4JI5E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji5E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji5E02
1FJGI 1IBKI 1H7SA 1DI2A 1XHKA 1B63A 2VF3A 3T1HI 1K47A 4UT4A 3M6AA 1N32I 4LF7E 1FKAE 2NA2A 1N0UA 2RTXA 3F0NA 3ADGA 4JI8E 1WUUA 3QT8A 1RC7A 4LFAI 1MU5A 3QT7A 4MYTA 3V5RA 4DR4I 2HK3A 4X64E 2N3HA 1Z0CA 4DV7E 1I94E 2CZ9A 1Z0TA 4B3TE 2EFGA 1KIJA 2Q2EB 4HACB 4JI6I 3J7AG 2A2DA 1N0VC 4M1KA 1YYOA 4Z7CA 4YY3E 3ZZ0A 3HTXA 4B3SE 2L33A 1Z0GA 2MDRA 2ZBKB 1WHQA 1HR0I 4DR6E 3J80C 4KHPE 1IBLI 1J26A 2J7KA 5IT9Q 1XMOE 1DARA 2ZM6I 1D6TA 4DV5I 4M2ZA 3ZKBA 3ADLA 1PVGA 1FWKA 4R1FA 2ZITA 2BV3A 1I94I 5LMUE 4B3TI 1PKPA 4ZVIA 3LLHA 3P1XA 4X65I 4DR5E 2LTRA 2LUQA 1S4EA 4RPFA 1XNQI 4B3SI 4JI2E 3PYDA 2UXCE 2E5LI 1GQEA 2NUFA 4P7AA 1BKNA 5LMNI 4GKJI 4LF4I 4DR6I 4NXNE 4JG4A 4DU8A 1IBMI 2R42A 2JY9A 2UXBI 2VQEE 4XTJA 4DR7E 2GS8A 1H7UA 4JI1I 4LFCE 1YZ9A 4I3HA 1HNWE 5LMUI 3LNUA 1RR9A 3CWVA 3PYFA 4OX9I 4DR1I 1HNZI 2YT4A 4JI3E 4X66I 3T1YI 2UXCI 1H73A 3ZM7A 3J7AM 1HNXE 3J80Q 2CPNA 3PYEA 4LF5E 4DV3E 3J81Q 3VYYA 4DV4E 4WFTA 4NXNI 1XNRE 1T4NA 2B3TB 4MYUA 1UHZA 3JAMC 2HHHE 4GKKI 4DR7I 4WUBA 2DIXA 3ZKDA 4DV1E 4JI0E 2XEXA 1H74A 2HK2A 4FWGA 4FWHA 5GMEA 5BR8I 4AQYE 2UUAE 1N33E 1MX0A 4LFBI 3J7Yp 4JI3I 1FI4A 1UILA 3WU6A 4OOGC 4DU7A 2UUCE 4DR2E 4JI5E 1EI1A 4LF6E 3HULA 1HNXI 4DUZE 1EA6A 4LF5I 2L2MA 1NHHA 4DV3I 2LUPB 4DUYE 3C4TA 4DPXA 2R3VA 3QT6A 4DV4I 4LF7I 1XNRI 3B82A 4HXZA 2HHHI 3PYGA 4FN5A 4DR3E 2HFUA 4JI0I 4JI8I 2UUBE 1Z5CA 2OI2A 4DPUA 1YYWA 3J81C 2V2ZA 1YYKA 1B62A 4AQYI 1N34E 1N33I 2X36A 4X64I 3OTOE 2L2NA 2L2KB 4DV7I 1N36E 1EKZA 4DUZI 3LTOA 2X7IA 4JYAE 2AJ4A 1FWLA 3JAMQ 4YY3I 1T4OA 2VQFE 1KVKA 1U2RA 1Z0VA 1ZM2A 5IWAE 4B3ME 4B3RE 3K1JA 4LF9E 2UUBI 4KHPI 4LF8E 3VYXA 4JI7E 1XMOI 2UU9E 5A2QC 1X47A 1T4LB 3OTOI 3ADJA 3WU5A 4DV0E 4M30A 4X62E 2V8PA 3B78A 2N3GA 1RQ0A 1N36I 2V2QA 1ZM4A 4WYQB 4UTGA 1OJ4A 1N32E 4FW9A 4X8WA 4HY1A 4DR5I 1A6FA 2BM1A 3QT5A 1RREA 4JI2I 4WUDA 1H72C 2RS6A 4HACA 5IWAI 1Z5BA 4B3RI 4NXME 4LF9I 1STUA 3WU3A 4LF8I 3Q1QA 4DR4E 2E1RA 4Z7YA 2VQEI 4FWDA 3V2UC 2L3JA 5FLXQ 2RSMA 2DEJA 2HKJA 1WHNA 2B7VA 4DXLA 1NHIA 4DV0I 4X62I 4DKKA 4LFCI 3D4JA 4PU9A 4USMA 1HNWI 4JI6E 4HYMA 3LPSA 4DPYA 3ZZTA 5CFFE 2HKEA 1NHJA 1O0WA 4P52A 1ZM9A 2EZ6A 1Z0BA 2F4VE 1HR0E 2DMYA 3C4BA 4NXMI 3H4LA 5A2QQ 1IBLE 2BM0A 2ZM6E 4JI4E 4DV2E 1Z5AA 2WW4A 1ZBTA 4DV5E 1Z0WA 4DV1I 3B8HA 4URLA 4YHHE 4K0KE 1KTVA 2V2VA 4DPWA 2L3CA 4DV6E 4X65E 1FNMA 2UUAI 1ZXNA 1Z59A 1XNQE 2B7TA 1S16A 4WUCA 2LJPA 5FLXC 2E5LE 4USKA 2UUCI 4DR2I 4JI5I 4LF6I 1KKHA 1J5EE 5LMNE 2LBSB 4ED4A 2F4VI 4GKJE 4LF4E 4DUYI 2UXDE 1IBME 1XMQE 2UXBE 1UEKA 4JI4I 3ADIA 4DV2I 2KHXA 4JV5E 4DR3I 2LTSA 4JI1E 1Z0EA 1QU6A 4YHHI 4KQVA 4K0KI 2JVAA 1X48A 1ZM3A 2NUGA 2IHR1 4PRVA 2A2CA 4PRXA 4OX9E 4DV6I 4DR1E 1HNZE 2NPFA 1MG7A 1N34I 4X66E 5GMDA 2LJHA 2DB2A 2LRSA 1IBKE 1FJGE 3GONA 3T1YE 4EMDA 2RS7A 3K17A 2NUEA 3WU4A 3ZZUA 1J5EI 3T1HE 4JYAI 2UXDI 1PIEA 1ELOA 1XMQI 2VQFI 4GKKE 1NZ0A 4DPTA 5L3JA 4JV5I 2DEIA 4B3MI 1VISA 1ZXMA 5LL6R 4LFAE 2V34A 5BR8E 4JI7I 2UU9I 1QZRA 4LFBE 1X49A 2HFSA 5IT9C
chains in the Genus database with same CATH superfamily
1FJGI 1IBKI 2EM5A 4MU3A 4Q28A 1H7SA 1DI2A 1XHKA 5AE3A 2YSOA 1B63A 3H09A 1ZBQA 1ZR9A 4IZKB 1T38A 5AC5A 2VF3A 3T1HI 1K47A 3FIGA 1YHCA 4UT4A 3M6AA 5GMDA 1N32I 4LF7E 1FKAE 4BCAA 2JPAA 2NA2A 1N0UA 3EPHA 2V88A 3PS2A 1WRJA 1TN9A 2YRKA 2EPAA 4R2AA 4U3BA 2RTXA 1LLMC 2PO0B 3F0NA 4IFDD 5JEAF 3ADGA 5ADZA 4O4KA 1USVA 4JI8E 1WUUA 4BA2A 4F9AB 3QT8A 4WXDA 1RC7A 3RMPA 4WX9A 4R2PA 3EPJA 3DD6A 4LFAI 1MU5A 2EL5A 1Y4UA 1Y6ZA 4NZVA 3QT7A 4MYTA 1JK2A 3V5RA 4DR4I 2HK3A 4OZEA 2JEBB 4BC7A 3GCMA 4X64E 2JE6A 2YTEA 4IS9A 2N3HA 2RPCA 1Z0CA 4R8OA 2CVEA 4DV7E 1I94E 1GTKA 3ECRA 2CZ9A 4IZJD 1Z0TA 2VE7C 4B3TE 1KIJA 1OYSA 2EFGA 2Q2EB 4HACB 2EN4A 2YTPA 4JI6I 2GLIA 5AASA 2BBGA 4BS9A 3BBGA 3J7AG 2A2DA 2EPPA 1N0VC 4M1KA 1X3CA 1YYOA 4Z7CA 4LPFA 4YY3E 3ZZ0A 3HTXA 4B3SE 2L33A 2EPRA 1EH6A 3PRYA 1G2DC 1Z0GA 4AM3A 3KWRA 2PO2B 1AAYA 3BF2A 2MDRA 2ZBKB 1WHQA 3CDJA 2YTOA 1HR0I 4DR6E 2NN6A 4MU1A 1PJTA 3DJWA 4F6NA 2M9AA 5A6AA 3J80C 4KHPE 4NBQA 4AIMA 1IBLI 2YTQA 1J26A 2C38A 2J7KA 4FW5A 2EM7A 1XMOE 4OO1D 5IT9Q 4LTYA 4ZYHA 5A6KA 1DARA 4LCGA 4N3OA 2ZM6I 1D6TA 2MDGA 2EN3A 2EQ0A 4R2RA 2L8TA 4DV5I 2M4IA 4M2ZA 3ADLA 3ZKBA 2EOZA 1PVGA 1FWKA 4ISAA 4R1FA 2GHFA 2ZITA 5C0XB 2EPNA 2EOHA 1UDNA 2BV3A 2YSPA 5LMUE 5EL9A 1I94I 4I8OA 1PKPA 4B3TI 4R03A 2YZTA 2WP8A 2Z5CA 4ZVIA 1Y4SA 3GMEA 1A1KA 3LLHA 2YU5A 3P1XA 2LE2A 2YTJA 1Y5YA 4LOMA 4X65I 4BA1A 3VK6A 4DR5E 2LTRA 2LUQA 1S4EA 2WBUA 4RPFA 1XNQI 2EM0A 3TQMA 3HKMA 3U1YA 1IQSA 4J8ZA 2VESA 4B3SI 4JI2E 3PYDA 2UXCE 2E5LI 3THOB 2F1DA 1GQEA 3C6MA 2NUFA 4P7AA 1BKNA 2PNZA 5LMNI 4IFDA 4GKJI 4LF4I 4DR6I 4LCHA 5LLQA 2GO4A 4NXNE 5K36C 4JG4A 2LO3A 4WSPA 1Z1BA 4DU8A 1IBMI 2R42A 2EP3A 2JY9A 3BGHA 4F9CB 1UN6B 2Z5EA 2UXBI 2VQEE 3OMLA 4XTJA 5JEAD 4DR7E 1A1GA 2GS8A 3B4TA 1H7UA 2MKNA 4O24A 2JT2A 2JEAA 2ELYA 4JI1I 2O1VA 2R1FA 2EL4A 4R2EA 4LFCE 1YZ9A 5DRRA 2C39A 4I3HA 1HNWE 3M85G 5LMUI 1KYQA 3LNUA 2YTGA 1RR9A 1R6LA 3MHSC 4IZJA 3IWBA 2EN8A 3CWVA 3THNA 2C37B 3PYFA 2EOMA 4OX9I 5A6JA 4DR1I 1HNZI 3JU0A 4HTGA 1YH8A 3NZKA 2K7IA 2YT4A 4JI3E 4X66I 2DMIA 3T1YI 2UXCI 2LVHA 1H73A 3ZM7A 1EH8A 3J7AM 1NEIA 1HNXE 2WCC3 3J80Q 2CPNA 3PYEA 4LF5E 4DV3E 1YFHA 3J81Q 3VYYA 4MLQA 1PDAA 3EPKA 4WFTA 4DV4E 2VF1A 4LU9A 2FV4B 3C6KA 1XNRE 4NXNI 1T4NA 1DGCA 2B3TB 2EOSA 4MYUA 1UHZA 3JAMC 2HHHE 4L8NA 2EPUA 4GKKI 2PO1B 2EM8A 4OO1A 4DR7I 4M0VA 3ZOQB 1WXRA 4WUBA 1A1LA 2DIXA 2DRPA 2EMAA 1IQOA 3ZKDA 4DV1E 3UK3C 4JI0E 2XEXA 3EPLA 2Z5BA 1ZAAC 2ENHA 2EWLA 2LMZA 1H74A 4ZYGA 2HK2A 4FWGA 4MQYA 4FWHA 2DSYA 5GMEA 5BR8I 4AQYE 3LMLA 2EMLA 2UUAE 3GLLA 1YUJA 1N33E 2YRHA 4F9BB 2DGCA 1MX0A 3UHMA 3J7Yp 4JI3I 4LFBI 4QNJA 3F6HA 4RHBB 1FI4A 1X6EA 3L7ZB 1UILA 1KJKA 3WU6A 4OOGC 2NN6C 4DU7A 2UUCE 4DR2E 4JI5E 2GPIA 5KL6A 4LF6E 1EI1A 3HULA 5FWKA 1HNXI 2V83A 4DUZE 1EA6A 4LF5I 2EM2A 3IWCA 2L2MA 4BBYA 1NHHA 3U1KA 2LUPB 3M99B 3C4TA 4DUYE 4DV3I 2EOFA 4DPXA 2L6MA 2R3VA 3QT6A 4DV4I 1AH5A 5KL4A 4LF7I 1XNRI 5A69A 3B82A 4FW6A 2WZOA 4HXZA 2V85A 2PNMA 1L4SA 5EKWA 2V89A 2HHHI 2HGHA 3PYGA 4FN5A 1DQ3A 4DR3E 2HFUA 5DROA 5K36B 4JI0I 5JEAA 4JI8I 3HJCA 2UUBE 4GEQB 1Z5CA 2DLKA 1YPNA 4OO1B 2OI2A 5DNXA 4DPUA 3J81C 1YYWA 1E3HA 2V2ZA 1YYKA 1B62A 4AQYI 2L92A 2EMFA 2HC5A 1N34E 2BR2A 4FW7A 4YHHI 2X36A 3EQ1A 2O1WA 3P3GA 4LCFA 4X64I 2JYAA 3OTOE 2EPLX 2EMHA 1YUIA 2L2NA 3DF6A 2L2KB 4IFDC 1ZU1A 2ENAA 4FW3A 3HQ1A 4DV7I 3JTZA 1X49A 1N36E 2MKDA 2I13A 1P42A 3M85D 4BHCA 4Q35B 1EKZA 1A1HA 5F3WA 1OYPA 4DUZI 3LTOA 3M7NG 4BA2B 2X7IA 4O5GA 4JYAE 2AJ4A 1FWLA 3JAMQ 4ZYDA 5K36E 2GQ0A 2EOQA 5C0XD 2JOBA 4YY3I 1T4OA 1N33I 1JK1A 2CSHA 2VQFE 1KVKA 1U2RA 1USUA 1Z0VA 1ZM2A 2YTIA 4IZKA 3P76A 4TUGA 4X9JA 1BB8A 1RMDA 5IXMB 2YU8A 5IWAE 4BHBA 4P7DA 4B3ME 4B3RE 3K1JA 4MU0A 4LF9E 2UUBI 2PRTA 4OKGA 4KHPI 4LF8E 1GZ6A 1QNTA 2LV2A 3VYXA 2EPKX 1TF6A 1BBGA 2EOJA 2Q8UA 4JI7E 1XMOI 2PO0A 5A2QC 2UU9E 3H1CA 5K36F 3AUZA 1X47A 1T4LB 3P3EA 1UDQA 3OTOI 2ENCA 3ADJA 3VHTB 3WU5A 4DV0E 4M30A 4X62E 2V8PA 4KZSA 3B78A 2JR1A 2N3GA 1RQ0A 1N36I 4WPYA 1WJPA 1X6HA 4J3DA 2DLQA 2V2QA 1ZM4A 2V86A 2YWQA 4WYQB 2JEBA 4UTGA 1OJ4A 4OO1C 4KWYA 1N32E 4FW9A 4X8WA 4HY1A 4DR5I 2CT1A 1A6FA 2C38B 5DNLA 2EMBA 2BM1A 2WNRB 3Q6NA 3MHHC 3QT5A 4R2SA 1RREA 4JI2I 2EM9A 3QG5C 2EPOA 4WUDA 1H72C 2RS6A 5KL2A 4HACA 1SR9A 2R76A 5IWAI 3P06A 2YTDA 4NHRA 1Z5BA 4R2QA 4HEIA 4B3RI 4NXME 4LF9I 1STUA 5A6BD 3WU3A 4GQUA 4LF8I 2E72A 4WSGA 2M7QA 3Q1QA 2WP8B 2Z5CB 4DR4E 5DRQA 5C0XC 2E1RA 4Z7YA 2VQEI 4FWDA 3V2UC 2L3JA 4BA1B 5FLXQ 2D9HA 2RSMA 4F2JC 2DEJA 2EOOA 2IOQA 2RSIA 2PO2A 2EMWA 2F8BA 2B7VA 1WHNA 2HKJA 4MLVA 1NHIA 4DXLA 2NN6E 4DV0I 4X62I 3IWDA 4DKKA 5AE1A 2MC6A 3CDIA 3D4JA 4LFCI 4PU9A 4USMA 2M1SA 3HPZA 1HNWI 4N4RB 4JI6E 4HYMA 2PNZB 3MSWA 3LPSA 5IV8B 4IFDB 1MEYC 2MC5A 2EQ3A 4DPYA 3ZZTA 1FJGE 5CFFE 1IBKE 2HKEA 5JEAC 2YTFA 4O43A 2LJUA 2YPNA 5C0XA 1A1JA 2CG9A 1NHJA 1O0WA 1X5WA 2HJJA 2IESA 4ZYEA 2EPCA 1ZM9A 2EN6A 2EZ6A 4P52A 4AIDA 1Z0BA 3KRNA 2JEAB 2NN6F 3M7ND 5ELWA 2EOXA 2F4VE 1HR0E 1Y60A 2DMYA 4F6MA 3C4BA 4NXMI 2EMCA 2C39B 3H4LA 5A2QQ 2H36X 1IBLE 1F2IG 1SFEA 2BM0A 2A25A 2ADRA 1UDOA 3PS1A 2BA0D 4IZJB 2ZM6E 4JI4E 4IS1C 4DV2E 1Z5AA 1PJSA 2WW4A 1ZBTA 4DV5E 1Z0WA 2JXPA 2O3ZA 2EL6A 3F6GA 2NABA 2O1TA 3B8HA 4DV1I 4URLA 4IFDE 4YHHE 4K0KE 2E1MA 1KTVA 2YTNA 1UBDC 1B69A 4QNKA 3KZYA 1YSAC 2V2VA 1E3PA 2EM6A 2FGGA 4DPWA 2L3CA 2EOIA 5KL5A 2EOEA 4DV6E 2LT7A 2LCEA 5K36D 4X65E 1FNMA 2UUAI 1EH7A 1ZXNA 2JOXA 1Z59A 4IJDA 4M9VC 2EM3A 3PS3A 2WBSA 4BC9A 1XNQE 2B7TA 2ODRD 1BBOA 4WXCA 1S16A 4WUCA 5FLXC 2EPZA 2LJPA 2E5LE 4USKA 2UUCI 2RQLA 4DR2I 2EM4A 2EQ1A 4JI5I 2GO3A 4LF6I 2K4VA 1KKHA 4IFDF 1J5EE 5LMNE 4FW4A 2LBSB 4ED4A 5KL3A 3L00A 4GKJE 2C37A 2Z5BB 4LF4E 4U3DA 2F4VI 4DUYI 4TUIA 2UXDE 4FK5C 1IBME 1T39A 2N8XA 1XMQE 2EE8A 5A6BA 2BA0G 1IMUA 2UXBE 2WNRA 2EMZA 1UEKA 4JI4I 2EN2A 3ADIA 5AE2A 1R6MA 4DV2I 2KHXA 4JV5E 5T6JA 4DR3I 2LTSA 3BIDA 2V87A 4F54A 4JI1E 1Z0EA 1PJQA 1QU6A 2JE6B 4BMJA 4DMIA 5DNYA 2PNLA 1MGTA 2EORA 4P78A 4RH8A 4KQVA 4R2DA 2JVAA 2BA1D 4K0KI 1X48A 1ZM3A 4MU4A 3P3CA 2NUGA 2EMKA 2EPMX 2IHR1 1HK7A 4PRVA 2A2CA 4PRXA 2IOPA 3HXLA 4OX9E 4DV6I 4DR1E 1HNZE 3K6QA 2NPFA 2PO1A 4OO1E 2YRMA 2EMYA 1MG7A 1XXEA 1N34I 3KZZA 4R2CA 5TSEA 4X66E 1X6FA 2B9DA 2DB2A 2EMXA 2BB8A 2EMGA 2KOUA 2LJHA 2LRSA 2WBTA 4GZNC 3T1YE 2RS7A 3GONA 5AC4A 4EMDA 5KL7A 2EPXA 3K17A 1P47A 3AV0A 2NUEA 2EMIA 3WU4A 3ZZUA 2EN1A 1J5EI 1UDSA 5JEAB 3T1HE 5DRPA 4JYAI 4L5NC 2CTDA 4MDTA 2EJ4A 2UXDI 1PIEA 2NN6B 2IERA 1ELOA 2CGEA 2O1UA 2V8QB 1OYRA 3L7ZA 1XMQI 5C0XE 2EOYA 2JWOA 4OO1F 2VQFI 2AE8A 3Q6MA 2J65A 4GKKE 1NZ0A 4DPTA 2ODRC 1NCSA 2BR2B 2VRDA 1A1FA 5L3JA 2NN6D 3K85A 4JV5I 2DEIA 1N3GA 4B3MI 1VISA 1VI7A 1ZXMA 3HPSA 5LL6R 1TF3A 2BA1G 2JP9A 2EN7A 4LFAE 1RHYA 2G7HA 2ELZA 1A1IA 2V34A 5BR8E 4JI7I 2FTXB 2I9IA 2UU9I 2KONA 1G2FC 1QZRA 4LFBE 2J7JA 2HFSA 5K36A 5IT9C 5C0XF 5JEAE
chains in the Genus database with same CATH topology
1FJGI 1IBKI 4Q28A 1H7SA 1DI2A 1XHKA 5AE3A 1B63A 3H09A 1ZBQA 4IZKB 2VF3A 3T1HI 1K47A 3FIGA 4UT4A 3M6AA 1N32I 4LF7E 1FKAE 4BCAA 2NA2A 1N0UA 2V88A 2RTXA 3F0NA 3ADGA 5ADZA 1USVA 4JI8E 1WUUA 4F9AB 3QT8A 1RC7A 3RMPA 4LFAI 1MU5A 1Y4UA 1Y6ZA 3QT7A 4MYTA 3V5RA 4DR4I 2HK3A 4BC7A 4X64E 2N3HA 1Z0CA 4R8OA 4DV7E 1I94E 4IZJD 2CZ9A 1Z0TA 2VE7C 4B3TE 1KIJA 2EFGA 2Q2EB 4HACB 4JI6I 5AASA 4BS9A 3J7AG 2A2DA 1N0VC 4M1KA 1YYOA 4Z7CA 4YY3E 3ZZ0A 3HTXA 4B3SE 2L33A 3PRYA 1Z0GA 3KWRA 2MDRA 2ZBKB 1WHQA 1HR0I 4DR6E 3DJWA 3J80C 4KHPE 1IBLI 1J26A 2J7KA 5IT9Q 1XMOE 4LTYA 1DARA 2ZM6I 4N3OA 1D6TA 2L8TA 4DV5I 2M4IA 4M2ZA 3ADLA 3ZKBA 1PVGA 1FWKA 4R1FA 2ZITA 2BV3A 1I94I 5LMUE 4I8OA 1PKPA 4B3TI 4R03A 2YZTA 2Z5CA 4ZVIA 1Y4SA 3LLHA 3P1XA 2LE2A 4X65I 3VK6A 4DR5E 2LTRA 2LUQA 1S4EA 4RPFA 1XNQI 4B3SI 4J8ZA 4JI2E 3PYDA 2UXCE 2E5LI 1GQEA 2NUFA 4P7AA 1BKNA 5LMNI 4GKJI 4LF4I 4DR6I 4NXNE 4JG4A 4WSPA 4DU8A 1IBMI 2R42A 2JY9A 4F9CB 2UXBI 2Z5EA 2VQEE 3OMLA 4XTJA 4DR7E 2GS8A 1H7UA 4JI1I 2O1VA 4LFCE 1YZ9A 4I3HA 1HNWE 5LMUI 3LNUA 1RR9A 4IZJA 3IWBA 3CWVA 3PYFA 4OX9I 4DR1I 1HNZI 3JU0A 2YT4A 4JI3E 4X66I 3T1YI 2UXCI 1H73A 3ZM7A 3J7AM 1HNXE 3J80Q 2CPNA 3PYEA 4LF5E 4DV3E 3J81Q 3VYYA 4DV4E 4WFTA 2VF1A 4LU9A 2FV4B 1XNRE 4NXNI 1T4NA 2B3TB 4MYUA 1UHZA 3JAMC 2HHHE 4L8NA 4GKKI 4DR7I 4M0VA 3ZOQB 1WXRA 4WUBA 2DIXA 3ZKDA 4DV1E 4JI0E 2XEXA 2Z5BA 2EWLA 2LMZA 1H74A 2HK2A 4FWGA 4FWHA 2DSYA 5GMEA 5BR8I 4AQYE 3LMLA 2UUAE 1N33E 4F9BB 1MX0A 4LFBI 3J7Yp 4JI3I 3F6HA 1FI4A 1UILA 3WU6A 4OOGC 4DU7A 2UUCE 4DR2E 4JI5E 5FWKA 1EI1A 4LF6E 3HULA 1HNXI 2V83A 4DUZE 1EA6A 4LF5I 3IWCA 2L2MA 4BBYA 1NHHA 4DV3I 2LUPB 4DUYE 3C4TA 4DPXA 2L6MA 2R3VA 3QT6A 4DV4I 4LF7I 1XNRI 3B82A 2WZOA 4HXZA 2V85A 2PNMA 2V89A 2HHHI 3PYGA 4FN5A 1DQ3A 4DR3E 2HFUA 4JI0I 4JI8I 3HJCA 2UUBE 4GEQB 1Z5CA 2OI2A 4DPUA 3J81C 1YYWA 2V2ZA 1YYKA 1B62A 4AQYI 2L92A 1N34E 1N33I 2X36A 4X64I 2O1WA 3OTOE 2L2NA 3DF6A 2L2KB 3HQ1A 4DV7I 3JTZA 1N36E 1EKZA 5F3WA 4DUZI 3LTOA 2X7IA 4JYAE 2AJ4A 1FWLA 3JAMQ 2GQ0A 2JOBA 4YY3I 1T4OA 2VQFE 1KVKA 1U2RA 1USUA 1Z0VA 1ZM2A 4IZKA 4TUGA 5IWAE 4P7DA 4B3ME 4B3RE 3K1JA 4LF9E 2UUBI 4KHPI 4LF8E 1GZ6A 3VYXA 4JI7E 1XMOI 5A2QC 2UU9E 3AUZA 1X47A 1T4LB 3OTOI 3ADJA 3WU5A 4DV0E 4M30A 4X62E 2V8PA 4KZSA 3B78A 2JR1A 2N3GA 1RQ0A 1N36I 4WPYA 2V2QA 1ZM4A 2V86A 4WYQB 4UTGA 1OJ4A 1N32E 4FW9A 4X8WA 4HY1A 4DR5I 1A6FA 2BM1A 3Q6NA 3QT5A 1RREA 4JI2I 4WUDA 1H72C 2RS6A 4HACA 1SR9A 5IWAI 3P06A 1Z5BA 4B3RI 4NXME 4LF9I 1STUA 3WU3A 4LF8I 2M7QA 3Q1QA 2Z5CB 4DR4E 2E1RA 4Z7YA 2VQEI 4FWDA 3V2UC 2L3JA 5FLXQ 2RSMA 2DEJA 2IOQA 2F8BA 2HKJA 2B7VA 1WHNA 4DXLA 1NHIA 4DV0I 4X62I 3IWDA 4DKKA 5AE1A 2MC6A 4LFCI 3D4JA 4PU9A 4USMA 2M1SA 3HPZA 1HNWI 4JI6E 4HYMA 3MSWA 3LPSA 2MC5A 4DPYA 3ZZTA 5CFFE 2HKEA 2CG9A 1NHJA 1O0WA 4P52A 1ZM9A 2EZ6A 1Z0BA 2F4VE 1HR0E 2DMYA 3C4BA 4NXMI 3H4LA 5A2QQ 2H36X 1IBLE 2BM0A 4IZJB 2ZM6E 4JI4E 4DV2E 1Z5AA 2WW4A 1ZBTA 4DV5E 1Z0WA 3F6GA 2O1TA 4DV1I 3B8HA 4URLA 4YHHE 4K0KE 2E1MA 1KTVA 2V2VA 2FGGA 4DPWA 2L3CA 4DV6E 4X65E 1FNMA 2UUAI 1ZXNA 2JOXA 1Z59A 1XNQE 4BC9A 2B7TA 2ODRD 1S16A 4WUCA 5FLXC 2LJPA 2E5LE 4USKA 2UUCI 4DR2I 4JI5I 4LF6I 2K4VA 1KKHA 1J5EE 5LMNE 2LBSB 4ED4A 2F4VI 4GKJE 2Z5BB 4LF4E 4DUYI 4TUIA 2UXDE 1IBME 1XMQE 2UXBE 1UEKA 4JI4I 3ADIA 5AE2A 4DV2I 2KHXA 4JV5E 5T6JA 4DR3I 2LTSA 4F54A 2V87A 4JI1E 1Z0EA 2PNLA 1QU6A 4BMJA 4DMIA 5DNYA 4KQVA 4P78A 4YHHI 4K0KI 2JVAA 1X48A 1ZM3A 2NUGA 2IHR1 1HK7A 4PRVA 2A2CA 4PRXA 2IOPA 3HXLA 4OX9E 4DV6I 4DR1E 1HNZE 3K6QA 2NPFA 1MG7A 1N34I 4X66E 2B9DA 2LJHA 2DB2A 2LRSA 1IBKE 1FJGE 2KOUA 3GONA 3T1YE 5GMDA 4EMDA 2RS7A 3K17A 3AV0A 2NUEA 3WU4A 3ZZUA 1J5EI 3T1HE 4JYAI 4L5NC 2UXDI 1PIEA 1ELOA 2CGEA 2O1UA 2V8QB 1XMQI 2JWOA 2VQFI 3Q6MA 4GKKE 1NZ0A 4DPTA 2ODRC 5L3JA 4JV5I 3K85A 2DEIA 4B3MI 1VISA 1ZXMA 3HPSA 5LL6R 4LFAE 2G7HA 2V34A 5BR8E 4JI7I 2FTXB 2UU9I 2KONA 1QZRA 4LFBE 1X49A 2HFSA 5IT9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG I;  1IBK I;  1H7S A;  1DI2 A;  1XHK A;  1B63 A;  2VF3 A;  3T1H I;  1K47 A;  4UT4 A;  3M6A A;  1N32 I;  4LF7 E;  1FKA E;  2NA2 A;  1N0U A;  2RTX A;  3F0N A;  3ADG A;  4JI8 E;  1WUU A;  3QT8 A;  1RC7 A;  4LFA I;  1MU5 A;  3QT7 A;  4MYT A;  3V5R A;  4DR4 I;  2HK3 A;  4X64 E;  2N3H A;  1Z0C A;  4DV7 E;  1I94 E;  2CZ9 A;  1Z0T A;  4B3T E;  2EFG A;  1KIJ A;  2Q2E B;  4HAC B;  4JI6 I;  3J7A G;  2A2D A;  1N0V C;  4M1K A;  1YYO A;  4Z7C A;  4YY3 E;  3ZZ0 A;  3HTX A;  4B3S E;  2L33 A;  1Z0G A;  2MDR A;  2ZBK B;  1WHQ A;  1HR0 I;  4DR6 E;  3J80 C;  4KHP E;  1IBL I;  1J26 A;  2J7K A;  5IT9 Q;  1XMO E;  1DAR A;  2ZM6 I;  1D6T A;  4DV5 I;  4M2Z A;  3ZKB A;  3ADL A;  1PVG A;  1FWK A;  4R1F A;  2ZIT A;  2BV3 A;  1I94 I;  5LMU E;  4B3T I;  1PKP A;  4ZVI A;  3LLH A;  3P1X A;  4X65 I;  4DR5 E;  2LTR A;  2LUQ A;  1S4E A;  4RPF A;  1XNQ I;  4B3S I;  4JI2 E;  3PYD A;  2UXC E;  2E5L I;  1GQE A;  2NUF A;  4P7A A;  1BKN A;  5LMN I;  4GKJ I;  4LF4 I;  4DR6 I;  4NXN E;  4JG4 A;  4DU8 A;  1IBM I;  2R42 A;  2JY9 A;  2UXB I;  2VQE E;  4XTJ A;  4DR7 E;  2GS8 A;  1H7U A;  4JI1 I;  4LFC E;  1YZ9 A;  4I3H A;  1HNW E;  5LMU I;  3LNU A;  1RR9 A;  3CWV A;  3PYF A;  4OX9 I;  4DR1 I;  1HNZ I;  2YT4 A;  4JI3 E;  4X66 I;  3T1Y I;  2UXC I;  1H73 A;  3ZM7 A;  3J7A M;  1HNX E;  3J80 Q;  2CPN A;  3PYE A;  4LF5 E;  4DV3 E;  3J81 Q;  3VYY A;  4DV4 E;  4WFT A;  4NXN I;  1XNR E;  1T4N A;  2B3T B;  4MYU A;  1UHZ A;  3JAM C;  2HHH E;  4GKK I;  4DR7 I;  4WUB A;  2DIX A;  3ZKD A;  4DV1 E;  4JI0 E;  2XEX A;  1H74 A;  2HK2 A;  4FWG A;  4FWH A;  5GME A;  5BR8 I;  4AQY E;  2UUA E;  1N33 E;  1MX0 A;  4LFB I;  3J7Y p;  4JI3 I;  1FI4 A;  1UIL A;  3WU6 A;  4OOG C;  4DU7 A;  2UUC E;  4DR2 E;  4JI5 E;  1EI1 A;  4LF6 E;  3HUL A;  1HNX I;  4DUZ E;  1EA6 A;  4LF5 I;  2L2M A;  1NHH A;  4DV3 I;  2LUP B;  4DUY E;  3C4T A;  4DPX A;  2R3V A;  3QT6 A;  4DV4 I;  4LF7 I;  1XNR I;  3B82 A;  4HXZ A;  2HHH I;  3PYG A;  4FN5 A;  4DR3 E;  2HFU A;  4JI0 I;  4JI8 I;  2UUB E;  1Z5C A;  2OI2 A;  4DPU A;  1YYW A;  3J81 C;  2V2Z A;  1YYK A;  1B62 A;  4AQY I;  1N34 E;  1N33 I;  2X36 A;  4X64 I;  3OTO E;  2L2N A;  2L2K B;  4DV7 I;  1N36 E;  1EKZ A;  4DUZ I;  3LTO A;  2X7I A;  4JYA E;  2AJ4 A;  1FWL A;  3JAM Q;  4YY3 I;  1T4O A;  2VQF E;  1KVK A;  1U2R A;  1Z0V A;  1ZM2 A;  5IWA E;  4B3M E;  4B3R E;  3K1J A;  4LF9 E;  2UUB I;  4KHP I;  4LF8 E;  3VYX A;  4JI7 E;  1XMO I;  2UU9 E;  5A2Q C;  1X47 A;  1T4L B;  3OTO I;  3ADJ A;  3WU5 A;  4DV0 E;  4M30 A;  4X62 E;  2V8P A;  3B78 A;  2N3G A;  1RQ0 A;  1N36 I;  2V2Q A;  1ZM4 A;  4WYQ B;  4UTG A;  1OJ4 A;  1N32 E;  4FW9 A;  4X8W A;  4HY1 A;  4DR5 I;  1A6F A;  2BM1 A;  3QT5 A;  1RRE A;  4JI2 I;  4WUD A;  1H72 C;  2RS6 A;  4HAC A;  5IWA I;  1Z5B A;  4B3R I;  4NXM E;  4LF9 I;  1STU A;  3WU3 A;  4LF8 I;  3Q1Q A;  4DR4 E;  2E1R A;  4Z7Y A;  2VQE I;  4FWD A;  3V2U C;  2L3J A;  5FLX Q;  2RSM A;  2DEJ A;  2HKJ A;  1WHN A;  2B7V A;  4DXL A;  1NHI A;  4DV0 I;  4X62 I;  4DKK A;  4LFC I;  3D4J A;  4PU9 A;  4USM A;  1HNW I;  4JI6 E;  4HYM A;  3LPS A;  4DPY A;  3ZZT A;  5CFF E;  2HKE A;  1NHJ A;  1O0W A;  4P52 A;  1ZM9 A;  2EZ6 A;  1Z0B A;  2F4V E;  1HR0 E;  2DMY A;  3C4B A;  4NXM I;  3H4L A;  5A2Q Q;  1IBL E;  2BM0 A;  2ZM6 E;  4JI4 E;  4DV2 E;  1Z5A A;  2WW4 A;  1ZBT A;  4DV5 E;  1Z0W A;  4DV1 I;  3B8H A;  4URL A;  4YHH E;  4K0K E;  1KTV A;  2V2V A;  4DPW A;  2L3C A;  4DV6 E;  4X65 E;  1FNM A;  2UUA I;  1ZXN A;  1Z59 A;  1XNQ E;  2B7T A;  1S16 A;  4WUC A;  2LJP A;  5FLX C;  2E5L E;  4USK A;  2UUC I;  4DR2 I;  4JI5 I;  4LF6 I;  1KKH A;  1J5E E;  5LMN E;  2LBS B;  4ED4 A;  2F4V I;  4GKJ E;  4LF4 E;  4DUY I;  2UXD E;  1IBM E;  1XMQ E;  2UXB E;  1UEK A;  4JI4 I;  3ADI A;  4DV2 I;  2KHX A;  4JV5 E;  4DR3 I;  2LTS A;  4JI1 E;  1Z0E A;  1QU6 A;  4YHH I;  4KQV A;  4K0K I;  2JVA A;  1X48 A;  1ZM3 A;  2NUG A;  2IHR 1;  4PRV A;  2A2C A;  4PRX A;  4OX9 E;  4DV6 I;  4DR1 E;  1HNZ E;  2NPF A;  1MG7 A;  1N34 I;  4X66 E;  5GMD A;  2LJH A;  2DB2 A;  2LRS A;  1IBK E;  1FJG E;  3GON A;  3T1Y E;  4EMD A;  2RS7 A;  3K17 A;  2NUE A;  3WU4 A;  3ZZU A;  1J5E I;  3T1H E;  4JYA I;  2UXD I;  1PIE A;  1ELO A;  1XMQ I;  2VQF I;  4GKK E;  1NZ0 A;  4DPT A;  5L3J A;  4JV5 I;  2DEI A;  4B3M I;  1VIS A;  1ZXM A;  5LL6 R;  4LFA E;  2V34 A;  5BR8 E;  4JI7 I;  2UU9 I;  1QZR A;  4LFB E;  1X49 A;  2HFS A;  5IT9 C; 
#chains in the Genus database with same CATH topology
 1FJG I;  1IBK I;  2EM5 A;  4MU3 A;  4Q28 A;  1H7S A;  1DI2 A;  1XHK A;  5AE3 A;  2YSO A;  1B63 A;  3H09 A;  1ZBQ A;  1ZR9 A;  4IZK B;  1T38 A;  5AC5 A;  2VF3 A;  3T1H I;  1K47 A;  3FIG A;  1YHC A;  4UT4 A;  3M6A A;  5GMD A;  1N32 I;  4LF7 E;  1FKA E;  4BCA A;  2JPA A;  2NA2 A;  1N0U A;  3EPH A;  2V88 A;  3PS2 A;  1WRJ A;  1TN9 A;  2YRK A;  2EPA A;  4R2A A;  4U3B A;  2RTX A;  1LLM C;  2PO0 B;  3F0N A;  4IFD D;  5JEA F;  3ADG A;  5ADZ A;  4O4K A;  1USV A;  4JI8 E;  1WUU A;  4BA2 A;  4F9A B;  3QT8 A;  4WXD A;  1RC7 A;  3RMP A;  4WX9 A;  4R2P A;  3EPJ A;  3DD6 A;  4LFA I;  1MU5 A;  2EL5 A;  1Y4U A;  1Y6Z A;  4NZV A;  3QT7 A;  4MYT A;  1JK2 A;  3V5R A;  4DR4 I;  2HK3 A;  4OZE A;  2JEB B;  4BC7 A;  3GCM A;  4X64 E;  2JE6 A;  2YTE A;  4IS9 A;  2N3H A;  2RPC A;  1Z0C A;  4R8O A;  2CVE A;  4DV7 E;  1I94 E;  1GTK A;  3ECR A;  2CZ9 A;  4IZJ D;  1Z0T A;  2VE7 C;  4B3T E;  1KIJ A;  1OYS A;  2EFG A;  2Q2E B;  4HAC B;  2EN4 A;  2YTP A;  4JI6 I;  2GLI A;  5AAS A;  2BBG A;  4BS9 A;  3BBG A;  3J7A G;  2A2D A;  2EPP A;  1N0V C;  4M1K A;  1X3C A;  1YYO A;  4Z7C A;  4LPF A;  4YY3 E;  3ZZ0 A;  3HTX A;  4B3S E;  2L33 A;  2EPR A;  1EH6 A;  3PRY A;  1G2D C;  1Z0G A;  4AM3 A;  3KWR A;  2PO2 B;  1AAY A;  3BF2 A;  2MDR A;  2ZBK B;  1WHQ A;  3CDJ A;  2YTO A;  1HR0 I;  4DR6 E;  2NN6 A;  4MU1 A;  1PJT A;  3DJW A;  4F6N A;  2M9A A;  5A6A A;  3J80 C;  4KHP E;  4NBQ A;  4AIM A;  1IBL I;  2YTQ A;  1J26 A;  2C38 A;  2J7K A;  4FW5 A;  2EM7 A;  1XMO E;  4OO1 D;  5IT9 Q;  4LTY A;  4ZYH A;  5A6K A;  1DAR A;  4LCG A;  4N3O A;  2ZM6 I;  1D6T A;  2MDG A;  2EN3 A;  2EQ0 A;  4R2R A;  2L8T A;  4DV5 I;  2M4I A;  4M2Z A;  3ADL A;  3ZKB A;  2EOZ A;  1PVG A;  1FWK A;  4ISA A;  4R1F A;  2GHF A;  2ZIT A;  5C0X B;  2EPN A;  2EOH A;  1UDN A;  2BV3 A;  2YSP A;  5LMU E;  5EL9 A;  1I94 I;  4I8O A;  1PKP A;  4B3T I;  4R03 A;  2YZT A;  2WP8 A;  2Z5C A;  4ZVI A;  1Y4S A;  3GME A;  1A1K A;  3LLH A;  2YU5 A;  3P1X A;  2LE2 A;  2YTJ A;  1Y5Y A;  4LOM A;  4X65 I;  4BA1 A;  3VK6 A;  4DR5 E;  2LTR A;  2LUQ A;  1S4E A;  2WBU A;  4RPF A;  1XNQ I;  2EM0 A;  3TQM A;  3HKM A;  3U1Y A;  1IQS A;  4J8Z A;  2VES A;  4B3S I;  4JI2 E;  3PYD A;  2UXC E;  2E5L I;  3THO B;  2F1D A;  1GQE A;  3C6M A;  2NUF A;  4P7A A;  1BKN A;  2PNZ A;  5LMN I;  4IFD A;  4GKJ I;  4LF4 I;  4DR6 I;  4LCH A;  5LLQ A;  2GO4 A;  4NXN E;  5K36 C;  4JG4 A;  2LO3 A;  4WSP A;  1Z1B A;  4DU8 A;  1IBM I;  2R42 A;  2EP3 A;  2JY9 A;  3BGH A;  4F9C B;  1UN6 B;  2Z5E A;  2UXB I;  2VQE E;  3OML A;  4XTJ A;  5JEA D;  4DR7 E;  1A1G A;  2GS8 A;  3B4T A;  1H7U A;  2MKN A;  4O24 A;  2JT2 A;  2JEA A;  2ELY A;  4JI1 I;  2O1V A;  2R1F A;  2EL4 A;  4R2E A;  4LFC E;  1YZ9 A;  5DRR A;  2C39 A;  4I3H A;  1HNW E;  3M85 G;  5LMU I;  1KYQ A;  3LNU A;  2YTG A;  1RR9 A;  1R6L A;  3MHS C;  4IZJ A;  3IWB A;  2EN8 A;  3CWV A;  3THN A;  2C37 B;  3PYF A;  2EOM A;  4OX9 I;  5A6J A;  4DR1 I;  1HNZ I;  3JU0 A;  4HTG A;  1YH8 A;  3NZK A;  2K7I A;  2YT4 A;  4JI3 E;  4X66 I;  2DMI A;  3T1Y I;  2UXC I;  2LVH A;  1H73 A;  3ZM7 A;  1EH8 A;  3J7A M;  1NEI A;  1HNX E;  2WCC 3;  3J80 Q;  2CPN A;  3PYE A;  4LF5 E;  4DV3 E;  1YFH A;  3J81 Q;  3VYY A;  4MLQ A;  1PDA A;  3EPK A;  4WFT A;  4DV4 E;  2VF1 A;  4LU9 A;  2FV4 B;  3C6K A;  1XNR E;  4NXN I;  1T4N A;  1DGC A;  2B3T B;  2EOS A;  4MYU A;  1UHZ A;  3JAM C;  2HHH E;  4L8N A;  2EPU A;  4GKK I;  2PO1 B;  2EM8 A;  4OO1 A;  4DR7 I;  4M0V A;  3ZOQ B;  1WXR A;  4WUB A;  1A1L A;  2DIX A;  2DRP A;  2EMA A;  1IQO A;  3ZKD A;  4DV1 E;  3UK3 C;  4JI0 E;  2XEX A;  3EPL A;  2Z5B A;  1ZAA C;  2ENH A;  2EWL A;  2LMZ A;  1H74 A;  4ZYG A;  2HK2 A;  4FWG A;  4MQY A;  4FWH A;  2DSY A;  5GME A;  5BR8 I;  4AQY E;  3LML A;  2EML A;  2UUA E;  3GLL A;  1YUJ A;  1N33 E;  2YRH A;  4F9B B;  2DGC A;  1MX0 A;  3UHM A;  3J7Y p;  4JI3 I;  4LFB I;  4QNJ A;  3F6H A;  4RHB B;  1FI4 A;  1X6E A;  3L7Z B;  1UIL A;  1KJK A;  3WU6 A;  4OOG C;  2NN6 C;  4DU7 A;  2UUC E;  4DR2 E;  4JI5 E;  2GPI A;  5KL6 A;  4LF6 E;  1EI1 A;  3HUL A;  5FWK A;  1HNX I;  2V83 A;  4DUZ E;  1EA6 A;  4LF5 I;  2EM2 A;  3IWC A;  2L2M A;  4BBY A;  1NHH A;  3U1K A;  2LUP B;  3M99 B;  3C4T A;  4DUY E;  4DV3 I;  2EOF A;  4DPX A;  2L6M A;  2R3V A;  3QT6 A;  4DV4 I;  1AH5 A;  5KL4 A;  4LF7 I;  1XNR I;  5A69 A;  3B82 A;  4FW6 A;  2WZO A;  4HXZ A;  2V85 A;  2PNM A;  1L4S A;  5EKW A;  2V89 A;  2HHH I;  2HGH A;  3PYG A;  4FN5 A;  1DQ3 A;  4DR3 E;  2HFU A;  5DRO A;  5K36 B;  4JI0 I;  5JEA A;  4JI8 I;  3HJC A;  2UUB E;  4GEQ B;  1Z5C A;  2DLK A;  1YPN A;  4OO1 B;  2OI2 A;  5DNX A;  4DPU A;  3J81 C;  1YYW A;  1E3H A;  2V2Z A;  1YYK A;  1B62 A;  4AQY I;  2L92 A;  2EMF A;  2HC5 A;  1N34 E;  2BR2 A;  4FW7 A;  4YHH I;  2X36 A;  3EQ1 A;  2O1W A;  3P3G A;  4LCF A;  4X64 I;  2JYA A;  3OTO E;  2EPL X;  2EMH A;  1YUI A;  2L2N A;  3DF6 A;  2L2K B;  4IFD C;  1ZU1 A;  2ENA A;  4FW3 A;  3HQ1 A;  4DV7 I;  3JTZ A;  1X49 A;  1N36 E;  2MKD A;  2I13 A;  1P42 A;  3M85 D;  4BHC A;  4Q35 B;  1EKZ A;  1A1H A;  5F3W A;  1OYP A;  4DUZ I;  3LTO A;  3M7N G;  4BA2 B;  2X7I A;  4O5G A;  4JYA E;  2AJ4 A;  1FWL A;  3JAM Q;  4ZYD A;  5K36 E;  2GQ0 A;  2EOQ A;  5C0X D;  2JOB A;  4YY3 I;  1T4O A;  1N33 I;  1JK1 A;  2CSH A;  2VQF E;  1KVK A;  1U2R A;  1USU A;  1Z0V A;  1ZM2 A;  2YTI A;  4IZK A;  3P76 A;  4TUG A;  4X9J A;  1BB8 A;  1RMD A;  5IXM B;  2YU8 A;  5IWA E;  4BHB A;  4P7D A;  4B3M E;  4B3R E;  3K1J A;  4MU0 A;  4LF9 E;  2UUB I;  2PRT A;  4OKG A;  4KHP I;  4LF8 E;  1GZ6 A;  1QNT A;  2LV2 A;  3VYX A;  2EPK X;  1TF6 A;  1BBG A;  2EOJ A;  2Q8U A;  4JI7 E;  1XMO I;  2PO0 A;  5A2Q C;  2UU9 E;  3H1C A;  5K36 F;  3AUZ A;  1X47 A;  1T4L B;  3P3E A;  1UDQ A;  3OTO I;  2ENC A;  3ADJ A;  3VHT B;  3WU5 A;  4DV0 E;  4M30 A;  4X62 E;  2V8P A;  4KZS A;  3B78 A;  2JR1 A;  2N3G A;  1RQ0 A;  1N36 I;  4WPY A;  1WJP A;  1X6H A;  4J3D A;  2DLQ A;  2V2Q A;  1ZM4 A;  2V86 A;  2YWQ A;  4WYQ B;  2JEB A;  4UTG A;  1OJ4 A;  4OO1 C;  4KWY A;  1N32 E;  4FW9 A;  4X8W A;  4HY1 A;  4DR5 I;  2CT1 A;  1A6F A;  2C38 B;  5DNL A;  2EMB A;  2BM1 A;  2WNR B;  3Q6N A;  3MHH C;  3QT5 A;  4R2S A;  1RRE A;  4JI2 I;  2EM9 A;  3QG5 C;  2EPO A;  4WUD A;  1H72 C;  2RS6 A;  5KL2 A;  4HAC A;  1SR9 A;  2R76 A;  5IWA I;  3P06 A;  2YTD A;  4NHR A;  1Z5B A;  4R2Q A;  4HEI A;  4B3R I;  4NXM E;  4LF9 I;  1STU A;  5A6B D;  3WU3 A;  4GQU A;  4LF8 I;  2E72 A;  4WSG A;  2M7Q A;  3Q1Q A;  2WP8 B;  2Z5C B;  4DR4 E;  5DRQ A;  5C0X C;  2E1R A;  4Z7Y A;  2VQE I;  4FWD A;  3V2U C;  2L3J A;  4BA1 B;  5FLX Q;  2D9H A;  2RSM A;  4F2J C;  2DEJ A;  2EOO A;  2IOQ A;  2RSI A;  2PO2 A;  2EMW A;  2F8B A;  2B7V A;  1WHN A;  2HKJ A;  4MLV A;  1NHI A;  4DXL A;  2NN6 E;  4DV0 I;  4X62 I;  3IWD A;  4DKK A;  5AE1 A;  2MC6 A;  3CDI A;  3D4J A;  4LFC I;  4PU9 A;  4USM A;  2M1S A;  3HPZ A;  1HNW I;  4N4R B;  4JI6 E;  4HYM A;  2PNZ B;  3MSW A;  3LPS A;  5IV8 B;  4IFD B;  1MEY C;  2MC5 A;  2EQ3 A;  4DPY A;  3ZZT A;  1FJG E;  5CFF E;  1IBK E;  2HKE A;  5JEA C;  2YTF A;  4O43 A;  2LJU A;  2YPN A;  5C0X A;  1A1J A;  2CG9 A;  1NHJ A;  1O0W A;  1X5W A;  2HJJ A;  2IES A;  4ZYE A;  2EPC A;  1ZM9 A;  2EN6 A;  2EZ6 A;  4P52 A;  4AID A;  1Z0B A;  3KRN A;  2JEA B;  2NN6 F;  3M7N D;  5ELW A;  2EOX A;  2F4V E;  1HR0 E;  1Y60 A;  2DMY A;  4F6M A;  3C4B A;  4NXM I;  2EMC A;  2C39 B;  3H4L A;  5A2Q Q;  2H36 X;  1IBL E;  1F2I G;  1SFE A;  2BM0 A;  2A25 A;  2ADR A;  1UDO A;  3PS1 A;  2BA0 D;  4IZJ B;  2ZM6 E;  4JI4 E;  4IS1 C;  4DV2 E;  1Z5A A;  1PJS A;  2WW4 A;  1ZBT A;  4DV5 E;  1Z0W A;  2JXP A;  2O3Z A;  2EL6 A;  3F6G A;  2NAB A;  2O1T A;  3B8H A;  4DV1 I;  4URL A;  4IFD E;  4YHH E;  4K0K E;  2E1M A;  1KTV A;  2YTN A;  1UBD C;  1B69 A;  4QNK A;  3KZY A;  1YSA C;  2V2V A;  1E3P A;  2EM6 A;  2FGG A;  4DPW A;  2L3C A;  2EOI A;  5KL5 A;  2EOE A;  4DV6 E;  2LT7 A;  2LCE A;  5K36 D;  4X65 E;  1FNM A;  2UUA I;  1EH7 A;  1ZXN A;  2JOX A;  1Z59 A;  4IJD A;  4M9V C;  2EM3 A;  3PS3 A;  2WBS A;  4BC9 A;  1XNQ E;  2B7T A;  2ODR D;  1BBO A;  4WXC A;  1S16 A;  4WUC A;  5FLX C;  2EPZ A;  2LJP A;  2E5L E;  4USK A;  2UUC I;  2RQL A;  4DR2 I;  2EM4 A;  2EQ1 A;  4JI5 I;  2GO3 A;  4LF6 I;  2K4V A;  1KKH A;  4IFD F;  1J5E E;  5LMN E;  4FW4 A;  2LBS B;  4ED4 A;  5KL3 A;  3L00 A;  4GKJ E;  2C37 A;  2Z5B B;  4LF4 E;  4U3D A;  2F4V I;  4DUY I;  4TUI A;  2UXD E;  4FK5 C;  1IBM E;  1T39 A;  2N8X A;  1XMQ E;  2EE8 A;  5A6B A;  2BA0 G;  1IMU A;  2UXB E;  2WNR A;  2EMZ A;  1UEK A;  4JI4 I;  2EN2 A;  3ADI A;  5AE2 A;  1R6M A;  4DV2 I;  2KHX A;  4JV5 E;  5T6J A;  4DR3 I;  2LTS A;  3BID A;  2V87 A;  4F54 A;  4JI1 E;  1Z0E A;  1PJQ A;  1QU6 A;  2JE6 B;  4BMJ A;  4DMI A;  5DNY A;  2PNL A;  1MGT A;  2EOR A;  4P78 A;  4RH8 A;  4KQV A;  4R2D A;  2JVA A;  2BA1 D;  4K0K I;  1X48 A;  1ZM3 A;  4MU4 A;  3P3C A;  2NUG A;  2EMK A;  2EPM X;  2IHR 1;  1HK7 A;  4PRV A;  2A2C A;  4PRX A;  2IOP A;  3HXL A;  4OX9 E;  4DV6 I;  4DR1 E;  1HNZ E;  3K6Q A;  2NPF A;  2PO1 A;  4OO1 E;  2YRM A;  2EMY A;  1MG7 A;  1XXE A;  1N34 I;  3KZZ A;  4R2C A;  5TSE A;  4X66 E;  1X6F A;  2B9D A;  2DB2 A;  2EMX A;  2BB8 A;  2EMG A;  2KOU A;  2LJH A;  2LRS A;  2WBT A;  4GZN C;  3T1Y E;  2RS7 A;  3GON A;  5AC4 A;  4EMD A;  5KL7 A;  2EPX A;  3K17 A;  1P47 A;  3AV0 A;  2NUE A;  2EMI A;  3WU4 A;  3ZZU A;  2EN1 A;  1J5E I;  1UDS A;  5JEA B;  3T1H E;  5DRP A;  4JYA I;  4L5N C;  2CTD A;  4MDT A;  2EJ4 A;  2UXD I;  1PIE A;  2NN6 B;  2IER A;  1ELO A;  2CGE A;  2O1U A;  2V8Q B;  1OYR A;  3L7Z A;  1XMQ I;  5C0X E;  2EOY A;  2JWO A;  4OO1 F;  2VQF I;  2AE8 A;  3Q6M A;  2J65 A;  4GKK E;  1NZ0 A;  4DPT A;  2ODR C;  1NCS A;  2BR2 B;  2VRD A;  1A1F A;  5L3J A;  2NN6 D;  3K85 A;  4JV5 I;  2DEI A;  1N3G A;  4B3M I;  1VIS A;  1VI7 A;  1ZXM A;  3HPS A;  5LL6 R;  1TF3 A;  2BA1 G;  2JP9 A;  2EN7 A;  4LFA E;  1RHY A;  2G7H A;  2ELZ A;  1A1I A;  2V34 A;  5BR8 E;  4JI7 I;  2FTX B;  2I9I A;  2UU9 I;  2KON A;  1G2F C;  1QZR A;  4LFB E;  2J7J A;  2HFS A;  5K36 A;  5IT9 C;  5C0X F;  5JEA E; 
#chains in the Genus database with same CATH homology
 1FJG I;  1IBK I;  4Q28 A;  1H7S A;  1DI2 A;  1XHK A;  5AE3 A;  1B63 A;  3H09 A;  1ZBQ A;  4IZK B;  2VF3 A;  3T1H I;  1K47 A;  3FIG A;  4UT4 A;  3M6A A;  1N32 I;  4LF7 E;  1FKA E;  4BCA A;  2NA2 A;  1N0U A;  2V88 A;  2RTX A;  3F0N A;  3ADG A;  5ADZ A;  1USV A;  4JI8 E;  1WUU A;  4F9A B;  3QT8 A;  1RC7 A;  3RMP A;  4LFA I;  1MU5 A;  1Y4U A;  1Y6Z A;  3QT7 A;  4MYT A;  3V5R A;  4DR4 I;  2HK3 A;  4BC7 A;  4X64 E;  2N3H A;  1Z0C A;  4R8O A;  4DV7 E;  1I94 E;  4IZJ D;  2CZ9 A;  1Z0T A;  2VE7 C;  4B3T E;  1KIJ A;  2EFG A;  2Q2E B;  4HAC B;  4JI6 I;  5AAS A;  4BS9 A;  3J7A G;  2A2D A;  1N0V C;  4M1K A;  1YYO A;  4Z7C A;  4YY3 E;  3ZZ0 A;  3HTX A;  4B3S E;  2L33 A;  3PRY A;  1Z0G A;  3KWR A;  2MDR A;  2ZBK B;  1WHQ A;  1HR0 I;  4DR6 E;  3DJW A;  3J80 C;  4KHP E;  1IBL I;  1J26 A;  2J7K A;  5IT9 Q;  1XMO E;  4LTY A;  1DAR A;  2ZM6 I;  4N3O A;  1D6T A;  2L8T A;  4DV5 I;  2M4I A;  4M2Z A;  3ADL A;  3ZKB A;  1PVG A;  1FWK A;  4R1F A;  2ZIT A;  2BV3 A;  1I94 I;  5LMU E;  4I8O A;  1PKP A;  4B3T I;  4R03 A;  2YZT A;  2Z5C A;  4ZVI A;  1Y4S A;  3LLH A;  3P1X A;  2LE2 A;  4X65 I;  3VK6 A;  4DR5 E;  2LTR A;  2LUQ A;  1S4E A;  4RPF A;  1XNQ I;  4B3S I;  4J8Z A;  4JI2 E;  3PYD A;  2UXC E;  2E5L I;  1GQE A;  2NUF A;  4P7A A;  1BKN A;  5LMN I;  4GKJ I;  4LF4 I;  4DR6 I;  4NXN E;  4JG4 A;  4WSP A;  4DU8 A;  1IBM I;  2R42 A;  2JY9 A;  4F9C B;  2UXB I;  2Z5E A;  2VQE E;  3OML A;  4XTJ A;  4DR7 E;  2GS8 A;  1H7U A;  4JI1 I;  2O1V A;  4LFC E;  1YZ9 A;  4I3H A;  1HNW E;  5LMU I;  3LNU A;  1RR9 A;  4IZJ A;  3IWB A;  3CWV A;  3PYF A;  4OX9 I;  4DR1 I;  1HNZ I;  3JU0 A;  2YT4 A;  4JI3 E;  4X66 I;  3T1Y I;  2UXC I;  1H73 A;  3ZM7 A;  3J7A M;  1HNX E;  3J80 Q;  2CPN A;  3PYE A;  4LF5 E;  4DV3 E;  3J81 Q;  3VYY A;  4DV4 E;  4WFT A;  2VF1 A;  4LU9 A;  2FV4 B;  1XNR E;  4NXN I;  1T4N A;  2B3T B;  4MYU A;  1UHZ A;  3JAM C;  2HHH E;  4L8N A;  4GKK I;  4DR7 I;  4M0V A;  3ZOQ B;  1WXR A;  4WUB A;  2DIX A;  3ZKD A;  4DV1 E;  4JI0 E;  2XEX A;  2Z5B A;  2EWL A;  2LMZ A;  1H74 A;  2HK2 A;  4FWG A;  4FWH A;  2DSY A;  5GME A;  5BR8 I;  4AQY E;  3LML A;  2UUA E;  1N33 E;  4F9B B;  1MX0 A;  4LFB I;  3J7Y p;  4JI3 I;  3F6H A;  1FI4 A;  1UIL A;  3WU6 A;  4OOG C;  4DU7 A;  2UUC E;  4DR2 E;  4JI5 E;  5FWK A;  1EI1 A;  4LF6 E;  3HUL A;  1HNX I;  2V83 A;  4DUZ E;  1EA6 A;  4LF5 I;  3IWC A;  2L2M A;  4BBY A;  1NHH A;  4DV3 I;  2LUP B;  4DUY E;  3C4T A;  4DPX A;  2L6M A;  2R3V A;  3QT6 A;  4DV4 I;  4LF7 I;  1XNR I;  3B82 A;  2WZO A;  4HXZ A;  2V85 A;  2PNM A;  2V89 A;  2HHH I;  3PYG A;  4FN5 A;  1DQ3 A;  4DR3 E;  2HFU A;  4JI0 I;  4JI8 I;  3HJC A;  2UUB E;  4GEQ B;  1Z5C A;  2OI2 A;  4DPU A;  3J81 C;  1YYW A;  2V2Z A;  1YYK A;  1B62 A;  4AQY I;  2L92 A;  1N34 E;  1N33 I;  2X36 A;  4X64 I;  2O1W A;  3OTO E;  2L2N A;  3DF6 A;  2L2K B;  3HQ1 A;  4DV7 I;  3JTZ A;  1N36 E;  1EKZ A;  5F3W A;  4DUZ I;  3LTO A;  2X7I A;  4JYA E;  2AJ4 A;  1FWL A;  3JAM Q;  2GQ0 A;  2JOB A;  4YY3 I;  1T4O A;  2VQF E;  1KVK A;  1U2R A;  1USU A;  1Z0V A;  1ZM2 A;  4IZK A;  4TUG A;  5IWA E;  4P7D A;  4B3M E;  4B3R E;  3K1J A;  4LF9 E;  2UUB I;  4KHP I;  4LF8 E;  1GZ6 A;  3VYX A;  4JI7 E;  1XMO I;  5A2Q C;  2UU9 E;  3AUZ A;  1X47 A;  1T4L B;  3OTO I;  3ADJ A;  3WU5 A;  4DV0 E;  4M30 A;  4X62 E;  2V8P A;  4KZS A;  3B78 A;  2JR1 A;  2N3G A;  1RQ0 A;  1N36 I;  4WPY A;  2V2Q A;  1ZM4 A;  2V86 A;  4WYQ B;  4UTG A;  1OJ4 A;  1N32 E;  4FW9 A;  4X8W A;  4HY1 A;  4DR5 I;  1A6F A;  2BM1 A;  3Q6N A;  3QT5 A;  1RRE A;  4JI2 I;  4WUD A;  1H72 C;  2RS6 A;  4HAC A;  1SR9 A;  5IWA I;  3P06 A;  1Z5B A;  4B3R I;  4NXM E;  4LF9 I;  1STU A;  3WU3 A;  4LF8 I;  2M7Q A;  3Q1Q A;  2Z5C B;  4DR4 E;  2E1R A;  4Z7Y A;  2VQE I;  4FWD A;  3V2U C;  2L3J A;  5FLX Q;  2RSM A;  2DEJ A;  2IOQ A;  2F8B A;  2HKJ A;  2B7V A;  1WHN A;  4DXL A;  1NHI A;  4DV0 I;  4X62 I;  3IWD A;  4DKK A;  5AE1 A;  2MC6 A;  4LFC I;  3D4J A;  4PU9 A;  4USM A;  2M1S A;  3HPZ A;  1HNW I;  4JI6 E;  4HYM A;  3MSW A;  3LPS A;  2MC5 A;  4DPY A;  3ZZT A;  5CFF E;  2HKE A;  2CG9 A;  1NHJ A;  1O0W A;  4P52 A;  1ZM9 A;  2EZ6 A;  1Z0B A;  2F4V E;  1HR0 E;  2DMY A;  3C4B A;  4NXM I;  3H4L A;  5A2Q Q;  2H36 X;  1IBL E;  2BM0 A;  4IZJ B;  2ZM6 E;  4JI4 E;  4DV2 E;  1Z5A A;  2WW4 A;  1ZBT A;  4DV5 E;  1Z0W A;  3F6G A;  2O1T A;  4DV1 I;  3B8H A;  4URL A;  4YHH E;  4K0K E;  2E1M A;  1KTV A;  2V2V A;  2FGG A;  4DPW A;  2L3C A;  4DV6 E;  4X65 E;  1FNM A;  2UUA I;  1ZXN A;  2JOX A;  1Z59 A;  1XNQ E;  4BC9 A;  2B7T A;  2ODR D;  1S16 A;  4WUC A;  5FLX C;  2LJP A;  2E5L E;  4USK A;  2UUC I;  4DR2 I;  4JI5 I;  4LF6 I;  2K4V A;  1KKH A;  1J5E E;  5LMN E;  2LBS B;  4ED4 A;  2F4V I;  4GKJ E;  2Z5B B;  4LF4 E;  4DUY I;  4TUI A;  2UXD E;  1IBM E;  1XMQ E;  2UXB E;  1UEK A;  4JI4 I;  3ADI A;  5AE2 A;  4DV2 I;  2KHX A;  4JV5 E;  5T6J A;  4DR3 I;  2LTS A;  4F54 A;  2V87 A;  4JI1 E;  1Z0E A;  2PNL A;  1QU6 A;  4BMJ A;  4DMI A;  5DNY A;  4KQV A;  4P78 A;  4YHH I;  4K0K I;  2JVA A;  1X48 A;  1ZM3 A;  2NUG A;  2IHR 1;  1HK7 A;  4PRV A;  2A2C A;  4PRX A;  2IOP A;  3HXL A;  4OX9 E;  4DV6 I;  4DR1 E;  1HNZ E;  3K6Q A;  2NPF A;  1MG7 A;  1N34 I;  4X66 E;  2B9D A;  2LJH A;  2DB2 A;  2LRS A;  1IBK E;  1FJG E;  2KOU A;  3GON A;  3T1Y E;  5GMD A;  4EMD A;  2RS7 A;  3K17 A;  3AV0 A;  2NUE A;  3WU4 A;  3ZZU A;  1J5E I;  3T1H E;  4JYA I;  4L5N C;  2UXD I;  1PIE A;  1ELO A;  2CGE A;  2O1U A;  2V8Q B;  1XMQ I;  2JWO A;  2VQF I;  3Q6M A;  4GKK E;  1NZ0 A;  4DPT A;  2ODR C;  5L3J A;  4JV5 I;  3K85 A;  2DEI A;  4B3M I;  1VIS A;  1ZXM A;  3HPS A;  5LL6 R;  4LFA E;  2G7H A;  2V34 A;  5BR8 E;  4JI7 I;  2FTX B;  2UU9 I;  2KON A;  1QZR A;  4LFB E;  1X49 A;  2HFS A;  5IT9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...