3J7AM

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
KRVQTFGKKKTAVAVATVTNGKGLIKLNGKNLDLVEPYILKTKVYEPLWLIGSGKLKNLDIRIRVKGGGQTSQIYAIRQAIGKGIISYYQKYVDESTKKELKDVLLRYDRSLLVGDTRRCEPKKFGGKGARARYQKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 31
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j7aM00
1EA6A 4PU9A 5BR8E 2VQFE 4JI1E 2HK2A 4PRXA 1FKAE 5GMDA 3PYFA 2E5LI 1N33E 4DV5E 1BKNA 4LFBI 1I94E 3K1JA 4JG4A 4B3TI 4JYAE 1XMOI 5A2QQ 2UXCI 4DUZE 4DV6I 4NXNI 4B3RI 4X66I 2BM0A 1B63A 3ZZTA 3J81C 4LFAE 4JI0I 5IT9C 1K47A 1HNWI 2UXDI 1ELOA 5GMEA 4K0KE 1QZRA 3H4LA 4B3MI 1UEKA 1ZM9A 4AQYI 4I3HA 4R1FA 1IBKE 1B62A 1IBMI 5LMUE 2VQEE 4JI7E 1N0VC 2WW4A 4DUYI 4DV7E 3T1YE 3CWVA 4ZVIA 2OI2A 4MYTA 5FLXC 4DV3E 2ZBKB 4LF4I 1XMQE 4DR6I 4X62I 1FWLA 2A2DA 5IWAE 2J7KA 2UXBE 3F0NA 2BM1A 3OTOI 4MYUA 2ZITA 4LF9E 4DR7I 2GS8A 3J80Q 4X65I 4LF8I 4DR5I 2DEJA 4YY3E 1MU5A 4PRVA 4JI6E 2UUAE 4JI8I 4HY1A 2UUBE 4LF7I 3QT5A 4NXME 4JI4I 4HACA 1FNMA 1HNZE 4DV1I 3J7AM 3WU3A 4DV2E 1FWKA 3JAMQ 2VQFI 1ZM2A 4HYMA 3PYDA 4DR2E 1H73A 4DV0I 4DPYA 3J80C 4USKA 4KHPI 4YHHE 3PYEA 3HULA 4JYAI 3ZZUA 4DU8A 3D4JA 4Z7YA 1D6TA 2NPFA 1XNQI 4LFCI 1J5EE 4LFAI 1NHHA 2EFGA 1IBLI 4LF6E 1A6FA 4DV4I 1HNXI 1Z0GA 1RREA 4JV5E 4JI2I 2A2CA 5LMNI 1Z0BA 3PYGA 1NHIA 4FWHA 4GKKI 1ZM3A 1N36I 2UUCE 4K0KI 2E5LE 4OX9I 1Z0TA 4KQVA 3ZKDA 4LFBE 4HACB 4JI7I 1U2RA 4B3TE 3QT6A 1EI1A 3T1YI 2HHHI 1XMOE 1N34E 4GKJI 4DPTA 2ZM6I 4NXNE 4B3RE 4LF5E 5A2QC 4DR1E 4X66E 2F4VE 1PVGA 1KKHA 4DU7A 1XMQI 2E1RA 3T1HI 1KVKA 1HNWE 1ZM4A 2UXDE 1N32I 1FJGE 3ZM7A 3Q1QA 1MG7A 2HFSA 4DR4I 4AQYE 1S4EA 4USMA 4DPUA 1RR9A 3B82A 3QT8A 2UUAI 3K17A 4JI5E 1IBME 4B3SI 1NHJA 3M6AA 1KIJA 4DUYE 1DARA 3WU4A 4JI3I 1Z0EA 1NZ0A 3LPSA 3QT7A 2HFUA 4DV2I 4LF4E 4DR6E 1N0UA 2R42A 4X64I 4ED4A 4DR3I 2UU9E 3OTOE 2V2ZA 5BR8I 4DXLA 4JI1I 4X65E 4LF8E 4DR5E 4P52A 1N33I 1XNRE 4UT4A 4DV5I 1KTVA 2HKJA 4JI8E 3LTOA 1I94I 2X36A 4LF7E 1XHKA 1Z5CA 4DUZI 1MX0A 3LNUA 1Z5AA 1Z5BA 4DV1E 1S16A 2AJ4A 2UUCI 1H7SA 4Z7CA 1Z0CA 1H72C 3JAMC 1HR0E 4DV0E 2XEXA 4KHPE 2BV3A 2V8PA 1N34I 1PKPA 1IBKI 1XNQE 4LFCE 4RPFA 4LF5I 5LMUI 2Q2EB 4DR1I 2VQEI 3ZZ0A 4DV7I 2F4VI 1H7UA 5FLXQ 1WUUA 1IBLE 1H74A 2UXCE 4DV4E 1HNXE 4DV6E 4DV3I 3B8HA 4JI2E 5LMNE 1Z59A 4GKKE 1FJGI 4JI0E 2LJPA 5LL6R 1N36E 5IWAI 2UXBI 1ZXNA 2V2QA 4EMDA 3V2UC 3V5RA 4OX9E 4DPXA 4LF9I 4JI5I 1Z0WA 3GONA 1FI4A 4YY3I 4B3ME 4WUCA 2HHHE 4JI6I 4URLA 4GKJE 2ZM6E 2UUBI 3WU5A 2DEIA 2V2VA 4NXMI 2VF3A 4P7AA 3T1HE 2CZ9A 4HXZA 2UU9I 1HNZI 1Z0VA 2R3VA 4XTJA 4FN5A 1N32E 4X62E 2HKEA 4UTGA 4DR2I 2V34A 1VISA 5L3JA 4DR4E 4FWGA 4FWDA 1OJ4A 1XNRI 4WUDA 4YHHI 4DR7E 4B3SE 3J7AG 4WUBA 3B78A 1PIEA 3WU6A 1ZXMA 4JI3E 4M1KA 1J5EI 4DPWA 4FW9A 2HK3A 4LF6I 2X7IA 4X64E 3J81Q 1HR0I 4DR3E 4JI4E 4JV5I 5IT9Q 3ZKBA
chains in the Genus database with same CATH superfamily
1EA6A 2CG9A 4PU9A 1YH8A 5BR8E 2JEBB 2VQFE 4JI1E 3M7ND 2HK2A 4PRXA 1FKAE 5GMDA 3PYFA 4IZJB 4MU4A 2E5LI 2NN6F 1N33E 2O1WA 4DV5E 1BKNA 4LFBI 1I94E 2GO4A 4MDTA 3K1JA 4JG4A 4B3TI 1OYSA 2O3ZA 4JYAE 2IOPA 1XMOI 1Y4SA 5A2QQ 2UXCI 4DUZE 3Q6NA 4DV6I 4NXNI 4B3RI 2CGEA 4X66I 4LCGA 2BM0A 1B63A 3ZZTA 3J81C 5K36F 4LFAE 4IZKB 4JI0I 5K36B 5IT9C 1P42A 5DRPA 1K47A 1HNWI 3KRNA 3DD6A 2UXDI 1ELOA 2CVEA 5GMEA 4K0KE 1QZRA 3H4LA 3Q6MA 4B3MI 1UEKA 1ZM9A 4AQYI 4I3HA 4R1FA 1HK7A 1IBKE 1B62A 1IBMI 5LMUE 2GQ0A 4LCFA 2VQEE 4JI7E 1N0VC 2WW4A 5FWKA 4DUYI 4DV7E 3T1YE 3CWVA 4ZVIA 2OI2A 2JEAA 2C39B 4MYTA 5FLXC 3P3CA 4MU0A 4DV3E 5C0XB 2ZBKB 2NN6D 4LF4I 4IFDC 3M85D 1XMQE 4DR6I 4X62I 1FWLA 4OO1F 2A2DA 5IWAE 2J7KA 4OO1B 2UXBE 3F0NA 2BM1A 3OTOI 2Z5BA 4MYUA 2JE6A 2ZITA 4LF9E 4DR7I 2GS8A 3H1CA 3J80Q 4X65I 4LF8I 4DR5I 1UDNA 4IFDE 2DEJA 4YY3E 1MU5A 1Y6ZA 4PRVA 4JI6E 2NN6A 3B4TA 2UUAE 4JI8I 4HY1A 1RHYA 2UUBE 2BA0D 4LF7I 3QT5A 4NXME 4JI4I 4HACA 1FNMA 1Y5YA 1HNZE 4DV1I 3J7AM 3WU3A 4DV2E 1FWKA 3JAMQ 1E3PA 2VQFI 1ZM2A 4HYMA 3PYDA 2BA1D 4DR2E 1UDOA 1H73A 4DV0I 4DPYA 3J80C 4USKA 2PNMA 4KHPI 2WNRA 4YHHE 3PYEA 5JEAD 4FW6A 2PO1A 3HULA 2Z5CB 4JYAI 2PNZA 1R6MA 3ZZUA 4DU8A 3D4JA 2PNLA 4Z7YA 2C37A 3M85G 1D6TA 2NPFA 2PO2A 1XNQI 4LFCI 1J5EE 4IFDA 5DNXA 3HKMA 2Z5BB 4LFAI 1NHHA 2EFGA 1IBLI 4LF6E 1A6FA 4DV4I 1HNXI 5JEAA 1Z0GA 1RREA 2AE8A 4JV5E 4JI2I 2A2CA 5LMNI 1Z0BA 3PYGA 2NN6C 1NHIA 4FWHA 4GKKI 5EL9A 4FW5A 1R6LA 1ZM3A 2VESA 1N36I 2UUCE 4K0KI 3L7ZA 2BA0G 2E5LE 4OX9I 1Z0TA 4KQVA 3GMEA 4ISAA 3ZKDA 5DRRA 4LFBE 2NN6E 4HACB 1Y4UA 4JI7I 2Z5EA 1U2RA 4B3TE 3QT6A 1EI1A 3T1YI 2HHHI 1XMOE 3UHMA 1N34E 4GKJI 1USVA 4DPTA 2ZM6I 2F1DA 4NXNE 4LF5E 4B3RE 2BA1G 4BA1A 5A2QC 4DR1E 3U1YA 4X66E 2WP8A 1PVGA 2F4VE 1KKHA 4DU7A 1XMQI 4LPFA 2E1RA 4AIDA 3T1HI 3M7NG 1KVKA 2PO1B 4IZJD 3P06A 5C0XF 1HNWE 1ZM4A 2PNZB 2UXDE 1N32I 4BA2A 1FJGE 4QNKA 3ZM7A 3Q1QA 4IFDB 4NBQA 1MG7A 1Y60A 5DROA 2HFSA 4DR4I 4AQYE 1S4EA 4OZEA 4USMA 4DPUA 1RR9A 3B82A 3QT8A 4N3OA 2UUAI 2JEBA 3K17A 5JEAC 4JI5E 2JT2A 1IBME 1NHJA 4B3SI 3M6AA 1KIJA 4IZJA 4DUYE 1DARA 1UDQA 3WU4A 5K36D 4FW3A 4JI3I 1Z0EA 1NZ0A 2BR2A 3LPSA 3QT7A 2HFUA 4QNJA 5JEAE 2IOQA 1UDSA 2O1UA 4DV2I 4LF4E 4DR6E 1N0UA 2R42A 4X64I 4ED4A 4DR3I 2UU9E 3OTOE 2V2ZA 3CDJA 5BR8I 4MQYA 5K36A 4DXLA 4JI1I 4X65E 4LF8E 4DR5E 4P52A 4AM3A 1N33I 1XNRE 4UT4A 4DV5I 3U1KA 2JEAB 1KTVA 2HKJA 4JI8E 3LTOA 1I94I 5C0XD 2X36A 4LF7E 1XHKA 1Z5CA 2IESA 2O1TA 5ELWA 4DUZI 4FW7A 3GLLA 1MX0A 4OO1D 3LNUA 4LOMA 3K85A 1E3HA 1Z5AA 1Z5BA 4DV1E 2JE6B 1S16A 2AJ4A 2C38A 1H7SA 2C39A 2UUCI 1OYRA 1YHCA 4Z7CA 1Z0CA 4U3BA 1H72C 3JAMC 4MU1A 1HR0E 4DV0E 5C0XA 2NN6B 2XEXA 2BR2B 4KHPE 4OO1A 2BV3A 2V8PA 3PRYA 1N34I 1PKPA 1IBKI 1XNQE 4LFCE 4RPFA 4LF5I 5LMUI 2Q2EB 4DR1I 2VQEI 3ZZ0A 1OYPA 4DV7I 2F4VI 1H7UA 5K36C 5FLXQ 1WUUA 1IBLE 1H74A 2UXCE 4DV4E 1HNXE 4U3DA 4DV6E 4DV3I 5DNLA 3B8HA 4JI2E 5LMNE 1Z59A 4GKKE 4J3DA 1FJGI 4JI0E 2WNRB 2LJPA 5LL6R 1N36E 5IWAI 5K36E 2PO0A 2UXBI 1ZXNA 2V2QA 4EMDA 1XXEA 3V2UC 3V5RA 4OX9E 4DPXA 4LF9I 2C37B 3NZKA 4IFDF 4JI5I 1Z0WA 2PO2B 3GCMA 3GONA 1FI4A 1VI7A 4YY3I 4B3ME 4WUCA 2HHHE 4JI6I 2C38B 5JEAF 4URLA 4GKJE 4IS9A 5JEAB 2ZM6E 2UUBI 3WU5A 5C0XC 2Z5CA 2J65A 2DEIA 2V2VA 3P76A 4NXMI 4GQUA 3P3EA 5DRQA 4OO1C 3L7ZB 4LCHA 2VF3A 4P7AA 3T1HE 3PS3A 2CZ9A 4HXZA 2UU9I 1HNZI 1Z0VA 2R3VA 4XTJA 4FN5A 1N32E 5C0XE 4X62E 2HKEA 4UTGA 4DR2I 2V34A 3P3GA 1VISA 4OKGA 4AIMA 5L3JA 4DR4E 2O1VA 4FWGA 4FWDA 4OO1E 1OJ4A 1XNRI 4IZKA 4WUDA 4YHHI 4DR7E 3PS2A 4B3SE 4BA1B 3J7AG 4WUBA 3B78A 3CDIA 2WP8B 1PIEA 3WU6A 1ZXMA 4FW4A 4MU3A 4JI3E 4M1KA 2IERA 1J5EI 3PS1A 2PO0B 4DPWA 2GO3A 3HJCA 4FW9A 2HK3A 4BA2B 4LF6I 4IFDD 1USUA 2X7IA 4X64E 3J81Q 1HR0I 4DR3E 4JI4E 4JV5I 5EKWA 5IT9Q 3ZKBA
chains in the Genus database with same CATH topology
1EA6A 2CG9A 4PU9A 5BR8E 2VQFE 4JI1E 2HK2A 4PRXA 1FKAE 5GMDA 3PYFA 4IZJB 2E5LI 1N33E 2O1WA 4DV5E 1BKNA 4LFBI 1I94E 3K1JA 4JG4A 4B3TI 4JYAE 2IOPA 1XMOI 1Y4SA 5A2QQ 2UXCI 4DUZE 3Q6NA 4DV6I 4NXNI 4B3RI 2CGEA 4X66I 2BM0A 1B63A 3ZZTA 3J81C 4LFAE 4IZKB 4JI0I 5IT9C 1K47A 1HNWI 2UXDI 1ELOA 5GMEA 4K0KE 1QZRA 3H4LA 3Q6MA 4B3MI 1UEKA 1ZM9A 4AQYI 4I3HA 4R1FA 1HK7A 1IBKE 1B62A 1IBMI 5LMUE 2GQ0A 2VQEE 4JI7E 1N0VC 2WW4A 5FWKA 4DUYI 4DV7E 3T1YE 3CWVA 4ZVIA 2OI2A 4MYTA 5FLXC 4DV3E 2ZBKB 4LF4I 1XMQE 4DR6I 4X62I 1FWLA 2A2DA 5IWAE 2J7KA 2UXBE 3F0NA 2BM1A 3OTOI 2Z5BA 4MYUA 2ZITA 4LF9E 4DR7I 2GS8A 3J80Q 4X65I 4LF8I 4DR5I 2DEJA 4YY3E 1MU5A 1Y6ZA 4PRVA 4JI6E 2UUAE 4JI8I 4HY1A 2UUBE 4LF7I 3QT5A 4NXME 4JI4I 4HACA 1FNMA 1HNZE 4DV1I 3J7AM 3WU3A 4DV2E 1FWKA 3JAMQ 2VQFI 1ZM2A 4HYMA 3PYDA 4DR2E 1H73A 4DV0I 4DPYA 3J80C 4USKA 2PNMA 4KHPI 4YHHE 3PYEA 3HULA 2Z5CB 4JYAI 3ZZUA 4DU8A 3D4JA 2PNLA 4Z7YA 1D6TA 2NPFA 1XNQI 4LFCI 1J5EE 2Z5BB 4LFAI 1NHHA 2EFGA 1IBLI 4LF6E 1A6FA 4DV4I 1HNXI 1Z0GA 1RREA 4JV5E 4JI2I 2A2CA 5LMNI 1Z0BA 3PYGA 1NHIA 4FWHA 4GKKI 1ZM3A 1N36I 2UUCE 4K0KI 2E5LE 4OX9I 1Z0TA 4KQVA 3ZKDA 4LFBE 4HACB 1Y4UA 4JI7I 2Z5EA 1U2RA 4B3TE 3QT6A 1EI1A 3T1YI 2HHHI 1XMOE 1N34E 4GKJI 1USVA 4DPTA 2ZM6I 4NXNE 4B3RE 4LF5E 5A2QC 4DR1E 4X66E 2F4VE 1PVGA 1KKHA 4DU7A 1XMQI 2E1RA 3T1HI 1KVKA 4IZJD 3P06A 1HNWE 1ZM4A 2UXDE 1N32I 1FJGE 3ZM7A 3Q1QA 1MG7A 2HFSA 4DR4I 4AQYE 1S4EA 4USMA 4DPUA 1RR9A 3B82A 3QT8A 4N3OA 2UUAI 3K17A 4JI5E 1IBME 1NHJA 4B3SI 3M6AA 1KIJA 4IZJA 4DUYE 1DARA 3WU4A 4JI3I 1Z0EA 1NZ0A 3LPSA 3QT7A 2HFUA 2IOQA 2O1UA 4DV2I 4LF4E 4DR6E 1N0UA 2R42A 4X64I 4ED4A 4DR3I 2UU9E 3OTOE 2V2ZA 5BR8I 4DXLA 4JI1I 4X65E 4LF8E 4DR5E 4P52A 1N33I 1XNRE 4UT4A 4DV5I 1KTVA 2HKJA 4JI8E 3LTOA 1I94I 2X36A 4LF7E 1XHKA 1Z5CA 2O1TA 4DUZI 1MX0A 3LNUA 3K85A 1Z5AA 1Z5BA 4DV1E 1S16A 2AJ4A 1H7SA 2UUCI 4Z7CA 1Z0CA 1H72C 3JAMC 1HR0E 4DV0E 2XEXA 4KHPE 2BV3A 2V8PA 3PRYA 1N34I 1PKPA 1IBKI 1XNQE 4LFCE 4RPFA 4LF5I 5LMUI 2Q2EB 4DR1I 2VQEI 3ZZ0A 4DV7I 2F4VI 1H7UA 5FLXQ 1WUUA 1IBLE 1H74A 2UXCE 4DV4E 1HNXE 4DV6E 4DV3I 3B8HA 4JI2E 5LMNE 1Z59A 4GKKE 1FJGI 4JI0E 2LJPA 5LL6R 1N36E 5IWAI 2UXBI 1ZXNA 2V2QA 4EMDA 3V2UC 3V5RA 4OX9E 4DPXA 4LF9I 4JI5I 1Z0WA 3GONA 1FI4A 4YY3I 4B3ME 4WUCA 2HHHE 4JI6I 4URLA 4GKJE 2ZM6E 2UUBI 3WU5A 2Z5CA 2DEIA 2V2VA 4NXMI 2VF3A 4P7AA 3T1HE 2CZ9A 4HXZA 2UU9I 1HNZI 1Z0VA 2R3VA 4XTJA 4FN5A 1N32E 4X62E 2HKEA 4UTGA 4DR2I 2V34A 1VISA 5L3JA 4DR4E 4FWGA 4FWDA 1OJ4A 1XNRI 4IZKA 4WUDA 4YHHI 4DR7E 4B3SE 3J7AG 4WUBA 3B78A 1PIEA 3WU6A 1ZXMA 4JI3E 4M1KA 1J5EI 4DPWA 3HJCA 4FW9A 2HK3A 4LF6I 1USUA 2X7IA 4X64E 3J81Q 1HR0I 4DR3E 4JI4E 4JV5I 2O1VA 5IT9Q 3ZKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA6 A;  4PU9 A;  5BR8 E;  2VQF E;  4JI1 E;  2HK2 A;  4PRX A;  1FKA E;  5GMD A;  3PYF A;  2E5L I;  1N33 E;  4DV5 E;  1BKN A;  4LFB I;  1I94 E;  3K1J A;  4JG4 A;  4B3T I;  4JYA E;  1XMO I;  5A2Q Q;  2UXC I;  4DUZ E;  4DV6 I;  4NXN I;  4B3R I;  4X66 I;  2BM0 A;  1B63 A;  3ZZT A;  3J81 C;  4LFA E;  4JI0 I;  5IT9 C;  1K47 A;  1HNW I;  2UXD I;  1ELO A;  5GME A;  4K0K E;  1QZR A;  3H4L A;  4B3M I;  1UEK A;  1ZM9 A;  4AQY I;  4I3H A;  4R1F A;  1IBK E;  1B62 A;  1IBM I;  5LMU E;  2VQE E;  4JI7 E;  1N0V C;  2WW4 A;  4DUY I;  4DV7 E;  3T1Y E;  3CWV A;  4ZVI A;  2OI2 A;  4MYT A;  5FLX C;  4DV3 E;  2ZBK B;  4LF4 I;  1XMQ E;  4DR6 I;  4X62 I;  1FWL A;  2A2D A;  5IWA E;  2J7K A;  2UXB E;  3F0N A;  2BM1 A;  3OTO I;  4MYU A;  2ZIT A;  4LF9 E;  4DR7 I;  2GS8 A;  3J80 Q;  4X65 I;  4LF8 I;  4DR5 I;  2DEJ A;  4YY3 E;  1MU5 A;  4PRV A;  4JI6 E;  2UUA E;  4JI8 I;  4HY1 A;  2UUB E;  4LF7 I;  3QT5 A;  4NXM E;  4JI4 I;  4HAC A;  1FNM A;  1HNZ E;  4DV1 I;  3J7A M;  3WU3 A;  4DV2 E;  1FWK A;  3JAM Q;  2VQF I;  1ZM2 A;  4HYM A;  3PYD A;  4DR2 E;  1H73 A;  4DV0 I;  4DPY A;  3J80 C;  4USK A;  4KHP I;  4YHH E;  3PYE A;  3HUL A;  4JYA I;  3ZZU A;  4DU8 A;  3D4J A;  4Z7Y A;  1D6T A;  2NPF A;  1XNQ I;  4LFC I;  1J5E E;  4LFA I;  1NHH A;  2EFG A;  1IBL I;  4LF6 E;  1A6F A;  4DV4 I;  1HNX I;  1Z0G A;  1RRE A;  4JV5 E;  4JI2 I;  2A2C A;  5LMN I;  1Z0B A;  3PYG A;  1NHI A;  4FWH A;  4GKK I;  1ZM3 A;  1N36 I;  2UUC E;  4K0K I;  2E5L E;  4OX9 I;  1Z0T A;  4KQV A;  3ZKD A;  4LFB E;  4HAC B;  4JI7 I;  1U2R A;  4B3T E;  3QT6 A;  1EI1 A;  3T1Y I;  2HHH I;  1XMO E;  1N34 E;  4GKJ I;  4DPT A;  2ZM6 I;  4NXN E;  4B3R E;  4LF5 E;  5A2Q C;  4DR1 E;  4X66 E;  2F4V E;  1PVG A;  1KKH A;  4DU7 A;  1XMQ I;  2E1R A;  3T1H I;  1KVK A;  1HNW E;  1ZM4 A;  2UXD E;  1N32 I;  1FJG E;  3ZM7 A;  3Q1Q A;  1MG7 A;  2HFS A;  4DR4 I;  4AQY E;  1S4E A;  4USM A;  4DPU A;  1RR9 A;  3B82 A;  3QT8 A;  2UUA I;  3K17 A;  4JI5 E;  1IBM E;  4B3S I;  1NHJ A;  3M6A A;  1KIJ A;  4DUY E;  1DAR A;  3WU4 A;  4JI3 I;  1Z0E A;  1NZ0 A;  3LPS A;  3QT7 A;  2HFU A;  4DV2 I;  4LF4 E;  4DR6 E;  1N0U A;  2R42 A;  4X64 I;  4ED4 A;  4DR3 I;  2UU9 E;  3OTO E;  2V2Z A;  5BR8 I;  4DXL A;  4JI1 I;  4X65 E;  4LF8 E;  4DR5 E;  4P52 A;  1N33 I;  1XNR E;  4UT4 A;  4DV5 I;  1KTV A;  2HKJ A;  4JI8 E;  3LTO A;  1I94 I;  2X36 A;  4LF7 E;  1XHK A;  1Z5C A;  4DUZ I;  1MX0 A;  3LNU A;  1Z5A A;  1Z5B A;  4DV1 E;  1S16 A;  2AJ4 A;  2UUC I;  1H7S A;  4Z7C A;  1Z0C A;  1H72 C;  3JAM C;  1HR0 E;  4DV0 E;  2XEX A;  4KHP E;  2BV3 A;  2V8P A;  1N34 I;  1PKP A;  1IBK I;  1XNQ E;  4LFC E;  4RPF A;  4LF5 I;  5LMU I;  2Q2E B;  4DR1 I;  2VQE I;  3ZZ0 A;  4DV7 I;  2F4V I;  1H7U A;  5FLX Q;  1WUU A;  1IBL E;  1H74 A;  2UXC E;  4DV4 E;  1HNX E;  4DV6 E;  4DV3 I;  3B8H A;  4JI2 E;  5LMN E;  1Z59 A;  4GKK E;  1FJG I;  4JI0 E;  2LJP A;  5LL6 R;  1N36 E;  5IWA I;  2UXB I;  1ZXN A;  2V2Q A;  4EMD A;  3V2U C;  3V5R A;  4OX9 E;  4DPX A;  4LF9 I;  4JI5 I;  1Z0W A;  3GON A;  1FI4 A;  4YY3 I;  4B3M E;  4WUC A;  2HHH E;  4JI6 I;  4URL A;  4GKJ E;  2ZM6 E;  2UUB I;  3WU5 A;  2DEI A;  2V2V A;  4NXM I;  2VF3 A;  4P7A A;  3T1H E;  2CZ9 A;  4HXZ A;  2UU9 I;  1HNZ I;  1Z0V A;  2R3V A;  4XTJ A;  4FN5 A;  1N32 E;  4X62 E;  2HKE A;  4UTG A;  4DR2 I;  2V34 A;  1VIS A;  5L3J A;  4DR4 E;  4FWG A;  4FWD A;  1OJ4 A;  1XNR I;  4WUD A;  4YHH I;  4DR7 E;  4B3S E;  3J7A G;  4WUB A;  3B78 A;  1PIE A;  3WU6 A;  1ZXM A;  4JI3 E;  4M1K A;  1J5E I;  4DPW A;  4FW9 A;  2HK3 A;  4LF6 I;  2X7I A;  4X64 E;  3J81 Q;  1HR0 I;  4DR3 E;  4JI4 E;  4JV5 I;  5IT9 Q;  3ZKB A; 
#chains in the Genus database with same CATH topology
 1EA6 A;  2CG9 A;  4PU9 A;  1YH8 A;  5BR8 E;  2JEB B;  2VQF E;  4JI1 E;  3M7N D;  2HK2 A;  4PRX A;  1FKA E;  5GMD A;  3PYF A;  4IZJ B;  4MU4 A;  2E5L I;  2NN6 F;  1N33 E;  2O1W A;  4DV5 E;  1BKN A;  4LFB I;  1I94 E;  2GO4 A;  4MDT A;  3K1J A;  4JG4 A;  4B3T I;  1OYS A;  2O3Z A;  4JYA E;  2IOP A;  1XMO I;  1Y4S A;  5A2Q Q;  2UXC I;  4DUZ E;  3Q6N A;  4DV6 I;  4NXN I;  4B3R I;  2CGE A;  4X66 I;  4LCG A;  2BM0 A;  1B63 A;  3ZZT A;  3J81 C;  5K36 F;  4LFA E;  4IZK B;  4JI0 I;  5K36 B;  5IT9 C;  1P42 A;  5DRP A;  1K47 A;  1HNW I;  3KRN A;  3DD6 A;  2UXD I;  1ELO A;  2CVE A;  5GME A;  4K0K E;  1QZR A;  3H4L A;  3Q6M A;  4B3M I;  1UEK A;  1ZM9 A;  4AQY I;  4I3H A;  4R1F A;  1HK7 A;  1IBK E;  1B62 A;  1IBM I;  5LMU E;  2GQ0 A;  4LCF A;  2VQE E;  4JI7 E;  1N0V C;  2WW4 A;  5FWK A;  4DUY I;  4DV7 E;  3T1Y E;  3CWV A;  4ZVI A;  2OI2 A;  2JEA A;  2C39 B;  4MYT A;  5FLX C;  3P3C A;  4MU0 A;  4DV3 E;  5C0X B;  2ZBK B;  2NN6 D;  4LF4 I;  4IFD C;  3M85 D;  1XMQ E;  4DR6 I;  4X62 I;  1FWL A;  4OO1 F;  2A2D A;  5IWA E;  2J7K A;  4OO1 B;  2UXB E;  3F0N A;  2BM1 A;  3OTO I;  2Z5B A;  4MYU A;  2JE6 A;  2ZIT A;  4LF9 E;  4DR7 I;  2GS8 A;  3H1C A;  3J80 Q;  4X65 I;  4LF8 I;  4DR5 I;  1UDN A;  4IFD E;  2DEJ A;  4YY3 E;  1MU5 A;  1Y6Z A;  4PRV A;  4JI6 E;  2NN6 A;  3B4T A;  2UUA E;  4JI8 I;  4HY1 A;  1RHY A;  2UUB E;  2BA0 D;  4LF7 I;  3QT5 A;  4NXM E;  4JI4 I;  4HAC A;  1FNM A;  1Y5Y A;  1HNZ E;  4DV1 I;  3J7A M;  3WU3 A;  4DV2 E;  1FWK A;  3JAM Q;  1E3P A;  2VQF I;  1ZM2 A;  4HYM A;  3PYD A;  2BA1 D;  4DR2 E;  1UDO A;  1H73 A;  4DV0 I;  4DPY A;  3J80 C;  4USK A;  2PNM A;  4KHP I;  2WNR A;  4YHH E;  3PYE A;  5JEA D;  4FW6 A;  2PO1 A;  3HUL A;  2Z5C B;  4JYA I;  2PNZ A;  1R6M A;  3ZZU A;  4DU8 A;  3D4J A;  2PNL A;  4Z7Y A;  2C37 A;  3M85 G;  1D6T A;  2NPF A;  2PO2 A;  1XNQ I;  4LFC I;  1J5E E;  4IFD A;  5DNX A;  3HKM A;  2Z5B B;  4LFA I;  1NHH A;  2EFG A;  1IBL I;  4LF6 E;  1A6F A;  4DV4 I;  1HNX I;  5JEA A;  1Z0G A;  1RRE A;  2AE8 A;  4JV5 E;  4JI2 I;  2A2C A;  5LMN I;  1Z0B A;  3PYG A;  2NN6 C;  1NHI A;  4FWH A;  4GKK I;  5EL9 A;  4FW5 A;  1R6L A;  1ZM3 A;  2VES A;  1N36 I;  2UUC E;  4K0K I;  3L7Z A;  2BA0 G;  2E5L E;  4OX9 I;  1Z0T A;  4KQV A;  3GME A;  4ISA A;  3ZKD A;  5DRR A;  4LFB E;  2NN6 E;  4HAC B;  1Y4U A;  4JI7 I;  2Z5E A;  1U2R A;  4B3T E;  3QT6 A;  1EI1 A;  3T1Y I;  2HHH I;  1XMO E;  3UHM A;  1N34 E;  4GKJ I;  1USV A;  4DPT A;  2ZM6 I;  2F1D A;  4NXN E;  4LF5 E;  4B3R E;  2BA1 G;  4BA1 A;  5A2Q C;  4DR1 E;  3U1Y A;  4X66 E;  2WP8 A;  1PVG A;  2F4V E;  1KKH A;  4DU7 A;  1XMQ I;  4LPF A;  2E1R A;  4AID A;  3T1H I;  3M7N G;  1KVK A;  2PO1 B;  4IZJ D;  3P06 A;  5C0X F;  1HNW E;  1ZM4 A;  2PNZ B;  2UXD E;  1N32 I;  4BA2 A;  1FJG E;  4QNK A;  3ZM7 A;  3Q1Q A;  4IFD B;  4NBQ A;  1MG7 A;  1Y60 A;  5DRO A;  2HFS A;  4DR4 I;  4AQY E;  1S4E A;  4OZE A;  4USM A;  4DPU A;  1RR9 A;  3B82 A;  3QT8 A;  4N3O A;  2UUA I;  2JEB A;  3K17 A;  5JEA C;  4JI5 E;  2JT2 A;  1IBM E;  1NHJ A;  4B3S I;  3M6A A;  1KIJ A;  4IZJ A;  4DUY E;  1DAR A;  1UDQ A;  3WU4 A;  5K36 D;  4FW3 A;  4JI3 I;  1Z0E A;  1NZ0 A;  2BR2 A;  3LPS A;  3QT7 A;  2HFU A;  4QNJ A;  5JEA E;  2IOQ A;  1UDS A;  2O1U A;  4DV2 I;  4LF4 E;  4DR6 E;  1N0U A;  2R42 A;  4X64 I;  4ED4 A;  4DR3 I;  2UU9 E;  3OTO E;  2V2Z A;  3CDJ A;  5BR8 I;  4MQY A;  5K36 A;  4DXL A;  4JI1 I;  4X65 E;  4LF8 E;  4DR5 E;  4P52 A;  4AM3 A;  1N33 I;  1XNR E;  4UT4 A;  4DV5 I;  3U1K A;  2JEA B;  1KTV A;  2HKJ A;  4JI8 E;  3LTO A;  1I94 I;  5C0X D;  2X36 A;  4LF7 E;  1XHK A;  1Z5C A;  2IES A;  2O1T A;  5ELW A;  4DUZ I;  4FW7 A;  3GLL A;  1MX0 A;  4OO1 D;  3LNU A;  4LOM A;  3K85 A;  1E3H A;  1Z5A A;  1Z5B A;  4DV1 E;  2JE6 B;  1S16 A;  2AJ4 A;  2C38 A;  1H7S A;  2C39 A;  2UUC I;  1OYR A;  1YHC A;  4Z7C A;  1Z0C A;  4U3B A;  1H72 C;  3JAM C;  4MU1 A;  1HR0 E;  4DV0 E;  5C0X A;  2NN6 B;  2XEX A;  2BR2 B;  4KHP E;  4OO1 A;  2BV3 A;  2V8P A;  3PRY A;  1N34 I;  1PKP A;  1IBK I;  1XNQ E;  4LFC E;  4RPF A;  4LF5 I;  5LMU I;  2Q2E B;  4DR1 I;  2VQE I;  3ZZ0 A;  1OYP A;  4DV7 I;  2F4V I;  1H7U A;  5K36 C;  5FLX Q;  1WUU A;  1IBL E;  1H74 A;  2UXC E;  4DV4 E;  1HNX E;  4U3D A;  4DV6 E;  4DV3 I;  5DNL A;  3B8H A;  4JI2 E;  5LMN E;  1Z59 A;  4GKK E;  4J3D A;  1FJG I;  4JI0 E;  2WNR B;  2LJP A;  5LL6 R;  1N36 E;  5IWA I;  5K36 E;  2PO0 A;  2UXB I;  1ZXN A;  2V2Q A;  4EMD A;  1XXE A;  3V2U C;  3V5R A;  4OX9 E;  4DPX A;  4LF9 I;  2C37 B;  3NZK A;  4IFD F;  4JI5 I;  1Z0W A;  2PO2 B;  3GCM A;  3GON A;  1FI4 A;  1VI7 A;  4YY3 I;  4B3M E;  4WUC A;  2HHH E;  4JI6 I;  2C38 B;  5JEA F;  4URL A;  4GKJ E;  4IS9 A;  5JEA B;  2ZM6 E;  2UUB I;  3WU5 A;  5C0X C;  2Z5C A;  2J65 A;  2DEI A;  2V2V A;  3P76 A;  4NXM I;  4GQU A;  3P3E A;  5DRQ A;  4OO1 C;  3L7Z B;  4LCH A;  2VF3 A;  4P7A A;  3T1H E;  3PS3 A;  2CZ9 A;  4HXZ A;  2UU9 I;  1HNZ I;  1Z0V A;  2R3V A;  4XTJ A;  4FN5 A;  1N32 E;  5C0X E;  4X62 E;  2HKE A;  4UTG A;  4DR2 I;  2V34 A;  3P3G A;  1VIS A;  4OKG A;  4AIM A;  5L3J A;  4DR4 E;  2O1V A;  4FWG A;  4FWD A;  4OO1 E;  1OJ4 A;  1XNR I;  4IZK A;  4WUD A;  4YHH I;  4DR7 E;  3PS2 A;  4B3S E;  4BA1 B;  3J7A G;  4WUB A;  3B78 A;  3CDI A;  2WP8 B;  1PIE A;  3WU6 A;  1ZXM A;  4FW4 A;  4MU3 A;  4JI3 E;  4M1K A;  2IER A;  1J5E I;  3PS1 A;  2PO0 B;  4DPW A;  2GO3 A;  3HJC A;  4FW9 A;  2HK3 A;  4BA2 B;  4LF6 I;  4IFD D;  1USU A;  2X7I A;  4X64 E;  3J81 Q;  1HR0 I;  4DR3 E;  4JI4 E;  4JV5 I;  5EKW A;  5IT9 Q;  3ZKB A; 
#chains in the Genus database with same CATH homology
 1EA6 A;  2CG9 A;  4PU9 A;  5BR8 E;  2VQF E;  4JI1 E;  2HK2 A;  4PRX A;  1FKA E;  5GMD A;  3PYF A;  4IZJ B;  2E5L I;  1N33 E;  2O1W A;  4DV5 E;  1BKN A;  4LFB I;  1I94 E;  3K1J A;  4JG4 A;  4B3T I;  4JYA E;  2IOP A;  1XMO I;  1Y4S A;  5A2Q Q;  2UXC I;  4DUZ E;  3Q6N A;  4DV6 I;  4NXN I;  4B3R I;  2CGE A;  4X66 I;  2BM0 A;  1B63 A;  3ZZT A;  3J81 C;  4LFA E;  4IZK B;  4JI0 I;  5IT9 C;  1K47 A;  1HNW I;  2UXD I;  1ELO A;  5GME A;  4K0K E;  1QZR A;  3H4L A;  3Q6M A;  4B3M I;  1UEK A;  1ZM9 A;  4AQY I;  4I3H A;  4R1F A;  1HK7 A;  1IBK E;  1B62 A;  1IBM I;  5LMU E;  2GQ0 A;  2VQE E;  4JI7 E;  1N0V C;  2WW4 A;  5FWK A;  4DUY I;  4DV7 E;  3T1Y E;  3CWV A;  4ZVI A;  2OI2 A;  4MYT A;  5FLX C;  4DV3 E;  2ZBK B;  4LF4 I;  1XMQ E;  4DR6 I;  4X62 I;  1FWL A;  2A2D A;  5IWA E;  2J7K A;  2UXB E;  3F0N A;  2BM1 A;  3OTO I;  2Z5B A;  4MYU A;  2ZIT A;  4LF9 E;  4DR7 I;  2GS8 A;  3J80 Q;  4X65 I;  4LF8 I;  4DR5 I;  2DEJ A;  4YY3 E;  1MU5 A;  1Y6Z A;  4PRV A;  4JI6 E;  2UUA E;  4JI8 I;  4HY1 A;  2UUB E;  4LF7 I;  3QT5 A;  4NXM E;  4JI4 I;  4HAC A;  1FNM A;  1HNZ E;  4DV1 I;  3J7A M;  3WU3 A;  4DV2 E;  1FWK A;  3JAM Q;  2VQF I;  1ZM2 A;  4HYM A;  3PYD A;  4DR2 E;  1H73 A;  4DV0 I;  4DPY A;  3J80 C;  4USK A;  2PNM A;  4KHP I;  4YHH E;  3PYE A;  3HUL A;  2Z5C B;  4JYA I;  3ZZU A;  4DU8 A;  3D4J A;  2PNL A;  4Z7Y A;  1D6T A;  2NPF A;  1XNQ I;  4LFC I;  1J5E E;  2Z5B B;  4LFA I;  1NHH A;  2EFG A;  1IBL I;  4LF6 E;  1A6F A;  4DV4 I;  1HNX I;  1Z0G A;  1RRE A;  4JV5 E;  4JI2 I;  2A2C A;  5LMN I;  1Z0B A;  3PYG A;  1NHI A;  4FWH A;  4GKK I;  1ZM3 A;  1N36 I;  2UUC E;  4K0K I;  2E5L E;  4OX9 I;  1Z0T A;  4KQV A;  3ZKD A;  4LFB E;  4HAC B;  1Y4U A;  4JI7 I;  2Z5E A;  1U2R A;  4B3T E;  3QT6 A;  1EI1 A;  3T1Y I;  2HHH I;  1XMO E;  1N34 E;  4GKJ I;  1USV A;  4DPT A;  2ZM6 I;  4NXN E;  4B3R E;  4LF5 E;  5A2Q C;  4DR1 E;  4X66 E;  2F4V E;  1PVG A;  1KKH A;  4DU7 A;  1XMQ I;  2E1R A;  3T1H I;  1KVK A;  4IZJ D;  3P06 A;  1HNW E;  1ZM4 A;  2UXD E;  1N32 I;  1FJG E;  3ZM7 A;  3Q1Q A;  1MG7 A;  2HFS A;  4DR4 I;  4AQY E;  1S4E A;  4USM A;  4DPU A;  1RR9 A;  3B82 A;  3QT8 A;  4N3O A;  2UUA I;  3K17 A;  4JI5 E;  1IBM E;  1NHJ A;  4B3S I;  3M6A A;  1KIJ A;  4IZJ A;  4DUY E;  1DAR A;  3WU4 A;  4JI3 I;  1Z0E A;  1NZ0 A;  3LPS A;  3QT7 A;  2HFU A;  2IOQ A;  2O1U A;  4DV2 I;  4LF4 E;  4DR6 E;  1N0U A;  2R42 A;  4X64 I;  4ED4 A;  4DR3 I;  2UU9 E;  3OTO E;  2V2Z A;  5BR8 I;  4DXL A;  4JI1 I;  4X65 E;  4LF8 E;  4DR5 E;  4P52 A;  1N33 I;  1XNR E;  4UT4 A;  4DV5 I;  1KTV A;  2HKJ A;  4JI8 E;  3LTO A;  1I94 I;  2X36 A;  4LF7 E;  1XHK A;  1Z5C A;  2O1T A;  4DUZ I;  1MX0 A;  3LNU A;  3K85 A;  1Z5A A;  1Z5B A;  4DV1 E;  1S16 A;  2AJ4 A;  1H7S A;  2UUC I;  4Z7C A;  1Z0C A;  1H72 C;  3JAM C;  1HR0 E;  4DV0 E;  2XEX A;  4KHP E;  2BV3 A;  2V8P A;  3PRY A;  1N34 I;  1PKP A;  1IBK I;  1XNQ E;  4LFC E;  4RPF A;  4LF5 I;  5LMU I;  2Q2E B;  4DR1 I;  2VQE I;  3ZZ0 A;  4DV7 I;  2F4V I;  1H7U A;  5FLX Q;  1WUU A;  1IBL E;  1H74 A;  2UXC E;  4DV4 E;  1HNX E;  4DV6 E;  4DV3 I;  3B8H A;  4JI2 E;  5LMN E;  1Z59 A;  4GKK E;  1FJG I;  4JI0 E;  2LJP A;  5LL6 R;  1N36 E;  5IWA I;  2UXB I;  1ZXN A;  2V2Q A;  4EMD A;  3V2U C;  3V5R A;  4OX9 E;  4DPX A;  4LF9 I;  4JI5 I;  1Z0W A;  3GON A;  1FI4 A;  4YY3 I;  4B3M E;  4WUC A;  2HHH E;  4JI6 I;  4URL A;  4GKJ E;  2ZM6 E;  2UUB I;  3WU5 A;  2Z5C A;  2DEI A;  2V2V A;  4NXM I;  2VF3 A;  4P7A A;  3T1H E;  2CZ9 A;  4HXZ A;  2UU9 I;  1HNZ I;  1Z0V A;  2R3V A;  4XTJ A;  4FN5 A;  1N32 E;  4X62 E;  2HKE A;  4UTG A;  4DR2 I;  2V34 A;  1VIS A;  5L3J A;  4DR4 E;  4FWG A;  4FWD A;  1OJ4 A;  1XNR I;  4IZK A;  4WUD A;  4YHH I;  4DR7 E;  4B3S E;  3J7A G;  4WUB A;  3B78 A;  1PIE A;  3WU6 A;  1ZXM A;  4JI3 E;  4M1K A;  1J5E I;  4DPW A;  3HJC A;  4FW9 A;  2HK3 A;  4LF6 I;  1USU A;  2X7I A;  4X64 E;  3J81 Q;  1HR0 I;  4DR3 E;  4JI4 E;  4JV5 I;  2O1V A;  5IT9 Q;  3ZKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...