3J7AM

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
KRVQTFGKKKTAVAVATVTNGKGLIKLNGKNLDLVEPYILKTKVYEPLWLIGSGKLKNLDIRIRVKGGGQTSQIYAIRQAIGKGIISYYQKYVDESTKKELKDVLLRYDRSLLVGDTRRCEPKKFGGKGARARYQKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 31
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j7aM00
2J7KA 1K47A 1RREA 4WUCA 4LFBI 4X62E 1N36E 1MG7A 2GS8A 1IBLI 4DV1E 3QT7A 4MYUA 1DARA 4X65E 3CWVA 4DV6I 4LF4E 4DR4I 2UXDE 4DR1E 2R42A 2V2ZA 4JI3I 4NXNE 4LFCE 3K1JA 2ZBKB 1Z5CA 3PYDA 4JI0I 2UUBE 2WW4A 4X64E 4DUZI 4B3TI 4URLA 2UXBE 2BM0A 1ZM2A 1Z0CA 5A2QC 4X62I 1N36I 2BV3A 5GMEA 4LF5E 2A2CA 4DXLA 4DV1I 4DR2E 5FLXQ 5BR8E 1RR9A 4X65I 4LF4I 4M1KA 2UXDI 4DR1I 4JI7E 4NXNI 4LFCI 4USMA 2UUBI 1Z59A 3ZM7A 4X64I 4FWHA 2X7IA 2V34A 4HXZA 1NZ0A 4DV0E 2UXBI 3D4JA 3QT6A 4K0KE 3QT5A 4LF5I 4DR2I 4Z7YA 4JI8E 5BR8I 1FNMA 3OTOE 1EI1A 4JI7I 1N32E 3JAMC 2DEJA 1PIEA 3F0NA 5IT9Q 1UEKA 2UU9E 3HULA 1N34E 1WUUA 4DV0I 1Z0BA 4K0KI 1U2RA 4LFAE 2E5LE 4JI8I 4JI4E 2VQFE 1XHKA 1PKPA 2UUCE 3OTOI 1NHIA 2HKJA 1N32I 4EMDA 3J7AM 4DPYA 4FWDA 2UU9I 4LF6E 4B3RE 4OX9I 1FWKA 1N34I 1KVKA 3PYGA 4DV5E 2XEXA 1N0VC 4DPTA 3ZKBA 4UT4A 3J81Q 4UTGA 4LFAI 2UXCE 2X36A 2E5LI 1A6FA 2NPFA 4JV5I 1HNWE 4JI4I 2VQFI 3ZZTA 2UUCI 3J81C 1IBKE 1B62A 1D6TA 4AQYE 3B82A 1S16A 4GKJE 4RPFA 4LF6I 4B3RI 2AJ4A 1XNRE 1Z0GA 3PYFA 3WU6A 3WU5A 4DV5I 5FLXC 1KTVA 1IBME 3GONA 1QZRA 1NHJA 4YY3E 1HNZE 4KHPE 1VISA 1ZXNA 2UXCI 5GMDA 4DU8A 3T1HE 2A2DA 4JI2E 1HNWI 1HNXE 4YHHE 1IBKI 3K17A 4JI6E 1FKAE 1PVGA 1H74A 4AQYI 1N33E 4FWGA 4KQVA 4GKJI 2EFGA 2HK2A 1XNRI 4DV4E 4DPUA 1KKHA 5LMNE 2E1RA 1KIJA 3LTOA 5IWAE 4FN5A 1IBMI 1Z5BA 1S4EA 2ZITA 4JG4A 4OX9E 4YY3I 1HNZI 1ZM3A 3J7AG 4KHPI 1H73A 4WUBA 4LF9E 4PRXA 1OJ4A 5IT9C 1XNQE 3T1HI 1Z0TA 4JI2I 4JI1E 3ZZ0A 3LNUA 1BKNA 1HNXI 4YHHI 3J80Q 5LMUE 4JI6I 2VF3A 1ZXMA 1N33I 1Z0WA 3J80C 4P7AA 1H72C 4DV4I 5LMNI 1FI4A 4DR6I 2HKEA 5IWAI 4DR3E 4DR7E 4MYTA 4B3ME 1FWLA 4PU9A 3Q1QA 2F4VE 1Z0VA 4LF9I 2HHHE 1XNQI 1HR0E 4JI1I 2HFSA 2HK3A 4I3HA 4HY1A 4X66E 5LMUI 1XMQE 4HACB 1J5EE 1ZM9A 3V2UC 1H7SA 3LPSA 4P52A 4ZVIA 2ZM6E 1FJGE 3WU4A 4Z7CA 4DR3I 4DR7I 1H7UA 4B3MI 1MX0A 4DV3E 5A2QQ 4DR5I 1N0UA 2F4VI 4HACA 4B3SE 2HHHI 4R1FA 4LF8E 2UUAE 1HR0I 2LJPA 4DV7E 4PRVA 4NXME 2R3VA 4X66I 1ELOA 1XMQI 3ZKDA 4DV2E 2OI2A 1ZM4A 2DEIA 4XTJA 4JI5E 3T1YE 1J5EI 4WUDA 2V2VA 4ED4A 3WU3A 2Q2EB 4GKKE 2ZM6I 4DUYE 1FJGI 4DPXA 4LF7E 2CZ9A 4DV3I 1XMOE 3B78A 4B3SI 2BM1A 4DR6E 4USKA 4LF8I 1Z5AA 4JYAE 2UUAI 1B63A 2VQEE 4DV7I 1EA6A 3H4LA 4NXMI 1I94E 4DV2I 4JV5E 4JI5I 3B8HA 4DPWA 3JAMQ 3T1YI 2V2QA 1Z0EA 4GKKI 4LFBE 3V5RA 2HFUA 4DUYI 2V8PA 1IBLE 1NHHA 3ZZUA 4LF7I 5LL6R 3M6AA 3QT8A 4DV6E 5L3JA 4DR4E 1XMOI 1MU5A 4DU7A 4JI3E 3PYEA 4JYAI 4JI0E 2VQEI 4FW9A 1I94I 4DR5E 4DUZE 4B3TE 4HYMA
chains in the Genus database with same CATH superfamily
2J7KA 1K47A 2C38A 1RREA 4WUCA 4LFBI 4X62E 1N36E 1MG7A 2GS8A 1IBLI 4IFDE 4DV1E 3QT7A 4OO1D 2GO3A 4IZKA 4OO1E 4MYUA 1DARA 4X65E 3CWVA 4DV6I 4LF4E 4DR4I 2UXDE 4DR1E 2CVEA 2R42A 2V2ZA 4JI3I 4NXNE 4LFCE 3K1JA 2ZBKB 1Z5CA 3PYDA 4JI0I 2UUBE 5JEAB 2WW4A 4X64E 4DUZI 4B3TI 4OKGA 4URLA 3P3EA 5K36B 2UXBE 2VESA 2BM0A 1ZM2A 2WNRB 1Z0CA 5A2QC 5C0XF 4X62I 1N36I 2BV3A 5GMEA 4LF5E 2A2CA 4FW4A 4DXLA 4DV1I 1UDOA 4DR2E 5FLXQ 5JEAA 5BR8E 3M7NG 3UHMA 1YH8A 1RR9A 2PNMA 4X65I 4LF4I 4M1KA 2NN6D 2UXDI 4DR1I 4JI7E 1Y4UA 2PO1B 4NXNI 5K36A 4LFCI 2WNRA 1E3HA 4USMA 2UUBI 1Z59A 3ZM7A 2O1VA 4X64I 4FWHA 2X7IA 4MQYA 2V34A 4HXZA 1NZ0A 4DV0E 2UXBI 3D4JA 1OYRA 2JT2A 5C0XD 3QT6A 4K0KE 1USVA 3QT5A 4LF5I 1Y6ZA 2PO1A 4DR2I 3GMEA 4Z7YA 4AIMA 4IFDB 4JI8E 2BA0G 2WP8B 5BR8I 4OO1B 1FNMA 3PS1A 3OTOE 1EI1A 3P76A 4JI7I 1N32E 1YHCA 4IZJD 2DEJA 3JAMC 1PIEA 2NN6C 3F0NA 5IT9Q 1UEKA 2UU9E 3HULA 4N3OA 1N34E 1WUUA 2IOPA 5DNXA 3M85D 4J3DA 4IFDA 4DV0I 1OYSA 2WP8A 3P06A 5DRRA 4OO1A 1Z0BA 4K0KI 5C0XC 1U2RA 4LFAE 1XXEA 2E5LE 1Y5YA 4JI8I 2PNZB 3U1KA 4JI4E 2VQFE 1XHKA 1PKPA 2UUCE 1Y4SA 1NHIA 3OTOI 2HKJA 3M7ND 1RHYA 1N32I 4MU3A 4EMDA 3J7AM 4DPYA 4FWDA 5EKWA 2UU9I 4LF6E 4B3RE 4OX9I 1FWKA 1UDQA 4FW5A 4AM3A 2GO4A 1N34I 4LCHA 1KVKA 3PYGA 3CDJA 4DV5E 2NN6F 2O1TA 5ELWA 2XEXA 2PNZA 1N0VC 4DPTA 3ZKBA 1P42A 4UT4A 3J81Q 4UTGA 4LFAI 2UXCE 2X36A 5EL9A 2E5LI 3L7ZB 1A6FA 2NPFA 4BA2B 4JV5I 1HNWE 4JI4I 2VQFI 3ZZTA 2UUCI 3J81C 1IBKE 1B62A 1D6TA 4AQYE 2JE6B 3B82A 2JEAB 1USUA 1S16A 4GKJE 4RPFA 4LF6I 4B3RI 2AJ4A 4IZJB 3B4TA 2PO2B 1XNRE 1OYPA 1Z0GA 3DD6A 3PYFA 3H1CA 3WU6A 3WU5A 3L7ZA 2NN6E 4DV5I 5FLXC 1KTVA 1IBME 3GONA 1QZRA 1NHJA 5FWKA 4YY3E 1HNZE 4KHPE 1VISA 2CGEA 1ZXNA 2UXCI 5GMDA 1Y60A 2JE6A 4DU8A 2JEAA 3T1HE 2A2DA 4JI2E 1HNWI 2BA1G 4IZJA 1UDNA 1HNXE 4YHHE 1IBKI 3K17A 5C0XE 4JI6E 1FKAE 1PVGA 1H74A 4AQYI 1N33E 4FWGA 4KQVA 4GKJI 1R6MA 2EFGA 2HK2A 2Z5BB 1XNRI 4DV4E 4DPUA 1KKHA 5LMNE 5JEAD 2E1RA 4ISAA 1KIJA 4FW7A 3LTOA 5IWAE 3P3CA 4FN5A 1IBMI 2CG9A 1Z5BA 1S4EA 2ZITA 4JG4A 2JEBB 4YY3I 1HNZI 4OX9E 4MDTA 1ZM3A 3NZKA 3J7AG 4KHPI 1H73A 4WUBA 4LF9E 4PRXA 4U3DA 1OJ4A 3PS2A 5IT9C 1XNQE 3T1HI 1Z0TA 4JI2I 4JI1E 3ZZ0A 2Z5BA 3LNUA 1BKNA 1HNXI 4YHHI 3J80Q 5LMUE 4JI6I 3PS3A 2VF3A 5DROA 4BA1B 1ZXMA 3HJCA 1N33I 1Z0WA 3J80C 4P7AA 1H72C 4DV4I 2IOQA 5LMNI 3Q6NA 1FI4A 4DR6I 2HKEA 5IWAI 2O1WA 3U1YA 4DR3E 4FW3A 5JEAC 3CDIA 4DR7E 2NN6B 4MYTA 4B3ME 3PRYA 1FWLA 4PU9A 3Q1QA 2F4VE 5DNLA 4AIDA 4LCFA 1Z0VA 4LF9I 4BA1A 2HHHE 5K36C 1XNQI 1HR0E 4JI1I 2HFSA 2Z5CB 2HK3A 4I3HA 2BA1D 4HY1A 5DRPA 4X66E 5LMUI 4IFDD 1XMQE 4IS9A 2PO0B 5C0XB 4HACB 1J5EE 1R6LA 4MU4A 1ZM9A 2NN6A 3V2UC 1H7SA 3LPSA 4P52A 2GQ0A 2BA0D 4ZVIA 2ZM6E 1FJGE 3WU4A 4Z7CA 1UDSA 2J65A 4DR3I 2C39B 4DR7I 1H7UA 4B3MI 2Z5CA 1MX0A 4DV3E 5A2QQ 3M85G 3K85A 4DR5I 1N0UA 2F4VI 2PO0A 3HKMA 5C0XA 4HACA 4B3SE 2HHHI 4R1FA 4LF8E 5JEAF 2UUAE 1HR0I 2LJPA 4DV7E 4BA2A 4PRVA 1VI7A 4NXME 2R3VA 4X66I 1ELOA 4LOMA 1XMQI 3ZKDA 4DV2E 2OI2A 1ZM4A 2DEIA 4XTJA 4JI5E 4IFDC 5K36F 2IESA 4QNJA 4WUDA 4LCGA 3T1YE 1J5EI 2C39A 5DRQA 4OO1C 2V2VA 4ED4A 3WU3A 2Q2EB 2PO2A 2AE8A 4GKKE 2ZM6I 4DUYE 1FJGI 3GCMA 4DPXA 4LF7E 2C37B 4FW6A 2CZ9A 4DV3I 4U3BA 4QNKA 1XMOE 3B78A 4B3SI 4NBQA 2BM1A 4DR6E 4USKA 5JEAE 4LF8I 1Z5AA 4JYAE 2UUAI 1B63A 2VQEE 4DV7I 2BR2B 1EA6A 4OZEA 3H4LA 4NXMI 3GLLA 1I94E 5K36D 4DV2I 4LPFA 4JV5E 4JI5I 3B8HA 2IERA 4DPWA 5K36E 3JAMQ 3KRNA 3T1YI 2C37A 2V2QA 1Z0EA 4GKKI 4MU1A 2F1DA 4LFBE 3V5RA 2HFUA 4DUYI 2V8PA 1IBLE 4IFDF 1HK7A 1NHHA 3ZZUA 4LF7I 2BR2A 5LL6R 4OO1F 3M6AA 2C38B 2O1UA 3QT8A 2JEBA 4DV6E 1E3PA 5L3JA 4DR4E 2O3ZA 1XMOI 1MU5A 4DU7A 4JI3E 3PYEA 4GQUA 3P3GA 4JYAI 4IZKB 4JI0E 2VQEI 3Q6MA 4FW9A 2PNLA 1I94I 4DR5E 4DUZE 4B3TE 4HYMA 2Z5EA 4MU0A
chains in the Genus database with same CATH topology
2J7KA 1K47A 1RREA 4WUCA 4LFBI 4X62E 1N36E 1MG7A 2GS8A 1IBLI 4DV1E 3QT7A 4IZKA 4MYUA 1DARA 4X65E 3CWVA 4DV6I 4LF4E 4DR4I 2UXDE 4DR1E 2R42A 2V2ZA 4JI3I 4NXNE 4LFCE 3K1JA 2ZBKB 1Z5CA 3PYDA 4JI0I 2UUBE 2WW4A 4X64E 4DUZI 4B3TI 4URLA 2UXBE 2BM0A 1ZM2A 1Z0CA 5A2QC 4X62I 1N36I 2BV3A 5GMEA 4LF5E 2A2CA 4DXLA 4DV1I 4DR2E 5FLXQ 5BR8E 1RR9A 2PNMA 4X65I 4LF4I 4M1KA 2UXDI 4DR1I 4JI7E 1Y4UA 4NXNI 4LFCI 4USMA 2UUBI 1Z59A 3ZM7A 2O1VA 4X64I 4FWHA 2X7IA 2V34A 4HXZA 1NZ0A 4DV0E 2UXBI 3D4JA 3QT6A 4K0KE 1USVA 3QT5A 4LF5I 1Y6ZA 4DR2I 4Z7YA 4JI8E 5BR8I 1FNMA 3OTOE 1EI1A 4JI7I 1N32E 3JAMC 4IZJD 2DEJA 1PIEA 3F0NA 5IT9Q 1UEKA 2UU9E 3HULA 4N3OA 1N34E 1WUUA 2IOPA 4DV0I 3P06A 1Z0BA 4K0KI 1U2RA 4LFAE 2E5LE 4JI8I 4JI4E 2VQFE 1XHKA 1PKPA 2UUCE 1Y4SA 1NHIA 3OTOI 2HKJA 1N32I 4EMDA 3J7AM 4DPYA 4FWDA 2UU9I 4LF6E 4B3RE 4OX9I 1FWKA 1N34I 1KVKA 3PYGA 4DV5E 2O1TA 2XEXA 1N0VC 4DPTA 3ZKBA 4UT4A 3J81Q 4UTGA 4LFAI 2UXCE 2X36A 2E5LI 1A6FA 2NPFA 4JV5I 1HNWE 4JI4I 2VQFI 3ZZTA 2UUCI 3J81C 1IBKE 1B62A 1D6TA 4AQYE 3B82A 1USUA 1S16A 4GKJE 4RPFA 4LF6I 4B3RI 2AJ4A 4IZJB 1XNRE 1Z0GA 3PYFA 3WU6A 3WU5A 4DV5I 5FLXC 1KTVA 1IBME 3GONA 1QZRA 1NHJA 5FWKA 4YY3E 1HNZE 4KHPE 1VISA 2CGEA 1ZXNA 2UXCI 5GMDA 4DU8A 3T1HE 2A2DA 4JI2E 1HNWI 4IZJA 1HNXE 4YHHE 1IBKI 3K17A 4JI6E 1FKAE 1PVGA 1H74A 4AQYI 1N33E 4FWGA 4KQVA 4GKJI 2EFGA 2HK2A 2Z5BB 1XNRI 4DV4E 4DPUA 1KKHA 5LMNE 2E1RA 1KIJA 3LTOA 5IWAE 4FN5A 1IBMI 2CG9A 1Z5BA 1S4EA 2ZITA 4JG4A 4OX9E 4YY3I 1HNZI 1ZM3A 3J7AG 4KHPI 1H73A 4WUBA 4LF9E 4PRXA 1OJ4A 5IT9C 1XNQE 3T1HI 1Z0TA 4JI2I 4JI1E 3ZZ0A 2Z5BA 3LNUA 1BKNA 1HNXI 4YHHI 3J80Q 5LMUE 4JI6I 2VF3A 1ZXMA 3HJCA 1N33I 1Z0WA 3J80C 4P7AA 1H72C 4DV4I 2IOQA 5LMNI 3Q6NA 1FI4A 4DR6I 2HKEA 5IWAI 2O1WA 4DR3E 4DR7E 4MYTA 4B3ME 3PRYA 1FWLA 4PU9A 3Q1QA 2F4VE 1Z0VA 4LF9I 2HHHE 1XNQI 1HR0E 4JI1I 2HFSA 2Z5CB 2HK3A 4I3HA 4HY1A 4X66E 5LMUI 1XMQE 4HACB 1J5EE 1ZM9A 3V2UC 1H7SA 3LPSA 4P52A 2GQ0A 4ZVIA 2ZM6E 1FJGE 3WU4A 4Z7CA 4DR3I 4DR7I 1H7UA 4B3MI 2Z5CA 1MX0A 4DV3E 5A2QQ 3K85A 4DR5I 1N0UA 2F4VI 4HACA 4B3SE 2HHHI 4R1FA 4LF8E 2UUAE 1HR0I 2LJPA 4DV7E 4PRVA 4NXME 2R3VA 4X66I 1ELOA 1XMQI 3ZKDA 4DV2E 2OI2A 1ZM4A 2DEIA 4XTJA 4JI5E 3T1YE 1J5EI 4WUDA 2V2VA 4ED4A 3WU3A 2Q2EB 4GKKE 2ZM6I 4DUYE 1FJGI 4DPXA 4LF7E 2CZ9A 4DV3I 1XMOE 3B78A 4B3SI 2BM1A 4DR6E 4USKA 4LF8I 1Z5AA 4JYAE 2UUAI 1B63A 2VQEE 4DV7I 1EA6A 3H4LA 4NXMI 1I94E 4DV2I 4JV5E 4JI5I 3B8HA 4DPWA 3JAMQ 3T1YI 2V2QA 1Z0EA 4GKKI 4LFBE 3V5RA 2HFUA 4DUYI 2V8PA 1IBLE 1HK7A 1NHHA 3ZZUA 4LF7I 5LL6R 3M6AA 2O1UA 3QT8A 4DV6E 5L3JA 4DR4E 1XMOI 1MU5A 4DU7A 4JI3E 3PYEA 4JYAI 4IZKB 4JI0E 2VQEI 3Q6MA 4FW9A 2PNLA 1I94I 4DR5E 4DUZE 4B3TE 4HYMA 2Z5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7K A;  1K47 A;  1RRE A;  4WUC A;  4LFB I;  4X62 E;  1N36 E;  1MG7 A;  2GS8 A;  1IBL I;  4DV1 E;  3QT7 A;  4MYU A;  1DAR A;  4X65 E;  3CWV A;  4DV6 I;  4LF4 E;  4DR4 I;  2UXD E;  4DR1 E;  2R42 A;  2V2Z A;  4JI3 I;  4NXN E;  4LFC E;  3K1J A;  2ZBK B;  1Z5C A;  3PYD A;  4JI0 I;  2UUB E;  2WW4 A;  4X64 E;  4DUZ I;  4B3T I;  4URL A;  2UXB E;  2BM0 A;  1ZM2 A;  1Z0C A;  5A2Q C;  4X62 I;  1N36 I;  2BV3 A;  5GME A;  4LF5 E;  2A2C A;  4DXL A;  4DV1 I;  4DR2 E;  5FLX Q;  5BR8 E;  1RR9 A;  4X65 I;  4LF4 I;  4M1K A;  2UXD I;  4DR1 I;  4JI7 E;  4NXN I;  4LFC I;  4USM A;  2UUB I;  1Z59 A;  3ZM7 A;  4X64 I;  4FWH A;  2X7I A;  2V34 A;  4HXZ A;  1NZ0 A;  4DV0 E;  2UXB I;  3D4J A;  3QT6 A;  4K0K E;  3QT5 A;  4LF5 I;  4DR2 I;  4Z7Y A;  4JI8 E;  5BR8 I;  1FNM A;  3OTO E;  1EI1 A;  4JI7 I;  1N32 E;  3JAM C;  2DEJ A;  1PIE A;  3F0N A;  5IT9 Q;  1UEK A;  2UU9 E;  3HUL A;  1N34 E;  1WUU A;  4DV0 I;  1Z0B A;  4K0K I;  1U2R A;  4LFA E;  2E5L E;  4JI8 I;  4JI4 E;  2VQF E;  1XHK A;  1PKP A;  2UUC E;  3OTO I;  1NHI A;  2HKJ A;  1N32 I;  4EMD A;  3J7A M;  4DPY A;  4FWD A;  2UU9 I;  4LF6 E;  4B3R E;  4OX9 I;  1FWK A;  1N34 I;  1KVK A;  3PYG A;  4DV5 E;  2XEX A;  1N0V C;  4DPT A;  3ZKB A;  4UT4 A;  3J81 Q;  4UTG A;  4LFA I;  2UXC E;  2X36 A;  2E5L I;  1A6F A;  2NPF A;  4JV5 I;  1HNW E;  4JI4 I;  2VQF I;  3ZZT A;  2UUC I;  3J81 C;  1IBK E;  1B62 A;  1D6T A;  4AQY E;  3B82 A;  1S16 A;  4GKJ E;  4RPF A;  4LF6 I;  4B3R I;  2AJ4 A;  1XNR E;  1Z0G A;  3PYF A;  3WU6 A;  3WU5 A;  4DV5 I;  5FLX C;  1KTV A;  1IBM E;  3GON A;  1QZR A;  1NHJ A;  4YY3 E;  1HNZ E;  4KHP E;  1VIS A;  1ZXN A;  2UXC I;  5GMD A;  4DU8 A;  3T1H E;  2A2D A;  4JI2 E;  1HNW I;  1HNX E;  4YHH E;  1IBK I;  3K17 A;  4JI6 E;  1FKA E;  1PVG A;  1H74 A;  4AQY I;  1N33 E;  4FWG A;  4KQV A;  4GKJ I;  2EFG A;  2HK2 A;  1XNR I;  4DV4 E;  4DPU A;  1KKH A;  5LMN E;  2E1R A;  1KIJ A;  3LTO A;  5IWA E;  4FN5 A;  1IBM I;  1Z5B A;  1S4E A;  2ZIT A;  4JG4 A;  4OX9 E;  4YY3 I;  1HNZ I;  1ZM3 A;  3J7A G;  4KHP I;  1H73 A;  4WUB A;  4LF9 E;  4PRX A;  1OJ4 A;  5IT9 C;  1XNQ E;  3T1H I;  1Z0T A;  4JI2 I;  4JI1 E;  3ZZ0 A;  3LNU A;  1BKN A;  1HNX I;  4YHH I;  3J80 Q;  5LMU E;  4JI6 I;  2VF3 A;  1ZXM A;  1N33 I;  1Z0W A;  3J80 C;  4P7A A;  1H72 C;  4DV4 I;  5LMN I;  1FI4 A;  4DR6 I;  2HKE A;  5IWA I;  4DR3 E;  4DR7 E;  4MYT A;  4B3M E;  1FWL A;  4PU9 A;  3Q1Q A;  2F4V E;  1Z0V A;  4LF9 I;  2HHH E;  1XNQ I;  1HR0 E;  4JI1 I;  2HFS A;  2HK3 A;  4I3H A;  4HY1 A;  4X66 E;  5LMU I;  1XMQ E;  4HAC B;  1J5E E;  1ZM9 A;  3V2U C;  1H7S A;  3LPS A;  4P52 A;  4ZVI A;  2ZM6 E;  1FJG E;  3WU4 A;  4Z7C A;  4DR3 I;  4DR7 I;  1H7U A;  4B3M I;  1MX0 A;  4DV3 E;  5A2Q Q;  4DR5 I;  1N0U A;  2F4V I;  4HAC A;  4B3S E;  2HHH I;  4R1F A;  4LF8 E;  2UUA E;  1HR0 I;  2LJP A;  4DV7 E;  4PRV A;  4NXM E;  2R3V A;  4X66 I;  1ELO A;  1XMQ I;  3ZKD A;  4DV2 E;  2OI2 A;  1ZM4 A;  2DEI A;  4XTJ A;  4JI5 E;  3T1Y E;  1J5E I;  4WUD A;  2V2V A;  4ED4 A;  3WU3 A;  2Q2E B;  4GKK E;  2ZM6 I;  4DUY E;  1FJG I;  4DPX A;  4LF7 E;  2CZ9 A;  4DV3 I;  1XMO E;  3B78 A;  4B3S I;  2BM1 A;  4DR6 E;  4USK A;  4LF8 I;  1Z5A A;  4JYA E;  2UUA I;  1B63 A;  2VQE E;  4DV7 I;  1EA6 A;  3H4L A;  4NXM I;  1I94 E;  4DV2 I;  4JV5 E;  4JI5 I;  3B8H A;  4DPW A;  3JAM Q;  3T1Y I;  2V2Q A;  1Z0E A;  4GKK I;  4LFB E;  3V5R A;  2HFU A;  4DUY I;  2V8P A;  1IBL E;  1NHH A;  3ZZU A;  4LF7 I;  5LL6 R;  3M6A A;  3QT8 A;  4DV6 E;  5L3J A;  4DR4 E;  1XMO I;  1MU5 A;  4DU7 A;  4JI3 E;  3PYE A;  4JYA I;  4JI0 E;  2VQE I;  4FW9 A;  1I94 I;  4DR5 E;  4DUZ E;  4B3T E;  4HYM A; 
#chains in the Genus database with same CATH topology
 2J7K A;  1K47 A;  2C38 A;  1RRE A;  4WUC A;  4LFB I;  4X62 E;  1N36 E;  1MG7 A;  2GS8 A;  1IBL I;  4IFD E;  4DV1 E;  3QT7 A;  4OO1 D;  2GO3 A;  4IZK A;  4OO1 E;  4MYU A;  1DAR A;  4X65 E;  3CWV A;  4DV6 I;  4LF4 E;  4DR4 I;  2UXD E;  4DR1 E;  2CVE A;  2R42 A;  2V2Z A;  4JI3 I;  4NXN E;  4LFC E;  3K1J A;  2ZBK B;  1Z5C A;  3PYD A;  4JI0 I;  2UUB E;  5JEA B;  2WW4 A;  4X64 E;  4DUZ I;  4B3T I;  4OKG A;  4URL A;  3P3E A;  5K36 B;  2UXB E;  2VES A;  2BM0 A;  1ZM2 A;  2WNR B;  1Z0C A;  5A2Q C;  5C0X F;  4X62 I;  1N36 I;  2BV3 A;  5GME A;  4LF5 E;  2A2C A;  4FW4 A;  4DXL A;  4DV1 I;  1UDO A;  4DR2 E;  5FLX Q;  5JEA A;  5BR8 E;  3M7N G;  3UHM A;  1YH8 A;  1RR9 A;  2PNM A;  4X65 I;  4LF4 I;  4M1K A;  2NN6 D;  2UXD I;  4DR1 I;  4JI7 E;  1Y4U A;  2PO1 B;  4NXN I;  5K36 A;  4LFC I;  2WNR A;  1E3H A;  4USM A;  2UUB I;  1Z59 A;  3ZM7 A;  2O1V A;  4X64 I;  4FWH A;  2X7I A;  4MQY A;  2V34 A;  4HXZ A;  1NZ0 A;  4DV0 E;  2UXB I;  3D4J A;  1OYR A;  2JT2 A;  5C0X D;  3QT6 A;  4K0K E;  1USV A;  3QT5 A;  4LF5 I;  1Y6Z A;  2PO1 A;  4DR2 I;  3GME A;  4Z7Y A;  4AIM A;  4IFD B;  4JI8 E;  2BA0 G;  2WP8 B;  5BR8 I;  4OO1 B;  1FNM A;  3PS1 A;  3OTO E;  1EI1 A;  3P76 A;  4JI7 I;  1N32 E;  1YHC A;  4IZJ D;  2DEJ A;  3JAM C;  1PIE A;  2NN6 C;  3F0N A;  5IT9 Q;  1UEK A;  2UU9 E;  3HUL A;  4N3O A;  1N34 E;  1WUU A;  2IOP A;  5DNX A;  3M85 D;  4J3D A;  4IFD A;  4DV0 I;  1OYS A;  2WP8 A;  3P06 A;  5DRR A;  4OO1 A;  1Z0B A;  4K0K I;  5C0X C;  1U2R A;  4LFA E;  1XXE A;  2E5L E;  1Y5Y A;  4JI8 I;  2PNZ B;  3U1K A;  4JI4 E;  2VQF E;  1XHK A;  1PKP A;  2UUC E;  1Y4S A;  1NHI A;  3OTO I;  2HKJ A;  3M7N D;  1RHY A;  1N32 I;  4MU3 A;  4EMD A;  3J7A M;  4DPY A;  4FWD A;  5EKW A;  2UU9 I;  4LF6 E;  4B3R E;  4OX9 I;  1FWK A;  1UDQ A;  4FW5 A;  4AM3 A;  2GO4 A;  1N34 I;  4LCH A;  1KVK A;  3PYG A;  3CDJ A;  4DV5 E;  2NN6 F;  2O1T A;  5ELW A;  2XEX A;  2PNZ A;  1N0V C;  4DPT A;  3ZKB A;  1P42 A;  4UT4 A;  3J81 Q;  4UTG A;  4LFA I;  2UXC E;  2X36 A;  5EL9 A;  2E5L I;  3L7Z B;  1A6F A;  2NPF A;  4BA2 B;  4JV5 I;  1HNW E;  4JI4 I;  2VQF I;  3ZZT A;  2UUC I;  3J81 C;  1IBK E;  1B62 A;  1D6T A;  4AQY E;  2JE6 B;  3B82 A;  2JEA B;  1USU A;  1S16 A;  4GKJ E;  4RPF A;  4LF6 I;  4B3R I;  2AJ4 A;  4IZJ B;  3B4T A;  2PO2 B;  1XNR E;  1OYP A;  1Z0G A;  3DD6 A;  3PYF A;  3H1C A;  3WU6 A;  3WU5 A;  3L7Z A;  2NN6 E;  4DV5 I;  5FLX C;  1KTV A;  1IBM E;  3GON A;  1QZR A;  1NHJ A;  5FWK A;  4YY3 E;  1HNZ E;  4KHP E;  1VIS A;  2CGE A;  1ZXN A;  2UXC I;  5GMD A;  1Y60 A;  2JE6 A;  4DU8 A;  2JEA A;  3T1H E;  2A2D A;  4JI2 E;  1HNW I;  2BA1 G;  4IZJ A;  1UDN A;  1HNX E;  4YHH E;  1IBK I;  3K17 A;  5C0X E;  4JI6 E;  1FKA E;  1PVG A;  1H74 A;  4AQY I;  1N33 E;  4FWG A;  4KQV A;  4GKJ I;  1R6M A;  2EFG A;  2HK2 A;  2Z5B B;  1XNR I;  4DV4 E;  4DPU A;  1KKH A;  5LMN E;  5JEA D;  2E1R A;  4ISA A;  1KIJ A;  4FW7 A;  3LTO A;  5IWA E;  3P3C A;  4FN5 A;  1IBM I;  2CG9 A;  1Z5B A;  1S4E A;  2ZIT A;  4JG4 A;  2JEB B;  4YY3 I;  1HNZ I;  4OX9 E;  4MDT A;  1ZM3 A;  3NZK A;  3J7A G;  4KHP I;  1H73 A;  4WUB A;  4LF9 E;  4PRX A;  4U3D A;  1OJ4 A;  3PS2 A;  5IT9 C;  1XNQ E;  3T1H I;  1Z0T A;  4JI2 I;  4JI1 E;  3ZZ0 A;  2Z5B A;  3LNU A;  1BKN A;  1HNX I;  4YHH I;  3J80 Q;  5LMU E;  4JI6 I;  3PS3 A;  2VF3 A;  5DRO A;  4BA1 B;  1ZXM A;  3HJC A;  1N33 I;  1Z0W A;  3J80 C;  4P7A A;  1H72 C;  4DV4 I;  2IOQ A;  5LMN I;  3Q6N A;  1FI4 A;  4DR6 I;  2HKE A;  5IWA I;  2O1W A;  3U1Y A;  4DR3 E;  4FW3 A;  5JEA C;  3CDI A;  4DR7 E;  2NN6 B;  4MYT A;  4B3M E;  3PRY A;  1FWL A;  4PU9 A;  3Q1Q A;  2F4V E;  5DNL A;  4AID A;  4LCF A;  1Z0V A;  4LF9 I;  4BA1 A;  2HHH E;  5K36 C;  1XNQ I;  1HR0 E;  4JI1 I;  2HFS A;  2Z5C B;  2HK3 A;  4I3H A;  2BA1 D;  4HY1 A;  5DRP A;  4X66 E;  5LMU I;  4IFD D;  1XMQ E;  4IS9 A;  2PO0 B;  5C0X B;  4HAC B;  1J5E E;  1R6L A;  4MU4 A;  1ZM9 A;  2NN6 A;  3V2U C;  1H7S A;  3LPS A;  4P52 A;  2GQ0 A;  2BA0 D;  4ZVI A;  2ZM6 E;  1FJG E;  3WU4 A;  4Z7C A;  1UDS A;  2J65 A;  4DR3 I;  2C39 B;  4DR7 I;  1H7U A;  4B3M I;  2Z5C A;  1MX0 A;  4DV3 E;  5A2Q Q;  3M85 G;  3K85 A;  4DR5 I;  1N0U A;  2F4V I;  2PO0 A;  3HKM A;  5C0X A;  4HAC A;  4B3S E;  2HHH I;  4R1F A;  4LF8 E;  5JEA F;  2UUA E;  1HR0 I;  2LJP A;  4DV7 E;  4BA2 A;  4PRV A;  1VI7 A;  4NXM E;  2R3V A;  4X66 I;  1ELO A;  4LOM A;  1XMQ I;  3ZKD A;  4DV2 E;  2OI2 A;  1ZM4 A;  2DEI A;  4XTJ A;  4JI5 E;  4IFD C;  5K36 F;  2IES A;  4QNJ A;  4WUD A;  4LCG A;  3T1Y E;  1J5E I;  2C39 A;  5DRQ A;  4OO1 C;  2V2V A;  4ED4 A;  3WU3 A;  2Q2E B;  2PO2 A;  2AE8 A;  4GKK E;  2ZM6 I;  4DUY E;  1FJG I;  3GCM A;  4DPX A;  4LF7 E;  2C37 B;  4FW6 A;  2CZ9 A;  4DV3 I;  4U3B A;  4QNK A;  1XMO E;  3B78 A;  4B3S I;  4NBQ A;  2BM1 A;  4DR6 E;  4USK A;  5JEA E;  4LF8 I;  1Z5A A;  4JYA E;  2UUA I;  1B63 A;  2VQE E;  4DV7 I;  2BR2 B;  1EA6 A;  4OZE A;  3H4L A;  4NXM I;  3GLL A;  1I94 E;  5K36 D;  4DV2 I;  4LPF A;  4JV5 E;  4JI5 I;  3B8H A;  2IER A;  4DPW A;  5K36 E;  3JAM Q;  3KRN A;  3T1Y I;  2C37 A;  2V2Q A;  1Z0E A;  4GKK I;  4MU1 A;  2F1D A;  4LFB E;  3V5R A;  2HFU A;  4DUY I;  2V8P A;  1IBL E;  4IFD F;  1HK7 A;  1NHH A;  3ZZU A;  4LF7 I;  2BR2 A;  5LL6 R;  4OO1 F;  3M6A A;  2C38 B;  2O1U A;  3QT8 A;  2JEB A;  4DV6 E;  1E3P A;  5L3J A;  4DR4 E;  2O3Z A;  1XMO I;  1MU5 A;  4DU7 A;  4JI3 E;  3PYE A;  4GQU A;  3P3G A;  4JYA I;  4IZK B;  4JI0 E;  2VQE I;  3Q6M A;  4FW9 A;  2PNL A;  1I94 I;  4DR5 E;  4DUZ E;  4B3T E;  4HYM A;  2Z5E A;  4MU0 A; 
#chains in the Genus database with same CATH homology
 2J7K A;  1K47 A;  1RRE A;  4WUC A;  4LFB I;  4X62 E;  1N36 E;  1MG7 A;  2GS8 A;  1IBL I;  4DV1 E;  3QT7 A;  4IZK A;  4MYU A;  1DAR A;  4X65 E;  3CWV A;  4DV6 I;  4LF4 E;  4DR4 I;  2UXD E;  4DR1 E;  2R42 A;  2V2Z A;  4JI3 I;  4NXN E;  4LFC E;  3K1J A;  2ZBK B;  1Z5C A;  3PYD A;  4JI0 I;  2UUB E;  2WW4 A;  4X64 E;  4DUZ I;  4B3T I;  4URL A;  2UXB E;  2BM0 A;  1ZM2 A;  1Z0C A;  5A2Q C;  4X62 I;  1N36 I;  2BV3 A;  5GME A;  4LF5 E;  2A2C A;  4DXL A;  4DV1 I;  4DR2 E;  5FLX Q;  5BR8 E;  1RR9 A;  2PNM A;  4X65 I;  4LF4 I;  4M1K A;  2UXD I;  4DR1 I;  4JI7 E;  1Y4U A;  4NXN I;  4LFC I;  4USM A;  2UUB I;  1Z59 A;  3ZM7 A;  2O1V A;  4X64 I;  4FWH A;  2X7I A;  2V34 A;  4HXZ A;  1NZ0 A;  4DV0 E;  2UXB I;  3D4J A;  3QT6 A;  4K0K E;  1USV A;  3QT5 A;  4LF5 I;  1Y6Z A;  4DR2 I;  4Z7Y A;  4JI8 E;  5BR8 I;  1FNM A;  3OTO E;  1EI1 A;  4JI7 I;  1N32 E;  3JAM C;  4IZJ D;  2DEJ A;  1PIE A;  3F0N A;  5IT9 Q;  1UEK A;  2UU9 E;  3HUL A;  4N3O A;  1N34 E;  1WUU A;  2IOP A;  4DV0 I;  3P06 A;  1Z0B A;  4K0K I;  1U2R A;  4LFA E;  2E5L E;  4JI8 I;  4JI4 E;  2VQF E;  1XHK A;  1PKP A;  2UUC E;  1Y4S A;  1NHI A;  3OTO I;  2HKJ A;  1N32 I;  4EMD A;  3J7A M;  4DPY A;  4FWD A;  2UU9 I;  4LF6 E;  4B3R E;  4OX9 I;  1FWK A;  1N34 I;  1KVK A;  3PYG A;  4DV5 E;  2O1T A;  2XEX A;  1N0V C;  4DPT A;  3ZKB A;  4UT4 A;  3J81 Q;  4UTG A;  4LFA I;  2UXC E;  2X36 A;  2E5L I;  1A6F A;  2NPF A;  4JV5 I;  1HNW E;  4JI4 I;  2VQF I;  3ZZT A;  2UUC I;  3J81 C;  1IBK E;  1B62 A;  1D6T A;  4AQY E;  3B82 A;  1USU A;  1S16 A;  4GKJ E;  4RPF A;  4LF6 I;  4B3R I;  2AJ4 A;  4IZJ B;  1XNR E;  1Z0G A;  3PYF A;  3WU6 A;  3WU5 A;  4DV5 I;  5FLX C;  1KTV A;  1IBM E;  3GON A;  1QZR A;  1NHJ A;  5FWK A;  4YY3 E;  1HNZ E;  4KHP E;  1VIS A;  2CGE A;  1ZXN A;  2UXC I;  5GMD A;  4DU8 A;  3T1H E;  2A2D A;  4JI2 E;  1HNW I;  4IZJ A;  1HNX E;  4YHH E;  1IBK I;  3K17 A;  4JI6 E;  1FKA E;  1PVG A;  1H74 A;  4AQY I;  1N33 E;  4FWG A;  4KQV A;  4GKJ I;  2EFG A;  2HK2 A;  2Z5B B;  1XNR I;  4DV4 E;  4DPU A;  1KKH A;  5LMN E;  2E1R A;  1KIJ A;  3LTO A;  5IWA E;  4FN5 A;  1IBM I;  2CG9 A;  1Z5B A;  1S4E A;  2ZIT A;  4JG4 A;  4OX9 E;  4YY3 I;  1HNZ I;  1ZM3 A;  3J7A G;  4KHP I;  1H73 A;  4WUB A;  4LF9 E;  4PRX A;  1OJ4 A;  5IT9 C;  1XNQ E;  3T1H I;  1Z0T A;  4JI2 I;  4JI1 E;  3ZZ0 A;  2Z5B A;  3LNU A;  1BKN A;  1HNX I;  4YHH I;  3J80 Q;  5LMU E;  4JI6 I;  2VF3 A;  1ZXM A;  3HJC A;  1N33 I;  1Z0W A;  3J80 C;  4P7A A;  1H72 C;  4DV4 I;  2IOQ A;  5LMN I;  3Q6N A;  1FI4 A;  4DR6 I;  2HKE A;  5IWA I;  2O1W A;  4DR3 E;  4DR7 E;  4MYT A;  4B3M E;  3PRY A;  1FWL A;  4PU9 A;  3Q1Q A;  2F4V E;  1Z0V A;  4LF9 I;  2HHH E;  1XNQ I;  1HR0 E;  4JI1 I;  2HFS A;  2Z5C B;  2HK3 A;  4I3H A;  4HY1 A;  4X66 E;  5LMU I;  1XMQ E;  4HAC B;  1J5E E;  1ZM9 A;  3V2U C;  1H7S A;  3LPS A;  4P52 A;  2GQ0 A;  4ZVI A;  2ZM6 E;  1FJG E;  3WU4 A;  4Z7C A;  4DR3 I;  4DR7 I;  1H7U A;  4B3M I;  2Z5C A;  1MX0 A;  4DV3 E;  5A2Q Q;  3K85 A;  4DR5 I;  1N0U A;  2F4V I;  4HAC A;  4B3S E;  2HHH I;  4R1F A;  4LF8 E;  2UUA E;  1HR0 I;  2LJP A;  4DV7 E;  4PRV A;  4NXM E;  2R3V A;  4X66 I;  1ELO A;  1XMQ I;  3ZKD A;  4DV2 E;  2OI2 A;  1ZM4 A;  2DEI A;  4XTJ A;  4JI5 E;  3T1Y E;  1J5E I;  4WUD A;  2V2V A;  4ED4 A;  3WU3 A;  2Q2E B;  4GKK E;  2ZM6 I;  4DUY E;  1FJG I;  4DPX A;  4LF7 E;  2CZ9 A;  4DV3 I;  1XMO E;  3B78 A;  4B3S I;  2BM1 A;  4DR6 E;  4USK A;  4LF8 I;  1Z5A A;  4JYA E;  2UUA I;  1B63 A;  2VQE E;  4DV7 I;  1EA6 A;  3H4L A;  4NXM I;  1I94 E;  4DV2 I;  4JV5 E;  4JI5 I;  3B8H A;  4DPW A;  3JAM Q;  3T1Y I;  2V2Q A;  1Z0E A;  4GKK I;  4LFB E;  3V5R A;  2HFU A;  4DUY I;  2V8P A;  1IBL E;  1HK7 A;  1NHH A;  3ZZU A;  4LF7 I;  5LL6 R;  3M6A A;  2O1U A;  3QT8 A;  4DV6 E;  5L3J A;  4DR4 E;  1XMO I;  1MU5 A;  4DU7 A;  4JI3 E;  3PYE A;  4JYA I;  4IZK B;  4JI0 E;  2VQE I;  3Q6M A;  4FW9 A;  2PNL A;  1I94 I;  4DR5 E;  4DUZ E;  4B3T E;  4HYM A;  2Z5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...