4JG4A

Ligand concentration regulates the pathways of coupled protein folding and binding
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
AHLKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQAENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKAASQLTYEETKKSLQHLWRKSSLYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand concentration regulates the pathways of coupled protein folding and binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component
total genus 37
structure length 114
sequence length 114
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jg4A00
4HY1A 2UUCE 2VQFI 5IT9C 4YY3E 2VQEI 4DPXA 1Z5BA 3PYGA 1N33E 3K1JA 5GMEA 1KTVA 3T1YE 1J5EE 4YY3I 2GS8A 1RR9A 4HXZA 4LF8E 4DPWA 4DR3E 4LF4E 4DU7A 4LF5I 4LF8I 5IWAI 2E1RA 5FLXQ 4X62E 2UXCI 4R1FA 4LFBE 3HULA 2XEXA 4DR6E 4K0KI 4FWDA 1EI1A 2UXBI 1XMOI 1ZM3A 1HNXE 4GKKI 4DV5E 2V2QA 2HKJA 2LJPA 1I94I 4B3RI 2VQFE 1ZXNA 2V2VA 4NXNE 4B3TE 4JYAI 4DV2I 4I3HA 4JI2E 4DV5I 2VQEE 1IBME 4JI4I 5L3JA 2HK2A 4HYMA 4X64E 2UUBI 4Z7CA 4LF4I 4DV3E 1PIEA 3PYEA 1N36E 4URLA 4JI8E 2V8PA 4LF7E 2UXBE 1PVGA 4X65I 1KIJA 4JI0I 1OJ4A 4P52A 4JI5E 1XHKA 4JV5I 1FKAE 4DPUA 4WUBA 2CZ9A 3M6AA 4JG4A 4FWGA 1N0UA 4DUYI 4DV2E 4LFAE 4RPFA 3OTOI 4DV7I 4USMA 4JI3E 4LFCE 4UTGA 4LFBI 1N32E 1XMQE 3WU6A 4DV7E 1Z5AA 1KVKA 3T1HI 4DXLA 3JAMQ 4PU9A 2DEIA 2BV3A 1I94E 4JYAE 4X65E 3T1YI 1Z0EA 1FNMA 2ZM6I 2F4VI 4JI6E 1Z0WA 3ZZ0A 1WUUA 4MYTA 4FN5A 1DARA 3V2UC 4X64I 1NHHA 2AJ4A 3WU5A 4M1KA 5A2QC 3QT8A 3J80Q 4DV0I 1Z0TA 4LF6I 1XNQI 2E5LI 4MYUA 3J7AM 1ZM4A 4Z7YA 1N36I 2A2CA 4DV6I 2R3VA 5LMNI 4DR2I 2E5LE 3WU3A 2HKEA 4DV1E 1HNWI 1NHJA 2HHHE 4DPTA 4JI5I 4JV5E 2HFSA 4DUZI 2NPFA 3J81C 3LPSA 4WUDA 1H7UA 4DV1I 2UUBE 4GKJE 1FI4A 4LFAI 2UU9E 1IBLI 4DR7I 3PYDA 1PKPA 1H7SA 2UU9I 4LF7I 2UXDI 3QT7A 4OX9I 1Z0CA 3LTOA 1A6FA 4KQVA 4LF6E 4LF9E 3J81Q 2UUCI 4DR6I 4YHHI 2BM0A 4DV6E 1Z0BA 3ZKDA 2VF3A 1FJGI 2BM1A 1K47A 4ZVIA 5A2QQ 1J5EI 4B3RE 5FLXC 5LMUE 2Q2EB 2R42A 4B3TI 2WW4A 1FJGE 3PYFA 3ZZTA 1IBKE 4FWHA 3Q1QA 1XNRE 3CWVA 2OI2A 2UXDE 3T1HE 1XMOE 4X62I 2UXCE 2X36A 1EA6A 4JI8I 2F4VE 4X66E 1N33I 4JI6I 1H73A 1HNZI 4B3SI 4DUZE 4NXNI 5BR8I 1H72C 1HR0I 2X7IA 1VISA 4JI1E 4DUYE 1IBMI 4JI4E 1S16A 2V34A 4LF5E 5BR8E 1Z59A 1MX0A 1N34I 1MG7A 3QT6A 3J7AG 1XNRI 5LMNE 1ELOA 3LNUA 3B82A 1BKNA 2UUAI 1H74A 4DR5I 1Z5CA 4NXME 3GONA 4GKJI 4JI0E 1ZXMA 4JI2I 5LMUI 4DR4E 1ZM2A 1D6TA 3D4JA 3B8HA 5LL6R 2HK3A 3ZM7A 1IBKI 2ZBKB 3OTOE 3JAMC 4DV3I 4UT4A 4PRVA 4JI3I 4FW9A 1UEKA 1XMQI 4EMDA 3QT5A 4YHHE 5IWAE 3WU4A 1NZ0A 1HNZE 4B3SE 1Z0VA 4AQYE 2DEJA 4DR5E 1HNWE 1FWKA 4HACB 1Z0GA 2ZM6E 4JI1I 4B3ME 1MU5A 1B63A 1HR0E 2A2DA 4DR4I 5IT9Q 4PRXA 4LFCI 1FWLA 2ZITA 1IBLE 1U2RA 1N32I 2J7KA 3F0NA 4DV0E 3B78A 1N34E 1XNQE 4HACA 2UUAE 4DR1E 4X66I 4JI7I 4DR2E 4XTJA 3V5RA 3ZKBA 3K17A 1HNXI 4GKKE 3J80C 4NXMI 4JI7E 4DU8A 4ED4A 4DV4E 1ZM9A 4AQYI 4DR3I 4WUCA 1S4EA 1KKHA 4KHPE 4DV4I 3ZZUA 4DR7E 4B3MI 1N0VC 5GMDA 1RREA 4OX9E 4USKA 4KHPI 4DPYA 2EFGA 1B62A 4P7AA 2V2ZA 4K0KE 1NHIA 3H4LA 2HFUA 1QZRA 4LF9I 4DR1I 2HHHI
chains in the Genus database with same CATH superfamily
4HY1A 5DRPA 2UUCE 1R6LA 1YH8A 2VQFI 5IT9C 4YY3E 2VQEI 4DPXA 1P42A 1Z5BA 3PYGA 1N33E 2C39A 3K1JA 5GMEA 4OKGA 1KTVA 3T1YE 1J5EE 4BA2A 4YY3I 2GS8A 4OZEA 1UDQA 1RR9A 4HXZA 4LF8E 4DPWA 5C0XA 4DR3E 1OYSA 4LF4E 4DU7A 3K85A 4LF5I 4LF8I 2PO0B 5IWAI 2E1RA 3GCMA 5FLXQ 4X62E 2UXCI 4R1FA 4MDTA 4LFBE 3HULA 2XEXA 4QNJA 4DR6E 4FWDA 1EI1A 4K0KI 2UXBI 1XMOI 5K36E 2JEAA 1ZM3A 2IOPA 3Q6NA 1HNXE 4GKKI 1USVA 4DV5E 2V2QA 2HKJA 5JEAA 2LJPA 1I94I 4U3DA 4B3RI 2VQFE 1ZXNA 2IESA 2V2VA 5C0XD 4NXNE 4IFDE 2WNRB 4B3TE 4JYAI 4DV2I 1YHCA 4I3HA 4JI2E 4DV5I 4OO1D 2VQEE 1IBME 4JI4I 2BR2B 3L7ZB 5L3JA 2HK2A 4HYMA 1UDOA 4X64E 2UUBI 1Y4SA 4Z7CA 1Y4UA 4LF4I 3M7ND 5K36B 4DV3E 1PIEA 3GMEA 3PYEA 4IFDD 1N36E 4URLA 4JI8E 2V8PA 4LF7E 2UXBE 1PVGA 2IERA 4X65I 1KIJA 4JI0I 1OJ4A 2O3ZA 5K36D 4P52A 4JI5E 1XHKA 4JV5I 1FKAE 4FW7A 4DPUA 2NN6F 2CZ9A 4WUBA 4LCFA 4MU0A 3M6AA 4JG4A 2C38A 4FWGA 1N0UA 2AE8A 3PS1A 3P3CA 2BA1G 4DUYI 4DV2E 4LFAE 2PO0A 1UDNA 5C0XF 1RHYA 4RPFA 3M85G 3OTOI 4DV7I 2WP8B 4USMA 4JI3E 3B4TA 2JE6A 2PO1B 4LFCE 2Z5BA 5DRQA 4UTGA 4LFBI 1N32E 1XMQE 4BA1A 4J3DA 3WU6A 4DV7E 1Z5AA 1KVKA 4N3OA 3T1HI 4DXLA 4OO1C 3H1CA 3JAMQ 4MU3A 2F1DA 2DEIA 4FW6A 4PU9A 2BV3A 2PNZB 1I94E 4JYAE 4X65E 5JEAF 3T1YI 1Z0EA 1FNMA 2ZM6I 2JT2A 2F4VI 2JEAB 2O1VA 2Z5EA 4JI6E 1Z0WA 3ZZ0A 1WUUA 2JEBB 4MYTA 4FN5A 1DARA 4IFDB 3V2UC 2C39B 4X64I 1NHHA 2PO2B 2AJ4A 3WU5A 4M1KA 5A2QC 3QT8A 3J80Q 4DV0I 5JEAE 1Z0TA 4LF6I 4LCHA 1XNQI 2E5LI 4MYUA 3J7AM 1ZM4A 4Z7YA 5DROA 1N36I 2A2CA 4DV6I 2R3VA 5LMNI 4MQYA 4DR2I 2E5LE 3WU3A 3Q6MA 2HKEA 4IZKB 4DV1E 1HNWI 1NHJA 1Y6ZA 2PO1A 5DRRA 2HHHE 4IFDC 4DPTA 4JI5I 4JV5E 2HFSA 4LPFA 4DUZI 2NPFA 1QZRA 3J81C 3LPSA 4WUDA 1H7UA 2J65A 4DV1I 2UUBE 4GKJE 1FI4A 5JEAD 4LFAI 2UU9E 1IBLI 3P76A 2NN6C 4DR7I 3PYDA 4IZKA 3M85D 2WNRA 5C0XE 4OO1B 2NN6D 1PKPA 1Y5YA 3U1KA 1H7SA 2Z5BB 2UU9I 5EL9A 4LF7I 2UXDI 3QT7A 4OX9I 2GQ0A 5EKWA 1Z0CA 3U1YA 3LTOA 3P3GA 3PS3A 2IOQA 1A6FA 2PNMA 4KQVA 4LF6E 4LF9E 3J81Q 4AM3A 2BR2A 2UUCI 4DR6I 4YHHI 2BM0A 2CGEA 4DV6E 1Z0BA 3P06A 4QNKA 2O1UA 3ZKDA 2NN6A 2VF3A 1FJGI 2BM1A 1K47A 4ZVIA 5A2QQ 1J5EI 4B3RE 5FLXC 5LMUE 2Q2EB 4ISAA 2R42A 4B3TI 2PNZA 2NN6B 2WW4A 5JEAC 1FJGE 3PYFA 3ZZTA 1IBKE 4FWHA 3Q1QA 4LCGA 2PNLA 1XNRE 2C37A 4IFDF 3CWVA 2OI2A 2UXDE 3T1HE 1XMOE 4X62I 2UXCE 2X36A 5ELWA 1EA6A 4JI8I 5K36F 3P3EA 2F4VE 4X66E 2GO3A 1N33I 4JI6I 1H73A 3KRNA 1HNZI 1USUA 4B3SI 3PS2A 4DUZE 4OO1F 2NN6E 4IZJB 5C0XB 4OO1E 4NXNI 5BR8I 3HJCA 2VESA 1H72C 1HK7A 4NBQA 1HR0I 2O1TA 2X7IA 1VISA 4JI1E 4DUYE 1IBMI 4JI4E 2C37B 1S16A 2V34A 1OYRA 4LF5E 5BR8E 1Z59A 1MX0A 1N34I 4FW3A 1MG7A 3QT6A 3J7AG 1XNRI 5LMNE 1ELOA 3LNUA 4MU4A 3B82A 1BKNA 2BA0G 1H74A 3PRYA 2UUAI 5K36C 1E3PA 4DR5I 5FWKA 1Z5CA 2PO2A 4NXME 3GONA 4GKJI 5JEAB 4JI0E 1ZXMA 4IZJD 4JI2I 5LMUI 4DR4E 1ZM2A 1D6TA 4OO1A 3D4JA 3B8HA 5LL6R 3CDJA 2HK3A 3ZM7A 1IBKI 2ZBKB 3OTOE 4IS9A 3JAMC 2GO4A 4DV3I 4MU1A 4UT4A 4PRVA 1OYPA 4JI3I 3HKMA 2Z5CB 3GLLA 4FW9A 1UEKA 2O1WA 1XMQI 4EMDA 3QT5A 1UDSA 4YHHE 2BA1D 5IWAE 1Y60A 3WU4A 1NZ0A 1HNZE 4B3SE 1Z0VA 4FW5A 4AQYE 2DEJA 2C38B 4DR5E 2JEBA 1HNWE 5DNXA 4U3BA 1FWKA 4HACB 1Z0GA 2ZM6E 4JI1I 4B3ME 4BA2B 1MU5A 1B63A 1HR0E 2A2DA 4DR4I 5DNLA 5IT9Q 4PRXA 4AIMA 4LFCI 1FWLA 2ZITA 1IBLE 1U2RA 1N32I 2J7KA 3F0NA 4DV0E 3B78A 5C0XC 1N34E 2JE6B 1XNQE 4IFDA 3M7NG 3DD6A 4HACA 2UUAE 4DR1E 4X66I 3NZKA 4JI7I 4DR2E 4XTJA 3V5RA 3ZKBA 3K17A 1HNXI 4GKKE 3J80C 4NXMI 3UHMA 4FW4A 4JI7E 4DU8A 1E3HA 3L7ZA 4ED4A 4GQUA 4DV4E 1ZM9A 4AQYI 4DR3I 4WUCA 1S4EA 4LOMA 1KKHA 4KHPE 4DV4I 4BA1B 2BA0D 3ZZUA 3CDIA 4IZJA 4DR7E 4AIDA 4B3MI 1N0VC 2CVEA 5GMDA 1R6MA 2WP8A 1RREA 4OX9E 4USKA 4KHPI 4DPYA 2EFGA 1B62A 4P7AA 2V2ZA 4K0KE 2CG9A 1NHIA 3H4LA 5K36A 2HFUA 1XXEA 2Z5CA 4LF9I 1VI7A 4DR1I 2HHHI
chains in the Genus database with same CATH topology
4HY1A 2UUCE 2VQFI 5IT9C 4YY3E 2VQEI 4DPXA 1Z5BA 3PYGA 1N33E 3K1JA 5GMEA 1KTVA 3T1YE 1J5EE 4YY3I 2GS8A 1RR9A 4HXZA 4LF8E 4DPWA 4DR3E 4LF4E 4DU7A 3K85A 4LF5I 4LF8I 5IWAI 2E1RA 5FLXQ 4X62E 2UXCI 4R1FA 4LFBE 3HULA 2XEXA 4DR6E 4K0KI 4FWDA 1EI1A 2UXBI 1XMOI 1ZM3A 2IOPA 3Q6NA 1HNXE 4GKKI 1USVA 4DV5E 2V2QA 2HKJA 2LJPA 1I94I 4B3RI 2VQFE 1ZXNA 2V2VA 4NXNE 4B3TE 4JYAI 4DV2I 4I3HA 4JI2E 4DV5I 2VQEE 1IBME 4JI4I 5L3JA 2HK2A 4HYMA 4X64E 2UUBI 1Y4SA 4Z7CA 1Y4UA 4LF4I 4DV3E 1PIEA 3PYEA 1N36E 4URLA 4JI8E 2V8PA 4LF7E 2UXBE 1PVGA 4X65I 1KIJA 4JI0I 1OJ4A 4P52A 4JI5E 1XHKA 4JV5I 1FKAE 4DPUA 4WUBA 2CZ9A 3M6AA 4JG4A 4FWGA 1N0UA 4DUYI 4DV2E 4LFAE 4RPFA 3OTOI 4DV7I 4USMA 4JI3E 4LFCE 2Z5BA 4UTGA 4LFBI 1N32E 1XMQE 3WU6A 4DV7E 1Z5AA 1KVKA 4N3OA 3T1HI 4DXLA 3JAMQ 4PU9A 2DEIA 2BV3A 1I94E 4JYAE 4X65E 3T1YI 1Z0EA 1FNMA 2ZM6I 2F4VI 2O1VA 2Z5EA 4JI6E 1Z0WA 3ZZ0A 1WUUA 4MYTA 4FN5A 1DARA 3V2UC 4X64I 1NHHA 2AJ4A 3WU5A 4M1KA 5A2QC 3QT8A 3J80Q 4DV0I 1Z0TA 4LF6I 1XNQI 2E5LI 4MYUA 3J7AM 1ZM4A 4Z7YA 1N36I 2A2CA 4DV6I 2R3VA 5LMNI 4DR2I 2E5LE 3WU3A 3Q6MA 2HKEA 4IZKB 4DV1E 1HNWI 1NHJA 1Y6ZA 2HHHE 4DPTA 4JI5I 4JV5E 2HFSA 4DUZI 2NPFA 3J81C 1QZRA 3LPSA 4WUDA 1H7UA 4DV1I 2UUBE 4GKJE 1FI4A 4LFAI 2UU9E 1IBLI 4DR7I 3PYDA 4IZKA 1PKPA 1H7SA 2Z5BB 2UU9I 4LF7I 2UXDI 3QT7A 4OX9I 2GQ0A 1Z0CA 3LTOA 2IOQA 1A6FA 2PNMA 4KQVA 4LF6E 4LF9E 3J81Q 2UUCI 4DR6I 4YHHI 2BM0A 2CGEA 4DV6E 1Z0BA 3P06A 2O1UA 3ZKDA 2VF3A 1FJGI 2BM1A 1K47A 4ZVIA 5A2QQ 1J5EI 4B3RE 5FLXC 5LMUE 2Q2EB 2R42A 4B3TI 2WW4A 1FJGE 3PYFA 3ZZTA 1IBKE 4FWHA 3Q1QA 2PNLA 1XNRE 3CWVA 2OI2A 2UXDE 3T1HE 1XMOE 4X62I 2UXCE 2X36A 1EA6A 4JI8I 2F4VE 4X66E 1N33I 4JI6I 1H73A 1HNZI 4B3SI 1USUA 4DUZE 4IZJB 4NXNI 5BR8I 3HJCA 1H72C 1HK7A 1HR0I 2O1TA 2X7IA 1VISA 4JI1E 4DUYE 1IBMI 4JI4E 1S16A 2V34A 4LF5E 5BR8E 1Z59A 1MX0A 1N34I 1MG7A 3QT6A 3J7AG 1XNRI 5LMNE 1ELOA 3LNUA 3B82A 1BKNA 2UUAI 1H74A 3PRYA 4DR5I 5FWKA 1Z5CA 4NXME 3GONA 4GKJI 4JI0E 1ZXMA 4IZJD 4JI2I 5LMUI 4DR4E 1ZM2A 1D6TA 3D4JA 3B8HA 5LL6R 2HK3A 3ZM7A 1IBKI 2ZBKB 3OTOE 3JAMC 4DV3I 4UT4A 4PRVA 4JI3I 2Z5CB 4FW9A 1UEKA 2O1WA 1XMQI 4EMDA 3QT5A 4YHHE 5IWAE 3WU4A 1NZ0A 1HNZE 4B3SE 1Z0VA 4AQYE 2DEJA 4DR5E 1HNWE 1FWKA 4HACB 1Z0GA 2ZM6E 4JI1I 4B3ME 1MU5A 1B63A 1HR0E 2A2DA 4DR4I 5IT9Q 4PRXA 4LFCI 1FWLA 2ZITA 1IBLE 1U2RA 1N32I 2J7KA 3F0NA 4DV0E 3B78A 1N34E 1XNQE 4HACA 2UUAE 4DR1E 4X66I 4JI7I 4DR2E 4XTJA 3V5RA 3ZKBA 3K17A 1HNXI 4GKKE 3J80C 4NXMI 4JI7E 4DU8A 4ED4A 4DV4E 1ZM9A 4AQYI 4DR3I 4WUCA 1S4EA 1KKHA 4KHPE 4DV4I 3ZZUA 4IZJA 4DR7E 4B3MI 1N0VC 5GMDA 1RREA 4OX9E 4USKA 4KHPI 4DPYA 2EFGA 1B62A 4P7AA 2V2ZA 4K0KE 2CG9A 1NHIA 3H4LA 2HFUA 2Z5CA 4LF9I 4DR1I 2HHHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HY1 A;  2UUC E;  2VQF I;  5IT9 C;  4YY3 E;  2VQE I;  4DPX A;  1Z5B A;  3PYG A;  1N33 E;  3K1J A;  5GME A;  1KTV A;  3T1Y E;  1J5E E;  4YY3 I;  2GS8 A;  1RR9 A;  4HXZ A;  4LF8 E;  4DPW A;  4DR3 E;  4LF4 E;  4DU7 A;  4LF5 I;  4LF8 I;  5IWA I;  2E1R A;  5FLX Q;  4X62 E;  2UXC I;  4R1F A;  4LFB E;  3HUL A;  2XEX A;  4DR6 E;  4K0K I;  4FWD A;  1EI1 A;  2UXB I;  1XMO I;  1ZM3 A;  1HNX E;  4GKK I;  4DV5 E;  2V2Q A;  2HKJ A;  2LJP A;  1I94 I;  4B3R I;  2VQF E;  1ZXN A;  2V2V A;  4NXN E;  4B3T E;  4JYA I;  4DV2 I;  4I3H A;  4JI2 E;  4DV5 I;  2VQE E;  1IBM E;  4JI4 I;  5L3J A;  2HK2 A;  4HYM A;  4X64 E;  2UUB I;  4Z7C A;  4LF4 I;  4DV3 E;  1PIE A;  3PYE A;  1N36 E;  4URL A;  4JI8 E;  2V8P A;  4LF7 E;  2UXB E;  1PVG A;  4X65 I;  1KIJ A;  4JI0 I;  1OJ4 A;  4P52 A;  4JI5 E;  1XHK A;  4JV5 I;  1FKA E;  4DPU A;  4WUB A;  2CZ9 A;  3M6A A;  4JG4 A;  4FWG A;  1N0U A;  4DUY I;  4DV2 E;  4LFA E;  4RPF A;  3OTO I;  4DV7 I;  4USM A;  4JI3 E;  4LFC E;  4UTG A;  4LFB I;  1N32 E;  1XMQ E;  3WU6 A;  4DV7 E;  1Z5A A;  1KVK A;  3T1H I;  4DXL A;  3JAM Q;  4PU9 A;  2DEI A;  2BV3 A;  1I94 E;  4JYA E;  4X65 E;  3T1Y I;  1Z0E A;  1FNM A;  2ZM6 I;  2F4V I;  4JI6 E;  1Z0W A;  3ZZ0 A;  1WUU A;  4MYT A;  4FN5 A;  1DAR A;  3V2U C;  4X64 I;  1NHH A;  2AJ4 A;  3WU5 A;  4M1K A;  5A2Q C;  3QT8 A;  3J80 Q;  4DV0 I;  1Z0T A;  4LF6 I;  1XNQ I;  2E5L I;  4MYU A;  3J7A M;  1ZM4 A;  4Z7Y A;  1N36 I;  2A2C A;  4DV6 I;  2R3V A;  5LMN I;  4DR2 I;  2E5L E;  3WU3 A;  2HKE A;  4DV1 E;  1HNW I;  1NHJ A;  2HHH E;  4DPT A;  4JI5 I;  4JV5 E;  2HFS A;  4DUZ I;  2NPF A;  3J81 C;  3LPS A;  4WUD A;  1H7U A;  4DV1 I;  2UUB E;  4GKJ E;  1FI4 A;  4LFA I;  2UU9 E;  1IBL I;  4DR7 I;  3PYD A;  1PKP A;  1H7S A;  2UU9 I;  4LF7 I;  2UXD I;  3QT7 A;  4OX9 I;  1Z0C A;  3LTO A;  1A6F A;  4KQV A;  4LF6 E;  4LF9 E;  3J81 Q;  2UUC I;  4DR6 I;  4YHH I;  2BM0 A;  4DV6 E;  1Z0B A;  3ZKD A;  2VF3 A;  1FJG I;  2BM1 A;  1K47 A;  4ZVI A;  5A2Q Q;  1J5E I;  4B3R E;  5FLX C;  5LMU E;  2Q2E B;  2R42 A;  4B3T I;  2WW4 A;  1FJG E;  3PYF A;  3ZZT A;  1IBK E;  4FWH A;  3Q1Q A;  1XNR E;  3CWV A;  2OI2 A;  2UXD E;  3T1H E;  1XMO E;  4X62 I;  2UXC E;  2X36 A;  1EA6 A;  4JI8 I;  2F4V E;  4X66 E;  1N33 I;  4JI6 I;  1H73 A;  1HNZ I;  4B3S I;  4DUZ E;  4NXN I;  5BR8 I;  1H72 C;  1HR0 I;  2X7I A;  1VIS A;  4JI1 E;  4DUY E;  1IBM I;  4JI4 E;  1S16 A;  2V34 A;  4LF5 E;  5BR8 E;  1Z59 A;  1MX0 A;  1N34 I;  1MG7 A;  3QT6 A;  3J7A G;  1XNR I;  5LMN E;  1ELO A;  3LNU A;  3B82 A;  1BKN A;  2UUA I;  1H74 A;  4DR5 I;  1Z5C A;  4NXM E;  3GON A;  4GKJ I;  4JI0 E;  1ZXM A;  4JI2 I;  5LMU I;  4DR4 E;  1ZM2 A;  1D6T A;  3D4J A;  3B8H A;  5LL6 R;  2HK3 A;  3ZM7 A;  1IBK I;  2ZBK B;  3OTO E;  3JAM C;  4DV3 I;  4UT4 A;  4PRV A;  4JI3 I;  4FW9 A;  1UEK A;  1XMQ I;  4EMD A;  3QT5 A;  4YHH E;  5IWA E;  3WU4 A;  1NZ0 A;  1HNZ E;  4B3S E;  1Z0V A;  4AQY E;  2DEJ A;  4DR5 E;  1HNW E;  1FWK A;  4HAC B;  1Z0G A;  2ZM6 E;  4JI1 I;  4B3M E;  1MU5 A;  1B63 A;  1HR0 E;  2A2D A;  4DR4 I;  5IT9 Q;  4PRX A;  4LFC I;  1FWL A;  2ZIT A;  1IBL E;  1U2R A;  1N32 I;  2J7K A;  3F0N A;  4DV0 E;  3B78 A;  1N34 E;  1XNQ E;  4HAC A;  2UUA E;  4DR1 E;  4X66 I;  4JI7 I;  4DR2 E;  4XTJ A;  3V5R A;  3ZKB A;  3K17 A;  1HNX I;  4GKK E;  3J80 C;  4NXM I;  4JI7 E;  4DU8 A;  4ED4 A;  4DV4 E;  1ZM9 A;  4AQY I;  4DR3 I;  4WUC A;  1S4E A;  1KKH A;  4KHP E;  4DV4 I;  3ZZU A;  4DR7 E;  4B3M I;  1N0V C;  5GMD A;  1RRE A;  4OX9 E;  4USK A;  4KHP I;  4DPY A;  2EFG A;  1B62 A;  4P7A A;  2V2Z A;  4K0K E;  1NHI A;  3H4L A;  2HFU A;  1QZR A;  4LF9 I;  4DR1 I;  2HHH I; 
#chains in the Genus database with same CATH topology
 4HY1 A;  5DRP A;  2UUC E;  1R6L A;  1YH8 A;  2VQF I;  5IT9 C;  4YY3 E;  2VQE I;  4DPX A;  1P42 A;  1Z5B A;  3PYG A;  1N33 E;  2C39 A;  3K1J A;  5GME A;  4OKG A;  1KTV A;  3T1Y E;  1J5E E;  4BA2 A;  4YY3 I;  2GS8 A;  4OZE A;  1UDQ A;  1RR9 A;  4HXZ A;  4LF8 E;  4DPW A;  5C0X A;  4DR3 E;  1OYS A;  4LF4 E;  4DU7 A;  3K85 A;  4LF5 I;  4LF8 I;  2PO0 B;  5IWA I;  2E1R A;  3GCM A;  5FLX Q;  4X62 E;  2UXC I;  4R1F A;  4MDT A;  4LFB E;  3HUL A;  2XEX A;  4QNJ A;  4DR6 E;  4FWD A;  1EI1 A;  4K0K I;  2UXB I;  1XMO I;  5K36 E;  2JEA A;  1ZM3 A;  2IOP A;  3Q6N A;  1HNX E;  4GKK I;  1USV A;  4DV5 E;  2V2Q A;  2HKJ A;  5JEA A;  2LJP A;  1I94 I;  4U3D A;  4B3R I;  2VQF E;  1ZXN A;  2IES A;  2V2V A;  5C0X D;  4NXN E;  4IFD E;  2WNR B;  4B3T E;  4JYA I;  4DV2 I;  1YHC A;  4I3H A;  4JI2 E;  4DV5 I;  4OO1 D;  2VQE E;  1IBM E;  4JI4 I;  2BR2 B;  3L7Z B;  5L3J A;  2HK2 A;  4HYM A;  1UDO A;  4X64 E;  2UUB I;  1Y4S A;  4Z7C A;  1Y4U A;  4LF4 I;  3M7N D;  5K36 B;  4DV3 E;  1PIE A;  3GME A;  3PYE A;  4IFD D;  1N36 E;  4URL A;  4JI8 E;  2V8P A;  4LF7 E;  2UXB E;  1PVG A;  2IER A;  4X65 I;  1KIJ A;  4JI0 I;  1OJ4 A;  2O3Z A;  5K36 D;  4P52 A;  4JI5 E;  1XHK A;  4JV5 I;  1FKA E;  4FW7 A;  4DPU A;  2NN6 F;  2CZ9 A;  4WUB A;  4LCF A;  4MU0 A;  3M6A A;  4JG4 A;  2C38 A;  4FWG A;  1N0U A;  2AE8 A;  3PS1 A;  3P3C A;  2BA1 G;  4DUY I;  4DV2 E;  4LFA E;  2PO0 A;  1UDN A;  5C0X F;  1RHY A;  4RPF A;  3M85 G;  3OTO I;  4DV7 I;  2WP8 B;  4USM A;  4JI3 E;  3B4T A;  2JE6 A;  2PO1 B;  4LFC E;  2Z5B A;  5DRQ A;  4UTG A;  4LFB I;  1N32 E;  1XMQ E;  4BA1 A;  4J3D A;  3WU6 A;  4DV7 E;  1Z5A A;  1KVK A;  4N3O A;  3T1H I;  4DXL A;  4OO1 C;  3H1C A;  3JAM Q;  4MU3 A;  2F1D A;  2DEI A;  4FW6 A;  4PU9 A;  2BV3 A;  2PNZ B;  1I94 E;  4JYA E;  4X65 E;  5JEA F;  3T1Y I;  1Z0E A;  1FNM A;  2ZM6 I;  2JT2 A;  2F4V I;  2JEA B;  2O1V A;  2Z5E A;  4JI6 E;  1Z0W A;  3ZZ0 A;  1WUU A;  2JEB B;  4MYT A;  4FN5 A;  1DAR A;  4IFD B;  3V2U C;  2C39 B;  4X64 I;  1NHH A;  2PO2 B;  2AJ4 A;  3WU5 A;  4M1K A;  5A2Q C;  3QT8 A;  3J80 Q;  4DV0 I;  5JEA E;  1Z0T A;  4LF6 I;  4LCH A;  1XNQ I;  2E5L I;  4MYU A;  3J7A M;  1ZM4 A;  4Z7Y A;  5DRO A;  1N36 I;  2A2C A;  4DV6 I;  2R3V A;  5LMN I;  4MQY A;  4DR2 I;  2E5L E;  3WU3 A;  3Q6M A;  2HKE A;  4IZK B;  4DV1 E;  1HNW I;  1NHJ A;  1Y6Z A;  2PO1 A;  5DRR A;  2HHH E;  4IFD C;  4DPT A;  4JI5 I;  4JV5 E;  2HFS A;  4LPF A;  4DUZ I;  2NPF A;  1QZR A;  3J81 C;  3LPS A;  4WUD A;  1H7U A;  2J65 A;  4DV1 I;  2UUB E;  4GKJ E;  1FI4 A;  5JEA D;  4LFA I;  2UU9 E;  1IBL I;  3P76 A;  2NN6 C;  4DR7 I;  3PYD A;  4IZK A;  3M85 D;  2WNR A;  5C0X E;  4OO1 B;  2NN6 D;  1PKP A;  1Y5Y A;  3U1K A;  1H7S A;  2Z5B B;  2UU9 I;  5EL9 A;  4LF7 I;  2UXD I;  3QT7 A;  4OX9 I;  2GQ0 A;  5EKW A;  1Z0C A;  3U1Y A;  3LTO A;  3P3G A;  3PS3 A;  2IOQ A;  1A6F A;  2PNM A;  4KQV A;  4LF6 E;  4LF9 E;  3J81 Q;  4AM3 A;  2BR2 A;  2UUC I;  4DR6 I;  4YHH I;  2BM0 A;  2CGE A;  4DV6 E;  1Z0B A;  3P06 A;  4QNK A;  2O1U A;  3ZKD A;  2NN6 A;  2VF3 A;  1FJG I;  2BM1 A;  1K47 A;  4ZVI A;  5A2Q Q;  1J5E I;  4B3R E;  5FLX C;  5LMU E;  2Q2E B;  4ISA A;  2R42 A;  4B3T I;  2PNZ A;  2NN6 B;  2WW4 A;  5JEA C;  1FJG E;  3PYF A;  3ZZT A;  1IBK E;  4FWH A;  3Q1Q A;  4LCG A;  2PNL A;  1XNR E;  2C37 A;  4IFD F;  3CWV A;  2OI2 A;  2UXD E;  3T1H E;  1XMO E;  4X62 I;  2UXC E;  2X36 A;  5ELW A;  1EA6 A;  4JI8 I;  5K36 F;  3P3E A;  2F4V E;  4X66 E;  2GO3 A;  1N33 I;  4JI6 I;  1H73 A;  3KRN A;  1HNZ I;  1USU A;  4B3S I;  3PS2 A;  4DUZ E;  4OO1 F;  2NN6 E;  4IZJ B;  5C0X B;  4OO1 E;  4NXN I;  5BR8 I;  3HJC A;  2VES A;  1H72 C;  1HK7 A;  4NBQ A;  1HR0 I;  2O1T A;  2X7I A;  1VIS A;  4JI1 E;  4DUY E;  1IBM I;  4JI4 E;  2C37 B;  1S16 A;  2V34 A;  1OYR A;  4LF5 E;  5BR8 E;  1Z59 A;  1MX0 A;  1N34 I;  4FW3 A;  1MG7 A;  3QT6 A;  3J7A G;  1XNR I;  5LMN E;  1ELO A;  3LNU A;  4MU4 A;  3B82 A;  1BKN A;  2BA0 G;  1H74 A;  3PRY A;  2UUA I;  5K36 C;  1E3P A;  4DR5 I;  5FWK A;  1Z5C A;  2PO2 A;  4NXM E;  3GON A;  4GKJ I;  5JEA B;  4JI0 E;  1ZXM A;  4IZJ D;  4JI2 I;  5LMU I;  4DR4 E;  1ZM2 A;  1D6T A;  4OO1 A;  3D4J A;  3B8H A;  5LL6 R;  3CDJ A;  2HK3 A;  3ZM7 A;  1IBK I;  2ZBK B;  3OTO E;  4IS9 A;  3JAM C;  2GO4 A;  4DV3 I;  4MU1 A;  4UT4 A;  4PRV A;  1OYP A;  4JI3 I;  3HKM A;  2Z5C B;  3GLL A;  4FW9 A;  1UEK A;  2O1W A;  1XMQ I;  4EMD A;  3QT5 A;  1UDS A;  4YHH E;  2BA1 D;  5IWA E;  1Y60 A;  3WU4 A;  1NZ0 A;  1HNZ E;  4B3S E;  1Z0V A;  4FW5 A;  4AQY E;  2DEJ A;  2C38 B;  4DR5 E;  2JEB A;  1HNW E;  5DNX A;  4U3B A;  1FWK A;  4HAC B;  1Z0G A;  2ZM6 E;  4JI1 I;  4B3M E;  4BA2 B;  1MU5 A;  1B63 A;  1HR0 E;  2A2D A;  4DR4 I;  5DNL A;  5IT9 Q;  4PRX A;  4AIM A;  4LFC I;  1FWL A;  2ZIT A;  1IBL E;  1U2R A;  1N32 I;  2J7K A;  3F0N A;  4DV0 E;  3B78 A;  5C0X C;  1N34 E;  2JE6 B;  1XNQ E;  4IFD A;  3M7N G;  3DD6 A;  4HAC A;  2UUA E;  4DR1 E;  4X66 I;  3NZK A;  4JI7 I;  4DR2 E;  4XTJ A;  3V5R A;  3ZKB A;  3K17 A;  1HNX I;  4GKK E;  3J80 C;  4NXM I;  3UHM A;  4FW4 A;  4JI7 E;  4DU8 A;  1E3H A;  3L7Z A;  4ED4 A;  4GQU A;  4DV4 E;  1ZM9 A;  4AQY I;  4DR3 I;  4WUC A;  1S4E A;  4LOM A;  1KKH A;  4KHP E;  4DV4 I;  4BA1 B;  2BA0 D;  3ZZU A;  3CDI A;  4IZJ A;  4DR7 E;  4AID A;  4B3M I;  1N0V C;  2CVE A;  5GMD A;  1R6M A;  2WP8 A;  1RRE A;  4OX9 E;  4USK A;  4KHP I;  4DPY A;  2EFG A;  1B62 A;  4P7A A;  2V2Z A;  4K0K E;  2CG9 A;  1NHI A;  3H4L A;  5K36 A;  2HFU A;  1XXE A;  2Z5C A;  4LF9 I;  1VI7 A;  4DR1 I;  2HHH I; 
#chains in the Genus database with same CATH homology
 4HY1 A;  2UUC E;  2VQF I;  5IT9 C;  4YY3 E;  2VQE I;  4DPX A;  1Z5B A;  3PYG A;  1N33 E;  3K1J A;  5GME A;  1KTV A;  3T1Y E;  1J5E E;  4YY3 I;  2GS8 A;  1RR9 A;  4HXZ A;  4LF8 E;  4DPW A;  4DR3 E;  4LF4 E;  4DU7 A;  3K85 A;  4LF5 I;  4LF8 I;  5IWA I;  2E1R A;  5FLX Q;  4X62 E;  2UXC I;  4R1F A;  4LFB E;  3HUL A;  2XEX A;  4DR6 E;  4K0K I;  4FWD A;  1EI1 A;  2UXB I;  1XMO I;  1ZM3 A;  2IOP A;  3Q6N A;  1HNX E;  4GKK I;  1USV A;  4DV5 E;  2V2Q A;  2HKJ A;  2LJP A;  1I94 I;  4B3R I;  2VQF E;  1ZXN A;  2V2V A;  4NXN E;  4B3T E;  4JYA I;  4DV2 I;  4I3H A;  4JI2 E;  4DV5 I;  2VQE E;  1IBM E;  4JI4 I;  5L3J A;  2HK2 A;  4HYM A;  4X64 E;  2UUB I;  1Y4S A;  4Z7C A;  1Y4U A;  4LF4 I;  4DV3 E;  1PIE A;  3PYE A;  1N36 E;  4URL A;  4JI8 E;  2V8P A;  4LF7 E;  2UXB E;  1PVG A;  4X65 I;  1KIJ A;  4JI0 I;  1OJ4 A;  4P52 A;  4JI5 E;  1XHK A;  4JV5 I;  1FKA E;  4DPU A;  4WUB A;  2CZ9 A;  3M6A A;  4JG4 A;  4FWG A;  1N0U A;  4DUY I;  4DV2 E;  4LFA E;  4RPF A;  3OTO I;  4DV7 I;  4USM A;  4JI3 E;  4LFC E;  2Z5B A;  4UTG A;  4LFB I;  1N32 E;  1XMQ E;  3WU6 A;  4DV7 E;  1Z5A A;  1KVK A;  4N3O A;  3T1H I;  4DXL A;  3JAM Q;  4PU9 A;  2DEI A;  2BV3 A;  1I94 E;  4JYA E;  4X65 E;  3T1Y I;  1Z0E A;  1FNM A;  2ZM6 I;  2F4V I;  2O1V A;  2Z5E A;  4JI6 E;  1Z0W A;  3ZZ0 A;  1WUU A;  4MYT A;  4FN5 A;  1DAR A;  3V2U C;  4X64 I;  1NHH A;  2AJ4 A;  3WU5 A;  4M1K A;  5A2Q C;  3QT8 A;  3J80 Q;  4DV0 I;  1Z0T A;  4LF6 I;  1XNQ I;  2E5L I;  4MYU A;  3J7A M;  1ZM4 A;  4Z7Y A;  1N36 I;  2A2C A;  4DV6 I;  2R3V A;  5LMN I;  4DR2 I;  2E5L E;  3WU3 A;  3Q6M A;  2HKE A;  4IZK B;  4DV1 E;  1HNW I;  1NHJ A;  1Y6Z A;  2HHH E;  4DPT A;  4JI5 I;  4JV5 E;  2HFS A;  4DUZ I;  2NPF A;  3J81 C;  1QZR A;  3LPS A;  4WUD A;  1H7U A;  4DV1 I;  2UUB E;  4GKJ E;  1FI4 A;  4LFA I;  2UU9 E;  1IBL I;  4DR7 I;  3PYD A;  4IZK A;  1PKP A;  1H7S A;  2Z5B B;  2UU9 I;  4LF7 I;  2UXD I;  3QT7 A;  4OX9 I;  2GQ0 A;  1Z0C A;  3LTO A;  2IOQ A;  1A6F A;  2PNM A;  4KQV A;  4LF6 E;  4LF9 E;  3J81 Q;  2UUC I;  4DR6 I;  4YHH I;  2BM0 A;  2CGE A;  4DV6 E;  1Z0B A;  3P06 A;  2O1U A;  3ZKD A;  2VF3 A;  1FJG I;  2BM1 A;  1K47 A;  4ZVI A;  5A2Q Q;  1J5E I;  4B3R E;  5FLX C;  5LMU E;  2Q2E B;  2R42 A;  4B3T I;  2WW4 A;  1FJG E;  3PYF A;  3ZZT A;  1IBK E;  4FWH A;  3Q1Q A;  2PNL A;  1XNR E;  3CWV A;  2OI2 A;  2UXD E;  3T1H E;  1XMO E;  4X62 I;  2UXC E;  2X36 A;  1EA6 A;  4JI8 I;  2F4V E;  4X66 E;  1N33 I;  4JI6 I;  1H73 A;  1HNZ I;  4B3S I;  1USU A;  4DUZ E;  4IZJ B;  4NXN I;  5BR8 I;  3HJC A;  1H72 C;  1HK7 A;  1HR0 I;  2O1T A;  2X7I A;  1VIS A;  4JI1 E;  4DUY E;  1IBM I;  4JI4 E;  1S16 A;  2V34 A;  4LF5 E;  5BR8 E;  1Z59 A;  1MX0 A;  1N34 I;  1MG7 A;  3QT6 A;  3J7A G;  1XNR I;  5LMN E;  1ELO A;  3LNU A;  3B82 A;  1BKN A;  2UUA I;  1H74 A;  3PRY A;  4DR5 I;  5FWK A;  1Z5C A;  4NXM E;  3GON A;  4GKJ I;  4JI0 E;  1ZXM A;  4IZJ D;  4JI2 I;  5LMU I;  4DR4 E;  1ZM2 A;  1D6T A;  3D4J A;  3B8H A;  5LL6 R;  2HK3 A;  3ZM7 A;  1IBK I;  2ZBK B;  3OTO E;  3JAM C;  4DV3 I;  4UT4 A;  4PRV A;  4JI3 I;  2Z5C B;  4FW9 A;  1UEK A;  2O1W A;  1XMQ I;  4EMD A;  3QT5 A;  4YHH E;  5IWA E;  3WU4 A;  1NZ0 A;  1HNZ E;  4B3S E;  1Z0V A;  4AQY E;  2DEJ A;  4DR5 E;  1HNW E;  1FWK A;  4HAC B;  1Z0G A;  2ZM6 E;  4JI1 I;  4B3M E;  1MU5 A;  1B63 A;  1HR0 E;  2A2D A;  4DR4 I;  5IT9 Q;  4PRX A;  4LFC I;  1FWL A;  2ZIT A;  1IBL E;  1U2R A;  1N32 I;  2J7K A;  3F0N A;  4DV0 E;  3B78 A;  1N34 E;  1XNQ E;  4HAC A;  2UUA E;  4DR1 E;  4X66 I;  4JI7 I;  4DR2 E;  4XTJ A;  3V5R A;  3ZKB A;  3K17 A;  1HNX I;  4GKK E;  3J80 C;  4NXM I;  4JI7 E;  4DU8 A;  4ED4 A;  4DV4 E;  1ZM9 A;  4AQY I;  4DR3 I;  4WUC A;  1S4E A;  1KKH A;  4KHP E;  4DV4 I;  3ZZU A;  4IZJ A;  4DR7 E;  4B3M I;  1N0V C;  5GMD A;  1RRE A;  4OX9 E;  4USK A;  4KHP I;  4DPY A;  2EFG A;  1B62 A;  4P7A A;  2V2Z A;  4K0K E;  2CG9 A;  1NHI A;  3H4L A;  2HFU A;  2Z5C A;  4LF9 I;  4DR1 I;  2HHH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...