1RR9A

Catalytic domain of e.coli lon protease
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent protease La
publication title The catalytic domain of Escherichia coli Lon protease has a unique fold and a Ser-Lys dyad in the active site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 58
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2003-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1rr9A01
3WU4A 5LMNE 2R42A 1RR9A 2F4VI 1OJ4A 1KVKA 1N32I 3J81C 3Q1QA 4DR6I 4USKA 4NXMI 2E5LE 2WW4A 3B78A 4DV0E 2A2CA 5IT9Q 1XNQE 2HKEA 4DV4I 3WU5A 4JI8I 4JI4E 4DR5I 2GS8A 3ZKBA 4JI5I 4DR4E 1N34E 4DR7E 2HFSA 4MYUA 4K0KI 4GKKI 2VQEE 5LMUE 2UXCI 3J7AG 5FLXC 2UXDE 4DU8A 4HACA 1NHJA 1XMQE 4JI1E 4FN5A 2VQFE 1HNXE 1NZ0A 1Z5CA 1EA6A 2E5LI 1K47A 4DPTA 4DV0I 3T1YI 3J7AM 1XNQI 2E1RA 1XMOE 2AJ4A 2HFUA 5A2QC 3V5RA 4DUYI 4JI4I 1HNZE 4URLA 4DR4I 1N34I 4DR2E 4DR7I 4JI3E 1N36E 1QZRA 4X65E 4LF8E 1N33E 5LMUI 4HY1A 2UXBE 5BR8E 4JI1I 1XMQI 2HK3A 2VQFI 4DPWA 1HNXI 3GONA 4B3RE 2HHHI 1N0VC 1J5EE 4LFAE 4DV6I 1S4EA 1HNWI 2A2DA 2ZM6I 4DV5I 3LTOA 1Z0WA 2CZ9A 1ZM3A 4B3TE 4JI2E 4DR2I 1HR0E 4FWGA 4JI3I 3F0NA 1N36I 4AQYE 4R1FA 1ZXMA 1N33I 4JI6E 1ZM9A 3QT8A 4YY3E 1UEKA 4P7AA 2UXBI 5BR8I 4JI0E 2ZBKB 4X62E 1KIJA 4JG4A 4WUBA 4FW9A 1BKNA 4DV1I 1J5EI 4LFAI 3QT7A 2V8PA 2UUAI 1IBLE 4B3TI 4LFCI 3JAMC 1KTVA 1XHKA 4DR3E 1Z5AA 3PYDA 4AQYI 4LF6E 4UT4A 4LFBE 3T1HE 4JI6I 4YY3I 1FJGE 4B3SE 3B82A 4DV3E 5LMNI 4NXNE 4P52A 4JI0I 1D6TA 1Z0EA 5IWAE 1MU5A 3J80Q 4LF5E 4KQVA 4ED4A 3ZZUA 2V2VA 1MX0A 3K1JA 4DV2E 4YHHE 4DUZE 1EI1A 4MYTA 2X36A 3J81Q 4WUDA 1A6FA 4DPUA 3OTOE 4LF7E 3T1HI 3PYEA 4LF4E 2VQEI 1H74A 2EFGA 4DXLA 4B3SI 2XEXA 4DV3I 4M1KA 4NXNI 2UXDI 2V34A 2V2ZA 5IWAI 1MG7A 3H4LA 3M6AA 4ZVIA 1IBKE 5IT9C 1XMOI 1Z0CA 4DV2I 1Z0TA 5FLXQ 4YHHI 1NHHA 2F4VE 2UUBE 1Z5BA 1B62A 1DARA 2HKJA 1HNZI 5LL6R 5GMEA 3QT5A 4FWHA 3OTOI 4LF7I 1N0UA 1PVGA 1ELOA 4X65I 4LF8I 4LF4I 2Q2EB 4GKJE 4X66E 1U2RA 5A2QQ 4I3HA 1FNMA 4DV4E 2X7IA 2LJPA 4JI8E 2R3VA 4UTGA 5GMDA 1S16A 2J7KA 4PRVA 4B3RI 2OI2A 3WU6A 4KHPE 2VF3A 4OX9E 1IBKI 2BM0A 2UU9E 2UXCE 5L3JA 3ZKDA 4WUCA 2UUBI 3D4JA 1PIEA 4EMDA 4JI2I 1HR0I 3CWVA 4DV7E 3ZZTA 4JYAE 1IBME 4USMA 4LF9E 1NHIA 3T1YE 1FI4A 4GKJI 4X66I 4X62I 3PYFA 4DUYE 1XNRE 1Z59A 4X64E 1WUUA 2HK2A 4RPFA 4FWDA 3ZZ0A 1FWLA 4KHPI 1H72C 4OX9I 2UU9I 4HACB 3V2UC 1B63A 1I94E 1H7UA 2BM1A 1IBLI 3ZM7A 3QT6A 4HXZA 3WU3A 4DR3I 4DV7I 4JI7E 4JYAI 1IBMI 4LF6I 4LF9I 4JV5E 2HHHE 4LFBI 1FKAE 3PYGA 2UUCE 1RREA 4DV6E 1FJGI 1ZXNA 4B3ME 1KKHA 1HNWE 2ZM6E 1XNRI 4DV5E 4Z7CA 4X64I 3JAMQ 4LF5I 4DU7A 3HULA 2NPFA 4DR1E 4PRXA 1FWKA 1I94I 1VISA 4PU9A 4DUZI 3LPSA 1H7SA 1Z0GA 4JI7I 1N32E 1PKPA 4JV5I 4DR6E 4DV1E 1Z0VA 4NXME 2UUCI 2V2QA 4HYMA 2DEIA 1H73A 4B3MI 4DPXA 4Z7YA 2ZITA 2UUAE 1ZM4A 4XTJA 3B8HA 4LFCE 4DR5E 4JI5E 1ZM2A 2DEJA 3J80C 3K17A 1Z0BA 4DR1I 4DPYA 4K0KE 4GKKE 2BV3A 3LNUA
chains in the Genus database with same CATH superfamily
3WU4A 1R6MA 5LMNE 2R42A 1RR9A 2F4VI 4IZJA 1OJ4A 1KVKA 2PO2A 5K36B 1N32I 3J81C 3Q1QA 4FW7A 4DR6I 5K36E 4USKA 4NXMI 1UDSA 2E5LE 2WW4A 2IERA 3B78A 4DV0E 2A2CA 5IT9Q 1XNQE 4ISAA 2HKEA 5JEAB 4DV4I 5K36F 3PRYA 3WU5A 5DROA 4JI8I 4JI4E 4BA1A 2GO4A 2CG9A 5JEAE 4DR5I 2GS8A 3ZKBA 4JI5I 4DR4E 1N34E 3M85G 4DR7E 2CVEA 2HFSA 4MYUA 4K0KI 4GKKI 2VQEE 5LMUE 2UXCI 3U1KA 4IFDC 3J7AG 4MU0A 5FLXC 5C0XC 2UXDE 4DU8A 4HACA 1NHJA 1XMQE 4JI1E 4FN5A 1Y6ZA 2VQFE 4FW4A 1HNXE 1OYRA 1NZ0A 4IS9A 1Z5CA 2WP8B 1EA6A 3KRNA 4MDTA 2E5LI 1K47A 4DPTA 4DV0I 3T1YI 3J7AM 4MU3A 1XNQI 2E1RA 1XMOE 2AJ4A 2HFUA 3GMEA 5A2QC 3V5RA 2IOPA 4DUYI 4JI4I 2C37B 4OO1B 1HNZE 4URLA 4FW3A 3CDJA 4DR4I 3NZKA 4DR2E 1N34I 2Z5CB 4DR7I 4JI3E 4OO1E 2PNMA 1N36E 3K85A 2C39A 4J3DA 1QZRA 4X65E 4LF8E 1N33E 5LMUI 4HY1A 3PS3A 4OO1F 2UXBE 4MU1A 5BR8E 3P3EA 4QNKA 4JI1I 1XMQI 5JEAC 4LPFA 2IOQA 2HK3A 1USUA 2VQFI 4DPWA 1HNXI 3L7ZB 2BA1G 3GONA 4IFDD 4B3RE 5C0XD 2HHHI 1N0VC 3M7ND 3U1YA 2PNZB 1USVA 1J5EE 4LFAE 1UDQA 2O1VA 4DV6I 1S4EA 2Z5EA 1HNWI 2A2DA 2ZM6I 4DV5I 3LTOA 1Z0WA 3GLLA 2CZ9A 2C38B 1ZM3A 4B3TE 4JI2E 4NBQA 3B4TA 4DR2I 4FWGA 1HR0E 4JI3I 3F0NA 1N36I 4IZJD 4AQYE 4R1FA 1ZXMA 2PO0B 1N33I 4JI6E 1ZM9A 3QT8A 4YY3E 1UEKA 4P7AA 3PS1A 2UXBI 5BR8I 2PNLA 4JI0E 2ZBKB 4X62E 1KIJA 4JG4A 4WUBA 4FW9A 3Q6NA 4LCGA 1BKNA 5K36A 4DV1I 1J5EI 5JEAD 4LFAI 3QT7A 2V8PA 2NN6B 4GQUA 2BA0D 2UUAI 3P3GA 1IBLE 2NN6E 4LFCI 4B3TI 5JEAA 3JAMC 1KTVA 1XHKA 3P76A 4DR3E 2IESA 1Z5AA 3PYDA 4AQYI 4LF6E 4UT4A 4LFBE 3T1HE 2NN6F 3Q6MA 4JI6I 4YY3I 1FJGE 4B3SE 3B82A 4DV3E 5LMNI 4NXNE 2Z5BB 4P52A 4JI0I 1D6TA 1Z0EA 5IWAE 2AE8A 1MU5A 3J80Q 4LF5E 4KQVA 4MQYA 4ED4A 5FWKA 3ZZUA 4FW6A 2V2VA 1MX0A 3K1JA 2WP8A 4DV2E 3M85D 4YHHE 4DUZE 4LCFA 1HK7A 2PO1B 1EI1A 4MYTA 2X36A 5ELWA 3J81Q 4WUDA 4OKGA 2BR2B 2F1DA 2C37A 4OO1A 5K36C 1E3HA 1A6FA 4DPUA 2O3ZA 3OTOE 4LF7E 3T1HI 2Z5CA 2BR2A 3PYEA 4LF4E 2VQEI 1H74A 2EFGA 4DXLA 4B3SI 2XEXA 2GQ0A 4IZKB 4DV3I 4M1KA 4OZEA 4NXNI 2UXDI 2V34A 1UDNA 2V2ZA 1XXEA 5IWAI 1MG7A 2O1TA 3H4LA 3M6AA 5DRQA 4N3OA 4ZVIA 3L7ZA 2GO3A 1IBKE 5IT9C 1XMOI 1E3PA 1Z0CA 5DRPA 4DV2I 1Z0TA 4AIDA 5FLXQ 3DD6A 2PNZA 4YHHI 1NHHA 5DNXA 2F4VE 2UUBE 1Z5BA 1B62A 1DARA 2HKJA 1HNZI 5LL6R 5GMEA 4AIMA 4BA2B 3QT5A 4FWHA 3OTOI 4LF7I 1N0UA 2C38A 1PVGA 1ELOA 4X65I 4LF8I 1Y4UA 4LF4I 4IFDB 5C0XB 2Q2EB 4GKJE 2PO0A 4X66E 1U2RA 5A2QQ 5K36D 4I3HA 1FNMA 4DV4E 2X7IA 4IFDE 2LJPA 2WNRB 5C0XE 4JI8E 2JEBB 2R3VA 4UTGA 2JEAB 5GMDA 1S16A 4OO1C 1OYSA 2J7KA 2JE6B 4PRVA 4B3RI 4IFDF 2OI2A 5C0XF 4LCHA 3WU6A 4KHPE 2VF3A 2JE6A 4OX9E 1IBKI 4IZJB 2BM0A 2UU9E 2PO2B 2UXCE 5L3JA 4LOMA 3ZKDA 4QNJA 4WUCA 2UUBI 3D4JA 1PIEA 2NN6A 4EMDA 4JI2I 4FW5A 1HR0I 3CWVA 4DV7E 3ZZTA 4JYAE 1IBME 4USMA 4LF9E 1YHCA 5EKWA 3PS2A 1NHIA 3T1YE 1FI4A 1VI7A 4GKJI 4X66I 4BA1B 4MU4A 3HKMA 1P42A 1Y5YA 3PYFA 4X62I 1R6LA 4DUYE 1XNRE 4U3DA 1Z59A 1OYPA 4X64E 1WUUA 2HK2A 2O1UA 2Z5BA 4RPFA 3P3CA 4FWDA 3ZZ0A 1FWLA 4KHPI 1H72C 4OX9I 5DRRA 5JEAF 2UU9I 4HACB 3V2UC 1B63A 5DNLA 4OO1D 1I94E 2VESA 1H7UA 5EL9A 2BM1A 1IBLI 3ZM7A 3QT6A 1Y4SA 4HXZA 3WU3A 4DR3I 4DV7I 4JI7E 4JYAI 1IBMI 4LF6I 2PO1A 4LF9I 4JV5E 2HHHE 4LFBI 1FKAE 3PYGA 2UUCE 1YH8A 1RREA 4DV6E 1FJGI 1ZXNA 4B3ME 3M7NG 2NN6C 1KKHA 1HNWE 2ZM6E 2J65A 1XNRI 4DV5E 4Z7CA 4X64I 4IZKA 2C39B 3JAMQ 3CDIA 4LF5I 4DU7A 3HULA 1UDOA 2NPFA 4DR1E 4PRXA 1FWKA 1I94I 1VISA 3HJCA 4U3BA 4PU9A 4DUZI 3LPSA 1Y60A 1H7SA 1Z0GA 4JI7I 1N32E 1PKPA 4JV5I 4DR6E 3UHMA 4DV1E 3P06A 2CGEA 1Z0VA 4NXME 2UUCI 4BA2A 2V2QA 4HYMA 2DEIA 1H73A 2O1WA 4B3MI 4DPXA 2BA1D 4Z7YA 2JT2A 4AM3A 4IFDA 5C0XA 2ZITA 2UUAE 1ZM4A 3GCMA 4XTJA 3B8HA 4LFCE 1RHYA 4DR5E 4JI5E 2WNRA 1ZM2A 2DEJA 2BA0G 2JEBA 3J80C 2NN6D 2JEAA 3H1CA 3K17A 1Z0BA 4DR1I 4DPYA 4K0KE 4GKKE 2BV3A 3LNUA
chains in the Genus database with same CATH topology
3WU4A 5LMNE 2R42A 1RR9A 2F4VI 4IZJA 1OJ4A 1KVKA 1N32I 3J81C 3Q1QA 4DR6I 4USKA 4NXMI 2E5LE 2WW4A 3B78A 4DV0E 2A2CA 5IT9Q 1XNQE 2HKEA 4DV4I 3PRYA 3WU5A 4JI8I 4JI4E 2CG9A 4DR5I 2GS8A 3ZKBA 4JI5I 4DR4E 1N34E 4DR7E 2HFSA 4MYUA 4K0KI 4GKKI 2VQEE 5LMUE 2UXCI 3J7AG 5FLXC 2UXDE 4DU8A 4HACA 1NHJA 1XMQE 4JI1E 4FN5A 1Y6ZA 2VQFE 1HNXE 1NZ0A 1Z5CA 1EA6A 2E5LI 1K47A 4DPTA 4DV0I 3T1YI 3J7AM 1XNQI 2E1RA 1XMOE 2AJ4A 2HFUA 5A2QC 3V5RA 2IOPA 4DUYI 4JI4I 1HNZE 4URLA 4DR4I 1N34I 4DR2E 2Z5CB 4DR7I 4JI3E 2PNMA 1N36E 3K85A 1QZRA 4X65E 4LF8E 1N33E 5LMUI 4HY1A 2UXBE 5BR8E 4JI1I 1XMQI 2IOQA 2HK3A 1USUA 2VQFI 4DPWA 1HNXI 3GONA 4B3RE 2HHHI 1N0VC 1USVA 1J5EE 4LFAE 2O1VA 4DV6I 1S4EA 2Z5EA 1HNWI 2A2DA 2ZM6I 4DV5I 3LTOA 1Z0WA 2CZ9A 1ZM3A 4B3TE 4JI2E 4DR2I 1HR0E 4FWGA 4JI3I 3F0NA 1N36I 4IZJD 4AQYE 4R1FA 1ZXMA 1N33I 4JI6E 1ZM9A 3QT8A 4YY3E 1UEKA 4P7AA 2UXBI 5BR8I 2PNLA 4JI0E 2ZBKB 4X62E 1KIJA 4JG4A 4WUBA 4FW9A 3Q6NA 1BKNA 4DV1I 1J5EI 4LFAI 3QT7A 2V8PA 2UUAI 1IBLE 4LFCI 4B3TI 3JAMC 1KTVA 1XHKA 4DR3E 1Z5AA 3PYDA 4AQYI 4LF6E 4UT4A 4LFBE 3T1HE 3Q6MA 4JI6I 4YY3I 1FJGE 4B3SE 3B82A 4DV3E 5LMNI 4NXNE 2Z5BB 4P52A 4JI0I 1D6TA 1Z0EA 5IWAE 1MU5A 3J80Q 4LF5E 4KQVA 4ED4A 5FWKA 3ZZUA 2V2VA 1MX0A 3K1JA 4DV2E 4YHHE 4DUZE 1HK7A 1EI1A 4MYTA 2X36A 3J81Q 4WUDA 1A6FA 4DPUA 3OTOE 4LF7E 3T1HI 2Z5CA 3PYEA 4LF4E 2VQEI 1H74A 2EFGA 4DXLA 4B3SI 2XEXA 2GQ0A 4IZKB 4DV3I 4M1KA 4NXNI 2UXDI 2V34A 2V2ZA 5IWAI 1MG7A 2O1TA 3H4LA 3M6AA 4N3OA 4ZVIA 1IBKE 5IT9C 1XMOI 1Z0CA 4DV2I 1Z0TA 5FLXQ 4YHHI 1NHHA 2F4VE 2UUBE 1Z5BA 1B62A 1DARA 2HKJA 1HNZI 5LL6R 5GMEA 3QT5A 4FWHA 3OTOI 4LF7I 1N0UA 1PVGA 1ELOA 4X65I 4LF8I 1Y4UA 4LF4I 2Q2EB 4GKJE 4X66E 1U2RA 5A2QQ 4I3HA 1FNMA 4DV4E 2X7IA 2LJPA 4JI8E 2R3VA 4UTGA 5GMDA 1S16A 2J7KA 4PRVA 4B3RI 2OI2A 3WU6A 4KHPE 2VF3A 4OX9E 1IBKI 4IZJB 2BM0A 2UU9E 2UXCE 5L3JA 3ZKDA 4WUCA 2UUBI 3D4JA 1PIEA 4EMDA 4JI2I 1HR0I 3CWVA 4DV7E 3ZZTA 4JYAE 1IBME 4USMA 4LF9E 1NHIA 3T1YE 1FI4A 4GKJI 4X66I 4X62I 3PYFA 4DUYE 1XNRE 1Z59A 4X64E 1WUUA 2HK2A 2O1UA 2Z5BA 4RPFA 4FWDA 3ZZ0A 1FWLA 4KHPI 1H72C 4OX9I 2UU9I 4HACB 3V2UC 1B63A 1I94E 1H7UA 2BM1A 1IBLI 3ZM7A 3QT6A 1Y4SA 4HXZA 3WU3A 4DR3I 4DV7I 4JI7E 4JYAI 1IBMI 4LF6I 4LF9I 4JV5E 2HHHE 4LFBI 1FKAE 3PYGA 2UUCE 1RREA 4DV6E 1FJGI 1ZXNA 4B3ME 1KKHA 1HNWE 2ZM6E 1XNRI 4DV5E 4Z7CA 4X64I 4IZKA 3JAMQ 4LF5I 4DU7A 3HULA 2NPFA 4DR1E 4PRXA 1FWKA 1I94I 1VISA 3HJCA 4PU9A 4DUZI 3LPSA 1H7SA 1Z0GA 4JI7I 1N32E 1PKPA 4JV5I 4DR6E 4DV1E 3P06A 2CGEA 1Z0VA 4NXME 2UUCI 2V2QA 4HYMA 2DEIA 1H73A 2O1WA 4B3MI 4DPXA 4Z7YA 2ZITA 2UUAE 1ZM4A 4XTJA 3B8HA 4LFCE 4DR5E 4JI5E 1ZM2A 2DEJA 3J80C 3K17A 1Z0BA 4DR1I 4DPYA 4K0KE 4GKKE 2BV3A 3LNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU4 A;  5LMN E;  2R42 A;  1RR9 A;  2F4V I;  1OJ4 A;  1KVK A;  1N32 I;  3J81 C;  3Q1Q A;  4DR6 I;  4USK A;  4NXM I;  2E5L E;  2WW4 A;  3B78 A;  4DV0 E;  2A2C A;  5IT9 Q;  1XNQ E;  2HKE A;  4DV4 I;  3WU5 A;  4JI8 I;  4JI4 E;  4DR5 I;  2GS8 A;  3ZKB A;  4JI5 I;  4DR4 E;  1N34 E;  4DR7 E;  2HFS A;  4MYU A;  4K0K I;  4GKK I;  2VQE E;  5LMU E;  2UXC I;  3J7A G;  5FLX C;  2UXD E;  4DU8 A;  4HAC A;  1NHJ A;  1XMQ E;  4JI1 E;  4FN5 A;  2VQF E;  1HNX E;  1NZ0 A;  1Z5C A;  1EA6 A;  2E5L I;  1K47 A;  4DPT A;  4DV0 I;  3T1Y I;  3J7A M;  1XNQ I;  2E1R A;  1XMO E;  2AJ4 A;  2HFU A;  5A2Q C;  3V5R A;  4DUY I;  4JI4 I;  1HNZ E;  4URL A;  4DR4 I;  1N34 I;  4DR2 E;  4DR7 I;  4JI3 E;  1N36 E;  1QZR A;  4X65 E;  4LF8 E;  1N33 E;  5LMU I;  4HY1 A;  2UXB E;  5BR8 E;  4JI1 I;  1XMQ I;  2HK3 A;  2VQF I;  4DPW A;  1HNX I;  3GON A;  4B3R E;  2HHH I;  1N0V C;  1J5E E;  4LFA E;  4DV6 I;  1S4E A;  1HNW I;  2A2D A;  2ZM6 I;  4DV5 I;  3LTO A;  1Z0W A;  2CZ9 A;  1ZM3 A;  4B3T E;  4JI2 E;  4DR2 I;  1HR0 E;  4FWG A;  4JI3 I;  3F0N A;  1N36 I;  4AQY E;  4R1F A;  1ZXM A;  1N33 I;  4JI6 E;  1ZM9 A;  3QT8 A;  4YY3 E;  1UEK A;  4P7A A;  2UXB I;  5BR8 I;  4JI0 E;  2ZBK B;  4X62 E;  1KIJ A;  4JG4 A;  4WUB A;  4FW9 A;  1BKN A;  4DV1 I;  1J5E I;  4LFA I;  3QT7 A;  2V8P A;  2UUA I;  1IBL E;  4B3T I;  4LFC I;  3JAM C;  1KTV A;  1XHK A;  4DR3 E;  1Z5A A;  3PYD A;  4AQY I;  4LF6 E;  4UT4 A;  4LFB E;  3T1H E;  4JI6 I;  4YY3 I;  1FJG E;  4B3S E;  3B82 A;  4DV3 E;  5LMN I;  4NXN E;  4P52 A;  4JI0 I;  1D6T A;  1Z0E A;  5IWA E;  1MU5 A;  3J80 Q;  4LF5 E;  4KQV A;  4ED4 A;  3ZZU A;  2V2V A;  1MX0 A;  3K1J A;  4DV2 E;  4YHH E;  4DUZ E;  1EI1 A;  4MYT A;  2X36 A;  3J81 Q;  4WUD A;  1A6F A;  4DPU A;  3OTO E;  4LF7 E;  3T1H I;  3PYE A;  4LF4 E;  2VQE I;  1H74 A;  2EFG A;  4DXL A;  4B3S I;  2XEX A;  4DV3 I;  4M1K A;  4NXN I;  2UXD I;  2V34 A;  2V2Z A;  5IWA I;  1MG7 A;  3H4L A;  3M6A A;  4ZVI A;  1IBK E;  5IT9 C;  1XMO I;  1Z0C A;  4DV2 I;  1Z0T A;  5FLX Q;  4YHH I;  1NHH A;  2F4V E;  2UUB E;  1Z5B A;  1B62 A;  1DAR A;  2HKJ A;  1HNZ I;  5LL6 R;  5GME A;  3QT5 A;  4FWH A;  3OTO I;  4LF7 I;  1N0U A;  1PVG A;  1ELO A;  4X65 I;  4LF8 I;  4LF4 I;  2Q2E B;  4GKJ E;  4X66 E;  1U2R A;  5A2Q Q;  4I3H A;  1FNM A;  4DV4 E;  2X7I A;  2LJP A;  4JI8 E;  2R3V A;  4UTG A;  5GMD A;  1S16 A;  2J7K A;  4PRV A;  4B3R I;  2OI2 A;  3WU6 A;  4KHP E;  2VF3 A;  4OX9 E;  1IBK I;  2BM0 A;  2UU9 E;  2UXC E;  5L3J A;  3ZKD A;  4WUC A;  2UUB I;  3D4J A;  1PIE A;  4EMD A;  4JI2 I;  1HR0 I;  3CWV A;  4DV7 E;  3ZZT A;  4JYA E;  1IBM E;  4USM A;  4LF9 E;  1NHI A;  3T1Y E;  1FI4 A;  4GKJ I;  4X66 I;  4X62 I;  3PYF A;  4DUY E;  1XNR E;  1Z59 A;  4X64 E;  1WUU A;  2HK2 A;  4RPF A;  4FWD A;  3ZZ0 A;  1FWL A;  4KHP I;  1H72 C;  4OX9 I;  2UU9 I;  4HAC B;  3V2U C;  1B63 A;  1I94 E;  1H7U A;  2BM1 A;  1IBL I;  3ZM7 A;  3QT6 A;  4HXZ A;  3WU3 A;  4DR3 I;  4DV7 I;  4JI7 E;  4JYA I;  1IBM I;  4LF6 I;  4LF9 I;  4JV5 E;  2HHH E;  4LFB I;  1FKA E;  3PYG A;  2UUC E;  1RRE A;  4DV6 E;  1FJG I;  1ZXN A;  4B3M E;  1KKH A;  1HNW E;  2ZM6 E;  1XNR I;  4DV5 E;  4Z7C A;  4X64 I;  3JAM Q;  4LF5 I;  4DU7 A;  3HUL A;  2NPF A;  4DR1 E;  4PRX A;  1FWK A;  1I94 I;  1VIS A;  4PU9 A;  4DUZ I;  3LPS A;  1H7S A;  1Z0G A;  4JI7 I;  1N32 E;  1PKP A;  4JV5 I;  4DR6 E;  4DV1 E;  1Z0V A;  4NXM E;  2UUC I;  2V2Q A;  4HYM A;  2DEI A;  1H73 A;  4B3M I;  4DPX A;  4Z7Y A;  2ZIT A;  2UUA E;  1ZM4 A;  4XTJ A;  3B8H A;  4LFC E;  4DR5 E;  4JI5 E;  1ZM2 A;  2DEJ A;  3J80 C;  3K17 A;  1Z0B A;  4DR1 I;  4DPY A;  4K0K E;  4GKK E;  2BV3 A;  3LNU A; 
#chains in the Genus database with same CATH topology
 3WU4 A;  1R6M A;  5LMN E;  2R42 A;  1RR9 A;  2F4V I;  4IZJ A;  1OJ4 A;  1KVK A;  2PO2 A;  5K36 B;  1N32 I;  3J81 C;  3Q1Q A;  4FW7 A;  4DR6 I;  5K36 E;  4USK A;  4NXM I;  1UDS A;  2E5L E;  2WW4 A;  2IER A;  3B78 A;  4DV0 E;  2A2C A;  5IT9 Q;  1XNQ E;  4ISA A;  2HKE A;  5JEA B;  4DV4 I;  5K36 F;  3PRY A;  3WU5 A;  5DRO A;  4JI8 I;  4JI4 E;  4BA1 A;  2GO4 A;  2CG9 A;  5JEA E;  4DR5 I;  2GS8 A;  3ZKB A;  4JI5 I;  4DR4 E;  1N34 E;  3M85 G;  4DR7 E;  2CVE A;  2HFS A;  4MYU A;  4K0K I;  4GKK I;  2VQE E;  5LMU E;  2UXC I;  3U1K A;  4IFD C;  3J7A G;  4MU0 A;  5FLX C;  5C0X C;  2UXD E;  4DU8 A;  4HAC A;  1NHJ A;  1XMQ E;  4JI1 E;  4FN5 A;  1Y6Z A;  2VQF E;  4FW4 A;  1HNX E;  1OYR A;  1NZ0 A;  4IS9 A;  1Z5C A;  2WP8 B;  1EA6 A;  3KRN A;  4MDT A;  2E5L I;  1K47 A;  4DPT A;  4DV0 I;  3T1Y I;  3J7A M;  4MU3 A;  1XNQ I;  2E1R A;  1XMO E;  2AJ4 A;  2HFU A;  3GME A;  5A2Q C;  3V5R A;  2IOP A;  4DUY I;  4JI4 I;  2C37 B;  4OO1 B;  1HNZ E;  4URL A;  4FW3 A;  3CDJ A;  4DR4 I;  3NZK A;  4DR2 E;  1N34 I;  2Z5C B;  4DR7 I;  4JI3 E;  4OO1 E;  2PNM A;  1N36 E;  3K85 A;  2C39 A;  4J3D A;  1QZR A;  4X65 E;  4LF8 E;  1N33 E;  5LMU I;  4HY1 A;  3PS3 A;  4OO1 F;  2UXB E;  4MU1 A;  5BR8 E;  3P3E A;  4QNK A;  4JI1 I;  1XMQ I;  5JEA C;  4LPF A;  2IOQ A;  2HK3 A;  1USU A;  2VQF I;  4DPW A;  1HNX I;  3L7Z B;  2BA1 G;  3GON A;  4IFD D;  4B3R E;  5C0X D;  2HHH I;  1N0V C;  3M7N D;  3U1Y A;  2PNZ B;  1USV A;  1J5E E;  4LFA E;  1UDQ A;  2O1V A;  4DV6 I;  1S4E A;  2Z5E A;  1HNW I;  2A2D A;  2ZM6 I;  4DV5 I;  3LTO A;  1Z0W A;  3GLL A;  2CZ9 A;  2C38 B;  1ZM3 A;  4B3T E;  4JI2 E;  4NBQ A;  3B4T A;  4DR2 I;  4FWG A;  1HR0 E;  4JI3 I;  3F0N A;  1N36 I;  4IZJ D;  4AQY E;  4R1F A;  1ZXM A;  2PO0 B;  1N33 I;  4JI6 E;  1ZM9 A;  3QT8 A;  4YY3 E;  1UEK A;  4P7A A;  3PS1 A;  2UXB I;  5BR8 I;  2PNL A;  4JI0 E;  2ZBK B;  4X62 E;  1KIJ A;  4JG4 A;  4WUB A;  4FW9 A;  3Q6N A;  4LCG A;  1BKN A;  5K36 A;  4DV1 I;  1J5E I;  5JEA D;  4LFA I;  3QT7 A;  2V8P A;  2NN6 B;  4GQU A;  2BA0 D;  2UUA I;  3P3G A;  1IBL E;  2NN6 E;  4LFC I;  4B3T I;  5JEA A;  3JAM C;  1KTV A;  1XHK A;  3P76 A;  4DR3 E;  2IES A;  1Z5A A;  3PYD A;  4AQY I;  4LF6 E;  4UT4 A;  4LFB E;  3T1H E;  2NN6 F;  3Q6M A;  4JI6 I;  4YY3 I;  1FJG E;  4B3S E;  3B82 A;  4DV3 E;  5LMN I;  4NXN E;  2Z5B B;  4P52 A;  4JI0 I;  1D6T A;  1Z0E A;  5IWA E;  2AE8 A;  1MU5 A;  3J80 Q;  4LF5 E;  4KQV A;  4MQY A;  4ED4 A;  5FWK A;  3ZZU A;  4FW6 A;  2V2V A;  1MX0 A;  3K1J A;  2WP8 A;  4DV2 E;  3M85 D;  4YHH E;  4DUZ E;  4LCF A;  1HK7 A;  2PO1 B;  1EI1 A;  4MYT A;  2X36 A;  5ELW A;  3J81 Q;  4WUD A;  4OKG A;  2BR2 B;  2F1D A;  2C37 A;  4OO1 A;  5K36 C;  1E3H A;  1A6F A;  4DPU A;  2O3Z A;  3OTO E;  4LF7 E;  3T1H I;  2Z5C A;  2BR2 A;  3PYE A;  4LF4 E;  2VQE I;  1H74 A;  2EFG A;  4DXL A;  4B3S I;  2XEX A;  2GQ0 A;  4IZK B;  4DV3 I;  4M1K A;  4OZE A;  4NXN I;  2UXD I;  2V34 A;  1UDN A;  2V2Z A;  1XXE A;  5IWA I;  1MG7 A;  2O1T A;  3H4L A;  3M6A A;  5DRQ A;  4N3O A;  4ZVI A;  3L7Z A;  2GO3 A;  1IBK E;  5IT9 C;  1XMO I;  1E3P A;  1Z0C A;  5DRP A;  4DV2 I;  1Z0T A;  4AID A;  5FLX Q;  3DD6 A;  2PNZ A;  4YHH I;  1NHH A;  5DNX A;  2F4V E;  2UUB E;  1Z5B A;  1B62 A;  1DAR A;  2HKJ A;  1HNZ I;  5LL6 R;  5GME A;  4AIM A;  4BA2 B;  3QT5 A;  4FWH A;  3OTO I;  4LF7 I;  1N0U A;  2C38 A;  1PVG A;  1ELO A;  4X65 I;  4LF8 I;  1Y4U A;  4LF4 I;  4IFD B;  5C0X B;  2Q2E B;  4GKJ E;  2PO0 A;  4X66 E;  1U2R A;  5A2Q Q;  5K36 D;  4I3H A;  1FNM A;  4DV4 E;  2X7I A;  4IFD E;  2LJP A;  2WNR B;  5C0X E;  4JI8 E;  2JEB B;  2R3V A;  4UTG A;  2JEA B;  5GMD A;  1S16 A;  4OO1 C;  1OYS A;  2J7K A;  2JE6 B;  4PRV A;  4B3R I;  4IFD F;  2OI2 A;  5C0X F;  4LCH A;  3WU6 A;  4KHP E;  2VF3 A;  2JE6 A;  4OX9 E;  1IBK I;  4IZJ B;  2BM0 A;  2UU9 E;  2PO2 B;  2UXC E;  5L3J A;  4LOM A;  3ZKD A;  4QNJ A;  4WUC A;  2UUB I;  3D4J A;  1PIE A;  2NN6 A;  4EMD A;  4JI2 I;  4FW5 A;  1HR0 I;  3CWV A;  4DV7 E;  3ZZT A;  4JYA E;  1IBM E;  4USM A;  4LF9 E;  1YHC A;  5EKW A;  3PS2 A;  1NHI A;  3T1Y E;  1FI4 A;  1VI7 A;  4GKJ I;  4X66 I;  4BA1 B;  4MU4 A;  3HKM A;  1P42 A;  1Y5Y A;  3PYF A;  4X62 I;  1R6L A;  4DUY E;  1XNR E;  4U3D A;  1Z59 A;  1OYP A;  4X64 E;  1WUU A;  2HK2 A;  2O1U A;  2Z5B A;  4RPF A;  3P3C A;  4FWD A;  3ZZ0 A;  1FWL A;  4KHP I;  1H72 C;  4OX9 I;  5DRR A;  5JEA F;  2UU9 I;  4HAC B;  3V2U C;  1B63 A;  5DNL A;  4OO1 D;  1I94 E;  2VES A;  1H7U A;  5EL9 A;  2BM1 A;  1IBL I;  3ZM7 A;  3QT6 A;  1Y4S A;  4HXZ A;  3WU3 A;  4DR3 I;  4DV7 I;  4JI7 E;  4JYA I;  1IBM I;  4LF6 I;  2PO1 A;  4LF9 I;  4JV5 E;  2HHH E;  4LFB I;  1FKA E;  3PYG A;  2UUC E;  1YH8 A;  1RRE A;  4DV6 E;  1FJG I;  1ZXN A;  4B3M E;  3M7N G;  2NN6 C;  1KKH A;  1HNW E;  2ZM6 E;  2J65 A;  1XNR I;  4DV5 E;  4Z7C A;  4X64 I;  4IZK A;  2C39 B;  3JAM Q;  3CDI A;  4LF5 I;  4DU7 A;  3HUL A;  1UDO A;  2NPF A;  4DR1 E;  4PRX A;  1FWK A;  1I94 I;  1VIS A;  3HJC A;  4U3B A;  4PU9 A;  4DUZ I;  3LPS A;  1Y60 A;  1H7S A;  1Z0G A;  4JI7 I;  1N32 E;  1PKP A;  4JV5 I;  4DR6 E;  3UHM A;  4DV1 E;  3P06 A;  2CGE A;  1Z0V A;  4NXM E;  2UUC I;  4BA2 A;  2V2Q A;  4HYM A;  2DEI A;  1H73 A;  2O1W A;  4B3M I;  4DPX A;  2BA1 D;  4Z7Y A;  2JT2 A;  4AM3 A;  4IFD A;  5C0X A;  2ZIT A;  2UUA E;  1ZM4 A;  3GCM A;  4XTJ A;  3B8H A;  4LFC E;  1RHY A;  4DR5 E;  4JI5 E;  2WNR A;  1ZM2 A;  2DEJ A;  2BA0 G;  2JEB A;  3J80 C;  2NN6 D;  2JEA A;  3H1C A;  3K17 A;  1Z0B A;  4DR1 I;  4DPY A;  4K0K E;  4GKK E;  2BV3 A;  3LNU A; 
#chains in the Genus database with same CATH homology
 3WU4 A;  5LMN E;  2R42 A;  1RR9 A;  2F4V I;  4IZJ A;  1OJ4 A;  1KVK A;  1N32 I;  3J81 C;  3Q1Q A;  4DR6 I;  4USK A;  4NXM I;  2E5L E;  2WW4 A;  3B78 A;  4DV0 E;  2A2C A;  5IT9 Q;  1XNQ E;  2HKE A;  4DV4 I;  3PRY A;  3WU5 A;  4JI8 I;  4JI4 E;  2CG9 A;  4DR5 I;  2GS8 A;  3ZKB A;  4JI5 I;  4DR4 E;  1N34 E;  4DR7 E;  2HFS A;  4MYU A;  4K0K I;  4GKK I;  2VQE E;  5LMU E;  2UXC I;  3J7A G;  5FLX C;  2UXD E;  4DU8 A;  4HAC A;  1NHJ A;  1XMQ E;  4JI1 E;  4FN5 A;  1Y6Z A;  2VQF E;  1HNX E;  1NZ0 A;  1Z5C A;  1EA6 A;  2E5L I;  1K47 A;  4DPT A;  4DV0 I;  3T1Y I;  3J7A M;  1XNQ I;  2E1R A;  1XMO E;  2AJ4 A;  2HFU A;  5A2Q C;  3V5R A;  2IOP A;  4DUY I;  4JI4 I;  1HNZ E;  4URL A;  4DR4 I;  1N34 I;  4DR2 E;  2Z5C B;  4DR7 I;  4JI3 E;  2PNM A;  1N36 E;  3K85 A;  1QZR A;  4X65 E;  4LF8 E;  1N33 E;  5LMU I;  4HY1 A;  2UXB E;  5BR8 E;  4JI1 I;  1XMQ I;  2IOQ A;  2HK3 A;  1USU A;  2VQF I;  4DPW A;  1HNX I;  3GON A;  4B3R E;  2HHH I;  1N0V C;  1USV A;  1J5E E;  4LFA E;  2O1V A;  4DV6 I;  1S4E A;  2Z5E A;  1HNW I;  2A2D A;  2ZM6 I;  4DV5 I;  3LTO A;  1Z0W A;  2CZ9 A;  1ZM3 A;  4B3T E;  4JI2 E;  4DR2 I;  1HR0 E;  4FWG A;  4JI3 I;  3F0N A;  1N36 I;  4IZJ D;  4AQY E;  4R1F A;  1ZXM A;  1N33 I;  4JI6 E;  1ZM9 A;  3QT8 A;  4YY3 E;  1UEK A;  4P7A A;  2UXB I;  5BR8 I;  2PNL A;  4JI0 E;  2ZBK B;  4X62 E;  1KIJ A;  4JG4 A;  4WUB A;  4FW9 A;  3Q6N A;  1BKN A;  4DV1 I;  1J5E I;  4LFA I;  3QT7 A;  2V8P A;  2UUA I;  1IBL E;  4LFC I;  4B3T I;  3JAM C;  1KTV A;  1XHK A;  4DR3 E;  1Z5A A;  3PYD A;  4AQY I;  4LF6 E;  4UT4 A;  4LFB E;  3T1H E;  3Q6M A;  4JI6 I;  4YY3 I;  1FJG E;  4B3S E;  3B82 A;  4DV3 E;  5LMN I;  4NXN E;  2Z5B B;  4P52 A;  4JI0 I;  1D6T A;  1Z0E A;  5IWA E;  1MU5 A;  3J80 Q;  4LF5 E;  4KQV A;  4ED4 A;  5FWK A;  3ZZU A;  2V2V A;  1MX0 A;  3K1J A;  4DV2 E;  4YHH E;  4DUZ E;  1HK7 A;  1EI1 A;  4MYT A;  2X36 A;  3J81 Q;  4WUD A;  1A6F A;  4DPU A;  3OTO E;  4LF7 E;  3T1H I;  2Z5C A;  3PYE A;  4LF4 E;  2VQE I;  1H74 A;  2EFG A;  4DXL A;  4B3S I;  2XEX A;  2GQ0 A;  4IZK B;  4DV3 I;  4M1K A;  4NXN I;  2UXD I;  2V34 A;  2V2Z A;  5IWA I;  1MG7 A;  2O1T A;  3H4L A;  3M6A A;  4N3O A;  4ZVI A;  1IBK E;  5IT9 C;  1XMO I;  1Z0C A;  4DV2 I;  1Z0T A;  5FLX Q;  4YHH I;  1NHH A;  2F4V E;  2UUB E;  1Z5B A;  1B62 A;  1DAR A;  2HKJ A;  1HNZ I;  5LL6 R;  5GME A;  3QT5 A;  4FWH A;  3OTO I;  4LF7 I;  1N0U A;  1PVG A;  1ELO A;  4X65 I;  4LF8 I;  1Y4U A;  4LF4 I;  2Q2E B;  4GKJ E;  4X66 E;  1U2R A;  5A2Q Q;  4I3H A;  1FNM A;  4DV4 E;  2X7I A;  2LJP A;  4JI8 E;  2R3V A;  4UTG A;  5GMD A;  1S16 A;  2J7K A;  4PRV A;  4B3R I;  2OI2 A;  3WU6 A;  4KHP E;  2VF3 A;  4OX9 E;  1IBK I;  4IZJ B;  2BM0 A;  2UU9 E;  2UXC E;  5L3J A;  3ZKD A;  4WUC A;  2UUB I;  3D4J A;  1PIE A;  4EMD A;  4JI2 I;  1HR0 I;  3CWV A;  4DV7 E;  3ZZT A;  4JYA E;  1IBM E;  4USM A;  4LF9 E;  1NHI A;  3T1Y E;  1FI4 A;  4GKJ I;  4X66 I;  4X62 I;  3PYF A;  4DUY E;  1XNR E;  1Z59 A;  4X64 E;  1WUU A;  2HK2 A;  2O1U A;  2Z5B A;  4RPF A;  4FWD A;  3ZZ0 A;  1FWL A;  4KHP I;  1H72 C;  4OX9 I;  2UU9 I;  4HAC B;  3V2U C;  1B63 A;  1I94 E;  1H7U A;  2BM1 A;  1IBL I;  3ZM7 A;  3QT6 A;  1Y4S A;  4HXZ A;  3WU3 A;  4DR3 I;  4DV7 I;  4JI7 E;  4JYA I;  1IBM I;  4LF6 I;  4LF9 I;  4JV5 E;  2HHH E;  4LFB I;  1FKA E;  3PYG A;  2UUC E;  1RRE A;  4DV6 E;  1FJG I;  1ZXN A;  4B3M E;  1KKH A;  1HNW E;  2ZM6 E;  1XNR I;  4DV5 E;  4Z7C A;  4X64 I;  4IZK A;  3JAM Q;  4LF5 I;  4DU7 A;  3HUL A;  2NPF A;  4DR1 E;  4PRX A;  1FWK A;  1I94 I;  1VIS A;  3HJC A;  4PU9 A;  4DUZ I;  3LPS A;  1H7S A;  1Z0G A;  4JI7 I;  1N32 E;  1PKP A;  4JV5 I;  4DR6 E;  4DV1 E;  3P06 A;  2CGE A;  1Z0V A;  4NXM E;  2UUC I;  2V2Q A;  4HYM A;  2DEI A;  1H73 A;  2O1W A;  4B3M I;  4DPX A;  4Z7Y A;  2ZIT A;  2UUA E;  1ZM4 A;  4XTJ A;  3B8H A;  4LFC E;  4DR5 E;  4JI5 E;  1ZM2 A;  2DEJ A;  3J80 C;  3K17 A;  1Z0B A;  4DR1 I;  4DPY A;  4K0K E;  4GKK E;  2BV3 A;  3LNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...