1RR9A

Catalytic domain of e.coli lon protease
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATP-dependent protease La
publication title The catalytic domain of Escherichia coli Lon protease has a unique fold and a Ser-Lys dyad in the active site
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2003-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1rr9A01
3J80Q 4AQYE 2Q2EB 4DR4I 4JI1E 4FN5A 2VQEE 1HR0I 5IWAI 1Z0CA 4DR1E 1Z5CA 4DR3I 1HNXI 4NXMI 3B78A 2DEJA 2V2ZA 5LMNI 3PYGA 1PKPA 1HNWE 2UUBI 3QT8A 3V2UC 3H4LA 1Z0WA 1UEKA 4HXZA 1EI1A 4K0KI 2HHHI 2UU9E 2VQFE 4M1KA 4USMA 4JV5E 3J81C 4DPYA 5IWAE 4DR3E 4NXME 4DR6E 5LMNE 2V2VA 1MG7A 4DV0E 1KVKA 2UUBE 4LF7I 2HFSA 4GKKI 5IT9Q 4LF8E 3WU3A 5GMEA 4DPWA 4K0KE 2HHHE 5FLXC 1IBLI 4JG4A 3ZZ0A 4JI0E 1PVGA 1N34E 1U2RA 4LFCI 4X64I 4HYMA 5BR8I 4OX9I 2J7KA 4HACA 4RPFA 4GKKE 1RREA 1FI4A 4JI7I 4HY1A 4FW9A 4LF5E 2EFGA 1Z59A 2HFUA 2LJPA 4JI8I 3WU4A 4B3SI 1MX0A 4EMDA 3T1YI 4DR7E 2UUAI 1N33E 2E1RA 4X64E 2ZBKB 4OX9E 4JI1I 2XEXA 4P7AA 2VQEI 2ZM6E 4DR1I 4X66E 4JI6I 5IT9C 1HNWI 1XNQE 4LFBE 4WUCA 3J7AG 3V5RA 4I3HA 4Z7CA 2UUAE 2UU9I 2VQFI 4DPTA 4JV5I 4FWGA 4JYAI 4DR5E 2CZ9A 3OTOE 4DV2I 2F4VE 2GS8A 1N0VC 4DR6I 4UT4A 1H73A 4JI6E 3D4JA 4LFAE 4GKJI 3PYDA 4DV0I 1ZM2A 3JAMQ 4Z7YA 4LF8I 1B63A 1ZXNA 4DV4I 1XMOI 1NHJA 1K47A 1J5EE 4DV6E 1Z0EA 1NZ0A 4JYAE 4DV3E 4PRXA 3ZZUA 1XNRE 4DV2E 4JI0I 2HK3A 3F0NA 1N34I 4DR2I 4X65E 4GKJE 3ZKBA 1ZM3A 1S4EA 1XMQI 3PYFA 4DV1E 4DV4E 4LF5I 4NXNI 1XMOE 5A2QQ 2A2CA 2HK2A 2AJ4A 4KHPE 4JI2I 3J80C 4DR7I 4DR2E 1N33I 4DUYE 2UXBE 3T1HI 4YY3E 3Q1QA 5LMUE 2UXCE 4FWHA 2ZM6I 1XMQE 1H7UA 4X66I 1MU5A 4NXNE 3ZZTA 3J7AM 4ZVIA 3JAMC 1FNMA 2R42A 1IBME 1XNQI 4JI4E 4DUZE 4JI2E 3ZKDA 4LFBI 1H7SA 3WU5A 1Z0GA 3T1HE 4DV7E 4B3MI 4MYTA 1ZM4A 4YHHE 4DV5E 1H74A 4DR5I 1Z0TA 4DU8A 3OTOI 2F4VI 2A2DA 4USKA 1S16A 3QT6A 2UXDE 1QZRA 4R1FA 2UUCE 4LFAI 1IBKI 2R3VA 3J81Q 2E5LE 4LF9E 1N36E 5GMDA 4XTJA 5A2QC 2DEIA 4P52A 3GONA 4LF6I 4X62E 1J5EI 2V8PA 4DV6I 4B3ME 1OJ4A 4DV3I 1XNRI 4DXLA 3CWVA 1N32E 4B3RE 3LNUA 4X65I 1IBKE 3LTOA 1HNZI 3QT5A 4HACB 1PIEA 4DV1I 4DPUA 4LF6E 1N0UA 4PRVA 3B8HA 4DPXA 1NHIA 4KHPI 2BV3A 1FKAE 4UTGA 4DUYI 2UXBI 4ED4A 4YY3I 5LMUI 2UXCI 1FWLA 3B82A 1I94E 1H72C 4B3TI 1HNZE 1XHKA 4WUDA 4DR4E 1BKNA 4MYUA 2WW4A 2OI2A 1HR0E 1KKHA 1HNXE 1IBMI 2HKJA 5LL6R 4JI4I 4DUZI 1EA6A 1VISA 1Z0BA 1D6TA 4DV7I 1B62A 4YHHI 4DV5I 4B3TE 1Z5AA 4JI3I 2X7IA 1KIJA 3WU6A 3LPSA 2UXDI 4JI5I 2UUCI 2E5LI 1Z5BA 1FJGI 4LF9I 1N36I 1RR9A 1FWKA 4PU9A 4X62I 4LF7E 3ZM7A 2V34A 1A6FA 4URLA 3HULA 4JI3E 4WUBA 1IBLE 4LF4I 1N32I 4B3RI 4JI5E 4FWDA 5L3JA 2BM0A 1FJGE 4LFCE 4AQYI 5BR8E 1DARA 3K17A 3M6AA 1ELOA 1KTVA 2NPFA 3QT7A 2VF3A 1ZXMA 4JI7E 2X36A 3K1JA 4KQVA 1NHHA 4LF4E 4JI8E 2BM1A 3PYEA 5FLXQ 1WUUA 2HKEA 2V2QA 4DU7A 4B3SE 3T1YE 1Z0VA 1I94I 1ZM9A 2ZITA
chains in the Genus database with same CATH superfamily
3J80Q 4AQYE 2Q2EB 4DR4I 1OYPA 4JI1E 4FN5A 1HK7A 2VQEE 1HR0I 5IWAI 1Z0CA 4DR1E 1Z5CA 4DR3I 1HNXI 4NXMI 3B78A 2CVEA 4NBQA 2C37B 2DEJA 2V2ZA 5LMNI 5K36A 4MU4A 3M85D 5C0XB 5K36E 3PYGA 1PKPA 1HNWE 2UUBI 3QT8A 3V2UC 3H4LA 3P3CA 1Z0WA 4BA2B 1UEKA 4HXZA 1EI1A 4IZKB 4K0KI 2HHHI 3GCMA 2UU9E 2VQFE 4M1KA 4USMA 4JV5E 2NN6D 3J81C 2O3ZA 4DPYA 5IWAE 4DR3E 4NXME 4DR6E 5LMNE 2V2VA 1MG7A 1UDNA 4DV0E 1KVKA 2UUBE 4LF7I 3P3GA 2HFSA 4GKKI 5C0XF 5IT9Q 4LF8E 3WU3A 2F1DA 5GMEA 4DPWA 4K0KE 2HHHE 5FLXC 3M85G 1IBLI 4MDTA 4JG4A 2WP8A 1R6LA 3ZZ0A 4JI0E 4LCFA 2IOQA 2AE8A 1PVGA 1N34E 2PO0A 4OO1C 3U1KA 1U2RA 4LFCI 4X64I 3PS3A 3UHMA 4HYMA 4ISAA 5BR8I 3L7ZB 4OX9I 2J7KA 4IS9A 2PO1B 4HACA 4RPFA 4GKKE 1RREA 5JEAB 1FI4A 4JI7I 4HY1A 2PO2B 1Y4SA 4FW9A 4LF5E 2EFGA 2GQ0A 1Z59A 2HFUA 1YH8A 2C37A 2LJPA 4JI8I 5K36D 5C0XA 3WU4A 4B3SI 1MX0A 4EMDA 3T1YI 4LPFA 4DR7E 4J3DA 2UUAI 5C0XE 1N33E 4BA2A 2E1RA 4X64E 4IZKA 2ZBKB 4MU1A 4OX9E 4JI1I 2XEXA 4P7AA 2VQEI 2ZM6E 4DR1I 2PNMA 3PS2A 4X66E 3P76A 5C0XC 4JI6I 4FW7A 5IT9C 1HNWI 1XNQE 5DNLA 2BR2B 1USUA 4FW4A 4IFDB 2BA1D 4LFBE 4WUCA 3J7AG 3V5RA 4I3HA 4OO1D 4OZEA 4Z7CA 2UUAE 2UU9I 2VQFI 4DPTA 4JV5I 4FWGA 4JYAI 1OYSA 4DR5E 2CZ9A 3OTOE 4OO1F 4IZJD 4DV2I 2F4VE 2GS8A 1N0VC 1UDQA 4DR6I 4UT4A 2IESA 1H73A 4JI6E 3D4JA 4LFAE 4GKJI 5ELWA 3Q6NA 3PYDA 4DV0I 3L7ZA 1ZM2A 3JAMQ 4Z7YA 4LF8I 1B63A 1E3PA 1ZXNA 2JEBB 4DV4I 2PO1A 1XMOI 1NHJA 1K47A 5JEAA 1J5EE 4DV6E 1Z0EA 1NZ0A 2Z5CB 2PO2A 4JYAE 4DV3E 4PRXA 2GO3A 3GMEA 3ZZUA 4DV2E 4JI0I 1XNRE 2HK3A 3F0NA 2BA1G 4LCHA 1N34I 4DR2I 2C38B 2Z5BB 5C0XD 4X65E 4GKJE 2JE6B 4N3OA 4OO1A 3ZKBA 1UDOA 1ZM3A 5JEAC 1S4EA 2C39A 1XMQI 3PYFA 4OO1E 5EKWA 4DV1E 4IZJA 4DV4E 4LF5I 4NXNI 1XMOE 5A2QQ 2A2CA 3HJCA 2HK2A 1USVA 2AJ4A 4KHPE 4GQUA 2O1VA 4JI2I 3PS1A 3J80C 2BR2A 4DR7I 4BA1A 4DR2E 1N33I 4DUYE 2UXBE 3T1HI 2Z5EA 1Y60A 4YY3E 3Q1QA 5LMUE 2UXCE 3Q6MA 4FWHA 2ZM6I 1Y4UA 1XMQE 1H7UA 4X66I 1MU5A 4NXNE 3ZZTA 3J7AM 4ZVIA 3JAMC 1FNMA 2R42A 3H1CA 1IBME 3CDJA 1XNQI 4IFDC 5DNXA 4JI4E 4DUZE 4JI2E 3ZKDA 4LFBI 2JT2A 1H7SA 3WU5A 1Z0GA 2J65A 3T1HE 4DV7E 4B3MI 4MYTA 1ZM4A 4YHHE 3U1YA 4DV5E 1H74A 4DR5I 1Z0TA 1P42A 4DU8A 3OTOI 2F4VI 2A2DA 4USKA 5JEAD 1S16A 2Z5CA 1Y5YA 3QT6A 4QNKA 2UXDE 4U3DA 1QZRA 4R1FA 2UUCE 4LFAI 2GO4A 1IBKI 2R3VA 1RHYA 3NZKA 5JEAF 3J81Q 4QNJA 2E5LE 2C38A 2Z5BA 4LF9E 1N36E 5GMDA 3PRYA 4XTJA 5A2QC 2JE6A 4MQYA 2O1WA 2DEIA 4P52A 2WNRB 3GONA 4LF6I 4X62E 1J5EI 2V8PA 4DV6I 4B3ME 1OJ4A 4DV3I 1XNRI 4DXLA 3CWVA 2CG9A 1N32E 2BA0G 2PO0B 4B3RE 3LNUA 5DRQA 3KRNA 4X65I 1IBKE 3LTOA 1HNZI 4IFDD 3HKMA 3QT5A 4HACB 2NN6B 1PIEA 4DV1I 2JEAB 4DPUA 4LF6E 1N0UA 4PRVA 2IERA 4IFDF 4AIDA 1VI7A 3B8HA 4DPXA 3M7ND 1NHIA 5JEAE 4KHPI 1YHCA 1E3HA 2BV3A 1FKAE 4UTGA 4DUYI 2UXBI 4ED4A 4YY3I 5LMUI 2UXCI 1FWLA 3P06A 3B82A 1I94E 1H72C 4B3TI 1HNZE 1XHKA 2PNZB 4MU3A 5DROA 4WUDA 4DR4E 1BKNA 5K36C 4MYUA 2WW4A 2OI2A 1HR0E 1KKHA 1HNXE 2NN6F 1IBMI 2HKJA 4AIMA 1OYRA 5DRRA 5LL6R 4DUZI 4JI4I 3P3EA 1EA6A 1VISA 4IFDA 1Z0BA 1D6TA 4DV7I 1B62A 4YHHI 4DV5I 2WNRA 4LCGA 3M7NG 4FW5A 4IFDE 1R6MA 2O1UA 3GLLA 1UDSA 4B3TE 1Z5AA 1XXEA 4JI3I 2X7IA 1KIJA 3WU6A 3LPSA 2UXDI 5K36B 4JI5I 2UUCI 3B4TA 2E5LI 1Z5BA 1FJGI 4LF9I 1N36I 1RR9A 1FWKA 4PU9A 2BA0D 4X62I 4LF7E 2IOPA 2PNLA 3ZM7A 2NN6A 2V34A 1A6FA 2JEBA 4URLA 2JEAA 4AM3A 3HULA 4JI3E 2NN6E 3DD6A 4WUBA 1IBLE 4LF4I 1N32I 4B3RI 4JI5E 4FWDA 5L3JA 2O1TA 1Y6ZA 2BM0A 1FJGE 4OO1B 5K36F 5DRPA 4LFCE 2NN6C 4AQYI 5BR8E 1DARA 2C39B 3K17A 3M6AA 1ELOA 1KTVA 2NPFA 4FW3A 2PNZA 4IZJB 3QT7A 2VF3A 3CDIA 1ZXMA 4OKGA 4JI7E 2X36A 2WP8B 3K85A 3K1JA 4KQVA 4U3BA 1NHHA 4LF4E 4FW6A 4JI8E 2BM1A 3PYEA 5FLXQ 1WUUA 4BA1B 2HKEA 2CGEA 2V2QA 4DU7A 4LOMA 4B3SE 4MU0A 5EL9A 3T1YE 1Z0VA 1I94I 1ZM9A 5FWKA 2VESA 2ZITA
chains in the Genus database with same CATH topology
3J80Q 4AQYE 2Q2EB 4DR4I 4JI1E 4FN5A 1HK7A 2VQEE 1HR0I 5IWAI 1Z0CA 4DR1E 1Z5CA 4DR3I 1HNXI 4NXMI 3B78A 2DEJA 2V2ZA 5LMNI 3PYGA 1PKPA 1HNWE 2UUBI 3QT8A 3V2UC 3H4LA 1Z0WA 1UEKA 4HXZA 1EI1A 4IZKB 4K0KI 2HHHI 2UU9E 2VQFE 4M1KA 4USMA 4JV5E 3J81C 4DPYA 5IWAE 4DR3E 4NXME 4DR6E 5LMNE 2V2VA 1MG7A 4DV0E 1KVKA 2UUBE 4LF7I 2HFSA 4GKKI 5IT9Q 4LF8E 3WU3A 5GMEA 4DPWA 4K0KE 2HHHE 5FLXC 1IBLI 4JG4A 3ZZ0A 4JI0E 2IOQA 1PVGA 1N34E 1U2RA 4LFCI 4X64I 4HYMA 5BR8I 4OX9I 2J7KA 4HACA 4RPFA 4GKKE 1RREA 1FI4A 4JI7I 4HY1A 4FW9A 1Y4SA 4LF5E 2EFGA 2GQ0A 1Z59A 2HFUA 2LJPA 4JI8I 3WU4A 4B3SI 1MX0A 4EMDA 3T1YI 4DR7E 2UUAI 1N33E 2E1RA 4X64E 4IZKA 2ZBKB 4OX9E 4JI1I 2XEXA 4P7AA 2VQEI 2ZM6E 4DR1I 2PNMA 4X66E 4JI6I 5IT9C 1HNWI 1XNQE 1USUA 4LFBE 4WUCA 3J7AG 3V5RA 4I3HA 4Z7CA 2UUAE 2UU9I 2VQFI 4DPTA 4JV5I 4FWGA 4JYAI 4DR5E 2CZ9A 3OTOE 4IZJD 4DV2I 2F4VE 2GS8A 1N0VC 4DR6I 4UT4A 1H73A 4JI6E 3D4JA 4LFAE 4GKJI 3Q6NA 3PYDA 4DV0I 1ZM2A 3JAMQ 4Z7YA 4LF8I 1B63A 1ZXNA 4DV4I 1XMOI 1NHJA 1K47A 1J5EE 4DV6E 1Z0EA 1NZ0A 2Z5CB 4JYAE 4DV3E 4PRXA 3ZZUA 1XNRE 4DV2E 4JI0I 2HK3A 3F0NA 1N34I 4DR2I 2Z5BB 4X65E 4GKJE 4N3OA 3ZKBA 1ZM3A 1S4EA 1XMQI 3PYFA 4DV1E 4IZJA 4DV4E 4LF5I 4NXNI 1XMOE 5A2QQ 2A2CA 3HJCA 2HK2A 1USVA 2AJ4A 4KHPE 2O1VA 4JI2I 3J80C 4DR7I 4DR2E 1N33I 4DUYE 2UXBE 3T1HI 2Z5EA 4YY3E 3Q1QA 5LMUE 2UXCE 3Q6MA 4FWHA 2ZM6I 1Y4UA 1XMQE 1H7UA 4X66I 1MU5A 4NXNE 3ZZTA 3J7AM 4ZVIA 3JAMC 1FNMA 2R42A 1IBME 1XNQI 4JI4E 4DUZE 4JI2E 3ZKDA 4LFBI 1H7SA 3WU5A 1Z0GA 3T1HE 4DV7E 4B3MI 4MYTA 1ZM4A 4YHHE 4DV5E 1H74A 4DR5I 1Z0TA 4DU8A 3OTOI 2F4VI 2A2DA 4USKA 1S16A 2Z5CA 3QT6A 2UXDE 1QZRA 4R1FA 2UUCE 4LFAI 1IBKI 2R3VA 3J81Q 2E5LE 2Z5BA 4LF9E 1N36E 5GMDA 3PRYA 4XTJA 5A2QC 2O1WA 2DEIA 4P52A 3GONA 4LF6I 4X62E 1J5EI 2V8PA 4DV6I 4B3ME 1OJ4A 4DV3I 1XNRI 4DXLA 3CWVA 2CG9A 1N32E 4B3RE 3LNUA 4X65I 1IBKE 3LTOA 1HNZI 3QT5A 4HACB 1PIEA 4DV1I 4DPUA 4LF6E 1N0UA 4PRVA 3B8HA 4DPXA 1NHIA 4KHPI 2BV3A 1FKAE 4UTGA 4DUYI 2UXBI 4ED4A 4YY3I 5LMUI 2UXCI 1FWLA 3P06A 3B82A 1I94E 1H72C 4B3TI 1HNZE 1XHKA 4WUDA 4DR4E 1BKNA 4MYUA 2WW4A 2OI2A 1HR0E 1KKHA 1HNXE 1IBMI 2HKJA 5LL6R 4JI4I 4DUZI 1EA6A 1VISA 1Z0BA 1D6TA 4DV7I 1B62A 4YHHI 4DV5I 2O1UA 4B3TE 1Z5AA 4JI3I 2X7IA 1KIJA 3WU6A 3LPSA 2UXDI 4JI5I 2UUCI 2E5LI 1Z5BA 1FJGI 4LF9I 1N36I 1RR9A 1FWKA 4PU9A 4X62I 4LF7E 2IOPA 2PNLA 3ZM7A 2V34A 1A6FA 4URLA 3HULA 4JI3E 4WUBA 1IBLE 4LF4I 1N32I 4B3RI 4JI5E 4FWDA 5L3JA 2O1TA 1Y6ZA 2BM0A 1FJGE 4LFCE 4AQYI 5BR8E 1DARA 3K17A 3M6AA 1ELOA 1KTVA 2NPFA 4IZJB 3QT7A 2VF3A 1ZXMA 4JI7E 2X36A 3K85A 3K1JA 4KQVA 1NHHA 4LF4E 4JI8E 2BM1A 3PYEA 5FLXQ 1WUUA 2HKEA 2CGEA 2V2QA 4DU7A 4B3SE 3T1YE 1Z0VA 1I94I 1ZM9A 5FWKA 2ZITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 Q;  4AQY E;  2Q2E B;  4DR4 I;  4JI1 E;  4FN5 A;  2VQE E;  1HR0 I;  5IWA I;  1Z0C A;  4DR1 E;  1Z5C A;  4DR3 I;  1HNX I;  4NXM I;  3B78 A;  2DEJ A;  2V2Z A;  5LMN I;  3PYG A;  1PKP A;  1HNW E;  2UUB I;  3QT8 A;  3V2U C;  3H4L A;  1Z0W A;  1UEK A;  4HXZ A;  1EI1 A;  4K0K I;  2HHH I;  2UU9 E;  2VQF E;  4M1K A;  4USM A;  4JV5 E;  3J81 C;  4DPY A;  5IWA E;  4DR3 E;  4NXM E;  4DR6 E;  5LMN E;  2V2V A;  1MG7 A;  4DV0 E;  1KVK A;  2UUB E;  4LF7 I;  2HFS A;  4GKK I;  5IT9 Q;  4LF8 E;  3WU3 A;  5GME A;  4DPW A;  4K0K E;  2HHH E;  5FLX C;  1IBL I;  4JG4 A;  3ZZ0 A;  4JI0 E;  1PVG A;  1N34 E;  1U2R A;  4LFC I;  4X64 I;  4HYM A;  5BR8 I;  4OX9 I;  2J7K A;  4HAC A;  4RPF A;  4GKK E;  1RRE A;  1FI4 A;  4JI7 I;  4HY1 A;  4FW9 A;  4LF5 E;  2EFG A;  1Z59 A;  2HFU A;  2LJP A;  4JI8 I;  3WU4 A;  4B3S I;  1MX0 A;  4EMD A;  3T1Y I;  4DR7 E;  2UUA I;  1N33 E;  2E1R A;  4X64 E;  2ZBK B;  4OX9 E;  4JI1 I;  2XEX A;  4P7A A;  2VQE I;  2ZM6 E;  4DR1 I;  4X66 E;  4JI6 I;  5IT9 C;  1HNW I;  1XNQ E;  4LFB E;  4WUC A;  3J7A G;  3V5R A;  4I3H A;  4Z7C A;  2UUA E;  2UU9 I;  2VQF I;  4DPT A;  4JV5 I;  4FWG A;  4JYA I;  4DR5 E;  2CZ9 A;  3OTO E;  4DV2 I;  2F4V E;  2GS8 A;  1N0V C;  4DR6 I;  4UT4 A;  1H73 A;  4JI6 E;  3D4J A;  4LFA E;  4GKJ I;  3PYD A;  4DV0 I;  1ZM2 A;  3JAM Q;  4Z7Y A;  4LF8 I;  1B63 A;  1ZXN A;  4DV4 I;  1XMO I;  1NHJ A;  1K47 A;  1J5E E;  4DV6 E;  1Z0E A;  1NZ0 A;  4JYA E;  4DV3 E;  4PRX A;  3ZZU A;  1XNR E;  4DV2 E;  4JI0 I;  2HK3 A;  3F0N A;  1N34 I;  4DR2 I;  4X65 E;  4GKJ E;  3ZKB A;  1ZM3 A;  1S4E A;  1XMQ I;  3PYF A;  4DV1 E;  4DV4 E;  4LF5 I;  4NXN I;  1XMO E;  5A2Q Q;  2A2C A;  2HK2 A;  2AJ4 A;  4KHP E;  4JI2 I;  3J80 C;  4DR7 I;  4DR2 E;  1N33 I;  4DUY E;  2UXB E;  3T1H I;  4YY3 E;  3Q1Q A;  5LMU E;  2UXC E;  4FWH A;  2ZM6 I;  1XMQ E;  1H7U A;  4X66 I;  1MU5 A;  4NXN E;  3ZZT A;  3J7A M;  4ZVI A;  3JAM C;  1FNM A;  2R42 A;  1IBM E;  1XNQ I;  4JI4 E;  4DUZ E;  4JI2 E;  3ZKD A;  4LFB I;  1H7S A;  3WU5 A;  1Z0G A;  3T1H E;  4DV7 E;  4B3M I;  4MYT A;  1ZM4 A;  4YHH E;  4DV5 E;  1H74 A;  4DR5 I;  1Z0T A;  4DU8 A;  3OTO I;  2F4V I;  2A2D A;  4USK A;  1S16 A;  3QT6 A;  2UXD E;  1QZR A;  4R1F A;  2UUC E;  4LFA I;  1IBK I;  2R3V A;  3J81 Q;  2E5L E;  4LF9 E;  1N36 E;  5GMD A;  4XTJ A;  5A2Q C;  2DEI A;  4P52 A;  3GON A;  4LF6 I;  4X62 E;  1J5E I;  2V8P A;  4DV6 I;  4B3M E;  1OJ4 A;  4DV3 I;  1XNR I;  4DXL A;  3CWV A;  1N32 E;  4B3R E;  3LNU A;  4X65 I;  1IBK E;  3LTO A;  1HNZ I;  3QT5 A;  4HAC B;  1PIE A;  4DV1 I;  4DPU A;  4LF6 E;  1N0U A;  4PRV A;  3B8H A;  4DPX A;  1NHI A;  4KHP I;  2BV3 A;  1FKA E;  4UTG A;  4DUY I;  2UXB I;  4ED4 A;  4YY3 I;  5LMU I;  2UXC I;  1FWL A;  3B82 A;  1I94 E;  1H72 C;  4B3T I;  1HNZ E;  1XHK A;  4WUD A;  4DR4 E;  1BKN A;  4MYU A;  2WW4 A;  2OI2 A;  1HR0 E;  1KKH A;  1HNX E;  1IBM I;  2HKJ A;  5LL6 R;  4JI4 I;  4DUZ I;  1EA6 A;  1VIS A;  1Z0B A;  1D6T A;  4DV7 I;  1B62 A;  4YHH I;  4DV5 I;  4B3T E;  1Z5A A;  4JI3 I;  2X7I A;  1KIJ A;  3WU6 A;  3LPS A;  2UXD I;  4JI5 I;  2UUC I;  2E5L I;  1Z5B A;  1FJG I;  4LF9 I;  1N36 I;  1RR9 A;  1FWK A;  4PU9 A;  4X62 I;  4LF7 E;  3ZM7 A;  2V34 A;  1A6F A;  4URL A;  3HUL A;  4JI3 E;  4WUB A;  1IBL E;  4LF4 I;  1N32 I;  4B3R I;  4JI5 E;  4FWD A;  5L3J A;  2BM0 A;  1FJG E;  4LFC E;  4AQY I;  5BR8 E;  1DAR A;  3K17 A;  3M6A A;  1ELO A;  1KTV A;  2NPF A;  3QT7 A;  2VF3 A;  1ZXM A;  4JI7 E;  2X36 A;  3K1J A;  4KQV A;  1NHH A;  4LF4 E;  4JI8 E;  2BM1 A;  3PYE A;  5FLX Q;  1WUU A;  2HKE A;  2V2Q A;  4DU7 A;  4B3S E;  3T1Y E;  1Z0V A;  1I94 I;  1ZM9 A;  2ZIT A; 
#chains in the Genus database with same CATH topology
 3J80 Q;  4AQY E;  2Q2E B;  4DR4 I;  1OYP A;  4JI1 E;  4FN5 A;  1HK7 A;  2VQE E;  1HR0 I;  5IWA I;  1Z0C A;  4DR1 E;  1Z5C A;  4DR3 I;  1HNX I;  4NXM I;  3B78 A;  2CVE A;  4NBQ A;  2C37 B;  2DEJ A;  2V2Z A;  5LMN I;  5K36 A;  4MU4 A;  3M85 D;  5C0X B;  5K36 E;  3PYG A;  1PKP A;  1HNW E;  2UUB I;  3QT8 A;  3V2U C;  3H4L A;  3P3C A;  1Z0W A;  4BA2 B;  1UEK A;  4HXZ A;  1EI1 A;  4IZK B;  4K0K I;  2HHH I;  3GCM A;  2UU9 E;  2VQF E;  4M1K A;  4USM A;  4JV5 E;  2NN6 D;  3J81 C;  2O3Z A;  4DPY A;  5IWA E;  4DR3 E;  4NXM E;  4DR6 E;  5LMN E;  2V2V A;  1MG7 A;  1UDN A;  4DV0 E;  1KVK A;  2UUB E;  4LF7 I;  3P3G A;  2HFS A;  4GKK I;  5C0X F;  5IT9 Q;  4LF8 E;  3WU3 A;  2F1D A;  5GME A;  4DPW A;  4K0K E;  2HHH E;  5FLX C;  3M85 G;  1IBL I;  4MDT A;  4JG4 A;  2WP8 A;  1R6L A;  3ZZ0 A;  4JI0 E;  4LCF A;  2IOQ A;  2AE8 A;  1PVG A;  1N34 E;  2PO0 A;  4OO1 C;  3U1K A;  1U2R A;  4LFC I;  4X64 I;  3PS3 A;  3UHM A;  4HYM A;  4ISA A;  5BR8 I;  3L7Z B;  4OX9 I;  2J7K A;  4IS9 A;  2PO1 B;  4HAC A;  4RPF A;  4GKK E;  1RRE A;  5JEA B;  1FI4 A;  4JI7 I;  4HY1 A;  2PO2 B;  1Y4S A;  4FW9 A;  4LF5 E;  2EFG A;  2GQ0 A;  1Z59 A;  2HFU A;  1YH8 A;  2C37 A;  2LJP A;  4JI8 I;  5K36 D;  5C0X A;  3WU4 A;  4B3S I;  1MX0 A;  4EMD A;  3T1Y I;  4LPF A;  4DR7 E;  4J3D A;  2UUA I;  5C0X E;  1N33 E;  4BA2 A;  2E1R A;  4X64 E;  4IZK A;  2ZBK B;  4MU1 A;  4OX9 E;  4JI1 I;  2XEX A;  4P7A A;  2VQE I;  2ZM6 E;  4DR1 I;  2PNM A;  3PS2 A;  4X66 E;  3P76 A;  5C0X C;  4JI6 I;  4FW7 A;  5IT9 C;  1HNW I;  1XNQ E;  5DNL A;  2BR2 B;  1USU A;  4FW4 A;  4IFD B;  2BA1 D;  4LFB E;  4WUC A;  3J7A G;  3V5R A;  4I3H A;  4OO1 D;  4OZE A;  4Z7C A;  2UUA E;  2UU9 I;  2VQF I;  4DPT A;  4JV5 I;  4FWG A;  4JYA I;  1OYS A;  4DR5 E;  2CZ9 A;  3OTO E;  4OO1 F;  4IZJ D;  4DV2 I;  2F4V E;  2GS8 A;  1N0V C;  1UDQ A;  4DR6 I;  4UT4 A;  2IES A;  1H73 A;  4JI6 E;  3D4J A;  4LFA E;  4GKJ I;  5ELW A;  3Q6N A;  3PYD A;  4DV0 I;  3L7Z A;  1ZM2 A;  3JAM Q;  4Z7Y A;  4LF8 I;  1B63 A;  1E3P A;  1ZXN A;  2JEB B;  4DV4 I;  2PO1 A;  1XMO I;  1NHJ A;  1K47 A;  5JEA A;  1J5E E;  4DV6 E;  1Z0E A;  1NZ0 A;  2Z5C B;  2PO2 A;  4JYA E;  4DV3 E;  4PRX A;  2GO3 A;  3GME A;  3ZZU A;  4DV2 E;  4JI0 I;  1XNR E;  2HK3 A;  3F0N A;  2BA1 G;  4LCH A;  1N34 I;  4DR2 I;  2C38 B;  2Z5B B;  5C0X D;  4X65 E;  4GKJ E;  2JE6 B;  4N3O A;  4OO1 A;  3ZKB A;  1UDO A;  1ZM3 A;  5JEA C;  1S4E A;  2C39 A;  1XMQ I;  3PYF A;  4OO1 E;  5EKW A;  4DV1 E;  4IZJ A;  4DV4 E;  4LF5 I;  4NXN I;  1XMO E;  5A2Q Q;  2A2C A;  3HJC A;  2HK2 A;  1USV A;  2AJ4 A;  4KHP E;  4GQU A;  2O1V A;  4JI2 I;  3PS1 A;  3J80 C;  2BR2 A;  4DR7 I;  4BA1 A;  4DR2 E;  1N33 I;  4DUY E;  2UXB E;  3T1H I;  2Z5E A;  1Y60 A;  4YY3 E;  3Q1Q A;  5LMU E;  2UXC E;  3Q6M A;  4FWH A;  2ZM6 I;  1Y4U A;  1XMQ E;  1H7U A;  4X66 I;  1MU5 A;  4NXN E;  3ZZT A;  3J7A M;  4ZVI A;  3JAM C;  1FNM A;  2R42 A;  3H1C A;  1IBM E;  3CDJ A;  1XNQ I;  4IFD C;  5DNX A;  4JI4 E;  4DUZ E;  4JI2 E;  3ZKD A;  4LFB I;  2JT2 A;  1H7S A;  3WU5 A;  1Z0G A;  2J65 A;  3T1H E;  4DV7 E;  4B3M I;  4MYT A;  1ZM4 A;  4YHH E;  3U1Y A;  4DV5 E;  1H74 A;  4DR5 I;  1Z0T A;  1P42 A;  4DU8 A;  3OTO I;  2F4V I;  2A2D A;  4USK A;  5JEA D;  1S16 A;  2Z5C A;  1Y5Y A;  3QT6 A;  4QNK A;  2UXD E;  4U3D A;  1QZR A;  4R1F A;  2UUC E;  4LFA I;  2GO4 A;  1IBK I;  2R3V A;  1RHY A;  3NZK A;  5JEA F;  3J81 Q;  4QNJ A;  2E5L E;  2C38 A;  2Z5B A;  4LF9 E;  1N36 E;  5GMD A;  3PRY A;  4XTJ A;  5A2Q C;  2JE6 A;  4MQY A;  2O1W A;  2DEI A;  4P52 A;  2WNR B;  3GON A;  4LF6 I;  4X62 E;  1J5E I;  2V8P A;  4DV6 I;  4B3M E;  1OJ4 A;  4DV3 I;  1XNR I;  4DXL A;  3CWV A;  2CG9 A;  1N32 E;  2BA0 G;  2PO0 B;  4B3R E;  3LNU A;  5DRQ A;  3KRN A;  4X65 I;  1IBK E;  3LTO A;  1HNZ I;  4IFD D;  3HKM A;  3QT5 A;  4HAC B;  2NN6 B;  1PIE A;  4DV1 I;  2JEA B;  4DPU A;  4LF6 E;  1N0U A;  4PRV A;  2IER A;  4IFD F;  4AID A;  1VI7 A;  3B8H A;  4DPX A;  3M7N D;  1NHI A;  5JEA E;  4KHP I;  1YHC A;  1E3H A;  2BV3 A;  1FKA E;  4UTG A;  4DUY I;  2UXB I;  4ED4 A;  4YY3 I;  5LMU I;  2UXC I;  1FWL A;  3P06 A;  3B82 A;  1I94 E;  1H72 C;  4B3T I;  1HNZ E;  1XHK A;  2PNZ B;  4MU3 A;  5DRO A;  4WUD A;  4DR4 E;  1BKN A;  5K36 C;  4MYU A;  2WW4 A;  2OI2 A;  1HR0 E;  1KKH A;  1HNX E;  2NN6 F;  1IBM I;  2HKJ A;  4AIM A;  1OYR A;  5DRR A;  5LL6 R;  4DUZ I;  4JI4 I;  3P3E A;  1EA6 A;  1VIS A;  4IFD A;  1Z0B A;  1D6T A;  4DV7 I;  1B62 A;  4YHH I;  4DV5 I;  2WNR A;  4LCG A;  3M7N G;  4FW5 A;  4IFD E;  1R6M A;  2O1U A;  3GLL A;  1UDS A;  4B3T E;  1Z5A A;  1XXE A;  4JI3 I;  2X7I A;  1KIJ A;  3WU6 A;  3LPS A;  2UXD I;  5K36 B;  4JI5 I;  2UUC I;  3B4T A;  2E5L I;  1Z5B A;  1FJG I;  4LF9 I;  1N36 I;  1RR9 A;  1FWK A;  4PU9 A;  2BA0 D;  4X62 I;  4LF7 E;  2IOP A;  2PNL A;  3ZM7 A;  2NN6 A;  2V34 A;  1A6F A;  2JEB A;  4URL A;  2JEA A;  4AM3 A;  3HUL A;  4JI3 E;  2NN6 E;  3DD6 A;  4WUB A;  1IBL E;  4LF4 I;  1N32 I;  4B3R I;  4JI5 E;  4FWD A;  5L3J A;  2O1T A;  1Y6Z A;  2BM0 A;  1FJG E;  4OO1 B;  5K36 F;  5DRP A;  4LFC E;  2NN6 C;  4AQY I;  5BR8 E;  1DAR A;  2C39 B;  3K17 A;  3M6A A;  1ELO A;  1KTV A;  2NPF A;  4FW3 A;  2PNZ A;  4IZJ B;  3QT7 A;  2VF3 A;  3CDI A;  1ZXM A;  4OKG A;  4JI7 E;  2X36 A;  2WP8 B;  3K85 A;  3K1J A;  4KQV A;  4U3B A;  1NHH A;  4LF4 E;  4FW6 A;  4JI8 E;  2BM1 A;  3PYE A;  5FLX Q;  1WUU A;  4BA1 B;  2HKE A;  2CGE A;  2V2Q A;  4DU7 A;  4LOM A;  4B3S E;  4MU0 A;  5EL9 A;  3T1Y E;  1Z0V A;  1I94 I;  1ZM9 A;  5FWK A;  2VES A;  2ZIT A; 
#chains in the Genus database with same CATH homology
 3J80 Q;  4AQY E;  2Q2E B;  4DR4 I;  4JI1 E;  4FN5 A;  1HK7 A;  2VQE E;  1HR0 I;  5IWA I;  1Z0C A;  4DR1 E;  1Z5C A;  4DR3 I;  1HNX I;  4NXM I;  3B78 A;  2DEJ A;  2V2Z A;  5LMN I;  3PYG A;  1PKP A;  1HNW E;  2UUB I;  3QT8 A;  3V2U C;  3H4L A;  1Z0W A;  1UEK A;  4HXZ A;  1EI1 A;  4IZK B;  4K0K I;  2HHH I;  2UU9 E;  2VQF E;  4M1K A;  4USM A;  4JV5 E;  3J81 C;  4DPY A;  5IWA E;  4DR3 E;  4NXM E;  4DR6 E;  5LMN E;  2V2V A;  1MG7 A;  4DV0 E;  1KVK A;  2UUB E;  4LF7 I;  2HFS A;  4GKK I;  5IT9 Q;  4LF8 E;  3WU3 A;  5GME A;  4DPW A;  4K0K E;  2HHH E;  5FLX C;  1IBL I;  4JG4 A;  3ZZ0 A;  4JI0 E;  2IOQ A;  1PVG A;  1N34 E;  1U2R A;  4LFC I;  4X64 I;  4HYM A;  5BR8 I;  4OX9 I;  2J7K A;  4HAC A;  4RPF A;  4GKK E;  1RRE A;  1FI4 A;  4JI7 I;  4HY1 A;  4FW9 A;  1Y4S A;  4LF5 E;  2EFG A;  2GQ0 A;  1Z59 A;  2HFU A;  2LJP A;  4JI8 I;  3WU4 A;  4B3S I;  1MX0 A;  4EMD A;  3T1Y I;  4DR7 E;  2UUA I;  1N33 E;  2E1R A;  4X64 E;  4IZK A;  2ZBK B;  4OX9 E;  4JI1 I;  2XEX A;  4P7A A;  2VQE I;  2ZM6 E;  4DR1 I;  2PNM A;  4X66 E;  4JI6 I;  5IT9 C;  1HNW I;  1XNQ E;  1USU A;  4LFB E;  4WUC A;  3J7A G;  3V5R A;  4I3H A;  4Z7C A;  2UUA E;  2UU9 I;  2VQF I;  4DPT A;  4JV5 I;  4FWG A;  4JYA I;  4DR5 E;  2CZ9 A;  3OTO E;  4IZJ D;  4DV2 I;  2F4V E;  2GS8 A;  1N0V C;  4DR6 I;  4UT4 A;  1H73 A;  4JI6 E;  3D4J A;  4LFA E;  4GKJ I;  3Q6N A;  3PYD A;  4DV0 I;  1ZM2 A;  3JAM Q;  4Z7Y A;  4LF8 I;  1B63 A;  1ZXN A;  4DV4 I;  1XMO I;  1NHJ A;  1K47 A;  1J5E E;  4DV6 E;  1Z0E A;  1NZ0 A;  2Z5C B;  4JYA E;  4DV3 E;  4PRX A;  3ZZU A;  1XNR E;  4DV2 E;  4JI0 I;  2HK3 A;  3F0N A;  1N34 I;  4DR2 I;  2Z5B B;  4X65 E;  4GKJ E;  4N3O A;  3ZKB A;  1ZM3 A;  1S4E A;  1XMQ I;  3PYF A;  4DV1 E;  4IZJ A;  4DV4 E;  4LF5 I;  4NXN I;  1XMO E;  5A2Q Q;  2A2C A;  3HJC A;  2HK2 A;  1USV A;  2AJ4 A;  4KHP E;  2O1V A;  4JI2 I;  3J80 C;  4DR7 I;  4DR2 E;  1N33 I;  4DUY E;  2UXB E;  3T1H I;  2Z5E A;  4YY3 E;  3Q1Q A;  5LMU E;  2UXC E;  3Q6M A;  4FWH A;  2ZM6 I;  1Y4U A;  1XMQ E;  1H7U A;  4X66 I;  1MU5 A;  4NXN E;  3ZZT A;  3J7A M;  4ZVI A;  3JAM C;  1FNM A;  2R42 A;  1IBM E;  1XNQ I;  4JI4 E;  4DUZ E;  4JI2 E;  3ZKD A;  4LFB I;  1H7S A;  3WU5 A;  1Z0G A;  3T1H E;  4DV7 E;  4B3M I;  4MYT A;  1ZM4 A;  4YHH E;  4DV5 E;  1H74 A;  4DR5 I;  1Z0T A;  4DU8 A;  3OTO I;  2F4V I;  2A2D A;  4USK A;  1S16 A;  2Z5C A;  3QT6 A;  2UXD E;  1QZR A;  4R1F A;  2UUC E;  4LFA I;  1IBK I;  2R3V A;  3J81 Q;  2E5L E;  2Z5B A;  4LF9 E;  1N36 E;  5GMD A;  3PRY A;  4XTJ A;  5A2Q C;  2O1W A;  2DEI A;  4P52 A;  3GON A;  4LF6 I;  4X62 E;  1J5E I;  2V8P A;  4DV6 I;  4B3M E;  1OJ4 A;  4DV3 I;  1XNR I;  4DXL A;  3CWV A;  2CG9 A;  1N32 E;  4B3R E;  3LNU A;  4X65 I;  1IBK E;  3LTO A;  1HNZ I;  3QT5 A;  4HAC B;  1PIE A;  4DV1 I;  4DPU A;  4LF6 E;  1N0U A;  4PRV A;  3B8H A;  4DPX A;  1NHI A;  4KHP I;  2BV3 A;  1FKA E;  4UTG A;  4DUY I;  2UXB I;  4ED4 A;  4YY3 I;  5LMU I;  2UXC I;  1FWL A;  3P06 A;  3B82 A;  1I94 E;  1H72 C;  4B3T I;  1HNZ E;  1XHK A;  4WUD A;  4DR4 E;  1BKN A;  4MYU A;  2WW4 A;  2OI2 A;  1HR0 E;  1KKH A;  1HNX E;  1IBM I;  2HKJ A;  5LL6 R;  4JI4 I;  4DUZ I;  1EA6 A;  1VIS A;  1Z0B A;  1D6T A;  4DV7 I;  1B62 A;  4YHH I;  4DV5 I;  2O1U A;  4B3T E;  1Z5A A;  4JI3 I;  2X7I A;  1KIJ A;  3WU6 A;  3LPS A;  2UXD I;  4JI5 I;  2UUC I;  2E5L I;  1Z5B A;  1FJG I;  4LF9 I;  1N36 I;  1RR9 A;  1FWK A;  4PU9 A;  4X62 I;  4LF7 E;  2IOP A;  2PNL A;  3ZM7 A;  2V34 A;  1A6F A;  4URL A;  3HUL A;  4JI3 E;  4WUB A;  1IBL E;  4LF4 I;  1N32 I;  4B3R I;  4JI5 E;  4FWD A;  5L3J A;  2O1T A;  1Y6Z A;  2BM0 A;  1FJG E;  4LFC E;  4AQY I;  5BR8 E;  1DAR A;  3K17 A;  3M6A A;  1ELO A;  1KTV A;  2NPF A;  4IZJ B;  3QT7 A;  2VF3 A;  1ZXM A;  4JI7 E;  2X36 A;  3K85 A;  3K1J A;  4KQV A;  1NHH A;  4LF4 E;  4JI8 E;  2BM1 A;  3PYE A;  5FLX Q;  1WUU A;  2HKE A;  2CGE A;  2V2Q A;  4DU7 A;  4B3S E;  3T1Y E;  1Z0V A;  1I94 I;  1ZM9 A;  5FWK A;  2ZIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...