4JG4A

Ligand concentration regulates the pathways of coupled protein folding and binding
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
b'AHLKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQAENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKAASQLTYEETKKSLQHLWRKSSLYKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component
publication title Ligand concentration regulates the pathways of coupled protein folding and binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 37
structure length 114
sequence length 114
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jg4A00
1Z0GA 4JI6E 4DV0I 4HACB 3PYGA 4UT4A 3ZZTA 4JI4E 1J5EE 1H73A 1ZXNA 1XNQI 1PIEA 2HK2A 2VQFE 1FJGI 4DPTA 4DV5I 4PRXA 2V2VA 4DR6I 4Z7CA 3PYFA 2F4VE 1XMQI 1KIJA 1ZXMA 4K0KE 3QT7A 1D6TA 1I94I 2UU9I 2AJ4A 1KTVA 3K17A 3PYDA 1H7UA 1ELOA 1NHJA 5IWAE 3J81Q 4X62I 2UUCE 2NPFA 4YHHE 1HNXE 4P52A 3V5RA 4GKJI 4XTJA 4LFBI 3WU5A 1S16A 2ZM6E 4DUZI 2UUBE 4LFAE 2UXCE 3ZKDA 2GS8A 4LFCE 4X65E 4USMA 1UEKA 4R1FA 4DV7E 4M1KA 4FWHA 4LF6I 4YY3E 2Q2EB 1HR0E 4DV2E 4AQYE 3T1YE 4MYTA 4NXNE 2CZ9A 1ZM9A 2UXBE 2V34A 4HYMA 4DR3E 2VQEI 1S4EA 1HNZE 4DR7E 1Z0BA 5IWAI 1XMOI 4B3SE 4P7AA 1HNXI 4LF4E 2VF3A 5GMDA 1ZM2A 3J7AM 1WUUA 4DV6E 4JI5I 4Z7YA 3T1HE 2DEIA 1QZRA 4B3TI 1FKAE 4DR2I 4MYUA 4URLA 4JV5E 4DV1I 4LF8I 4AQYI 1N0UA 2UXDI 1PKPA 4LF7E 1H7SA 3JAMC 3J7AG 4DPYA 5A2QQ 4DV3I 1N36E 4JYAE 2HHHI 1DARA 2HK3A 1Z5BA 2XEXA 2V2ZA 4JI1I 5L3JA 4DR1E 5GMEA 3B82A 4UTGA 4JI0I 3ZZ0A 4DR5E 1HNWE 5LMNE 4GKKE 4HY1A 2E5LI 4OX9I 4PRVA 1XNRE 1N34I 4JV5I 3M6AA 1NHIA 3OTOI 1Z0EA 3B8HA 5LMUI 4ZVIA 4DUYI 4NXMI 3LPSA 4B3RI 1Z59A 1B62A 4JI6I 4FN5A 1Z5CA 4HXZA 4X64E 3WU4A 4JI4I 4KHPE 1FWKA 4WUCA 1J5EI 4DPUA 5BR8E 1IBLE 3ZZUA 2VQFI 2LJPA 2UUAE 2EFGA 2HKJA 4DV4E 4FWGA 1H74A 4X66E 2F4VI 4K0KI 4JI8E 1Z0TA 1FNMA 1N32E 4EMDA 4LF5E 3H4LA 3LTOA 2V2QA 4JI3E 2X36A 2UUCI 2E1RA 4JI2E 4YHHI 3J80Q 4JI7E 4RPFA 4DR4E 2ZM6I 2UUBI 2X7IA 4LFAI 3J81C 2UXCI 1FI4A 4LFCI 4X65I 4LF9E 1IBKE 1IBME 4DV7I 1N33E 4YY3I 3ZM7A 4DV0E 4DPXA 1HR0I 4DV2I 1NHHA 3HULA 4FWDA 3T1YI 4NXNI 4PU9A 2UXBI 3D4JA 2HFUA 4DR3I 4B3ME 1HNZI 1XNQE 4DR7I 3QT5A 4JG4A 4B3SI 1FJGE 4LF4I 4JI7I 3QT6A 4DV5E 4WUBA 2ZITA 4DR6E 4DV6I 3WU3A 3T1HI 2HFSA 5FLXQ 1XMQE 3GONA 2BV3A 1I94E 2UU9E 1B63A 4DU7A 2A2CA 1U2RA 3Q1QA 3LNUA 1PVGA 1RREA 1ZM4A 4LF7I 2ZBKB 2DEJA 4X62E 1RR9A 4JYAI 1N36I 4GKJE 4B3MI 4LFBE 4DUZE 3QT8A 2OI2A 5A2QC 4DR1I 1FWLA 4WUDA 2HKEA 1Z5AA 1MX0A 4DR5I 3F0NA 4KQVA 1HNWI 5LMNI 4I3HA 4GKKI 4LF6E 4DPWA 1OJ4A 4ED4A 1XNRI 5FLXC 1Z0WA 1MG7A 2WW4A 2VQEE 1EI1A 1XMOE 3PYEA 4DU8A 4FW9A 1K47A 1ZM3A 4USKA 2A2DA 3CWVA 3ZKBA 2R42A 4JI5E 4X64I 3K1JA 4HACA 4B3TE 4KHPI 1Z0CA 4DR2E 3WU6A 1A6FA 3V2UC 5BR8I 1IBLI 3JAMQ 1Z0VA 1VISA 4DV1E 2UUAI 4LF8E 4DXLA 5IT9Q 2UXDE 4DV4I 2J7KA 1EA6A 1KKHA 4DV3E 1KVKA 2HHHE 4X66I 2BM1A 2V8PA 1N0VC 5LL6R 4JI1E 4JI8I 1N32I 4LF5I 1H72C 2R3VA 4JI0E 4JI3I 2BM0A 2E5LE 4OX9E 4JI2I 1N34E 1MU5A 4DR4I 3OTOE 5LMUE 3J80C 3B78A 4LF9I 1NZ0A 4DUYE 4NXME 1IBKI 1XHKA 1IBMI 1BKNA 5IT9C 1N33I 4B3RE
chains in the Genus database with same CATH superfamily
3B4TA 1Z0GA 4MDTA 4JI6E 4DV0I 4HACB 3PYGA 4UT4A 3ZZTA 4JI4E 4J3DA 4IZJA 1J5EE 4IFDC 1H73A 1ZXNA 1XNQI 1PIEA 5C0XD 2HK2A 2VQFE 1FJGI 4DPTA 4OKGA 4FW5A 4DV5I 4PRXA 2JEBB 4MU4A 2V2VA 3GCMA 4IFDA 4DR6I 4Z7CA 1OYRA 1YH8A 4FW3A 1YHCA 3PYFA 4OO1E 2F4VE 1XMQI 1KIJA 1ZXMA 4K0KE 3QT7A 4IZKB 1D6TA 4OO1B 1I94I 2UU9I 2JEAA 4LCHA 2Z5CB 1VI7A 4IFDD 2AJ4A 1KTVA 4U3BA 3K17A 3PYDA 1H7UA 1ELOA 1NHJA 5IWAE 2PNMA 3J81Q 2BA0D 4X62I 2UUCE 2Z5BB 2NPFA 5DRRA 4YHHE 1HNXE 4P52A 5EKWA 3V5RA 4GKJI 4XTJA 5DROA 4LFBI 2PO0B 3WU5A 1S16A 2ZM6E 4DUZI 2UUBE 4FW6A 2C38B 4LFAE 2UXCE 2WNRA 3ZKDA 2GS8A 4BA1A 3M85D 4LFCE 4MU3A 3M7NG 2C39B 4X65E 2BA1D 5ELWA 4USMA 1UEKA 4R1FA 3GLLA 4DV7E 4M1KA 4FWHA 4LF6I 4YY3E 2Q2EB 1HR0E 4DV2E 4AQYE 3T1YE 4LOMA 4MYTA 4NXNE 2Z5EA 4IZJB 5DNXA 2CZ9A 5DRPA 1ZM9A 2UXBE 2V34A 5K36F 4HYMA 4DR3E 2VQEI 1S4EA 1HNZE 4DR7E 1Z0BA 5IWAI 4FW7A 1XMOI 4B3SE 4P7AA 1HNXI 1UDSA 4LF4E 2VF3A 5GMDA 1ZM2A 4MQYA 3J7AM 1WUUA 4DV6E 4JI5I 3Q6NA 4Z7YA 3T1HE 2DEIA 1QZRA 4B3TI 1FKAE 1Y6ZA 4DR2I 1P42A 4LCGA 2Z5BA 4MYUA 2PO1A 2O1TA 2NN6E 4URLA 4JV5E 4DV1I 4LF8I 2NN6B 4AQYI 1N0UA 2UXDI 1PKPA 4LF7E 2CVEA 2IOQA 1H7SA 2C39A 3JAMC 3J7AG 4DPYA 5A2QQ 4DV3I 1N36E 4JYAE 2HHHI 1Y4UA 2JE6A 3KRNA 1DARA 2HK3A 3U1KA 2WNRB 3K85A 1OYPA 1Z5BA 2XEXA 2V2ZA 4JI1I 4BA1B 5L3JA 4DR1E 2O1UA 5GMEA 2J65A 3B82A 4UTGA 4JI0I 3ZZ0A 4DR5E 1HNWE 5LMNE 4GKKE 4HY1A 2E5LI 4OX9I 2JT2A 4PRVA 1XNRE 1N34I 4JV5I 2WP8A 4FW4A 3M6AA 1NHIA 4IZJD 3OTOI 1Z0EA 3B8HA 5LMUI 3M7ND 4ZVIA 2NN6C 4DUYI 4NXMI 4MU1A 3LPSA 4B3RI 1Z59A 1B62A 4JI6I 4FN5A 1Z5CA 4HXZA 4X64E 2NN6A 3WU4A 3UHMA 4JI4I 4KHPE 1FWKA 1HK7A 5K36A 1E3HA 4WUCA 1J5EI 2PO1B 4DPUA 4AM3A 5BR8E 1IBLE 3ZZUA 2VQFI 2CG9A 2IOPA 5C0XF 2LJPA 5JEAF 2UUAE 3P06A 2NN6D 2EFGA 2HKJA 4DV4E 4FWGA 1H74A 2CGEA 2JE6B 3P3CA 4X66E 2F4VI 4K0KI 4JI8E 2O1WA 1Z0TA 1FNMA 1N32E 4EMDA 4LF5E 3PS1A 1N33I 3H4LA 3LTOA 2V2QA 4IFDF 4JI3E 4ISAA 2X36A 3PRYA 3DD6A 2UUCI 2E1RA 4JI2E 4YHHI 3J80Q 4JI7E 2WP8B 4RPFA 4DR4E 2ZM6I 3PS2A 2UUBI 2X7IA 4LFAI 3J81C 2UXCI 3CDJA 1E3PA 1FI4A 3HJCA 4LFCI 2AE8A 4X65I 4LF9E 1Y60A 2VESA 1IBKE 2O3ZA 1IBME 4DV7I 2GQ0A 1N33E 1R6MA 4YY3I 3H1CA 3ZM7A 1Y5YA 4DV0E 4DPXA 5K36E 1HR0I 4DV2I 2F1DA 1NHHA 3HULA 4FWDA 3M85G 1UDOA 3T1YI 5K36B 4NBQA 4NXNI 4PU9A 4AIDA 2UXBI 3D4JA 3GMEA 2HFUA 4DR3I 4B3ME 1HNZI 1XNQE 4DR7I 3P3EA 5DRQA 3QT5A 4IS9A 4JG4A 4B3SI 1FJGE 4LF4I 4JI7I 5FWKA 3QT6A 4DV5E 5JEAC 4GQUA 4WUBA 2ZITA 4DR6E 4DV6I 3Q6MA 3WU3A 3T1HI 2HFSA 5FLXQ 1XMQE 1UDNA 3GONA 2BV3A 3PS3A 5JEAA 1I94E 2UU9E 2GO3A 1B63A 4DU7A 2A2CA 1U2RA 4OO1F 4QNJA 3Q1QA 3CDIA 1PVGA 1RREA 3LNUA 2BR2B 4LCFA 1ZM4A 4LF7I 2PNZA 2ZBKB 2DEJA 4X62E 1RR9A 4JYAI 1N36I 5K36C 4GKJE 4B3MI 5JEAD 4LFBE 4DUZE 3QT8A 2OI2A 5A2QC 4DR1I 1FWLA 4WUDA 2PNLA 2HKEA 1Z5AA 2PO2B 3P76A 1MX0A 4DR5I 3F0NA 4KQVA 1HNWI 5LMNI 4I3HA 4GKKI 4LF6E 3P3GA 3HKMA 1OJ4A 4DPWA 4ED4A 1XNRI 4MU0A 4LPFA 5FLXC 1Z0WA 1R6LA 5K36D 1MG7A 2WW4A 3L7ZA 2VQEE 1UDQA 1EI1A 1USVA 1XMOE 3PYEA 4DU8A 1USUA 4BA2A 1XXEA 4FW9A 1K47A 1ZM3A 4USKA 2A2DA 3CWVA 3ZKBA 2R42A 3NZKA 4JI5E 4X64I 3K1JA 4HACA 5JEAE 5C0XE 4B3TE 2BR2A 4KHPI 1Z0CA 4DR2E 3WU6A 1A6FA 5JEAB 5C0XB 2C37B 3V2UC 1RHYA 5BR8I 1IBLI 3JAMQ 1Z0VA 1VISA 4DV1E 2UUAI 4LF8E 4DXLA 5IT9Q 2PNZB 2IERA 2UXDE 4OO1C 4OZEA 2JEBA 2NN6F 4DV4I 2J7KA 2BA0G 1EA6A 1KKHA 3U1YA 4DV3E 4AIMA 2PO2A 1KVKA 2HHHE 4X66I 2BM1A 2V8PA 1N0VC 4QNKA 5LL6R 4IFDE 5EL9A 4JI1E 4JI8I 4IZKA 4U3DA 4OO1A 1N32I 4IFDB 4LF5I 1OYSA 1H72C 2Z5CA 2GO4A 2R3VA 2BA1G 4JI0E 4JI3I 2BM0A 2O1VA 2E5LE 4OX9E 4JI2I 2JEAB 1N34E 4OO1D 1MU5A 4DR4I 2PO0A 5C0XC 4N3OA 1Y4SA 2C38A 3L7ZB 3OTOE 5LMUE 3J80C 3B78A 4LF9I 1NZ0A 4DUYE 4NXME 1IBKI 1XHKA 5DNLA 2IESA 4BA2B 1IBMI 1BKNA 5C0XA 5IT9C 2C37A 4B3RE
chains in the Genus database with same CATH topology
1Z0GA 4JI6E 4DV0I 4HACB 3PYGA 4UT4A 3ZZTA 4JI4E 4IZJA 1J5EE 1H73A 1ZXNA 1XNQI 1PIEA 2HK2A 2VQFE 1FJGI 4DPTA 4DV5I 4PRXA 2V2VA 4DR6I 4Z7CA 3PYFA 2F4VE 1XMQI 1KIJA 1ZXMA 4K0KE 3QT7A 4IZKB 1D6TA 1I94I 2UU9I 2Z5CB 2AJ4A 1KTVA 3K17A 3PYDA 1H7UA 1ELOA 1NHJA 5IWAE 2PNMA 3J81Q 4X62I 2UUCE 2Z5BB 2NPFA 4YHHE 1HNXE 4P52A 3V5RA 4GKJI 4XTJA 4LFBI 3WU5A 1S16A 2ZM6E 4DUZI 2UUBE 4LFAE 2UXCE 3ZKDA 2GS8A 4LFCE 4X65E 4USMA 1UEKA 4R1FA 4DV7E 4M1KA 4FWHA 4LF6I 4YY3E 2Q2EB 1HR0E 4DV2E 4AQYE 3T1YE 4MYTA 4NXNE 2Z5EA 4IZJB 2CZ9A 1ZM9A 2UXBE 2V34A 4HYMA 4DR3E 2VQEI 1S4EA 1HNZE 4DR7E 1Z0BA 5IWAI 1XMOI 4B3SE 4P7AA 1HNXI 4LF4E 2VF3A 5GMDA 1ZM2A 3J7AM 1WUUA 4DV6E 4JI5I 3Q6NA 4Z7YA 3T1HE 2DEIA 1QZRA 4B3TI 1FKAE 1Y6ZA 4DR2I 2Z5BA 4MYUA 2O1TA 4URLA 4JV5E 4DV1I 4LF8I 4AQYI 1N0UA 2UXDI 1PKPA 4LF7E 2IOQA 1H7SA 3JAMC 3J7AG 4DPYA 5A2QQ 4DV3I 1N36E 4JYAE 2HHHI 1Y4UA 1DARA 2HK3A 3K85A 1Z5BA 2XEXA 2V2ZA 4JI1I 5L3JA 4DR1E 2O1UA 5GMEA 3B82A 4UTGA 4JI0I 3ZZ0A 4DR5E 1HNWE 5LMNE 4GKKE 4HY1A 2E5LI 4OX9I 4PRVA 1XNRE 1N34I 4JV5I 3M6AA 1NHIA 4IZJD 3OTOI 1Z0EA 3B8HA 5LMUI 4ZVIA 4DUYI 4NXMI 3LPSA 4B3RI 1Z59A 1B62A 4JI6I 4FN5A 1Z5CA 4HXZA 4X64E 3WU4A 4JI4I 4KHPE 1FWKA 1HK7A 4WUCA 1J5EI 4DPUA 5BR8E 1IBLE 3ZZUA 2VQFI 2CG9A 2IOPA 2LJPA 2UUAE 3P06A 2EFGA 2HKJA 4DV4E 4FWGA 1H74A 2CGEA 4X66E 2F4VI 4K0KI 4JI8E 2O1WA 1Z0TA 1FNMA 1N32E 4EMDA 4LF5E 3H4LA 3LTOA 2V2QA 4JI3E 2X36A 3PRYA 2UUCI 2E1RA 4JI2E 4YHHI 3J80Q 4JI7E 4RPFA 4DR4E 2ZM6I 2UUBI 2X7IA 4LFAI 3J81C 2UXCI 1FI4A 3HJCA 4LFCI 4X65I 4LF9E 1IBKE 1IBME 4DV7I 2GQ0A 1N33E 4YY3I 3ZM7A 4DV0E 4DPXA 1HR0I 4DV2I 1NHHA 3HULA 4FWDA 3T1YI 4NXNI 4PU9A 2UXBI 3D4JA 2HFUA 4DR3I 4B3ME 1HNZI 1XNQE 4DR7I 3QT5A 4JG4A 4B3SI 1FJGE 4LF4I 4JI7I 5FWKA 3QT6A 4DV5E 4WUBA 2ZITA 4DR6E 4DV6I 3Q6MA 3WU3A 3T1HI 2HFSA 5FLXQ 1XMQE 3GONA 2BV3A 1I94E 2UU9E 1B63A 4DU7A 2A2CA 1U2RA 3Q1QA 3LNUA 1PVGA 1RREA 1ZM4A 4LF7I 2ZBKB 2DEJA 4X62E 1RR9A 4JYAI 1N36I 4GKJE 4B3MI 4LFBE 4DUZE 3QT8A 2OI2A 5A2QC 4DR1I 1FWLA 4WUDA 2PNLA 2HKEA 1Z5AA 1MX0A 4DR5I 3F0NA 4KQVA 1HNWI 5LMNI 4I3HA 4GKKI 4LF6E 4DPWA 1OJ4A 4ED4A 1XNRI 5FLXC 1Z0WA 1MG7A 2WW4A 2VQEE 1EI1A 1USVA 1XMOE 3PYEA 4DU8A 1USUA 4FW9A 1K47A 1ZM3A 4USKA 2A2DA 3CWVA 3ZKBA 2R42A 4JI5E 4X64I 3K1JA 4HACA 4B3TE 4KHPI 1Z0CA 4DR2E 3WU6A 1A6FA 3V2UC 5BR8I 1IBLI 3JAMQ 1Z0VA 1VISA 4DV1E 2UUAI 4LF8E 4DXLA 5IT9Q 2UXDE 4DV4I 2J7KA 1EA6A 1KKHA 4DV3E 1KVKA 2HHHE 4X66I 2BM1A 2V8PA 1N0VC 5LL6R 4JI1E 4JI8I 4IZKA 1N32I 4LF5I 1H72C 2Z5CA 2R3VA 4JI0E 4JI3I 2BM0A 2O1VA 2E5LE 4OX9E 4JI2I 1N34E 1MU5A 4DR4I 4N3OA 1Y4SA 3OTOE 5LMUE 3J80C 3B78A 4LF9I 1NZ0A 4DUYE 4NXME 1IBKI 1XHKA 1IBMI 1BKNA 5IT9C 1N33I 4B3RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0G A;  4JI6 E;  4DV0 I;  4HAC B;  3PYG A;  4UT4 A;  3ZZT A;  4JI4 E;  1J5E E;  1H73 A;  1ZXN A;  1XNQ I;  1PIE A;  2HK2 A;  2VQF E;  1FJG I;  4DPT A;  4DV5 I;  4PRX A;  2V2V A;  4DR6 I;  4Z7C A;  3PYF A;  2F4V E;  1XMQ I;  1KIJ A;  1ZXM A;  4K0K E;  3QT7 A;  1D6T A;  1I94 I;  2UU9 I;  2AJ4 A;  1KTV A;  3K17 A;  3PYD A;  1H7U A;  1ELO A;  1NHJ A;  5IWA E;  3J81 Q;  4X62 I;  2UUC E;  2NPF A;  4YHH E;  1HNX E;  4P52 A;  3V5R A;  4GKJ I;  4XTJ A;  4LFB I;  3WU5 A;  1S16 A;  2ZM6 E;  4DUZ I;  2UUB E;  4LFA E;  2UXC E;  3ZKD A;  2GS8 A;  4LFC E;  4X65 E;  4USM A;  1UEK A;  4R1F A;  4DV7 E;  4M1K A;  4FWH A;  4LF6 I;  4YY3 E;  2Q2E B;  1HR0 E;  4DV2 E;  4AQY E;  3T1Y E;  4MYT A;  4NXN E;  2CZ9 A;  1ZM9 A;  2UXB E;  2V34 A;  4HYM A;  4DR3 E;  2VQE I;  1S4E A;  1HNZ E;  4DR7 E;  1Z0B A;  5IWA I;  1XMO I;  4B3S E;  4P7A A;  1HNX I;  4LF4 E;  2VF3 A;  5GMD A;  1ZM2 A;  3J7A M;  1WUU A;  4DV6 E;  4JI5 I;  4Z7Y A;  3T1H E;  2DEI A;  1QZR A;  4B3T I;  1FKA E;  4DR2 I;  4MYU A;  4URL A;  4JV5 E;  4DV1 I;  4LF8 I;  4AQY I;  1N0U A;  2UXD I;  1PKP A;  4LF7 E;  1H7S A;  3JAM C;  3J7A G;  4DPY A;  5A2Q Q;  4DV3 I;  1N36 E;  4JYA E;  2HHH I;  1DAR A;  2HK3 A;  1Z5B A;  2XEX A;  2V2Z A;  4JI1 I;  5L3J A;  4DR1 E;  5GME A;  3B82 A;  4UTG A;  4JI0 I;  3ZZ0 A;  4DR5 E;  1HNW E;  5LMN E;  4GKK E;  4HY1 A;  2E5L I;  4OX9 I;  4PRV A;  1XNR E;  1N34 I;  4JV5 I;  3M6A A;  1NHI A;  3OTO I;  1Z0E A;  3B8H A;  5LMU I;  4ZVI A;  4DUY I;  4NXM I;  3LPS A;  4B3R I;  1Z59 A;  1B62 A;  4JI6 I;  4FN5 A;  1Z5C A;  4HXZ A;  4X64 E;  3WU4 A;  4JI4 I;  4KHP E;  1FWK A;  4WUC A;  1J5E I;  4DPU A;  5BR8 E;  1IBL E;  3ZZU A;  2VQF I;  2LJP A;  2UUA E;  2EFG A;  2HKJ A;  4DV4 E;  4FWG A;  1H74 A;  4X66 E;  2F4V I;  4K0K I;  4JI8 E;  1Z0T A;  1FNM A;  1N32 E;  4EMD A;  4LF5 E;  3H4L A;  3LTO A;  2V2Q A;  4JI3 E;  2X36 A;  2UUC I;  2E1R A;  4JI2 E;  4YHH I;  3J80 Q;  4JI7 E;  4RPF A;  4DR4 E;  2ZM6 I;  2UUB I;  2X7I A;  4LFA I;  3J81 C;  2UXC I;  1FI4 A;  4LFC I;  4X65 I;  4LF9 E;  1IBK E;  1IBM E;  4DV7 I;  1N33 E;  4YY3 I;  3ZM7 A;  4DV0 E;  4DPX A;  1HR0 I;  4DV2 I;  1NHH A;  3HUL A;  4FWD A;  3T1Y I;  4NXN I;  4PU9 A;  2UXB I;  3D4J A;  2HFU A;  4DR3 I;  4B3M E;  1HNZ I;  1XNQ E;  4DR7 I;  3QT5 A;  4JG4 A;  4B3S I;  1FJG E;  4LF4 I;  4JI7 I;  3QT6 A;  4DV5 E;  4WUB A;  2ZIT A;  4DR6 E;  4DV6 I;  3WU3 A;  3T1H I;  2HFS A;  5FLX Q;  1XMQ E;  3GON A;  2BV3 A;  1I94 E;  2UU9 E;  1B63 A;  4DU7 A;  2A2C A;  1U2R A;  3Q1Q A;  3LNU A;  1PVG A;  1RRE A;  1ZM4 A;  4LF7 I;  2ZBK B;  2DEJ A;  4X62 E;  1RR9 A;  4JYA I;  1N36 I;  4GKJ E;  4B3M I;  4LFB E;  4DUZ E;  3QT8 A;  2OI2 A;  5A2Q C;  4DR1 I;  1FWL A;  4WUD A;  2HKE A;  1Z5A A;  1MX0 A;  4DR5 I;  3F0N A;  4KQV A;  1HNW I;  5LMN I;  4I3H A;  4GKK I;  4LF6 E;  4DPW A;  1OJ4 A;  4ED4 A;  1XNR I;  5FLX C;  1Z0W A;  1MG7 A;  2WW4 A;  2VQE E;  1EI1 A;  1XMO E;  3PYE A;  4DU8 A;  4FW9 A;  1K47 A;  1ZM3 A;  4USK A;  2A2D A;  3CWV A;  3ZKB A;  2R42 A;  4JI5 E;  4X64 I;  3K1J A;  4HAC A;  4B3T E;  4KHP I;  1Z0C A;  4DR2 E;  3WU6 A;  1A6F A;  3V2U C;  5BR8 I;  1IBL I;  3JAM Q;  1Z0V A;  1VIS A;  4DV1 E;  2UUA I;  4LF8 E;  4DXL A;  5IT9 Q;  2UXD E;  4DV4 I;  2J7K A;  1EA6 A;  1KKH A;  4DV3 E;  1KVK A;  2HHH E;  4X66 I;  2BM1 A;  2V8P A;  1N0V C;  5LL6 R;  4JI1 E;  4JI8 I;  1N32 I;  4LF5 I;  1H72 C;  2R3V A;  4JI0 E;  4JI3 I;  2BM0 A;  2E5L E;  4OX9 E;  4JI2 I;  1N34 E;  1MU5 A;  4DR4 I;  3OTO E;  5LMU E;  3J80 C;  3B78 A;  4LF9 I;  1NZ0 A;  4DUY E;  4NXM E;  1IBK I;  1XHK A;  1IBM I;  1BKN A;  5IT9 C;  1N33 I;  4B3R E; 
#chains in the Genus database with same CATH topology
 3B4T A;  1Z0G A;  4MDT A;  4JI6 E;  4DV0 I;  4HAC B;  3PYG A;  4UT4 A;  3ZZT A;  4JI4 E;  4J3D A;  4IZJ A;  1J5E E;  4IFD C;  1H73 A;  1ZXN A;  1XNQ I;  1PIE A;  5C0X D;  2HK2 A;  2VQF E;  1FJG I;  4DPT A;  4OKG A;  4FW5 A;  4DV5 I;  4PRX A;  2JEB B;  4MU4 A;  2V2V A;  3GCM A;  4IFD A;  4DR6 I;  4Z7C A;  1OYR A;  1YH8 A;  4FW3 A;  1YHC A;  3PYF A;  4OO1 E;  2F4V E;  1XMQ I;  1KIJ A;  1ZXM A;  4K0K E;  3QT7 A;  4IZK B;  1D6T A;  4OO1 B;  1I94 I;  2UU9 I;  2JEA A;  4LCH A;  2Z5C B;  1VI7 A;  4IFD D;  2AJ4 A;  1KTV A;  4U3B A;  3K17 A;  3PYD A;  1H7U A;  1ELO A;  1NHJ A;  5IWA E;  2PNM A;  3J81 Q;  2BA0 D;  4X62 I;  2UUC E;  2Z5B B;  2NPF A;  5DRR A;  4YHH E;  1HNX E;  4P52 A;  5EKW A;  3V5R A;  4GKJ I;  4XTJ A;  5DRO A;  4LFB I;  2PO0 B;  3WU5 A;  1S16 A;  2ZM6 E;  4DUZ I;  2UUB E;  4FW6 A;  2C38 B;  4LFA E;  2UXC E;  2WNR A;  3ZKD A;  2GS8 A;  4BA1 A;  3M85 D;  4LFC E;  4MU3 A;  3M7N G;  2C39 B;  4X65 E;  2BA1 D;  5ELW A;  4USM A;  1UEK A;  4R1F A;  3GLL A;  4DV7 E;  4M1K A;  4FWH A;  4LF6 I;  4YY3 E;  2Q2E B;  1HR0 E;  4DV2 E;  4AQY E;  3T1Y E;  4LOM A;  4MYT A;  4NXN E;  2Z5E A;  4IZJ B;  5DNX A;  2CZ9 A;  5DRP A;  1ZM9 A;  2UXB E;  2V34 A;  5K36 F;  4HYM A;  4DR3 E;  2VQE I;  1S4E A;  1HNZ E;  4DR7 E;  1Z0B A;  5IWA I;  4FW7 A;  1XMO I;  4B3S E;  4P7A A;  1HNX I;  1UDS A;  4LF4 E;  2VF3 A;  5GMD A;  1ZM2 A;  4MQY A;  3J7A M;  1WUU A;  4DV6 E;  4JI5 I;  3Q6N A;  4Z7Y A;  3T1H E;  2DEI A;  1QZR A;  4B3T I;  1FKA E;  1Y6Z A;  4DR2 I;  1P42 A;  4LCG A;  2Z5B A;  4MYU A;  2PO1 A;  2O1T A;  2NN6 E;  4URL A;  4JV5 E;  4DV1 I;  4LF8 I;  2NN6 B;  4AQY I;  1N0U A;  2UXD I;  1PKP A;  4LF7 E;  2CVE A;  2IOQ A;  1H7S A;  2C39 A;  3JAM C;  3J7A G;  4DPY A;  5A2Q Q;  4DV3 I;  1N36 E;  4JYA E;  2HHH I;  1Y4U A;  2JE6 A;  3KRN A;  1DAR A;  2HK3 A;  3U1K A;  2WNR B;  3K85 A;  1OYP A;  1Z5B A;  2XEX A;  2V2Z A;  4JI1 I;  4BA1 B;  5L3J A;  4DR1 E;  2O1U A;  5GME A;  2J65 A;  3B82 A;  4UTG A;  4JI0 I;  3ZZ0 A;  4DR5 E;  1HNW E;  5LMN E;  4GKK E;  4HY1 A;  2E5L I;  4OX9 I;  2JT2 A;  4PRV A;  1XNR E;  1N34 I;  4JV5 I;  2WP8 A;  4FW4 A;  3M6A A;  1NHI A;  4IZJ D;  3OTO I;  1Z0E A;  3B8H A;  5LMU I;  3M7N D;  4ZVI A;  2NN6 C;  4DUY I;  4NXM I;  4MU1 A;  3LPS A;  4B3R I;  1Z59 A;  1B62 A;  4JI6 I;  4FN5 A;  1Z5C A;  4HXZ A;  4X64 E;  2NN6 A;  3WU4 A;  3UHM A;  4JI4 I;  4KHP E;  1FWK A;  1HK7 A;  5K36 A;  1E3H A;  4WUC A;  1J5E I;  2PO1 B;  4DPU A;  4AM3 A;  5BR8 E;  1IBL E;  3ZZU A;  2VQF I;  2CG9 A;  2IOP A;  5C0X F;  2LJP A;  5JEA F;  2UUA E;  3P06 A;  2NN6 D;  2EFG A;  2HKJ A;  4DV4 E;  4FWG A;  1H74 A;  2CGE A;  2JE6 B;  3P3C A;  4X66 E;  2F4V I;  4K0K I;  4JI8 E;  2O1W A;  1Z0T A;  1FNM A;  1N32 E;  4EMD A;  4LF5 E;  3PS1 A;  1N33 I;  3H4L A;  3LTO A;  2V2Q A;  4IFD F;  4JI3 E;  4ISA A;  2X36 A;  3PRY A;  3DD6 A;  2UUC I;  2E1R A;  4JI2 E;  4YHH I;  3J80 Q;  4JI7 E;  2WP8 B;  4RPF A;  4DR4 E;  2ZM6 I;  3PS2 A;  2UUB I;  2X7I A;  4LFA I;  3J81 C;  2UXC I;  3CDJ A;  1E3P A;  1FI4 A;  3HJC A;  4LFC I;  2AE8 A;  4X65 I;  4LF9 E;  1Y60 A;  2VES A;  1IBK E;  2O3Z A;  1IBM E;  4DV7 I;  2GQ0 A;  1N33 E;  1R6M A;  4YY3 I;  3H1C A;  3ZM7 A;  1Y5Y A;  4DV0 E;  4DPX A;  5K36 E;  1HR0 I;  4DV2 I;  2F1D A;  1NHH A;  3HUL A;  4FWD A;  3M85 G;  1UDO A;  3T1Y I;  5K36 B;  4NBQ A;  4NXN I;  4PU9 A;  4AID A;  2UXB I;  3D4J A;  3GME A;  2HFU A;  4DR3 I;  4B3M E;  1HNZ I;  1XNQ E;  4DR7 I;  3P3E A;  5DRQ A;  3QT5 A;  4IS9 A;  4JG4 A;  4B3S I;  1FJG E;  4LF4 I;  4JI7 I;  5FWK A;  3QT6 A;  4DV5 E;  5JEA C;  4GQU A;  4WUB A;  2ZIT A;  4DR6 E;  4DV6 I;  3Q6M A;  3WU3 A;  3T1H I;  2HFS A;  5FLX Q;  1XMQ E;  1UDN A;  3GON A;  2BV3 A;  3PS3 A;  5JEA A;  1I94 E;  2UU9 E;  2GO3 A;  1B63 A;  4DU7 A;  2A2C A;  1U2R A;  4OO1 F;  4QNJ A;  3Q1Q A;  3CDI A;  1PVG A;  1RRE A;  3LNU A;  2BR2 B;  4LCF A;  1ZM4 A;  4LF7 I;  2PNZ A;  2ZBK B;  2DEJ A;  4X62 E;  1RR9 A;  4JYA I;  1N36 I;  5K36 C;  4GKJ E;  4B3M I;  5JEA D;  4LFB E;  4DUZ E;  3QT8 A;  2OI2 A;  5A2Q C;  4DR1 I;  1FWL A;  4WUD A;  2PNL A;  2HKE A;  1Z5A A;  2PO2 B;  3P76 A;  1MX0 A;  4DR5 I;  3F0N A;  4KQV A;  1HNW I;  5LMN I;  4I3H A;  4GKK I;  4LF6 E;  3P3G A;  3HKM A;  1OJ4 A;  4DPW A;  4ED4 A;  1XNR I;  4MU0 A;  4LPF A;  5FLX C;  1Z0W A;  1R6L A;  5K36 D;  1MG7 A;  2WW4 A;  3L7Z A;  2VQE E;  1UDQ A;  1EI1 A;  1USV A;  1XMO E;  3PYE A;  4DU8 A;  1USU A;  4BA2 A;  1XXE A;  4FW9 A;  1K47 A;  1ZM3 A;  4USK A;  2A2D A;  3CWV A;  3ZKB A;  2R42 A;  3NZK A;  4JI5 E;  4X64 I;  3K1J A;  4HAC A;  5JEA E;  5C0X E;  4B3T E;  2BR2 A;  4KHP I;  1Z0C A;  4DR2 E;  3WU6 A;  1A6F A;  5JEA B;  5C0X B;  2C37 B;  3V2U C;  1RHY A;  5BR8 I;  1IBL I;  3JAM Q;  1Z0V A;  1VIS A;  4DV1 E;  2UUA I;  4LF8 E;  4DXL A;  5IT9 Q;  2PNZ B;  2IER A;  2UXD E;  4OO1 C;  4OZE A;  2JEB A;  2NN6 F;  4DV4 I;  2J7K A;  2BA0 G;  1EA6 A;  1KKH A;  3U1Y A;  4DV3 E;  4AIM A;  2PO2 A;  1KVK A;  2HHH E;  4X66 I;  2BM1 A;  2V8P A;  1N0V C;  4QNK A;  5LL6 R;  4IFD E;  5EL9 A;  4JI1 E;  4JI8 I;  4IZK A;  4U3D A;  4OO1 A;  1N32 I;  4IFD B;  4LF5 I;  1OYS A;  1H72 C;  2Z5C A;  2GO4 A;  2R3V A;  2BA1 G;  4JI0 E;  4JI3 I;  2BM0 A;  2O1V A;  2E5L E;  4OX9 E;  4JI2 I;  2JEA B;  1N34 E;  4OO1 D;  1MU5 A;  4DR4 I;  2PO0 A;  5C0X C;  4N3O A;  1Y4S A;  2C38 A;  3L7Z B;  3OTO E;  5LMU E;  3J80 C;  3B78 A;  4LF9 I;  1NZ0 A;  4DUY E;  4NXM E;  1IBK I;  1XHK A;  5DNL A;  2IES A;  4BA2 B;  1IBM I;  1BKN A;  5C0X A;  5IT9 C;  2C37 A;  4B3R E; 
#chains in the Genus database with same CATH homology
 1Z0G A;  4JI6 E;  4DV0 I;  4HAC B;  3PYG A;  4UT4 A;  3ZZT A;  4JI4 E;  4IZJ A;  1J5E E;  1H73 A;  1ZXN A;  1XNQ I;  1PIE A;  2HK2 A;  2VQF E;  1FJG I;  4DPT A;  4DV5 I;  4PRX A;  2V2V A;  4DR6 I;  4Z7C A;  3PYF A;  2F4V E;  1XMQ I;  1KIJ A;  1ZXM A;  4K0K E;  3QT7 A;  4IZK B;  1D6T A;  1I94 I;  2UU9 I;  2Z5C B;  2AJ4 A;  1KTV A;  3K17 A;  3PYD A;  1H7U A;  1ELO A;  1NHJ A;  5IWA E;  2PNM A;  3J81 Q;  4X62 I;  2UUC E;  2Z5B B;  2NPF A;  4YHH E;  1HNX E;  4P52 A;  3V5R A;  4GKJ I;  4XTJ A;  4LFB I;  3WU5 A;  1S16 A;  2ZM6 E;  4DUZ I;  2UUB E;  4LFA E;  2UXC E;  3ZKD A;  2GS8 A;  4LFC E;  4X65 E;  4USM A;  1UEK A;  4R1F A;  4DV7 E;  4M1K A;  4FWH A;  4LF6 I;  4YY3 E;  2Q2E B;  1HR0 E;  4DV2 E;  4AQY E;  3T1Y E;  4MYT A;  4NXN E;  2Z5E A;  4IZJ B;  2CZ9 A;  1ZM9 A;  2UXB E;  2V34 A;  4HYM A;  4DR3 E;  2VQE I;  1S4E A;  1HNZ E;  4DR7 E;  1Z0B A;  5IWA I;  1XMO I;  4B3S E;  4P7A A;  1HNX I;  4LF4 E;  2VF3 A;  5GMD A;  1ZM2 A;  3J7A M;  1WUU A;  4DV6 E;  4JI5 I;  3Q6N A;  4Z7Y A;  3T1H E;  2DEI A;  1QZR A;  4B3T I;  1FKA E;  1Y6Z A;  4DR2 I;  2Z5B A;  4MYU A;  2O1T A;  4URL A;  4JV5 E;  4DV1 I;  4LF8 I;  4AQY I;  1N0U A;  2UXD I;  1PKP A;  4LF7 E;  2IOQ A;  1H7S A;  3JAM C;  3J7A G;  4DPY A;  5A2Q Q;  4DV3 I;  1N36 E;  4JYA E;  2HHH I;  1Y4U A;  1DAR A;  2HK3 A;  3K85 A;  1Z5B A;  2XEX A;  2V2Z A;  4JI1 I;  5L3J A;  4DR1 E;  2O1U A;  5GME A;  3B82 A;  4UTG A;  4JI0 I;  3ZZ0 A;  4DR5 E;  1HNW E;  5LMN E;  4GKK E;  4HY1 A;  2E5L I;  4OX9 I;  4PRV A;  1XNR E;  1N34 I;  4JV5 I;  3M6A A;  1NHI A;  4IZJ D;  3OTO I;  1Z0E A;  3B8H A;  5LMU I;  4ZVI A;  4DUY I;  4NXM I;  3LPS A;  4B3R I;  1Z59 A;  1B62 A;  4JI6 I;  4FN5 A;  1Z5C A;  4HXZ A;  4X64 E;  3WU4 A;  4JI4 I;  4KHP E;  1FWK A;  1HK7 A;  4WUC A;  1J5E I;  4DPU A;  5BR8 E;  1IBL E;  3ZZU A;  2VQF I;  2CG9 A;  2IOP A;  2LJP A;  2UUA E;  3P06 A;  2EFG A;  2HKJ A;  4DV4 E;  4FWG A;  1H74 A;  2CGE A;  4X66 E;  2F4V I;  4K0K I;  4JI8 E;  2O1W A;  1Z0T A;  1FNM A;  1N32 E;  4EMD A;  4LF5 E;  3H4L A;  3LTO A;  2V2Q A;  4JI3 E;  2X36 A;  3PRY A;  2UUC I;  2E1R A;  4JI2 E;  4YHH I;  3J80 Q;  4JI7 E;  4RPF A;  4DR4 E;  2ZM6 I;  2UUB I;  2X7I A;  4LFA I;  3J81 C;  2UXC I;  1FI4 A;  3HJC A;  4LFC I;  4X65 I;  4LF9 E;  1IBK E;  1IBM E;  4DV7 I;  2GQ0 A;  1N33 E;  4YY3 I;  3ZM7 A;  4DV0 E;  4DPX A;  1HR0 I;  4DV2 I;  1NHH A;  3HUL A;  4FWD A;  3T1Y I;  4NXN I;  4PU9 A;  2UXB I;  3D4J A;  2HFU A;  4DR3 I;  4B3M E;  1HNZ I;  1XNQ E;  4DR7 I;  3QT5 A;  4JG4 A;  4B3S I;  1FJG E;  4LF4 I;  4JI7 I;  5FWK A;  3QT6 A;  4DV5 E;  4WUB A;  2ZIT A;  4DR6 E;  4DV6 I;  3Q6M A;  3WU3 A;  3T1H I;  2HFS A;  5FLX Q;  1XMQ E;  3GON A;  2BV3 A;  1I94 E;  2UU9 E;  1B63 A;  4DU7 A;  2A2C A;  1U2R A;  3Q1Q A;  3LNU A;  1PVG A;  1RRE A;  1ZM4 A;  4LF7 I;  2ZBK B;  2DEJ A;  4X62 E;  1RR9 A;  4JYA I;  1N36 I;  4GKJ E;  4B3M I;  4LFB E;  4DUZ E;  3QT8 A;  2OI2 A;  5A2Q C;  4DR1 I;  1FWL A;  4WUD A;  2PNL A;  2HKE A;  1Z5A A;  1MX0 A;  4DR5 I;  3F0N A;  4KQV A;  1HNW I;  5LMN I;  4I3H A;  4GKK I;  4LF6 E;  4DPW A;  1OJ4 A;  4ED4 A;  1XNR I;  5FLX C;  1Z0W A;  1MG7 A;  2WW4 A;  2VQE E;  1EI1 A;  1USV A;  1XMO E;  3PYE A;  4DU8 A;  1USU A;  4FW9 A;  1K47 A;  1ZM3 A;  4USK A;  2A2D A;  3CWV A;  3ZKB A;  2R42 A;  4JI5 E;  4X64 I;  3K1J A;  4HAC A;  4B3T E;  4KHP I;  1Z0C A;  4DR2 E;  3WU6 A;  1A6F A;  3V2U C;  5BR8 I;  1IBL I;  3JAM Q;  1Z0V A;  1VIS A;  4DV1 E;  2UUA I;  4LF8 E;  4DXL A;  5IT9 Q;  2UXD E;  4DV4 I;  2J7K A;  1EA6 A;  1KKH A;  4DV3 E;  1KVK A;  2HHH E;  4X66 I;  2BM1 A;  2V8P A;  1N0V C;  5LL6 R;  4JI1 E;  4JI8 I;  4IZK A;  1N32 I;  4LF5 I;  1H72 C;  2Z5C A;  2R3V A;  4JI0 E;  4JI3 I;  2BM0 A;  2O1V A;  2E5L E;  4OX9 E;  4JI2 I;  1N34 E;  1MU5 A;  4DR4 I;  4N3O A;  1Y4S A;  3OTO E;  5LMU E;  3J80 C;  3B78 A;  4LF9 I;  1NZ0 A;  4DUY E;  4NXM E;  1IBK I;  1XHK A;  1IBM I;  1BKN A;  5IT9 C;  1N33 I;  4B3R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...