4JI5E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji5E02
1NHHA 2F4VE 3ADGA 2F4VI 4B3ME 4B3MI 1ZM2A 1NHIA 2LBSB 1FI4A 1ZBTA 4DV4E 4DV4I 2L3JA 4JI8E 1XNQE 4JI8I 4DU7A 3J7AG 5GMDA 2V2QA 4LF9E 4LF9I 4DR4E 4YHHE 4DR4I 4YHHI 2UUBI 2B3TB 4JI6I 3J80Q 2RSMA 2DMYA 2A2DA 2HFUA 3ZZUA 1UILA 4FWDA 4MYTA 1Z0BA 1HNXE 4X62I 4JI2E 2UUAE 4HYMA 3M6AA 4JI2I 2UUAI 5LMNE 1N34E 4X66E 1N34I 2EZ6A 4X66I 4ED4A 1Z59A 1O0WA 4JI3E 4JI3I 1WHQA 4FWGA 4LF6E 4LF5E 4LF6I 4LF5I 1Z5AA 2ZM6E 4P7AA 3J81C 2ZM6I 3J7AM 3PYGA 3C4TA 4GKJE 4X64E 2R42A 4GKJI 4JI1E 2UXBE 4X64I 2HKJA 4JI1I 3B78A 1QU6A 3Q1QA 5IT9C 4B3RE 4B3RI 2XEXA 4LF7E 4DV1E 4LF7I 4PRXA 4DV1I 4FN5A 2HHHE 2NUFA 2HHHI 1Z5CA 4UTGA 4M30A 2E5LE 4HXZA 2E5LI 3QT6A 1I94E 1I94I 4DV5E 4DV5I 1YYKA 2LTSA 4DR3E 4LFBE 2VQFE 4DR3I 4LFBI 2VQEE 4PRVA 2VQEI 3K17A 2CZ9A 1KIJA 4LF4E 4LF4I 1J26A 2WW4A 4PU9A 2L2NA 1FJGE 1BKNA 1XHKA 1FJGI 2LJHA 1ZM9A 2RTXA 4EMDA 3C4BA 4DV7E 1IBKE 4DV7I 1IBKI 3LTOA 1YYOA 2BM1A 4USKA 2UUCE 2UUCI 5IWAI 2IHR1 3PYEA 1X48A 1PVGA 2OI2A 2N3GA 2ZITA 4Z7CA 1Z5BA 1YZ9A 1T4OA 2HK2A 1XMQE 4AQYE 1XMQI 2X36A 4AQYI 3B8HA 4ZVIA 1NZ0A 1RR9A 4KHPI 2L33A 2N3HA 2B7TA 4DV2E 1DI2A 4DV2I 2LJPA 1Z0WA 4DPYA 2ZBKB 2UXDE 4Z7YA 1HR0I 2UXDI 1UEKA 2UUBE 1H7UA 4NXNI 4JI6E 3VYXA 4UT4A 4MYUA 3QT7A 2EFGA 1FWLA 4XTJA 1HNWI 5A2QC 1PKPA 4DUYE 4DUYI 4X62E 2BM0A 4JI5E 4JI5I 4B3SI 4URLA 4M1KA 3D4JA 3J81Q 2NUEA 4WYQB 1S16A 2KHXA 1ZXNA 4DXLA 3K1JA 1ELOA 3ADJA 3JAMC 4HACB 3OTOE 3OTOI 5IT9Q 1UHZA 1Z0GA 2Q2EB 2HKEA 4DPXA 3ZZ0A 4JV5I 4WUDA 1H72C 4WFTA 1Z0CA 2DIXA 4K0KE 4K0KI 3ADIA 4JI7E 2NUGA 4JI7I 4DR5E 1ZM3A 4DR5I 3P1XA 1EI1A 3ZKBA 2L2KB 1XMOE 1XMOI 1XNRE 2R3VA 4DR1E 1XNRI 4DR6E 4DR1I 4DR6I 4WUBA 2NA2A 2V2ZA 1Z0TA 1KVKA 1STUA 3T1HE 3T1HI 2YT4A 4R1FA 4DU8A 1T4LB 2HFSA 3ZKDA 1N32E 2VF3A 1N32I 1IBME 3QT8A 1FNMA 1IBMI 5FLXC 3WU6A 5IWAE 4DPTA 1S4EA 5GMEA 4LF8E 1K47A 4LF8I 4HACA 2LUQA 4JYAE 4JYAI 4JI0E 2LTRA 4JI0I 2NPFA 1HNZE 1HNZI 4KHPE 3T1YI 4DV3E 1RQ0A 4DV3I 1N0UA 3PYDA 4DKKA 1PIEA 4JG4A 2RS7A 1HR0E 4YY3E 4DPWA 1RREA 4YY3I 4NXNE 2LUPB 1DARA 3ZZTA 1KKHA 1RC7A 5A2QQ 2CPNA 1ZXMA 3PYFA 1NHJA 3WU3A 1XNQI 1HNWE 4RPFA 3HTXA 1EA6A 1IBLE 1IBLI 4B3SE 3V5RA 1FWKA 3JAMQ 4JI4E 1N0VC 5CFFE 4LFAE 1GQEA 1A6FA 4JI4I 4LFAI 2LRSA 4DV0E 2UXCE 2J7KA 2V8PA 4DV0I 2UXCI 1FKAE 2A2CA 4P52A 4I3HA 4DPUA 3J80C 3CWVA 4NXME 4USMA 4NXMI 1B62A 1J5EE 3ZM7A 1MU5A 2AJ4A 1J5EI 3J7Yp 4DR7E 1HNXI 1Z0VA 4DR7I 5BR8E 1KTVA 5BR8I 5LMNI 4KQVA 4JV5E 3WU4A 4X8WA 1EKZA 2BV3A 1X49A 4DV6E 2MDRA 4DV6I 1VISA 3QT5A 1H73A 2UU9E 2UU9I 2UXBI 3ADLA 1N33E 2V2VA 4FW9A 1WHNA 1N33I 4GKKE 3V2UC 2DEJA 4GKKI 1X47A 1Z0EA 3LPSA 5LMUE 5LMUI 3GONA 4FWHA 3VYYA 4LFCE 4DUZE 4LFCI 4OX9E 4DUZI 2DB2A 4OX9I 1U2RA 1H7SA 1H74A 1MG7A 2HK3A 3B82A 2VQFI 1QZRA 5FLXQ 4DR2E 4DR2I 1ZM4A 4B3TE 4B3TI 1B63A 5LL6R 2B7VA 2JY9A 1D6TA 1OJ4A 4X65E 1T4NA 4X65I 3F0NA 1YYWA 2X7IA 2E1RA 1MX0A 2JVAA 2L3CA 1WUUA 2GS8A 2V34A 3H4LA 3LLHA 5L3JA 3T1YE 4OOGC 4HY1A 2RS6A 2DEIA 3LNUA 4WUCA 3WU5A 2L2MA 1N36E 3HULA 4M2ZA 1N36I
chains in the Genus database with same CATH superfamily
5JEAE 1NHHA 3NZKA 2YRKA 1PJSA 2F4VE 3ADGA 2F4VI 4B3ME 3EPLA 4LCGA 4B3MI 4F2JC 1ZM2A 2EN7A 3DF6A 4BA2B 4IFDA 2G7HA 2I9IA 4R8OA 3IWCA 2FTXB 1PJTA 4LTYA 2LBSB 1FI4A 1NHIA 1ZBTA 4DV4E 2JT2A 4DV4I 1Y5YA 2L3JA 4BHCA 5K36F 2GPIA 2LMZA 2YU8A 4JI8E 3VHTB 2HC5A 1YUIA 1XNQE 2JE6B 3J7AG 4JI8I 4DU7A 5GMDA 1VI7A 3P06A 2V2QA 3AUZA 4LF9E 2BA0G 4LF9I 2BR2B 2H36X 4DR4E 3UHMA 1ZBQA 4YHHE 2E72A 1JK1A 4DR4I 4BS9A 4YHHI 2UUBI 2B3TB 1WJPA 2Z5BA 3HQ1A 4JI6I 3J80Q 2RSMA 2J65A 2DMYA 2GO3A 2A2DA 5JEAF 2EOQA 2EORA 2YTFA 2HFUA 2EPXA 2LV2A 1X6EA 3ZZUA 1UILA 2EOOA 2EOFA 2WBSA 1Z1BA 4FWDA 1WXRA 4MYTA 1Z0BA 1A1FA 1HNXE 4X62I 5K36C 4JI2E 2UUAE 5A6AA 3M6AA 2JOBA 2M7QA 1A1LA 2HGHA 4HYMA 2UUAI 4JI2I 5LMNE 4O43A 2EQ3A 1N34E 2DLQA 4X66E 1N34I 2EZ6A 4X66I 1SFEA 4N3OA 4ED4A 1Z59A 4IFDD 2EPCA 1O0WA 4JI3E 4JI3I 1WHQA 2O1TA 4FWGA 2EMYA 2NN6C 1A1IA 4LF6E 4LF5E 2EP3A 4LF6I 4LF5I 2PO2B 4WPYA 1Z5AA 4LCFA 1T38A 2ZM6E 4P7AA 1Y4SA 3J81C 2EMHA 2ZM6I 3J7AM 3PYGA 3C4TA 3K6QA 4IFDE 4IZJA 1BBGA 4GKJE 4X64E 2R42A 4GKJI 4JI1E 2EPRA 2UXBE 4U3DA 2HKJA 4X64I 4NHRA 4JI1I 5JEAC 2A25A 2NN6A 4IS1C 2CT1A 2ENCA 4NZVA 2R1FA 3B78A 1QU6A 3Q1QA 4HEIA 5DRRA 2R76A 1YFHA 4N4RB 5DNYA 5IT9C 2YU5A 2V87A 4WSPA 4B3RE 2EMFA 2EN8A 2EPZA 1A1GA 4B3RI 2XEXA 4LF7E 2YTNA 4O4KA 4DV1E 3HXLA 4PRXA 4DV1I 4FN5A 4LF7I 2C38B 3HJCA 1TF3A 1PDAA 1EH6A 1IQOA 2HHHE 2NUFA 2HHHI 1Z5CA 4UTGA 2EMBA 4M30A 2E5LE 1X3CA 4HXZA 2E5LI 2KOUA 2EPLX 4R2EA 4BA2A 3QT6A 2BBGA 4P7DA 1I94E 4KWYA 1Y6ZA 4DV5E 1I94I 4LOMA 4DV5I 1YYKA 2IOQA 2LTSA 3KRNA 4R2DA 4DR3E 4LFBE 2BA1D 2VQFE 2WNRB 4DR3I 2MDGA 2VQEE 4LFBI 4PRVA 2JE6A 2VQEI 3K17A 2LCEA 4L5NC 2CZ9A 4IFDF 2EPAA 3P3GA 4KZSA 3TQMA 4ZYHA 1KIJA 1TF6A 4LF4E 1IMUA 1Y60A 5FWKA 2EM6A 2EMGA 4LCHA 4LF4I 2PO1A 3H1CA 1USUA 1USVA 1J26A 2WW4A 4NBQA 1LLMC 2RSIA 3F6GA 1AAYA 1UDNA 3EPHA 1UDQA 4PU9A 5AASA 2EL5A 4IZJD 3VK6A 2DLKA 2L2NA 1FJGE 2V88A 1BKNA 1XHKA 5EKWA 1FJGI 2NN6D 2V83A 1R6LA 2Q8UA 4WXDA 2LJHA 4MU0A 1ZM9A 2RTXA 2V89A 2VRDA 4EMDA 3C4BA 4DV7E 1IBKE 2C37B 2CVEA 4DV7I 1IBKI 3P76A 3LTOA 4RHBB 1YYOA 2JEBA 1F2IG 2BM1A 2NN6E 4X9JA 4USKA 2UUCE 2UUCI 2V86A 5IWAI 2IHR1 3PYEA 1X48A 2EMLA 5AC4A 1YSAC 1PVGA 2OI2A 3PS1A 2N3GA 4R2CA 2ZITA 4Z7CA 4GEQB 1Z5BA 2EOZA 1YH8A 1BB8A 2FGGA 4BHBA 3B4TA 4M9VC 3KZZA 2PO2A 4FW3A 4HTGA 1A1HA 2CGEA 1YZ9A 2Z5CB 4RH8A 4MU3A 4WXCA 1UDSA 1T4OA 2JR1A 2ODRC 2HK2A 2WBUA 3DJWA 1XMQE 4AQYE 1XMQI 2X36A 4R03A 2KONA 4AQYI 2YTIA 4OZEA 2PO0B 3B8HA 4ZVIA 1NZ0A 1RR9A 4KHPI 2L33A 4QNKA 2N3HA 3MHHC 5A69A 2B7TA 1G2FC 4ISAA 4DV2E 4Q35B 1DI2A 4GZNC 2B9DA 5C0XB 4DV2I 2LJPA 1Z0WA 1EH7A 2ZBKB 2UXDE 4Z7YA 4DPYA 1HR0I 2UXDI 1UEKA 3RMPA 2C38A 4FK5C 2UUBE 2EPPA 2NN6F 2WP8B 4R2SA 1H7UA 1B69A 2LO3A 4FW5A 4JI6E 4NXNI 2AE8A 4LPFA 2EMAA 3VYXA 2EM2A 4F6MA 4UT4A 3Q6MA 4MYUA 2DGCA 2BA1G 3QT7A 4R2PA 5AE1A 3PRYA 5KL7A 2EFGA 1R6MA 3FIGA 2F1DA 2WNRA 2N8XA 2LT7A 5KL4A 1FWLA 4XTJA 1HNWI 5A2QC 1PKPA 1MEYC 1ZAAC 4DUYE 3IWBA 2IERA 4DUYI 2C39B 4X62E 2BM0A 4JI5E 1TN9A 4BA1B 3H09A 2JEBB 3MHSC 4JI5I 4OO1B 2JWOA 3KWRA 4B3SI 2L8TA 2MC5A 4URLA 4M1KA 3D4JA 2GO4A 3J81Q 2JXPA 5IXMB 2NUEA 3PS3A 4WYQB 1S16A 2KHXA 2EMCA 1ZXNA 3CDJA 3K1JA 4DXLA 1ELOA 3ADJA 3JAMC 4HACB 2E1MA 4ZYGA 3OTOE 2JEAB 3OTOI 2C37A 4R2RA 2ODRD 1ZR9A 2O1VA 5IT9Q 5KL2A 1UHZA 1Z0GA 2V85A 2JYAA 2Q2EB 2FV4B 2EM7A 2HKEA 2EOYA 4DPXA 3ZZ0A 2ELZA 3QG5C 3GMEA 4WUDA 1H72C 4WFTA 2YTPA 4JV5I 4TUIA 1Z0CA 2YRHA 2DIXA 3M7NG 4K0KE 2YTDA 3MSWA 3GCMA 4K0KI 3ADIA 2K4VA 2EM8A 4JI7E 2NUGA 5EL9A 4JI7I 4DR5E 4Q28A 2Z5CA 1PJQA 1ZM3A 3U1KA 3P1XA 4DR5I 4P78A 3GLLA 1EI1A 2EM0A 2MC6A 3ZOQB 5F3WA 3ZKBA 2PO0A 2PRTA 2L2KB 5AC5A 1XMOE 2O3ZA 4MLQA 1XMOI 1XNRE 1GTKA 2R3VA 4DR1E 1XNRI 4DR6E 4DR1I 1DQ3A 3HKMA 4DR6I 4WUBA 3OMLA 5C0XA 2NA2A 2EPMX 4R2AA 2V2ZA 2YTEA 3IWDA 1Z0TA 2BA0D 1KVKA 2WP8A 2EOSA 2EOJA 1STUA 3T1HE 3T1HI 4I8OA 2YT4A 2D9HA 2EOIA 5A6BA 4TUGA 4R1FA 5ELWA 4DU8A 1L4SA 1T4LB 2HFSA 3C6MA 2NABA 1HK7A 2EPKX 3ZKDA 4ZYDA 4F9AB 1T39A 1N32E 2LE2A 2VF3A 1N32I 2C39A 2O1UA 2IESA 2VE7C 1IBME 3QT8A 4BA1A 1JK2A 1FNMA 3M99B 1IBMI 4OO1A 5FLXC 2F8BA 2EOXA 5T6JA 1P42A 1YPNA 3WU6A 4MU1A 5IWAE 4BC9A 1N3GA 2EPOA 4DPTA 1S4EA 5GMEA 4L8NA 1NEIA 3THOB 4MU4A 2HJJA 4LF8E 1K47A 1WRJA 4LF8I 1G2DC 4GQUA 5K36B 5LLQA 4HACA 2LUQA 4JYAE 2JEAA 5A6JA 4JYAI 5IV8B 4JI0E 2LVHA 2LTRA 4JI0I 2NPFA 5C0XD 1HNZE 3JU0A 1HNZI 4KHPE 3T1YI 1BBOA 2EM9A 2DMIA 4DV3E 1RQ0A 2M4IA 4DV3I 5KL3A 1NCSA 1N0UA 3PYDA 2EN3A 2L6MA 2EPUA 4DKKA 3BGHA 1PIEA 4DMIA 1YHCA 4JG4A 3EQ1A 4F54A 1KJKA 1DGCA 1X6HA 3ECRA 5C0XE 2RS7A 2GQ0A 2EM5A 1HR0E 4YY3E 4DPWA 2DRPA 5A6BD 1RREA 4YY3I 5JEAB 3F6HA 2EM4A 4M0VA 4NXNE 2LUPB 3HPSA 3CDIA 2M9AA 2RQLA 2PNLA 1RMDA 1DARA 3BIDA 3ZZTA 2ELYA 3EPJA 1RC7A 1KKHA 4MDTA 1OYPA 5A2QQ 2CPNA 4OO1D 1ZXMA 1EH8A 4F9BB 4MLVA 3PYFA 3C6KA 3AV0A 1NHJA 3WU3A 1XNQI 1HNWE 3U1YA 2WCC3 4RPFA 2EQ0A 2CG9A 3HTXA 1EA6A 2EQ1A 1IBLE 3THNA 4FW7A 1IBLI 4IS9A 2YZTA 4B3SE 4OO1E 3V5RA 3P3CA 2ADRA 2EN6A 2PNZB 3M85D 1FWKA 3JAMQ 4JI4E 1N0VC 4BBYA 5CFFE 1GQEA 4LFAE 1A6FA 5C0XF 4JI4I 3DD6A 2EMIA 4LFAI 2EOMA 2K7IA 2LRSA 2EL6A 2EM3A 4DV0E 2UXCE 1UDOA 2J7KA 2V8PA 4DV0I 2UXCI 2EMXA 1FKAE 2A2CA 2GHFA 4P52A 4I3HA 3J80C 4DPUA 2EMWA 3CWVA 4OKGA 2LJUA 3HPZA 4NXME 2BB8A 5DROA 4USMA 4NXMI 2V8QB 1J5EE 1B62A 3ZM7A 3L7ZB 1MU5A 2AJ4A 1J5EI 5TSEA 1OYRA 2WBTA 3J7Yp 2L92A 1UN6B 4DR7E 3L00A 1Z0VA 1HNXI 3LMLA 4DR7I 2YTGA 5BR8E 4WSGA 1KTVA 4IZKB 5BR8I 5LMNI 4KQVA 4JV5E 2EN4A 5DRQA 2EN2A 3WU4A 4X8WA 4LU9A 1EKZA 2I13A 1X49A 1MGTA 4DV6E 2BV3A 2PO1B 2MDRA 4F9CB 1VISA 2IOPA 4DV6I 4OO1F 5K36A 4O5GA 3UK3C 2MKDA 2WZOA 2YTQA 3QT5A 4WX9A 1H73A 1KYQA 2JOXA 3Q6NA 5C0XC 4IFDB 2EJ4A 5DNLA 2UU9E 2UU9I 1AH5A 4U3BA 2UXBI 3ADLA 2YTJA 1N33E 2V2VA 4FW9A 1WHNA 1N33I 2YWQA 4GKKE 3V2UC 2DEJA 4GKKI 2GLIA 1X47A 2PNMA 5A6KA 1Z0EA 2VESA 3LPSA 3M7ND 2YSOA 2EE8A 3EPKA 5LMUE 2CSHA 1A1JA 5AE2A 5JEAA 5LMUI 3GONA 4FWHA 1SR9A 3VYYA 5DNXA 1RHYA 4LFCE 2Z5BB 4DUZE 2ENAA 4LFCI 3BBGA 2EL4A 1UBDC 4OX9E 1IQSA 2DB2A 4DUZI 2O1WA 4OX9I 4FW6A 1YUJA 1P47A 1U2RA 2DSYA 1H7SA 2EOHA 1H74A 4OO1C 1MG7A 2HK3A 3BF2A 1XXEA 2J7JA 2EWLA 3PS2A 4QNJA 3B82A 2VQFI 4J3DA 1QZRA 5FLXQ 5ADZA 4DR2E 4DR2I 1ZM4A 4AIDA 4B3TE 2BR2A 4B3TI 2CTDA 4J8ZA 1B63A 5LL6R 2JP9A 4BC7A 2Z5EA 4R2QA 3M85G 5K36D 4AIMA 2PNZA 4BMJA 2B7VA 2JY9A 2M1SA 3P3EA 1D6TA 4O24A 3JTZA 1E3HA 1OJ4A 1Y4UA 2EOEA 3KZYA 5KL6A 4X65E 1T4NA 1E3PA 4X65I 3F0NA 1YYWA 2X7IA 1A1KA 2ENHA 5K36E 2RPCA 4ZYEA 2E1RA 5AE3A 1MX0A 2JVAA 2L3CA 2EMKA 2EN1A 1WUUA 2YSPA 2GS8A 2V34A 2MKNA 3H4LA 1X6FA 3L7ZA 3LLHA 4IZJB 1ZU1A 5L3JA 1X5WA 2EMZA 3T1YE 1OYSA 3K85A 4MQYA 4OOGC 4HY1A 2RS6A 5KL5A 2JPAA 4F6NA 4FW4A 2NN6B 5JEAD 2DEIA 4IZKA 5DRPA 2YRMA 3LNUA 4WUCA 4IFDC 3WU5A 2EPNA 2L2MA 4AM3A 1GZ6A 2VF1A 1N36E 3HULA 4M2ZA 1N36I 4BCAA 2YPNA 1QNTA 4IJDA 2YTOA
chains in the Genus database with same CATH topology
1NHHA 2F4VE 3ADGA 2F4VI 4B3ME 4B3MI 1ZM2A 3DF6A 2G7HA 4R8OA 3IWCA 2FTXB 4LTYA 2LBSB 1FI4A 1NHIA 1ZBTA 4DV4E 4DV4I 2L3JA 2LMZA 4JI8E 1XNQE 4JI8I 4DU7A 3J7AG 5GMDA 3P06A 2V2QA 3AUZA 4LF9E 4LF9I 2H36X 4DR4E 1ZBQA 4YHHE 4DR4I 4BS9A 4YHHI 2UUBI 2B3TB 2Z5BA 3HQ1A 4JI6I 3J80Q 2RSMA 2DMYA 2A2DA 2HFUA 3ZZUA 1UILA 4FWDA 1WXRA 4MYTA 1Z0BA 1HNXE 4X62I 4JI2E 2UUAE 4HYMA 3M6AA 2JOBA 2M7QA 4JI2I 2UUAI 5LMNE 1N34E 4X66E 1N34I 2EZ6A 4X66I 4N3OA 4ED4A 1Z59A 1O0WA 4JI3E 4JI3I 1WHQA 2O1TA 4FWGA 4LF6E 4LF5E 4LF6I 4LF5I 4WPYA 1Z5AA 2ZM6E 4P7AA 1Y4SA 3J81C 2ZM6I 3J7AM 3PYGA 3C4TA 3K6QA 4IZJA 4GKJE 4X64E 2R42A 4GKJI 4JI1E 2UXBE 4X64I 2HKJA 4JI1I 3B78A 1QU6A 3Q1QA 5DNYA 5IT9C 2V87A 4WSPA 4B3RE 4B3RI 2XEXA 4LF7E 4DV1E 3HXLA 4PRXA 4DV1I 4FN5A 4LF7I 3HJCA 2HHHE 2NUFA 2HHHI 1Z5CA 4UTGA 4M30A 2E5LE 4HXZA 2E5LI 2KOUA 3QT6A 4P7DA 1I94E 1Y6ZA 4DV5E 1I94I 4DV5I 1YYKA 2IOQA 2LTSA 4DR3E 4LFBE 2VQFE 4DR3I 4LFBI 2VQEE 4PRVA 2VQEI 3K17A 4L5NC 2CZ9A 4KZSA 1KIJA 5FWKA 4LF4E 4LF4I 1USUA 1USVA 1J26A 2WW4A 3F6GA 4PU9A 5AASA 4IZJD 3VK6A 2L2NA 1FJGE 2V88A 1BKNA 1XHKA 1FJGI 2V83A 2LJHA 1ZM9A 2RTXA 2V89A 4EMDA 3C4BA 4DV7E 1IBKE 4DV7I 1IBKI 3LTOA 1YYOA 2BM1A 4USKA 2UUCE 2UUCI 2V86A 5IWAI 2IHR1 3PYEA 1X48A 1PVGA 2OI2A 2N3GA 2ZITA 4Z7CA 4GEQB 1Z5BA 2FGGA 2CGEA 1YZ9A 2Z5CB 1T4OA 2JR1A 2ODRC 2HK2A 3DJWA 1XMQE 4AQYE 1XMQI 2X36A 4R03A 2KONA 4AQYI 3B8HA 4ZVIA 1NZ0A 1RR9A 4KHPI 2L33A 2N3HA 2B7TA 4DV2E 1DI2A 2B9DA 4DV2I 2LJPA 1Z0WA 4DPYA 2ZBKB 2UXDE 4Z7YA 1HR0I 2UXDI 1UEKA 3RMPA 2UUBE 1H7UA 4NXNI 4JI6E 3VYXA 4UT4A 3Q6MA 4MYUA 3QT7A 5AE1A 3PRYA 2EFGA 3FIGA 1FWLA 4XTJA 1HNWI 5A2QC 1PKPA 4DUYE 3IWBA 4DUYI 4X62E 2BM0A 4JI5E 3H09A 4JI5I 2JWOA 3KWRA 4B3SI 2L8TA 2MC5A 4URLA 4M1KA 3D4JA 3J81Q 2NUEA 4WYQB 1S16A 2KHXA 1ZXNA 4DXLA 3K1JA 1ELOA 3ADJA 3JAMC 4HACB 2E1MA 3OTOE 3OTOI 2ODRD 2O1VA 5IT9Q 1UHZA 1Z0GA 2V85A 2Q2EB 2FV4B 2HKEA 4DPXA 3ZZ0A 4JV5I 4WUDA 1H72C 4WFTA 4TUIA 1Z0CA 2DIXA 4K0KE 3MSWA 4K0KI 3ADIA 2K4VA 4JI7E 2NUGA 4JI7I 4DR5E 4Q28A 2Z5CA 1ZM3A 4DR5I 3P1XA 4P78A 1EI1A 2MC6A 3ZOQB 5F3WA 3ZKBA 2L2KB 1XMOE 1XMOI 1XNRE 2R3VA 4DR1E 1XNRI 4DR6E 4DR1I 1DQ3A 4DR6I 4WUBA 3OMLA 2NA2A 2V2ZA 3IWDA 1Z0TA 1KVKA 1STUA 3T1HE 3T1HI 4I8OA 2YT4A 4TUGA 4R1FA 4DU8A 1T4LB 2HFSA 1HK7A 3ZKDA 1N32E 4F9AB 2LE2A 2VF3A 1N32I 2O1UA 2VE7C 1IBME 3QT8A 1FNMA 1IBMI 5FLXC 2F8BA 5T6JA 3WU6A 5IWAE 4BC9A 4DPTA 1S4EA 5GMEA 4L8NA 4LF8E 1K47A 4LF8I 4HACA 2LUQA 4JYAE 4JYAI 4JI0E 2LTRA 4JI0I 2NPFA 1HNZE 3JU0A 1HNZI 4KHPE 3T1YI 4DV3E 1RQ0A 2M4IA 4DV3I 1N0UA 3PYDA 2L6MA 4DKKA 1PIEA 4DMIA 4JG4A 2RS7A 2GQ0A 1HR0E 4YY3E 4DPWA 1RREA 4YY3I 3F6HA 4M0VA 4NXNE 2LUPB 3HPSA 2PNLA 1DARA 3ZZTA 1KKHA 1RC7A 5A2QQ 2CPNA 1ZXMA 4F9BB 3PYFA 3AV0A 1NHJA 3WU3A 1XNQI 1HNWE 4RPFA 2CG9A 3HTXA 1EA6A 1IBLE 1IBLI 2YZTA 4B3SE 3V5RA 1FWKA 3JAMQ 4JI4E 1N0VC 4BBYA 5CFFE 1GQEA 4LFAE 1A6FA 4JI4I 4LFAI 2LRSA 4DV0E 2UXCE 2J7KA 2V8PA 4DV0I 2UXCI 1FKAE 2A2CA 4P52A 4I3HA 4DPUA 3J80C 3CWVA 3HPZA 4NXME 4USMA 4NXMI 2V8QB 1J5EE 1B62A 3ZM7A 1MU5A 2AJ4A 1J5EI 3J7Yp 2L92A 4DR7E 1Z0VA 1HNXI 3LMLA 4DR7I 5BR8E 1KTVA 4IZKB 5BR8I 5LMNI 4KQVA 4JV5E 3WU4A 4X8WA 4LU9A 1EKZA 2BV3A 1X49A 4DV6E 2MDRA 4F9CB 1VISA 2IOPA 4DV6I 2WZOA 3QT5A 1H73A 2JOXA 3Q6NA 2UU9E 2UU9I 2UXBI 3ADLA 1N33E 2V2VA 4FW9A 1WHNA 1N33I 4GKKE 3V2UC 2DEJA 4GKKI 1X47A 2PNMA 1Z0EA 3LPSA 5LMUE 5AE2A 5LMUI 3GONA 4FWHA 1SR9A 3VYYA 4LFCE 2Z5BB 4DUZE 4LFCI 4OX9E 4DUZI 2DB2A 4OX9I 2O1WA 1U2RA 2DSYA 1H7SA 1H74A 1MG7A 2HK3A 2EWLA 3B82A 2VQFI 1QZRA 5FLXQ 5ADZA 4DR2E 4DR2I 1ZM4A 4B3TE 4B3TI 4J8ZA 1B63A 5LL6R 4BC7A 2Z5EA 4BMJA 2B7VA 2JY9A 2M1SA 1D6TA 3JTZA 1OJ4A 1Y4UA 4X65E 1T4NA 4X65I 3F0NA 1YYWA 2X7IA 2E1RA 5AE3A 1MX0A 2JVAA 2L3CA 1WUUA 2GS8A 2V34A 3H4LA 3LLHA 4IZJB 5L3JA 3K85A 3T1YE 4OOGC 4HY1A 2RS6A 2DEIA 4IZKA 3LNUA 4WUCA 3WU5A 2L2MA 1GZ6A 2VF1A 1N36E 3HULA 4M2ZA 1N36I 4BCAA 4F54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHH A;  2F4V E;  3ADG A;  2F4V I;  4B3M E;  4B3M I;  1ZM2 A;  1NHI A;  2LBS B;  1FI4 A;  1ZBT A;  4DV4 E;  4DV4 I;  2L3J A;  4JI8 E;  1XNQ E;  4JI8 I;  4DU7 A;  3J7A G;  5GMD A;  2V2Q A;  4LF9 E;  4LF9 I;  4DR4 E;  4YHH E;  4DR4 I;  4YHH I;  2UUB I;  2B3T B;  4JI6 I;  3J80 Q;  2RSM A;  2DMY A;  2A2D A;  2HFU A;  3ZZU A;  1UIL A;  4FWD A;  4MYT A;  1Z0B A;  1HNX E;  4X62 I;  4JI2 E;  2UUA E;  4HYM A;  3M6A A;  4JI2 I;  2UUA I;  5LMN E;  1N34 E;  4X66 E;  1N34 I;  2EZ6 A;  4X66 I;  4ED4 A;  1Z59 A;  1O0W A;  4JI3 E;  4JI3 I;  1WHQ A;  4FWG A;  4LF6 E;  4LF5 E;  4LF6 I;  4LF5 I;  1Z5A A;  2ZM6 E;  4P7A A;  3J81 C;  2ZM6 I;  3J7A M;  3PYG A;  3C4T A;  4GKJ E;  4X64 E;  2R42 A;  4GKJ I;  4JI1 E;  2UXB E;  4X64 I;  2HKJ A;  4JI1 I;  3B78 A;  1QU6 A;  3Q1Q A;  5IT9 C;  4B3R E;  4B3R I;  2XEX A;  4LF7 E;  4DV1 E;  4LF7 I;  4PRX A;  4DV1 I;  4FN5 A;  2HHH E;  2NUF A;  2HHH I;  1Z5C A;  4UTG A;  4M30 A;  2E5L E;  4HXZ A;  2E5L I;  3QT6 A;  1I94 E;  1I94 I;  4DV5 E;  4DV5 I;  1YYK A;  2LTS A;  4DR3 E;  4LFB E;  2VQF E;  4DR3 I;  4LFB I;  2VQE E;  4PRV A;  2VQE I;  3K17 A;  2CZ9 A;  1KIJ A;  4LF4 E;  4LF4 I;  1J26 A;  2WW4 A;  4PU9 A;  2L2N A;  1FJG E;  1BKN A;  1XHK A;  1FJG I;  2LJH A;  1ZM9 A;  2RTX A;  4EMD A;  3C4B A;  4DV7 E;  1IBK E;  4DV7 I;  1IBK I;  3LTO A;  1YYO A;  2BM1 A;  4USK A;  2UUC E;  2UUC I;  5IWA I;  2IHR 1;  3PYE A;  1X48 A;  1PVG A;  2OI2 A;  2N3G A;  2ZIT A;  4Z7C A;  1Z5B A;  1YZ9 A;  1T4O A;  2HK2 A;  1XMQ E;  4AQY E;  1XMQ I;  2X36 A;  4AQY I;  3B8H A;  4ZVI A;  1NZ0 A;  1RR9 A;  4KHP I;  2L33 A;  2N3H A;  2B7T A;  4DV2 E;  1DI2 A;  4DV2 I;  2LJP A;  1Z0W A;  4DPY A;  2ZBK B;  2UXD E;  4Z7Y A;  1HR0 I;  2UXD I;  1UEK A;  2UUB E;  1H7U A;  4NXN I;  4JI6 E;  3VYX A;  4UT4 A;  4MYU A;  3QT7 A;  2EFG A;  1FWL A;  4XTJ A;  1HNW I;  5A2Q C;  1PKP A;  4DUY E;  4DUY I;  4X62 E;  2BM0 A;  4JI5 E;  4JI5 I;  4B3S I;  4URL A;  4M1K A;  3D4J A;  3J81 Q;  2NUE A;  4WYQ B;  1S16 A;  2KHX A;  1ZXN A;  4DXL A;  3K1J A;  1ELO A;  3ADJ A;  3JAM C;  4HAC B;  3OTO E;  3OTO I;  5IT9 Q;  1UHZ A;  1Z0G A;  2Q2E B;  2HKE A;  4DPX A;  3ZZ0 A;  4JV5 I;  4WUD A;  1H72 C;  4WFT A;  1Z0C A;  2DIX A;  4K0K E;  4K0K I;  3ADI A;  4JI7 E;  2NUG A;  4JI7 I;  4DR5 E;  1ZM3 A;  4DR5 I;  3P1X A;  1EI1 A;  3ZKB A;  2L2K B;  1XMO E;  1XMO I;  1XNR E;  2R3V A;  4DR1 E;  1XNR I;  4DR6 E;  4DR1 I;  4DR6 I;  4WUB A;  2NA2 A;  2V2Z A;  1Z0T A;  1KVK A;  1STU A;  3T1H E;  3T1H I;  2YT4 A;  4R1F A;  4DU8 A;  1T4L B;  2HFS A;  3ZKD A;  1N32 E;  2VF3 A;  1N32 I;  1IBM E;  3QT8 A;  1FNM A;  1IBM I;  5FLX C;  3WU6 A;  5IWA E;  4DPT A;  1S4E A;  5GME A;  4LF8 E;  1K47 A;  4LF8 I;  4HAC A;  2LUQ A;  4JYA E;  4JYA I;  4JI0 E;  2LTR A;  4JI0 I;  2NPF A;  1HNZ E;  1HNZ I;  4KHP E;  3T1Y I;  4DV3 E;  1RQ0 A;  4DV3 I;  1N0U A;  3PYD A;  4DKK A;  1PIE A;  4JG4 A;  2RS7 A;  1HR0 E;  4YY3 E;  4DPW A;  1RRE A;  4YY3 I;  4NXN E;  2LUP B;  1DAR A;  3ZZT A;  1KKH A;  1RC7 A;  5A2Q Q;  2CPN A;  1ZXM A;  3PYF A;  1NHJ A;  3WU3 A;  1XNQ I;  1HNW E;  4RPF A;  3HTX A;  1EA6 A;  1IBL E;  1IBL I;  4B3S E;  3V5R A;  1FWK A;  3JAM Q;  4JI4 E;  1N0V C;  5CFF E;  4LFA E;  1GQE A;  1A6F A;  4JI4 I;  4LFA I;  2LRS A;  4DV0 E;  2UXC E;  2J7K A;  2V8P A;  4DV0 I;  2UXC I;  1FKA E;  2A2C A;  4P52 A;  4I3H A;  4DPU A;  3J80 C;  3CWV A;  4NXM E;  4USM A;  4NXM I;  1B62 A;  1J5E E;  3ZM7 A;  1MU5 A;  2AJ4 A;  1J5E I;  3J7Y p;  4DR7 E;  1HNX I;  1Z0V A;  4DR7 I;  5BR8 E;  1KTV A;  5BR8 I;  5LMN I;  4KQV A;  4JV5 E;  3WU4 A;  4X8W A;  1EKZ A;  2BV3 A;  1X49 A;  4DV6 E;  2MDR A;  4DV6 I;  1VIS A;  3QT5 A;  1H73 A;  2UU9 E;  2UU9 I;  2UXB I;  3ADL A;  1N33 E;  2V2V A;  4FW9 A;  1WHN A;  1N33 I;  4GKK E;  3V2U C;  2DEJ A;  4GKK I;  1X47 A;  1Z0E A;  3LPS A;  5LMU E;  5LMU I;  3GON A;  4FWH A;  3VYY A;  4LFC E;  4DUZ E;  4LFC I;  4OX9 E;  4DUZ I;  2DB2 A;  4OX9 I;  1U2R A;  1H7S A;  1H74 A;  1MG7 A;  2HK3 A;  3B82 A;  2VQF I;  1QZR A;  5FLX Q;  4DR2 E;  4DR2 I;  1ZM4 A;  4B3T E;  4B3T I;  1B63 A;  5LL6 R;  2B7V A;  2JY9 A;  1D6T A;  1OJ4 A;  4X65 E;  1T4N A;  4X65 I;  3F0N A;  1YYW A;  2X7I A;  2E1R A;  1MX0 A;  2JVA A;  2L3C A;  1WUU A;  2GS8 A;  2V34 A;  3H4L A;  3LLH A;  5L3J A;  3T1Y E;  4OOG C;  4HY1 A;  2RS6 A;  2DEI A;  3LNU A;  4WUC A;  3WU5 A;  2L2M A;  1N36 E;  3HUL A;  4M2Z A;  1N36 I; 
#chains in the Genus database with same CATH topology
 5JEA E;  1NHH A;  3NZK A;  2YRK A;  1PJS A;  2F4V E;  3ADG A;  2F4V I;  4B3M E;  3EPL A;  4LCG A;  4B3M I;  4F2J C;  1ZM2 A;  2EN7 A;  3DF6 A;  4BA2 B;  4IFD A;  2G7H A;  2I9I A;  4R8O A;  3IWC A;  2FTX B;  1PJT A;  4LTY A;  2LBS B;  1FI4 A;  1NHI A;  1ZBT A;  4DV4 E;  2JT2 A;  4DV4 I;  1Y5Y A;  2L3J A;  4BHC A;  5K36 F;  2GPI A;  2LMZ A;  2YU8 A;  4JI8 E;  3VHT B;  2HC5 A;  1YUI A;  1XNQ E;  2JE6 B;  3J7A G;  4JI8 I;  4DU7 A;  5GMD A;  1VI7 A;  3P06 A;  2V2Q A;  3AUZ A;  4LF9 E;  2BA0 G;  4LF9 I;  2BR2 B;  2H36 X;  4DR4 E;  3UHM A;  1ZBQ A;  4YHH E;  2E72 A;  1JK1 A;  4DR4 I;  4BS9 A;  4YHH I;  2UUB I;  2B3T B;  1WJP A;  2Z5B A;  3HQ1 A;  4JI6 I;  3J80 Q;  2RSM A;  2J65 A;  2DMY A;  2GO3 A;  2A2D A;  5JEA F;  2EOQ A;  2EOR A;  2YTF A;  2HFU A;  2EPX A;  2LV2 A;  1X6E A;  3ZZU A;  1UIL A;  2EOO A;  2EOF A;  2WBS A;  1Z1B A;  4FWD A;  1WXR A;  4MYT A;  1Z0B A;  1A1F A;  1HNX E;  4X62 I;  5K36 C;  4JI2 E;  2UUA E;  5A6A A;  3M6A A;  2JOB A;  2M7Q A;  1A1L A;  2HGH A;  4HYM A;  2UUA I;  4JI2 I;  5LMN E;  4O43 A;  2EQ3 A;  1N34 E;  2DLQ A;  4X66 E;  1N34 I;  2EZ6 A;  4X66 I;  1SFE A;  4N3O A;  4ED4 A;  1Z59 A;  4IFD D;  2EPC A;  1O0W A;  4JI3 E;  4JI3 I;  1WHQ A;  2O1T A;  4FWG A;  2EMY A;  2NN6 C;  1A1I A;  4LF6 E;  4LF5 E;  2EP3 A;  4LF6 I;  4LF5 I;  2PO2 B;  4WPY A;  1Z5A A;  4LCF A;  1T38 A;  2ZM6 E;  4P7A A;  1Y4S A;  3J81 C;  2EMH A;  2ZM6 I;  3J7A M;  3PYG A;  3C4T A;  3K6Q A;  4IFD E;  4IZJ A;  1BBG A;  4GKJ E;  4X64 E;  2R42 A;  4GKJ I;  4JI1 E;  2EPR A;  2UXB E;  4U3D A;  2HKJ A;  4X64 I;  4NHR A;  4JI1 I;  5JEA C;  2A25 A;  2NN6 A;  4IS1 C;  2CT1 A;  2ENC A;  4NZV A;  2R1F A;  3B78 A;  1QU6 A;  3Q1Q A;  4HEI A;  5DRR A;  2R76 A;  1YFH A;  4N4R B;  5DNY A;  5IT9 C;  2YU5 A;  2V87 A;  4WSP A;  4B3R E;  2EMF A;  2EN8 A;  2EPZ A;  1A1G A;  4B3R I;  2XEX A;  4LF7 E;  2YTN A;  4O4K A;  4DV1 E;  3HXL A;  4PRX A;  4DV1 I;  4FN5 A;  4LF7 I;  2C38 B;  3HJC A;  1TF3 A;  1PDA A;  1EH6 A;  1IQO A;  2HHH E;  2NUF A;  2HHH I;  1Z5C A;  4UTG A;  2EMB A;  4M30 A;  2E5L E;  1X3C A;  4HXZ A;  2E5L I;  2KOU A;  2EPL X;  4R2E A;  4BA2 A;  3QT6 A;  2BBG A;  4P7D A;  1I94 E;  4KWY A;  1Y6Z A;  4DV5 E;  1I94 I;  4LOM A;  4DV5 I;  1YYK A;  2IOQ A;  2LTS A;  3KRN A;  4R2D A;  4DR3 E;  4LFB E;  2BA1 D;  2VQF E;  2WNR B;  4DR3 I;  2MDG A;  2VQE E;  4LFB I;  4PRV A;  2JE6 A;  2VQE I;  3K17 A;  2LCE A;  4L5N C;  2CZ9 A;  4IFD F;  2EPA A;  3P3G A;  4KZS A;  3TQM A;  4ZYH A;  1KIJ A;  1TF6 A;  4LF4 E;  1IMU A;  1Y60 A;  5FWK A;  2EM6 A;  2EMG A;  4LCH A;  4LF4 I;  2PO1 A;  3H1C A;  1USU A;  1USV A;  1J26 A;  2WW4 A;  4NBQ A;  1LLM C;  2RSI A;  3F6G A;  1AAY A;  1UDN A;  3EPH A;  1UDQ A;  4PU9 A;  5AAS A;  2EL5 A;  4IZJ D;  3VK6 A;  2DLK A;  2L2N A;  1FJG E;  2V88 A;  1BKN A;  1XHK A;  5EKW A;  1FJG I;  2NN6 D;  2V83 A;  1R6L A;  2Q8U A;  4WXD A;  2LJH A;  4MU0 A;  1ZM9 A;  2RTX A;  2V89 A;  2VRD A;  4EMD A;  3C4B A;  4DV7 E;  1IBK E;  2C37 B;  2CVE A;  4DV7 I;  1IBK I;  3P76 A;  3LTO A;  4RHB B;  1YYO A;  2JEB A;  1F2I G;  2BM1 A;  2NN6 E;  4X9J A;  4USK A;  2UUC E;  2UUC I;  2V86 A;  5IWA I;  2IHR 1;  3PYE A;  1X48 A;  2EML A;  5AC4 A;  1YSA C;  1PVG A;  2OI2 A;  3PS1 A;  2N3G A;  4R2C A;  2ZIT A;  4Z7C A;  4GEQ B;  1Z5B A;  2EOZ A;  1YH8 A;  1BB8 A;  2FGG A;  4BHB A;  3B4T A;  4M9V C;  3KZZ A;  2PO2 A;  4FW3 A;  4HTG A;  1A1H A;  2CGE A;  1YZ9 A;  2Z5C B;  4RH8 A;  4MU3 A;  4WXC A;  1UDS A;  1T4O A;  2JR1 A;  2ODR C;  2HK2 A;  2WBU A;  3DJW A;  1XMQ E;  4AQY E;  1XMQ I;  2X36 A;  4R03 A;  2KON A;  4AQY I;  2YTI A;  4OZE A;  2PO0 B;  3B8H A;  4ZVI A;  1NZ0 A;  1RR9 A;  4KHP I;  2L33 A;  4QNK A;  2N3H A;  3MHH C;  5A69 A;  2B7T A;  1G2F C;  4ISA A;  4DV2 E;  4Q35 B;  1DI2 A;  4GZN C;  2B9D A;  5C0X B;  4DV2 I;  2LJP A;  1Z0W A;  1EH7 A;  2ZBK B;  2UXD E;  4Z7Y A;  4DPY A;  1HR0 I;  2UXD I;  1UEK A;  3RMP A;  2C38 A;  4FK5 C;  2UUB E;  2EPP A;  2NN6 F;  2WP8 B;  4R2S A;  1H7U A;  1B69 A;  2LO3 A;  4FW5 A;  4JI6 E;  4NXN I;  2AE8 A;  4LPF A;  2EMA A;  3VYX A;  2EM2 A;  4F6M A;  4UT4 A;  3Q6M A;  4MYU A;  2DGC A;  2BA1 G;  3QT7 A;  4R2P A;  5AE1 A;  3PRY A;  5KL7 A;  2EFG A;  1R6M A;  3FIG A;  2F1D A;  2WNR A;  2N8X A;  2LT7 A;  5KL4 A;  1FWL A;  4XTJ A;  1HNW I;  5A2Q C;  1PKP A;  1MEY C;  1ZAA C;  4DUY E;  3IWB A;  2IER A;  4DUY I;  2C39 B;  4X62 E;  2BM0 A;  4JI5 E;  1TN9 A;  4BA1 B;  3H09 A;  2JEB B;  3MHS C;  4JI5 I;  4OO1 B;  2JWO A;  3KWR A;  4B3S I;  2L8T A;  2MC5 A;  4URL A;  4M1K A;  3D4J A;  2GO4 A;  3J81 Q;  2JXP A;  5IXM B;  2NUE A;  3PS3 A;  4WYQ B;  1S16 A;  2KHX A;  2EMC A;  1ZXN A;  3CDJ A;  3K1J A;  4DXL A;  1ELO A;  3ADJ A;  3JAM C;  4HAC B;  2E1M A;  4ZYG A;  3OTO E;  2JEA B;  3OTO I;  2C37 A;  4R2R A;  2ODR D;  1ZR9 A;  2O1V A;  5IT9 Q;  5KL2 A;  1UHZ A;  1Z0G A;  2V85 A;  2JYA A;  2Q2E B;  2FV4 B;  2EM7 A;  2HKE A;  2EOY A;  4DPX A;  3ZZ0 A;  2ELZ A;  3QG5 C;  3GME A;  4WUD A;  1H72 C;  4WFT A;  2YTP A;  4JV5 I;  4TUI A;  1Z0C A;  2YRH A;  2DIX A;  3M7N G;  4K0K E;  2YTD A;  3MSW A;  3GCM A;  4K0K I;  3ADI A;  2K4V A;  2EM8 A;  4JI7 E;  2NUG A;  5EL9 A;  4JI7 I;  4DR5 E;  4Q28 A;  2Z5C A;  1PJQ A;  1ZM3 A;  3U1K A;  3P1X A;  4DR5 I;  4P78 A;  3GLL A;  1EI1 A;  2EM0 A;  2MC6 A;  3ZOQ B;  5F3W A;  3ZKB A;  2PO0 A;  2PRT A;  2L2K B;  5AC5 A;  1XMO E;  2O3Z A;  4MLQ A;  1XMO I;  1XNR E;  1GTK A;  2R3V A;  4DR1 E;  1XNR I;  4DR6 E;  4DR1 I;  1DQ3 A;  3HKM A;  4DR6 I;  4WUB A;  3OML A;  5C0X A;  2NA2 A;  2EPM X;  4R2A A;  2V2Z A;  2YTE A;  3IWD A;  1Z0T A;  2BA0 D;  1KVK A;  2WP8 A;  2EOS A;  2EOJ A;  1STU A;  3T1H E;  3T1H I;  4I8O A;  2YT4 A;  2D9H A;  2EOI A;  5A6B A;  4TUG A;  4R1F A;  5ELW A;  4DU8 A;  1L4S A;  1T4L B;  2HFS A;  3C6M A;  2NAB A;  1HK7 A;  2EPK X;  3ZKD A;  4ZYD A;  4F9A B;  1T39 A;  1N32 E;  2LE2 A;  2VF3 A;  1N32 I;  2C39 A;  2O1U A;  2IES A;  2VE7 C;  1IBM E;  3QT8 A;  4BA1 A;  1JK2 A;  1FNM A;  3M99 B;  1IBM I;  4OO1 A;  5FLX C;  2F8B A;  2EOX A;  5T6J A;  1P42 A;  1YPN A;  3WU6 A;  4MU1 A;  5IWA E;  4BC9 A;  1N3G A;  2EPO A;  4DPT A;  1S4E A;  5GME A;  4L8N A;  1NEI A;  3THO B;  4MU4 A;  2HJJ A;  4LF8 E;  1K47 A;  1WRJ A;  4LF8 I;  1G2D C;  4GQU A;  5K36 B;  5LLQ A;  4HAC A;  2LUQ A;  4JYA E;  2JEA A;  5A6J A;  4JYA I;  5IV8 B;  4JI0 E;  2LVH A;  2LTR A;  4JI0 I;  2NPF A;  5C0X D;  1HNZ E;  3JU0 A;  1HNZ I;  4KHP E;  3T1Y I;  1BBO A;  2EM9 A;  2DMI A;  4DV3 E;  1RQ0 A;  2M4I A;  4DV3 I;  5KL3 A;  1NCS A;  1N0U A;  3PYD A;  2EN3 A;  2L6M A;  2EPU A;  4DKK A;  3BGH A;  1PIE A;  4DMI A;  1YHC A;  4JG4 A;  3EQ1 A;  4F54 A;  1KJK A;  1DGC A;  1X6H A;  3ECR A;  5C0X E;  2RS7 A;  2GQ0 A;  2EM5 A;  1HR0 E;  4YY3 E;  4DPW A;  2DRP A;  5A6B D;  1RRE A;  4YY3 I;  5JEA B;  3F6H A;  2EM4 A;  4M0V A;  4NXN E;  2LUP B;  3HPS A;  3CDI A;  2M9A A;  2RQL A;  2PNL A;  1RMD A;  1DAR A;  3BID A;  3ZZT A;  2ELY A;  3EPJ A;  1RC7 A;  1KKH A;  4MDT A;  1OYP A;  5A2Q Q;  2CPN A;  4OO1 D;  1ZXM A;  1EH8 A;  4F9B B;  4MLV A;  3PYF A;  3C6K A;  3AV0 A;  1NHJ A;  3WU3 A;  1XNQ I;  1HNW E;  3U1Y A;  2WCC 3;  4RPF A;  2EQ0 A;  2CG9 A;  3HTX A;  1EA6 A;  2EQ1 A;  1IBL E;  3THN A;  4FW7 A;  1IBL I;  4IS9 A;  2YZT A;  4B3S E;  4OO1 E;  3V5R A;  3P3C A;  2ADR A;  2EN6 A;  2PNZ B;  3M85 D;  1FWK A;  3JAM Q;  4JI4 E;  1N0V C;  4BBY A;  5CFF E;  1GQE A;  4LFA E;  1A6F A;  5C0X F;  4JI4 I;  3DD6 A;  2EMI A;  4LFA I;  2EOM A;  2K7I A;  2LRS A;  2EL6 A;  2EM3 A;  4DV0 E;  2UXC E;  1UDO A;  2J7K A;  2V8P A;  4DV0 I;  2UXC I;  2EMX A;  1FKA E;  2A2C A;  2GHF A;  4P52 A;  4I3H A;  3J80 C;  4DPU A;  2EMW A;  3CWV A;  4OKG A;  2LJU A;  3HPZ A;  4NXM E;  2BB8 A;  5DRO A;  4USM A;  4NXM I;  2V8Q B;  1J5E E;  1B62 A;  3ZM7 A;  3L7Z B;  1MU5 A;  2AJ4 A;  1J5E I;  5TSE A;  1OYR A;  2WBT A;  3J7Y p;  2L92 A;  1UN6 B;  4DR7 E;  3L00 A;  1Z0V A;  1HNX I;  3LML A;  4DR7 I;  2YTG A;  5BR8 E;  4WSG A;  1KTV A;  4IZK B;  5BR8 I;  5LMN I;  4KQV A;  4JV5 E;  2EN4 A;  5DRQ A;  2EN2 A;  3WU4 A;  4X8W A;  4LU9 A;  1EKZ A;  2I13 A;  1X49 A;  1MGT A;  4DV6 E;  2BV3 A;  2PO1 B;  2MDR A;  4F9C B;  1VIS A;  2IOP A;  4DV6 I;  4OO1 F;  5K36 A;  4O5G A;  3UK3 C;  2MKD A;  2WZO A;  2YTQ A;  3QT5 A;  4WX9 A;  1H73 A;  1KYQ A;  2JOX A;  3Q6N A;  5C0X C;  4IFD B;  2EJ4 A;  5DNL A;  2UU9 E;  2UU9 I;  1AH5 A;  4U3B A;  2UXB I;  3ADL A;  2YTJ A;  1N33 E;  2V2V A;  4FW9 A;  1WHN A;  1N33 I;  2YWQ A;  4GKK E;  3V2U C;  2DEJ A;  4GKK I;  2GLI A;  1X47 A;  2PNM A;  5A6K A;  1Z0E A;  2VES A;  3LPS A;  3M7N D;  2YSO A;  2EE8 A;  3EPK A;  5LMU E;  2CSH A;  1A1J A;  5AE2 A;  5JEA A;  5LMU I;  3GON A;  4FWH A;  1SR9 A;  3VYY A;  5DNX A;  1RHY A;  4LFC E;  2Z5B B;  4DUZ E;  2ENA A;  4LFC I;  3BBG A;  2EL4 A;  1UBD C;  4OX9 E;  1IQS A;  2DB2 A;  4DUZ I;  2O1W A;  4OX9 I;  4FW6 A;  1YUJ A;  1P47 A;  1U2R A;  2DSY A;  1H7S A;  2EOH A;  1H74 A;  4OO1 C;  1MG7 A;  2HK3 A;  3BF2 A;  1XXE A;  2J7J A;  2EWL A;  3PS2 A;  4QNJ A;  3B82 A;  2VQF I;  4J3D A;  1QZR A;  5FLX Q;  5ADZ A;  4DR2 E;  4DR2 I;  1ZM4 A;  4AID A;  4B3T E;  2BR2 A;  4B3T I;  2CTD A;  4J8Z A;  1B63 A;  5LL6 R;  2JP9 A;  4BC7 A;  2Z5E A;  4R2Q A;  3M85 G;  5K36 D;  4AIM A;  2PNZ A;  4BMJ A;  2B7V A;  2JY9 A;  2M1S A;  3P3E A;  1D6T A;  4O24 A;  3JTZ A;  1E3H A;  1OJ4 A;  1Y4U A;  2EOE A;  3KZY A;  5KL6 A;  4X65 E;  1T4N A;  1E3P A;  4X65 I;  3F0N A;  1YYW A;  2X7I A;  1A1K A;  2ENH A;  5K36 E;  2RPC A;  4ZYE A;  2E1R A;  5AE3 A;  1MX0 A;  2JVA A;  2L3C A;  2EMK A;  2EN1 A;  1WUU A;  2YSP A;  2GS8 A;  2V34 A;  2MKN A;  3H4L A;  1X6F A;  3L7Z A;  3LLH A;  4IZJ B;  1ZU1 A;  5L3J A;  1X5W A;  2EMZ A;  3T1Y E;  1OYS A;  3K85 A;  4MQY A;  4OOG C;  4HY1 A;  2RS6 A;  5KL5 A;  2JPA A;  4F6N A;  4FW4 A;  2NN6 B;  5JEA D;  2DEI A;  4IZK A;  5DRP A;  2YRM A;  3LNU A;  4WUC A;  4IFD C;  3WU5 A;  2EPN A;  2L2M A;  4AM3 A;  1GZ6 A;  2VF1 A;  1N36 E;  3HUL A;  4M2Z A;  1N36 I;  4BCA A;  2YPN A;  1QNT A;  4IJD A;  2YTO A; 
#chains in the Genus database with same CATH homology
 1NHH A;  2F4V E;  3ADG A;  2F4V I;  4B3M E;  4B3M I;  1ZM2 A;  3DF6 A;  2G7H A;  4R8O A;  3IWC A;  2FTX B;  4LTY A;  2LBS B;  1FI4 A;  1NHI A;  1ZBT A;  4DV4 E;  4DV4 I;  2L3J A;  2LMZ A;  4JI8 E;  1XNQ E;  4JI8 I;  4DU7 A;  3J7A G;  5GMD A;  3P06 A;  2V2Q A;  3AUZ A;  4LF9 E;  4LF9 I;  2H36 X;  4DR4 E;  1ZBQ A;  4YHH E;  4DR4 I;  4BS9 A;  4YHH I;  2UUB I;  2B3T B;  2Z5B A;  3HQ1 A;  4JI6 I;  3J80 Q;  2RSM A;  2DMY A;  2A2D A;  2HFU A;  3ZZU A;  1UIL A;  4FWD A;  1WXR A;  4MYT A;  1Z0B A;  1HNX E;  4X62 I;  4JI2 E;  2UUA E;  4HYM A;  3M6A A;  2JOB A;  2M7Q A;  4JI2 I;  2UUA I;  5LMN E;  1N34 E;  4X66 E;  1N34 I;  2EZ6 A;  4X66 I;  4N3O A;  4ED4 A;  1Z59 A;  1O0W A;  4JI3 E;  4JI3 I;  1WHQ A;  2O1T A;  4FWG A;  4LF6 E;  4LF5 E;  4LF6 I;  4LF5 I;  4WPY A;  1Z5A A;  2ZM6 E;  4P7A A;  1Y4S A;  3J81 C;  2ZM6 I;  3J7A M;  3PYG A;  3C4T A;  3K6Q A;  4IZJ A;  4GKJ E;  4X64 E;  2R42 A;  4GKJ I;  4JI1 E;  2UXB E;  4X64 I;  2HKJ A;  4JI1 I;  3B78 A;  1QU6 A;  3Q1Q A;  5DNY A;  5IT9 C;  2V87 A;  4WSP A;  4B3R E;  4B3R I;  2XEX A;  4LF7 E;  4DV1 E;  3HXL A;  4PRX A;  4DV1 I;  4FN5 A;  4LF7 I;  3HJC A;  2HHH E;  2NUF A;  2HHH I;  1Z5C A;  4UTG A;  4M30 A;  2E5L E;  4HXZ A;  2E5L I;  2KOU A;  3QT6 A;  4P7D A;  1I94 E;  1Y6Z A;  4DV5 E;  1I94 I;  4DV5 I;  1YYK A;  2IOQ A;  2LTS A;  4DR3 E;  4LFB E;  2VQF E;  4DR3 I;  4LFB I;  2VQE E;  4PRV A;  2VQE I;  3K17 A;  4L5N C;  2CZ9 A;  4KZS A;  1KIJ A;  5FWK A;  4LF4 E;  4LF4 I;  1USU A;  1USV A;  1J26 A;  2WW4 A;  3F6G A;  4PU9 A;  5AAS A;  4IZJ D;  3VK6 A;  2L2N A;  1FJG E;  2V88 A;  1BKN A;  1XHK A;  1FJG I;  2V83 A;  2LJH A;  1ZM9 A;  2RTX A;  2V89 A;  4EMD A;  3C4B A;  4DV7 E;  1IBK E;  4DV7 I;  1IBK I;  3LTO A;  1YYO A;  2BM1 A;  4USK A;  2UUC E;  2UUC I;  2V86 A;  5IWA I;  2IHR 1;  3PYE A;  1X48 A;  1PVG A;  2OI2 A;  2N3G A;  2ZIT A;  4Z7C A;  4GEQ B;  1Z5B A;  2FGG A;  2CGE A;  1YZ9 A;  2Z5C B;  1T4O A;  2JR1 A;  2ODR C;  2HK2 A;  3DJW A;  1XMQ E;  4AQY E;  1XMQ I;  2X36 A;  4R03 A;  2KON A;  4AQY I;  3B8H A;  4ZVI A;  1NZ0 A;  1RR9 A;  4KHP I;  2L33 A;  2N3H A;  2B7T A;  4DV2 E;  1DI2 A;  2B9D A;  4DV2 I;  2LJP A;  1Z0W A;  4DPY A;  2ZBK B;  2UXD E;  4Z7Y A;  1HR0 I;  2UXD I;  1UEK A;  3RMP A;  2UUB E;  1H7U A;  4NXN I;  4JI6 E;  3VYX A;  4UT4 A;  3Q6M A;  4MYU A;  3QT7 A;  5AE1 A;  3PRY A;  2EFG A;  3FIG A;  1FWL A;  4XTJ A;  1HNW I;  5A2Q C;  1PKP A;  4DUY E;  3IWB A;  4DUY I;  4X62 E;  2BM0 A;  4JI5 E;  3H09 A;  4JI5 I;  2JWO A;  3KWR A;  4B3S I;  2L8T A;  2MC5 A;  4URL A;  4M1K A;  3D4J A;  3J81 Q;  2NUE A;  4WYQ B;  1S16 A;  2KHX A;  1ZXN A;  4DXL A;  3K1J A;  1ELO A;  3ADJ A;  3JAM C;  4HAC B;  2E1M A;  3OTO E;  3OTO I;  2ODR D;  2O1V A;  5IT9 Q;  1UHZ A;  1Z0G A;  2V85 A;  2Q2E B;  2FV4 B;  2HKE A;  4DPX A;  3ZZ0 A;  4JV5 I;  4WUD A;  1H72 C;  4WFT A;  4TUI A;  1Z0C A;  2DIX A;  4K0K E;  3MSW A;  4K0K I;  3ADI A;  2K4V A;  4JI7 E;  2NUG A;  4JI7 I;  4DR5 E;  4Q28 A;  2Z5C A;  1ZM3 A;  4DR5 I;  3P1X A;  4P78 A;  1EI1 A;  2MC6 A;  3ZOQ B;  5F3W A;  3ZKB A;  2L2K B;  1XMO E;  1XMO I;  1XNR E;  2R3V A;  4DR1 E;  1XNR I;  4DR6 E;  4DR1 I;  1DQ3 A;  4DR6 I;  4WUB A;  3OML A;  2NA2 A;  2V2Z A;  3IWD A;  1Z0T A;  1KVK A;  1STU A;  3T1H E;  3T1H I;  4I8O A;  2YT4 A;  4TUG A;  4R1F A;  4DU8 A;  1T4L B;  2HFS A;  1HK7 A;  3ZKD A;  1N32 E;  4F9A B;  2LE2 A;  2VF3 A;  1N32 I;  2O1U A;  2VE7 C;  1IBM E;  3QT8 A;  1FNM A;  1IBM I;  5FLX C;  2F8B A;  5T6J A;  3WU6 A;  5IWA E;  4BC9 A;  4DPT A;  1S4E A;  5GME A;  4L8N A;  4LF8 E;  1K47 A;  4LF8 I;  4HAC A;  2LUQ A;  4JYA E;  4JYA I;  4JI0 E;  2LTR A;  4JI0 I;  2NPF A;  1HNZ E;  3JU0 A;  1HNZ I;  4KHP E;  3T1Y I;  4DV3 E;  1RQ0 A;  2M4I A;  4DV3 I;  1N0U A;  3PYD A;  2L6M A;  4DKK A;  1PIE A;  4DMI A;  4JG4 A;  2RS7 A;  2GQ0 A;  1HR0 E;  4YY3 E;  4DPW A;  1RRE A;  4YY3 I;  3F6H A;  4M0V A;  4NXN E;  2LUP B;  3HPS A;  2PNL A;  1DAR A;  3ZZT A;  1KKH A;  1RC7 A;  5A2Q Q;  2CPN A;  1ZXM A;  4F9B B;  3PYF A;  3AV0 A;  1NHJ A;  3WU3 A;  1XNQ I;  1HNW E;  4RPF A;  2CG9 A;  3HTX A;  1EA6 A;  1IBL E;  1IBL I;  2YZT A;  4B3S E;  3V5R A;  1FWK A;  3JAM Q;  4JI4 E;  1N0V C;  4BBY A;  5CFF E;  1GQE A;  4LFA E;  1A6F A;  4JI4 I;  4LFA I;  2LRS A;  4DV0 E;  2UXC E;  2J7K A;  2V8P A;  4DV0 I;  2UXC I;  1FKA E;  2A2C A;  4P52 A;  4I3H A;  4DPU A;  3J80 C;  3CWV A;  3HPZ A;  4NXM E;  4USM A;  4NXM I;  2V8Q B;  1J5E E;  1B62 A;  3ZM7 A;  1MU5 A;  2AJ4 A;  1J5E I;  3J7Y p;  2L92 A;  4DR7 E;  1Z0V A;  1HNX I;  3LML A;  4DR7 I;  5BR8 E;  1KTV A;  4IZK B;  5BR8 I;  5LMN I;  4KQV A;  4JV5 E;  3WU4 A;  4X8W A;  4LU9 A;  1EKZ A;  2BV3 A;  1X49 A;  4DV6 E;  2MDR A;  4F9C B;  1VIS A;  2IOP A;  4DV6 I;  2WZO A;  3QT5 A;  1H73 A;  2JOX A;  3Q6N A;  2UU9 E;  2UU9 I;  2UXB I;  3ADL A;  1N33 E;  2V2V A;  4FW9 A;  1WHN A;  1N33 I;  4GKK E;  3V2U C;  2DEJ A;  4GKK I;  1X47 A;  2PNM A;  1Z0E A;  3LPS A;  5LMU E;  5AE2 A;  5LMU I;  3GON A;  4FWH A;  1SR9 A;  3VYY A;  4LFC E;  2Z5B B;  4DUZ E;  4LFC I;  4OX9 E;  4DUZ I;  2DB2 A;  4OX9 I;  2O1W A;  1U2R A;  2DSY A;  1H7S A;  1H74 A;  1MG7 A;  2HK3 A;  2EWL A;  3B82 A;  2VQF I;  1QZR A;  5FLX Q;  5ADZ A;  4DR2 E;  4DR2 I;  1ZM4 A;  4B3T E;  4B3T I;  4J8Z A;  1B63 A;  5LL6 R;  4BC7 A;  2Z5E A;  4BMJ A;  2B7V A;  2JY9 A;  2M1S A;  1D6T A;  3JTZ A;  1OJ4 A;  1Y4U A;  4X65 E;  1T4N A;  4X65 I;  3F0N A;  1YYW A;  2X7I A;  2E1R A;  5AE3 A;  1MX0 A;  2JVA A;  2L3C A;  1WUU A;  2GS8 A;  2V34 A;  3H4L A;  3LLH A;  4IZJ B;  5L3J A;  3K85 A;  3T1Y E;  4OOG C;  4HY1 A;  2RS6 A;  2DEI A;  4IZK A;  3LNU A;  4WUC A;  3WU5 A;  2L2M A;  1GZ6 A;  2VF1 A;  1N36 E;  3HUL A;  4M2Z A;  1N36 I;  4BCA A;  4F54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...