4JG4A

Ligand concentration regulates the pathways of coupled protein folding and binding
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
AHLKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQAENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKAASQLTYEETKKSLQHLWRKSSLYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component
publication title Ligand concentration regulates the pathways of coupled protein folding and binding.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 37
structure length 114
sequence length 114
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jg4A00
2R42A 2UXCE 4JI7I 2BV3A 1VISA 2LJPA 2ZITA 4FN5A 1B63A 4X66I 4JI0I 4ED4A 4B3TI 4HYMA 4DV5I 4Z7YA 4DR1E 5IT9Q 2DEJA 4LF6E 2Q2EB 4WUDA 1KVKA 2A2CA 1QZRA 5A2QC 3PYDA 1I94I 2J7KA 2ZM6I 5IWAE 1H73A 1Z0BA 4LFAE 3ZZTA 4Z7CA 4HACB 5GMDA 3J7AM 3ZM7A 1IBLI 4LFBI 2UUAE 4DPYA 3QT6A 4DV6E 3J80Q 1FJGI 4MYUA 1H72C 2ZBKB 2UU9I 5FLXQ 4DR5I 3WU4A 1N33I 1XMOI 4JI6I 4DUYE 1MG7A 1PVGA 4UTGA 2E5LI 3J7AG 3T1HI 2HHHE 4X64I 4DV1E 4DV2I 4LF9I 1RR9A 2HFSA 1FWLA 3QT5A 1FI4A 4B3ME 4DR3E 1H7SA 4X65I 4YY3I 4NXMI 1HNZI 4DV0I 4JI1I 4DV4E 3J81C 4DUZE 1K47A 4DR6E 2UXDI 1HNXE 4URLA 1FKAE 4DV7I 4B3SI 1XNRE 2UUCE 3ZZUA 1N36E 4GKJE 4B3RI 4K0KI 1HR0E 1FJGE 2VQFE 3B78A 2E1RA 2V34A 1N0UA 2OI2A 2XEXA 1NHHA 2V8PA 1N32E 1Z0WA 4LF7I 4FWHA 4LFCE 1FNMA 2X7IA 5A2QQ 4LF4I 1N0VC 2DEIA 1RREA 1Z59A 5BR8I 4OX9E 4DPTA 2BM1A 1H74A 2HKJA 4JI5I 1PIEA 4X62I 1WUUA 1J5EE 4JV5E 1N34E 4FW9A 4LF8I 4JI2E 5GMEA 4DR4I 4LF5E 1ELOA 4P7AA 4JI4I 2UXBI 4PRXA 4YHHI 4AQYI 4PRVA 4JYAI 4USKA 4NXNI 4FWDA 5L3JA 4KHPE 2F4VE 2UUBI 4DU8A 1XNQI 2V2QA 4HXZA 3J81Q 4GKKI 4DR7I 3D4JA 3WU6A 1MU5A 1HNWE 4WUBA 4KQVA 4DPXA 1Z0CA 4JI7E 1IBKI 2GS8A 2VQEI 5LMUI 3K17A 3T1YI 4JI3I 1Z5AA 3QT7A 4X66E 2WW4A 4JI0E 3V5RA 3F0NA 4B3TE 4DV5E 1EI1A 4JI8I 4DV3I 2BM0A 1IBMI 1U2RA 1XMQI 5LL6R 1I94E 1MX0A 2ZM6E 1BKNA 1UEKA 2HFUA 5LMNI 1NHIA 3OTOI 1KTVA 4DR2I 1IBLE 4LFBE 2UXCI 3LPSA 2UU9E 4DR5E 1N33E 2R3VA 1XMOE 4JI6E 4DR1I 2E5LE 4LF6I 3T1HE 3B82A 3PYFA 4X64E 4DV2E 4LF9E 3JAMC 2EFGA 1ZM4A 3ZKDA 3PYGA 4X65E 4YY3E 4NXME 5IWAI 1HNZE 3V2UC 4DV0E 4JI1E 4LFAI 1ZM2A 3LNUA 3CWVA 4HY1A 2UUAI 4HACA 2UXDE 4DV7E 4B3SE 1KIJA 4DV6I 1PKPA 1H7UA 4JG4A 4B3RE 4K0KE 4RPFA 4DUYI 4USMA 1ZXMA 2V2VA 2HHHI 4DXLA 4ZVIA 4DU7A 3M6AA 4DV1I 4MYTA 3H4LA 3QT8A 4WUCA 1Z5CA 4B3MI 3B8HA 4DR3I 1ZM3A 4LF7E 4P52A 4LF4E 4DV4I 4R1FA 1Z0TA 1XHKA 4DUZI 1B62A 4DPWA 2HK3A 4DR6I 2HKEA 1HNXI 2HK2A 1Z5BA 4M1KA 5BR8E 2V2ZA 1KKHA 1Z0VA 1XNRI 2UUCI 1ZXNA 3Q1QA 1N36I 1OJ4A 2A2DA 4JI5E 4GKJI 4X62E 3WU5A 4DPUA 1HR0I 4XTJA 2VQFI 4FWGA 1Z0EA 5IT9C 2VF3A 1S4EA 4LF8E 4DR4E 4JI4E 2UXBE 4YHHE 4EMDA 4AQYE 1N32I 4JYAE 4LFCI 3JAMQ 1A6FA 2AJ4A 1NZ0A 4NXNE 2UUBE 1XNQE 4UT4A 1Z0GA 2NPFA 4GKKE 4DR7E 2X36A 1FWKA 4OX9I 3J80C 1EA6A 1IBKE 2VQEE 5FLXC 3ZZ0A 5LMUE 1J5EI 3T1YE 4JI3E 4JV5I 1D6TA 3PYEA 1N34I 3GONA 4PU9A 1S16A 1ZM9A 4I3HA 4JI2I 4LF5I 3ZKBA 3LTOA 1NHJA 4JI8E 4DV3E 3WU3A 1IBME 2CZ9A 1XMQE 3HULA 3K1JA 4KHPI 2F4VI 5LMNE 3OTOE 1DARA 4DR2E 1HNWI
chains in the Genus database with same CATH superfamily
2O1WA 2R42A 2UXCE 4JI7I 4BA1B 2BV3A 1VISA 2LJPA 2ZITA 4OO1C 4FW5A 1UDQA 2BA0D 1B63A 4FN5A 3M85D 4X66I 2BA0G 4JI0I 4ED4A 4B3TI 1UDSA 3NZKA 4HYMA 4DV5I 3HJCA 4Z7YA 4DR1E 5IT9Q 2DEJA 4LF6E 2Q2EB 4WUDA 1KVKA 2A2CA 1QZRA 2CGEA 2GQ0A 5A2QC 2CVEA 3PYDA 1I94I 2J7KA 5JEAD 2ZM6I 5IWAE 4MU3A 1H73A 1Z0BA 2PO2B 4LFAE 1YHCA 3ZZTA 4Z7CA 4HACB 5GMDA 3J7AM 3ZM7A 4FW7A 1IBLI 4LFBI 2UUAE 4DPYA 1XXEA 3QT6A 5JEAC 4GQUA 4DV6E 3J80Q 2WNRA 1FJGI 3HKMA 4MYUA 3L7ZA 1H72C 2NN6C 2ZBKB 5FLXQ 2UU9I 4DR5I 3WU4A 1N33I 1R6LA 1XMOI 4JI6I 4DUYE 1MG7A 1PVGA 5DROA 4UTGA 2E5LI 3J7AG 3T1HI 2HHHE 5JEAA 5DNXA 4X64I 4DV1E 4DV2I 4LF9I 1RR9A 2HFSA 1FWLA 3QT5A 2IESA 1FI4A 4B3ME 2NN6A 4DR3E 1H7SA 2C38A 4X65I 4YY3I 4NXMI 1HNZI 4DV0I 4JI1I 2PNZB 4DV4E 3J81C 4DUZE 2BA1D 4IZJA 4BA2A 1K47A 4DR6E 2UXDI 1HNXE 4URLA 1FKAE 4IFDD 4DV7I 4B3SI 3M7ND 1XNRE 2UUCE 3M7NG 3ZZUA 1N36E 4GKJE 4LPFA 4B3RI 3L7ZB 4K0KI 1HR0E 1FJGE 4OO1F 4IS9A 2VQFE 3B78A 2E1RA 2V34A 1N0UA 2OI2A 2XEXA 1NHHA 3GLLA 3U1KA 2V8PA 1N32E 1Z0WA 4LCHA 4FWHA 4LF7I 4LFCE 1FNMA 2BR2B 2GO3A 2X7IA 5A2QQ 4LF4I 5K36C 1Y4UA 2NN6B 2C38B 3CDJA 1N0VC 2DEIA 2PO1A 1RREA 1Z59A 2C39A 5BR8I 5DRQA 4IZJB 4OX9E 4DPTA 2CG9A 2BM1A 1H74A 3M85G 2HKJA 4JI5I 5K36A 1PIEA 4X62I 1WUUA 3B4TA 5JEAF 2C37A 1J5EE 4JV5E 1N34E 3H1CA 2NN6F 5C0XD 4AM3A 4FW9A 4LF8I 4JI2E 4OO1A 5GMEA 2JEAB 4DR4I 4LF5E 1ELOA 4P7AA 4JI4I 4MU4A 2UXBI 4PRXA 4YHHI 4AQYI 4PRVA 4JYAI 4AIMA 4USKA 4NXNI 1E3HA 4FWDA 2PO0A 5L3JA 5C0XC 4KHPE 2F4VE 2UUBI 4DU8A 1XNQI 2V2QA 1VI7A 4HXZA 3J81Q 4GKKI 4DR7I 1UDNA 3D4JA 2PO1B 4OZEA 3WU6A 1MU5A 2C39B 1HNWE 4WUBA 4KQVA 4DPXA 1Z0CA 4JI7E 3DD6A 1IBKI 1OYSA 2GS8A 2VESA 2VQEI 5C0XA 2JEBA 5LMUI 3K17A 3T1YI 4JI3I 1Z5AA 3QT7A 4MDTA 4X66E 2WW4A 4JI0E 2C37B 3V5RA 3F0NA 4B3TE 4AIDA 4DV5E 1EI1A 2Z5EA 4JI8I 2JT2A 3PS3A 4DV3I 2BM0A 2WP8A 4OO1B 1UDOA 1IBMI 2Z5BA 1U2RA 1XMQI 5LL6R 2PNMA 3PRYA 1I94E 2BA1G 1MX0A 2ZM6E 3Q6NA 1BKNA 1UEKA 2HFUA 3Q6MA 2PO0B 1NHIA 5LMNI 3OTOI 2NN6E 1KTVA 2IOQA 5K36F 3U1YA 4DR2I 1IBLE 4LFBE 2UXCI 2WNRB 1OYPA 1OYRA 3LPSA 4MQYA 3CDIA 4MU1A 4IFDC 2UU9E 2JEBB 2O3ZA 4DR5E 1N33E 2R3VA 1XMOE 4JI6E 4FW6A 4FW3A 3P76A 4ISAA 4DR1I 5JEAB 2E5LE 4LF6I 3T1HE 3B82A 4IZKA 3PYFA 4X64E 4FW4A 4DV2E 4LF9E 3JAMC 2WP8B 1Y60A 2EFGA 1ZM4A 2J65A 3ZKDA 4IFDA 3PYGA 1P42A 4X65E 2Z5BB 4YY3E 4NXME 5IWAI 1HNZE 3V2UC 4DV0E 4JI1E 3PS1A 3PS2A 1R6MA 4LFAI 4U3BA 1HK7A 4BA2B 1ZM2A 5C0XF 3LNUA 3CWVA 4HY1A 2UUAI 4HACA 2IOPA 2UXDE 4MU0A 4LOMA 4DV7E 4B3SE 1KIJA 4DV6I 2JE6A 1PKPA 4N3OA 1H7UA 4JG4A 4B3RE 4K0KE 4RPFA 4DUYI 4USMA 5K36E 1ZXMA 2V2VA 1RHYA 2HHHI 4DXLA 4ZVIA 3K85A 4DU7A 3M6AA 4DV1I 5DRPA 4MYTA 3H4LA 3QT8A 4WUCA 1Z5CA 4B3MI 4IZKB 3B8HA 4DR3I 1ZM3A 2O1VA 3P3CA 4OO1E 4LF7E 4P52A 4QNJA 4LF4E 4DV4I 4IFDB 4R1FA 1Z0TA 2PNZA 1XHKA 4DUZI 1B62A 4DPWA 2HK3A 4DR6I 2HKEA 5ELWA 1HNXI 2HK2A 1Z5BA 4M1KA 5BR8E 2NN6D 3GMEA 2V2ZA 1KKHA 1Z0VA 1XNRI 2UUCI 1ZXNA 1Y6ZA 3Q1QA 5K36B 1N36I 1OJ4A 2A2DA 4JI5E 4GKJI 4X62E 3WU5A 2JE6B 1YH8A 4DPUA 4IZJD 1HR0I 4XTJA 5C0XE 2VQFI 4FWGA 4IFDF 1Z0EA 5IT9C 2VF3A 1S4EA 3P3EA 4LF8E 4QNKA 4DR4E 2PNLA 2O1TA 5JEAE 4JI4E 2UXBE 2Z5CA 4YHHE 4EMDA 4AQYE 1N32I 4JYAE 4LFCI 2F1DA 3JAMQ 1A6FA 2AJ4A 4LCGA 5EKWA 1NZ0A 3KRNA 4NXNE 2BR2A 2UUBE 5DNLA 4NBQA 1XNQE 4UT4A 1Z0GA 2NPFA 4GKKE 4DR7E 2X36A 1FWKA 4BA1A 4OX9I 1USUA 3J80C 5C0XB 1EA6A 1IBKE 2VQEE 5FLXC 1Y4SA 3ZZ0A 5LMUE 1J5EI 3T1YE 4JI3E 4JV5I 1D6TA 3PYEA 1N34I 3GONA 4PU9A 1S16A 1ZM9A 2O1UA 4I3HA 2GO4A 3UHMA 4JI2I 2IERA 1Y5YA 5EL9A 4LF5I 3ZKBA 3LTOA 1NHJA 4JI8E 5K36D 4DV3E 3P3GA 3GCMA 2JEAA 3P06A 3WU3A 4OKGA 1IBME 2Z5CB 2CZ9A 1XMQE 3HULA 3K1JA 4KHPI 2PO2A 2F4VI 5DRRA 4U3DA 4OO1D 5LMNE 5FWKA 4IFDE 3OTOE 2AE8A 4LCFA 1E3PA 1DARA 4DR2E 1HNWI 1USVA 4J3DA
chains in the Genus database with same CATH topology
2O1WA 2R42A 2UXCE 4JI7I 2BV3A 1VISA 2LJPA 2ZITA 4FN5A 1B63A 4X66I 4JI0I 4ED4A 4B3TI 4HYMA 4DV5I 3HJCA 4Z7YA 4DR1E 5IT9Q 2DEJA 4LF6E 2Q2EB 4WUDA 1KVKA 2A2CA 1QZRA 2CGEA 2GQ0A 5A2QC 3PYDA 1I94I 2J7KA 2ZM6I 5IWAE 1H73A 1Z0BA 4LFAE 3ZZTA 4Z7CA 4HACB 5GMDA 3J7AM 3ZM7A 1IBLI 4LFBI 2UUAE 4DPYA 3QT6A 4DV6E 3J80Q 1FJGI 4MYUA 1H72C 2ZBKB 5FLXQ 2UU9I 4DR5I 3WU4A 1N33I 1XMOI 4JI6I 4DUYE 1MG7A 1PVGA 4UTGA 2E5LI 3J7AG 3T1HI 2HHHE 4X64I 4DV1E 4DV2I 4LF9I 1RR9A 2HFSA 1FWLA 3QT5A 1FI4A 4B3ME 4DR3E 1H7SA 4X65I 4YY3I 4NXMI 1HNZI 4DV0I 4JI1I 4DV4E 3J81C 4DUZE 4IZJA 1K47A 4DR6E 2UXDI 1HNXE 4URLA 1FKAE 4DV7I 4B3SI 1XNRE 2UUCE 3ZZUA 1N36E 4GKJE 4B3RI 4K0KI 1HR0E 1FJGE 2VQFE 3B78A 2E1RA 2V34A 1N0UA 2OI2A 2XEXA 1NHHA 2V8PA 1N32E 1Z0WA 4LF7I 4FWHA 4LFCE 1FNMA 2X7IA 5A2QQ 4LF4I 1Y4UA 1N0VC 2DEIA 1RREA 1Z59A 5BR8I 4IZJB 4OX9E 4DPTA 2CG9A 2BM1A 1H74A 2HKJA 4JI5I 1PIEA 4X62I 1WUUA 1J5EE 4JV5E 1N34E 4FW9A 4LF8I 4JI2E 5GMEA 4DR4I 4LF5E 1ELOA 4P7AA 4JI4I 2UXBI 4PRXA 4YHHI 4AQYI 4PRVA 4JYAI 4USKA 4NXNI 4FWDA 5L3JA 4KHPE 2F4VE 2UUBI 4DU8A 1XNQI 2V2QA 4HXZA 3J81Q 4GKKI 4DR7I 3D4JA 3WU6A 1MU5A 1HNWE 4WUBA 4KQVA 4DPXA 1Z0CA 4JI7E 1IBKI 2GS8A 2VQEI 5LMUI 3K17A 3T1YI 4JI3I 1Z5AA 3QT7A 4X66E 2WW4A 4JI0E 3V5RA 3F0NA 4B3TE 4DV5E 1EI1A 2Z5EA 4JI8I 4DV3I 2BM0A 1IBMI 2Z5BA 1U2RA 1XMQI 5LL6R 2PNMA 3PRYA 1I94E 1MX0A 2ZM6E 3Q6NA 1BKNA 1UEKA 2HFUA 3Q6MA 5LMNI 1NHIA 3OTOI 1KTVA 2IOQA 4DR2I 1IBLE 4LFBE 2UXCI 3LPSA 2UU9E 4DR5E 1N33E 2R3VA 1XMOE 4JI6E 4DR1I 2E5LE 4LF6I 3T1HE 3B82A 4IZKA 3PYFA 4X64E 4DV2E 4LF9E 3JAMC 2EFGA 1ZM4A 3ZKDA 3PYGA 4X65E 2Z5BB 4YY3E 4NXME 5IWAI 1HNZE 3V2UC 4DV0E 4JI1E 4LFAI 1HK7A 1ZM2A 3LNUA 3CWVA 4HY1A 2UUAI 4HACA 2IOPA 2UXDE 4DV7E 4B3SE 1KIJA 4DV6I 1PKPA 4N3OA 1H7UA 4JG4A 4B3RE 4K0KE 4RPFA 4DUYI 4USMA 1ZXMA 2V2VA 2HHHI 4DXLA 4ZVIA 3K85A 4DU7A 3M6AA 4DV1I 4MYTA 3H4LA 3QT8A 4WUCA 1Z5CA 4B3MI 4IZKB 3B8HA 4DR3I 1ZM3A 2O1VA 4LF7E 4P52A 4LF4E 4DV4I 4R1FA 1Z0TA 1XHKA 4DUZI 1B62A 4DPWA 2HK3A 4DR6I 2HKEA 1HNXI 2HK2A 1Z5BA 4M1KA 5BR8E 2V2ZA 1KKHA 1Z0VA 1XNRI 2UUCI 1ZXNA 1Y6ZA 3Q1QA 1N36I 1OJ4A 2A2DA 4JI5E 4GKJI 4X62E 3WU5A 4DPUA 4IZJD 1HR0I 4XTJA 2VQFI 4FWGA 1Z0EA 5IT9C 2VF3A 1S4EA 4LF8E 4DR4E 2PNLA 2O1TA 4JI4E 2UXBE 2Z5CA 4YHHE 4EMDA 4AQYE 1N32I 4JYAE 4LFCI 3JAMQ 1A6FA 2AJ4A 1NZ0A 4NXNE 2UUBE 1XNQE 4UT4A 1Z0GA 2NPFA 4GKKE 4DR7E 2X36A 1FWKA 4OX9I 1USUA 3J80C 1EA6A 1IBKE 2VQEE 5FLXC 1Y4SA 3ZZ0A 5LMUE 1J5EI 3T1YE 4JI3E 4JV5I 1D6TA 3PYEA 1N34I 3GONA 4PU9A 1S16A 1ZM9A 2O1UA 4I3HA 4JI2I 4LF5I 3ZKBA 3LTOA 1NHJA 4JI8E 4DV3E 3P06A 3WU3A 1IBME 2Z5CB 2CZ9A 1XMQE 3HULA 3K1JA 4KHPI 2F4VI 5LMNE 5FWKA 3OTOE 1DARA 4DR2E 1HNWI 1USVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R42 A;  2UXC E;  4JI7 I;  2BV3 A;  1VIS A;  2LJP A;  2ZIT A;  4FN5 A;  1B63 A;  4X66 I;  4JI0 I;  4ED4 A;  4B3T I;  4HYM A;  4DV5 I;  4Z7Y A;  4DR1 E;  5IT9 Q;  2DEJ A;  4LF6 E;  2Q2E B;  4WUD A;  1KVK A;  2A2C A;  1QZR A;  5A2Q C;  3PYD A;  1I94 I;  2J7K A;  2ZM6 I;  5IWA E;  1H73 A;  1Z0B A;  4LFA E;  3ZZT A;  4Z7C A;  4HAC B;  5GMD A;  3J7A M;  3ZM7 A;  1IBL I;  4LFB I;  2UUA E;  4DPY A;  3QT6 A;  4DV6 E;  3J80 Q;  1FJG I;  4MYU A;  1H72 C;  2ZBK B;  2UU9 I;  5FLX Q;  4DR5 I;  3WU4 A;  1N33 I;  1XMO I;  4JI6 I;  4DUY E;  1MG7 A;  1PVG A;  4UTG A;  2E5L I;  3J7A G;  3T1H I;  2HHH E;  4X64 I;  4DV1 E;  4DV2 I;  4LF9 I;  1RR9 A;  2HFS A;  1FWL A;  3QT5 A;  1FI4 A;  4B3M E;  4DR3 E;  1H7S A;  4X65 I;  4YY3 I;  4NXM I;  1HNZ I;  4DV0 I;  4JI1 I;  4DV4 E;  3J81 C;  4DUZ E;  1K47 A;  4DR6 E;  2UXD I;  1HNX E;  4URL A;  1FKA E;  4DV7 I;  4B3S I;  1XNR E;  2UUC E;  3ZZU A;  1N36 E;  4GKJ E;  4B3R I;  4K0K I;  1HR0 E;  1FJG E;  2VQF E;  3B78 A;  2E1R A;  2V34 A;  1N0U A;  2OI2 A;  2XEX A;  1NHH A;  2V8P A;  1N32 E;  1Z0W A;  4LF7 I;  4FWH A;  4LFC E;  1FNM A;  2X7I A;  5A2Q Q;  4LF4 I;  1N0V C;  2DEI A;  1RRE A;  1Z59 A;  5BR8 I;  4OX9 E;  4DPT A;  2BM1 A;  1H74 A;  2HKJ A;  4JI5 I;  1PIE A;  4X62 I;  1WUU A;  1J5E E;  4JV5 E;  1N34 E;  4FW9 A;  4LF8 I;  4JI2 E;  5GME A;  4DR4 I;  4LF5 E;  1ELO A;  4P7A A;  4JI4 I;  2UXB I;  4PRX A;  4YHH I;  4AQY I;  4PRV A;  4JYA I;  4USK A;  4NXN I;  4FWD A;  5L3J A;  4KHP E;  2F4V E;  2UUB I;  4DU8 A;  1XNQ I;  2V2Q A;  4HXZ A;  3J81 Q;  4GKK I;  4DR7 I;  3D4J A;  3WU6 A;  1MU5 A;  1HNW E;  4WUB A;  4KQV A;  4DPX A;  1Z0C A;  4JI7 E;  1IBK I;  2GS8 A;  2VQE I;  5LMU I;  3K17 A;  3T1Y I;  4JI3 I;  1Z5A A;  3QT7 A;  4X66 E;  2WW4 A;  4JI0 E;  3V5R A;  3F0N A;  4B3T E;  4DV5 E;  1EI1 A;  4JI8 I;  4DV3 I;  2BM0 A;  1IBM I;  1U2R A;  1XMQ I;  5LL6 R;  1I94 E;  1MX0 A;  2ZM6 E;  1BKN A;  1UEK A;  2HFU A;  5LMN I;  1NHI A;  3OTO I;  1KTV A;  4DR2 I;  1IBL E;  4LFB E;  2UXC I;  3LPS A;  2UU9 E;  4DR5 E;  1N33 E;  2R3V A;  1XMO E;  4JI6 E;  4DR1 I;  2E5L E;  4LF6 I;  3T1H E;  3B82 A;  3PYF A;  4X64 E;  4DV2 E;  4LF9 E;  3JAM C;  2EFG A;  1ZM4 A;  3ZKD A;  3PYG A;  4X65 E;  4YY3 E;  4NXM E;  5IWA I;  1HNZ E;  3V2U C;  4DV0 E;  4JI1 E;  4LFA I;  1ZM2 A;  3LNU A;  3CWV A;  4HY1 A;  2UUA I;  4HAC A;  2UXD E;  4DV7 E;  4B3S E;  1KIJ A;  4DV6 I;  1PKP A;  1H7U A;  4JG4 A;  4B3R E;  4K0K E;  4RPF A;  4DUY I;  4USM A;  1ZXM A;  2V2V A;  2HHH I;  4DXL A;  4ZVI A;  4DU7 A;  3M6A A;  4DV1 I;  4MYT A;  3H4L A;  3QT8 A;  4WUC A;  1Z5C A;  4B3M I;  3B8H A;  4DR3 I;  1ZM3 A;  4LF7 E;  4P52 A;  4LF4 E;  4DV4 I;  4R1F A;  1Z0T A;  1XHK A;  4DUZ I;  1B62 A;  4DPW A;  2HK3 A;  4DR6 I;  2HKE A;  1HNX I;  2HK2 A;  1Z5B A;  4M1K A;  5BR8 E;  2V2Z A;  1KKH A;  1Z0V A;  1XNR I;  2UUC I;  1ZXN A;  3Q1Q A;  1N36 I;  1OJ4 A;  2A2D A;  4JI5 E;  4GKJ I;  4X62 E;  3WU5 A;  4DPU A;  1HR0 I;  4XTJ A;  2VQF I;  4FWG A;  1Z0E A;  5IT9 C;  2VF3 A;  1S4E A;  4LF8 E;  4DR4 E;  4JI4 E;  2UXB E;  4YHH E;  4EMD A;  4AQY E;  1N32 I;  4JYA E;  4LFC I;  3JAM Q;  1A6F A;  2AJ4 A;  1NZ0 A;  4NXN E;  2UUB E;  1XNQ E;  4UT4 A;  1Z0G A;  2NPF A;  4GKK E;  4DR7 E;  2X36 A;  1FWK A;  4OX9 I;  3J80 C;  1EA6 A;  1IBK E;  2VQE E;  5FLX C;  3ZZ0 A;  5LMU E;  1J5E I;  3T1Y E;  4JI3 E;  4JV5 I;  1D6T A;  3PYE A;  1N34 I;  3GON A;  4PU9 A;  1S16 A;  1ZM9 A;  4I3H A;  4JI2 I;  4LF5 I;  3ZKB A;  3LTO A;  1NHJ A;  4JI8 E;  4DV3 E;  3WU3 A;  1IBM E;  2CZ9 A;  1XMQ E;  3HUL A;  3K1J A;  4KHP I;  2F4V I;  5LMN E;  3OTO E;  1DAR A;  4DR2 E;  1HNW I; 
#chains in the Genus database with same CATH topology
 2O1W A;  2R42 A;  2UXC E;  4JI7 I;  4BA1 B;  2BV3 A;  1VIS A;  2LJP A;  2ZIT A;  4OO1 C;  4FW5 A;  1UDQ A;  2BA0 D;  1B63 A;  4FN5 A;  3M85 D;  4X66 I;  2BA0 G;  4JI0 I;  4ED4 A;  4B3T I;  1UDS A;  3NZK A;  4HYM A;  4DV5 I;  3HJC A;  4Z7Y A;  4DR1 E;  5IT9 Q;  2DEJ A;  4LF6 E;  2Q2E B;  4WUD A;  1KVK A;  2A2C A;  1QZR A;  2CGE A;  2GQ0 A;  5A2Q C;  2CVE A;  3PYD A;  1I94 I;  2J7K A;  5JEA D;  2ZM6 I;  5IWA E;  4MU3 A;  1H73 A;  1Z0B A;  2PO2 B;  4LFA E;  1YHC A;  3ZZT A;  4Z7C A;  4HAC B;  5GMD A;  3J7A M;  3ZM7 A;  4FW7 A;  1IBL I;  4LFB I;  2UUA E;  4DPY A;  1XXE A;  3QT6 A;  5JEA C;  4GQU A;  4DV6 E;  3J80 Q;  2WNR A;  1FJG I;  3HKM A;  4MYU A;  3L7Z A;  1H72 C;  2NN6 C;  2ZBK B;  5FLX Q;  2UU9 I;  4DR5 I;  3WU4 A;  1N33 I;  1R6L A;  1XMO I;  4JI6 I;  4DUY E;  1MG7 A;  1PVG A;  5DRO A;  4UTG A;  2E5L I;  3J7A G;  3T1H I;  2HHH E;  5JEA A;  5DNX A;  4X64 I;  4DV1 E;  4DV2 I;  4LF9 I;  1RR9 A;  2HFS A;  1FWL A;  3QT5 A;  2IES A;  1FI4 A;  4B3M E;  2NN6 A;  4DR3 E;  1H7S A;  2C38 A;  4X65 I;  4YY3 I;  4NXM I;  1HNZ I;  4DV0 I;  4JI1 I;  2PNZ B;  4DV4 E;  3J81 C;  4DUZ E;  2BA1 D;  4IZJ A;  4BA2 A;  1K47 A;  4DR6 E;  2UXD I;  1HNX E;  4URL A;  1FKA E;  4IFD D;  4DV7 I;  4B3S I;  3M7N D;  1XNR E;  2UUC E;  3M7N G;  3ZZU A;  1N36 E;  4GKJ E;  4LPF A;  4B3R I;  3L7Z B;  4K0K I;  1HR0 E;  1FJG E;  4OO1 F;  4IS9 A;  2VQF E;  3B78 A;  2E1R A;  2V34 A;  1N0U A;  2OI2 A;  2XEX A;  1NHH A;  3GLL A;  3U1K A;  2V8P A;  1N32 E;  1Z0W A;  4LCH A;  4FWH A;  4LF7 I;  4LFC E;  1FNM A;  2BR2 B;  2GO3 A;  2X7I A;  5A2Q Q;  4LF4 I;  5K36 C;  1Y4U A;  2NN6 B;  2C38 B;  3CDJ A;  1N0V C;  2DEI A;  2PO1 A;  1RRE A;  1Z59 A;  2C39 A;  5BR8 I;  5DRQ A;  4IZJ B;  4OX9 E;  4DPT A;  2CG9 A;  2BM1 A;  1H74 A;  3M85 G;  2HKJ A;  4JI5 I;  5K36 A;  1PIE A;  4X62 I;  1WUU A;  3B4T A;  5JEA F;  2C37 A;  1J5E E;  4JV5 E;  1N34 E;  3H1C A;  2NN6 F;  5C0X D;  4AM3 A;  4FW9 A;  4LF8 I;  4JI2 E;  4OO1 A;  5GME A;  2JEA B;  4DR4 I;  4LF5 E;  1ELO A;  4P7A A;  4JI4 I;  4MU4 A;  2UXB I;  4PRX A;  4YHH I;  4AQY I;  4PRV A;  4JYA I;  4AIM A;  4USK A;  4NXN I;  1E3H A;  4FWD A;  2PO0 A;  5L3J A;  5C0X C;  4KHP E;  2F4V E;  2UUB I;  4DU8 A;  1XNQ I;  2V2Q A;  1VI7 A;  4HXZ A;  3J81 Q;  4GKK I;  4DR7 I;  1UDN A;  3D4J A;  2PO1 B;  4OZE A;  3WU6 A;  1MU5 A;  2C39 B;  1HNW E;  4WUB A;  4KQV A;  4DPX A;  1Z0C A;  4JI7 E;  3DD6 A;  1IBK I;  1OYS A;  2GS8 A;  2VES A;  2VQE I;  5C0X A;  2JEB A;  5LMU I;  3K17 A;  3T1Y I;  4JI3 I;  1Z5A A;  3QT7 A;  4MDT A;  4X66 E;  2WW4 A;  4JI0 E;  2C37 B;  3V5R A;  3F0N A;  4B3T E;  4AID A;  4DV5 E;  1EI1 A;  2Z5E A;  4JI8 I;  2JT2 A;  3PS3 A;  4DV3 I;  2BM0 A;  2WP8 A;  4OO1 B;  1UDO A;  1IBM I;  2Z5B A;  1U2R A;  1XMQ I;  5LL6 R;  2PNM A;  3PRY A;  1I94 E;  2BA1 G;  1MX0 A;  2ZM6 E;  3Q6N A;  1BKN A;  1UEK A;  2HFU A;  3Q6M A;  2PO0 B;  1NHI A;  5LMN I;  3OTO I;  2NN6 E;  1KTV A;  2IOQ A;  5K36 F;  3U1Y A;  4DR2 I;  1IBL E;  4LFB E;  2UXC I;  2WNR B;  1OYP A;  1OYR A;  3LPS A;  4MQY A;  3CDI A;  4MU1 A;  4IFD C;  2UU9 E;  2JEB B;  2O3Z A;  4DR5 E;  1N33 E;  2R3V A;  1XMO E;  4JI6 E;  4FW6 A;  4FW3 A;  3P76 A;  4ISA A;  4DR1 I;  5JEA B;  2E5L E;  4LF6 I;  3T1H E;  3B82 A;  4IZK A;  3PYF A;  4X64 E;  4FW4 A;  4DV2 E;  4LF9 E;  3JAM C;  2WP8 B;  1Y60 A;  2EFG A;  1ZM4 A;  2J65 A;  3ZKD A;  4IFD A;  3PYG A;  1P42 A;  4X65 E;  2Z5B B;  4YY3 E;  4NXM E;  5IWA I;  1HNZ E;  3V2U C;  4DV0 E;  4JI1 E;  3PS1 A;  3PS2 A;  1R6M A;  4LFA I;  4U3B A;  1HK7 A;  4BA2 B;  1ZM2 A;  5C0X F;  3LNU A;  3CWV A;  4HY1 A;  2UUA I;  4HAC A;  2IOP A;  2UXD E;  4MU0 A;  4LOM A;  4DV7 E;  4B3S E;  1KIJ A;  4DV6 I;  2JE6 A;  1PKP A;  4N3O A;  1H7U A;  4JG4 A;  4B3R E;  4K0K E;  4RPF A;  4DUY I;  4USM A;  5K36 E;  1ZXM A;  2V2V A;  1RHY A;  2HHH I;  4DXL A;  4ZVI A;  3K85 A;  4DU7 A;  3M6A A;  4DV1 I;  5DRP A;  4MYT A;  3H4L A;  3QT8 A;  4WUC A;  1Z5C A;  4B3M I;  4IZK B;  3B8H A;  4DR3 I;  1ZM3 A;  2O1V A;  3P3C A;  4OO1 E;  4LF7 E;  4P52 A;  4QNJ A;  4LF4 E;  4DV4 I;  4IFD B;  4R1F A;  1Z0T A;  2PNZ A;  1XHK A;  4DUZ I;  1B62 A;  4DPW A;  2HK3 A;  4DR6 I;  2HKE A;  5ELW A;  1HNX I;  2HK2 A;  1Z5B A;  4M1K A;  5BR8 E;  2NN6 D;  3GME A;  2V2Z A;  1KKH A;  1Z0V A;  1XNR I;  2UUC I;  1ZXN A;  1Y6Z A;  3Q1Q A;  5K36 B;  1N36 I;  1OJ4 A;  2A2D A;  4JI5 E;  4GKJ I;  4X62 E;  3WU5 A;  2JE6 B;  1YH8 A;  4DPU A;  4IZJ D;  1HR0 I;  4XTJ A;  5C0X E;  2VQF I;  4FWG A;  4IFD F;  1Z0E A;  5IT9 C;  2VF3 A;  1S4E A;  3P3E A;  4LF8 E;  4QNK A;  4DR4 E;  2PNL A;  2O1T A;  5JEA E;  4JI4 E;  2UXB E;  2Z5C A;  4YHH E;  4EMD A;  4AQY E;  1N32 I;  4JYA E;  4LFC I;  2F1D A;  3JAM Q;  1A6F A;  2AJ4 A;  4LCG A;  5EKW A;  1NZ0 A;  3KRN A;  4NXN E;  2BR2 A;  2UUB E;  5DNL A;  4NBQ A;  1XNQ E;  4UT4 A;  1Z0G A;  2NPF A;  4GKK E;  4DR7 E;  2X36 A;  1FWK A;  4BA1 A;  4OX9 I;  1USU A;  3J80 C;  5C0X B;  1EA6 A;  1IBK E;  2VQE E;  5FLX C;  1Y4S A;  3ZZ0 A;  5LMU E;  1J5E I;  3T1Y E;  4JI3 E;  4JV5 I;  1D6T A;  3PYE A;  1N34 I;  3GON A;  4PU9 A;  1S16 A;  1ZM9 A;  2O1U A;  4I3H A;  2GO4 A;  3UHM A;  4JI2 I;  2IER A;  1Y5Y A;  5EL9 A;  4LF5 I;  3ZKB A;  3LTO A;  1NHJ A;  4JI8 E;  5K36 D;  4DV3 E;  3P3G A;  3GCM A;  2JEA A;  3P06 A;  3WU3 A;  4OKG A;  1IBM E;  2Z5C B;  2CZ9 A;  1XMQ E;  3HUL A;  3K1J A;  4KHP I;  2PO2 A;  2F4V I;  5DRR A;  4U3D A;  4OO1 D;  5LMN E;  5FWK A;  4IFD E;  3OTO E;  2AE8 A;  4LCF A;  1E3P A;  1DAR A;  4DR2 E;  1HNW I;  1USV A;  4J3D A; 
#chains in the Genus database with same CATH homology
 2O1W A;  2R42 A;  2UXC E;  4JI7 I;  2BV3 A;  1VIS A;  2LJP A;  2ZIT A;  4FN5 A;  1B63 A;  4X66 I;  4JI0 I;  4ED4 A;  4B3T I;  4HYM A;  4DV5 I;  3HJC A;  4Z7Y A;  4DR1 E;  5IT9 Q;  2DEJ A;  4LF6 E;  2Q2E B;  4WUD A;  1KVK A;  2A2C A;  1QZR A;  2CGE A;  2GQ0 A;  5A2Q C;  3PYD A;  1I94 I;  2J7K A;  2ZM6 I;  5IWA E;  1H73 A;  1Z0B A;  4LFA E;  3ZZT A;  4Z7C A;  4HAC B;  5GMD A;  3J7A M;  3ZM7 A;  1IBL I;  4LFB I;  2UUA E;  4DPY A;  3QT6 A;  4DV6 E;  3J80 Q;  1FJG I;  4MYU A;  1H72 C;  2ZBK B;  5FLX Q;  2UU9 I;  4DR5 I;  3WU4 A;  1N33 I;  1XMO I;  4JI6 I;  4DUY E;  1MG7 A;  1PVG A;  4UTG A;  2E5L I;  3J7A G;  3T1H I;  2HHH E;  4X64 I;  4DV1 E;  4DV2 I;  4LF9 I;  1RR9 A;  2HFS A;  1FWL A;  3QT5 A;  1FI4 A;  4B3M E;  4DR3 E;  1H7S A;  4X65 I;  4YY3 I;  4NXM I;  1HNZ I;  4DV0 I;  4JI1 I;  4DV4 E;  3J81 C;  4DUZ E;  4IZJ A;  1K47 A;  4DR6 E;  2UXD I;  1HNX E;  4URL A;  1FKA E;  4DV7 I;  4B3S I;  1XNR E;  2UUC E;  3ZZU A;  1N36 E;  4GKJ E;  4B3R I;  4K0K I;  1HR0 E;  1FJG E;  2VQF E;  3B78 A;  2E1R A;  2V34 A;  1N0U A;  2OI2 A;  2XEX A;  1NHH A;  2V8P A;  1N32 E;  1Z0W A;  4LF7 I;  4FWH A;  4LFC E;  1FNM A;  2X7I A;  5A2Q Q;  4LF4 I;  1Y4U A;  1N0V C;  2DEI A;  1RRE A;  1Z59 A;  5BR8 I;  4IZJ B;  4OX9 E;  4DPT A;  2CG9 A;  2BM1 A;  1H74 A;  2HKJ A;  4JI5 I;  1PIE A;  4X62 I;  1WUU A;  1J5E E;  4JV5 E;  1N34 E;  4FW9 A;  4LF8 I;  4JI2 E;  5GME A;  4DR4 I;  4LF5 E;  1ELO A;  4P7A A;  4JI4 I;  2UXB I;  4PRX A;  4YHH I;  4AQY I;  4PRV A;  4JYA I;  4USK A;  4NXN I;  4FWD A;  5L3J A;  4KHP E;  2F4V E;  2UUB I;  4DU8 A;  1XNQ I;  2V2Q A;  4HXZ A;  3J81 Q;  4GKK I;  4DR7 I;  3D4J A;  3WU6 A;  1MU5 A;  1HNW E;  4WUB A;  4KQV A;  4DPX A;  1Z0C A;  4JI7 E;  1IBK I;  2GS8 A;  2VQE I;  5LMU I;  3K17 A;  3T1Y I;  4JI3 I;  1Z5A A;  3QT7 A;  4X66 E;  2WW4 A;  4JI0 E;  3V5R A;  3F0N A;  4B3T E;  4DV5 E;  1EI1 A;  2Z5E A;  4JI8 I;  4DV3 I;  2BM0 A;  1IBM I;  2Z5B A;  1U2R A;  1XMQ I;  5LL6 R;  2PNM A;  3PRY A;  1I94 E;  1MX0 A;  2ZM6 E;  3Q6N A;  1BKN A;  1UEK A;  2HFU A;  3Q6M A;  5LMN I;  1NHI A;  3OTO I;  1KTV A;  2IOQ A;  4DR2 I;  1IBL E;  4LFB E;  2UXC I;  3LPS A;  2UU9 E;  4DR5 E;  1N33 E;  2R3V A;  1XMO E;  4JI6 E;  4DR1 I;  2E5L E;  4LF6 I;  3T1H E;  3B82 A;  4IZK A;  3PYF A;  4X64 E;  4DV2 E;  4LF9 E;  3JAM C;  2EFG A;  1ZM4 A;  3ZKD A;  3PYG A;  4X65 E;  2Z5B B;  4YY3 E;  4NXM E;  5IWA I;  1HNZ E;  3V2U C;  4DV0 E;  4JI1 E;  4LFA I;  1HK7 A;  1ZM2 A;  3LNU A;  3CWV A;  4HY1 A;  2UUA I;  4HAC A;  2IOP A;  2UXD E;  4DV7 E;  4B3S E;  1KIJ A;  4DV6 I;  1PKP A;  4N3O A;  1H7U A;  4JG4 A;  4B3R E;  4K0K E;  4RPF A;  4DUY I;  4USM A;  1ZXM A;  2V2V A;  2HHH I;  4DXL A;  4ZVI A;  3K85 A;  4DU7 A;  3M6A A;  4DV1 I;  4MYT A;  3H4L A;  3QT8 A;  4WUC A;  1Z5C A;  4B3M I;  4IZK B;  3B8H A;  4DR3 I;  1ZM3 A;  2O1V A;  4LF7 E;  4P52 A;  4LF4 E;  4DV4 I;  4R1F A;  1Z0T A;  1XHK A;  4DUZ I;  1B62 A;  4DPW A;  2HK3 A;  4DR6 I;  2HKE A;  1HNX I;  2HK2 A;  1Z5B A;  4M1K A;  5BR8 E;  2V2Z A;  1KKH A;  1Z0V A;  1XNR I;  2UUC I;  1ZXN A;  1Y6Z A;  3Q1Q A;  1N36 I;  1OJ4 A;  2A2D A;  4JI5 E;  4GKJ I;  4X62 E;  3WU5 A;  4DPU A;  4IZJ D;  1HR0 I;  4XTJ A;  2VQF I;  4FWG A;  1Z0E A;  5IT9 C;  2VF3 A;  1S4E A;  4LF8 E;  4DR4 E;  2PNL A;  2O1T A;  4JI4 E;  2UXB E;  2Z5C A;  4YHH E;  4EMD A;  4AQY E;  1N32 I;  4JYA E;  4LFC I;  3JAM Q;  1A6F A;  2AJ4 A;  1NZ0 A;  4NXN E;  2UUB E;  1XNQ E;  4UT4 A;  1Z0G A;  2NPF A;  4GKK E;  4DR7 E;  2X36 A;  1FWK A;  4OX9 I;  1USU A;  3J80 C;  1EA6 A;  1IBK E;  2VQE E;  5FLX C;  1Y4S A;  3ZZ0 A;  5LMU E;  1J5E I;  3T1Y E;  4JI3 E;  4JV5 I;  1D6T A;  3PYE A;  1N34 I;  3GON A;  4PU9 A;  1S16 A;  1ZM9 A;  2O1U A;  4I3H A;  4JI2 I;  4LF5 I;  3ZKB A;  3LTO A;  1NHJ A;  4JI8 E;  4DV3 E;  3P06 A;  3WU3 A;  1IBM E;  2Z5C B;  2CZ9 A;  1XMQ E;  3HUL A;  3K1J A;  4KHP I;  2F4V I;  5LMN E;  5FWK A;  3OTO E;  1DAR A;  4DR2 E;  1HNW I;  1USV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...