4JG4A

Ligand concentration regulates the pathways of coupled protein folding and binding
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
AHLKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQAENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKAASQLTYEETKKSLQHLWRKSSLYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component
publication title Ligand concentration regulates the pathways of coupled protein folding and binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 37
structure length 114
sequence length 114
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jg4A00
3B8HA 4DR5E 4X64E 1I94I 5BR8E 4LF7I 1HNXI 1FWLA 4B3RI 1Z0TA 5LMUI 4JI0I 4LFBE 4B3TE 1MG7A 4LF4E 1KKHA 1IBLI 4DUZE 3D4JA 3B78A 1HNWI 1XNQE 1B63A 4JI3I 1A6FA 2UUAE 3LNUA 2V34A 1DARA 3WU3A 4LFCE 1N36I 4P52A 1H7SA 4LF8I 4DV4E 4DR2I 1H74A 4DV5E 4JG4A 4JV5I 3J80Q 4LFAE 4X62E 1FJGI 4JI1E 2E5LI 4UTGA 3PYGA 4PU9A 2E1RA 1N33E 1WUUA 2X36A 3QT8A 2VQEI 1VISA 4DV2I 2LJPA 4DPWA 3K1JA 4FN5A 2R42A 4XTJA 1FKAE 4FWGA 2J7KA 4DV0E 4DR7I 3K17A 4DV6I 4ZVIA 3GONA 2HHHI 3V2UC 4Z7YA 4MYUA 2UUCI 4JYAI 3WU4A 4WUBA 3M6AA 4LF5E 4YY3E 3HULA 1HNZI 2ZM6I 2HK3A 1KTVA 4LF9E 3H4LA 4WUCA 4JI4I 1Z5CA 2V2VA 3ZM7A 4AQYE 1XMQI 4JI6I 1EA6A 2UXDI 4DR3E 4FWHA 1XMOE 5GMEA 2VQFE 4PRVA 4X65E 1IBME 4EMDA 3ZZUA 4DV1E 4DUYE 4HY1A 4NXNI 1FWKA 4JI2I 1ZM4A 3PYDA 4P7AA 1QZRA 3Q1QA 1FNMA 1KIJA 4DV3E 2HKJA 4X66I 5FLXC 4DR4E 4B3SI 2NPFA 4ED4A 3OTOI 3QT7A 3JAMC 4GKKE 2EFGA 3J81C 1EI1A 3WU5A 1HR0E 2V2ZA 2UXCI 4YHHE 2UUBE 4JI8I 1U2RA 1N32I 1K47A 2BM0A 2UXBE 1Z5AA 5LMNI 1XNRI 4DPYA 4JI7I 1I94E 4DR6I 1ZXNA 4Z7CA 4LF7E 4HYMA 1HNXE 4HXZA 4K0KI 4B3RE 5LMUE 4JI0E 5A2QC 2ZBKB 2UU9I 1OJ4A 1IBLE 4GKJI 1J5EI 1N0VC 5IWAI 4KHPI 1IBKI 1HNWE 4JI5I 4JI3E 3F0NA 1Z0EA 4LF6I 3T1HI 2DEJA 1BKNA 1PVGA 2DEIA 1N36E 4LF8E 2GS8A 1NHHA 4DXLA 1Z0VA 4KQVA 4DR2E 4B3MI 2BV3A 4JV5E 1NHIA 2A2DA 1FJGE 2E5LE 4NXMI 1Z5BA 3LTOA 4RPFA 4DR1I 4WUDA 1N34I 3T1YI 2VQEE 4M1KA 4DV2E 1D6TA 2F4VI 1RR9A 4I3HA 4OX9I 4DR5I 4X64I 3ZKBA 2ZITA 4MYTA 1Z0CA 5BR8I 2HFSA 4DR7E 1KVKA 1S16A 4DV6E 4LFBI 2HHHE 4B3TI 1NHJA 4LF4I 2HK2A 4DUZI 3LPSA 4R1FA 1H7UA 3ZKDA 1XNQI 1ZM3A 2UUCE 4JYAE 2UUAI 4HACB 4HACA 4LFCI 1NZ0A 1S4EA 1HNZE 2ZM6E 5GMDA 4DV4I 3QT6A 3QT5A 4DV7E 2HKEA 2V2QA 4JI4E 3B82A 4DV5I 1PIEA 1XMQE 5FLXQ 2A2CA 2WW4A 1UEKA 4JI6E 2AJ4A 4LFAI 4X62I 2UXDE 4JI1I 1ZXMA 1ELOA 1N33I 4DU8A 4PRXA 3JAMQ 3J81Q 4NXNE 1Z59A 4JI2E 2BM1A 3J7AM 3ZZTA 1XHKA 2Q2EB 4X66E 4B3SE 3J80C 2R3VA 3PYFA 4UT4A 4DV0I 5IT9C 3OTOE 2CZ9A 2XEXA 4DPUA 5A2QQ 2UXCE 5IT9Q 2X7IA 4JI8E 1N0UA 1N32E 4LF5I 4YY3I 3WU6A 5LMNE 3PYEA 4DU7A 1XNRE 4USKA 4URLA 4JI7E 2V8PA 4DR6E 4LF9I 1MX0A 3ZZ0A 4K0KE 1H73A 4AQYI 1ZM2A 2VF3A 4DR3I 2UU9E 1XMOI 4USMA 1Z0GA 2VQFI 4GKJE 1PKPA 1H72C 1J5EE 1Z0BA 4X65I 1IBMI 5IWAE 4KHPE 1IBKE 4DV1I 4DUYI 4JI5E 4FWDA 4DPXA 4LF6E 1Z0WA 3T1HE 1MU5A 4DV3I 1ZM9A 4DR4I 3J7AG 4DPTA 4B3ME 1B62A 4DV7I 4GKKI 2OI2A 4NXME 3V5RA 4FW9A 5LL6R 1HR0I 5L3JA 4DR1E 1N34E 3T1YE 4YHHI 2UUBI 2HFUA 1FI4A 2F4VE 2UXBI 3CWVA 4OX9E 1RREA
chains in the Genus database with same CATH superfamily
5DRPA 3B8HA 4DR5E 2NN6E 4X64E 5ELWA 1I94I 4MQYA 4GQUA 5BR8E 4LF7I 1HNXI 1FWLA 4B3RI 1Z0TA 1Y4UA 5LMUI 4JI0I 3DD6A 4LFBE 4B3TE 1MG7A 4LF4E 1KKHA 1IBLI 4DUZE 4BA2B 4OKGA 2Z5BA 3B78A 3D4JA 1HNWI 1XNQE 1B63A 2F1DA 5JEAE 4JI3I 5EKWA 3P76A 1Y4SA 1A6FA 4IFDB 2UUAE 3LNUA 2V34A 1DARA 3WU3A 4OO1B 4LFCE 2NN6A 1N36I 4P52A 1H7SA 5EL9A 4LF8I 3P3GA 3K85A 4DV4E 2O1TA 4DR2I 3P3CA 5C0XE 1H74A 2NN6F 4DV5E 4NBQA 4JG4A 4JV5I 3Q6MA 3J80Q 4LFAE 3M7ND 2C39A 4X62E 1FJGI 2E5LI 4JI1E 3KRNA 4UTGA 3PYGA 4PU9A 1USVA 2E1RA 1N33E 2C37A 1WUUA 2X36A 5JEAA 3QT8A 2VQEI 2IERA 2NN6C 1VISA 4DV2I 1USUA 2LJPA 4DPWA 3K1JA 2JEAA 1HK7A 4FN5A 2R42A 1UDOA 4XTJA 1FKAE 4FWGA 2J7KA 4DV0E 4DR7I 3K17A 4DV6I 2BR2B 4MU0A 4ZVIA 3GONA 2BR2A 2HHHI 1Y5YA 2PO2A 5C0XF 4IS9A 3V2UC 4Z7YA 4MYUA 3CDIA 4OZEA 5DNXA 2UUCI 3PS3A 4FW7A 4JYAI 3WU4A 4LOMA 2Z5CB 3M6AA 4WUBA 5C0XC 1VI7A 4LF5E 4FW4A 5K36F 4YY3E 3HULA 1HNZI 2C38B 2ZM6I 3U1YA 2HK3A 1KTVA 4LF9E 2JEBB 3H4LA 4WUCA 4JI4I 2PO0B 1Z5CA 4MDTA 2V2VA 3ZM7A 4AQYE 1XMQI 5K36C 4JI6I 1EA6A 2UXDI 4DR3E 4FWHA 1XMOE 5GMEA 2VQFE 4PRVA 4X65E 1IBME 3L7ZB 4IFDD 4EMDA 3ZZUA 4DV1E 4DUYE 4HY1A 4NXNI 4IFDE 4OO1D 1FWKA 1OYSA 4JI2I 1ZM4A 2O1UA 4OO1E 2IOPA 3PYDA 4P7AA 1QZRA 3Q1QA 1FNMA 1KIJA 4DV3E 2HKJA 4X66I 5FLXC 4DR4E 3CDJA 4B3SI 2NPFA 3PRYA 2WNRB 3PS1A 4ED4A 3OTOI 4BA2A 3QT7A 3JAMC 4GKKE 2EFGA 3J81C 1EI1A 3WU5A 1HR0E 2V2ZA 2UXCI 4YHHE 4IFDA 2UUBE 2PO1B 4JI8I 4OO1A 1U2RA 3Q6NA 1N32I 1K47A 4LCHA 2BM0A 2UXBE 1Z5AA 5LMNI 1XNRI 4DPYA 4JI7I 1I94E 4DR6I 1ZXNA 4AM3A 4Z7CA 4LF7E 4HYMA 1HNXE 4HXZA 4K0KI 4B3RE 3P3EA 5LMUE 4JI0E 5A2QC 2ZBKB 2UU9I 3M7NG 1UDNA 1OJ4A 1IBLE 4GKJI 1J5EI 1N0VC 5IWAI 4KHPI 1IBKI 1HNWE 5JEAF 4JI5I 4JI3E 3M85D 3F0NA 3GMEA 1Z0EA 2BA0D 4IZKB 2PNLA 4LCFA 4LF6I 4FW5A 3T1HI 2DEJA 1Y6ZA 1BKNA 4LPFA 4MU1A 1PVGA 5K36D 4U3DA 2DEIA 1N36E 4LF8E 2JT2A 2BA0G 2GS8A 5JEAC 1NHHA 3HJCA 4IZJD 3PS2A 1Z0VA 4DXLA 1OYPA 4KQVA 4DR2E 4B3MI 2O1WA 2BV3A 4JV5E 1NHIA 2A2DA 1FJGE 2E5LE 4NXMI 1Z5BA 3LTOA 4RPFA 4DR1I 2PNMA 1R6MA 4WUDA 1YHCA 1N34I 3T1YI 1UDQA 2VQEE 2AE8A 2WP8B 2Z5CA 5DRQA 4M1KA 4DV2E 2CVEA 1D6TA 2F4VI 1RR9A 4I3HA 4OX9I 2C38A 3U1KA 5K36B 4DR5I 4X64I 2JEBA 3ZKBA 2PO0A 4IZJB 2ZITA 4MYTA 1RHYA 1Z0CA 5BR8I 2HFSA 4DR7E 1KVKA 1S16A 2J65A 2Z5EA 4DV6E 5DRRA 2JE6B 4LFBI 2HHHE 4B3TI 1NHJA 4LF4I 2JE6A 2HK2A 4DUZI 3L7ZA 3LPSA 4R1FA 2PNZB 2GQ0A 1H7UA 3ZKDA 1XNQI 5DNLA 1ZM3A 2UUCE 4JYAE 2UUAI 1Y60A 4HACB 4HACA 4LFCI 1NZ0A 1S4EA 1HNZE 2ZM6E 1P42A 3GCMA 2CGEA 5GMDA 2WNRA 4DV4I 3QT6A 2NN6D 3QT5A 4DV7E 2HKEA 2V2QA 4JI4E 3B82A 4DV5I 1PIEA 1XMQE 3HKMA 5FLXQ 2A2CA 2WW4A 1UEKA 4JI6E 2AJ4A 4LFAI 4N3OA 2GO4A 4X62I 3GLLA 4JI1I 2UXDE 1ZXMA 4MU3A 1ELOA 1N33I 4DU8A 2PO1A 4PRXA 3JAMQ 1XXEA 2Z5BB 3H1CA 3J81Q 4NXNE 4IFDF 1Z59A 5JEAD 4JI2E 1YH8A 4OO1F 2BM1A 3J7AM 1R6LA 3ZZTA 4AIDA 1XHKA 2Q2EB 4MU4A 4X66E 2NN6B 4B3SE 3J80C 4IFDC 2R3VA 3PYFA 4UT4A 1E3HA 4DV0I 4OO1C 5IT9C 1UDSA 5DROA 3OTOE 5C0XD 4FW6A 2CZ9A 1E3PA 2O3ZA 2XEXA 4DPUA 2C39B 5A2QQ 2UXCE 2IOQA 5IT9Q 4IZKA 2C37B 4U3BA 2X7IA 5JEAB 3NZKA 4JI8E 1N0UA 3M85G 1N32E 4LF5I 5K36E 4YY3I 3WU6A 4BA1B 5LMNE 4FW3A 3PYEA 4DU7A 1XNRE 4USKA 4URLA 4BA1A 2JEAB 4JI7E 2V8PA 4DR6E 4LF9I 1MX0A 3ZZ0A 4K0KE 1H73A 4AQYI 5C0XB 1ZM2A 2VF3A 4AIMA 2GO3A 5C0XA 4DR3I 2UU9E 1XMOI 4USMA 1Z0GA 2VQFI 4GKJE 1PKPA 4QNKA 1H72C 1J5EE 1Z0BA 2PO2B 4X65I 1IBMI 5IWAE 2WP8A 4ISAA 4KHPE 1IBKE 4LCGA 3P06A 4DV1I 4DUYI 4JI5E 1OYRA 4FWDA 4DPXA 2O1VA 5K36A 4LF6E 1Z0WA 3T1HE 2BA1D 4IZJA 2CG9A 1MU5A 4DV3I 3B4TA 1ZM9A 4DR4I 2VESA 3J7AG 4DPTA 4QNJA 2BA1G 4B3ME 1B62A 4DV7I 2IESA 5FWKA 2PNZA 4GKKI 4J3DA 2OI2A 4NXME 3V5RA 4FW9A 5LL6R 3UHMA 1HR0I 5L3JA 4DR1E 1N34E 3T1YE 4YHHI 2UUBI 2HFUA 1FI4A 2F4VE 2UXBI 3CWVA 4OX9E 1RREA
chains in the Genus database with same CATH topology
3B8HA 4DR5E 4X64E 1I94I 5BR8E 4LF7I 1HNXI 1FWLA 4B3RI 1Z0TA 1Y4UA 5LMUI 4JI0I 4LFBE 4B3TE 1MG7A 4LF4E 1KKHA 1IBLI 4DUZE 2Z5BA 3B78A 3D4JA 1HNWI 1XNQE 1B63A 4JI3I 1Y4SA 1A6FA 2UUAE 3LNUA 2V34A 1DARA 3WU3A 4LFCE 1N36I 4P52A 1H7SA 4LF8I 3K85A 4DV4E 2O1TA 4DR2I 1H74A 4DV5E 4JG4A 4JV5I 3Q6MA 3J80Q 4LFAE 4X62E 1FJGI 2E5LI 4JI1E 4UTGA 3PYGA 4PU9A 1USVA 2E1RA 1N33E 1WUUA 2X36A 3QT8A 2VQEI 1VISA 4DV2I 1USUA 2LJPA 4DPWA 3K1JA 1HK7A 4FN5A 2R42A 4XTJA 1FKAE 4FWGA 2J7KA 4DV0E 4DR7I 3K17A 4DV6I 4ZVIA 3GONA 2HHHI 3V2UC 4Z7YA 4MYUA 2UUCI 4JYAI 3WU4A 2Z5CB 3M6AA 4WUBA 4LF5E 4YY3E 3HULA 1HNZI 2ZM6I 2HK3A 1KTVA 4LF9E 3H4LA 4WUCA 4JI4I 1Z5CA 2V2VA 3ZM7A 4AQYE 1XMQI 4JI6I 1EA6A 2UXDI 4DR3E 4FWHA 1XMOE 5GMEA 2VQFE 4PRVA 4X65E 1IBME 4EMDA 3ZZUA 4DV1E 4DUYE 4HY1A 4NXNI 1FWKA 4JI2I 1ZM4A 2O1UA 2IOPA 3PYDA 4P7AA 1QZRA 3Q1QA 1FNMA 1KIJA 4DV3E 2HKJA 4X66I 5FLXC 4DR4E 4B3SI 2NPFA 3PRYA 4ED4A 3OTOI 3QT7A 3JAMC 4GKKE 2EFGA 3J81C 1EI1A 3WU5A 1HR0E 2V2ZA 2UXCI 4YHHE 2UUBE 4JI8I 1U2RA 3Q6NA 1N32I 1K47A 2BM0A 2UXBE 1Z5AA 5LMNI 1XNRI 4DPYA 4JI7I 1I94E 4DR6I 1ZXNA 4Z7CA 4LF7E 4HYMA 1HNXE 4HXZA 4K0KI 4B3RE 5LMUE 4JI0E 5A2QC 2ZBKB 2UU9I 1OJ4A 1IBLE 4GKJI 1J5EI 1N0VC 5IWAI 4KHPI 1IBKI 1HNWE 4JI5I 4JI3E 3F0NA 1Z0EA 4IZKB 2PNLA 4LF6I 3T1HI 2DEJA 1Y6ZA 1BKNA 1PVGA 2DEIA 1N36E 4LF8E 2GS8A 1NHHA 3HJCA 4IZJD 4DXLA 1Z0VA 4KQVA 4DR2E 4B3MI 2O1WA 2BV3A 4JV5E 1NHIA 2A2DA 1FJGE 2E5LE 4NXMI 1Z5BA 3LTOA 4RPFA 4DR1I 2PNMA 4WUDA 1N34I 3T1YI 2VQEE 2Z5CA 4M1KA 4DV2E 1D6TA 2F4VI 1RR9A 4I3HA 4OX9I 4DR5I 4X64I 3ZKBA 4IZJB 2ZITA 4MYTA 1Z0CA 5BR8I 2HFSA 4DR7E 1KVKA 1S16A 2Z5EA 4DV6E 4LFBI 2HHHE 4B3TI 1NHJA 4LF4I 2HK2A 4DUZI 3LPSA 4R1FA 2GQ0A 1H7UA 3ZKDA 1XNQI 1ZM3A 2UUCE 4JYAE 2UUAI 4HACB 4HACA 4LFCI 1NZ0A 1S4EA 1HNZE 2ZM6E 2CGEA 5GMDA 4DV4I 3QT6A 3QT5A 4DV7E 2HKEA 2V2QA 4JI4E 3B82A 4DV5I 1PIEA 1XMQE 5FLXQ 2A2CA 2WW4A 1UEKA 4JI6E 2AJ4A 4LFAI 4N3OA 4X62I 2UXDE 4JI1I 1ZXMA 1ELOA 1N33I 4DU8A 4PRXA 3JAMQ 2Z5BB 3J81Q 4NXNE 1Z59A 4JI2E 2BM1A 3J7AM 3ZZTA 1XHKA 2Q2EB 4X66E 4B3SE 3J80C 2R3VA 3PYFA 4UT4A 4DV0I 5IT9C 3OTOE 2CZ9A 2XEXA 4DPUA 5A2QQ 2UXCE 2IOQA 5IT9Q 4IZKA 2X7IA 4JI8E 1N0UA 1N32E 4LF5I 4YY3I 3WU6A 5LMNE 3PYEA 4DU7A 1XNRE 4USKA 4URLA 4JI7E 2V8PA 4DR6E 4LF9I 1MX0A 3ZZ0A 4K0KE 1H73A 4AQYI 1ZM2A 2VF3A 4DR3I 2UU9E 1XMOI 4USMA 1Z0GA 2VQFI 4GKJE 1PKPA 1H72C 1J5EE 1Z0BA 4X65I 1IBMI 5IWAE 4KHPE 1IBKE 3P06A 4DV1I 4DUYI 4JI5E 4FWDA 4DPXA 2O1VA 4LF6E 1Z0WA 3T1HE 4IZJA 2CG9A 1MU5A 4DV3I 1ZM9A 4DR4I 3J7AG 4DPTA 4B3ME 1B62A 4DV7I 5FWKA 4GKKI 2OI2A 4NXME 3V5RA 4FW9A 5LL6R 1HR0I 5L3JA 4DR1E 1N34E 3T1YE 4YHHI 2UUBI 2HFUA 1FI4A 2F4VE 2UXBI 3CWVA 4OX9E 1RREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8H A;  4DR5 E;  4X64 E;  1I94 I;  5BR8 E;  4LF7 I;  1HNX I;  1FWL A;  4B3R I;  1Z0T A;  5LMU I;  4JI0 I;  4LFB E;  4B3T E;  1MG7 A;  4LF4 E;  1KKH A;  1IBL I;  4DUZ E;  3D4J A;  3B78 A;  1HNW I;  1XNQ E;  1B63 A;  4JI3 I;  1A6F A;  2UUA E;  3LNU A;  2V34 A;  1DAR A;  3WU3 A;  4LFC E;  1N36 I;  4P52 A;  1H7S A;  4LF8 I;  4DV4 E;  4DR2 I;  1H74 A;  4DV5 E;  4JG4 A;  4JV5 I;  3J80 Q;  4LFA E;  4X62 E;  1FJG I;  4JI1 E;  2E5L I;  4UTG A;  3PYG A;  4PU9 A;  2E1R A;  1N33 E;  1WUU A;  2X36 A;  3QT8 A;  2VQE I;  1VIS A;  4DV2 I;  2LJP A;  4DPW A;  3K1J A;  4FN5 A;  2R42 A;  4XTJ A;  1FKA E;  4FWG A;  2J7K A;  4DV0 E;  4DR7 I;  3K17 A;  4DV6 I;  4ZVI A;  3GON A;  2HHH I;  3V2U C;  4Z7Y A;  4MYU A;  2UUC I;  4JYA I;  3WU4 A;  4WUB A;  3M6A A;  4LF5 E;  4YY3 E;  3HUL A;  1HNZ I;  2ZM6 I;  2HK3 A;  1KTV A;  4LF9 E;  3H4L A;  4WUC A;  4JI4 I;  1Z5C A;  2V2V A;  3ZM7 A;  4AQY E;  1XMQ I;  4JI6 I;  1EA6 A;  2UXD I;  4DR3 E;  4FWH A;  1XMO E;  5GME A;  2VQF E;  4PRV A;  4X65 E;  1IBM E;  4EMD A;  3ZZU A;  4DV1 E;  4DUY E;  4HY1 A;  4NXN I;  1FWK A;  4JI2 I;  1ZM4 A;  3PYD A;  4P7A A;  1QZR A;  3Q1Q A;  1FNM A;  1KIJ A;  4DV3 E;  2HKJ A;  4X66 I;  5FLX C;  4DR4 E;  4B3S I;  2NPF A;  4ED4 A;  3OTO I;  3QT7 A;  3JAM C;  4GKK E;  2EFG A;  3J81 C;  1EI1 A;  3WU5 A;  1HR0 E;  2V2Z A;  2UXC I;  4YHH E;  2UUB E;  4JI8 I;  1U2R A;  1N32 I;  1K47 A;  2BM0 A;  2UXB E;  1Z5A A;  5LMN I;  1XNR I;  4DPY A;  4JI7 I;  1I94 E;  4DR6 I;  1ZXN A;  4Z7C A;  4LF7 E;  4HYM A;  1HNX E;  4HXZ A;  4K0K I;  4B3R E;  5LMU E;  4JI0 E;  5A2Q C;  2ZBK B;  2UU9 I;  1OJ4 A;  1IBL E;  4GKJ I;  1J5E I;  1N0V C;  5IWA I;  4KHP I;  1IBK I;  1HNW E;  4JI5 I;  4JI3 E;  3F0N A;  1Z0E A;  4LF6 I;  3T1H I;  2DEJ A;  1BKN A;  1PVG A;  2DEI A;  1N36 E;  4LF8 E;  2GS8 A;  1NHH A;  4DXL A;  1Z0V A;  4KQV A;  4DR2 E;  4B3M I;  2BV3 A;  4JV5 E;  1NHI A;  2A2D A;  1FJG E;  2E5L E;  4NXM I;  1Z5B A;  3LTO A;  4RPF A;  4DR1 I;  4WUD A;  1N34 I;  3T1Y I;  2VQE E;  4M1K A;  4DV2 E;  1D6T A;  2F4V I;  1RR9 A;  4I3H A;  4OX9 I;  4DR5 I;  4X64 I;  3ZKB A;  2ZIT A;  4MYT A;  1Z0C A;  5BR8 I;  2HFS A;  4DR7 E;  1KVK A;  1S16 A;  4DV6 E;  4LFB I;  2HHH E;  4B3T I;  1NHJ A;  4LF4 I;  2HK2 A;  4DUZ I;  3LPS A;  4R1F A;  1H7U A;  3ZKD A;  1XNQ I;  1ZM3 A;  2UUC E;  4JYA E;  2UUA I;  4HAC B;  4HAC A;  4LFC I;  1NZ0 A;  1S4E A;  1HNZ E;  2ZM6 E;  5GMD A;  4DV4 I;  3QT6 A;  3QT5 A;  4DV7 E;  2HKE A;  2V2Q A;  4JI4 E;  3B82 A;  4DV5 I;  1PIE A;  1XMQ E;  5FLX Q;  2A2C A;  2WW4 A;  1UEK A;  4JI6 E;  2AJ4 A;  4LFA I;  4X62 I;  2UXD E;  4JI1 I;  1ZXM A;  1ELO A;  1N33 I;  4DU8 A;  4PRX A;  3JAM Q;  3J81 Q;  4NXN E;  1Z59 A;  4JI2 E;  2BM1 A;  3J7A M;  3ZZT A;  1XHK A;  2Q2E B;  4X66 E;  4B3S E;  3J80 C;  2R3V A;  3PYF A;  4UT4 A;  4DV0 I;  5IT9 C;  3OTO E;  2CZ9 A;  2XEX A;  4DPU A;  5A2Q Q;  2UXC E;  5IT9 Q;  2X7I A;  4JI8 E;  1N0U A;  1N32 E;  4LF5 I;  4YY3 I;  3WU6 A;  5LMN E;  3PYE A;  4DU7 A;  1XNR E;  4USK A;  4URL A;  4JI7 E;  2V8P A;  4DR6 E;  4LF9 I;  1MX0 A;  3ZZ0 A;  4K0K E;  1H73 A;  4AQY I;  1ZM2 A;  2VF3 A;  4DR3 I;  2UU9 E;  1XMO I;  4USM A;  1Z0G A;  2VQF I;  4GKJ E;  1PKP A;  1H72 C;  1J5E E;  1Z0B A;  4X65 I;  1IBM I;  5IWA E;  4KHP E;  1IBK E;  4DV1 I;  4DUY I;  4JI5 E;  4FWD A;  4DPX A;  4LF6 E;  1Z0W A;  3T1H E;  1MU5 A;  4DV3 I;  1ZM9 A;  4DR4 I;  3J7A G;  4DPT A;  4B3M E;  1B62 A;  4DV7 I;  4GKK I;  2OI2 A;  4NXM E;  3V5R A;  4FW9 A;  5LL6 R;  1HR0 I;  5L3J A;  4DR1 E;  1N34 E;  3T1Y E;  4YHH I;  2UUB I;  2HFU A;  1FI4 A;  2F4V E;  2UXB I;  3CWV A;  4OX9 E;  1RRE A; 
#chains in the Genus database with same CATH topology
 5DRP A;  3B8H A;  4DR5 E;  2NN6 E;  4X64 E;  5ELW A;  1I94 I;  4MQY A;  4GQU A;  5BR8 E;  4LF7 I;  1HNX I;  1FWL A;  4B3R I;  1Z0T A;  1Y4U A;  5LMU I;  4JI0 I;  3DD6 A;  4LFB E;  4B3T E;  1MG7 A;  4LF4 E;  1KKH A;  1IBL I;  4DUZ E;  4BA2 B;  4OKG A;  2Z5B A;  3B78 A;  3D4J A;  1HNW I;  1XNQ E;  1B63 A;  2F1D A;  5JEA E;  4JI3 I;  5EKW A;  3P76 A;  1Y4S A;  1A6F A;  4IFD B;  2UUA E;  3LNU A;  2V34 A;  1DAR A;  3WU3 A;  4OO1 B;  4LFC E;  2NN6 A;  1N36 I;  4P52 A;  1H7S A;  5EL9 A;  4LF8 I;  3P3G A;  3K85 A;  4DV4 E;  2O1T A;  4DR2 I;  3P3C A;  5C0X E;  1H74 A;  2NN6 F;  4DV5 E;  4NBQ A;  4JG4 A;  4JV5 I;  3Q6M A;  3J80 Q;  4LFA E;  3M7N D;  2C39 A;  4X62 E;  1FJG I;  2E5L I;  4JI1 E;  3KRN A;  4UTG A;  3PYG A;  4PU9 A;  1USV A;  2E1R A;  1N33 E;  2C37 A;  1WUU A;  2X36 A;  5JEA A;  3QT8 A;  2VQE I;  2IER A;  2NN6 C;  1VIS A;  4DV2 I;  1USU A;  2LJP A;  4DPW A;  3K1J A;  2JEA A;  1HK7 A;  4FN5 A;  2R42 A;  1UDO A;  4XTJ A;  1FKA E;  4FWG A;  2J7K A;  4DV0 E;  4DR7 I;  3K17 A;  4DV6 I;  2BR2 B;  4MU0 A;  4ZVI A;  3GON A;  2BR2 A;  2HHH I;  1Y5Y A;  2PO2 A;  5C0X F;  4IS9 A;  3V2U C;  4Z7Y A;  4MYU A;  3CDI A;  4OZE A;  5DNX A;  2UUC I;  3PS3 A;  4FW7 A;  4JYA I;  3WU4 A;  4LOM A;  2Z5C B;  3M6A A;  4WUB A;  5C0X C;  1VI7 A;  4LF5 E;  4FW4 A;  5K36 F;  4YY3 E;  3HUL A;  1HNZ I;  2C38 B;  2ZM6 I;  3U1Y A;  2HK3 A;  1KTV A;  4LF9 E;  2JEB B;  3H4L A;  4WUC A;  4JI4 I;  2PO0 B;  1Z5C A;  4MDT A;  2V2V A;  3ZM7 A;  4AQY E;  1XMQ I;  5K36 C;  4JI6 I;  1EA6 A;  2UXD I;  4DR3 E;  4FWH A;  1XMO E;  5GME A;  2VQF E;  4PRV A;  4X65 E;  1IBM E;  3L7Z B;  4IFD D;  4EMD A;  3ZZU A;  4DV1 E;  4DUY E;  4HY1 A;  4NXN I;  4IFD E;  4OO1 D;  1FWK A;  1OYS A;  4JI2 I;  1ZM4 A;  2O1U A;  4OO1 E;  2IOP A;  3PYD A;  4P7A A;  1QZR A;  3Q1Q A;  1FNM A;  1KIJ A;  4DV3 E;  2HKJ A;  4X66 I;  5FLX C;  4DR4 E;  3CDJ A;  4B3S I;  2NPF A;  3PRY A;  2WNR B;  3PS1 A;  4ED4 A;  3OTO I;  4BA2 A;  3QT7 A;  3JAM C;  4GKK E;  2EFG A;  3J81 C;  1EI1 A;  3WU5 A;  1HR0 E;  2V2Z A;  2UXC I;  4YHH E;  4IFD A;  2UUB E;  2PO1 B;  4JI8 I;  4OO1 A;  1U2R A;  3Q6N A;  1N32 I;  1K47 A;  4LCH A;  2BM0 A;  2UXB E;  1Z5A A;  5LMN I;  1XNR I;  4DPY A;  4JI7 I;  1I94 E;  4DR6 I;  1ZXN A;  4AM3 A;  4Z7C A;  4LF7 E;  4HYM A;  1HNX E;  4HXZ A;  4K0K I;  4B3R E;  3P3E A;  5LMU E;  4JI0 E;  5A2Q C;  2ZBK B;  2UU9 I;  3M7N G;  1UDN A;  1OJ4 A;  1IBL E;  4GKJ I;  1J5E I;  1N0V C;  5IWA I;  4KHP I;  1IBK I;  1HNW E;  5JEA F;  4JI5 I;  4JI3 E;  3M85 D;  3F0N A;  3GME A;  1Z0E A;  2BA0 D;  4IZK B;  2PNL A;  4LCF A;  4LF6 I;  4FW5 A;  3T1H I;  2DEJ A;  1Y6Z A;  1BKN A;  4LPF A;  4MU1 A;  1PVG A;  5K36 D;  4U3D A;  2DEI A;  1N36 E;  4LF8 E;  2JT2 A;  2BA0 G;  2GS8 A;  5JEA C;  1NHH A;  3HJC A;  4IZJ D;  3PS2 A;  1Z0V A;  4DXL A;  1OYP A;  4KQV A;  4DR2 E;  4B3M I;  2O1W A;  2BV3 A;  4JV5 E;  1NHI A;  2A2D A;  1FJG E;  2E5L E;  4NXM I;  1Z5B A;  3LTO A;  4RPF A;  4DR1 I;  2PNM A;  1R6M A;  4WUD A;  1YHC A;  1N34 I;  3T1Y I;  1UDQ A;  2VQE E;  2AE8 A;  2WP8 B;  2Z5C A;  5DRQ A;  4M1K A;  4DV2 E;  2CVE A;  1D6T A;  2F4V I;  1RR9 A;  4I3H A;  4OX9 I;  2C38 A;  3U1K A;  5K36 B;  4DR5 I;  4X64 I;  2JEB A;  3ZKB A;  2PO0 A;  4IZJ B;  2ZIT A;  4MYT A;  1RHY A;  1Z0C A;  5BR8 I;  2HFS A;  4DR7 E;  1KVK A;  1S16 A;  2J65 A;  2Z5E A;  4DV6 E;  5DRR A;  2JE6 B;  4LFB I;  2HHH E;  4B3T I;  1NHJ A;  4LF4 I;  2JE6 A;  2HK2 A;  4DUZ I;  3L7Z A;  3LPS A;  4R1F A;  2PNZ B;  2GQ0 A;  1H7U A;  3ZKD A;  1XNQ I;  5DNL A;  1ZM3 A;  2UUC E;  4JYA E;  2UUA I;  1Y60 A;  4HAC B;  4HAC A;  4LFC I;  1NZ0 A;  1S4E A;  1HNZ E;  2ZM6 E;  1P42 A;  3GCM A;  2CGE A;  5GMD A;  2WNR A;  4DV4 I;  3QT6 A;  2NN6 D;  3QT5 A;  4DV7 E;  2HKE A;  2V2Q A;  4JI4 E;  3B82 A;  4DV5 I;  1PIE A;  1XMQ E;  3HKM A;  5FLX Q;  2A2C A;  2WW4 A;  1UEK A;  4JI6 E;  2AJ4 A;  4LFA I;  4N3O A;  2GO4 A;  4X62 I;  3GLL A;  4JI1 I;  2UXD E;  1ZXM A;  4MU3 A;  1ELO A;  1N33 I;  4DU8 A;  2PO1 A;  4PRX A;  3JAM Q;  1XXE A;  2Z5B B;  3H1C A;  3J81 Q;  4NXN E;  4IFD F;  1Z59 A;  5JEA D;  4JI2 E;  1YH8 A;  4OO1 F;  2BM1 A;  3J7A M;  1R6L A;  3ZZT A;  4AID A;  1XHK A;  2Q2E B;  4MU4 A;  4X66 E;  2NN6 B;  4B3S E;  3J80 C;  4IFD C;  2R3V A;  3PYF A;  4UT4 A;  1E3H A;  4DV0 I;  4OO1 C;  5IT9 C;  1UDS A;  5DRO A;  3OTO E;  5C0X D;  4FW6 A;  2CZ9 A;  1E3P A;  2O3Z A;  2XEX A;  4DPU A;  2C39 B;  5A2Q Q;  2UXC E;  2IOQ A;  5IT9 Q;  4IZK A;  2C37 B;  4U3B A;  2X7I A;  5JEA B;  3NZK A;  4JI8 E;  1N0U A;  3M85 G;  1N32 E;  4LF5 I;  5K36 E;  4YY3 I;  3WU6 A;  4BA1 B;  5LMN E;  4FW3 A;  3PYE A;  4DU7 A;  1XNR E;  4USK A;  4URL A;  4BA1 A;  2JEA B;  4JI7 E;  2V8P A;  4DR6 E;  4LF9 I;  1MX0 A;  3ZZ0 A;  4K0K E;  1H73 A;  4AQY I;  5C0X B;  1ZM2 A;  2VF3 A;  4AIM A;  2GO3 A;  5C0X A;  4DR3 I;  2UU9 E;  1XMO I;  4USM A;  1Z0G A;  2VQF I;  4GKJ E;  1PKP A;  4QNK A;  1H72 C;  1J5E E;  1Z0B A;  2PO2 B;  4X65 I;  1IBM I;  5IWA E;  2WP8 A;  4ISA A;  4KHP E;  1IBK E;  4LCG A;  3P06 A;  4DV1 I;  4DUY I;  4JI5 E;  1OYR A;  4FWD A;  4DPX A;  2O1V A;  5K36 A;  4LF6 E;  1Z0W A;  3T1H E;  2BA1 D;  4IZJ A;  2CG9 A;  1MU5 A;  4DV3 I;  3B4T A;  1ZM9 A;  4DR4 I;  2VES A;  3J7A G;  4DPT A;  4QNJ A;  2BA1 G;  4B3M E;  1B62 A;  4DV7 I;  2IES A;  5FWK A;  2PNZ A;  4GKK I;  4J3D A;  2OI2 A;  4NXM E;  3V5R A;  4FW9 A;  5LL6 R;  3UHM A;  1HR0 I;  5L3J A;  4DR1 E;  1N34 E;  3T1Y E;  4YHH I;  2UUB I;  2HFU A;  1FI4 A;  2F4V E;  2UXB I;  3CWV A;  4OX9 E;  1RRE A; 
#chains in the Genus database with same CATH homology
 3B8H A;  4DR5 E;  4X64 E;  1I94 I;  5BR8 E;  4LF7 I;  1HNX I;  1FWL A;  4B3R I;  1Z0T A;  1Y4U A;  5LMU I;  4JI0 I;  4LFB E;  4B3T E;  1MG7 A;  4LF4 E;  1KKH A;  1IBL I;  4DUZ E;  2Z5B A;  3B78 A;  3D4J A;  1HNW I;  1XNQ E;  1B63 A;  4JI3 I;  1Y4S A;  1A6F A;  2UUA E;  3LNU A;  2V34 A;  1DAR A;  3WU3 A;  4LFC E;  1N36 I;  4P52 A;  1H7S A;  4LF8 I;  3K85 A;  4DV4 E;  2O1T A;  4DR2 I;  1H74 A;  4DV5 E;  4JG4 A;  4JV5 I;  3Q6M A;  3J80 Q;  4LFA E;  4X62 E;  1FJG I;  2E5L I;  4JI1 E;  4UTG A;  3PYG A;  4PU9 A;  1USV A;  2E1R A;  1N33 E;  1WUU A;  2X36 A;  3QT8 A;  2VQE I;  1VIS A;  4DV2 I;  1USU A;  2LJP A;  4DPW A;  3K1J A;  1HK7 A;  4FN5 A;  2R42 A;  4XTJ A;  1FKA E;  4FWG A;  2J7K A;  4DV0 E;  4DR7 I;  3K17 A;  4DV6 I;  4ZVI A;  3GON A;  2HHH I;  3V2U C;  4Z7Y A;  4MYU A;  2UUC I;  4JYA I;  3WU4 A;  2Z5C B;  3M6A A;  4WUB A;  4LF5 E;  4YY3 E;  3HUL A;  1HNZ I;  2ZM6 I;  2HK3 A;  1KTV A;  4LF9 E;  3H4L A;  4WUC A;  4JI4 I;  1Z5C A;  2V2V A;  3ZM7 A;  4AQY E;  1XMQ I;  4JI6 I;  1EA6 A;  2UXD I;  4DR3 E;  4FWH A;  1XMO E;  5GME A;  2VQF E;  4PRV A;  4X65 E;  1IBM E;  4EMD A;  3ZZU A;  4DV1 E;  4DUY E;  4HY1 A;  4NXN I;  1FWK A;  4JI2 I;  1ZM4 A;  2O1U A;  2IOP A;  3PYD A;  4P7A A;  1QZR A;  3Q1Q A;  1FNM A;  1KIJ A;  4DV3 E;  2HKJ A;  4X66 I;  5FLX C;  4DR4 E;  4B3S I;  2NPF A;  3PRY A;  4ED4 A;  3OTO I;  3QT7 A;  3JAM C;  4GKK E;  2EFG A;  3J81 C;  1EI1 A;  3WU5 A;  1HR0 E;  2V2Z A;  2UXC I;  4YHH E;  2UUB E;  4JI8 I;  1U2R A;  3Q6N A;  1N32 I;  1K47 A;  2BM0 A;  2UXB E;  1Z5A A;  5LMN I;  1XNR I;  4DPY A;  4JI7 I;  1I94 E;  4DR6 I;  1ZXN A;  4Z7C A;  4LF7 E;  4HYM A;  1HNX E;  4HXZ A;  4K0K I;  4B3R E;  5LMU E;  4JI0 E;  5A2Q C;  2ZBK B;  2UU9 I;  1OJ4 A;  1IBL E;  4GKJ I;  1J5E I;  1N0V C;  5IWA I;  4KHP I;  1IBK I;  1HNW E;  4JI5 I;  4JI3 E;  3F0N A;  1Z0E A;  4IZK B;  2PNL A;  4LF6 I;  3T1H I;  2DEJ A;  1Y6Z A;  1BKN A;  1PVG A;  2DEI A;  1N36 E;  4LF8 E;  2GS8 A;  1NHH A;  3HJC A;  4IZJ D;  4DXL A;  1Z0V A;  4KQV A;  4DR2 E;  4B3M I;  2O1W A;  2BV3 A;  4JV5 E;  1NHI A;  2A2D A;  1FJG E;  2E5L E;  4NXM I;  1Z5B A;  3LTO A;  4RPF A;  4DR1 I;  2PNM A;  4WUD A;  1N34 I;  3T1Y I;  2VQE E;  2Z5C A;  4M1K A;  4DV2 E;  1D6T A;  2F4V I;  1RR9 A;  4I3H A;  4OX9 I;  4DR5 I;  4X64 I;  3ZKB A;  4IZJ B;  2ZIT A;  4MYT A;  1Z0C A;  5BR8 I;  2HFS A;  4DR7 E;  1KVK A;  1S16 A;  2Z5E A;  4DV6 E;  4LFB I;  2HHH E;  4B3T I;  1NHJ A;  4LF4 I;  2HK2 A;  4DUZ I;  3LPS A;  4R1F A;  2GQ0 A;  1H7U A;  3ZKD A;  1XNQ I;  1ZM3 A;  2UUC E;  4JYA E;  2UUA I;  4HAC B;  4HAC A;  4LFC I;  1NZ0 A;  1S4E A;  1HNZ E;  2ZM6 E;  2CGE A;  5GMD A;  4DV4 I;  3QT6 A;  3QT5 A;  4DV7 E;  2HKE A;  2V2Q A;  4JI4 E;  3B82 A;  4DV5 I;  1PIE A;  1XMQ E;  5FLX Q;  2A2C A;  2WW4 A;  1UEK A;  4JI6 E;  2AJ4 A;  4LFA I;  4N3O A;  4X62 I;  2UXD E;  4JI1 I;  1ZXM A;  1ELO A;  1N33 I;  4DU8 A;  4PRX A;  3JAM Q;  2Z5B B;  3J81 Q;  4NXN E;  1Z59 A;  4JI2 E;  2BM1 A;  3J7A M;  3ZZT A;  1XHK A;  2Q2E B;  4X66 E;  4B3S E;  3J80 C;  2R3V A;  3PYF A;  4UT4 A;  4DV0 I;  5IT9 C;  3OTO E;  2CZ9 A;  2XEX A;  4DPU A;  5A2Q Q;  2UXC E;  2IOQ A;  5IT9 Q;  4IZK A;  2X7I A;  4JI8 E;  1N0U A;  1N32 E;  4LF5 I;  4YY3 I;  3WU6 A;  5LMN E;  3PYE A;  4DU7 A;  1XNR E;  4USK A;  4URL A;  4JI7 E;  2V8P A;  4DR6 E;  4LF9 I;  1MX0 A;  3ZZ0 A;  4K0K E;  1H73 A;  4AQY I;  1ZM2 A;  2VF3 A;  4DR3 I;  2UU9 E;  1XMO I;  4USM A;  1Z0G A;  2VQF I;  4GKJ E;  1PKP A;  1H72 C;  1J5E E;  1Z0B A;  4X65 I;  1IBM I;  5IWA E;  4KHP E;  1IBK E;  3P06 A;  4DV1 I;  4DUY I;  4JI5 E;  4FWD A;  4DPX A;  2O1V A;  4LF6 E;  1Z0W A;  3T1H E;  4IZJ A;  2CG9 A;  1MU5 A;  4DV3 I;  1ZM9 A;  4DR4 I;  3J7A G;  4DPT A;  4B3M E;  1B62 A;  4DV7 I;  5FWK A;  4GKK I;  2OI2 A;  4NXM E;  3V5R A;  4FW9 A;  5LL6 R;  1HR0 I;  5L3J A;  4DR1 E;  1N34 E;  3T1Y E;  4YHH I;  2UUB I;  2HFU A;  1FI4 A;  2F4V E;  2UXB I;  3CWV A;  4OX9 E;  1RRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...