3J7AM

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
b'KRVQTFGKKKTAVAVATVTNGKGLIKLNGKNLDLVEPYILKTKVYEPLWLIGSGKLKNLDIRIRVKGGGQTSQIYAIRQAIGKGIISYYQKYVDESTKKELKDVLLRYDRSLLVGDTRRCEPKKFGGKGARARYQKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 31
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j7aM00
2EFGA 1EA6A 2VF3A 2VQEI 3PYFA 2VQFI 3V2UC 1H7UA 2UXCE 2A2CA 1ZM4A 3LPSA 2NPFA 1IBLI 1N34I 4DV1E 4FWHA 2ZBKB 1ZXMA 1J5EI 4HXZA 4B3SI 2HKEA 5LMUI 4UTGA 4PRVA 2GS8A 4LF9I 1KIJA 4X66I 4DU8A 3ZKDA 5GMDA 2X7IA 4JI0I 3ZM7A 2VQFE 4DV7E 5A2QQ 4DR4I 1FWLA 1FKAE 4DV6I 4B3MI 4DR2I 4FWDA 5BR8I 3PYEA 1H72C 3J81Q 3ZKBA 1N34E 1S4EA 4PU9A 4B3SE 1NHHA 1ZM2A 4ZVIA 4X64E 5LMUE 4LF9E 3CWVA 3ZZ0A 4GKJE 5LL6R 4X66E 3JAMC 5LMNI 4JI0E 1HNZI 1XMQI 2UUAE 2J7KA 2UXDI 4HY1A 4DR4E 2LJPA 4DV6E 2UXBI 4DR2E 1IBKI 1Z5BA 4GKKI 5IT9Q 4DV3I 4LFBI 4FN5A 4LFCI 4Z7CA 2HK3A 2BM0A 1FJGI 1Z0GA 4EMDA 4KQVA 1MX0A 3WU3A 3J80C 4X65I 4LF6I 2UXCI 5IWAI 2V34A 2V2VA 5GMEA 5LMNE 5A2QC 3LTOA 1XMQE 3V5RA 4DR5I 1N33E 2UXDE 4P52A 1QZRA 4X62I 4DUYE 2UXBE 3J81C 4URLA 4YHHI 4GKKE 4JYAI 4DV3E 4LFBE 4JI3I 4LFCE 2WW4A 2CZ9A 4HYMA 4JI1I 1FJGE 1ZM3A 4DV7I 1Z0BA 4P7AA 4DV0I 4JI7I 4X65E 3J7AG 2V2QA 3QT8A 1KTVA 4LF6E 2BV3A 5IWAE 1IBMI 1H7SA 4OX9E 4JI2I 4DR5E 2ZITA 1XMOI 4X62E 5IT9C 1KKHA 1N32I 4X64I 4YHHE 4YY3E 2HFUA 4JYAE 4B3RI 4LF4I 4GKJI 4JI3E 5L3JA 2HFSA 4JI1E 2ZM6I 2UUBI 2UUAI 4DV4I 2HHHI 4JI7E 4DV0E 1DARA 1FI4A 4JI5I 1IBME 4ED4A 4DXLA 1K47A 4DU7A 4DPUA 4JI2E 2XEXA 4WUDA 4AQYI 1NHIA 4DR6I 4DR1I 1XMOE 2UU9E 1N32E 4DPTA 2DEJA 1HNWE 4B3RE 1N0VC 4LF4E 1EI1A 4PRXA 4R1FA 4DPXA 1H73A 2ZM6E 2UUBE 2Q2EB 2BM1A 4DV4E 1N33I 4RPFA 2HHHE 3WU4A 4JI5E 4DUYI 2R42A 1VISA 2UUCI 5FLXQ 1KVKA 4JI6E 4USMA 4LF7E 4XTJA 1PKPA 1RREA 4HACA 4DR3E 4AQYE 3B8HA 4DR6E 4DR1E 4DR7E 1N36E 1ZM9A 2E1RA 1ZXNA 4JG4A 4FWGA 3QT7A 4DV2I 3B78A 3OTOE 4OX9I 3QT6A 4UT4A 4B3TI 1S16A 1U2RA 3WU5A 1Z5CA 2UUCE 3PYGA 4YY3I 2AJ4A 1ELOA 3QT5A 3PYDA 1Z0CA 4M1KA 1XNRI 1I94E 1PVGA 1WUUA 4USKA 3WU6A 2V8PA 4LFAE 4DV2E 1HR0I 3T1YI 2E5LI 1MG7A 4LF8I 4B3TE 4Z7YA 3LNUA 5FLXC 3JAMQ 4JI4I 2UU9I 3Q1QA 4KHPI 2F4VI 1HNWI 1BKNA 3HULA 1HNXE 2OI2A 1Z59A 1XNRE 4NXME 2A2DA 2HK2A 3K17A 4JV5I 1OJ4A 1FWKA 3J80Q 4JI6I 1HR0E 3T1YE 2E5LE 4LF8E 1PIEA 1A6FA 4K0KI 4LF7I 3GONA 2V2ZA 2VQEE 3F0NA 4MYUA 4DR3I 1MU5A 1Z0VA 3B82A 4DR7I 4JI4E 1N36I 4KHPE 1NHJA 1FNMA 2X36A 1Z0TA 1NZ0A 4DV5I 2F4VE 4NXNI 1Z5AA 3OTOI 4DPWA 1IBLE 4FW9A 1Z0EA 1B62A 1J5EE 4I3HA 2R3VA 3D4JA 4JV5E 1XHKA 4HACB 4DUZI 3K1JA 4K0KE 1N0UA 1XNQI 4LF5I 1I94I 1B63A 4B3ME 4DV5E 4JI8I 4NXNE 1Z0WA 1RR9A 3T1HI 5BR8E 4LFAI 4MYTA 3M6AA 2HKJA 4DPYA 3H4LA 1D6TA 3J7AM 3ZZTA 4DUZE 1HNXI 1H74A 4WUBA 1XNQE 4NXMI 4DV1I 1HNZE 2DEIA 3ZZUA 4LF5E 4WUCA 4JI8E 3T1HE 1IBKE 1UEKA
chains in the Genus database with same CATH superfamily
2Z5EA 1P42A 2EFGA 1EA6A 2VF3A 2VQEI 3PYFA 4OZEA 4BA1A 3PS1A 5JEAC 2VQFI 3V2UC 3CDIA 1H7UA 2JT2A 2UXCE 2A2CA 1XXEA 5C0XB 1ZM4A 4IFDB 3DD6A 3LPSA 2NPFA 3KRNA 1IBLI 1N34I 4DV1E 4FWHA 2ZBKB 2Z5BB 1ZXMA 4MQYA 1J5EI 2O1VA 4IFDA 4IZJB 5C0XE 2Z5CB 4IFDE 3H1CA 4HXZA 1UDNA 3P3EA 1YH8A 4B3SI 1R6MA 2HKEA 5LMUI 4UTGA 4PRVA 2GS8A 3PS3A 4U3BA 4LF9I 4IZJA 1KIJA 2Z5CA 4LOMA 3P3GA 4X66I 4DU8A 3ZKDA 5GMDA 2X7IA 4JI0I 3ZM7A 2IERA 4AIMA 2VQFE 4DV7E 5A2QQ 4DR4I 1FWLA 1FKAE 4DV6I 4B3MI 5JEAB 2NN6C 4DR2I 4FWDA 5BR8I 3PYEA 1H72C 1HK7A 2O1UA 3PRYA 3J81Q 2BA1G 3ZKBA 5JEAA 1N34E 4IS9A 5JEAE 1S4EA 4PU9A 4LCGA 3UHMA 3U1YA 2BR2B 2J65A 4B3SE 1NHHA 1ZM2A 2IESA 4ZVIA 4X64E 5LMUE 4BA2B 4LF9E 3CWVA 3ZZ0A 4GKJE 5LL6R 2BR2A 3JAMC 4X66E 5LMNI 4JI0E 2PO2B 1XMQI 1OYRA 1HNZI 5K36D 2UUAE 2J7KA 5C0XD 2UXDI 4HY1A 4DR4E 2LJPA 4IFDD 4FW7A 1UDQA 4DV6E 2PO0B 4ISAA 2UXBI 4DR2E 2JE6B 1IBKI 5DROA 1Z5BA 4GKKI 5IT9Q 2NN6B 4DV3I 4LFBI 4FN5A 4OO1D 4LFCI 4IZJD 2WP8B 2CGEA 5DNLA 4N3OA 4Z7CA 5EKWA 4MDTA 2HK3A 2BM0A 1FJGI 2O1TA 1Z0GA 4EMDA 4KQVA 1MX0A 3WU3A 3J80C 4X65I 4LF6I 2NN6E 2UXCI 5IWAI 3GLLA 1Y4UA 2V34A 2V2VA 4U3DA 4LCHA 5GMEA 5LMNE 5A2QC 3LTOA 1XMQE 3V5RA 4MU1A 4DR5I 1N33E 2UXDE 4P52A 1QZRA 4X62I 4DUYE 2UXBE 3J81C 3CDJA 4URLA 4YHHI 4BA1B 4GKKE 4JYAI 4DV3E 4LFBE 1Y4SA 1USUA 4JI3I 4LFCE 2WW4A 2CZ9A 4HYMA 4LCFA 4JI1I 1FJGE 1ZM3A 4DV7I 1Z0BA 4P7AA 4DV0I 4JI7I 4X65E 3J7AG 2V2QA 3QT8A 1KTVA 4LF6E 2BV3A 5IWAE 1IBMI 4IZKB 1E3HA 3P3CA 1H7SA 4OX9E 4JI2I 4IZKA 4DR5E 2ZITA 3M85G 1XMOI 4X62E 2PO1B 5IT9C 1KKHA 1N32I 2NN6D 4X64I 2JEAB 4YHHE 4YY3E 2HFUA 3GMEA 4JYAE 4B3RI 2PO1A 4LF4I 3GCMA 4GKJI 4JI3E 5L3JA 2JEAA 2C38B 2HFSA 4JI1E 1OYSA 1Y6ZA 2ZM6I 2UUBI 2UUAI 4DV4I 3U1KA 2HHHI 4JI7E 4DV0E 1DARA 4NBQA 2IOPA 1FI4A 2PNZB 4JI5I 1IBME 4ED4A 4DXLA 2C38A 1K47A 4DU7A 5K36F 2O3ZA 4DPUA 5C0XF 4JI2E 2XEXA 2PNZA 4WUDA 4AQYI 1NHIA 4DR6I 4DR1I 1XMOE 2UU9E 1N32E 4DPTA 4OO1F 2CG9A 2DEJA 1HNWE 4B3RE 1N0VC 4LF4E 1EI1A 2BA1D 2WNRB 4PRXA 4R1FA 4GQUA 4DPXA 1H73A 2ZM6E 2UUBE 2Q2EB 2BM1A 4DV4E 1N33I 4RPFA 2HHHE 3WU4A 2WNRA 4JI5E 4DUYI 2R42A 1VISA 2UUCI 5FLXQ 1KVKA 4JI6E 2JEBB 4USMA 4LF7E 4XTJA 1PKPA 1VI7A 1RREA 4HACA 4DR3E 4AQYE 2C39B 3M7NG 3B8HA 4LPFA 4DR6E 4DR1E 4DR7E 1N36E 2JEBA 1ZM9A 2E1RA 1ZXNA 2C39A 4JG4A 4FWGA 3QT7A 4DV2I 3B78A 3OTOE 4OX9I 5DRPA 3QT6A 4FW3A 4UT4A 5JEAD 4MU0A 4B3TI 1S16A 1U2RA 2BA0G 3WU5A 1Z5CA 1YHCA 2CVEA 2UUCE 4MU3A 3PYGA 4YY3I 4MU4A 2AJ4A 1ELOA 3QT5A 3L7ZB 5DRRA 3PYDA 1Z0CA 2NN6F 4M1KA 2GO4A 1XNRI 3L7ZA 1I94E 1PVGA 2GQ0A 1WUUA 4USKA 2GO3A 3WU6A 2V8PA 4LFAE 3P76A 4DV2E 1HR0I 1USVA 3T1YI 2E5LI 1MG7A 4OKGA 4LF8I 4AM3A 4B3TE 4QNJA 4Z7YA 3LNUA 5FLXC 3JAMQ 4JI4I 2UU9I 3B4TA 3Q1QA 4KHPI 5EL9A 5K36B 2F4VI 1HNWI 1BKNA 3HULA 1RHYA 1HNXE 2OI2A 5K36A 2AE8A 1Z59A 1E3PA 1XNRE 4NXME 2A2DA 5C0XA 5K36E 3K85A 3M85D 4OO1B 2HK2A 5DRQA 3K17A 4JV5I 1OJ4A 2Z5BA 5FWKA 1FWKA 3J80Q 4OO1A 4JI6I 1HR0E 5DNXA 3T1YE 2E5LE 4LF8E 1PIEA 1A6FA 4IFDF 4OO1E 4K0KI 4LF7I 3GONA 2V2ZA 2VQEE 3F0NA 4MYUA 4DR3I 1MU5A 3Q6MA 1Z0VA 3B82A 4DR7I 4JI4E 1N36I 4KHPE 4FW6A 1NHJA 1FNMA 2X36A 3P06A 1Z0TA 1NZ0A 4J3DA 4DV5I 2F4VE 4NXNI 1Z5AA 4FW5A 2IOQA 3OTOI 4DPWA 1UDSA 1IBLE 4FW9A 1Z0EA 1B62A 1J5EE 4I3HA 2R3VA 3D4JA 4JV5E 1XHKA 4HACB 4DUZI 5JEAF 3PS2A 1R6LA 3K1JA 4K0KE 1N0UA 4AIDA 2C37B 3NZKA 1XNQI 4BA2A 2VESA 4LF5I 1I94I 4QNKA 1B63A 4B3ME 2PNLA 4DV5E 2C37A 4JI8I 4NXNE 1Z0WA 1RR9A 3HKMA 2F1DA 2PO2A 3T1HI 5BR8E 5ELWA 4LFAI 2PNMA 2O1WA 2PO0A 4MYTA 2JE6A 3M6AA 3M7ND 2HKJA 4DPYA 5K36C 3H4LA 1D6TA 3J7AM 5C0XC 2NN6A 4IFDC 3ZZTA 4DUZE 2WP8A 3Q6NA 1HNXI 4OO1C 1H74A 1Y5YA 4WUBA 1XNQE 4NXMI 4DV1I 1HNZE 2BA0D 2DEIA 3ZZUA 4LF5E 4FW4A 1Y60A 1UDOA 4WUCA 4JI8E 3HJCA 3T1HE 1OYPA 1IBKE 1UEKA
chains in the Genus database with same CATH topology
2Z5EA 2EFGA 1EA6A 2VF3A 2VQEI 3PYFA 2VQFI 3V2UC 1H7UA 2UXCE 2A2CA 1ZM4A 3LPSA 2NPFA 1IBLI 1N34I 4DV1E 4FWHA 2ZBKB 2Z5BB 1ZXMA 1J5EI 2O1VA 4IZJB 2Z5CB 4HXZA 4B3SI 2HKEA 5LMUI 4UTGA 4PRVA 2GS8A 4LF9I 4IZJA 1KIJA 2Z5CA 4X66I 4DU8A 3ZKDA 5GMDA 2X7IA 4JI0I 3ZM7A 2VQFE 4DV7E 5A2QQ 4DR4I 1FWLA 1FKAE 4DV6I 4B3MI 4DR2I 4FWDA 5BR8I 3PYEA 1H72C 1HK7A 2O1UA 3PRYA 3J81Q 3ZKBA 1N34E 1S4EA 4PU9A 4B3SE 1NHHA 1ZM2A 4ZVIA 4X64E 5LMUE 4LF9E 3CWVA 3ZZ0A 4GKJE 5LL6R 4X66E 3JAMC 5LMNI 4JI0E 1HNZI 1XMQI 2UUAE 2J7KA 2UXDI 4HY1A 4DR4E 2LJPA 4DV6E 2UXBI 4DR2E 1IBKI 1Z5BA 4GKKI 5IT9Q 4DV3I 4LFBI 4FN5A 4LFCI 4IZJD 2CGEA 4N3OA 4Z7CA 2HK3A 2BM0A 1FJGI 2O1TA 1Z0GA 4EMDA 4KQVA 1MX0A 3WU3A 3J80C 4X65I 4LF6I 2UXCI 5IWAI 1Y4UA 2V34A 2V2VA 5GMEA 5LMNE 5A2QC 3LTOA 1XMQE 3V5RA 4DR5I 1N33E 2UXDE 4P52A 1QZRA 4X62I 4DUYE 2UXBE 3J81C 4URLA 4YHHI 4GKKE 4JYAI 4DV3E 4LFBE 1Y4SA 1USUA 4JI3I 4LFCE 2WW4A 2CZ9A 4HYMA 4JI1I 1FJGE 1ZM3A 4DV7I 1Z0BA 4P7AA 4DV0I 4JI7I 4X65E 3J7AG 2V2QA 3QT8A 1KTVA 4LF6E 2BV3A 5IWAE 1IBMI 4IZKB 1H7SA 4OX9E 4JI2I 4IZKA 4DR5E 2ZITA 1XMOI 4X62E 5IT9C 1KKHA 1N32I 4X64I 4YHHE 4YY3E 2HFUA 4JYAE 4B3RI 4LF4I 4GKJI 4JI3E 5L3JA 2HFSA 4JI1E 1Y6ZA 2ZM6I 2UUBI 2UUAI 4DV4I 2HHHI 4JI7E 4DV0E 1DARA 2IOPA 1FI4A 4JI5I 1IBME 4ED4A 4DXLA 1K47A 4DU7A 4DPUA 4JI2E 2XEXA 4WUDA 4AQYI 1NHIA 4DR6I 4DR1I 1XMOE 2UU9E 1N32E 4DPTA 2CG9A 2DEJA 1HNWE 4B3RE 1N0VC 4LF4E 1EI1A 4PRXA 4R1FA 4DPXA 1H73A 2ZM6E 2UUBE 2Q2EB 2BM1A 4DV4E 1N33I 4RPFA 2HHHE 3WU4A 4JI5E 4DUYI 2R42A 1VISA 2UUCI 5FLXQ 1KVKA 4JI6E 4USMA 4LF7E 4XTJA 1PKPA 1RREA 4AQYE 4HACA 4DR3E 3B8HA 4DR6E 4DR1E 4DR7E 1N36E 1ZM9A 2E1RA 1ZXNA 4JG4A 4FWGA 3QT7A 4DV2I 3B78A 3OTOE 4OX9I 3QT6A 4UT4A 4B3TI 1S16A 1U2RA 3WU5A 1Z5CA 2UUCE 3PYGA 4YY3I 2AJ4A 1ELOA 3QT5A 3PYDA 1Z0CA 4M1KA 1XNRI 1I94E 1PVGA 2GQ0A 1WUUA 4USKA 3WU6A 2V8PA 4LFAE 4DV2E 1HR0I 1USVA 3T1YI 2E5LI 1MG7A 4LF8I 4B3TE 4Z7YA 3LNUA 5FLXC 3JAMQ 4JI4I 2UU9I 3Q1QA 4KHPI 2F4VI 1HNWI 1BKNA 3HULA 1HNXE 2OI2A 1Z59A 1XNRE 4NXME 2A2DA 3K85A 2HK2A 3K17A 4JV5I 1OJ4A 2Z5BA 5FWKA 1FWKA 3J80Q 4JI6I 1HR0E 3T1YE 2E5LE 4LF8E 1PIEA 1A6FA 4K0KI 4LF7I 3GONA 2V2ZA 2VQEE 3F0NA 4MYUA 4DR3I 1MU5A 3Q6MA 1Z0VA 3B82A 4DR7I 4JI4E 1N36I 4KHPE 1NHJA 1FNMA 2X36A 3P06A 1Z0TA 1NZ0A 4DV5I 2F4VE 4NXNI 1Z5AA 2IOQA 3OTOI 4DPWA 1IBLE 4FW9A 1Z0EA 1B62A 1J5EE 4I3HA 2R3VA 3D4JA 4JV5E 1XHKA 4HACB 4DUZI 3K1JA 4K0KE 1N0UA 1XNQI 4LF5I 1I94I 1B63A 4B3ME 2PNLA 4DV5E 4JI8I 4NXNE 1Z0WA 1RR9A 3T1HI 5BR8E 4LFAI 2PNMA 2O1WA 4MYTA 3M6AA 2HKJA 4DPYA 3H4LA 1D6TA 3J7AM 3ZZTA 4DUZE 3Q6NA 1HNXI 1H74A 4WUBA 1XNQE 4NXMI 4DV1I 1HNZE 2DEIA 3ZZUA 4LF5E 4WUCA 4JI8E 3HJCA 3T1HE 1IBKE 1UEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFG A;  1EA6 A;  2VF3 A;  2VQE I;  3PYF A;  2VQF I;  3V2U C;  1H7U A;  2UXC E;  2A2C A;  1ZM4 A;  3LPS A;  2NPF A;  1IBL I;  1N34 I;  4DV1 E;  4FWH A;  2ZBK B;  1ZXM A;  1J5E I;  4HXZ A;  4B3S I;  2HKE A;  5LMU I;  4UTG A;  4PRV A;  2GS8 A;  4LF9 I;  1KIJ A;  4X66 I;  4DU8 A;  3ZKD A;  5GMD A;  2X7I A;  4JI0 I;  3ZM7 A;  2VQF E;  4DV7 E;  5A2Q Q;  4DR4 I;  1FWL A;  1FKA E;  4DV6 I;  4B3M I;  4DR2 I;  4FWD A;  5BR8 I;  3PYE A;  1H72 C;  3J81 Q;  3ZKB A;  1N34 E;  1S4E A;  4PU9 A;  4B3S E;  1NHH A;  1ZM2 A;  4ZVI A;  4X64 E;  5LMU E;  4LF9 E;  3CWV A;  3ZZ0 A;  4GKJ E;  5LL6 R;  4X66 E;  3JAM C;  5LMN I;  4JI0 E;  1HNZ I;  1XMQ I;  2UUA E;  2J7K A;  2UXD I;  4HY1 A;  4DR4 E;  2LJP A;  4DV6 E;  2UXB I;  4DR2 E;  1IBK I;  1Z5B A;  4GKK I;  5IT9 Q;  4DV3 I;  4LFB I;  4FN5 A;  4LFC I;  4Z7C A;  2HK3 A;  2BM0 A;  1FJG I;  1Z0G A;  4EMD A;  4KQV A;  1MX0 A;  3WU3 A;  3J80 C;  4X65 I;  4LF6 I;  2UXC I;  5IWA I;  2V34 A;  2V2V A;  5GME A;  5LMN E;  5A2Q C;  3LTO A;  1XMQ E;  3V5R A;  4DR5 I;  1N33 E;  2UXD E;  4P52 A;  1QZR A;  4X62 I;  4DUY E;  2UXB E;  3J81 C;  4URL A;  4YHH I;  4GKK E;  4JYA I;  4DV3 E;  4LFB E;  4JI3 I;  4LFC E;  2WW4 A;  2CZ9 A;  4HYM A;  4JI1 I;  1FJG E;  1ZM3 A;  4DV7 I;  1Z0B A;  4P7A A;  4DV0 I;  4JI7 I;  4X65 E;  3J7A G;  2V2Q A;  3QT8 A;  1KTV A;  4LF6 E;  2BV3 A;  5IWA E;  1IBM I;  1H7S A;  4OX9 E;  4JI2 I;  4DR5 E;  2ZIT A;  1XMO I;  4X62 E;  5IT9 C;  1KKH A;  1N32 I;  4X64 I;  4YHH E;  4YY3 E;  2HFU A;  4JYA E;  4B3R I;  4LF4 I;  4GKJ I;  4JI3 E;  5L3J A;  2HFS A;  4JI1 E;  2ZM6 I;  2UUB I;  2UUA I;  4DV4 I;  2HHH I;  4JI7 E;  4DV0 E;  1DAR A;  1FI4 A;  4JI5 I;  1IBM E;  4ED4 A;  4DXL A;  1K47 A;  4DU7 A;  4DPU A;  4JI2 E;  2XEX A;  4WUD A;  4AQY I;  1NHI A;  4DR6 I;  4DR1 I;  1XMO E;  2UU9 E;  1N32 E;  4DPT A;  2DEJ A;  1HNW E;  4B3R E;  1N0V C;  4LF4 E;  1EI1 A;  4PRX A;  4R1F A;  4DPX A;  1H73 A;  2ZM6 E;  2UUB E;  2Q2E B;  2BM1 A;  4DV4 E;  1N33 I;  4RPF A;  2HHH E;  3WU4 A;  4JI5 E;  4DUY I;  2R42 A;  1VIS A;  2UUC I;  5FLX Q;  1KVK A;  4JI6 E;  4USM A;  4LF7 E;  4XTJ A;  1PKP A;  1RRE A;  4HAC A;  4DR3 E;  4AQY E;  3B8H A;  4DR6 E;  4DR1 E;  4DR7 E;  1N36 E;  1ZM9 A;  2E1R A;  1ZXN A;  4JG4 A;  4FWG A;  3QT7 A;  4DV2 I;  3B78 A;  3OTO E;  4OX9 I;  3QT6 A;  4UT4 A;  4B3T I;  1S16 A;  1U2R A;  3WU5 A;  1Z5C A;  2UUC E;  3PYG A;  4YY3 I;  2AJ4 A;  1ELO A;  3QT5 A;  3PYD A;  1Z0C A;  4M1K A;  1XNR I;  1I94 E;  1PVG A;  1WUU A;  4USK A;  3WU6 A;  2V8P A;  4LFA E;  4DV2 E;  1HR0 I;  3T1Y I;  2E5L I;  1MG7 A;  4LF8 I;  4B3T E;  4Z7Y A;  3LNU A;  5FLX C;  3JAM Q;  4JI4 I;  2UU9 I;  3Q1Q A;  4KHP I;  2F4V I;  1HNW I;  1BKN A;  3HUL A;  1HNX E;  2OI2 A;  1Z59 A;  1XNR E;  4NXM E;  2A2D A;  2HK2 A;  3K17 A;  4JV5 I;  1OJ4 A;  1FWK A;  3J80 Q;  4JI6 I;  1HR0 E;  3T1Y E;  2E5L E;  4LF8 E;  1PIE A;  1A6F A;  4K0K I;  4LF7 I;  3GON A;  2V2Z A;  2VQE E;  3F0N A;  4MYU A;  4DR3 I;  1MU5 A;  1Z0V A;  3B82 A;  4DR7 I;  4JI4 E;  1N36 I;  4KHP E;  1NHJ A;  1FNM A;  2X36 A;  1Z0T A;  1NZ0 A;  4DV5 I;  2F4V E;  4NXN I;  1Z5A A;  3OTO I;  4DPW A;  1IBL E;  4FW9 A;  1Z0E A;  1B62 A;  1J5E E;  4I3H A;  2R3V A;  3D4J A;  4JV5 E;  1XHK A;  4HAC B;  4DUZ I;  3K1J A;  4K0K E;  1N0U A;  1XNQ I;  4LF5 I;  1I94 I;  1B63 A;  4B3M E;  4DV5 E;  4JI8 I;  4NXN E;  1Z0W A;  1RR9 A;  3T1H I;  5BR8 E;  4LFA I;  4MYT A;  3M6A A;  2HKJ A;  4DPY A;  3H4L A;  1D6T A;  3J7A M;  3ZZT A;  4DUZ E;  1HNX I;  1H74 A;  4WUB A;  1XNQ E;  4NXM I;  4DV1 I;  1HNZ E;  2DEI A;  3ZZU A;  4LF5 E;  4WUC A;  4JI8 E;  3T1H E;  1IBK E;  1UEK A; 
#chains in the Genus database with same CATH topology
 2Z5E A;  1P42 A;  2EFG A;  1EA6 A;  2VF3 A;  2VQE I;  3PYF A;  4OZE A;  4BA1 A;  3PS1 A;  5JEA C;  2VQF I;  3V2U C;  3CDI A;  1H7U A;  2JT2 A;  2UXC E;  2A2C A;  1XXE A;  5C0X B;  1ZM4 A;  4IFD B;  3DD6 A;  3LPS A;  2NPF A;  3KRN A;  1IBL I;  1N34 I;  4DV1 E;  4FWH A;  2ZBK B;  2Z5B B;  1ZXM A;  4MQY A;  1J5E I;  2O1V A;  4IFD A;  4IZJ B;  5C0X E;  2Z5C B;  4IFD E;  3H1C A;  4HXZ A;  1UDN A;  3P3E A;  1YH8 A;  4B3S I;  1R6M A;  2HKE A;  5LMU I;  4UTG A;  4PRV A;  2GS8 A;  3PS3 A;  4U3B A;  4LF9 I;  4IZJ A;  1KIJ A;  2Z5C A;  4LOM A;  3P3G A;  4X66 I;  4DU8 A;  3ZKD A;  5GMD A;  2X7I A;  4JI0 I;  3ZM7 A;  2IER A;  4AIM A;  2VQF E;  4DV7 E;  5A2Q Q;  4DR4 I;  1FWL A;  1FKA E;  4DV6 I;  4B3M I;  5JEA B;  2NN6 C;  4DR2 I;  4FWD A;  5BR8 I;  3PYE A;  1H72 C;  1HK7 A;  2O1U A;  3PRY A;  3J81 Q;  2BA1 G;  3ZKB A;  5JEA A;  1N34 E;  4IS9 A;  5JEA E;  1S4E A;  4PU9 A;  4LCG A;  3UHM A;  3U1Y A;  2BR2 B;  2J65 A;  4B3S E;  1NHH A;  1ZM2 A;  2IES A;  4ZVI A;  4X64 E;  5LMU E;  4BA2 B;  4LF9 E;  3CWV A;  3ZZ0 A;  4GKJ E;  5LL6 R;  2BR2 A;  3JAM C;  4X66 E;  5LMN I;  4JI0 E;  2PO2 B;  1XMQ I;  1OYR A;  1HNZ I;  5K36 D;  2UUA E;  2J7K A;  5C0X D;  2UXD I;  4HY1 A;  4DR4 E;  2LJP A;  4IFD D;  4FW7 A;  1UDQ A;  4DV6 E;  2PO0 B;  4ISA A;  2UXB I;  4DR2 E;  2JE6 B;  1IBK I;  5DRO A;  1Z5B A;  4GKK I;  5IT9 Q;  2NN6 B;  4DV3 I;  4LFB I;  4FN5 A;  4OO1 D;  4LFC I;  4IZJ D;  2WP8 B;  2CGE A;  5DNL A;  4N3O A;  4Z7C A;  5EKW A;  4MDT A;  2HK3 A;  2BM0 A;  1FJG I;  2O1T A;  1Z0G A;  4EMD A;  4KQV A;  1MX0 A;  3WU3 A;  3J80 C;  4X65 I;  4LF6 I;  2NN6 E;  2UXC I;  5IWA I;  3GLL A;  1Y4U A;  2V34 A;  2V2V A;  4U3D A;  4LCH A;  5GME A;  5LMN E;  5A2Q C;  3LTO A;  1XMQ E;  3V5R A;  4MU1 A;  4DR5 I;  1N33 E;  2UXD E;  4P52 A;  1QZR A;  4X62 I;  4DUY E;  2UXB E;  3J81 C;  3CDJ A;  4URL A;  4YHH I;  4BA1 B;  4GKK E;  4JYA I;  4DV3 E;  4LFB E;  1Y4S A;  1USU A;  4JI3 I;  4LFC E;  2WW4 A;  2CZ9 A;  4HYM A;  4LCF A;  4JI1 I;  1FJG E;  1ZM3 A;  4DV7 I;  1Z0B A;  4P7A A;  4DV0 I;  4JI7 I;  4X65 E;  3J7A G;  2V2Q A;  3QT8 A;  1KTV A;  4LF6 E;  2BV3 A;  5IWA E;  1IBM I;  4IZK B;  1E3H A;  3P3C A;  1H7S A;  4OX9 E;  4JI2 I;  4IZK A;  4DR5 E;  2ZIT A;  3M85 G;  1XMO I;  4X62 E;  2PO1 B;  5IT9 C;  1KKH A;  1N32 I;  2NN6 D;  4X64 I;  2JEA B;  4YHH E;  4YY3 E;  2HFU A;  3GME A;  4JYA E;  4B3R I;  2PO1 A;  4LF4 I;  3GCM A;  4GKJ I;  4JI3 E;  5L3J A;  2JEA A;  2C38 B;  2HFS A;  4JI1 E;  1OYS A;  1Y6Z A;  2ZM6 I;  2UUB I;  2UUA I;  4DV4 I;  3U1K A;  2HHH I;  4JI7 E;  4DV0 E;  1DAR A;  4NBQ A;  2IOP A;  1FI4 A;  2PNZ B;  4JI5 I;  1IBM E;  4ED4 A;  4DXL A;  2C38 A;  1K47 A;  4DU7 A;  5K36 F;  2O3Z A;  4DPU A;  5C0X F;  4JI2 E;  2XEX A;  2PNZ A;  4WUD A;  4AQY I;  1NHI A;  4DR6 I;  4DR1 I;  1XMO E;  2UU9 E;  1N32 E;  4DPT A;  4OO1 F;  2CG9 A;  2DEJ A;  1HNW E;  4B3R E;  1N0V C;  4LF4 E;  1EI1 A;  2BA1 D;  2WNR B;  4PRX A;  4R1F A;  4GQU A;  4DPX A;  1H73 A;  2ZM6 E;  2UUB E;  2Q2E B;  2BM1 A;  4DV4 E;  1N33 I;  4RPF A;  2HHH E;  3WU4 A;  2WNR A;  4JI5 E;  4DUY I;  2R42 A;  1VIS A;  2UUC I;  5FLX Q;  1KVK A;  4JI6 E;  2JEB B;  4USM A;  4LF7 E;  4XTJ A;  1PKP A;  1VI7 A;  1RRE A;  4HAC A;  4DR3 E;  4AQY E;  2C39 B;  3M7N G;  3B8H A;  4LPF A;  4DR6 E;  4DR1 E;  4DR7 E;  1N36 E;  2JEB A;  1ZM9 A;  2E1R A;  1ZXN A;  2C39 A;  4JG4 A;  4FWG A;  3QT7 A;  4DV2 I;  3B78 A;  3OTO E;  4OX9 I;  5DRP A;  3QT6 A;  4FW3 A;  4UT4 A;  5JEA D;  4MU0 A;  4B3T I;  1S16 A;  1U2R A;  2BA0 G;  3WU5 A;  1Z5C A;  1YHC A;  2CVE A;  2UUC E;  4MU3 A;  3PYG A;  4YY3 I;  4MU4 A;  2AJ4 A;  1ELO A;  3QT5 A;  3L7Z B;  5DRR A;  3PYD A;  1Z0C A;  2NN6 F;  4M1K A;  2GO4 A;  1XNR I;  3L7Z A;  1I94 E;  1PVG A;  2GQ0 A;  1WUU A;  4USK A;  2GO3 A;  3WU6 A;  2V8P A;  4LFA E;  3P76 A;  4DV2 E;  1HR0 I;  1USV A;  3T1Y I;  2E5L I;  1MG7 A;  4OKG A;  4LF8 I;  4AM3 A;  4B3T E;  4QNJ A;  4Z7Y A;  3LNU A;  5FLX C;  3JAM Q;  4JI4 I;  2UU9 I;  3B4T A;  3Q1Q A;  4KHP I;  5EL9 A;  5K36 B;  2F4V I;  1HNW I;  1BKN A;  3HUL A;  1RHY A;  1HNX E;  2OI2 A;  5K36 A;  2AE8 A;  1Z59 A;  1E3P A;  1XNR E;  4NXM E;  2A2D A;  5C0X A;  5K36 E;  3K85 A;  3M85 D;  4OO1 B;  2HK2 A;  5DRQ A;  3K17 A;  4JV5 I;  1OJ4 A;  2Z5B A;  5FWK A;  1FWK A;  3J80 Q;  4OO1 A;  4JI6 I;  1HR0 E;  5DNX A;  3T1Y E;  2E5L E;  4LF8 E;  1PIE A;  1A6F A;  4IFD F;  4OO1 E;  4K0K I;  4LF7 I;  3GON A;  2V2Z A;  2VQE E;  3F0N A;  4MYU A;  4DR3 I;  1MU5 A;  3Q6M A;  1Z0V A;  3B82 A;  4DR7 I;  4JI4 E;  1N36 I;  4KHP E;  4FW6 A;  1NHJ A;  1FNM A;  2X36 A;  3P06 A;  1Z0T A;  1NZ0 A;  4J3D A;  4DV5 I;  2F4V E;  4NXN I;  1Z5A A;  4FW5 A;  2IOQ A;  3OTO I;  4DPW A;  1UDS A;  1IBL E;  4FW9 A;  1Z0E A;  1B62 A;  1J5E E;  4I3H A;  2R3V A;  3D4J A;  4JV5 E;  1XHK A;  4HAC B;  4DUZ I;  5JEA F;  3PS2 A;  1R6L A;  3K1J A;  4K0K E;  1N0U A;  4AID A;  2C37 B;  3NZK A;  1XNQ I;  4BA2 A;  2VES A;  4LF5 I;  1I94 I;  4QNK A;  1B63 A;  4B3M E;  2PNL A;  4DV5 E;  2C37 A;  4JI8 I;  4NXN E;  1Z0W A;  1RR9 A;  3HKM A;  2F1D A;  2PO2 A;  3T1H I;  5BR8 E;  5ELW A;  4LFA I;  2PNM A;  2O1W A;  2PO0 A;  4MYT A;  2JE6 A;  3M6A A;  3M7N D;  2HKJ A;  4DPY A;  5K36 C;  3H4L A;  1D6T A;  3J7A M;  5C0X C;  2NN6 A;  4IFD C;  3ZZT A;  4DUZ E;  2WP8 A;  3Q6N A;  1HNX I;  4OO1 C;  1H74 A;  1Y5Y A;  4WUB A;  1XNQ E;  4NXM I;  4DV1 I;  1HNZ E;  2BA0 D;  2DEI A;  3ZZU A;  4LF5 E;  4FW4 A;  1Y60 A;  1UDO A;  4WUC A;  4JI8 E;  3HJC A;  3T1H E;  1OYP A;  1IBK E;  1UEK A; 
#chains in the Genus database with same CATH homology
 2Z5E A;  2EFG A;  1EA6 A;  2VF3 A;  2VQE I;  3PYF A;  2VQF I;  3V2U C;  1H7U A;  2UXC E;  2A2C A;  1ZM4 A;  3LPS A;  2NPF A;  1IBL I;  1N34 I;  4DV1 E;  4FWH A;  2ZBK B;  2Z5B B;  1ZXM A;  1J5E I;  2O1V A;  4IZJ B;  2Z5C B;  4HXZ A;  4B3S I;  2HKE A;  5LMU I;  4UTG A;  4PRV A;  2GS8 A;  4LF9 I;  4IZJ A;  1KIJ A;  2Z5C A;  4X66 I;  4DU8 A;  3ZKD A;  5GMD A;  2X7I A;  4JI0 I;  3ZM7 A;  2VQF E;  4DV7 E;  5A2Q Q;  4DR4 I;  1FWL A;  1FKA E;  4DV6 I;  4B3M I;  4DR2 I;  4FWD A;  5BR8 I;  3PYE A;  1H72 C;  1HK7 A;  2O1U A;  3PRY A;  3J81 Q;  3ZKB A;  1N34 E;  1S4E A;  4PU9 A;  4B3S E;  1NHH A;  1ZM2 A;  4ZVI A;  4X64 E;  5LMU E;  4LF9 E;  3CWV A;  3ZZ0 A;  4GKJ E;  5LL6 R;  4X66 E;  3JAM C;  5LMN I;  4JI0 E;  1HNZ I;  1XMQ I;  2UUA E;  2J7K A;  2UXD I;  4HY1 A;  4DR4 E;  2LJP A;  4DV6 E;  2UXB I;  4DR2 E;  1IBK I;  1Z5B A;  4GKK I;  5IT9 Q;  4DV3 I;  4LFB I;  4FN5 A;  4LFC I;  4IZJ D;  2CGE A;  4N3O A;  4Z7C A;  2HK3 A;  2BM0 A;  1FJG I;  2O1T A;  1Z0G A;  4EMD A;  4KQV A;  1MX0 A;  3WU3 A;  3J80 C;  4X65 I;  4LF6 I;  2UXC I;  5IWA I;  1Y4U A;  2V34 A;  2V2V A;  5GME A;  5LMN E;  5A2Q C;  3LTO A;  1XMQ E;  3V5R A;  4DR5 I;  1N33 E;  2UXD E;  4P52 A;  1QZR A;  4X62 I;  4DUY E;  2UXB E;  3J81 C;  4URL A;  4YHH I;  4GKK E;  4JYA I;  4DV3 E;  4LFB E;  1Y4S A;  1USU A;  4JI3 I;  4LFC E;  2WW4 A;  2CZ9 A;  4HYM A;  4JI1 I;  1FJG E;  1ZM3 A;  4DV7 I;  1Z0B A;  4P7A A;  4DV0 I;  4JI7 I;  4X65 E;  3J7A G;  2V2Q A;  3QT8 A;  1KTV A;  4LF6 E;  2BV3 A;  5IWA E;  1IBM I;  4IZK B;  1H7S A;  4OX9 E;  4JI2 I;  4IZK A;  4DR5 E;  2ZIT A;  1XMO I;  4X62 E;  5IT9 C;  1KKH A;  1N32 I;  4X64 I;  4YHH E;  4YY3 E;  2HFU A;  4JYA E;  4B3R I;  4LF4 I;  4GKJ I;  4JI3 E;  5L3J A;  2HFS A;  4JI1 E;  1Y6Z A;  2ZM6 I;  2UUB I;  2UUA I;  4DV4 I;  2HHH I;  4JI7 E;  4DV0 E;  1DAR A;  2IOP A;  1FI4 A;  4JI5 I;  1IBM E;  4ED4 A;  4DXL A;  1K47 A;  4DU7 A;  4DPU A;  4JI2 E;  2XEX A;  4WUD A;  4AQY I;  1NHI A;  4DR6 I;  4DR1 I;  1XMO E;  2UU9 E;  1N32 E;  4DPT A;  2CG9 A;  2DEJ A;  1HNW E;  4B3R E;  1N0V C;  4LF4 E;  1EI1 A;  4PRX A;  4R1F A;  4DPX A;  1H73 A;  2ZM6 E;  2UUB E;  2Q2E B;  2BM1 A;  4DV4 E;  1N33 I;  4RPF A;  2HHH E;  3WU4 A;  4JI5 E;  4DUY I;  2R42 A;  1VIS A;  2UUC I;  5FLX Q;  1KVK A;  4JI6 E;  4USM A;  4LF7 E;  4XTJ A;  1PKP A;  1RRE A;  4AQY E;  4HAC A;  4DR3 E;  3B8H A;  4DR6 E;  4DR1 E;  4DR7 E;  1N36 E;  1ZM9 A;  2E1R A;  1ZXN A;  4JG4 A;  4FWG A;  3QT7 A;  4DV2 I;  3B78 A;  3OTO E;  4OX9 I;  3QT6 A;  4UT4 A;  4B3T I;  1S16 A;  1U2R A;  3WU5 A;  1Z5C A;  2UUC E;  3PYG A;  4YY3 I;  2AJ4 A;  1ELO A;  3QT5 A;  3PYD A;  1Z0C A;  4M1K A;  1XNR I;  1I94 E;  1PVG A;  2GQ0 A;  1WUU A;  4USK A;  3WU6 A;  2V8P A;  4LFA E;  4DV2 E;  1HR0 I;  1USV A;  3T1Y I;  2E5L I;  1MG7 A;  4LF8 I;  4B3T E;  4Z7Y A;  3LNU A;  5FLX C;  3JAM Q;  4JI4 I;  2UU9 I;  3Q1Q A;  4KHP I;  2F4V I;  1HNW I;  1BKN A;  3HUL A;  1HNX E;  2OI2 A;  1Z59 A;  1XNR E;  4NXM E;  2A2D A;  3K85 A;  2HK2 A;  3K17 A;  4JV5 I;  1OJ4 A;  2Z5B A;  5FWK A;  1FWK A;  3J80 Q;  4JI6 I;  1HR0 E;  3T1Y E;  2E5L E;  4LF8 E;  1PIE A;  1A6F A;  4K0K I;  4LF7 I;  3GON A;  2V2Z A;  2VQE E;  3F0N A;  4MYU A;  4DR3 I;  1MU5 A;  3Q6M A;  1Z0V A;  3B82 A;  4DR7 I;  4JI4 E;  1N36 I;  4KHP E;  1NHJ A;  1FNM A;  2X36 A;  3P06 A;  1Z0T A;  1NZ0 A;  4DV5 I;  2F4V E;  4NXN I;  1Z5A A;  2IOQ A;  3OTO I;  4DPW A;  1IBL E;  4FW9 A;  1Z0E A;  1B62 A;  1J5E E;  4I3H A;  2R3V A;  3D4J A;  4JV5 E;  1XHK A;  4HAC B;  4DUZ I;  3K1J A;  4K0K E;  1N0U A;  1XNQ I;  4LF5 I;  1I94 I;  1B63 A;  4B3M E;  2PNL A;  4DV5 E;  4JI8 I;  4NXN E;  1Z0W A;  1RR9 A;  3T1H I;  5BR8 E;  4LFA I;  2PNM A;  2O1W A;  4MYT A;  3M6A A;  2HKJ A;  4DPY A;  3H4L A;  1D6T A;  3J7A M;  3ZZT A;  4DUZ E;  3Q6N A;  1HNX I;  1H74 A;  4WUB A;  1XNQ E;  4NXM I;  4DV1 I;  1HNZ E;  2DEI A;  3ZZU A;  4LF5 E;  4WUC A;  4JI8 E;  3HJC A;  3T1H E;  1IBK E;  1UEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...