1RR9A

Catalytic domain of e.coli lon protease
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent protease La
publication title The catalytic domain of Escherichia coli Lon protease has a unique fold and a Ser-Lys dyad in the active site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 58
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2003-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1rr9A01
1HNWE 3J80Q 3QT5A 1B62A 1MU5A 3J80C 5BR8E 4P52A 1ZM2A 4DR6E 2VQEI 4DV5E 1Z5CA 2HKJA 4LFBI 4JI4I 3PYFA 2X36A 4LFCE 4ED4A 2VQFI 1N36I 4LF6E 1BKNA 1OJ4A 2V8PA 1KVKA 2UUAI 4DV7E 4DV6I 4LFAI 1N34E 5IT9Q 1IBKI 4KHPE 3OTOE 2BV3A 4FWDA 4HACA 1ZXNA 4LF9E 3K17A 4DR5I 2OI2A 1N32I 4OX9I 1QZRA 2EFGA 4WUBA 4NXNI 1KTVA 1IBMI 1Z0VA 2ZITA 2R3VA 2R42A 2Q2EB 4NXMI 1A6FA 4B3RE 4I3HA 4YY3I 4WUDA 2BM0A 4GKJI 1Z0CA 4B3ME 4DPUA 1ZM4A 1H74A 3QT7A 4X66I 1DARA 2XEXA 3LPSA 4DR4E 3M6AA 4JI2I 3K1JA 4LF4I 1H73A 4DR3I 4DV4E 1ZM9A 3JAMC 2BM1A 4LF8E 1KKHA 4JV5I 3V2UC 4JI8E 5LMNE 1S4EA 4DV1E 1XMOE 3LTOA 2HHHI 4FWHA 1MX0A 3H4LA 2NPFA 3HULA 3PYEA 4X64I 1I94E 1PIEA 1Z5AA 5A2QC 2WW4A 4DUZE 1N33I 4DR7E 5LMUE 2F4VI 4HXZA 3WU6A 1PVGA 2A2CA 2F4VE 1HR0I 3WU5A 4LF5I 2HFUA 1FJGI 3B78A 1RR9A 4DR2I 4HACB 2VQEE 4R1FA 1HNZI 4PRXA 2UU9I 3PYGA 4LFBE 3J81C 4JI4E 1XNRI 4DV2I 2VQFE 2V2ZA 1N36E 4YHHI 4JI0I 1H7UA 3QT8A 1XMQI 2V2QA 2UUAE 1FWLA 4DV6E 4LFAE 1FNMA 1IBKE 2DEJA 4JG4A 2CZ9A 2GS8A 5L3JA 3Q1QA 4DPTA 4DR5E 1KIJA 2UXDI 4HY1A 3J7AM 4DV3I 2V34A 4P7AA 4AQYI 1N32E 4OX9E 4DR1I 4JI6I 1Z59A 4HYMA 1NHIA 4USKA 4NXNE 4PU9A 1IBLI 1IBME 5LL6R 2DEIA 4NXME 1B63A 1FKAE 2E5LI 1PKPA 4DU8A 4MYUA 4YY3E 2UXCI 1WUUA 4GKJE 3LNUA 4B3SI 4X66E 4JI1I 3JAMQ 2HK3A 3WU3A 4JI2E 4LF4E 4DR3E 4JI3I 4UTGA 1H72C 1Z5BA 1XNQI 2UUBI 4LF7I 3ZKBA 4JI3E 4JV5E 4DU7A 5IWAI 1N0UA 1FI4A 1RREA 3T1HI 1J5EI 4JI5I 1MG7A 4Z7YA 2HHHE 3T1YI 4GKKI 3J7AG 5A2QQ 2ZM6I 4JI7I 4X62I 4X64E 2UUCI 4RPFA 4DUYI 2E1RA 1HNXI 4DV0I 4JYAI 4K0KI 1UEKA 1N33E 2UXBI 1Z0BA 3B82A 1HR0E 2UXBE 3ZKDA 3V5RA 4LF5E 1K47A 1EA6A 2HKEA 4URLA 1FJGE 1HNWI 3J81Q 4DR2E 3ZZTA 1HNZE 4Z7CA 4DR6I 2UU9E 4DV5I 4FWGA 1XNRE 4DV2E 4USMA 4PRVA 4LFCI 4DPWA 2A2DA 1ELOA 4YHHE 1NHJA 1FWKA 4JI0E 2ZBKB 4LF6I 1XMQE 1EI1A 4DV7I 1N34I 3GONA 4EMDA 4DPYA 4KHPI 3OTOI 1Z0GA 2J7KA 1D6TA 2UXDE 5IT9C 5FLXQ 4LF9I 5GMDA 5FLXC 4DV3E 3ZZ0A 4AQYE 4DR1E 4JI6E 1Z0TA 1Z0WA 1IBLE 4KQVA 3PYDA 2VF3A 1NHHA 4ZVIA 2E5LE 2V2VA 4XTJA 2HK2A 2UXCE 3F0NA 4B3RI 1N0VC 4B3SE 4M1KA 4B3MI 1NZ0A 1Z0EA 2AJ4A 3D4JA 4JI1E 4MYTA 4DR4I 3WU4A 2LJPA 4B3TI 1ZM3A 1XNQE 4DV4I 2UUBE 3B8HA 4LF7E 4B3TE 1H7SA 4LF8I 5IWAE 1XHKA 3T1HE 4JI8I 5LMNI 1J5EE 4JI5E 4DV1I 4WUCA 1ZXMA 3T1YE 1XMOI 3QT6A 4GKKE 4FW9A 1VISA 2ZM6E 4JI7E 4X62E 3ZZUA 2UUCE 2HFSA 4X65I 1I94I 4DUYE 4X65E 1HNXE 4DV0E 4JYAE 4K0KE 4DPXA 4DUZI 3ZM7A 4DR7I 5LMUI 1U2RA 2X7IA 5GMEA 1S16A 4UT4A 4FN5A 4DXLA 3CWVA 5BR8I
chains in the Genus database with same CATH superfamily
1HNWE 3J80Q 3QT5A 1UDSA 1B62A 1MU5A 3J80C 5BR8E 4P52A 1OYRA 2PO0B 1ZM2A 2IOQA 4DR6E 2VQEI 4DV5E 5DRQA 1Z5CA 2HKJA 2GO4A 4LFBI 4JI4I 3PYFA 2X36A 4LFCE 4ED4A 2VQFI 4OO1D 1N36I 5JEAF 4BA1B 4LF6E 1BKNA 1OJ4A 5C0XD 2V8PA 1KVKA 1YH8A 5JEAA 2UUAI 4DV7E 4DV6I 4LFAI 1N34E 2PNMA 5IT9Q 1IBKI 4LPFA 3OTOE 4KHPE 2BV3A 4FWDA 4LCFA 4HACA 2NN6D 5K36F 2BR2B 2WNRB 3L7ZB 1ZXNA 4LF9E 3K17A 4DR5I 5K36A 2WP8A 2OI2A 1E3HA 1N32I 4OX9I 1QZRA 2EFGA 4WUBA 3CDIA 1OYSA 4NXNI 1KTVA 4J3DA 3KRNA 1IBMI 1Z0VA 2ZITA 3PRYA 2R3VA 2R42A 2Q2EB 4NXMI 1VI7A 1A6FA 4B3RE 4I3HA 2BA1G 4YY3I 4WUDA 2BM0A 4GKJI 1Z0CA 4B3ME 4DPUA 1ZM4A 1USVA 1H74A 2Z5BB 3QT7A 1DARA 2BA1D 4X66I 4OO1E 1OYPA 2NN6B 2XEXA 2AE8A 3LPSA 4DR4E 3M6AA 4JI2I 3K1JA 3PS1A 4LF4I 2BA0G 1H73A 4DR3I 4DV4E 1ZM9A 2CVEA 3JAMC 2JEBB 2BM1A 4LF8E 2BA0D 1KKHA 2NN6E 4JV5I 3V2UC 4JI8E 5LMNE 1S4EA 4DV1E 1XMOE 3LTOA 2HHHI 4AM3A 4FWHA 1MX0A 4GQUA 3H4LA 4IZJA 5C0XF 2NPFA 1UDQA 3HULA 2JEAA 3PYEA 4IS9A 4X64I 1I94E 1PIEA 2GQ0A 1Z5AA 4IFDF 3HJCA 5A2QC 2PNLA 2WW4A 2NN6C 4DUZE 1N33I 4DR7E 1RHYA 5LMUE 2F4VI 4IFDA 2F1DA 4HXZA 3WU6A 4IZKA 2O1VA 1PVGA 3DD6A 2A2CA 2F4VE 3Q6MA 1HR0I 3WU5A 4LF5I 4NBQA 2HFUA 1FJGI 4LCHA 3B78A 1RR9A 4DR2I 4HACB 2VQEE 4R1FA 1HNZI 4PRXA 4LCGA 3PYGA 2UU9I 2Z5CA 4LFBE 3J81C 4JI4E 1XNRI 2PNZA 4MQYA 4U3DA 4DV2I 2VQFE 2V2ZA 1N36E 2O1TA 4YHHI 4JI0I 1H7UA 4MDTA 2PO1A 3QT8A 1XMQI 2V2QA 2UUAE 1FWLA 4DV6E 4LFAE 1FNMA 1IBKE 2DEJA 2JE6B 2CZ9A 2C38A 4JG4A 2GS8A 5L3JA 3Q1QA 4MU1A 4DPTA 5DNXA 1Y6ZA 4DR5E 1KIJA 2O3ZA 4FW5A 2UXDI 4HY1A 3J7AM 4DV3I 2V34A 4P7AA 5DRPA 4AQYI 1N32E 4OX9E 1XXEA 4DR1I 4JI6I 3HKMA 1Z59A 4HYMA 1NHIA 4USKA 4NXNE 4PU9A 1IBLI 3GCMA 1IBME 4MU4A 5LL6R 2DEIA 3P3CA 3GMEA 4BA1A 4NXME 1B63A 1FKAE 2E5LI 1PKPA 4DU8A 3M85G 3B4TA 4MYUA 4YY3E 2UXCI 1WUUA 4GKJE 3LNUA 4B3SI 4N3OA 3M85D 3P3GA 4X66E 2WNRA 4JI1I 3JAMQ 2HK3A 3WU3A 3Q6NA 2C39B 4JI2E 2O1WA 4LF4E 4OZEA 5JEAD 4DR3E 4JI3I 5DNLA 4UTGA 1H72C 1Z5BA 1R6LA 1XNQI 3GLLA 3NZKA 2UUBI 4LF7I 3ZKBA 4JI3E 4QNKA 4OO1F 4JV5E 4DU7A 5EKWA 5IWAI 1N0UA 1FI4A 1RREA 3T1HI 1J5EI 4JI5I 1MG7A 5K36D 2C37A 4OO1A 4Z7YA 2HHHE 2CG9A 3UHMA 3T1YI 4GKKI 1R6MA 3J7AG 5C0XA 5A2QQ 2ZM6I 4JI7I 4X62I 2NN6F 2IOPA 4X64E 2UUCI 4RPFA 2Z5CB 4DUYI 2Z5BA 2E1RA 5DRRA 2PNZB 4DV0I 1HNXI 4JYAI 4K0KI 1UEKA 1N33E 2UXBI 1HK7A 1Z0BA 5JEAB 3B82A 4BA2A 1HR0E 2UXBE 3ZKDA 2JEBA 3V5RA 4LOMA 4LF5E 1K47A 1EA6A 2HKEA 2C38B 3U1YA 4URLA 1FJGE 1HNWI 3J81Q 4DR2E 3ZZTA 5K36B 2WP8B 5JEAE 1HNZE 4Z7CA 4DR6I 2UU9E 4DV5I 4FW7A 4FWGA 2VESA 1XNRE 4U3BA 1P42A 2O1UA 3P3EA 4DV2E 1UDOA 4USMA 1Y4UA 4PRVA 2PO2A 4LFCI 5K36E 4DPWA 2IERA 2A2DA 1ELOA 4YHHE 1NHJA 1FWKA 4JI0E 2ZBKB 2IESA 4IZJD 4LF6I 1XMQE 1EI1A 4DV7I 5ELWA 5JEAC 1N34I 3GONA 4EMDA 4DPYA 4ISAA 4KHPI 3OTOI 1Z0GA 2J7KA 1D6TA 1E3PA 2PO0A 2JT2A 2UXDE 5IT9C 5FLXQ 4IFDD 4LF9I 1Y4SA 5GMDA 3M7NG 5FLXC 4DV3E 3ZZ0A 4AQYE 4MU0A 4FW3A 3K85A 5K36C 4OKGA 4DR1E 4JI6E 3M7ND 3PS2A 1Z0TA 3H1CA 1Z0WA 1IBLE 4KQVA 2CGEA 3PYDA 2VF3A 1NHHA 4ZVIA 5EL9A 3P06A 2E5LE 2V2VA 4XTJA 2HK2A 1Y60A 4IZJB 2C37B 4OO1B 2UXCE 1UDNA 3F0NA 4FW4A 4B3RI 2JEAB 2BR2A 3L7ZA 1N0VC 4B3SE 2JE6A 4M1KA 4B3MI 5C0XB 1NZ0A 1Z0EA 2AJ4A 5DROA 3D4JA 4JI1E 5FWKA 4QNJA 4MYTA 4DR4I 3WU4A 4IFDB 2LJPA 4B3TI 4AIDA 4IZKB 1ZM3A 1XNQE 4AIMA 4DV4I 2UUBE 3B8HA 4LF7E 5C0XE 4B3TE 1H7SA 4LF8I 4MU3A 2J65A 4BA2B 3PS3A 5IWAE 2Z5EA 1XHKA 3T1HE 4JI8I 5LMNI 1J5EE 4JI5E 4IFDE 4DV1I 1Y5YA 1YHCA 1ZXMA 3QT6A 4WUCA 3T1YE 1XMOI 4GKKE 4FW9A 3U1KA 1VISA 2ZM6E 4JI7E 4X62E 3ZZUA 4X65I 2HFSA 2NN6A 2UUCE 4OO1C 2GO3A 1I94I 4DUYE 4X65E 5C0XC 1HNXE 4DV0E 4JYAE 4K0KE 4DPXA 4DUZI 3CDJA 2C39A 3ZM7A 2PO2B 2PO1B 4DR7I 5LMUI 1U2RA 2X7IA 5GMEA 4IFDC 1S16A 4UT4A 4FN5A 3P76A 4DXLA 1USUA 3CWVA 4FW6A 5BR8I
chains in the Genus database with same CATH topology
1HNWE 3J80Q 3QT5A 1B62A 1MU5A 3J80C 5BR8E 4P52A 1ZM2A 2IOQA 4DR6E 2VQEI 4DV5E 1Z5CA 2HKJA 4LFBI 4JI4I 3PYFA 2X36A 4LFCE 4ED4A 2VQFI 1N36I 4LF6E 1BKNA 1OJ4A 2V8PA 1KVKA 2UUAI 4DV7E 4DV6I 4LFAI 1N34E 2PNMA 5IT9Q 1IBKI 4KHPE 3OTOE 2BV3A 4FWDA 4HACA 1ZXNA 4LF9E 3K17A 4DR5I 2OI2A 1N32I 4OX9I 1QZRA 2EFGA 4WUBA 4NXNI 1KTVA 1IBMI 1Z0VA 2ZITA 3PRYA 2R3VA 2R42A 2Q2EB 4NXMI 1A6FA 4B3RE 4I3HA 4YY3I 4WUDA 2BM0A 4GKJI 1Z0CA 4B3ME 4DPUA 1ZM4A 1USVA 1H74A 2Z5BB 3QT7A 1DARA 4X66I 2XEXA 3LPSA 4DR4E 3M6AA 4JI2I 3K1JA 4LF4I 1H73A 4DR3I 4DV4E 1ZM9A 3JAMC 2BM1A 4LF8E 1KKHA 4JV5I 3V2UC 4JI8E 5LMNE 1S4EA 4DV1E 1XMOE 3LTOA 2HHHI 4FWHA 1MX0A 3H4LA 4IZJA 2NPFA 3HULA 3PYEA 4X64I 1I94E 1PIEA 2GQ0A 1Z5AA 3HJCA 5A2QC 2PNLA 2WW4A 4DUZE 1N33I 4DR7E 5LMUE 2F4VI 4HXZA 3WU6A 4IZKA 2O1VA 1PVGA 2A2CA 2F4VE 3Q6MA 1HR0I 3WU5A 4LF5I 2HFUA 1FJGI 3B78A 1RR9A 4DR2I 4HACB 2VQEE 4R1FA 1HNZI 4PRXA 2UU9I 3PYGA 2Z5CA 4LFBE 3J81C 4JI4E 1XNRI 4DV2I 2VQFE 2V2ZA 1N36E 2O1TA 4YHHI 4JI0I 1H7UA 3QT8A 1XMQI 2V2QA 2UUAE 1FWLA 4DV6E 4LFAE 1FNMA 1IBKE 2DEJA 4JG4A 2CZ9A 2GS8A 5L3JA 3Q1QA 4DPTA 1Y6ZA 4DR5E 1KIJA 2UXDI 4HY1A 3J7AM 4DV3I 2V34A 4P7AA 4AQYI 1N32E 4OX9E 4DR1I 4JI6I 1Z59A 4HYMA 1NHIA 4USKA 4NXNE 4PU9A 1IBLI 1IBME 5LL6R 2DEIA 4NXME 1B63A 1FKAE 2E5LI 1PKPA 4DU8A 4MYUA 4YY3E 2UXCI 1WUUA 4GKJE 3LNUA 4B3SI 4N3OA 4X66E 4JI1I 3JAMQ 2HK3A 3WU3A 3Q6NA 4JI2E 2O1WA 4LF4E 4DR3E 4JI3I 4UTGA 1H72C 1Z5BA 1XNQI 2UUBI 4LF7I 3ZKBA 4JI3E 4JV5E 4DU7A 5IWAI 1N0UA 1FI4A 1RREA 3T1HI 1J5EI 4JI5I 1MG7A 4Z7YA 2HHHE 2CG9A 3T1YI 4GKKI 3J7AG 5A2QQ 2ZM6I 4JI7I 4X62I 2IOPA 4X64E 2UUCI 4RPFA 2Z5CB 4DUYI 2Z5BA 2E1RA 1HNXI 4DV0I 4JYAI 4K0KI 1UEKA 1N33E 2UXBI 1HK7A 1Z0BA 3B82A 1HR0E 2UXBE 3ZKDA 3V5RA 4LF5E 1K47A 1EA6A 2HKEA 4URLA 1FJGE 1HNWI 3J81Q 4DR2E 3ZZTA 1HNZE 4Z7CA 4DR6I 2UU9E 4DV5I 4FWGA 1XNRE 2O1UA 4DV2E 4USMA 1Y4UA 4PRVA 4LFCI 4DPWA 2A2DA 1ELOA 4YHHE 1NHJA 1FWKA 4JI0E 2ZBKB 4IZJD 4LF6I 1XMQE 1EI1A 4DV7I 1N34I 3GONA 4EMDA 4DPYA 4KHPI 3OTOI 1Z0GA 2J7KA 1D6TA 2UXDE 5IT9C 5FLXQ 4LF9I 1Y4SA 5GMDA 5FLXC 4DV3E 3ZZ0A 4AQYE 3K85A 4DR1E 4JI6E 1Z0TA 1Z0WA 1IBLE 4KQVA 2CGEA 3PYDA 2VF3A 1NHHA 4ZVIA 3P06A 2E5LE 2V2VA 4XTJA 2HK2A 4IZJB 2UXCE 3F0NA 4B3RI 1N0VC 4B3SE 4M1KA 4B3MI 1NZ0A 1Z0EA 2AJ4A 3D4JA 4JI1E 5FWKA 4MYTA 4DR4I 3WU4A 2LJPA 4B3TI 4IZKB 1ZM3A 1XNQE 4DV4I 2UUBE 3B8HA 4LF7E 4B3TE 1H7SA 4LF8I 5IWAE 2Z5EA 1XHKA 3T1HE 4JI8I 5LMNI 1J5EE 4JI5E 4DV1I 4WUCA 1ZXMA 3T1YE 1XMOI 3QT6A 4GKKE 4FW9A 1VISA 2ZM6E 4JI7E 4X62E 3ZZUA 4X65I 2HFSA 2UUCE 1I94I 4DUYE 4X65E 1HNXE 4DV0E 4JYAE 4K0KE 4DPXA 4DUZI 3ZM7A 4DR7I 5LMUI 1U2RA 2X7IA 5GMEA 1S16A 4UT4A 4FN5A 4DXLA 1USUA 3CWVA 5BR8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW E;  3J80 Q;  3QT5 A;  1B62 A;  1MU5 A;  3J80 C;  5BR8 E;  4P52 A;  1ZM2 A;  4DR6 E;  2VQE I;  4DV5 E;  1Z5C A;  2HKJ A;  4LFB I;  4JI4 I;  3PYF A;  2X36 A;  4LFC E;  4ED4 A;  2VQF I;  1N36 I;  4LF6 E;  1BKN A;  1OJ4 A;  2V8P A;  1KVK A;  2UUA I;  4DV7 E;  4DV6 I;  4LFA I;  1N34 E;  5IT9 Q;  1IBK I;  4KHP E;  3OTO E;  2BV3 A;  4FWD A;  4HAC A;  1ZXN A;  4LF9 E;  3K17 A;  4DR5 I;  2OI2 A;  1N32 I;  4OX9 I;  1QZR A;  2EFG A;  4WUB A;  4NXN I;  1KTV A;  1IBM I;  1Z0V A;  2ZIT A;  2R3V A;  2R42 A;  2Q2E B;  4NXM I;  1A6F A;  4B3R E;  4I3H A;  4YY3 I;  4WUD A;  2BM0 A;  4GKJ I;  1Z0C A;  4B3M E;  4DPU A;  1ZM4 A;  1H74 A;  3QT7 A;  4X66 I;  1DAR A;  2XEX A;  3LPS A;  4DR4 E;  3M6A A;  4JI2 I;  3K1J A;  4LF4 I;  1H73 A;  4DR3 I;  4DV4 E;  1ZM9 A;  3JAM C;  2BM1 A;  4LF8 E;  1KKH A;  4JV5 I;  3V2U C;  4JI8 E;  5LMN E;  1S4E A;  4DV1 E;  1XMO E;  3LTO A;  2HHH I;  4FWH A;  1MX0 A;  3H4L A;  2NPF A;  3HUL A;  3PYE A;  4X64 I;  1I94 E;  1PIE A;  1Z5A A;  5A2Q C;  2WW4 A;  4DUZ E;  1N33 I;  4DR7 E;  5LMU E;  2F4V I;  4HXZ A;  3WU6 A;  1PVG A;  2A2C A;  2F4V E;  1HR0 I;  3WU5 A;  4LF5 I;  2HFU A;  1FJG I;  3B78 A;  1RR9 A;  4DR2 I;  4HAC B;  2VQE E;  4R1F A;  1HNZ I;  4PRX A;  2UU9 I;  3PYG A;  4LFB E;  3J81 C;  4JI4 E;  1XNR I;  4DV2 I;  2VQF E;  2V2Z A;  1N36 E;  4YHH I;  4JI0 I;  1H7U A;  3QT8 A;  1XMQ I;  2V2Q A;  2UUA E;  1FWL A;  4DV6 E;  4LFA E;  1FNM A;  1IBK E;  2DEJ A;  4JG4 A;  2CZ9 A;  2GS8 A;  5L3J A;  3Q1Q A;  4DPT A;  4DR5 E;  1KIJ A;  2UXD I;  4HY1 A;  3J7A M;  4DV3 I;  2V34 A;  4P7A A;  4AQY I;  1N32 E;  4OX9 E;  4DR1 I;  4JI6 I;  1Z59 A;  4HYM A;  1NHI A;  4USK A;  4NXN E;  4PU9 A;  1IBL I;  1IBM E;  5LL6 R;  2DEI A;  4NXM E;  1B63 A;  1FKA E;  2E5L I;  1PKP A;  4DU8 A;  4MYU A;  4YY3 E;  2UXC I;  1WUU A;  4GKJ E;  3LNU A;  4B3S I;  4X66 E;  4JI1 I;  3JAM Q;  2HK3 A;  3WU3 A;  4JI2 E;  4LF4 E;  4DR3 E;  4JI3 I;  4UTG A;  1H72 C;  1Z5B A;  1XNQ I;  2UUB I;  4LF7 I;  3ZKB A;  4JI3 E;  4JV5 E;  4DU7 A;  5IWA I;  1N0U A;  1FI4 A;  1RRE A;  3T1H I;  1J5E I;  4JI5 I;  1MG7 A;  4Z7Y A;  2HHH E;  3T1Y I;  4GKK I;  3J7A G;  5A2Q Q;  2ZM6 I;  4JI7 I;  4X62 I;  4X64 E;  2UUC I;  4RPF A;  4DUY I;  2E1R A;  1HNX I;  4DV0 I;  4JYA I;  4K0K I;  1UEK A;  1N33 E;  2UXB I;  1Z0B A;  3B82 A;  1HR0 E;  2UXB E;  3ZKD A;  3V5R A;  4LF5 E;  1K47 A;  1EA6 A;  2HKE A;  4URL A;  1FJG E;  1HNW I;  3J81 Q;  4DR2 E;  3ZZT A;  1HNZ E;  4Z7C A;  4DR6 I;  2UU9 E;  4DV5 I;  4FWG A;  1XNR E;  4DV2 E;  4USM A;  4PRV A;  4LFC I;  4DPW A;  2A2D A;  1ELO A;  4YHH E;  1NHJ A;  1FWK A;  4JI0 E;  2ZBK B;  4LF6 I;  1XMQ E;  1EI1 A;  4DV7 I;  1N34 I;  3GON A;  4EMD A;  4DPY A;  4KHP I;  3OTO I;  1Z0G A;  2J7K A;  1D6T A;  2UXD E;  5IT9 C;  5FLX Q;  4LF9 I;  5GMD A;  5FLX C;  4DV3 E;  3ZZ0 A;  4AQY E;  4DR1 E;  4JI6 E;  1Z0T A;  1Z0W A;  1IBL E;  4KQV A;  3PYD A;  2VF3 A;  1NHH A;  4ZVI A;  2E5L E;  2V2V A;  4XTJ A;  2HK2 A;  2UXC E;  3F0N A;  4B3R I;  1N0V C;  4B3S E;  4M1K A;  4B3M I;  1NZ0 A;  1Z0E A;  2AJ4 A;  3D4J A;  4JI1 E;  4MYT A;  4DR4 I;  3WU4 A;  2LJP A;  4B3T I;  1ZM3 A;  1XNQ E;  4DV4 I;  2UUB E;  3B8H A;  4LF7 E;  4B3T E;  1H7S A;  4LF8 I;  5IWA E;  1XHK A;  3T1H E;  4JI8 I;  5LMN I;  1J5E E;  4JI5 E;  4DV1 I;  4WUC A;  1ZXM A;  3T1Y E;  1XMO I;  3QT6 A;  4GKK E;  4FW9 A;  1VIS A;  2ZM6 E;  4JI7 E;  4X62 E;  3ZZU A;  2UUC E;  2HFS A;  4X65 I;  1I94 I;  4DUY E;  4X65 E;  1HNX E;  4DV0 E;  4JYA E;  4K0K E;  4DPX A;  4DUZ I;  3ZM7 A;  4DR7 I;  5LMU I;  1U2R A;  2X7I A;  5GME A;  1S16 A;  4UT4 A;  4FN5 A;  4DXL A;  3CWV A;  5BR8 I; 
#chains in the Genus database with same CATH topology
 1HNW E;  3J80 Q;  3QT5 A;  1UDS A;  1B62 A;  1MU5 A;  3J80 C;  5BR8 E;  4P52 A;  1OYR A;  2PO0 B;  1ZM2 A;  2IOQ A;  4DR6 E;  2VQE I;  4DV5 E;  5DRQ A;  1Z5C A;  2HKJ A;  2GO4 A;  4LFB I;  4JI4 I;  3PYF A;  2X36 A;  4LFC E;  4ED4 A;  2VQF I;  4OO1 D;  1N36 I;  5JEA F;  4BA1 B;  4LF6 E;  1BKN A;  1OJ4 A;  5C0X D;  2V8P A;  1KVK A;  1YH8 A;  5JEA A;  2UUA I;  4DV7 E;  4DV6 I;  4LFA I;  1N34 E;  2PNM A;  5IT9 Q;  1IBK I;  4LPF A;  3OTO E;  4KHP E;  2BV3 A;  4FWD A;  4LCF A;  4HAC A;  2NN6 D;  5K36 F;  2BR2 B;  2WNR B;  3L7Z B;  1ZXN A;  4LF9 E;  3K17 A;  4DR5 I;  5K36 A;  2WP8 A;  2OI2 A;  1E3H A;  1N32 I;  4OX9 I;  1QZR A;  2EFG A;  4WUB A;  3CDI A;  1OYS A;  4NXN I;  1KTV A;  4J3D A;  3KRN A;  1IBM I;  1Z0V A;  2ZIT A;  3PRY A;  2R3V A;  2R42 A;  2Q2E B;  4NXM I;  1VI7 A;  1A6F A;  4B3R E;  4I3H A;  2BA1 G;  4YY3 I;  4WUD A;  2BM0 A;  4GKJ I;  1Z0C A;  4B3M E;  4DPU A;  1ZM4 A;  1USV A;  1H74 A;  2Z5B B;  3QT7 A;  1DAR A;  2BA1 D;  4X66 I;  4OO1 E;  1OYP A;  2NN6 B;  2XEX A;  2AE8 A;  3LPS A;  4DR4 E;  3M6A A;  4JI2 I;  3K1J A;  3PS1 A;  4LF4 I;  2BA0 G;  1H73 A;  4DR3 I;  4DV4 E;  1ZM9 A;  2CVE A;  3JAM C;  2JEB B;  2BM1 A;  4LF8 E;  2BA0 D;  1KKH A;  2NN6 E;  4JV5 I;  3V2U C;  4JI8 E;  5LMN E;  1S4E A;  4DV1 E;  1XMO E;  3LTO A;  2HHH I;  4AM3 A;  4FWH A;  1MX0 A;  4GQU A;  3H4L A;  4IZJ A;  5C0X F;  2NPF A;  1UDQ A;  3HUL A;  2JEA A;  3PYE A;  4IS9 A;  4X64 I;  1I94 E;  1PIE A;  2GQ0 A;  1Z5A A;  4IFD F;  3HJC A;  5A2Q C;  2PNL A;  2WW4 A;  2NN6 C;  4DUZ E;  1N33 I;  4DR7 E;  1RHY A;  5LMU E;  2F4V I;  4IFD A;  2F1D A;  4HXZ A;  3WU6 A;  4IZK A;  2O1V A;  1PVG A;  3DD6 A;  2A2C A;  2F4V E;  3Q6M A;  1HR0 I;  3WU5 A;  4LF5 I;  4NBQ A;  2HFU A;  1FJG I;  4LCH A;  3B78 A;  1RR9 A;  4DR2 I;  4HAC B;  2VQE E;  4R1F A;  1HNZ I;  4PRX A;  4LCG A;  3PYG A;  2UU9 I;  2Z5C A;  4LFB E;  3J81 C;  4JI4 E;  1XNR I;  2PNZ A;  4MQY A;  4U3D A;  4DV2 I;  2VQF E;  2V2Z A;  1N36 E;  2O1T A;  4YHH I;  4JI0 I;  1H7U A;  4MDT A;  2PO1 A;  3QT8 A;  1XMQ I;  2V2Q A;  2UUA E;  1FWL A;  4DV6 E;  4LFA E;  1FNM A;  1IBK E;  2DEJ A;  2JE6 B;  2CZ9 A;  2C38 A;  4JG4 A;  2GS8 A;  5L3J A;  3Q1Q A;  4MU1 A;  4DPT A;  5DNX A;  1Y6Z A;  4DR5 E;  1KIJ A;  2O3Z A;  4FW5 A;  2UXD I;  4HY1 A;  3J7A M;  4DV3 I;  2V34 A;  4P7A A;  5DRP A;  4AQY I;  1N32 E;  4OX9 E;  1XXE A;  4DR1 I;  4JI6 I;  3HKM A;  1Z59 A;  4HYM A;  1NHI A;  4USK A;  4NXN E;  4PU9 A;  1IBL I;  3GCM A;  1IBM E;  4MU4 A;  5LL6 R;  2DEI A;  3P3C A;  3GME A;  4BA1 A;  4NXM E;  1B63 A;  1FKA E;  2E5L I;  1PKP A;  4DU8 A;  3M85 G;  3B4T A;  4MYU A;  4YY3 E;  2UXC I;  1WUU A;  4GKJ E;  3LNU A;  4B3S I;  4N3O A;  3M85 D;  3P3G A;  4X66 E;  2WNR A;  4JI1 I;  3JAM Q;  2HK3 A;  3WU3 A;  3Q6N A;  2C39 B;  4JI2 E;  2O1W A;  4LF4 E;  4OZE A;  5JEA D;  4DR3 E;  4JI3 I;  5DNL A;  4UTG A;  1H72 C;  1Z5B A;  1R6L A;  1XNQ I;  3GLL A;  3NZK A;  2UUB I;  4LF7 I;  3ZKB A;  4JI3 E;  4QNK A;  4OO1 F;  4JV5 E;  4DU7 A;  5EKW A;  5IWA I;  1N0U A;  1FI4 A;  1RRE A;  3T1H I;  1J5E I;  4JI5 I;  1MG7 A;  5K36 D;  2C37 A;  4OO1 A;  4Z7Y A;  2HHH E;  2CG9 A;  3UHM A;  3T1Y I;  4GKK I;  1R6M A;  3J7A G;  5C0X A;  5A2Q Q;  2ZM6 I;  4JI7 I;  4X62 I;  2NN6 F;  2IOP A;  4X64 E;  2UUC I;  4RPF A;  2Z5C B;  4DUY I;  2Z5B A;  2E1R A;  5DRR A;  2PNZ B;  4DV0 I;  1HNX I;  4JYA I;  4K0K I;  1UEK A;  1N33 E;  2UXB I;  1HK7 A;  1Z0B A;  5JEA B;  3B82 A;  4BA2 A;  1HR0 E;  2UXB E;  3ZKD A;  2JEB A;  3V5R A;  4LOM A;  4LF5 E;  1K47 A;  1EA6 A;  2HKE A;  2C38 B;  3U1Y A;  4URL A;  1FJG E;  1HNW I;  3J81 Q;  4DR2 E;  3ZZT A;  5K36 B;  2WP8 B;  5JEA E;  1HNZ E;  4Z7C A;  4DR6 I;  2UU9 E;  4DV5 I;  4FW7 A;  4FWG A;  2VES A;  1XNR E;  4U3B A;  1P42 A;  2O1U A;  3P3E A;  4DV2 E;  1UDO A;  4USM A;  1Y4U A;  4PRV A;  2PO2 A;  4LFC I;  5K36 E;  4DPW A;  2IER A;  2A2D A;  1ELO A;  4YHH E;  1NHJ A;  1FWK A;  4JI0 E;  2ZBK B;  2IES A;  4IZJ D;  4LF6 I;  1XMQ E;  1EI1 A;  4DV7 I;  5ELW A;  5JEA C;  1N34 I;  3GON A;  4EMD A;  4DPY A;  4ISA A;  4KHP I;  3OTO I;  1Z0G A;  2J7K A;  1D6T A;  1E3P A;  2PO0 A;  2JT2 A;  2UXD E;  5IT9 C;  5FLX Q;  4IFD D;  4LF9 I;  1Y4S A;  5GMD A;  3M7N G;  5FLX C;  4DV3 E;  3ZZ0 A;  4AQY E;  4MU0 A;  4FW3 A;  3K85 A;  5K36 C;  4OKG A;  4DR1 E;  4JI6 E;  3M7N D;  3PS2 A;  1Z0T A;  3H1C A;  1Z0W A;  1IBL E;  4KQV A;  2CGE A;  3PYD A;  2VF3 A;  1NHH A;  4ZVI A;  5EL9 A;  3P06 A;  2E5L E;  2V2V A;  4XTJ A;  2HK2 A;  1Y60 A;  4IZJ B;  2C37 B;  4OO1 B;  2UXC E;  1UDN A;  3F0N A;  4FW4 A;  4B3R I;  2JEA B;  2BR2 A;  3L7Z A;  1N0V C;  4B3S E;  2JE6 A;  4M1K A;  4B3M I;  5C0X B;  1NZ0 A;  1Z0E A;  2AJ4 A;  5DRO A;  3D4J A;  4JI1 E;  5FWK A;  4QNJ A;  4MYT A;  4DR4 I;  3WU4 A;  4IFD B;  2LJP A;  4B3T I;  4AID A;  4IZK B;  1ZM3 A;  1XNQ E;  4AIM A;  4DV4 I;  2UUB E;  3B8H A;  4LF7 E;  5C0X E;  4B3T E;  1H7S A;  4LF8 I;  4MU3 A;  2J65 A;  4BA2 B;  3PS3 A;  5IWA E;  2Z5E A;  1XHK A;  3T1H E;  4JI8 I;  5LMN I;  1J5E E;  4JI5 E;  4IFD E;  4DV1 I;  1Y5Y A;  1YHC A;  1ZXM A;  3QT6 A;  4WUC A;  3T1Y E;  1XMO I;  4GKK E;  4FW9 A;  3U1K A;  1VIS A;  2ZM6 E;  4JI7 E;  4X62 E;  3ZZU A;  4X65 I;  2HFS A;  2NN6 A;  2UUC E;  4OO1 C;  2GO3 A;  1I94 I;  4DUY E;  4X65 E;  5C0X C;  1HNX E;  4DV0 E;  4JYA E;  4K0K E;  4DPX A;  4DUZ I;  3CDJ A;  2C39 A;  3ZM7 A;  2PO2 B;  2PO1 B;  4DR7 I;  5LMU I;  1U2R A;  2X7I A;  5GME A;  4IFD C;  1S16 A;  4UT4 A;  4FN5 A;  3P76 A;  4DXL A;  1USU A;  3CWV A;  4FW6 A;  5BR8 I; 
#chains in the Genus database with same CATH homology
 1HNW E;  3J80 Q;  3QT5 A;  1B62 A;  1MU5 A;  3J80 C;  5BR8 E;  4P52 A;  1ZM2 A;  2IOQ A;  4DR6 E;  2VQE I;  4DV5 E;  1Z5C A;  2HKJ A;  4LFB I;  4JI4 I;  3PYF A;  2X36 A;  4LFC E;  4ED4 A;  2VQF I;  1N36 I;  4LF6 E;  1BKN A;  1OJ4 A;  2V8P A;  1KVK A;  2UUA I;  4DV7 E;  4DV6 I;  4LFA I;  1N34 E;  2PNM A;  5IT9 Q;  1IBK I;  4KHP E;  3OTO E;  2BV3 A;  4FWD A;  4HAC A;  1ZXN A;  4LF9 E;  3K17 A;  4DR5 I;  2OI2 A;  1N32 I;  4OX9 I;  1QZR A;  2EFG A;  4WUB A;  4NXN I;  1KTV A;  1IBM I;  1Z0V A;  2ZIT A;  3PRY A;  2R3V A;  2R42 A;  2Q2E B;  4NXM I;  1A6F A;  4B3R E;  4I3H A;  4YY3 I;  4WUD A;  2BM0 A;  4GKJ I;  1Z0C A;  4B3M E;  4DPU A;  1ZM4 A;  1USV A;  1H74 A;  2Z5B B;  3QT7 A;  1DAR A;  4X66 I;  2XEX A;  3LPS A;  4DR4 E;  3M6A A;  4JI2 I;  3K1J A;  4LF4 I;  1H73 A;  4DR3 I;  4DV4 E;  1ZM9 A;  3JAM C;  2BM1 A;  4LF8 E;  1KKH A;  4JV5 I;  3V2U C;  4JI8 E;  5LMN E;  1S4E A;  4DV1 E;  1XMO E;  3LTO A;  2HHH I;  4FWH A;  1MX0 A;  3H4L A;  4IZJ A;  2NPF A;  3HUL A;  3PYE A;  4X64 I;  1I94 E;  1PIE A;  2GQ0 A;  1Z5A A;  3HJC A;  5A2Q C;  2PNL A;  2WW4 A;  4DUZ E;  1N33 I;  4DR7 E;  5LMU E;  2F4V I;  4HXZ A;  3WU6 A;  4IZK A;  2O1V A;  1PVG A;  2A2C A;  2F4V E;  3Q6M A;  1HR0 I;  3WU5 A;  4LF5 I;  2HFU A;  1FJG I;  3B78 A;  1RR9 A;  4DR2 I;  4HAC B;  2VQE E;  4R1F A;  1HNZ I;  4PRX A;  2UU9 I;  3PYG A;  2Z5C A;  4LFB E;  3J81 C;  4JI4 E;  1XNR I;  4DV2 I;  2VQF E;  2V2Z A;  1N36 E;  2O1T A;  4YHH I;  4JI0 I;  1H7U A;  3QT8 A;  1XMQ I;  2V2Q A;  2UUA E;  1FWL A;  4DV6 E;  4LFA E;  1FNM A;  1IBK E;  2DEJ A;  4JG4 A;  2CZ9 A;  2GS8 A;  5L3J A;  3Q1Q A;  4DPT A;  1Y6Z A;  4DR5 E;  1KIJ A;  2UXD I;  4HY1 A;  3J7A M;  4DV3 I;  2V34 A;  4P7A A;  4AQY I;  1N32 E;  4OX9 E;  4DR1 I;  4JI6 I;  1Z59 A;  4HYM A;  1NHI A;  4USK A;  4NXN E;  4PU9 A;  1IBL I;  1IBM E;  5LL6 R;  2DEI A;  4NXM E;  1B63 A;  1FKA E;  2E5L I;  1PKP A;  4DU8 A;  4MYU A;  4YY3 E;  2UXC I;  1WUU A;  4GKJ E;  3LNU A;  4B3S I;  4N3O A;  4X66 E;  4JI1 I;  3JAM Q;  2HK3 A;  3WU3 A;  3Q6N A;  4JI2 E;  2O1W A;  4LF4 E;  4DR3 E;  4JI3 I;  4UTG A;  1H72 C;  1Z5B A;  1XNQ I;  2UUB I;  4LF7 I;  3ZKB A;  4JI3 E;  4JV5 E;  4DU7 A;  5IWA I;  1N0U A;  1FI4 A;  1RRE A;  3T1H I;  1J5E I;  4JI5 I;  1MG7 A;  4Z7Y A;  2HHH E;  2CG9 A;  3T1Y I;  4GKK I;  3J7A G;  5A2Q Q;  2ZM6 I;  4JI7 I;  4X62 I;  2IOP A;  4X64 E;  2UUC I;  4RPF A;  2Z5C B;  4DUY I;  2Z5B A;  2E1R A;  1HNX I;  4DV0 I;  4JYA I;  4K0K I;  1UEK A;  1N33 E;  2UXB I;  1HK7 A;  1Z0B A;  3B82 A;  1HR0 E;  2UXB E;  3ZKD A;  3V5R A;  4LF5 E;  1K47 A;  1EA6 A;  2HKE A;  4URL A;  1FJG E;  1HNW I;  3J81 Q;  4DR2 E;  3ZZT A;  1HNZ E;  4Z7C A;  4DR6 I;  2UU9 E;  4DV5 I;  4FWG A;  1XNR E;  2O1U A;  4DV2 E;  4USM A;  1Y4U A;  4PRV A;  4LFC I;  4DPW A;  2A2D A;  1ELO A;  4YHH E;  1NHJ A;  1FWK A;  4JI0 E;  2ZBK B;  4IZJ D;  4LF6 I;  1XMQ E;  1EI1 A;  4DV7 I;  1N34 I;  3GON A;  4EMD A;  4DPY A;  4KHP I;  3OTO I;  1Z0G A;  2J7K A;  1D6T A;  2UXD E;  5IT9 C;  5FLX Q;  4LF9 I;  1Y4S A;  5GMD A;  5FLX C;  4DV3 E;  3ZZ0 A;  4AQY E;  3K85 A;  4DR1 E;  4JI6 E;  1Z0T A;  1Z0W A;  1IBL E;  4KQV A;  2CGE A;  3PYD A;  2VF3 A;  1NHH A;  4ZVI A;  3P06 A;  2E5L E;  2V2V A;  4XTJ A;  2HK2 A;  4IZJ B;  2UXC E;  3F0N A;  4B3R I;  1N0V C;  4B3S E;  4M1K A;  4B3M I;  1NZ0 A;  1Z0E A;  2AJ4 A;  3D4J A;  4JI1 E;  5FWK A;  4MYT A;  4DR4 I;  3WU4 A;  2LJP A;  4B3T I;  4IZK B;  1ZM3 A;  1XNQ E;  4DV4 I;  2UUB E;  3B8H A;  4LF7 E;  4B3T E;  1H7S A;  4LF8 I;  5IWA E;  2Z5E A;  1XHK A;  3T1H E;  4JI8 I;  5LMN I;  1J5E E;  4JI5 E;  4DV1 I;  4WUC A;  1ZXM A;  3T1Y E;  1XMO I;  3QT6 A;  4GKK E;  4FW9 A;  1VIS A;  2ZM6 E;  4JI7 E;  4X62 E;  3ZZU A;  4X65 I;  2HFS A;  2UUC E;  1I94 I;  4DUY E;  4X65 E;  1HNX E;  4DV0 E;  4JYA E;  4K0K E;  4DPX A;  4DUZ I;  3ZM7 A;  4DR7 I;  5LMU I;  1U2R A;  2X7I A;  5GME A;  1S16 A;  4UT4 A;  4FN5 A;  4DXL A;  1USU A;  3CWV A;  5BR8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...