGC 1FJGI 2L6MA 2V2ZA 5T6JA 4F54A 2VQEI 4FWGA 4DV3E 4DR1E 1XMOE 4DR2E 2E1RA 4M1KA 2Q2EB 2HFUA 3J7Yp 4HACB 1KTVA 1ZM4A 5IWAE 2Z5CB 4MYUA 3ZKBA 1HNXI 4DV0E 2BM1A 4N3OA 4DPUA 3OTOE 1ELOA 2PNMA 3T1HE 3AV0A 1YZ9A 4P52A 4JI7I 1PVGA 2F8BA 4JI3E 4DPYA 3HULA 3QT5A 1I94I 4DR5I 2EZ6A 4LF9E 2JOBA 2GQ0A 1ZXNA 4YY3I 4BMJA 4ED4A 2V88A 4USKA 2V34A 1NZ0A 3QT7A 2KOUA 3ADIA 5GMEA 2ZM6I 4AQYI 3KWRA 4M2ZA 3WU3A 4L8NA 4KQVA 3J80Q 3ZZ0A 1N32E 4DV7E 4DV5E 4USMA 4JI5E 2LRSA 4JI1E 3PYFA 5BR8E 1D6TA 3B78A 4DUYE 2L3CA 1WUUA 4DV3I 3T1YI 2L92A 1XNRI 3J81C 1XNQI 2UUAI 2CZ9A 3PYEA 4DV0I 3WU5A 1MG7A 3T1HI 1N0UA 5LMNI 4JI3I 2LTRA 4IZJA 4DPXA 1X49A 1YYKA 2F4VI 1N33I 1Z59A 4DV6I 2JVAA 1MU5A 4Q28A 1ZM2A 1Z0CA 4LF6E 2VF3A 2ODRD 4K0KI 3RMPA 1SR9A 4I3HA 2IOQA 2R3VA 1N32I 1N0VC 2MDRA 3JTZA 1Y6ZA 5AE1A 4DU8A 5A2QC 5AASA 2A2CA 4DR4E 3C4BA 1WXRA 4OX9E 1O0WA 2L2NA 2GS8A 4JG4A 4P7DA 3ADGA 1HNZE 1XNQE 1KVKA 2O1WA 2YT4A 2VF1A 1RC7A 4LU9A 2BV3A 5GMDA 2UUAE 2BM0A 2NPFA 3J81Q 4WYQB 4JYAE 2MC6A 4DR6I 4JI8I 4I8OA 4X62E 1WHQA 3QT6A 4PU9A 2KONA 2UUBE 3P1XA 4LF8I 4JI4E 4JI0I 1DARA 2FGGA 2ODRC 4R1FA 2UU9E 2UXCI 3DF6A 1Z0TA 1Z5CA 4YHHE 5F3WA 1YYOA 2WW4A 3GONA 4LFAI 1RQ0A 5FLXQ 4UTGA 4LF4I 3JAMC 3Q6NA 2CPNA 1MX0A 4HXZA 2B9DA 2JR1A 1RREA 3CWVA 3J7AG 5A2QQ 1X47A 4DV1E 2DB2A 4DR7E 3V2UC 3H09A 5IWAI 2N3HA 4DUZE 3LTOA 3LMLA 2LJHA 1ZBQA 1I94E 2RSMA 4JI8E 4DV4E 4JYAI 1FKAE 1GQEA 3VK6A 2LBSB 2NUFA 3J7AM 1S16A 4RPFA 2HK3A 1XMQI 4XTJA 4NXNE 1N34I 4BCAA 2KHXA 4LF8E 4B3RE 4DPTA 4LF4E 1GZ6A 4DV7I 1USVA 2L3JA 4YHHI 1BKNA 1DQ3A 4JI5I 3F6GA 4DR3I 2V2VA 2Z5BB 4DPWA 4BC7A 1XMQE 5FLXC 4URLA 4DUYI 4KHPE 1HK7A 4X65I 1T4LB 4L5NC 2L8TA 2O1UA 2G7HA 1UEKA 4NXME 3ZM7A 1HR0E 1IBMI 4NXNI 2MC5A 2RS6A 2LUPB 2XEXA 4HY1A 4LTYA 3K6QA 3M6AA 4X64I 1ZM9A 1Z5BA 4X8WA 1EKZA 4X66I 4LFCI 1Z0VA 4FN5A 2B3TB 2WZOA 4FW9A 4WUCA 2B7TA 2L2MA 2UXBE 4IZKA 2JWOA 1RR9A 5IT9C 5FWKA 4WUBA 2V89A 3ZZUA 1ZXMA 3FIGA 4X65E 2O1TA 4JI6E 3QT8A 3PYGA 4GEQB 4GKKI 4BC9A 2E1MA 1QU6A 5LL6R 4B3TI 2LJPA 4NXMI 1XMOI 1HR0I 2HHHI 3AUZA 2V87A 1Z0WA 2PNLA 2J7KA 1Y4UA 4B3SI 5ADZA 2N3GA 4WPYA 4HYMA 1K47A 3OMLA 2UU9I 4X66E 1S4EA 1KKHA 4LFCE 4JI7E 4JI1I 4BBYA 5BR8I 4WSPA 2HK2A 1HNWI 2AJ4A 2V86A 2B7VA 1J26A 4JV5I 1DI2A 3ZOQB 1B63A 4Z7YA 4WUDA 2Z5BA 1ZM3A 5IT9Q 1U2RA 4DUZI 3HQ1A 4JI6I 2HKJA 2M4IA 4F9AB 4DV4I 4GKJE 2ZITA 1N36I 4B3TE 4B3SE 4K0KE 2HHHE 3T1YE 2A2DA 1XNRE 2O1VA 1UHZA 4PRVA 4B3RI 2K4VA 4DXLA 5AE2A 3DJWA 3P06A 1NHIA 2L2KB 5LMNE 1J5EI 3F0NA 1HNWE 1A6FA 3ZZTA 2F4VE 1N33E 4DV6E 1PKPA 2L33A 3B8HA 5DNYA 1H73A 4LF6I 4ZVIA 3WU4A 3B82A 4M30A 2DEJA 2LMZA 4JI2E 1IBLE 2X7IA 1KIJA 3MSWA 2DEIA 1WHNA 1PIEA 4EMDA 4GKJI 2LE2A 1Z0EA 4DR4I 2IHR1 4X62I 2JY9A 4OX9I 2V83A 3K17A 4DR1I 2RS7A 3JU0A 4DU7A 4IZJB 2LUQA 4KZSA 2H36X 4B3ME 3LNUA 2DMYA 4X64E 2CG9A 4DMIA 4LFAE 5LMUE 1J5EE 1FI4A 4UT4A 4DR5E 1T4OA 2HKEA 1Z5AA 2VE7C 4LF9I 3Q1QA 1XHKA 4DR6E 2UXBI 3LPSA 2E5LI 4DV1I 4DR7I 2JOXA 3F6HA 4JI2I 2R42A 4DV2I 1STUA 4JI0E 4JI4I 3HTXA 3H4LA 2OI2A 1IBLI 3IWCA 4IZKB 4LFBE 4WFTA 4GKKE 1H74A 2CGEA 4FWDA 2UXDI 4F9BB 4J8ZA 3ADLA 4LF7I 2FV4B 2Z5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF I;  4B3M I;  1X48 A;  3WU6 A;  3D4J A;  1FNM A;  1IBK E;  2UUC E;  3LLH A;  5LMU I;  2LTS A;  4HAC A;  1UIL A;  2NA2 A;  2X36 A;  1YYW A;  4JV5 E;  2E5L E;  4DV2 E;  1T4N A;  1NHH A;  1OJ4 A;  2ZBK B;  3K1J A;  1H7S A;  1N34 E;  4LF5 E;  2NUE A;  3V5R A;  4Z7C A;  3ADJ A;  2UXD E;  4DR3 E;  4LFB I;  1FJG E;  2HFS A;  1EI1 A;  4FWH A;  1NHJ A;  1FWK A;  4DR2 I;  2DIX A;  1XMQ I;  1FWL A;  1H7U A;  4LF7 E;  1N36 E;  2V8P A;  2VQE E;  4P7A A;  2EFG A;  3ZKD A;  1HNZ I;  4KHP I;  2VQF E;  1QZR A;  1IBK I;  2UUC I;  4MYT A;  1B62 A;  4DKK A;  1HNX E;  3JAM Q;  2NUG A;  3OTO I;  1Z0B A;  1H72 C;  1EA6 A;  2UUB I;  1IBM E;  3J80 C;  4YY3 E;  4PRX A;  2V2Q A;  1VIS A;  1Z0G A;  5CFF E;  3C4T A;  2ZM6 E;  4AQY E;  3VYX A;  2UXC E;  5L3J A;  3VYY A;  2RTX A;  3PYD A;  1ZBT A;  4LF5 I;  4DV5 I;  4OOG C;  1FJG I;  2V2Z A;  2VQE I;  4FWG A;  4DV3 E;  4DR1 E;  1XMO E;  4M1K A;  4DR2 E;  2E1R A;  2Q2E B;  2HFU A;  3J7Y p;  4HAC B;  1KTV A;  1ZM4 A;  5IWA E;  4MYU A;  3ZKB A;  1HNX I;  4DV0 E;  2BM1 A;  4DPU A;  3OTO E;  1ELO A;  3T1H E;  1YZ9 A;  4P52 A;  4JI7 I;  1PVG A;  4JI3 E;  4DPY A;  3HUL A;  3QT5 A;  1I94 I;  4DR5 I;  2EZ6 A;  4LF9 E;  1ZXN A;  4YY3 I;  4ED4 A;  4USK A;  2V34 A;  1NZ0 A;  3QT7 A;  3ADI A;  5GME A;  2ZM6 I;  4AQY I;  4M2Z A;  3WU3 A;  4KQV A;  3J80 Q;  3ZZ0 A;  1N32 E;  4DV7 E;  4DV5 E;  4USM A;  4JI5 E;  2LRS A;  4JI1 E;  3PYF A;  5BR8 E;  1D6T A;  3B78 A;  4DUY E;  2L3C A;  1WUU A;  4DV3 I;  3T1Y I;  1XNR I;  3J81 C;  1XNQ I;  2UUA I;  2CZ9 A;  3PYE A;  4DV0 I;  3WU5 A;  1MG7 A;  3T1H I;  1N0U A;  5LMN I;  4JI3 I;  2LTR A;  4DPX A;  1X49 A;  1YYK A;  2F4V I;  1N33 I;  1Z59 A;  4DV6 I;  2JVA A;  1MU5 A;  1ZM2 A;  1Z0C A;  4LF6 E;  2VF3 A;  4K0K I;  4I3H A;  2R3V A;  1N32 I;  1N0V C;  2MDR A;  4DU8 A;  5A2Q C;  2A2C A;  4DR4 E;  3C4B A;  4OX9 E;  1O0W A;  2L2N A;  2GS8 A;  4JG4 A;  3ADG A;  1HNZ E;  1XNQ E;  1KVK A;  2YT4 A;  1RC7 A;  2BV3 A;  5GMD A;  2UUA E;  2BM0 A;  2NPF A;  3J81 Q;  4WYQ B;  4JYA E;  4DR6 I;  4JI8 I;  4X62 E;  3QT6 A;  1WHQ A;  4PU9 A;  2UUB E;  3P1X A;  4LF8 I;  4JI4 E;  4JI0 I;  1DAR A;  4R1F A;  2UU9 E;  2UXC I;  1Z0T A;  1Z5C A;  4YHH E;  3GON A;  1YYO A;  2WW4 A;  4LFA I;  1RQ0 A;  5FLX Q;  4UTG A;  4LF4 I;  3JAM C;  2CPN A;  1MX0 A;  4HXZ A;  1RRE A;  3CWV A;  5A2Q Q;  3J7A G;  1X47 A;  4DV1 E;  2DB2 A;  4DR7 E;  3V2U C;  5IWA I;  2N3H A;  3LTO A;  4DUZ E;  2LJH A;  1I94 E;  2RSM A;  4JI8 E;  4DV4 E;  4JYA I;  1FKA E;  1GQE A;  2LBS B;  2NUF A;  3J7A M;  1S16 A;  4RPF A;  2HK3 A;  4XTJ A;  4NXN E;  1N34 I;  2KHX A;  4LF8 E;  4B3R E;  4DPT A;  4LF4 E;  4DV7 I;  2L3J A;  4YHH I;  1BKN A;  4JI5 I;  4DR3 I;  2V2V A;  4DPW A;  1XMQ E;  5FLX C;  4URL A;  4DUY I;  4KHP E;  4X65 I;  1T4L B;  1UEK A;  4NXM E;  3ZM7 A;  1HR0 E;  1IBM I;  4NXN I;  2RS6 A;  2LUP B;  2XEX A;  4HY1 A;  3M6A A;  4X64 I;  1ZM9 A;  1Z5B A;  4X8W A;  1EKZ A;  4X66 I;  4LFC I;  1Z0V A;  4FN5 A;  2B3T B;  4FW9 A;  4WUC A;  2B7T A;  2L2M A;  2UXB E;  1RR9 A;  5IT9 C;  4WUB A;  3ZZU A;  1ZXM A;  4X65 E;  4JI6 E;  3QT8 A;  3PYG A;  4GKK I;  1QU6 A;  5LL6 R;  4B3T I;  2LJP A;  4NXM I;  1XMO I;  1HR0 I;  2HHH I;  1Z0W A;  2J7K A;  4B3S I;  2N3G A;  4HYM A;  1K47 A;  2UU9 I;  4X66 E;  1S4E A;  1KKH A;  4LFC E;  4JI7 E;  4JI1 I;  5BR8 I;  2HK2 A;  1HNW I;  2AJ4 A;  2B7V A;  1J26 A;  4JV5 I;  1DI2 A;  1B63 A;  4Z7Y A;  4WUD A;  1ZM3 A;  5IT9 Q;  1U2R A;  4DUZ I;  4JI6 I;  2HKJ A;  4DV4 I;  4GKJ E;  2ZIT A;  1N36 I;  4B3T E;  4B3S E;  4K0K E;  2HHH E;  3T1Y E;  2A2D A;  1XNR E;  1UHZ A;  4PRV A;  4B3R I;  4DXL A;  1NHI A;  2L2K B;  5LMN E;  1J5E I;  3F0N A;  1HNW E;  1A6F A;  3ZZT A;  2F4V E;  1N33 E;  4DV6 E;  1PKP A;  2L33 A;  3B8H A;  4LF6 I;  1H73 A;  4ZVI A;  3WU4 A;  3B82 A;  4M30 A;  2DEJ A;  4JI2 E;  1IBL E;  2X7I A;  1KIJ A;  2DEI A;  1WHN A;  1PIE A;  4EMD A;  4GKJ I;  1Z0E A;  4DR4 I;  2IHR 1;  4X62 I;  2JY9 A;  4OX9 I;  3K17 A;  4DR1 I;  2RS7 A;  4DU7 A;  2LUQ A;  4B3M E;  3LNU A;  2DMY A;  4X64 E;  4LFA E;  5LMU E;  1J5E E;  1FI4 A;  4UT4 A;  4DR5 E;  1T4O A;  2HKE A;  1Z5A A;  4LF9 I;  3Q1Q A;  1XHK A;  4DR6 E;  2UXB I;  3LPS A;  2E5L I;  4DV1 I;  4DR7 I;  4JI2 I;  2R42 A;  4DV2 I;  1STU A;  4JI0 E;  4JI4 I;  3HTX A;  3H4L A;  2OI2 A;  1IBL I;  4LFB E;  4WFT A;  4GKK E;  1H74 A;  4FWD A;  2UXD I;  3ADL A;  4LF7 I; 
#chains in the Genus database with same CATH topology
 4WXD A;  2VQF I;  2EN4 A;  2V8Q B;  4B3M I;  1X48 A;  1X6E A;  2PO1 B;  2IOP A;  3WU6 A;  3D4J A;  2YZT A;  1FNM A;  1PJQ A;  2JPA A;  4MU3 A;  1IBK E;  2UUC E;  1UDN A;  3PRY A;  5A6K A;  2I9I A;  1VI7 A;  3LLH A;  5LMU I;  2LTS A;  3KZY A;  2EMH A;  4U3D A;  1YPN A;  3EQ1 A;  4HAC A;  1UIL A;  2NA2 A;  2X36 A;  5AE3 A;  2O3Z A;  4IZJ D;  1YYW A;  1IMU A;  4BA1 B;  4JV5 E;  3U1K A;  3UHM A;  4R8O A;  4DV2 E;  1T4N A;  2E5L E;  1NHH A;  1OJ4 A;  2ZBK B;  3K1J A;  1USU A;  3K85 A;  4M0V A;  1IQS A;  1N34 E;  1H7S A;  2GPI A;  4X9J A;  2JXP A;  5C0X E;  2YPN A;  4LF5 E;  2EN8 A;  2EPM X;  2NUE A;  2Z5E A;  1YHC A;  1ZAA C;  3V5R A;  4Z7C A;  1YUI A;  2EWL A;  1LLM C;  3ADJ A;  2UXD E;  4DR3 E;  4LFB I;  1FJG E;  2HFS A;  1Z1B A;  3IWB A;  2EJ4 A;  1EI1 A;  2EQ1 A;  1NHJ A;  2LT7 A;  4FWH A;  4MDT A;  1FWK A;  2M7Q A;  4DR2 I;  2DIX A;  3IWD A;  4F9C B;  1FWL A;  1H7U A;  3HPZ A;  4LF7 E;  1N36 E;  2V8P A;  2VQE E;  4BS9 A;  2EFG A;  4BHC A;  1A1J A;  3PS2 A;  4P7A A;  1X5W A;  2EE8 A;  3ZKD A;  1HNZ I;  4KHP I;  2VQF E;  2YTQ A;  3P76 A;  1QZR A;  1PDA A;  1IBK I;  2UUC I;  2WP8 A;  4MYT A;  1B62 A;  2DSY A;  2FTX B;  2M9A A;  4DKK A;  2E72 A;  4ZYD A;  3EPJ A;  1HNX E;  1Y4S A;  1P47 A;  3CDI A;  5K36 F;  5K36 B;  4R03 A;  1A1F A;  2EMG A;  3THO B;  2NUG A;  3JAM Q;  3OTO I;  4P78 A;  1Z0B A;  3HJC A;  2M1S A;  4OO1 E;  2YSP A;  1H72 C;  2CT1 A;  1EA6 A;  3HXL A;  2C39 A;  1BBG A;  2EL5 A;  2EML A;  2UUB I;  2EM5 A;  1IBM E;  3J80 C;  4YY3 E;  2ENA A;  5C0X C;  4IFD E;  2NN6 F;  4PRX A;  2V2Q A;  5EKW A;  1VIS A;  1Z0G A;  5CFF E;  3C4T A;  2ZM6 E;  4TUG A;  4AQY E;  3VYX A;  2UXC E;  1BB8 A;  3U1Y A;  5L3J A;  2EM2 A;  3HPS A;  2RTX A;  4R2Q A;  3VYY A;  3PYD A;  1ZBT A;  4LF5 I;  2EM3 A;  3QG5 C;  2YTP A;  2V85 A;  3Q6M A;  2YTF A;  4DV5 I;  4TUI A;  4MU4 A;  4OOG C;  1A1L A;  1FJG I;  2L6M A;  2V2Z A;  5T6J A;  4F54 A;  2DLQ A;  3M85 D;  2VQE I;  4FWG A;  4DV3 E;  2EPK X;  4DR1 E;  1XMO E;  2WBU A;  4DR2 E;  2E1R A;  3PS1 A;  2Q2E B;  2HFU A;  3J7Y p;  4M9V C;  4M1K A;  2EOQ A;  4HAC B;  2EOF A;  1KTV A;  1ZM4 A;  3M99 B;  4HEI A;  5IWA E;  2Z5C B;  4MYU A;  3ZKB A;  1HNX I;  4DV0 E;  1T39 A;  2BM1 A;  2NN6 D;  2EOH A;  4N3O A;  4DPU A;  2DMI A;  3OTO E;  1ELO A;  2PNM A;  3T1H E;  3AV0 A;  1YZ9 A;  4P52 A;  2YTI A;  4JI7 I;  1PVG A;  2F8B A;  4OO1 C;  4JI3 E;  2EOR A;  2J65 A;  3HUL A;  4DPY A;  3QT5 A;  3EPK A;  4WXC A;  1Y60 A;  4DR5 I;  1I94 I;  2VES A;  2EZ6 A;  2PO1 A;  4LF9 E;  2JOB A;  2YWQ A;  2GQ0 A;  2JYA A;  1ZXN A;  2R76 A;  4YY3 I;  4BMJ A;  2C37 A;  4ED4 A;  2V88 A;  4USK A;  3NZK A;  4R2C A;  2V34 A;  2EPP A;  4IFD F;  1NZ0 A;  5DRQ A;  3QT7 A;  2KOU A;  3ADI A;  5GME A;  2ZM6 I;  2GHF A;  3MHH C;  3KWR A;  2EPU A;  4M2Z A;  4AQY I;  3WU3 A;  2YU5 A;  4L8N A;  4KQV A;  3J80 Q;  4LCG A;  3ZZ0 A;  4O4K A;  1N32 E;  4DV7 E;  1PJT A;  5KL4 A;  5KL6 A;  4DV5 E;  4USM A;  4JI5 E;  2LRS A;  4JI1 E;  3PYF A;  5BR8 E;  1YUJ A;  4AIM A;  3ECR A;  5AC5 A;  5K36 E;  1D6T A;  2ELZ A;  3P3C A;  4BHB A;  2MDG A;  1NCS A;  3B78 A;  4DUY E;  2L3C A;  5DRO A;  1WUU A;  4DV3 I;  4OO1 B;  3T1Y I;  2L92 A;  1A1H A;  1XNR I;  3J81 C;  5C0X B;  2EOY A;  1SFE A;  1XNQ I;  2UUA I;  2CZ9 A;  3PYE A;  4DV0 I;  1OYS A;  3KZZ A;  3WU5 A;  1A1I A;  1MG7 A;  3T1H I;  1N0U A;  1P42 A;  5LMN I;  4MLV A;  4JI3 I;  2LTR A;  2PNZ B;  4R2S A;  4IZJ A;  4DPX A;  1X49 A;  1YYK A;  2F4V I;  1N33 I;  1Z59 A;  4DV6 I;  2JVA A;  1MU5 A;  4Q28 A;  1ZM2 A;  3H1C A;  1Z0C A;  1ZU1 A;  4LF6 E;  2VF3 A;  1EH8 A;  4ZYG A;  2ODR D;  2NN6 B;  4AID A;  1L4S A;  4K0K I;  2WNR B;  3RMP A;  1SR9 A;  4I3H A;  2IOQ A;  2Q8U A;  2R3V A;  1N32 I;  4O24 A;  1N0V C;  2MDR A;  3JTZ A;  1Y6Z A;  5AE1 A;  4DU8 A;  5A2Q C;  3M7N G;  5AAS A;  4LCF A;  4MQY A;  1Y5Y A;  4DR4 E;  2YTJ A;  3C4B A;  2A2C A;  1WXR A;  2C39 B;  4OX9 E;  1O0W A;  2L2N A;  2BA1 G;  2GS8 A;  4JG4 A;  2PNZ A;  1EH6 A;  4P7D A;  3ADG A;  1HNZ E;  2GLI A;  5JEA B;  1XNQ E;  3L7Z A;  2LV2 A;  1KVK A;  2O1W A;  2ELY A;  2YT4 A;  2VF1 A;  1RC7 A;  4LU9 A;  1JK1 A;  2BV3 A;  2GO3 A;  2R1F A;  5GMD A;  2UUA E;  2HC5 A;  5AC4 A;  2BA0 G;  1AH5 A;  2BM0 A;  4BA2 A;  2NPF A;  4WX9 A;  4AM3 A;  2C37 B;  2BA1 D;  3J81 Q;  2NN6 C;  4WYQ B;  2EN7 A;  4JYA E;  1OYP A;  4IS9 A;  2JEA A;  2JEA B;  4OO1 D;  2MC6 A;  2EMW A;  4JI8 I;  4DR6 I;  4I8O A;  4X62 E;  1WHQ A;  3QT6 A;  4PU9 A;  2KON A;  2EPL X;  2UUB E;  2JE6 A;  4BA2 B;  2DLK A;  1YFH A;  3P1X A;  4LF8 I;  4JI4 E;  4JI0 I;  1DAR A;  2EQ3 A;  2EM4 A;  2FGG A;  2ODR C;  3BID A;  4R1F A;  5DRP A;  2MKN A;  2PRT A;  2BB8 A;  2UU9 E;  2UXC I;  3DF6 A;  5JEA A;  1Z0T A;  1Z5C A;  4YHH E;  5F3W A;  1YYO A;  2WW4 A;  3GON A;  4LFA I;  1RQ0 A;  5FLX Q;  4UTG A;  4NBQ A;  4LF4 I;  4NHR A;  2NAB A;  3JAM C;  3Q6N A;  4FW4 A;  2CPN A;  4MU1 A;  2EM8 A;  2WCC 3;  4FW7 A;  4IFD B;  3MHS C;  1MX0 A;  1RHY A;  4HXZ A;  2B9D A;  2EN2 A;  1X3C A;  2JR1 A;  5A6J A;  2EMK A;  1RRE A;  3CWV A;  3J7A G;  1TN9 A;  1X47 A;  2GO4 A;  4DV1 E;  2DB2 A;  4DR7 E;  5A2Q Q;  3P3G A;  5JEA F;  3V2U C;  3H09 A;  4MU0 A;  5IWA I;  2YTN A;  2NN6 E;  2WBT A;  1R6M A;  2BBG A;  2WNR A;  2N3H A;  2EM7 A;  4DUZ E;  3LML A;  3LTO A;  1GTK A;  2LJH A;  1ZBQ A;  1I94 E;  2EN3 A;  2RSM A;  4JI8 E;  4R2D A;  4DV4 E;  3BGH A;  4JYA I;  5A6B A;  5DNL A;  5K36 D;  1FKA E;  1GQE A;  3VK6 A;  2LBS B;  4N4R B;  2NUF A;  4QNK A;  3J7A M;  4ZYE A;  1S16 A;  4RPF A;  2HK3 A;  1XMQ I;  4XTJ A;  4NXN E;  2JP9 A;  1N34 I;  4BCA A;  2YSO A;  1BBO A;  5C0X A;  2KHX A;  4LF8 E;  4B3R E;  4DPT A;  1NEI A;  2ENC A;  4LF4 E;  3GME A;  1GZ6 A;  4DV7 I;  1USV A;  2L3J A;  4IFD D;  3C6M A;  5TSE A;  2RSI A;  1BKN A;  2BR2 A;  4YHH I;  1DQ3 A;  1E3H A;  3F6G A;  4DR3 I;  4JI5 I;  2J7J A;  3P3E A;  2V2V A;  2Z5B B;  3BF2 A;  3B4T A;  2EOJ A;  4DPW A;  4OO1 F;  4BC7 A;  1XMQ E;  5FLX C;  4URL A;  4J3D A;  4DUY I;  1MEY C;  2PO2 A;  4KHP E;  2EM6 A;  5C0X F;  2EPX A;  2LO3 A;  1PJS A;  1HK7 A;  2EPA A;  4X65 I;  1T4L B;  4L5N C;  2YTG A;  2L8T A;  2O1U A;  1JK2 A;  4LOM A;  5IXM B;  2WBS A;  2G7H A;  4FW5 A;  1F2I G;  4IS1 C;  5JEA C;  1UEK A;  2K7I A;  1X6H A;  4NXM E;  3ZM7 A;  1HR0 E;  1IBM I;  4NXN I;  2MC5 A;  1XXE A;  4O43 A;  2RS6 A;  2LUP B;  2XEX A;  4HY1 A;  5C0X D;  4F2J C;  2YRK A;  2CVE A;  4LTY A;  3K6Q A;  3M6A A;  2EOS A;  4KWY A;  4X64 I;  1ZM9 A;  1Z5B A;  4X8W A;  4GQU A;  3M7N D;  3C6K A;  1EKZ A;  2PO0 B;  4X66 I;  5A69 A;  4LFC I;  1Z0V A;  4ZYH A;  3CDJ A;  2EPO A;  2DRP A;  4FN5 A;  2B3T B;  2WZO A;  4FW9 A;  4LPF A;  4WUC A;  2B7T A;  4BA1 A;  2A25 A;  2EL6 A;  2L2M A;  2UXB E;  4RHB B;  4IZK A;  2JWO A;  1RR9 A;  5LLQ A;  2EN6 A;  5IT9 C;  4OKG A;  5DRR A;  4WUB A;  2V89 A;  5FWK A;  3ZZU A;  1ZXM A;  1RMD A;  2LCE A;  2EQ0 A;  1R6L A;  1MGT A;  1OYR A;  2VRD A;  1AAY A;  3FIG A;  2EP3 A;  4X65 E;  2O1T A;  4F6N A;  4JI6 E;  1ZR9 A;  3QT8 A;  5KL5 A;  3PYG A;  2D9H A;  2EMY A;  4GEQ B;  1UN6 B;  4U3B A;  4GKK I;  4BC9 A;  3THN A;  2EOI A;  2E1M A;  2N8X A;  1QU6 A;  2C38 A;  3GLL A;  5LL6 R;  4B3T I;  2LJP A;  2LVH A;  2ADR A;  3DD6 A;  1XMO I;  1HR0 I;  2HHH I;  4NXM I;  4FW6 A;  3AUZ A;  2V87 A;  4WSG A;  1Z0W A;  2PNL A;  2J7K A;  1Y4U A;  4B3S I;  3L00 A;  5ADZ A;  2N3G A;  4WPY A;  4HYM A;  1K47 A;  3OML A;  2UU9 I;  4R2R A;  4X66 E;  1S4E A;  1KKH A;  1N3G A;  2EM0 A;  4LFC E;  4JI7 E;  4OZE A;  4JI1 I;  4BBY A;  5BR8 I;  2ENH A;  5KL2 A;  4FK5 C;  4WSP A;  2HK2 A;  1HNW I;  2AJ4 A;  2V86 A;  1TF6 A;  2EMI A;  4MLQ A;  2B7V A;  1J26 A;  2IES A;  2EPZ A;  2YTO A;  4JV5 I;  1DI2 A;  3ZOQ B;  2JT2 A;  4HTG A;  1G2F C;  5KL7 A;  1B63 A;  2NN6 A;  4Z7Y A;  5A6A A;  4WUD A;  2Z5B A;  2HJJ A;  1ZM3 A;  5JEA D;  1U2R A;  5IT9 Q;  1A1G A;  4DUZ I;  3HQ1 A;  3HKM A;  2HKJ A;  4JI6 I;  2AE8 A;  2CSH A;  2EOX A;  2YTD A;  1QNT A;  2M4I A;  4F9A B;  1X6F A;  1YSA C;  4DV4 I;  4FW3 A;  4QNJ A;  4GKJ E;  5DNX A;  1KYQ A;  2JE6 B;  5A6B D;  2ZIT A;  5K36 A;  2EPN A;  1N36 I;  3PS3 A;  4B3T E;  4B3S E;  3L7Z B;  4K0K E;  1WRJ A;  2EMC A;  2MKD A;  2HHH E;  3T1Y E;  4ISA A;  2A2D A;  1XNR E;  1E3P A;  1EH7 A;  2O1V A;  1UHZ A;  3EPL A;  4PRV A;  4B3R I;  2K4V A;  4Q35 B;  4DXL A;  1KJK A;  2EL4 A;  5AE2 A;  2RPC A;  3DJW A;  3P06 A;  2CTD A;  2JEB A;  1NHI A;  2L2K B;  1A1K A;  5LMN E;  5EL9 A;  1J5E I;  4IFD C;  3F0N A;  1HNW E;  1A6F A;  3ZZT A;  2F4V E;  1N33 E;  2EPC A;  4DV6 E;  1IQO A;  4OO1 A;  1PKP A;  2L33 A;  3B8H A;  2EN1 A;  5DNY A;  1H73 A;  4LF6 I;  4ZVI A;  2JEB B;  3WU4 A;  3B82 A;  4NZV A;  4M30 A;  2DEJ A;  4IFD A;  2LMZ A;  4JI2 E;  1IBL E;  5ELW A;  2X7I A;  4R2P A;  4GZN C;  3MSW A;  1WJP A;  3UK3 C;  1KIJ A;  1WHN A;  1PIE A;  2BR2 B;  2DEI A;  4EMD A;  2EOM A;  1B69 A;  1T38 A;  2HGH A;  4GKJ I;  2LE2 A;  1Z0E A;  4DR4 I;  4F6M A;  2IHR 1;  2WP8 B;  4X62 I;  1YH8 A;  2JY9 A;  4OX9 I;  2V83 A;  3K17 A;  3M85 G;  4DR1 I;  2RS7 A;  2EMF A;  1UBD C;  3GCM A;  4RH8 A;  3JU0 A;  2EOO A;  4DU7 A;  3VHT B;  4IZJ B;  4R2E A;  2YU8 A;  5JEA E;  2LUQ A;  4KZS A;  4LCH A;  2H36 X;  2EMZ A;  4IJD A;  4B3M E;  2DMY A;  4X64 E;  2CG9 A;  3LNU A;  1G2D C;  4DMI A;  4LFA E;  2EOZ A;  2LJU A;  4O5G A;  5LMU E;  1J5E E;  1FI4 A;  2C38 B;  2IER A;  4DR5 E;  1T4O A;  2BA0 D;  2PO2 B;  4UT4 A;  2I13 A;  2HKE A;  3TQM A;  2YRM A;  1Z5A A;  2VE7 C;  4LF9 I;  1TF3 A;  1UDQ A;  3BBG A;  3Q1Q A;  1UDO A;  1XHK A;  4DR6 E;  2EMB A;  2UXB I;  3LPS A;  2E5L I;  4DV1 I;  2YTE A;  2JOX A;  2RQL A;  4DR7 I;  3F6H A;  4JI2 I;  2EMA A;  2PO0 A;  3KRN A;  2R42 A;  4DV2 I;  5KL3 A;  1STU A;  4JI0 E;  2F1D A;  2EPR A;  3HTX A;  4JI4 I;  5K36 C;  3H4L A;  2OI2 A;  1IBL I;  2EMX A;  3IWC A;  4R2A A;  4IZK B;  4LFB E;  3EPH A;  4WFT A;  4GKK E;  1DGC A;  1H74 A;  2CGE A;  4FWD A;  1UDS A;  2UXD I;  4F9B B;  2DGC A;  4J8Z A;  2EOE A;  3ADL A;  4LF7 I;  2FV4 B;  5IV8 B;  2EM9 A;  2Z5C A;  2YRH A; 
#chains in the Genus database with same CATH homology
 2VQF I;  2V8Q B;  4B3M I;  1X48 A;  2IOP A;  3WU6 A;  3D4J A;  2YZT A;  1FNM A;  1IBK E;  2UUC E;  3PRY A;  3LLH A;  5LMU I;  2LTS A;  4HAC A;  2NA2 A;  1UIL A;  2X36 A;  5AE3 A;  4IZJ D;  1YYW A;  4JV5 E;  4R8O A;  4DV2 E;  1T4N A;  2E5L E;  1NHH A;  1OJ4 A;  2ZBK B;  3K1J A;  1USU A;  3K85 A;  4M0V A;  1H7S A;  1N34 E;  4LF5 E;  2Z5E A;  2NUE A;  3V5R A;  4Z7C A;  2EWL A;  3ADJ A;  2UXD E;  4DR3 E;  4LFB I;  1FJG E;  2HFS A;  3IWB A;  1EI1 A;  4FWH A;  1NHJ A;  1FWK A;  2M7Q A;  4DR2 I;  2DIX A;  3IWD A;  4F9C B;  1FWL A;  1H7U A;  3HPZ A;  4LF7 E;  1N36 E;  2V8P A;  2VQE E;  4BS9 A;  2EFG A;  4P7A A;  3ZKD A;  1HNZ I;  4KHP I;  2VQF E;  1QZR A;  1IBK I;  2UUC I;  4MYT A;  1B62 A;  2DSY A;  2FTX B;  4DKK A;  1HNX E;  1Y4S A;  4R03 A;  3JAM Q;  2NUG A;  3OTO I;  4P78 A;  1Z0B A;  3HJC A;  2M1S A;  1H72 C;  1EA6 A;  3HXL A;  2UUB I;  1IBM E;  3J80 C;  4YY3 E;  4PRX A;  2V2Q A;  1VIS A;  1Z0G A;  5CFF E;  3C4T A;  2ZM6 E;  4TUG A;  4AQY E;  3VYX A;  2UXC E;  5L3J A;  3HPS A;  3VYY A;  2RTX A;  3PYD A;  1ZBT A;  4LF5 I;  2V85 A;  3Q6M A;  4DV5 I;  4TUI A;  4OOG C;  1FJG I;  2L6M A;  2V2Z A;  5T6J A;  4F54 A;  2VQE I;  4FWG A;  4DV3 E;  4DR1 E;  1XMO E;  4DR2 E;  2E1R A;  4M1K A;  2Q2E B;  2HFU A;  3J7Y p;  4HAC B;  1KTV A;  1ZM4 A;  5IWA E;  2Z5C B;  4MYU A;  3ZKB A;  1HNX I;  4DV0 E;  2BM1 A;  4N3O A;  4DPU A;  3OTO E;  1ELO A;  2PNM A;  3T1H E;  3AV0 A;  1YZ9 A;  4P52 A;  4JI7 I;  1PVG A;  2F8B A;  4JI3 E;  4DPY A;  3HUL A;  3QT5 A;  1I94 I;  4DR5 I;  2EZ6 A;  4LF9 E;  2JOB A;  2GQ0 A;  1ZXN A;  4YY3 I;  4BMJ A;  4ED4 A;  2V88 A;  4USK A;  2V34 A;  1NZ0 A;  3QT7 A;  2KOU A;  3ADI A;  5GME A;  2ZM6 I;  4AQY I;  3KWR A;  4M2Z A;  3WU3 A;  4L8N A;  4KQV A;  3J80 Q;  3ZZ0 A;  1N32 E;  4DV7 E;  4DV5 E;  4USM A;  4JI5 E;  2LRS A;  4JI1 E;  3PYF A;  5BR8 E;  1D6T A;  3B78 A;  4DUY E;  2L3C A;  1WUU A;  4DV3 I;  3T1Y I;  2L92 A;  1XNR I;  3J81 C;  1XNQ I;  2UUA I;  2CZ9 A;  3PYE A;  4DV0 I;  3WU5 A;  1MG7 A;  3T1H I;  1N0U A;  5LMN I;  4JI3 I;  2LTR A;  4IZJ A;  4DPX A;  1X49 A;  1YYK A;  2F4V I;  1N33 I;  1Z59 A;  4DV6 I;  2JVA A;  1MU5 A;  4Q28 A;  1ZM2 A;  1Z0C A;  4LF6 E;  2VF3 A;  2ODR D;  4K0K I;  3RMP A;  1SR9 A;  4I3H A;  2IOQ A;  2R3V A;  1N32 I;  1N0V C;  2MDR A;  3JTZ A;  1Y6Z A;  5AE1 A;  4DU8 A;  5A2Q C;  5AAS A;  2A2C A;  4DR4 E;  3C4B A;  1WXR A;  4OX9 E;  1O0W A;  2L2N A;  2GS8 A;  4JG4 A;  4P7D A;  3ADG A;  1HNZ E;  1XNQ E;  1KVK A;  2O1W A;  2YT4 A;  2VF1 A;  1RC7 A;  4LU9 A;  2BV3 A;  5GMD A;  2UUA E;  2BM0 A;  2NPF A;  3J81 Q;  4WYQ B;  4JYA E;  2MC6 A;  4DR6 I;  4JI8 I;  4I8O A;  4X62 E;  1WHQ A;  3QT6 A;  4PU9 A;  2KON A;  2UUB E;  3P1X A;  4LF8 I;  4JI4 E;  4JI0 I;  1DAR A;  2FGG A;  2ODR C;  4R1F A;  2UU9 E;  2UXC I;  3DF6 A;  1Z0T A;  1Z5C A;  4YHH E;  5F3W A;  1YYO A;  2WW4 A;  3GON A;  4LFA I;  1RQ0 A;  5FLX Q;  4UTG A;  4LF4 I;  3JAM C;  3Q6N A;  2CPN A;  1MX0 A;  4HXZ A;  2B9D A;  2JR1 A;  1RRE A;  3CWV A;  3J7A G;  5A2Q Q;  1X47 A;  4DV1 E;  2DB2 A;  4DR7 E;  3V2U C;  3H09 A;  5IWA I;  2N3H A;  4DUZ E;  3LTO A;  3LML A;  2LJH A;  1ZBQ A;  1I94 E;  2RSM A;  4JI8 E;  4DV4 E;  4JYA I;  1FKA E;  1GQE A;  3VK6 A;  2LBS B;  2NUF A;  3J7A M;  1S16 A;  4RPF A;  2HK3 A;  1XMQ I;  4XTJ A;  4NXN E;  1N34 I;  4BCA A;  2KHX A;  4LF8 E;  4B3R E;  4DPT A;  4LF4 E;  1GZ6 A;  4DV7 I;  1USV A;  2L3J A;  4YHH I;  1BKN A;  1DQ3 A;  4JI5 I;  3F6G A;  4DR3 I;  2V2V A;  2Z5B B;  4DPW A;  4BC7 A;  1XMQ E;  5FLX C;  4URL A;  4DUY I;  4KHP E;  1HK7 A;  4X65 I;  1T4L B;  4L5N C;  2L8T A;  2O1U A;  2G7H A;  1UEK A;  4NXM E;  3ZM7 A;  1HR0 E;  1IBM I;  4NXN I;  2MC5 A;  2RS6 A;  2LUP B;  2XEX A;  4HY1 A;  4LTY A;  3K6Q A;  3M6A A;  4X64 I;  1ZM9 A;  1Z5B A;  4X8W A;  1EKZ A;  4X66 I;  4LFC I;  1Z0V A;  4FN5 A;  2B3T B;  2WZO A;  4FW9 A;  4WUC A;  2B7T A;  2L2M A;  2UXB E;  4IZK A;  2JWO A;  1RR9 A;  5IT9 C;  5FWK A;  4WUB A;  2V89 A;  3ZZU A;  1ZXM A;  3FIG A;  4X65 E;  2O1T A;  4JI6 E;  3QT8 A;  3PYG A;  4GEQ B;  4GKK I;  4BC9 A;  2E1M A;  1QU6 A;  5LL6 R;  4B3T I;  2LJP A;  4NXM I;  1XMO I;  1HR0 I;  2HHH I;  3AUZ A;  2V87 A;  1Z0W A;  2PNL A;  2J7K A;  1Y4U A;  4B3S I;  5ADZ A;  2N3G A;  4WPY A;  4HYM A;  1K47 A;  3OML A;  2UU9 I;  4X66 E;  1S4E A;  1KKH A;  4LFC E;  4JI7 E;  4JI1 I;  4BBY A;  5BR8 I;  4WSP A;  2HK2 A;  1HNW I;  2AJ4 A;  2V86 A;  2B7V A;  1J26 A;  4JV5 I;  1DI2 A;  3ZOQ B;  1B63 A;  4Z7Y A;  4WUD A;  2Z5B A;  1ZM3 A;  5IT9 Q;  1U2R A;  4DUZ I;  3HQ1 A;  4JI6 I;  2HKJ A;  2M4I A;  4F9A B;  4DV4 I;  4GKJ E;  2ZIT A;  1N36 I;  4B3T E;  4B3S E;  4K0K E;  2HHH E;  3T1Y E;  2A2D A;  1XNR E;  2O1V A;  1UHZ A;  4PRV A;  4B3R I;  2K4V A;  4DXL A;  5AE2 A;  3DJW A;  3P06 A;  1NHI A;  2L2K B;  5LMN E;  1J5E I;  3F0N A;  1HNW E;  1A6F A;  3ZZT A;  2F4V E;  1N33 E;  4DV6 E;  1PKP A;  2L33 A;  3B8H A;  5DNY A;  1H73 A;  4LF6 I;  4ZVI A;  3WU4 A;  3B82 A;  4M30 A;  2DEJ A;  2LMZ A;  4JI2 E;  1IBL E;  2X7I A;  1KIJ A;  3MSW A;  2DEI A;  1WHN A;  1PIE A;  4EMD A;  4GKJ I;  2LE2 A;  1Z0E A;  4DR4 I;  2IHR 1;  4X62 I;  2JY9 A;  4OX9 I;  2V83 A;  3K17 A;  4DR1 I;  2RS7 A;  3JU0 A;  4DU7 A;  4IZJ B;  2LUQ A;  4KZS A;  2H36 X;  4B3M E;  3LNU A;  2DMY A;  4X64 E;  2CG9 A;  4DMI A;  4LFA E;  5LMU E;  1J5E E;  1FI4 A;  4UT4 A;  4DR5 E;  1T4O A;  2HKE A;  1Z5A A;  2VE7 C;  4LF9 I;  3Q1Q A;  1XHK A;  4DR6 E;  2UXB I;  3LPS A;  2E5L I;  4DV1 I;  4DR7 I;  2JOX A;  3F6H A;  4JI2 I;  2R42 A;  4DV2 I;  1STU A;  4JI0 E;  4JI4 I;  3HTX A;  3H4L A;  2OI2 A;  1IBL I;  3IWC A;  4IZK B;  4LFB E;  4WFT A;  4GKK E;  1H74 A;  2CGE A;  4FWD A;  2UXD I;  4F9B B;  4J8Z A;  3ADL A;  4LF7 I;  2FV4 B;  2Z5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...