4JI5E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji5E02
1X47A 4LFCI 5L3JA 4LFAE 1RREA 3H4LA 2UXCI 1N34I 1IBMI 1YYWA 1Z5CA 2EFGA 4LF6I 4LFBE 4JI8E 2UU9E 4LF9E 2HFUA 4WUDA 2NUFA 3B82A 1B63A 1S4EA 4GKKE 3CWVA 4HY1A 3C4TA 4MYTA 2UUBI 1XNQI 4K0KI 4OX9I 4DV7I 2J7KA 4DV7E 4JG4A 4B3TE 1PIEA 4M30A 2LUPB 1ZBTA 4X66E 4RPFA 4DUYE 4Z7CA 1IBLI 4WUCA 4DR5E 1XMOI 1FKAE 2F4VE 2N3GA 2L2MA 1YYKA 1FWLA 4DU8A 1ZM4A 1YYOA 1WUUA 2UUCI 4FWGA 4X64I 4ZVIA 1N32I 4DR6E 1N32E 1QU6A 1Z59A 2V34A 4AQYE 3V2UC 1N36E 1H7UA 5LMUE 1B62A 4JI4E 4NXNE 2HKEA 5LMNE 1H7SA 3JAMC 1HR0E 2UXBE 4DV0E 1Z5AA 4B3RI 1FJGE 1N0VC 4DV6I 2HFSA 5IT9Q 4OOGC 5A2QQ 2NA2A 2X36A 2LUQA 4UT4A 1EI1A 4DPUA 2UXDE 1EA6A 4DPTA 2VF3A 4JI7I 3LPSA 5CFFE 3D4JA 4Z7YA 4JI1E 3C4BA 3OTOI 1YZ9A 3WU3A 3B8HA 3J7AM 4X65E 2HHHE 4DXLA 1XNRE 1J5EI 1Z0CA 3V5RA 4URLA 2IHR1 2LJHA 4WFTA 4NXME 4DR2E 4JI5I 4DV3I 1HNWI 4JI6I 3QT6A 3K17A 5BR8I 4JI3I 2NUGA 4PRXA 1PVGA 4DR7I 4DV1I 4JI0I 3T1YE 2E1RA 4JI0E 1T4OA 3J81C 3ADLA 4KHPE 4JI2E 4YY3E 4PRVA 1H72C 3J7AG 4LFAI 5IWAE 1ZM9A 2VQEE 4DR1E 2L2KB 2LJPA 3J7Yp 4LFBI 4JI8I 4I3HA 2UU9I 4LF9I 1MX0A 1OJ4A 4X8WA 1J26A 3ZZ0A 4GKKI 2MDRA 1EKZA 4DPYA 3P1XA 1UEKA 3T1HE 4JV5E 4FWHA 4M2ZA 1X48A 4B3TI 4JYAE 2E5LI 4HACB 1FWKA 1RC7A 1H74A 2E5LE 4X66I 2NUEA 2LTRA 4DUYI 3J81Q 2HK3A 4DR5I 2F4VI 2NPFA 4LF8E 4B3SE 2B7TA 1N33E 2V2ZA 5IT9C 3PYFA 2RS6A 4DPXA 4YHHE 5A2QC 3PYDA 1MG7A 4DV2E 3QT8A 4DR6I 4MYUA 1Z0EA 4DV5E 3PYEA 4AQYI 1N36I 5LMUI 3ZM7A 2CPNA 4JI4I 4NXNI 5LMNI 2BM1A 2X7IA 1T4NA 1HR0I 4HXZA 2UXBI 4DV0I 2A2DA 1X49A 2CZ9A 3VYXA 1FJGI 1KTVA 1VISA 1XMQE 4DUZE 1NHHA 2AJ4A 2R3VA 2RSMA 2VQFE 2ZM6E 2UXDI 1ZM2A 4JI1I 4M1KA 4X65I 3B78A 2HHHI 2L2NA 2OI2A 3M6AA 1XNRI 4LF4E 4LF7E 4X62E 2B7VA 4DR4E 2EZ6A 1QZRA 2JVAA 4NXMI 4DR2I 1HNXE 3PYGA 1RQ0A 3WU5A 1IBKE 2L33A 1I94E 1ELOA 4FN5A 4EMDA 4DV4E 4WUBA 2UUAE 1S16A 2BM0A 2GS8A 4DR3E 3T1YI 1BKNA 1UHZA 1D6TA 4USKA 4JI2I 4YY3I 4KHPI 2ZITA 5IWAI 1HNZE 1DI2A 2HK2A 3LLHA 4DU7A 2VQEI 4DR1I 4USMA 4LF5E 4P7AA 1MU5A 1Z5BA 3J80Q 3QT5A 1FNMA 2LTSA 1Z0VA 1A6FA 4WYQB 5GMEA 3HTXA 1FI4A 1KKHA 4ED4A 4GKJE 3T1HI 3Q1QA 4JV5I 5FLXQ 2N3HA 4JYAI 3ZZUA 2V8PA 2A2CA 5GMDA 4LFCE 2LBSB 3HULA 2UXCE 4FW9A 1N34E 1IBME 1GQEA 1STUA 4LF6E 1U2RA 4LF8I 2DEIA 4B3SI 3ZKDA 1N33I 1ZXNA 2R42A 4FWDA 2BV3A 4YHHI 3ADGA 3VYYA 4K0KE 2UUBE 1ZXMA 1XNQE 3ADIA 4DV2I 4OX9E 2RTXA 3ZKBA 4DV5I 2DIXA 4B3MI 1IBLE 4B3ME 3LNUA 4DPWA 2XEXA 1XMOE 2DMYA 1T4LB 1N0UA 4DKKA 1K47A 2JY9A 1KIJA 2V2QA 1NZ0A 3K1JA 1XMQI 2UUCE 3GONA 4X64E 4DUZI 2DB2A 1NHJA 4UTGA 2VQFI 2ZM6I 1Z0WA 1ZM3A 3F0NA 2RS7A 2L3JA 3LTOA 4HYMA 2WW4A 4B3RE 4LF4I 2Q2EB 4LF7I 4X62I 4DV6E 1DARA 4DR4I 1Z0BA 1NHIA 3WU6A 1O0WA 1HNXI 3ADJA 3J80C 1RR9A 4JI7E 5LL6R 1IBKI 4R1FA 3OTOE 1WHNA 1PKPA 1H73A 2DEJA 4XTJA 3ZZTA 3JAMQ 1I94I 2YT4A 1Z0TA 4DV4I 1J5EE 4HACA 5FLXC 3QT7A 2UUAI 4DR3I 2LRSA 1UILA 2L3CA 4JI5E 4P52A 4DV3E 1HNWE 4JI6E 4KQVA 4PU9A 1HNZI 2V2VA 1XHKA 5BR8E 1WHQA 4JI3E 2ZBKB 4LF5I 1Z0GA 4DR7E 3WU4A 2KHXA 4DV1E 2HKJA 2B3TB 4GKJI 1KVKA
chains in the Genus database with same CATH superfamily
2UXCI 1X47A 4LFCI 5L3JA 4LFAE 4OKGA 1RREA 4M0VA 2V88A 3H4LA 2M7QA 1N34I 1IBMI 2EMFA 2EM7A 1A1IA 1QNTA 2GO3A 2EOYA 2EMCA 3H1CA 1YYWA 1Z5CA 2EFGA 4LF6I 1SFEA 2EOEA 2EOXA 2EOQA 3Q6NA 4LFBE 4JI8E 2EPZA 2UU9E 4LF9E 2BA0G 2HFUA 2K4VA 5T6JA 2EPKX 4WUDA 2NUFA 2LE2A 1VI7A 3B82A 3P3GA 1B63A 1S4EA 4GKKE 2EN3A 4BBYA 3CDIA 2EMBA 2JWOA 3CWVA 4HY1A 2EM3A 3C4TA 2V83A 3EPJA 4MYTA 2UUBI 1XNQI 1A1FA 2C37A 2PO0B 4OX9I 2PO1A 3U1YA 5JEAF 4DV7I 1Y5YA 2J7KA 4DV7E 4JG4A 4B3TE 5EKWA 5FWKA 2I9IA 1PIEA 4M30A 2EMKA 2LUPB 2EOSA 1ZBTA 3MHHC 4X66E 4MU0A 4MLQA 2WBSA 2BR2B 4RPFA 4DUYE 4Z7CA 1IBLI 4IFDD 4WUCA 4DR5E 1XMOI 3HPZA 1FKAE 2F4VE 2N3GA 2ENCA 2LV2A 4QNJA 1YH8A 2EMZA 2HC5A 2L2MA 2EM0A 2LO3A 4WSGA 1YYKA 1FWLA 1ZU1A 2O1WA 4DU8A 1A1KA 1ZM4A 4L8NA 3IWBA 2JPAA 1YYOA 3AV0A 1WUUA 2EN4A 2UUCI 4FWGA 2F1DA 2JT2A 1ZBQA 2WBTA 4BCAA 4X64I 4ZVIA 2EMIA 1SR9A 4DR6E 1Y4SA 1N32I 4WX9A 1QU6A 2EPMX 1N32E 1Z59A 2CVEA 3C6KA 4AQYE 1YPNA 1N36E 1H7UA 5LMUE 2V34A 1B62A 2F8BA 2C38B 1IQSA 2FGGA 4O43A 1GZ6A 4JI4E 4NXNE 4BHCA 2HKEA 5LMNE 2IOQA 1H7SA 3JAMC 1HR0E 2UXBE 4DV0E 2RQLA 2CG9A 2DLKA 4IJDA 2NN6A 4IFDF 1Z5AA 1OYPA 1P47A 4B3RI 5A6AA 2EMHA 4WXDA 1FJGE 3M85G 1N0VC 4DV6I 2HFSA 4MU3A 3GCMA 5IT9Q 4OOGC 5A2QQ 2NA2A 3MHSC 2X36A 2GO4A 2E72A 2LUQA 4UT4A 2C37B 2EPPA 1EI1A 2EORA 4DPUA 2PO1B 4ISAA 2YTOA 2UXDE 4KWYA 2V87A 1EA6A 4DPTA 5JEAE 4K0KI 2VF3A 4JI7I 2EPXA 2JOXA 5CFFE 1AAYA 3D4JA 3LPSA 4Z7YA 4JI1E 3C4BA 3P3EA 3OTOI 1YZ9A 3WU3A 3B8HA 2H36X 3J7AM 2EPAA 2EM4A 4X65E 1YUJA 2CT1A 2HHHE 4LCHA 2JEAA 4OO1D 5AC4A 2YSPA 4DXLA 4MLVA 4TUIA 2LMZA 1XNRE 3K85A 1J5EI 4IZKB 1A1LA 2PNLA 1Z0CA 3V5RA 1JK2A 2V85A 2G7HA 4BHBA 4URLA 1X3CA 2IHR1 2KOUA 2LJHA 1R6MA 2EWLA 4WFTA 2Z5CA 4NXME 5IV8B 4DR2E 4JI5I 4NZVA 4DV3I 1HNWI 4JI6I 5K36C 3PS1A 4O4KA 5A69A 3K17A 1F2IG 2ADRA 2CGEA 3QT6A 2EN8A 4WXCA 5BR8I 3HPSA 4JI3I 2NUGA 1YSAC 4IZJA 4PRXA 4N3OA 5K36E 2ELYA 3FIGA 1PVGA 2PNMA 4DR7I 4U3BA 2MKDA 4LCGA 5A6JA 2NN6B 2R76A 2WP8A 3KRNA 2JEBA 4DV1I 4JI0I 5KL6A 3T1YE 2E1RA 4FW7A 2C39A 4IFDE 4JI0E 3M7NG 4OO1F 1T4OA 2IESA 3J81C 3ADLA 5K36A 2DMIA 2PO2A 4KHPE 4JI2E 4YY3E 4FW4A 4PRVA 1H72C 3J7AG 4LFAI 1UDNA 5IWAE 1ZM9A 4OZEA 2R1FA 3HQ1A 2VQEE 4DR1E 2L2KB 2LJPA 4HEIA 3J7Yp 4LFBI 4R2PA 4QNKA 4JI8I 4I3HA 2UU9I 1MX0A 4LF9I 2O3ZA 3Q6MA 1OJ4A 4RHBB 4X8WA 1J26A 3ZZ0A 1HK7A 4U3DA 2BBGA 4GKKI 2MDRA 2YU5A 4ZYEA 1LLMC 1UDSA 1EKZA 2PNZB 1UN6B 5DRRA 4DPYA 2EN7A 2YRMA 2ENAA 3DF6A 3P1XA 2HGHA 1UEKA 2JEAB 3T1HE 4JV5E 4FWHA 3OMLA 4M2ZA 1X48A 4BMJA 4B3TI 4JYAE 3HJCA 4IZJD 2E5LI 4HACB 1FWKA 1RC7A 1YFHA 1H74A 2E5LE 1T38A 3H09A 4X66I 2NUEA 2LTRA 1RMDA 1UDQA 1YHCA 3HKMA 4DUYI 4Q35B 3J81Q 4DMIA 2HK3A 3P3CA 1OYSA 4DR5I 2F4VI 2CTDA 2BB8A 4F6MA 1A1HA 4LU9A 2DLQA 1P42A 2NPFA 4LF8E 2EN2A 4B3SE 2B7TA 1N33E 3BGHA 2V2ZA 4MU1A 3F6GA 3L7ZB 4IZJB 5IT9C 2BA0D 3PYFA 2RS6A 4DPXA 4YHHE 2YTNA 2EMWA 5A2QC 2YTQA 4F9CB 3QG5C 5A6BA 1MG7A 2E1MA 3PYDA 4AM3A 3K6QA 4DV2E 5C0XC 3QT8A 4HTGA 2WBUA 4DR6I 4MYUA 1AH5A 4BC9A 1Z0EA 3LMLA 4DV5E 2WP8B 3PYEA 2JEBB 5ELWA 4AQYI 5KL3A 3TQMA 1N36I 5LMUI 3ZM7A 1PJQA 2C39B 2CPNA 3BF2A 2RPCA 2LT7A 3NZKA 4JI4I 4NXNI 1T39A 2J7JA 2PO2B 5C0XE 2BM1A 5LMNI 2X7IA 2EE8A 2EOIA 1T4NA 1IMUA 3GLLA 2GHFA 3THNA 4HXZA 1HR0I 4FW6A 4DV0I 2UXBI 2A2DA 1X49A 2ODRD 3ECRA 5KL2A 2L92A 2CZ9A 2BA1G 4LCFA 5DNXA 3VYXA 1Y6ZA 5ADZA 1XXEA 1KTVA 2M9AA 1FJGI 5EL9A 1VISA 2JR1A 1XMQE 5C0XA 5JEAC 2A25A 1WJPA 2V86A 1KYQA 3ZOQB 4DUZE 1NHHA 2MC5A 1ZAAC 2AJ4A 4LTYA 1TF3A 2WZOA 2R3VA 2RSMA 3V2UC 2VQFE 2ZM6E 1USVA 2UXDI 3IWDA 2EPUA 2IOPA 3EPKA 2CSHA 4ZYDA 4LPFA 4R03A 1ZM2A 4O24A 4JI1I 5AC5A 3KZYA 3PS3A 4M1KA 2VESA 3BIDA 4R2QA 4X65I 4BA2A 2EM2A 1MGTA 2L2NA 2OI2A 3B4TA 3B78A 3M6AA 2HHHI 1WRJA 2Q8UA 2YTFA 1XNRI 4LF4E 5DROA 3EPLA 4LF7E 4X62E 4M9VC 2EQ3A 4IS1C 1USUA 2B7VA 4DR4E 5JEAA 2EZ6A 2NABA 1G2DC 2EMGA 2YRHA 1QZRA 2YTDA 2JVAA 1MEYC 1ZR9A 4DR2I 2EMXA 4NXMI 1E3PA 5AE2A 2Z5BA 1HNXE 2L8TA 3PYGA 2NN6D 2GQ0A 2GPIA 4F2JC 1RQ0A 5IXMB 1NEIA 3WU5A 1IBKE 1A1JA 2J65A 2L33A 3PS2A 2VE7C 2EMAA 3GMEA 4IFDC 3UK3C 1I94E 1E3HA 5KL4A 1ELOA 4FN5A 4EMDA 4DV4E 2Z5EA 1EH7A 2EL6A 2EMLA 1R6LA 3M7ND 4WUBA 2UUAE 1S16A 2BM0A 2GS8A 2JOBA 4DR3E 3T1YI 2ENHA 3BBGA 5DNLA 4BS9A 1BKNA 1UHZA 1D6TA 4R2EA 3JTZA 3KWRA 4USKA 4JI2I 4YY3I 3JU0A 4KHPI 2ZITA 2EM5A 4BA1A 5IWAI 1HNZE 4I8OA 4X9JA 1DI2A 4N4RB 2HK2A 4FW3A 3LLHA 4DU7A 2VQEI 4DR1I 4USMA 1JK1A 4LF5E 4P7AA 4BC7A 1BBGA 1MU5A 2O1VA 2K7IA 4IS9A 4TUGA 2EN1A 1Z5BA 3J80Q 1EH6A 4NHRA 1DQ3A 2EPLX 5F3WA 2PRTA 3QT5A 1FNMA 4IFDA 3C6MA 2LTSA 4R2CA 2NN6F 1Z0VA 1NCSA 3P06A 1A6FA 2ELZA 1UDOA 4WYQB 1G2FC 2M4IA 4R2AA 5GMEA 3HTXA 3KZZA 4BA2B 1FI4A 1RHYA 1KKHA 4ED4A 4GKJE 3T1HI 3Q1QA 4JV5I 5FLXQ 2N3HA 4R8OA 4JYAI 3ZZUA 2V8PA 1X6EA 1PDAA 2HJJA 4F54A 4F6NA 2A2CA 4LFCE 5GMDA 5JEAB 2LBSB 1TN9A 3HULA 2UXCE 4FW9A 1N34E 1IBME 1GQEA 3DJWA 2Z5CB 1STUA 3VHTB 5AASA 2VRDA 4LF6E 4MU4A 2YZTA 3EQ1A 2Z5BB 1U2RA 4LF8I 2DEIA 4B3SI 2EQ1A 3ZKDA 1ZXNA 2O1TA 1N33I 4LOMA 4WPYA 2R42A 4MQYA 2EOZA 2LVHA 2YRKA 2EMYA 4FWDA 2DSYA 2GLIA 2EL4A 2O1UA 5AE1A 2BV3A 4YHHI 5K36D 3ADGA 4GEQB 2YTGA 3EPHA 3VYYA 4K0KE 2UUBE 1ZXMA 1XNQE 3ADIA 4DV2I 4OX9E 2DGCA 4R2SA 2EM8A 2IERA 1IQOA 3IWCA 4OO1C 2RTXA 3ZKBA 4DV5I 1GTKA 2DIXA 2EL5A 3VK6A 3HXLA 4B3MI 1IBLE 4B3ME 3LNUA 4DPWA 4MDTA 5K36B 2XEXA 1XMOE 4OO1E 4BA1B 2MC6A 2DMYA 5DRQA 2RSIA 2EPRA 3P76A 2LJUA 2YPNA 1T4LB 4L5NC 1N0UA 2NN6C 4IZKA 4RH8A 4DKKA 1K47A 1BBOA 2JE6A 2YTEA 3M99B 4R2RA 2JY9A 1KIJA 2V8QB 2V2QA 1YUIA 1NZ0A 3K1JA 4IFDB 4WSPA 1XMQI 2UUCE 3GONA 4X64E 4OO1A 2NN6E 2DRPA 4FW5A 4DUZI 2DB2A 1NHJA 2YTJA 2EPNA 5K36F 2JP9A 2EM6A 4UTGA 2EP3A 3PRYA 2VQFI 3AUZA 3F6HA 2ZM6I 1Y60A 1Z0WA 1ZM3A 3F0NA 2YSOA 4J3DA 5KL7A 3UHMA 4F9AB 1WXRA 1X6HA 2RS7A 1A1GA 2D9HA 2EPCA 2L3JA 3LTOA 2V89A 4HYMA 5A6BD 2VF1A 2N8XA 2KONA 3THOB 1DGCA 2WW4A 4B3RE 4ZYGA 4LF4I 2WNRA 2Q2EB 4LF7I 4X62I 4DV6E 2EOJA 1Z1BA 4ZYHA 2BA1D 1DARA 4DR4I 2EOOA 1Z0BA 2YTPA 5KL5A 1NHIA 4AIMA 1Y4UA 2JXPA 5AE3A 2JYAA 3M85D 1BB8A 3WU6A 1O0WA 2EM9A 4NBQA 1HNXI 2YU8A 3MSWA 5A6KA 3ADJA 3J80C 4F9BB 1RR9A 4JI7E 5LL6R 1X5WA 1UBDC 4P78A 4J8ZA 1IBKI 4FK5C 1L4SA 2LCEA 1TF6A 4O5GA 4R1FA 3OTOE 1WHNA 1PKPA 2I13A 1H73A 2DEJA 2PNZA 4XTJA 5C0XD 3ZZTA 3JAMQ 1I94I 2YT4A 1PJSA 2MDGA 5LLQA 3RMPA 2PO0A 1Z0TA 4DV4I 1J5EE 4HACA 5FLXC 2FTXB 3QT7A 2M1SA 2UUAI 2JE6B 4DR3I 3CDJA 2EN6A 3L00A 2EOMA 2LRSA 2BR2A 1UILA 2FV4B 5TSEA 2L3CA 4JI5E 4P52A 4DV3E 1HNWE 4JI6E 1KJKA 4GQUA 4KQVA 5C0XB 4PU9A 5DRPA 3U1KA 1HNZI 2V2VA 4OO1B 2AE8A 1XHKA 5BR8E 3L7ZA 1WHQA 1N3GA 4JI3E 2ZBKB 1Z0GA 4KZSA 4LF5I 2B9DA 2EOHA 2L6MA 2EOFA 1X6FA 4DR7E 5JEAD 2YTIA 2EPOA 2MKNA 2EQ0A 4AIDA 4R2DA 3DD6A 2ODRC 5DNYA 3WU4A 2KHXA 2WCC3 4DV1E 2HKJA 2B3TB 1B69A 4GZNC 1EH8A 4P7DA 2C38A 5C0XF 4GKJI 2WNRB 2EJ4A 1PJTA 1OYRA 4Q28A 2YWQA 1KVKA
chains in the Genus database with same CATH topology
1X47A 4LFCI 5L3JA 4LFAE 1RREA 4M0VA 2V88A 3H4LA 2M7QA 1N34I 1IBMI 2UXCI 1YYWA 1Z5CA 2EFGA 4LF6I 3Q6NA 4LFBE 4JI8E 2UU9E 4LF9E 2HFUA 2K4VA 5T6JA 4WUDA 2NUFA 2LE2A 3B82A 1B63A 1S4EA 4GKKE 4BBYA 2JWOA 3CWVA 4HY1A 3C4TA 2V83A 4MYTA 2UUBI 1XNQI 4K0KI 4OX9I 4DV7I 2J7KA 4DV7E 4JG4A 4B3TE 5FWKA 1PIEA 4M30A 2LUPB 1ZBTA 4X66E 4RPFA 4DUYE 4Z7CA 1IBLI 4WUCA 4DR5E 1XMOI 3HPZA 1FKAE 2F4VE 2N3GA 2L2MA 1YYKA 1FWLA 2O1WA 4DU8A 1ZM4A 4L8NA 3IWBA 1YYOA 3AV0A 1WUUA 2UUCI 4FWGA 4X64I 1ZBQA 4BCAA 4ZVIA 1N32I 1SR9A 4DR6E 1Y4SA 1N32E 1QU6A 1Z59A 2V34A 4AQYE 3V2UC 1N36E 1H7UA 5LMUE 1B62A 2F8BA 2FGGA 1GZ6A 4JI4E 4NXNE 2HKEA 5LMNE 2IOQA 1H7SA 3JAMC 1HR0E 2UXBE 4DV0E 2CG9A 1Z5AA 4B3RI 1FJGE 1N0VC 4DV6I 2HFSA 5IT9Q 4OOGC 5A2QQ 2NA2A 2X36A 2LUQA 4UT4A 1EI1A 4DPUA 2UXDE 1EA6A 2V87A 4DPTA 2VF3A 4JI7I 2JOXA 5CFFE 3LPSA 3D4JA 4Z7YA 4JI1E 3C4BA 3OTOI 1YZ9A 3WU3A 3B8HA 2H36X 3J7AM 4X65E 2HHHE 4DXLA 4TUIA 2LMZA 1XNRE 3K85A 1J5EI 4IZKB 2PNLA 1Z0CA 3V5RA 2V85A 2G7HA 4URLA 2IHR1 2KOUA 2LJHA 2Z5CA 2EWLA 4WFTA 4NXME 4DR2E 4JI5I 4DV3I 1HNWI 4JI6I 3QT6A 3K17A 2CGEA 5BR8I 3HPSA 4JI3I 2NUGA 4IZJA 4PRXA 4N3OA 3FIGA 1PVGA 2PNMA 4DR7I 4DV1I 4JI0I 3T1YE 2E1RA 4JI0E 1T4OA 3J81C 3ADLA 4KHPE 4JI2E 4YY3E 4PRVA 1H72C 3J7AG 4LFAI 5IWAE 1ZM9A 3HQ1A 2VQEE 4DR1E 2L2KB 2LJPA 3J7Yp 4LFBI 4JI8I 4I3HA 2UU9I 4LF9I 1MX0A 3Q6MA 1OJ4A 4X8WA 1J26A 3ZZ0A 1HK7A 4GKKI 2MDRA 1EKZA 4DPYA 3DF6A 3P1XA 1UEKA 3T1HE 4JV5E 4FWHA 3OMLA 4M2ZA 1X48A 4BMJA 4B3TI 4JYAE 3HJCA 4IZJD 2E5LI 4HACB 1FWKA 1RC7A 1H74A 2E5LE 3H09A 4X66I 2NUEA 2LTRA 4DUYI 3J81Q 4DMIA 2HK3A 4DR5I 2F4VI 4LU9A 2NPFA 4LF8E 4B3SE 2B7TA 1N33E 2V2ZA 3F6GA 4IZJB 5IT9C 3PYFA 2RS6A 4DPXA 4YHHE 5A2QC 4F9CB 3PYDA 1MG7A 2E1MA 3K6QA 4DV2E 3QT8A 4DR6I 4MYUA 4BC9A 1Z0EA 3LMLA 4DV5E 3PYEA 4AQYI 1N36I 5LMUI 3ZM7A 2CPNA 4JI4I 4NXNI 5LMNI 2BM1A 2X7IA 1T4NA 1HR0I 4HXZA 2UXBI 4DV0I 2A2DA 1X49A 2ODRD 2L92A 2CZ9A 3VYXA 1Y6ZA 5ADZA 1FJGI 1KTVA 1VISA 2JR1A 1XMQE 2V86A 3ZOQB 4DUZE 1NHHA 2MC5A 2AJ4A 4LTYA 2WZOA 2R3VA 2RSMA 2VQFE 2ZM6E 1USVA 2UXDI 3IWDA 2IOPA 4R03A 1ZM2A 4JI1I 4M1KA 4X65I 3B78A 2HHHI 2L2NA 2OI2A 3M6AA 1XNRI 4LF4E 4LF7E 4X62E 1USUA 2B7VA 4DR4E 2EZ6A 1QZRA 2JVAA 4NXMI 4DR2I 5AE2A 2Z5BA 1HNXE 2L8TA 3PYGA 2GQ0A 1RQ0A 3WU5A 1IBKE 2L33A 2VE7C 1I94E 1ELOA 4FN5A 4EMDA 4DV4E 2Z5EA 4WUBA 2UUAE 1S16A 2BM0A 2GS8A 2JOBA 4DR3E 3T1YI 1BKNA 4BS9A 1UHZA 1D6TA 3JTZA 3KWRA 4USKA 4JI2I 4YY3I 3JU0A 4KHPI 2ZITA 5IWAI 1HNZE 4I8OA 1DI2A 2HK2A 3LLHA 4DU7A 2VQEI 4DR1I 4USMA 4LF5E 4P7AA 4BC7A 1MU5A 2O1VA 4TUGA 1Z5BA 3J80Q 1DQ3A 5F3WA 3QT5A 1FNMA 2LTSA 1Z0VA 3P06A 1A6FA 4WYQB 2M4IA 5GMEA 3HTXA 1FI4A 1KKHA 4ED4A 4GKJE 3T1HI 3Q1QA 4JV5I 5FLXQ 2N3HA 4R8OA 4JYAI 3ZZUA 2V8PA 4F54A 2A2CA 5GMDA 4LFCE 2LBSB 3HULA 2UXCE 4FW9A 1N34E 1IBME 1GQEA 3DJWA 2Z5CB 1STUA 5AASA 4LF6E 2YZTA 2Z5BB 1U2RA 4LF8I 2DEIA 4B3SI 3ZKDA 1N33I 1ZXNA 2O1TA 4WPYA 2R42A 4FWDA 2DSYA 2O1UA 5AE1A 2BV3A 4YHHI 3ADGA 4GEQB 3VYYA 4K0KE 2UUBE 1ZXMA 1XNQE 3ADIA 4DV2I 4OX9E 3IWCA 2RTXA 3ZKBA 4DV5I 2DIXA 3VK6A 3HXLA 4B3MI 1IBLE 4B3ME 3LNUA 4DPWA 2XEXA 1XMOE 2MC6A 2DMYA 1T4LB 4L5NC 1N0UA 4IZKA 4DKKA 1K47A 2JY9A 1KIJA 2V8QB 2V2QA 1NZ0A 3K1JA 4WSPA 1XMQI 2UUCE 3GONA 4X64E 4DUZI 2DB2A 1NHJA 4UTGA 3PRYA 2VQFI 3AUZA 3F6HA 2ZM6I 1Z0WA 1ZM3A 3F0NA 4F9AB 1WXRA 2RS7A 2L3JA 3LTOA 2V89A 4HYMA 2VF1A 2KONA 2WW4A 4B3RE 4LF4I 2Q2EB 4LF7I 4X62I 4DV6E 1DARA 4DR4I 1Z0BA 1NHIA 1Y4UA 5AE3A 3WU6A 1O0WA 1HNXI 3MSWA 3ADJA 3J80C 4F9BB 1RR9A 4JI7E 5LL6R 4P78A 4J8ZA 1IBKI 4R1FA 3OTOE 1WHNA 1PKPA 1H73A 2DEJA 4XTJA 3ZZTA 3JAMQ 1I94I 2YT4A 3RMPA 1Z0TA 4DV4I 1J5EE 4HACA 5FLXC 2FTXB 3QT7A 2M1SA 2UUAI 4DR3I 2LRSA 1UILA 2FV4B 2L3CA 4JI5E 4P52A 4DV3E 1HNWE 4JI6E 4KQVA 4PU9A 1HNZI 2V2VA 1XHKA 5BR8E 1WHQA 4JI3E 2ZBKB 4LF5I 1Z0GA 4KZSA 2B9DA 2L6MA 4DR7E 2ODRC 5DNYA 3WU4A 2KHXA 4DV1E 2HKJA 2B3TB 4GKJI 4P7DA 4Q28A 1KVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X47 A;  4LFC I;  5L3J A;  4LFA E;  1RRE A;  3H4L A;  2UXC I;  1N34 I;  1IBM I;  1YYW A;  1Z5C A;  2EFG A;  4LF6 I;  4LFB E;  4JI8 E;  2UU9 E;  4LF9 E;  2HFU A;  4WUD A;  2NUF A;  3B82 A;  1B63 A;  1S4E A;  4GKK E;  3CWV A;  4HY1 A;  3C4T A;  4MYT A;  2UUB I;  1XNQ I;  4K0K I;  4OX9 I;  4DV7 I;  2J7K A;  4DV7 E;  4JG4 A;  4B3T E;  1PIE A;  4M30 A;  2LUP B;  1ZBT A;  4X66 E;  4RPF A;  4DUY E;  4Z7C A;  1IBL I;  4WUC A;  4DR5 E;  1XMO I;  1FKA E;  2F4V E;  2N3G A;  2L2M A;  1YYK A;  1FWL A;  4DU8 A;  1ZM4 A;  1YYO A;  1WUU A;  2UUC I;  4FWG A;  4X64 I;  4ZVI A;  1N32 I;  4DR6 E;  1N32 E;  1QU6 A;  1Z59 A;  2V34 A;  4AQY E;  3V2U C;  1N36 E;  1H7U A;  5LMU E;  1B62 A;  4JI4 E;  4NXN E;  2HKE A;  5LMN E;  1H7S A;  3JAM C;  1HR0 E;  2UXB E;  4DV0 E;  1Z5A A;  4B3R I;  1FJG E;  1N0V C;  4DV6 I;  2HFS A;  5IT9 Q;  4OOG C;  5A2Q Q;  2NA2 A;  2X36 A;  2LUQ A;  4UT4 A;  1EI1 A;  4DPU A;  2UXD E;  1EA6 A;  4DPT A;  2VF3 A;  4JI7 I;  3LPS A;  5CFF E;  3D4J A;  4Z7Y A;  4JI1 E;  3C4B A;  3OTO I;  1YZ9 A;  3WU3 A;  3B8H A;  3J7A M;  4X65 E;  2HHH E;  4DXL A;  1XNR E;  1J5E I;  1Z0C A;  3V5R A;  4URL A;  2IHR 1;  2LJH A;  4WFT A;  4NXM E;  4DR2 E;  4JI5 I;  4DV3 I;  1HNW I;  4JI6 I;  3QT6 A;  3K17 A;  5BR8 I;  4JI3 I;  2NUG A;  4PRX A;  1PVG A;  4DR7 I;  4DV1 I;  4JI0 I;  3T1Y E;  2E1R A;  4JI0 E;  1T4O A;  3J81 C;  3ADL A;  4KHP E;  4JI2 E;  4YY3 E;  4PRV A;  1H72 C;  3J7A G;  4LFA I;  5IWA E;  1ZM9 A;  2VQE E;  4DR1 E;  2L2K B;  2LJP A;  3J7Y p;  4LFB I;  4JI8 I;  4I3H A;  2UU9 I;  4LF9 I;  1MX0 A;  1OJ4 A;  4X8W A;  1J26 A;  3ZZ0 A;  4GKK I;  2MDR A;  1EKZ A;  4DPY A;  3P1X A;  1UEK A;  3T1H E;  4JV5 E;  4FWH A;  4M2Z A;  1X48 A;  4B3T I;  4JYA E;  2E5L I;  4HAC B;  1FWK A;  1RC7 A;  1H74 A;  2E5L E;  4X66 I;  2NUE A;  2LTR A;  4DUY I;  3J81 Q;  2HK3 A;  4DR5 I;  2F4V I;  2NPF A;  4LF8 E;  4B3S E;  2B7T A;  1N33 E;  2V2Z A;  5IT9 C;  3PYF A;  2RS6 A;  4DPX A;  4YHH E;  5A2Q C;  3PYD A;  1MG7 A;  4DV2 E;  3QT8 A;  4DR6 I;  4MYU A;  1Z0E A;  4DV5 E;  3PYE A;  4AQY I;  1N36 I;  5LMU I;  3ZM7 A;  2CPN A;  4JI4 I;  4NXN I;  5LMN I;  2BM1 A;  2X7I A;  1T4N A;  1HR0 I;  4HXZ A;  2UXB I;  4DV0 I;  2A2D A;  1X49 A;  2CZ9 A;  3VYX A;  1FJG I;  1KTV A;  1VIS A;  1XMQ E;  4DUZ E;  1NHH A;  2AJ4 A;  2R3V A;  2RSM A;  2VQF E;  2ZM6 E;  2UXD I;  1ZM2 A;  4JI1 I;  4M1K A;  4X65 I;  3B78 A;  2HHH I;  2L2N A;  2OI2 A;  3M6A A;  1XNR I;  4LF4 E;  4LF7 E;  4X62 E;  2B7V A;  4DR4 E;  2EZ6 A;  1QZR A;  2JVA A;  4NXM I;  4DR2 I;  1HNX E;  3PYG A;  1RQ0 A;  3WU5 A;  1IBK E;  2L33 A;  1I94 E;  1ELO A;  4FN5 A;  4EMD A;  4DV4 E;  4WUB A;  2UUA E;  1S16 A;  2BM0 A;  2GS8 A;  4DR3 E;  3T1Y I;  1BKN A;  1UHZ A;  1D6T A;  4USK A;  4JI2 I;  4YY3 I;  4KHP I;  2ZIT A;  5IWA I;  1HNZ E;  1DI2 A;  2HK2 A;  3LLH A;  4DU7 A;  2VQE I;  4DR1 I;  4USM A;  4LF5 E;  4P7A A;  1MU5 A;  1Z5B A;  3J80 Q;  3QT5 A;  1FNM A;  2LTS A;  1Z0V A;  1A6F A;  4WYQ B;  5GME A;  3HTX A;  1FI4 A;  1KKH A;  4ED4 A;  4GKJ E;  3T1H I;  3Q1Q A;  4JV5 I;  5FLX Q;  2N3H A;  4JYA I;  3ZZU A;  2V8P A;  2A2C A;  5GMD A;  4LFC E;  2LBS B;  3HUL A;  2UXC E;  4FW9 A;  1N34 E;  1IBM E;  1GQE A;  1STU A;  4LF6 E;  1U2R A;  4LF8 I;  2DEI A;  4B3S I;  3ZKD A;  1N33 I;  1ZXN A;  2R42 A;  4FWD A;  2BV3 A;  4YHH I;  3ADG A;  3VYY A;  4K0K E;  2UUB E;  1ZXM A;  1XNQ E;  3ADI A;  4DV2 I;  4OX9 E;  2RTX A;  3ZKB A;  4DV5 I;  2DIX A;  4B3M I;  1IBL E;  4B3M E;  3LNU A;  4DPW A;  2XEX A;  1XMO E;  2DMY A;  1T4L B;  1N0U A;  4DKK A;  1K47 A;  2JY9 A;  1KIJ A;  2V2Q A;  1NZ0 A;  3K1J A;  1XMQ I;  2UUC E;  3GON A;  4X64 E;  4DUZ I;  2DB2 A;  1NHJ A;  4UTG A;  2VQF I;  2ZM6 I;  1Z0W A;  1ZM3 A;  3F0N A;  2RS7 A;  2L3J A;  3LTO A;  4HYM A;  2WW4 A;  4B3R E;  4LF4 I;  2Q2E B;  4LF7 I;  4X62 I;  4DV6 E;  1DAR A;  4DR4 I;  1Z0B A;  1NHI A;  3WU6 A;  1O0W A;  1HNX I;  3ADJ A;  3J80 C;  1RR9 A;  4JI7 E;  5LL6 R;  1IBK I;  4R1F A;  3OTO E;  1WHN A;  1PKP A;  1H73 A;  2DEJ A;  4XTJ A;  3ZZT A;  3JAM Q;  1I94 I;  2YT4 A;  1Z0T A;  4DV4 I;  1J5E E;  4HAC A;  5FLX C;  3QT7 A;  2UUA I;  4DR3 I;  2LRS A;  1UIL A;  2L3C A;  4JI5 E;  4P52 A;  4DV3 E;  1HNW E;  4JI6 E;  4KQV A;  4PU9 A;  1HNZ I;  2V2V A;  1XHK A;  5BR8 E;  1WHQ A;  4JI3 E;  2ZBK B;  4LF5 I;  1Z0G A;  4DR7 E;  3WU4 A;  2KHX A;  4DV1 E;  2HKJ A;  2B3T B;  4GKJ I;  1KVK A; 
#chains in the Genus database with same CATH topology
 2UXC I;  1X47 A;  4LFC I;  5L3J A;  4LFA E;  4OKG A;  1RRE A;  4M0V A;  2V88 A;  3H4L A;  2M7Q A;  1N34 I;  1IBM I;  2EMF A;  2EM7 A;  1A1I A;  1QNT A;  2GO3 A;  2EOY A;  2EMC A;  3H1C A;  1YYW A;  1Z5C A;  2EFG A;  4LF6 I;  1SFE A;  2EOE A;  2EOX A;  2EOQ A;  3Q6N A;  4LFB E;  4JI8 E;  2EPZ A;  2UU9 E;  4LF9 E;  2BA0 G;  2HFU A;  2K4V A;  5T6J A;  2EPK X;  4WUD A;  2NUF A;  2LE2 A;  1VI7 A;  3B82 A;  3P3G A;  1B63 A;  1S4E A;  4GKK E;  2EN3 A;  4BBY A;  3CDI A;  2EMB A;  2JWO A;  3CWV A;  4HY1 A;  2EM3 A;  3C4T A;  2V83 A;  3EPJ A;  4MYT A;  2UUB I;  1XNQ I;  1A1F A;  2C37 A;  2PO0 B;  4OX9 I;  2PO1 A;  3U1Y A;  5JEA F;  4DV7 I;  1Y5Y A;  2J7K A;  4DV7 E;  4JG4 A;  4B3T E;  5EKW A;  5FWK A;  2I9I A;  1PIE A;  4M30 A;  2EMK A;  2LUP B;  2EOS A;  1ZBT A;  3MHH C;  4X66 E;  4MU0 A;  4MLQ A;  2WBS A;  2BR2 B;  4RPF A;  4DUY E;  4Z7C A;  1IBL I;  4IFD D;  4WUC A;  4DR5 E;  1XMO I;  3HPZ A;  1FKA E;  2F4V E;  2N3G A;  2ENC A;  2LV2 A;  4QNJ A;  1YH8 A;  2EMZ A;  2HC5 A;  2L2M A;  2EM0 A;  2LO3 A;  4WSG A;  1YYK A;  1FWL A;  1ZU1 A;  2O1W A;  4DU8 A;  1A1K A;  1ZM4 A;  4L8N A;  3IWB A;  2JPA A;  1YYO A;  3AV0 A;  1WUU A;  2EN4 A;  2UUC I;  4FWG A;  2F1D A;  2JT2 A;  1ZBQ A;  2WBT A;  4BCA A;  4X64 I;  4ZVI A;  2EMI A;  1SR9 A;  4DR6 E;  1Y4S A;  1N32 I;  4WX9 A;  1QU6 A;  2EPM X;  1N32 E;  1Z59 A;  2CVE A;  3C6K A;  4AQY E;  1YPN A;  1N36 E;  1H7U A;  5LMU E;  2V34 A;  1B62 A;  2F8B A;  2C38 B;  1IQS A;  2FGG A;  4O43 A;  1GZ6 A;  4JI4 E;  4NXN E;  4BHC A;  2HKE A;  5LMN E;  2IOQ A;  1H7S A;  3JAM C;  1HR0 E;  2UXB E;  4DV0 E;  2RQL A;  2CG9 A;  2DLK A;  4IJD A;  2NN6 A;  4IFD F;  1Z5A A;  1OYP A;  1P47 A;  4B3R I;  5A6A A;  2EMH A;  4WXD A;  1FJG E;  3M85 G;  1N0V C;  4DV6 I;  2HFS A;  4MU3 A;  3GCM A;  5IT9 Q;  4OOG C;  5A2Q Q;  2NA2 A;  3MHS C;  2X36 A;  2GO4 A;  2E72 A;  2LUQ A;  4UT4 A;  2C37 B;  2EPP A;  1EI1 A;  2EOR A;  4DPU A;  2PO1 B;  4ISA A;  2YTO A;  2UXD E;  4KWY A;  2V87 A;  1EA6 A;  4DPT A;  5JEA E;  4K0K I;  2VF3 A;  4JI7 I;  2EPX A;  2JOX A;  5CFF E;  1AAY A;  3D4J A;  3LPS A;  4Z7Y A;  4JI1 E;  3C4B A;  3P3E A;  3OTO I;  1YZ9 A;  3WU3 A;  3B8H A;  2H36 X;  3J7A M;  2EPA A;  2EM4 A;  4X65 E;  1YUJ A;  2CT1 A;  2HHH E;  4LCH A;  2JEA A;  4OO1 D;  5AC4 A;  2YSP A;  4DXL A;  4MLV A;  4TUI A;  2LMZ A;  1XNR E;  3K85 A;  1J5E I;  4IZK B;  1A1L A;  2PNL A;  1Z0C A;  3V5R A;  1JK2 A;  2V85 A;  2G7H A;  4BHB A;  4URL A;  1X3C A;  2IHR 1;  2KOU A;  2LJH A;  1R6M A;  2EWL A;  4WFT A;  2Z5C A;  4NXM E;  5IV8 B;  4DR2 E;  4JI5 I;  4NZV A;  4DV3 I;  1HNW I;  4JI6 I;  5K36 C;  3PS1 A;  4O4K A;  5A69 A;  3K17 A;  1F2I G;  2ADR A;  2CGE A;  3QT6 A;  2EN8 A;  4WXC A;  5BR8 I;  3HPS A;  4JI3 I;  2NUG A;  1YSA C;  4IZJ A;  4PRX A;  4N3O A;  5K36 E;  2ELY A;  3FIG A;  1PVG A;  2PNM A;  4DR7 I;  4U3B A;  2MKD A;  4LCG A;  5A6J A;  2NN6 B;  2R76 A;  2WP8 A;  3KRN A;  2JEB A;  4DV1 I;  4JI0 I;  5KL6 A;  3T1Y E;  2E1R A;  4FW7 A;  2C39 A;  4IFD E;  4JI0 E;  3M7N G;  4OO1 F;  1T4O A;  2IES A;  3J81 C;  3ADL A;  5K36 A;  2DMI A;  2PO2 A;  4KHP E;  4JI2 E;  4YY3 E;  4FW4 A;  4PRV A;  1H72 C;  3J7A G;  4LFA I;  1UDN A;  5IWA E;  1ZM9 A;  4OZE A;  2R1F A;  3HQ1 A;  2VQE E;  4DR1 E;  2L2K B;  2LJP A;  4HEI A;  3J7Y p;  4LFB I;  4R2P A;  4QNK A;  4JI8 I;  4I3H A;  2UU9 I;  1MX0 A;  4LF9 I;  2O3Z A;  3Q6M A;  1OJ4 A;  4RHB B;  4X8W A;  1J26 A;  3ZZ0 A;  1HK7 A;  4U3D A;  2BBG A;  4GKK I;  2MDR A;  2YU5 A;  4ZYE A;  1LLM C;  1UDS A;  1EKZ A;  2PNZ B;  1UN6 B;  5DRR A;  4DPY A;  2EN7 A;  2YRM A;  2ENA A;  3DF6 A;  3P1X A;  2HGH A;  1UEK A;  2JEA B;  3T1H E;  4JV5 E;  4FWH A;  3OML A;  4M2Z A;  1X48 A;  4BMJ A;  4B3T I;  4JYA E;  3HJC A;  4IZJ D;  2E5L I;  4HAC B;  1FWK A;  1RC7 A;  1YFH A;  1H74 A;  2E5L E;  1T38 A;  3H09 A;  4X66 I;  2NUE A;  2LTR A;  1RMD A;  1UDQ A;  1YHC A;  3HKM A;  4DUY I;  4Q35 B;  3J81 Q;  4DMI A;  2HK3 A;  3P3C A;  1OYS A;  4DR5 I;  2F4V I;  2CTD A;  2BB8 A;  4F6M A;  1A1H A;  4LU9 A;  2DLQ A;  1P42 A;  2NPF A;  4LF8 E;  2EN2 A;  4B3S E;  2B7T A;  1N33 E;  3BGH A;  2V2Z A;  4MU1 A;  3F6G A;  3L7Z B;  4IZJ B;  5IT9 C;  2BA0 D;  3PYF A;  2RS6 A;  4DPX A;  4YHH E;  2YTN A;  2EMW A;  5A2Q C;  2YTQ A;  4F9C B;  3QG5 C;  5A6B A;  1MG7 A;  2E1M A;  3PYD A;  4AM3 A;  3K6Q A;  4DV2 E;  5C0X C;  3QT8 A;  4HTG A;  2WBU A;  4DR6 I;  4MYU A;  1AH5 A;  4BC9 A;  1Z0E A;  3LML A;  4DV5 E;  2WP8 B;  3PYE A;  2JEB B;  5ELW A;  4AQY I;  5KL3 A;  3TQM A;  1N36 I;  5LMU I;  3ZM7 A;  1PJQ A;  2C39 B;  2CPN A;  3BF2 A;  2RPC A;  2LT7 A;  3NZK A;  4JI4 I;  4NXN I;  1T39 A;  2J7J A;  2PO2 B;  5C0X E;  2BM1 A;  5LMN I;  2X7I A;  2EE8 A;  2EOI A;  1T4N A;  1IMU A;  3GLL A;  2GHF A;  3THN A;  4HXZ A;  1HR0 I;  4FW6 A;  4DV0 I;  2UXB I;  2A2D A;  1X49 A;  2ODR D;  3ECR A;  5KL2 A;  2L92 A;  2CZ9 A;  2BA1 G;  4LCF A;  5DNX A;  3VYX A;  1Y6Z A;  5ADZ A;  1XXE A;  1KTV A;  2M9A A;  1FJG I;  5EL9 A;  1VIS A;  2JR1 A;  1XMQ E;  5C0X A;  5JEA C;  2A25 A;  1WJP A;  2V86 A;  1KYQ A;  3ZOQ B;  4DUZ E;  1NHH A;  2MC5 A;  1ZAA C;  2AJ4 A;  4LTY A;  1TF3 A;  2WZO A;  2R3V A;  2RSM A;  3V2U C;  2VQF E;  2ZM6 E;  1USV A;  2UXD I;  3IWD A;  2EPU A;  2IOP A;  3EPK A;  2CSH A;  4ZYD A;  4LPF A;  4R03 A;  1ZM2 A;  4O24 A;  4JI1 I;  5AC5 A;  3KZY A;  3PS3 A;  4M1K A;  2VES A;  3BID A;  4R2Q A;  4X65 I;  4BA2 A;  2EM2 A;  1MGT A;  2L2N A;  2OI2 A;  3B4T A;  3B78 A;  3M6A A;  2HHH I;  1WRJ A;  2Q8U A;  2YTF A;  1XNR I;  4LF4 E;  5DRO A;  3EPL A;  4LF7 E;  4X62 E;  4M9V C;  2EQ3 A;  4IS1 C;  1USU A;  2B7V A;  4DR4 E;  5JEA A;  2EZ6 A;  2NAB A;  1G2D C;  2EMG A;  2YRH A;  1QZR A;  2YTD A;  2JVA A;  1MEY C;  1ZR9 A;  4DR2 I;  2EMX A;  4NXM I;  1E3P A;  5AE2 A;  2Z5B A;  1HNX E;  2L8T A;  3PYG A;  2NN6 D;  2GQ0 A;  2GPI A;  4F2J C;  1RQ0 A;  5IXM B;  1NEI A;  3WU5 A;  1IBK E;  1A1J A;  2J65 A;  2L33 A;  3PS2 A;  2VE7 C;  2EMA A;  3GME A;  4IFD C;  3UK3 C;  1I94 E;  1E3H A;  5KL4 A;  1ELO A;  4FN5 A;  4EMD A;  4DV4 E;  2Z5E A;  1EH7 A;  2EL6 A;  2EML A;  1R6L A;  3M7N D;  4WUB A;  2UUA E;  1S16 A;  2BM0 A;  2GS8 A;  2JOB A;  4DR3 E;  3T1Y I;  2ENH A;  3BBG A;  5DNL A;  4BS9 A;  1BKN A;  1UHZ A;  1D6T A;  4R2E A;  3JTZ A;  3KWR A;  4USK A;  4JI2 I;  4YY3 I;  3JU0 A;  4KHP I;  2ZIT A;  2EM5 A;  4BA1 A;  5IWA I;  1HNZ E;  4I8O A;  4X9J A;  1DI2 A;  4N4R B;  2HK2 A;  4FW3 A;  3LLH A;  4DU7 A;  2VQE I;  4DR1 I;  4USM A;  1JK1 A;  4LF5 E;  4P7A A;  4BC7 A;  1BBG A;  1MU5 A;  2O1V A;  2K7I A;  4IS9 A;  4TUG A;  2EN1 A;  1Z5B A;  3J80 Q;  1EH6 A;  4NHR A;  1DQ3 A;  2EPL X;  5F3W A;  2PRT A;  3QT5 A;  1FNM A;  4IFD A;  3C6M A;  2LTS A;  4R2C A;  2NN6 F;  1Z0V A;  1NCS A;  3P06 A;  1A6F A;  2ELZ A;  1UDO A;  4WYQ B;  1G2F C;  2M4I A;  4R2A A;  5GME A;  3HTX A;  3KZZ A;  4BA2 B;  1FI4 A;  1RHY A;  1KKH A;  4ED4 A;  4GKJ E;  3T1H I;  3Q1Q A;  4JV5 I;  5FLX Q;  2N3H A;  4R8O A;  4JYA I;  3ZZU A;  2V8P A;  1X6E A;  1PDA A;  2HJJ A;  4F54 A;  4F6N A;  2A2C A;  4LFC E;  5GMD A;  5JEA B;  2LBS B;  1TN9 A;  3HUL A;  2UXC E;  4FW9 A;  1N34 E;  1IBM E;  1GQE A;  3DJW A;  2Z5C B;  1STU A;  3VHT B;  5AAS A;  2VRD A;  4LF6 E;  4MU4 A;  2YZT A;  3EQ1 A;  2Z5B B;  1U2R A;  4LF8 I;  2DEI A;  4B3S I;  2EQ1 A;  3ZKD A;  1ZXN A;  2O1T A;  1N33 I;  4LOM A;  4WPY A;  2R42 A;  4MQY A;  2EOZ A;  2LVH A;  2YRK A;  2EMY A;  4FWD A;  2DSY A;  2GLI A;  2EL4 A;  2O1U A;  5AE1 A;  2BV3 A;  4YHH I;  5K36 D;  3ADG A;  4GEQ B;  2YTG A;  3EPH A;  3VYY A;  4K0K E;  2UUB E;  1ZXM A;  1XNQ E;  3ADI A;  4DV2 I;  4OX9 E;  2DGC A;  4R2S A;  2EM8 A;  2IER A;  1IQO A;  3IWC A;  4OO1 C;  2RTX A;  3ZKB A;  4DV5 I;  1GTK A;  2DIX A;  2EL5 A;  3VK6 A;  3HXL A;  4B3M I;  1IBL E;  4B3M E;  3LNU A;  4DPW A;  4MDT A;  5K36 B;  2XEX A;  1XMO E;  4OO1 E;  4BA1 B;  2MC6 A;  2DMY A;  5DRQ A;  2RSI A;  2EPR A;  3P76 A;  2LJU A;  2YPN A;  1T4L B;  4L5N C;  1N0U A;  2NN6 C;  4IZK A;  4RH8 A;  4DKK A;  1K47 A;  1BBO A;  2JE6 A;  2YTE A;  3M99 B;  4R2R A;  2JY9 A;  1KIJ A;  2V8Q B;  2V2Q A;  1YUI A;  1NZ0 A;  3K1J A;  4IFD B;  4WSP A;  1XMQ I;  2UUC E;  3GON A;  4X64 E;  4OO1 A;  2NN6 E;  2DRP A;  4FW5 A;  4DUZ I;  2DB2 A;  1NHJ A;  2YTJ A;  2EPN A;  5K36 F;  2JP9 A;  2EM6 A;  4UTG A;  2EP3 A;  3PRY A;  2VQF I;  3AUZ A;  3F6H A;  2ZM6 I;  1Y60 A;  1Z0W A;  1ZM3 A;  3F0N A;  2YSO A;  4J3D A;  5KL7 A;  3UHM A;  4F9A B;  1WXR A;  1X6H A;  2RS7 A;  1A1G A;  2D9H A;  2EPC A;  2L3J A;  3LTO A;  2V89 A;  4HYM A;  5A6B D;  2VF1 A;  2N8X A;  2KON A;  3THO B;  1DGC A;  2WW4 A;  4B3R E;  4ZYG A;  4LF4 I;  2WNR A;  2Q2E B;  4LF7 I;  4X62 I;  4DV6 E;  2EOJ A;  1Z1B A;  4ZYH A;  2BA1 D;  1DAR A;  4DR4 I;  2EOO A;  1Z0B A;  2YTP A;  5KL5 A;  1NHI A;  4AIM A;  1Y4U A;  2JXP A;  5AE3 A;  2JYA A;  3M85 D;  1BB8 A;  3WU6 A;  1O0W A;  2EM9 A;  4NBQ A;  1HNX I;  2YU8 A;  3MSW A;  5A6K A;  3ADJ A;  3J80 C;  4F9B B;  1RR9 A;  4JI7 E;  5LL6 R;  1X5W A;  1UBD C;  4P78 A;  4J8Z A;  1IBK I;  4FK5 C;  1L4S A;  2LCE A;  1TF6 A;  4O5G A;  4R1F A;  3OTO E;  1WHN A;  1PKP A;  2I13 A;  1H73 A;  2DEJ A;  2PNZ A;  4XTJ A;  5C0X D;  3ZZT A;  3JAM Q;  1I94 I;  2YT4 A;  1PJS A;  2MDG A;  5LLQ A;  3RMP A;  2PO0 A;  1Z0T A;  4DV4 I;  1J5E E;  4HAC A;  5FLX C;  2FTX B;  3QT7 A;  2M1S A;  2UUA I;  2JE6 B;  4DR3 I;  3CDJ A;  2EN6 A;  3L00 A;  2EOM A;  2LRS A;  2BR2 A;  1UIL A;  2FV4 B;  5TSE A;  2L3C A;  4JI5 E;  4P52 A;  4DV3 E;  1HNW E;  4JI6 E;  1KJK A;  4GQU A;  4KQV A;  5C0X B;  4PU9 A;  5DRP A;  3U1K A;  1HNZ I;  2V2V A;  4OO1 B;  2AE8 A;  1XHK A;  5BR8 E;  3L7Z A;  1WHQ A;  1N3G A;  4JI3 E;  2ZBK B;  1Z0G A;  4KZS A;  4LF5 I;  2B9D A;  2EOH A;  2L6M A;  2EOF A;  1X6F A;  4DR7 E;  5JEA D;  2YTI A;  2EPO A;  2MKN A;  2EQ0 A;  4AID A;  4R2D A;  3DD6 A;  2ODR C;  5DNY A;  3WU4 A;  2KHX A;  2WCC 3;  4DV1 E;  2HKJ A;  2B3T B;  1B69 A;  4GZN C;  1EH8 A;  4P7D A;  2C38 A;  5C0X F;  4GKJ I;  2WNR B;  2EJ4 A;  1PJT A;  1OYR A;  4Q28 A;  2YWQ A;  1KVK A; 
#chains in the Genus database with same CATH homology
 1X47 A;  4LFC I;  5L3J A;  4LFA E;  1RRE A;  4M0V A;  2V88 A;  3H4L A;  2M7Q A;  1N34 I;  1IBM I;  2UXC I;  1YYW A;  1Z5C A;  2EFG A;  4LF6 I;  3Q6N A;  4LFB E;  4JI8 E;  2UU9 E;  4LF9 E;  2HFU A;  2K4V A;  5T6J A;  4WUD A;  2NUF A;  2LE2 A;  3B82 A;  1B63 A;  1S4E A;  4GKK E;  4BBY A;  2JWO A;  3CWV A;  4HY1 A;  3C4T A;  2V83 A;  4MYT A;  2UUB I;  1XNQ I;  4K0K I;  4OX9 I;  4DV7 I;  2J7K A;  4DV7 E;  4JG4 A;  4B3T E;  5FWK A;  1PIE A;  4M30 A;  2LUP B;  1ZBT A;  4X66 E;  4RPF A;  4DUY E;  4Z7C A;  1IBL I;  4WUC A;  4DR5 E;  1XMO I;  3HPZ A;  1FKA E;  2F4V E;  2N3G A;  2L2M A;  1YYK A;  1FWL A;  2O1W A;  4DU8 A;  1ZM4 A;  4L8N A;  3IWB A;  1YYO A;  3AV0 A;  1WUU A;  2UUC I;  4FWG A;  4X64 I;  1ZBQ A;  4BCA A;  4ZVI A;  1N32 I;  1SR9 A;  4DR6 E;  1Y4S A;  1N32 E;  1QU6 A;  1Z59 A;  2V34 A;  4AQY E;  3V2U C;  1N36 E;  1H7U A;  5LMU E;  1B62 A;  2F8B A;  2FGG A;  1GZ6 A;  4JI4 E;  4NXN E;  2HKE A;  5LMN E;  2IOQ A;  1H7S A;  3JAM C;  1HR0 E;  2UXB E;  4DV0 E;  2CG9 A;  1Z5A A;  4B3R I;  1FJG E;  1N0V C;  4DV6 I;  2HFS A;  5IT9 Q;  4OOG C;  5A2Q Q;  2NA2 A;  2X36 A;  2LUQ A;  4UT4 A;  1EI1 A;  4DPU A;  2UXD E;  1EA6 A;  2V87 A;  4DPT A;  2VF3 A;  4JI7 I;  2JOX A;  5CFF E;  3LPS A;  3D4J A;  4Z7Y A;  4JI1 E;  3C4B A;  3OTO I;  1YZ9 A;  3WU3 A;  3B8H A;  2H36 X;  3J7A M;  4X65 E;  2HHH E;  4DXL A;  4TUI A;  2LMZ A;  1XNR E;  3K85 A;  1J5E I;  4IZK B;  2PNL A;  1Z0C A;  3V5R A;  2V85 A;  2G7H A;  4URL A;  2IHR 1;  2KOU A;  2LJH A;  2Z5C A;  2EWL A;  4WFT A;  4NXM E;  4DR2 E;  4JI5 I;  4DV3 I;  1HNW I;  4JI6 I;  3QT6 A;  3K17 A;  2CGE A;  5BR8 I;  3HPS A;  4JI3 I;  2NUG A;  4IZJ A;  4PRX A;  4N3O A;  3FIG A;  1PVG A;  2PNM A;  4DR7 I;  4DV1 I;  4JI0 I;  3T1Y E;  2E1R A;  4JI0 E;  1T4O A;  3J81 C;  3ADL A;  4KHP E;  4JI2 E;  4YY3 E;  4PRV A;  1H72 C;  3J7A G;  4LFA I;  5IWA E;  1ZM9 A;  3HQ1 A;  2VQE E;  4DR1 E;  2L2K B;  2LJP A;  3J7Y p;  4LFB I;  4JI8 I;  4I3H A;  2UU9 I;  4LF9 I;  1MX0 A;  3Q6M A;  1OJ4 A;  4X8W A;  1J26 A;  3ZZ0 A;  1HK7 A;  4GKK I;  2MDR A;  1EKZ A;  4DPY A;  3DF6 A;  3P1X A;  1UEK A;  3T1H E;  4JV5 E;  4FWH A;  3OML A;  4M2Z A;  1X48 A;  4BMJ A;  4B3T I;  4JYA E;  3HJC A;  4IZJ D;  2E5L I;  4HAC B;  1FWK A;  1RC7 A;  1H74 A;  2E5L E;  3H09 A;  4X66 I;  2NUE A;  2LTR A;  4DUY I;  3J81 Q;  4DMI A;  2HK3 A;  4DR5 I;  2F4V I;  4LU9 A;  2NPF A;  4LF8 E;  4B3S E;  2B7T A;  1N33 E;  2V2Z A;  3F6G A;  4IZJ B;  5IT9 C;  3PYF A;  2RS6 A;  4DPX A;  4YHH E;  5A2Q C;  4F9C B;  3PYD A;  1MG7 A;  2E1M A;  3K6Q A;  4DV2 E;  3QT8 A;  4DR6 I;  4MYU A;  4BC9 A;  1Z0E A;  3LML A;  4DV5 E;  3PYE A;  4AQY I;  1N36 I;  5LMU I;  3ZM7 A;  2CPN A;  4JI4 I;  4NXN I;  5LMN I;  2BM1 A;  2X7I A;  1T4N A;  1HR0 I;  4HXZ A;  2UXB I;  4DV0 I;  2A2D A;  1X49 A;  2ODR D;  2L92 A;  2CZ9 A;  3VYX A;  1Y6Z A;  5ADZ A;  1FJG I;  1KTV A;  1VIS A;  2JR1 A;  1XMQ E;  2V86 A;  3ZOQ B;  4DUZ E;  1NHH A;  2MC5 A;  2AJ4 A;  4LTY A;  2WZO A;  2R3V A;  2RSM A;  2VQF E;  2ZM6 E;  1USV A;  2UXD I;  3IWD A;  2IOP A;  4R03 A;  1ZM2 A;  4JI1 I;  4M1K A;  4X65 I;  3B78 A;  2HHH I;  2L2N A;  2OI2 A;  3M6A A;  1XNR I;  4LF4 E;  4LF7 E;  4X62 E;  1USU A;  2B7V A;  4DR4 E;  2EZ6 A;  1QZR A;  2JVA A;  4NXM I;  4DR2 I;  5AE2 A;  2Z5B A;  1HNX E;  2L8T A;  3PYG A;  2GQ0 A;  1RQ0 A;  3WU5 A;  1IBK E;  2L33 A;  2VE7 C;  1I94 E;  1ELO A;  4FN5 A;  4EMD A;  4DV4 E;  2Z5E A;  4WUB A;  2UUA E;  1S16 A;  2BM0 A;  2GS8 A;  2JOB A;  4DR3 E;  3T1Y I;  1BKN A;  4BS9 A;  1UHZ A;  1D6T A;  3JTZ A;  3KWR A;  4USK A;  4JI2 I;  4YY3 I;  3JU0 A;  4KHP I;  2ZIT A;  5IWA I;  1HNZ E;  4I8O A;  1DI2 A;  2HK2 A;  3LLH A;  4DU7 A;  2VQE I;  4DR1 I;  4USM A;  4LF5 E;  4P7A A;  4BC7 A;  1MU5 A;  2O1V A;  4TUG A;  1Z5B A;  3J80 Q;  1DQ3 A;  5F3W A;  3QT5 A;  1FNM A;  2LTS A;  1Z0V A;  3P06 A;  1A6F A;  4WYQ B;  2M4I A;  5GME A;  3HTX A;  1FI4 A;  1KKH A;  4ED4 A;  4GKJ E;  3T1H I;  3Q1Q A;  4JV5 I;  5FLX Q;  2N3H A;  4R8O A;  4JYA I;  3ZZU A;  2V8P A;  4F54 A;  2A2C A;  5GMD A;  4LFC E;  2LBS B;  3HUL A;  2UXC E;  4FW9 A;  1N34 E;  1IBM E;  1GQE A;  3DJW A;  2Z5C B;  1STU A;  5AAS A;  4LF6 E;  2YZT A;  2Z5B B;  1U2R A;  4LF8 I;  2DEI A;  4B3S I;  3ZKD A;  1N33 I;  1ZXN A;  2O1T A;  4WPY A;  2R42 A;  4FWD A;  2DSY A;  2O1U A;  5AE1 A;  2BV3 A;  4YHH I;  3ADG A;  4GEQ B;  3VYY A;  4K0K E;  2UUB E;  1ZXM A;  1XNQ E;  3ADI A;  4DV2 I;  4OX9 E;  3IWC A;  2RTX A;  3ZKB A;  4DV5 I;  2DIX A;  3VK6 A;  3HXL A;  4B3M I;  1IBL E;  4B3M E;  3LNU A;  4DPW A;  2XEX A;  1XMO E;  2MC6 A;  2DMY A;  1T4L B;  4L5N C;  1N0U A;  4IZK A;  4DKK A;  1K47 A;  2JY9 A;  1KIJ A;  2V8Q B;  2V2Q A;  1NZ0 A;  3K1J A;  4WSP A;  1XMQ I;  2UUC E;  3GON A;  4X64 E;  4DUZ I;  2DB2 A;  1NHJ A;  4UTG A;  3PRY A;  2VQF I;  3AUZ A;  3F6H A;  2ZM6 I;  1Z0W A;  1ZM3 A;  3F0N A;  4F9A B;  1WXR A;  2RS7 A;  2L3J A;  3LTO A;  2V89 A;  4HYM A;  2VF1 A;  2KON A;  2WW4 A;  4B3R E;  4LF4 I;  2Q2E B;  4LF7 I;  4X62 I;  4DV6 E;  1DAR A;  4DR4 I;  1Z0B A;  1NHI A;  1Y4U A;  5AE3 A;  3WU6 A;  1O0W A;  1HNX I;  3MSW A;  3ADJ A;  3J80 C;  4F9B B;  1RR9 A;  4JI7 E;  5LL6 R;  4P78 A;  4J8Z A;  1IBK I;  4R1F A;  3OTO E;  1WHN A;  1PKP A;  1H73 A;  2DEJ A;  4XTJ A;  3ZZT A;  3JAM Q;  1I94 I;  2YT4 A;  3RMP A;  1Z0T A;  4DV4 I;  1J5E E;  4HAC A;  5FLX C;  2FTX B;  3QT7 A;  2M1S A;  2UUA I;  4DR3 I;  2LRS A;  1UIL A;  2FV4 B;  2L3C A;  4JI5 E;  4P52 A;  4DV3 E;  1HNW E;  4JI6 E;  4KQV A;  4PU9 A;  1HNZ I;  2V2V A;  1XHK A;  5BR8 E;  1WHQ A;  4JI3 E;  2ZBK B;  4LF5 I;  1Z0G A;  4KZS A;  2B9D A;  2L6M A;  4DR7 E;  2ODR C;  5DNY A;  3WU4 A;  2KHX A;  4DV1 E;  2HKJ A;  2B3T B;  4GKJ I;  4P7D A;  4Q28 A;  1KVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...