4JI5E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji5E02
4LF4I 4DUZI 5LMUI 4LFBI 3HTXA 2LUPB 1N36E 5GMEA 1IBLI 1ZM4A 4OOGC 1S4EA 4LF6E 4B3ME 3CWVA 4DV0I 2BV3A 4GKKE 1Z0BA 4FN5A 1UHZA 3T1HI 1Z0CA 3VYYA 3WU5A 2KHXA 4DR7I 5IWAE 3QT5A 1N34E 2L2NA 4JI4E 2HFSA 2DIXA 1PKPA 3ZZ0A 1WHNA 2HK3A 4WYQB 1RQ0A 4P52A 1D6TA 3ZM7A 2CZ9A 2VF3A 2X36A 1FNMA 2F4VI 1PIEA 1HNXI 2BM0A 4DU7A 1IBKE 3WU6A 4DV3E 3V2UC 3OTOE 1H72C 5LMNE 4DV2I 4DR4I 3WU3A 5A2QC 3K17A 2F4VE 5FLXQ 4X62E 1XMOI 1FI4A 5LL6R 1QU6A 4LFBE 4LFCI 1FWKA 2E5LE 1FWLA 3WU4A 3J80C 3J7AG 2UUBI 2A2CA 2E5LI 1H7UA 3K1JA 4DV5E 4RPFA 4X62I 1A6FA 2ZM6I 4B3TI 4DR6I 4DPWA 2UXDE 5IT9C 3F0NA 1HR0I 2UUCI 3QT8A 3V5RA 4UTGA 4DR5I 4DV7I 4DR2E 1XNQE 3B82A 5LMUE 2EZ6A 2LRSA 2X7IA 2NUFA 1RREA 2V2ZA 2L33A 4DR3I 2L3CA 2HHHI 4DR1I 4R1FA 4GKKI 4DR3E 1S16A 1IBLE 1B62A 3ZZUA 4WFTA 3J81Q 4JI3I 1HNZE 2IHR1 2B7TA 1HNZI 4B3RE 4M30A 2UUCE 2LTRA 1I94E 2RSMA 2UUAE 5L3JA 4B3TE 3H4LA 4YHHE 4JI0E 4OX9I 3ADIA 1FKAE 1RC7A 4X8WA 1HNWE 1WUUA 3J81C 4M1KA 4B3SI 1KKHA 1XMOE 1HNWI 1ELOA 3QT7A 2NA2A 4DPXA 4DV7E 3J7Yp 4K0KE 1Z0VA 1XNRE 2NUEA 1MU5A 4X65I 2YT4A 4JYAE 2BM1A 2V2VA 1J26A 4XTJA 1N36I 4DV3I 2V8PA 4B3RI 1EI1A 4JYAI 5IWAI 4JV5E 1K47A 4DV4E 4JV5I 4DV0E 3LPSA 1ZM9A 2V2QA 4DV5I 1EA6A 4JI8E 2RTXA 2L2MA 1DI2A 1H74A 1XMQE 4YHHI 1WHQA 4NXME 4DXLA 2DEJA 1IBKI 2J7KA 2ZBKB 4KQVA 4JI7I 4PRVA 3Q1QA 2OI2A 1HNXE 1Z5AA 2DB2A 2VQEI 1YYOA 4DPYA 4DUYE 1XNRI 1DARA 4YY3I 1UEKA 2UU9E 1XHKA 4GKJI 4HACA 4EMDA 1H7SA 2UXCI 4JI5E 2DMYA 1N0VC 2B3TB 2NPFA 4JI5I 1J5EI 1I94I 3LTOA 1YYWA 1N34I 3ZKDA 1IBME 4USKA 4DR7E 4KHPE 4DV6I 4ZVIA 2LJPA 4LF7E 4HXZA 1NHJA 4JI6E 4DV6E 1QZRA 2MDRA 4FWDA 5IT9Q 4M2ZA 4LF9E 5A2QQ 4UT4A 4JI6I 2LUQA 1MX0A 4DPTA 4MYTA 4HY1A 2EFGA 4OX9E 4JI0I 3PYGA 1FJGI 4USMA 3J80Q 1MG7A 2ZITA 4LFAI 4LF5E 2RS6A 4P7AA 1N32E 5BR8I 3B78A 3QT6A 2NUGA 3C4BA 2R3VA 4YY3E 1YZ9A 1X49A 2UXCE 4LF8E 1Z5CA 2JVAA 1B63A 2UU9I 3P1XA 2CPNA 4LF4E 3T1HE 4JI3E 1N0UA 5GMDA 4X66E 1Z0EA 4ED4A 1IBMI 4JI8I 4B3MI 4X66I 1Z0GA 1HR0E 1H73A 2LBSB 3JAMQ 2JY9A 2ZM6E 3LLHA 5FLXC 4AQYI 2UXBE 4PU9A 4URLA 3PYDA 2L3JA 1ZM2A 3ZKBA 2WW4A 1KIJA 4WUDA 4HYMA 1T4NA 1PVGA 3GONA 4JI4I 4GKJE 2UXBI 4LFAE 5BR8E 2VQFI 2B7VA 1YYKA 1ZBTA 2VQFE 1Z0WA 4NXMI 2HKJA 3ADGA 3M6AA 4DV2E 3JAMC 2VQEE 5LMNI 4DPUA 2UUBE 3PYFA 1O0WA 1T4LB 3T1YE 4WUCA 4JI1I 2DEIA 4FWGA 1Z59A 4NXNI 3T1YI 1VISA 3LNUA 4KHPI 4FWHA 2LTSA 2E1RA 1U2RA 5CFFE 3PYEA 4X64I 4JI2I 4Z7YA 2RS7A 1ZM3A 4AQYE 1EKZA 4LF9I 1UILA 1N32I 4JI7E 1OJ4A 4Z7CA 1XNQI 4DV1I 4LF7I 2Q2EB 3ADLA 4DR2I 4DR4E 2HK2A 4DR5E 1NHIA 1XMQI 1KVKA 2N3HA 1T4OA 1GQEA 2V34A 3B8HA 2L2KB 4DUZE 1X47A 4X65E 1ZXNA 1ZXMA 1Z0TA 2LJHA 2AJ4A 1KTVA 4HACB 1STUA 4LF6I 1N33I 4LFCE 4JG4A 2HHHE 3OTOI 1N33E 1J5EE 3D4JA 1BKNA 2HFUA 4NXNE 4PRXA 3VYXA 4DV4I 2A2DA 4WUBA 4LF8I 1NZ0A 1Z5BA 2UUAI 4DR6E 4DU8A 2UXDI 4DV1E 3J7AM 3ADJA 1X48A 4X64E 4JI2E 4FW9A 4I3HA 4K0KI 4DR1E 4LF5I 4B3SE 1FJGE 2XEXA 3ZZTA 1NHHA 4MYUA 4DUYI 2HKEA 2R42A 3C4TA 4JI1E 2N3GA 3HULA 4DKKA 2GS8A 1RR9A
chains in the Genus database with same CATH superfamily
3EPHA 4LCFA 5DNLA 4LPFA 4LF4I 4DUZI 2PNZA 4MLQA 4WSGA 5LMUI 5AE2A 4LFBI 3GCMA 3P3EA 4P7DA 3HTXA 2LUPB 3H09A 2E72A 1N36E 5GMEA 2EM4A 1IBLI 5IXMB 1ZM4A 4OOGC 2ELYA 2M7QA 1S4EA 4LF6E 4B3ME 3KZZA 3CWVA 4IFDF 4DV0I 2NN6A 2BV3A 4GKKE 1Z0BA 4FN5A 1TF3A 2HGHA 2NN6E 1UHZA 3T1HI 1WXRA 1Z0CA 3LMLA 1DQ3A 4GEQB 3VYYA 4BA1B 3WU5A 2LCEA 2KHXA 4BMJA 5C0XD 5IWAE 4DR7I 2BB8A 4MLVA 2GQ0A 2MC6A 3QT5A 2ELZA 2EM5A 1KYQA 3AUZA 2J65A 2O1VA 4IFDC 4IFDB 1N34E 2L2NA 1UDSA 2KOUA 4JI4E 2HFSA 1G2FC 2EMHA 3MHSC 2DIXA 1PKPA 2L6MA 2GO3A 3ZZ0A 1WHNA 2HK3A 3HQ1A 4WYQB 1RQ0A 4L5NC 2EOQA 4P52A 1D6TA 3ZM7A 2CZ9A 2EORA 2VF3A 2X36A 1FNMA 4N4RB 4MU3A 2F4VI 1PIEA 5DRQA 2N8XA 2WZOA 3JTZA 5AASA 1BB8A 2BM0A 1HNXI 4DU7A 2V89A 4HTGA 1IBKE 3WU6A 5AC5A 5KL5A 4DV3E 2WNRA 3V2UC 3OTOE 2C38B 4ZYGA 1H72C 2EL6A 5LMNE 4DV2I 4DR4I 2NABA 3WU3A 5A2QC 3K17A 4FK5C 2FTXB 2F4VE 5DROA 5FLXQ 4X62E 1XMOI 5LL6R 2EMBA 1QU6A 1A1GA 1AAYA 4LFBE 1FI4A 4LFCI 4AIDA 5JEAD 4P78A 3PS1A 1FWKA 2E5LE 1FWLA 2BR2B 5KL2A 3WU4A 3J80C 3J7AG 2UUBI 2JR1A 1T38A 2A2CA 1YPNA 4DMIA 4LCGA 1H7UA 2E5LI 1EH6A 3CDIA 2HJJA 2BA1D 3K1JA 4DV5E 2RPCA 2GLIA 1EH8A 4RPFA 4X62I 1A6FA 2C39B 3M85G 1A1JA 5DRRA 2ZM6I 3K85A 3KWRA 2JEBA 4B3TI 4LTYA 4DR6I 4DPWA 2JOXA 2UXDE 5IT9C 2R76A 3F0NA 4IZKA 1HR0I 2FGGA 2JT2A 2UUCI 2WP8A 4HEIA 3QT8A 1PJTA 2GPIA 3V5RA 1NEIA 4UTGA 2CGEA 2EOZA 4DR5I 3L7ZA 4FW4A 4DV7I 4DR2E 4MU0A 2O1UA 1A1FA 1XNQE 4LOMA 2EMCA 4IZJB 3P76A 5K36D 2BR2A 2M9AA 3B82A 5LMUE 2EZ6A 5K36E 2LRSA 2BA1G 2X7IA 3BF2A 5C0XA 2NUFA 1RREA 2K4VA 2EN3A 3BGHA 2V2ZA 2GHFA 2DLQA 2L33A 3IWBA 2LO3A 4BCAA 3M85D 4DR3I 2L3CA 2EPRA 2EOYA 2DMIA 2HHHI 2EN2A 4DR1I 2MKNA 1HK7A 4R1FA 4GKKI 4DR3E 1L4SA 2F1DA 2A25A 2E1MA 2EMIA 2EJ4A 3VHTB 1S16A 4OKGA 5TSEA 4X9JA 1IBLE 3ZOQB 4Q28A 1B62A 4IZJA 5KL3A 2YTJA 2L8TA 2PRTA 3BBGA 3ZZUA 2WBSA 2EP3A 4WFTA 3J81Q 2EN6A 2YU8A 2AE8A 2EMAA 3U1YA 4JI3I 1HNZE 2IHR1 2B7TA 2RQLA 1HNZI 4RHBB 4ZYEA 4OO1D 4O24A 1F2IG 4B3RE 4FW6A 4M30A 2V85A 2UUCE 5KL6A 2LTRA 2EMWA 1I94E 2JE6B 4BS9A 1OYRA 3EQ1A 2YWQA 4J3DA 1Y4SA 2RSMA 2UUAE 2LT7A 5L3JA 1PDAA 2I9IA 4B3TE 2C39A 1IMUA 4R2AA 5DNYA 1SFEA 3H4LA 4YHHE 2EPKX 2VESA 4JI0E 2O3ZA 4OX9I 3ADIA 1FKAE 3M99B 1AH5A 4X8WA 1RC7A 3J81C 3ECRA 3FIGA 1HNWE 1WUUA 4M1KA 1KKHA 4B3SI 4R2SA 1XMOE 1HNWI 1ELOA 3QT7A 2EOIA 2NA2A 2WBUA 2YTNA 4DPXA 4DV7E 2VRDA 3J7Yp 1YUIA 3DD6A 3P06A 4K0KE 4BHBA 1Z0VA 2WBTA 1UDOA 2ODRD 1YUJA 3DJWA 1XNRE 2NUEA 1MU5A 1USVA 2EOXA 3GMEA 4X65I 2YT4A 2JYAA 4JYAE 2IOPA 4R2RA 2BM1A 2V2VA 1P42A 1J26A 2CG9A 5A6JA 5A6KA 4XTJA 2IESA 2EQ3A 1N36I 4IZKB 4DV3I 2YRKA 4F6MA 4Q35B 2V8PA 2WCC3 5AE1A 4MQYA 3IWDA 4R2CA 4B3RI 2EOHA 1EI1A 1WRJA 2EPMX 2IOQA 4O43A 4TUGA 4JYAI 3NZKA 5IWAI 1PJQA 4NHRA 4IFDA 2V86A 4JV5E 1IQOA 1SR9A 1K47A 3THNA 4DV4E 1UDQA 4JV5I 3RMPA 4DV0E 2YSPA 4WX9A 2G7HA 3LPSA 2EPCA 1ZM9A 4IJDA 4RH8A 1A1HA 2EM0A 2V2QA 4DV5I 4ZYHA 4GZNC 2EPLX 2YU5A 4JI8E 2RTXA 2L2MA 1DI2A 1EA6A 1OYSA 5ADZA 1H74A 4F2JC 1XMQE 3P3CA 2EOEA 4ZYDA 2VE7C 4M0VA 4YHHI 2PNZB 1WHQA 2LE2A 4NXME 4DXLA 2DEJA 1IBKI 2J7KA 2ZBKB 4KQVA 4F9BB 4PRVA 4JI7I 3Q1QA 4R2QA 2OI2A 1HNXE 1Z5AA 1JK2A 3M7NG 2DB2A 2EMKA 2VQEI 1ZAAC 5AC4A 4R2EA 1R6LA 1YYOA 4DPYA 4DUYE 1XNRI 2HC5A 1DARA 4YY3I 2EWLA 1UEKA 4ISAA 2BBGA 2UU9E 1XHKA 4N3OA 4GKJI 4NZVA 4HACA 2B9DA 4F9CB 1H7SA 4I8OA 5LLQA 4EMDA 5FWKA 5JEAE 4JI5E 2UXCI 4OO1A 2DMYA 1N0VC 2ENHA 1TN9A 2B3TB 2EOSA 2YTGA 2NPFA 4JI5I 4BC7A 2CSHA 2J7JA 2EMLA 3EPLA 2JEAA 4M9VC 2VF1A 1J5EI 2ADRA 1I94I 3LTOA 1YYWA 1N34I 2EM8A 3ZKDA 2EOFA 1IBME 2EPNA 3L7ZB 4USKA 4DR7E 4KHPE 1WJPA 1Z1BA 4ZVIA 4DV6I 2DLKA 2LJPA 4LF7E 1R6MA 2NN6B 2NN6C 2WP8B 1NHJA 4HXZA 4JI6E 4DV6E 1QZRA 2MDRA 3M7ND 1Y60A 4FWDA 5IT9Q 4M2ZA 4LF9E 5A2QQ 4UT4A 4JI6I 2JEAB 1XXEA 3OMLA 1NCSA 1X3CA 2LUQA 4L8NA 1E3HA 1MX0A 4MDTA 4DPTA 4MYTA 3C6MA 4HY1A 2EFGA 4OX9E 4JI0I 4BC9A 3HJCA 3PYGA 4KWYA 4JI2I 4KZSA 1X5WA 2Z5CA 4USMA 4OO1F 3J80Q 1FJGI 3GLLA 5C0XE 1MG7A 2ZITA 4LFAI 5T6JA 3AV0A 1JK1A 1MEYC 2RS6A 4LF5E 4P7AA 1USUA 1VI7A 1N32E 5BR8I 3B78A 2Z5BB 3QT6A 4U3DA 2EQ0A 1ZR9A 1Y6ZA 4LU9A 2NUGA 3C4BA 4R8OA 2O1WA 2R3VA 3HPZA 4YY3E 2BA0D 1RHYA 1YZ9A 1GZ6A 3F6GA 1X49A 1A1LA 5EL9A 2PO2B 2D9HA 2EN4A 2UXCE 4LF8E 1Z5CA 2JVAA 3TQMA 1B63A 2UU9I 5A69A 4BA2B 3P1XA 2CPNA 5KL4A 3T1HE 4LF4E 1BBGA 2H36X 4JI3E 4U3BA 3EPKA 1E3PA 4R2DA 4X66E 1N0UA 2V88A 5GMDA 1P47A 4F9AB 2NN6D 4F6NA 1Z0EA 5EKWA 4ED4A 4JI8I 1IBMI 4B3MI 4X66I 2JOBA 4O5GA 1Z0GA 2Z5EA 1HR0E 2YTEA 3K6QA 2EM3A 2R1FA 4MU1A 2EM7A 1H73A 2JP9A 2LBSB 2EL5A 3C6KA 1G2DC 4GQUA 3JAMQ 2EPXA 2JY9A 2JE6A 2ZM6E 3LLHA 2EPOA 5FLXC 4AQYI 2ENAA 4F54A 3EPJA 1DGCA 2UXBE 4PU9A 4URLA 1X6HA 3PYDA 2YRHA 2L3JA 1ZM2A 1GTKA 3ZKBA 2WW4A 2IERA 1KIJA 1UDNA 4WUDA 3P3GA 3KZYA 1T4NA 1PVGA 4HYMA 3GONA 2EPPA 4FW7A 2MC5A 4NBQA 4JI4I 2V8QB 2CT1A 2RSIA 4GKJE 2UXBI 3DF6A 4LFAE 2EMXA 2EN8A 2O1TA 2LMZA 5BR8E 4O4KA 2EOMA 2VQFI 2B7VA 1YYKA 1UN6B 4TUIA 2PO2A 1ZBTA 2VQFE 2Q8UA 2JPAA 4WSPA 1Z0WA 2WNRB 4NXMI 5A6BA 2HKJA 3ADGA 3M6AA 4DV2E 3JAMC 1T39A 3U1KA 4WXCA 2YTOA 2EMFA 1N3GA 2VQEE 5ELWA 5LMNI 2ODRC 4AM3A 4DPUA 2Z5CB 1Y4UA 4WPYA 3MSWA 2UUBE 2YTPA 5AE3A 3PYFA 1O0WA 2ENCA 1T4LB 3T1YE 4WUCA 4JI1I 2DEIA 4FWGA 2M1SA 2EM6A 1X6EA 1OYPA 1RMDA 1Z59A 4R03A 4FW3A 4J8ZA 5DRPA 1VISA 2M4IA 4NXNI 3T1YI 1EH7A 3HPSA 2LJUA 3LNUA 4KHPI 2EE8A 2YZTA 4FWHA 2LVHA 3CDJA 3HKMA 1B69A 2JEBB 1A1IA 2LTSA 1YHCA 5A6BD 2JWOA 5A6AA 4IFDE 1PJSA 3F6HA 2E1RA 2F8BA 2K7IA 5CFFE 1U2RA 3H1CA 5K36F 4OZEA 1IQSA 2GO4A 3PYEA 4X64I 3HXLA 2EL4A 1QNTA 4Z7YA 2RS7A 2EQ1A 4AQYE 1ZM3A 2I13A 2YTQA 4BA1A 1EKZA 2YPNA 2FV4B 1UILA 4LF9I 2EOJA 4JI7E 1KJKA 1OJ4A 1N32I 4AIMA 4Z7CA 2PO0A 2PO1B 3THOB 1XNQI 4BA2A 3BIDA 2KONA 4DV1I 2EPAA 4LF7I 1X6FA 2EOOA 1TF6A 3ADLA 2Q2EB 4DR2I 2YTFA 4DR4E 2HK2A 4FW5A 4DR5E 1NHIA 4OO1B 4OO1C 1XMQI 1KVKA 4IFDD 2PNMA 4BHCA 1YFHA 2N3HA 1T4OA 3IWCA 4OO1E 1GQEA 2V34A 5C0XB 5C0XC 3B8HA 5JEAA 2L2KB 5C0XF 2EPUA 4DUZE 3UK3C 2JXPA 3MHHC 1X47A 3B4TA 3Q6MA 4X65E 3VK6A 1ZU1A 2EMZA 2EMGA 1MGTA 1ZXNA 1ZXMA 1Z0TA 2LJHA 2AJ4A 1KTVA 4HACB 4MU4A 5K36A 2MDGA 2DGCA 4WXDA 2EN7A 1STUA 4LF6I 5IV8B 1N33I 4LFCE 4JG4A 2HHHE 1LLMC 3OTOI 1N33E 1J5EE 4IS9A 3D4JA 2CVEA 1BKNA 5DNXA 2HFUA 4NXNE 4PRXA 3VYXA 4DV4I 2V87A 2A2DA 4WUBA 2EM9A 4LF8I 1NZ0A 1Z5BA 2UUAI 2DRPA 4DR6E 1YH8A 4DU8A 1A1KA 1BBOA 5JEAF 2PO0B 2PO1A 2YRMA 2UXDI 3L00A 2LV2A 2MKDA 4DV1E 3J7AM 2EM2A 3QG5C 1YSAC 3ADJA 1UBDC 4IS1C 1X48A 2BA0G 3JU0A 4X64E 4JI2E 2NN6F 4QNJA 3KRNA 3PRYA 2CTDA 3PS3A 4FW9A 4R2PA 4I3HA 4K0KI 2EMYA 2EN1A 2YTIA 4DR1E 3PS2A 4LCHA 4B3SE 2C38A 4BBYA 2L92A 5F3WA 3Q6NA 2DSYA 1FJGE 4LF5I 2C37A 2XEXA 2Z5BA 4QNKA 3ZZTA 1NHHA 2EPZA 2C37B 1ZBQA 2V83A 4MYUA 4DUYI 4IZJD 5KL7A 5K36C 2HKEA 2R42A 5K36B 3C4TA 2YTDA 3UHMA 2PNLA 4JI1E 2N3GA 3HULA 5JEAC 5JEAB 4DKKA 2GS8A 1Y5YA 1RR9A 2YSOA
chains in the Genus database with same CATH topology
4LF4I 4DUZI 5LMUI 5AE2A 4LFBI 4P7DA 3HTXA 2LUPB 3H09A 1N36E 5GMEA 1IBLI 1ZM4A 4OOGC 2M7QA 1S4EA 4LF6E 4B3ME 3CWVA 4DV0I 2BV3A 4GKKE 1Z0BA 4FN5A 1UHZA 3T1HI 1WXRA 1Z0CA 3LMLA 1DQ3A 4GEQB 3VYYA 3WU5A 2KHXA 4BMJA 4DR7I 5IWAE 2GQ0A 2MC6A 3QT5A 2O1VA 3AUZA 1N34E 2L2NA 2KOUA 4JI4E 2HFSA 2DIXA 1PKPA 2L6MA 3ZZ0A 1WHNA 2HK3A 3HQ1A 4WYQB 1RQ0A 4L5NC 4P52A 1D6TA 3ZM7A 2CZ9A 2VF3A 2X36A 1FNMA 2F4VI 1PIEA 3JTZA 2WZOA 5AASA 1HNXI 2BM0A 4DU7A 2V89A 1IBKE 3WU6A 4DV3E 3V2UC 3OTOE 1H72C 5LMNE 4DV2I 4DR4I 3WU3A 5A2QC 3K17A 2FTXB 2F4VE 5FLXQ 4X62E 1XMOI 5LL6R 1FI4A 1QU6A 4LFBE 4LFCI 4P78A 1FWKA 2E5LE 1FWLA 3WU4A 3J80C 3J7AG 2UUBI 2JR1A 2A2CA 2E5LI 4DMIA 1H7UA 3K1JA 4DV5E 4RPFA 4X62I 1A6FA 2ZM6I 3K85A 3KWRA 4B3TI 4LTYA 4DR6I 4DPWA 2JOXA 2UXDE 5IT9C 3F0NA 4IZKA 1HR0I 2FGGA 2UUCI 3QT8A 3V5RA 4UTGA 2CGEA 4DR5I 4DV7I 4DR2E 2O1UA 1XNQE 4IZJB 3B82A 5LMUE 2EZ6A 2LRSA 2X7IA 2NUFA 1RREA 2K4VA 2V2ZA 2L33A 3IWBA 4BCAA 4DR3I 2L3CA 2HHHI 4DR1I 1HK7A 4R1FA 4GKKI 4DR3E 2E1MA 1S16A 1IBLE 3ZOQB 4Q28A 1B62A 4IZJA 2L8TA 3ZZUA 4WFTA 3J81Q 4JI3I 1HNZE 2IHR1 2B7TA 1HNZI 4B3RE 4M30A 2V85A 2UUCE 2LTRA 1I94E 4BS9A 1Y4SA 2RSMA 2UUAE 5L3JA 4B3TE 3H4LA 5DNYA 4YHHE 4JI0E 4OX9I 3ADIA 1WUUA 1FKAE 1RC7A 4X8WA 1HNWE 3J81C 3FIGA 4M1KA 4B3SI 1KKHA 1XMOE 1HNWI 1ELOA 3QT7A 2NA2A 4DPXA 4DV7E 3J7Yp 3P06A 4K0KE 1Z0VA 2ODRD 3DJWA 1XNRE 2NUEA 1MU5A 1USVA 4X65I 2YT4A 4JYAE 2IOPA 2BM1A 2V2VA 1J26A 2CG9A 4XTJA 1N36I 4IZKB 4DV3I 2V8PA 5AE1A 3IWDA 4B3RI 1EI1A 2IOQA 4TUGA 4JYAI 5IWAI 2V86A 4JV5E 1K47A 1SR9A 4DV4E 4JV5I 3RMPA 4DV0E 2G7HA 3LPSA 1ZM9A 2V2QA 4DV5I 1EA6A 4JI8E 2RTXA 2L2MA 1DI2A 5ADZA 1H74A 1XMQE 2VE7C 4M0VA 4YHHI 1WHQA 2LE2A 4NXME 4DXLA 2DEJA 1IBKI 2J7KA 2ZBKB 4KQVA 4F9BB 4PRVA 4JI7I 3Q1QA 2OI2A 1HNXE 1Z5AA 2DB2A 2VQEI 1YYOA 4DPYA 4DUYE 1XNRI 1DARA 4YY3I 1UEKA 2EWLA 2UU9E 1XHKA 4N3OA 4GKJI 4HACA 2B9DA 4F9CB 1H7SA 4I8OA 4EMDA 5FWKA 2UXCI 4JI5E 2DMYA 1N0VC 2B3TB 2NPFA 4JI5I 4BC7A 2VF1A 1J5EI 1I94I 3LTOA 1YYWA 1N34I 3ZKDA 1IBME 4USKA 4DR7E 4KHPE 4DV6I 4ZVIA 2LJPA 4LF7E 4HXZA 1NHJA 4JI6E 4DV6E 1QZRA 2MDRA 4FWDA 5IT9Q 4M2ZA 4LF9E 5A2QQ 4UT4A 4JI6I 3OMLA 2LUQA 4L8NA 1MX0A 4DPTA 4MYTA 4HY1A 2EFGA 4OX9E 4JI0I 4BC9A 3HJCA 3PYGA 1FJGI 4KZSA 4USMA 2Z5CA 3J80Q 1MG7A 2ZITA 4LFAI 5T6JA 3AV0A 4LF5E 2RS6A 4P7AA 1USUA 1N32E 5BR8I 3B78A 2Z5BB 3QT6A 1Y6ZA 4LU9A 2NUGA 3C4BA 4R8OA 2O1WA 2R3VA 3HPZA 4YY3E 1YZ9A 1GZ6A 3F6GA 1X49A 2UXCE 4LF8E 1Z5CA 2JVAA 1B63A 2UU9I 3P1XA 2CPNA 4LF4E 3T1HE 2H36X 4JI3E 1N0UA 5GMDA 4X66E 2V88A 4F9AB 1Z0EA 4ED4A 1IBMI 4JI8I 4B3MI 4X66I 2JOBA 1Z0GA 2Z5EA 1HR0E 3K6QA 1H73A 2LBSB 3JAMQ 2JY9A 2ZM6E 3LLHA 5FLXC 4AQYI 4F54A 2UXBE 4PU9A 4URLA 3PYDA 2L3JA 1ZM2A 3ZKBA 2WW4A 1KIJA 4WUDA 4HYMA 1T4NA 1PVGA 3GONA 2MC5A 4JI4I 2V8QB 4GKJE 2UXBI 3DF6A 4LFAE 2O1TA 2LMZA 5BR8E 2VQFI 2B7VA 1YYKA 4TUIA 1ZBTA 2VQFE 1Z0WA 4WSPA 4NXMI 2HKJA 3ADGA 3M6AA 4DV2E 3JAMC 2VQEE 5LMNI 2ODRC 4DPUA 2Z5CB 1Y4UA 4WPYA 3MSWA 2UUBE 5AE3A 3PYFA 1O0WA 1T4LB 3T1YE 4WUCA 4JI1I 2DEIA 4FWGA 2M1SA 1Z59A 4R03A 4NXNI 4J8ZA 3T1YI 1VISA 2M4IA 3HPSA 3LNUA 4KHPI 2YZTA 4FWHA 2LTSA 2JWOA 3F6HA 2E1RA 2F8BA 1U2RA 5CFFE 3PYEA 4X64I 4JI2I 3HXLA 4Z7YA 2RS7A 1ZM3A 4AQYE 1EKZA 2FV4B 1UILA 4LF9I 4JI7E 1N32I 1OJ4A 4Z7CA 1XNQI 2KONA 4DV1I 4LF7I 2Q2EB 3ADLA 4DR2I 4DR4E 2HK2A 4DR5E 1NHIA 1XMQI 1KVKA 2PNMA 2N3HA 1T4OA 3IWCA 1GQEA 2V34A 3B8HA 2L2KB 4DUZE 3Q6MA 1X47A 4X65E 3VK6A 1ZXNA 1ZXMA 1Z0TA 2LJHA 2AJ4A 1KTVA 4HACB 1STUA 4LF6I 1N33I 4LFCE 4JG4A 2HHHE 3OTOI 1N33E 1J5EE 3D4JA 1BKNA 2HFUA 4NXNE 4PRXA 3VYXA 4DV4I 2V87A 2A2DA 4WUBA 4LF8I 1NZ0A 1Z5BA 2UUAI 4DR6E 4DU8A 2UXDI 4DV1E 3J7AM 3ADJA 1X48A 3JU0A 4X64E 4JI2E 3PRYA 4FW9A 4I3HA 4K0KI 4DR1E 4LF5I 4B3SE 3Q6NA 4BBYA 2L92A 5F3WA 2DSYA 1FJGE 2XEXA 2Z5BA 3ZZTA 1NHHA 1ZBQA 2V83A 4MYUA 4DUYI 4IZJD 2HKEA 2R42A 3C4TA 2PNLA 4JI1E 2N3GA 3HULA 4DKKA 2GS8A 1RR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 I;  4DUZ I;  5LMU I;  4LFB I;  3HTX A;  2LUP B;  1N36 E;  5GME A;  1IBL I;  1ZM4 A;  4OOG C;  1S4E A;  4LF6 E;  4B3M E;  3CWV A;  4DV0 I;  2BV3 A;  4GKK E;  1Z0B A;  4FN5 A;  1UHZ A;  3T1H I;  1Z0C A;  3VYY A;  3WU5 A;  2KHX A;  4DR7 I;  5IWA E;  3QT5 A;  1N34 E;  2L2N A;  4JI4 E;  2HFS A;  2DIX A;  1PKP A;  3ZZ0 A;  1WHN A;  2HK3 A;  4WYQ B;  1RQ0 A;  4P52 A;  1D6T A;  3ZM7 A;  2CZ9 A;  2VF3 A;  2X36 A;  1FNM A;  2F4V I;  1PIE A;  1HNX I;  2BM0 A;  4DU7 A;  1IBK E;  3WU6 A;  4DV3 E;  3V2U C;  3OTO E;  1H72 C;  5LMN E;  4DV2 I;  4DR4 I;  3WU3 A;  5A2Q C;  3K17 A;  2F4V E;  5FLX Q;  4X62 E;  1XMO I;  1FI4 A;  5LL6 R;  1QU6 A;  4LFB E;  4LFC I;  1FWK A;  2E5L E;  1FWL A;  3WU4 A;  3J80 C;  3J7A G;  2UUB I;  2A2C A;  2E5L I;  1H7U A;  3K1J A;  4DV5 E;  4RPF A;  4X62 I;  1A6F A;  2ZM6 I;  4B3T I;  4DR6 I;  4DPW A;  2UXD E;  5IT9 C;  3F0N A;  1HR0 I;  2UUC I;  3QT8 A;  3V5R A;  4UTG A;  4DR5 I;  4DV7 I;  4DR2 E;  1XNQ E;  3B82 A;  5LMU E;  2EZ6 A;  2LRS A;  2X7I A;  2NUF A;  1RRE A;  2V2Z A;  2L33 A;  4DR3 I;  2L3C A;  2HHH I;  4DR1 I;  4R1F A;  4GKK I;  4DR3 E;  1S16 A;  1IBL E;  1B62 A;  3ZZU A;  4WFT A;  3J81 Q;  4JI3 I;  1HNZ E;  2IHR 1;  2B7T A;  1HNZ I;  4B3R E;  4M30 A;  2UUC E;  2LTR A;  1I94 E;  2RSM A;  2UUA E;  5L3J A;  4B3T E;  3H4L A;  4YHH E;  4JI0 E;  4OX9 I;  3ADI A;  1FKA E;  1RC7 A;  4X8W A;  1HNW E;  1WUU A;  3J81 C;  4M1K A;  4B3S I;  1KKH A;  1XMO E;  1HNW I;  1ELO A;  3QT7 A;  2NA2 A;  4DPX A;  4DV7 E;  3J7Y p;  4K0K E;  1Z0V A;  1XNR E;  2NUE A;  1MU5 A;  4X65 I;  2YT4 A;  4JYA E;  2BM1 A;  2V2V A;  1J26 A;  4XTJ A;  1N36 I;  4DV3 I;  2V8P A;  4B3R I;  1EI1 A;  4JYA I;  5IWA I;  4JV5 E;  1K47 A;  4DV4 E;  4JV5 I;  4DV0 E;  3LPS A;  1ZM9 A;  2V2Q A;  4DV5 I;  1EA6 A;  4JI8 E;  2RTX A;  2L2M A;  1DI2 A;  1H74 A;  1XMQ E;  4YHH I;  1WHQ A;  4NXM E;  4DXL A;  2DEJ A;  1IBK I;  2J7K A;  2ZBK B;  4KQV A;  4JI7 I;  4PRV A;  3Q1Q A;  2OI2 A;  1HNX E;  1Z5A A;  2DB2 A;  2VQE I;  1YYO A;  4DPY A;  4DUY E;  1XNR I;  1DAR A;  4YY3 I;  1UEK A;  2UU9 E;  1XHK A;  4GKJ I;  4HAC A;  4EMD A;  1H7S A;  2UXC I;  4JI5 E;  2DMY A;  1N0V C;  2B3T B;  2NPF A;  4JI5 I;  1J5E I;  1I94 I;  3LTO A;  1YYW A;  1N34 I;  3ZKD A;  1IBM E;  4USK A;  4DR7 E;  4KHP E;  4DV6 I;  4ZVI A;  2LJP A;  4LF7 E;  4HXZ A;  1NHJ A;  4JI6 E;  4DV6 E;  1QZR A;  2MDR A;  4FWD A;  5IT9 Q;  4M2Z A;  4LF9 E;  5A2Q Q;  4UT4 A;  4JI6 I;  2LUQ A;  1MX0 A;  4DPT A;  4MYT A;  4HY1 A;  2EFG A;  4OX9 E;  4JI0 I;  3PYG A;  1FJG I;  4USM A;  3J80 Q;  1MG7 A;  2ZIT A;  4LFA I;  4LF5 E;  2RS6 A;  4P7A A;  1N32 E;  5BR8 I;  3B78 A;  3QT6 A;  2NUG A;  3C4B A;  2R3V A;  4YY3 E;  1YZ9 A;  1X49 A;  2UXC E;  4LF8 E;  1Z5C A;  2JVA A;  1B63 A;  2UU9 I;  3P1X A;  2CPN A;  4LF4 E;  3T1H E;  4JI3 E;  1N0U A;  5GMD A;  4X66 E;  1Z0E A;  4ED4 A;  1IBM I;  4JI8 I;  4B3M I;  4X66 I;  1Z0G A;  1HR0 E;  1H73 A;  2LBS B;  3JAM Q;  2JY9 A;  2ZM6 E;  3LLH A;  5FLX C;  4AQY I;  2UXB E;  4PU9 A;  4URL A;  3PYD A;  2L3J A;  1ZM2 A;  3ZKB A;  2WW4 A;  1KIJ A;  4WUD A;  4HYM A;  1T4N A;  1PVG A;  3GON A;  4JI4 I;  4GKJ E;  2UXB I;  4LFA E;  5BR8 E;  2VQF I;  2B7V A;  1YYK A;  1ZBT A;  2VQF E;  1Z0W A;  4NXM I;  2HKJ A;  3ADG A;  3M6A A;  4DV2 E;  3JAM C;  2VQE E;  5LMN I;  4DPU A;  2UUB E;  3PYF A;  1O0W A;  1T4L B;  3T1Y E;  4WUC A;  4JI1 I;  2DEI A;  4FWG A;  1Z59 A;  4NXN I;  3T1Y I;  1VIS A;  3LNU A;  4KHP I;  4FWH A;  2LTS A;  2E1R A;  1U2R A;  5CFF E;  3PYE A;  4X64 I;  4JI2 I;  4Z7Y A;  2RS7 A;  1ZM3 A;  4AQY E;  1EKZ A;  4LF9 I;  1UIL A;  1N32 I;  4JI7 E;  1OJ4 A;  4Z7C A;  1XNQ I;  4DV1 I;  4LF7 I;  2Q2E B;  3ADL A;  4DR2 I;  4DR4 E;  2HK2 A;  4DR5 E;  1NHI A;  1XMQ I;  1KVK A;  2N3H A;  1T4O A;  1GQE A;  2V34 A;  3B8H A;  2L2K B;  4DUZ E;  1X47 A;  4X65 E;  1ZXN A;  1ZXM A;  1Z0T A;  2LJH A;  2AJ4 A;  1KTV A;  4HAC B;  1STU A;  4LF6 I;  1N33 I;  4LFC E;  4JG4 A;  2HHH E;  3OTO I;  1N33 E;  1J5E E;  3D4J A;  1BKN A;  2HFU A;  4NXN E;  4PRX A;  3VYX A;  4DV4 I;  2A2D A;  4WUB A;  4LF8 I;  1NZ0 A;  1Z5B A;  2UUA I;  4DR6 E;  4DU8 A;  2UXD I;  4DV1 E;  3J7A M;  3ADJ A;  1X48 A;  4X64 E;  4JI2 E;  4FW9 A;  4I3H A;  4K0K I;  4DR1 E;  4LF5 I;  4B3S E;  1FJG E;  2XEX A;  3ZZT A;  1NHH A;  4MYU A;  4DUY I;  2HKE A;  2R42 A;  3C4T A;  4JI1 E;  2N3G A;  3HUL A;  4DKK A;  2GS8 A;  1RR9 A; 
#chains in the Genus database with same CATH topology
 3EPH A;  4LCF A;  5DNL A;  4LPF A;  4LF4 I;  4DUZ I;  2PNZ A;  4MLQ A;  4WSG A;  5LMU I;  5AE2 A;  4LFB I;  3GCM A;  3P3E A;  4P7D A;  3HTX A;  2LUP B;  3H09 A;  2E72 A;  1N36 E;  5GME A;  2EM4 A;  1IBL I;  5IXM B;  1ZM4 A;  4OOG C;  2ELY A;  2M7Q A;  1S4E A;  4LF6 E;  4B3M E;  3KZZ A;  3CWV A;  4IFD F;  4DV0 I;  2NN6 A;  2BV3 A;  4GKK E;  1Z0B A;  4FN5 A;  1TF3 A;  2HGH A;  2NN6 E;  1UHZ A;  3T1H I;  1WXR A;  1Z0C A;  3LML A;  1DQ3 A;  4GEQ B;  3VYY A;  4BA1 B;  3WU5 A;  2LCE A;  2KHX A;  4BMJ A;  5C0X D;  5IWA E;  4DR7 I;  2BB8 A;  4MLV A;  2GQ0 A;  2MC6 A;  3QT5 A;  2ELZ A;  2EM5 A;  1KYQ A;  3AUZ A;  2J65 A;  2O1V A;  4IFD C;  4IFD B;  1N34 E;  2L2N A;  1UDS A;  2KOU A;  4JI4 E;  2HFS A;  1G2F C;  2EMH A;  3MHS C;  2DIX A;  1PKP A;  2L6M A;  2GO3 A;  3ZZ0 A;  1WHN A;  2HK3 A;  3HQ1 A;  4WYQ B;  1RQ0 A;  4L5N C;  2EOQ A;  4P52 A;  1D6T A;  3ZM7 A;  2CZ9 A;  2EOR A;  2VF3 A;  2X36 A;  1FNM A;  4N4R B;  4MU3 A;  2F4V I;  1PIE A;  5DRQ A;  2N8X A;  2WZO A;  3JTZ A;  5AAS A;  1BB8 A;  2BM0 A;  1HNX I;  4DU7 A;  2V89 A;  4HTG A;  1IBK E;  3WU6 A;  5AC5 A;  5KL5 A;  4DV3 E;  2WNR A;  3V2U C;  3OTO E;  2C38 B;  4ZYG A;  1H72 C;  2EL6 A;  5LMN E;  4DV2 I;  4DR4 I;  2NAB A;  3WU3 A;  5A2Q C;  3K17 A;  4FK5 C;  2FTX B;  2F4V E;  5DRO A;  5FLX Q;  4X62 E;  1XMO I;  5LL6 R;  2EMB A;  1QU6 A;  1A1G A;  1AAY A;  4LFB E;  1FI4 A;  4LFC I;  4AID A;  5JEA D;  4P78 A;  3PS1 A;  1FWK A;  2E5L E;  1FWL A;  2BR2 B;  5KL2 A;  3WU4 A;  3J80 C;  3J7A G;  2UUB I;  2JR1 A;  1T38 A;  2A2C A;  1YPN A;  4DMI A;  4LCG A;  1H7U A;  2E5L I;  1EH6 A;  3CDI A;  2HJJ A;  2BA1 D;  3K1J A;  4DV5 E;  2RPC A;  2GLI A;  1EH8 A;  4RPF A;  4X62 I;  1A6F A;  2C39 B;  3M85 G;  1A1J A;  5DRR A;  2ZM6 I;  3K85 A;  3KWR A;  2JEB A;  4B3T I;  4LTY A;  4DR6 I;  4DPW A;  2JOX A;  2UXD E;  5IT9 C;  2R76 A;  3F0N A;  4IZK A;  1HR0 I;  2FGG A;  2JT2 A;  2UUC I;  2WP8 A;  4HEI A;  3QT8 A;  1PJT A;  2GPI A;  3V5R A;  1NEI A;  4UTG A;  2CGE A;  2EOZ A;  4DR5 I;  3L7Z A;  4FW4 A;  4DV7 I;  4DR2 E;  4MU0 A;  2O1U A;  1A1F A;  1XNQ E;  4LOM A;  2EMC A;  4IZJ B;  3P76 A;  5K36 D;  2BR2 A;  2M9A A;  3B82 A;  5LMU E;  2EZ6 A;  5K36 E;  2LRS A;  2BA1 G;  2X7I A;  3BF2 A;  5C0X A;  2NUF A;  1RRE A;  2K4V A;  2EN3 A;  3BGH A;  2V2Z A;  2GHF A;  2DLQ A;  2L33 A;  3IWB A;  2LO3 A;  4BCA A;  3M85 D;  4DR3 I;  2L3C A;  2EPR A;  2EOY A;  2DMI A;  2HHH I;  2EN2 A;  4DR1 I;  2MKN A;  1HK7 A;  4R1F A;  4GKK I;  4DR3 E;  1L4S A;  2F1D A;  2A25 A;  2E1M A;  2EMI A;  2EJ4 A;  3VHT B;  1S16 A;  4OKG A;  5TSE A;  4X9J A;  1IBL E;  3ZOQ B;  4Q28 A;  1B62 A;  4IZJ A;  5KL3 A;  2YTJ A;  2L8T A;  2PRT A;  3BBG A;  3ZZU A;  2WBS A;  2EP3 A;  4WFT A;  3J81 Q;  2EN6 A;  2YU8 A;  2AE8 A;  2EMA A;  3U1Y A;  4JI3 I;  1HNZ E;  2IHR 1;  2B7T A;  2RQL A;  1HNZ I;  4RHB B;  4ZYE A;  4OO1 D;  4O24 A;  1F2I G;  4B3R E;  4FW6 A;  4M30 A;  2V85 A;  2UUC E;  5KL6 A;  2LTR A;  2EMW A;  1I94 E;  2JE6 B;  4BS9 A;  1OYR A;  3EQ1 A;  2YWQ A;  4J3D A;  1Y4S A;  2RSM A;  2UUA E;  2LT7 A;  5L3J A;  1PDA A;  2I9I A;  4B3T E;  2C39 A;  1IMU A;  4R2A A;  5DNY A;  1SFE A;  3H4L A;  4YHH E;  2EPK X;  2VES A;  4JI0 E;  2O3Z A;  4OX9 I;  3ADI A;  1FKA E;  3M99 B;  1AH5 A;  4X8W A;  1RC7 A;  3J81 C;  3ECR A;  3FIG A;  1HNW E;  1WUU A;  4M1K A;  1KKH A;  4B3S I;  4R2S A;  1XMO E;  1HNW I;  1ELO A;  3QT7 A;  2EOI A;  2NA2 A;  2WBU A;  2YTN A;  4DPX A;  4DV7 E;  2VRD A;  3J7Y p;  1YUI A;  3DD6 A;  3P06 A;  4K0K E;  4BHB A;  1Z0V A;  2WBT A;  1UDO A;  2ODR D;  1YUJ A;  3DJW A;  1XNR E;  2NUE A;  1MU5 A;  1USV A;  2EOX A;  3GME A;  4X65 I;  2YT4 A;  2JYA A;  4JYA E;  2IOP A;  4R2R A;  2BM1 A;  2V2V A;  1P42 A;  1J26 A;  2CG9 A;  5A6J A;  5A6K A;  4XTJ A;  2IES A;  2EQ3 A;  1N36 I;  4IZK B;  4DV3 I;  2YRK A;  4F6M A;  4Q35 B;  2V8P A;  2WCC 3;  5AE1 A;  4MQY A;  3IWD A;  4R2C A;  4B3R I;  2EOH A;  1EI1 A;  1WRJ A;  2EPM X;  2IOQ A;  4O43 A;  4TUG A;  4JYA I;  3NZK A;  5IWA I;  1PJQ A;  4NHR A;  4IFD A;  2V86 A;  4JV5 E;  1IQO A;  1SR9 A;  1K47 A;  3THN A;  4DV4 E;  1UDQ A;  4JV5 I;  3RMP A;  4DV0 E;  2YSP A;  4WX9 A;  2G7H A;  3LPS A;  2EPC A;  1ZM9 A;  4IJD A;  4RH8 A;  1A1H A;  2EM0 A;  2V2Q A;  4DV5 I;  4ZYH A;  4GZN C;  2EPL X;  2YU5 A;  4JI8 E;  2RTX A;  2L2M A;  1DI2 A;  1EA6 A;  1OYS A;  5ADZ A;  1H74 A;  4F2J C;  1XMQ E;  3P3C A;  2EOE A;  4ZYD A;  2VE7 C;  4M0V A;  4YHH I;  2PNZ B;  1WHQ A;  2LE2 A;  4NXM E;  4DXL A;  2DEJ A;  1IBK I;  2J7K A;  2ZBK B;  4KQV A;  4F9B B;  4PRV A;  4JI7 I;  3Q1Q A;  4R2Q A;  2OI2 A;  1HNX E;  1Z5A A;  1JK2 A;  3M7N G;  2DB2 A;  2EMK A;  2VQE I;  1ZAA C;  5AC4 A;  4R2E A;  1R6L A;  1YYO A;  4DPY A;  4DUY E;  1XNR I;  2HC5 A;  1DAR A;  4YY3 I;  2EWL A;  1UEK A;  4ISA A;  2BBG A;  2UU9 E;  1XHK A;  4N3O A;  4GKJ I;  4NZV A;  4HAC A;  2B9D A;  4F9C B;  1H7S A;  4I8O A;  5LLQ A;  4EMD A;  5FWK A;  5JEA E;  4JI5 E;  2UXC I;  4OO1 A;  2DMY A;  1N0V C;  2ENH A;  1TN9 A;  2B3T B;  2EOS A;  2YTG A;  2NPF A;  4JI5 I;  4BC7 A;  2CSH A;  2J7J A;  2EML A;  3EPL A;  2JEA A;  4M9V C;  2VF1 A;  1J5E I;  2ADR A;  1I94 I;  3LTO A;  1YYW A;  1N34 I;  2EM8 A;  3ZKD A;  2EOF A;  1IBM E;  2EPN A;  3L7Z B;  4USK A;  4DR7 E;  4KHP E;  1WJP A;  1Z1B A;  4ZVI A;  4DV6 I;  2DLK A;  2LJP A;  4LF7 E;  1R6M A;  2NN6 B;  2NN6 C;  2WP8 B;  1NHJ A;  4HXZ A;  4JI6 E;  4DV6 E;  1QZR A;  2MDR A;  3M7N D;  1Y60 A;  4FWD A;  5IT9 Q;  4M2Z A;  4LF9 E;  5A2Q Q;  4UT4 A;  4JI6 I;  2JEA B;  1XXE A;  3OML A;  1NCS A;  1X3C A;  2LUQ A;  4L8N A;  1E3H A;  1MX0 A;  4MDT A;  4DPT A;  4MYT A;  3C6M A;  4HY1 A;  2EFG A;  4OX9 E;  4JI0 I;  4BC9 A;  3HJC A;  3PYG A;  4KWY A;  4JI2 I;  4KZS A;  1X5W A;  2Z5C A;  4USM A;  4OO1 F;  3J80 Q;  1FJG I;  3GLL A;  5C0X E;  1MG7 A;  2ZIT A;  4LFA I;  5T6J A;  3AV0 A;  1JK1 A;  1MEY C;  2RS6 A;  4LF5 E;  4P7A A;  1USU A;  1VI7 A;  1N32 E;  5BR8 I;  3B78 A;  2Z5B B;  3QT6 A;  4U3D A;  2EQ0 A;  1ZR9 A;  1Y6Z A;  4LU9 A;  2NUG A;  3C4B A;  4R8O A;  2O1W A;  2R3V A;  3HPZ A;  4YY3 E;  2BA0 D;  1RHY A;  1YZ9 A;  1GZ6 A;  3F6G A;  1X49 A;  1A1L A;  5EL9 A;  2PO2 B;  2D9H A;  2EN4 A;  2UXC E;  4LF8 E;  1Z5C A;  2JVA A;  3TQM A;  1B63 A;  2UU9 I;  5A69 A;  4BA2 B;  3P1X A;  2CPN A;  5KL4 A;  3T1H E;  4LF4 E;  1BBG A;  2H36 X;  4JI3 E;  4U3B A;  3EPK A;  1E3P A;  4R2D A;  4X66 E;  1N0U A;  2V88 A;  5GMD A;  1P47 A;  4F9A B;  2NN6 D;  4F6N A;  1Z0E A;  5EKW A;  4ED4 A;  4JI8 I;  1IBM I;  4B3M I;  4X66 I;  2JOB A;  4O5G A;  1Z0G A;  2Z5E A;  1HR0 E;  2YTE A;  3K6Q A;  2EM3 A;  2R1F A;  4MU1 A;  2EM7 A;  1H73 A;  2JP9 A;  2LBS B;  2EL5 A;  3C6K A;  1G2D C;  4GQU A;  3JAM Q;  2EPX A;  2JY9 A;  2JE6 A;  2ZM6 E;  3LLH A;  2EPO A;  5FLX C;  4AQY I;  2ENA A;  4F54 A;  3EPJ A;  1DGC A;  2UXB E;  4PU9 A;  4URL A;  1X6H A;  3PYD A;  2YRH A;  2L3J A;  1ZM2 A;  1GTK A;  3ZKB A;  2WW4 A;  2IER A;  1KIJ A;  1UDN A;  4WUD A;  3P3G A;  3KZY A;  1T4N A;  1PVG A;  4HYM A;  3GON A;  2EPP A;  4FW7 A;  2MC5 A;  4NBQ A;  4JI4 I;  2V8Q B;  2CT1 A;  2RSI A;  4GKJ E;  2UXB I;  3DF6 A;  4LFA E;  2EMX A;  2EN8 A;  2O1T A;  2LMZ A;  5BR8 E;  4O4K A;  2EOM A;  2VQF I;  2B7V A;  1YYK A;  1UN6 B;  4TUI A;  2PO2 A;  1ZBT A;  2VQF E;  2Q8U A;  2JPA A;  4WSP A;  1Z0W A;  2WNR B;  4NXM I;  5A6B A;  2HKJ A;  3ADG A;  3M6A A;  4DV2 E;  3JAM C;  1T39 A;  3U1K A;  4WXC A;  2YTO A;  2EMF A;  1N3G A;  2VQE E;  5ELW A;  5LMN I;  2ODR C;  4AM3 A;  4DPU A;  2Z5C B;  1Y4U A;  4WPY A;  3MSW A;  2UUB E;  2YTP A;  5AE3 A;  3PYF A;  1O0W A;  2ENC A;  1T4L B;  3T1Y E;  4WUC A;  4JI1 I;  2DEI A;  4FWG A;  2M1S A;  2EM6 A;  1X6E A;  1OYP A;  1RMD A;  1Z59 A;  4R03 A;  4FW3 A;  4J8Z A;  5DRP A;  1VIS A;  2M4I A;  4NXN I;  3T1Y I;  1EH7 A;  3HPS A;  2LJU A;  3LNU A;  4KHP I;  2EE8 A;  2YZT A;  4FWH A;  2LVH A;  3CDJ A;  3HKM A;  1B69 A;  2JEB B;  1A1I A;  2LTS A;  1YHC A;  5A6B D;  2JWO A;  5A6A A;  4IFD E;  1PJS A;  3F6H A;  2E1R A;  2F8B A;  2K7I A;  5CFF E;  1U2R A;  3H1C A;  5K36 F;  4OZE A;  1IQS A;  2GO4 A;  3PYE A;  4X64 I;  3HXL A;  2EL4 A;  1QNT A;  4Z7Y A;  2RS7 A;  2EQ1 A;  4AQY E;  1ZM3 A;  2I13 A;  2YTQ A;  4BA1 A;  1EKZ A;  2YPN A;  2FV4 B;  1UIL A;  4LF9 I;  2EOJ A;  4JI7 E;  1KJK A;  1OJ4 A;  1N32 I;  4AIM A;  4Z7C A;  2PO0 A;  2PO1 B;  3THO B;  1XNQ I;  4BA2 A;  3BID A;  2KON A;  4DV1 I;  2EPA A;  4LF7 I;  1X6F A;  2EOO A;  1TF6 A;  3ADL A;  2Q2E B;  4DR2 I;  2YTF A;  4DR4 E;  2HK2 A;  4FW5 A;  4DR5 E;  1NHI A;  4OO1 B;  4OO1 C;  1XMQ I;  1KVK A;  4IFD D;  2PNM A;  4BHC A;  1YFH A;  2N3H A;  1T4O A;  3IWC A;  4OO1 E;  1GQE A;  2V34 A;  5C0X B;  5C0X C;  3B8H A;  5JEA A;  2L2K B;  5C0X F;  2EPU A;  4DUZ E;  3UK3 C;  2JXP A;  3MHH C;  1X47 A;  3B4T A;  3Q6M A;  4X65 E;  3VK6 A;  1ZU1 A;  2EMZ A;  2EMG A;  1MGT A;  1ZXN A;  1ZXM A;  1Z0T A;  2LJH A;  2AJ4 A;  1KTV A;  4HAC B;  4MU4 A;  5K36 A;  2MDG A;  2DGC A;  4WXD A;  2EN7 A;  1STU A;  4LF6 I;  5IV8 B;  1N33 I;  4LFC E;  4JG4 A;  2HHH E;  1LLM C;  3OTO I;  1N33 E;  1J5E E;  4IS9 A;  3D4J A;  2CVE A;  1BKN A;  5DNX A;  2HFU A;  4NXN E;  4PRX A;  3VYX A;  4DV4 I;  2V87 A;  2A2D A;  4WUB A;  2EM9 A;  4LF8 I;  1NZ0 A;  1Z5B A;  2UUA I;  2DRP A;  4DR6 E;  1YH8 A;  4DU8 A;  1A1K A;  1BBO A;  5JEA F;  2PO0 B;  2PO1 A;  2YRM A;  2UXD I;  3L00 A;  2LV2 A;  2MKD A;  4DV1 E;  3J7A M;  2EM2 A;  3QG5 C;  1YSA C;  3ADJ A;  1UBD C;  4IS1 C;  1X48 A;  2BA0 G;  3JU0 A;  4X64 E;  4JI2 E;  2NN6 F;  4QNJ A;  3KRN A;  3PRY A;  2CTD A;  3PS3 A;  4FW9 A;  4R2P A;  4I3H A;  4K0K I;  2EMY A;  2EN1 A;  2YTI A;  4DR1 E;  3PS2 A;  4LCH A;  4B3S E;  2C38 A;  4BBY A;  2L92 A;  5F3W A;  3Q6N A;  2DSY A;  1FJG E;  4LF5 I;  2C37 A;  2XEX A;  2Z5B A;  4QNK A;  3ZZT A;  1NHH A;  2EPZ A;  2C37 B;  1ZBQ A;  2V83 A;  4MYU A;  4DUY I;  4IZJ D;  5KL7 A;  5K36 C;  2HKE A;  2R42 A;  5K36 B;  3C4T A;  2YTD A;  3UHM A;  2PNL A;  4JI1 E;  2N3G A;  3HUL A;  5JEA C;  5JEA B;  4DKK A;  2GS8 A;  1Y5Y A;  1RR9 A;  2YSO A; 
#chains in the Genus database with same CATH homology
 4LF4 I;  4DUZ I;  5LMU I;  5AE2 A;  4LFB I;  4P7D A;  3HTX A;  2LUP B;  3H09 A;  1N36 E;  5GME A;  1IBL I;  1ZM4 A;  4OOG C;  2M7Q A;  1S4E A;  4LF6 E;  4B3M E;  3CWV A;  4DV0 I;  2BV3 A;  4GKK E;  1Z0B A;  4FN5 A;  1UHZ A;  3T1H I;  1WXR A;  1Z0C A;  3LML A;  1DQ3 A;  4GEQ B;  3VYY A;  3WU5 A;  2KHX A;  4BMJ A;  4DR7 I;  5IWA E;  2GQ0 A;  2MC6 A;  3QT5 A;  2O1V A;  3AUZ A;  1N34 E;  2L2N A;  2KOU A;  4JI4 E;  2HFS A;  2DIX A;  1PKP A;  2L6M A;  3ZZ0 A;  1WHN A;  2HK3 A;  3HQ1 A;  4WYQ B;  1RQ0 A;  4L5N C;  4P52 A;  1D6T A;  3ZM7 A;  2CZ9 A;  2VF3 A;  2X36 A;  1FNM A;  2F4V I;  1PIE A;  3JTZ A;  2WZO A;  5AAS A;  1HNX I;  2BM0 A;  4DU7 A;  2V89 A;  1IBK E;  3WU6 A;  4DV3 E;  3V2U C;  3OTO E;  1H72 C;  5LMN E;  4DV2 I;  4DR4 I;  3WU3 A;  5A2Q C;  3K17 A;  2FTX B;  2F4V E;  5FLX Q;  4X62 E;  1XMO I;  5LL6 R;  1FI4 A;  1QU6 A;  4LFB E;  4LFC I;  4P78 A;  1FWK A;  2E5L E;  1FWL A;  3WU4 A;  3J80 C;  3J7A G;  2UUB I;  2JR1 A;  2A2C A;  2E5L I;  4DMI A;  1H7U A;  3K1J A;  4DV5 E;  4RPF A;  4X62 I;  1A6F A;  2ZM6 I;  3K85 A;  3KWR A;  4B3T I;  4LTY A;  4DR6 I;  4DPW A;  2JOX A;  2UXD E;  5IT9 C;  3F0N A;  4IZK A;  1HR0 I;  2FGG A;  2UUC I;  3QT8 A;  3V5R A;  4UTG A;  2CGE A;  4DR5 I;  4DV7 I;  4DR2 E;  2O1U A;  1XNQ E;  4IZJ B;  3B82 A;  5LMU E;  2EZ6 A;  2LRS A;  2X7I A;  2NUF A;  1RRE A;  2K4V A;  2V2Z A;  2L33 A;  3IWB A;  4BCA A;  4DR3 I;  2L3C A;  2HHH I;  4DR1 I;  1HK7 A;  4R1F A;  4GKK I;  4DR3 E;  2E1M A;  1S16 A;  1IBL E;  3ZOQ B;  4Q28 A;  1B62 A;  4IZJ A;  2L8T A;  3ZZU A;  4WFT A;  3J81 Q;  4JI3 I;  1HNZ E;  2IHR 1;  2B7T A;  1HNZ I;  4B3R E;  4M30 A;  2V85 A;  2UUC E;  2LTR A;  1I94 E;  4BS9 A;  1Y4S A;  2RSM A;  2UUA E;  5L3J A;  4B3T E;  3H4L A;  5DNY A;  4YHH E;  4JI0 E;  4OX9 I;  3ADI A;  1WUU A;  1FKA E;  1RC7 A;  4X8W A;  1HNW E;  3J81 C;  3FIG A;  4M1K A;  4B3S I;  1KKH A;  1XMO E;  1HNW I;  1ELO A;  3QT7 A;  2NA2 A;  4DPX A;  4DV7 E;  3J7Y p;  3P06 A;  4K0K E;  1Z0V A;  2ODR D;  3DJW A;  1XNR E;  2NUE A;  1MU5 A;  1USV A;  4X65 I;  2YT4 A;  4JYA E;  2IOP A;  2BM1 A;  2V2V A;  1J26 A;  2CG9 A;  4XTJ A;  1N36 I;  4IZK B;  4DV3 I;  2V8P A;  5AE1 A;  3IWD A;  4B3R I;  1EI1 A;  2IOQ A;  4TUG A;  4JYA I;  5IWA I;  2V86 A;  4JV5 E;  1K47 A;  1SR9 A;  4DV4 E;  4JV5 I;  3RMP A;  4DV0 E;  2G7H A;  3LPS A;  1ZM9 A;  2V2Q A;  4DV5 I;  1EA6 A;  4JI8 E;  2RTX A;  2L2M A;  1DI2 A;  5ADZ A;  1H74 A;  1XMQ E;  2VE7 C;  4M0V A;  4YHH I;  1WHQ A;  2LE2 A;  4NXM E;  4DXL A;  2DEJ A;  1IBK I;  2J7K A;  2ZBK B;  4KQV A;  4F9B B;  4PRV A;  4JI7 I;  3Q1Q A;  2OI2 A;  1HNX E;  1Z5A A;  2DB2 A;  2VQE I;  1YYO A;  4DPY A;  4DUY E;  1XNR I;  1DAR A;  4YY3 I;  1UEK A;  2EWL A;  2UU9 E;  1XHK A;  4N3O A;  4GKJ I;  4HAC A;  2B9D A;  4F9C B;  1H7S A;  4I8O A;  4EMD A;  5FWK A;  2UXC I;  4JI5 E;  2DMY A;  1N0V C;  2B3T B;  2NPF A;  4JI5 I;  4BC7 A;  2VF1 A;  1J5E I;  1I94 I;  3LTO A;  1YYW A;  1N34 I;  3ZKD A;  1IBM E;  4USK A;  4DR7 E;  4KHP E;  4DV6 I;  4ZVI A;  2LJP A;  4LF7 E;  4HXZ A;  1NHJ A;  4JI6 E;  4DV6 E;  1QZR A;  2MDR A;  4FWD A;  5IT9 Q;  4M2Z A;  4LF9 E;  5A2Q Q;  4UT4 A;  4JI6 I;  3OML A;  2LUQ A;  4L8N A;  1MX0 A;  4DPT A;  4MYT A;  4HY1 A;  2EFG A;  4OX9 E;  4JI0 I;  4BC9 A;  3HJC A;  3PYG A;  1FJG I;  4KZS A;  4USM A;  2Z5C A;  3J80 Q;  1MG7 A;  2ZIT A;  4LFA I;  5T6J A;  3AV0 A;  4LF5 E;  2RS6 A;  4P7A A;  1USU A;  1N32 E;  5BR8 I;  3B78 A;  2Z5B B;  3QT6 A;  1Y6Z A;  4LU9 A;  2NUG A;  3C4B A;  4R8O A;  2O1W A;  2R3V A;  3HPZ A;  4YY3 E;  1YZ9 A;  1GZ6 A;  3F6G A;  1X49 A;  2UXC E;  4LF8 E;  1Z5C A;  2JVA A;  1B63 A;  2UU9 I;  3P1X A;  2CPN A;  4LF4 E;  3T1H E;  2H36 X;  4JI3 E;  1N0U A;  5GMD A;  4X66 E;  2V88 A;  4F9A B;  1Z0E A;  4ED4 A;  1IBM I;  4JI8 I;  4B3M I;  4X66 I;  2JOB A;  1Z0G A;  2Z5E A;  1HR0 E;  3K6Q A;  1H73 A;  2LBS B;  3JAM Q;  2JY9 A;  2ZM6 E;  3LLH A;  5FLX C;  4AQY I;  4F54 A;  2UXB E;  4PU9 A;  4URL A;  3PYD A;  2L3J A;  1ZM2 A;  3ZKB A;  2WW4 A;  1KIJ A;  4WUD A;  4HYM A;  1T4N A;  1PVG A;  3GON A;  2MC5 A;  4JI4 I;  2V8Q B;  4GKJ E;  2UXB I;  3DF6 A;  4LFA E;  2O1T A;  2LMZ A;  5BR8 E;  2VQF I;  2B7V A;  1YYK A;  4TUI A;  1ZBT A;  2VQF E;  1Z0W A;  4WSP A;  4NXM I;  2HKJ A;  3ADG A;  3M6A A;  4DV2 E;  3JAM C;  2VQE E;  5LMN I;  2ODR C;  4DPU A;  2Z5C B;  1Y4U A;  4WPY A;  3MSW A;  2UUB E;  5AE3 A;  3PYF A;  1O0W A;  1T4L B;  3T1Y E;  4WUC A;  4JI1 I;  2DEI A;  4FWG A;  2M1S A;  1Z59 A;  4R03 A;  4NXN I;  4J8Z A;  3T1Y I;  1VIS A;  2M4I A;  3HPS A;  3LNU A;  4KHP I;  2YZT A;  4FWH A;  2LTS A;  2JWO A;  3F6H A;  2E1R A;  2F8B A;  1U2R A;  5CFF E;  3PYE A;  4X64 I;  4JI2 I;  3HXL A;  4Z7Y A;  2RS7 A;  1ZM3 A;  4AQY E;  1EKZ A;  2FV4 B;  1UIL A;  4LF9 I;  4JI7 E;  1N32 I;  1OJ4 A;  4Z7C A;  1XNQ I;  2KON A;  4DV1 I;  4LF7 I;  2Q2E B;  3ADL A;  4DR2 I;  4DR4 E;  2HK2 A;  4DR5 E;  1NHI A;  1XMQ I;  1KVK A;  2PNM A;  2N3H A;  1T4O A;  3IWC A;  1GQE A;  2V34 A;  3B8H A;  2L2K B;  4DUZ E;  3Q6M A;  1X47 A;  4X65 E;  3VK6 A;  1ZXN A;  1ZXM A;  1Z0T A;  2LJH A;  2AJ4 A;  1KTV A;  4HAC B;  1STU A;  4LF6 I;  1N33 I;  4LFC E;  4JG4 A;  2HHH E;  3OTO I;  1N33 E;  1J5E E;  3D4J A;  1BKN A;  2HFU A;  4NXN E;  4PRX A;  3VYX A;  4DV4 I;  2V87 A;  2A2D A;  4WUB A;  4LF8 I;  1NZ0 A;  1Z5B A;  2UUA I;  4DR6 E;  4DU8 A;  2UXD I;  4DV1 E;  3J7A M;  3ADJ A;  1X48 A;  3JU0 A;  4X64 E;  4JI2 E;  3PRY A;  4FW9 A;  4I3H A;  4K0K I;  4DR1 E;  4LF5 I;  4B3S E;  3Q6N A;  4BBY A;  2L92 A;  5F3W A;  2DSY A;  1FJG E;  2XEX A;  2Z5B A;  3ZZT A;  1NHH A;  1ZBQ A;  2V83 A;  4MYU A;  4DUY I;  4IZJ D;  2HKE A;  2R42 A;  3C4T A;  2PNL A;  4JI1 E;  2N3G A;  3HUL A;  4DKK A;  2GS8 A;  1RR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...