4DV4E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4E02
4JI8E 1D6TA 1KKHA 2LRSA 4K0KI 1X49A 2LUPB 3J81C 2UUAI 1Z0GA 3QT8A 2R3VA 4LF4E 1FWLA 4DV2I 1DARA 3LTOA 3ZZ0A 3H4LA 5IWAE 4DV5I 2UXDI 2RS6A 3ZZTA 2E5LI 1QZRA 4LFBI 3PYFA 2E5LE 3QT6A 2NUEA 4JI6I 4WUDA 4DV4I 4JI0E 1XNRE 3K17A 2WW4A 4B3ME 4DV0I 4JV5I 2VQFI 1UHZA 1N32I 3P1XA 4JI7E 3V5RA 3ADLA 4Z7CA 1BKNA 3WU4A 4DUZE 1K47A 2HK3A 1T4NA 1O0WA 4UT4A 1N36E 2B3TB 2A2CA 3K1JA 1N33E 2UXCE 4JI1E 4YY3E 2L2KB 2IHR1 1OJ4A 2KHXA 2L33A 1XNQE 3T1YI 2HKJA 4HXZA 1Z5AA 4B3SE 2V2ZA 4DV3I 5LMUI 4DV3E 2UXBI 4DR1I 1KIJA 1ZXNA 4DR1E 5A2QQ 2UU9I 4LFAI 2L2MA 4X62E 1FNMA 2Q2EB 1FWKA 4HACA 3WU3A 4R1FA 1Z0EA 4DR2E 3CWVA 4DV7E 4DR3E 1PVGA 1QU6A 2DB2A 4DU7A 1FJGI 4YHHI 4B3TI 4KHPE 4AQYE 1A6FA 1EA6A 4YHHE 4KQVA 2NUGA 3D4JA 5CFFE 4URLA 1X48A 1NHIA 4LF8E 2VF3A 1MG7A 3OTOI 5LMNI 2XEXA 3C4TA 1HNZE 4DV6I 5LMNE 1J5EE 3WU5A 5IT9C 1T4LB 1NHHA 4LFCI 4DR5I 2B7TA 1KVKA 3JAMQ 1RC7A 4LFCE 1WHNA 3M6AA 1HNWE 1Z0CA 4JI2E 1IBME 4XTJA 4DR7I 4DV1I 3LPSA 1Z0BA 4JI4I 2X7IA 2N3GA 3T1HI 1EKZA 2V8PA 4X8WA 4PRXA 4GKKI 3J81Q 4K0KE 1N34I 5BR8I 2DMYA 1N0VC 2UUAE 3VYYA 1T4OA 1UILA 4DV2E 2LJHA 1ZM3A 4NXMI 4USMA 4DV5E 4FWHA 2UXDE 4M1KA 4GKJI 4WUCA 1IBKI 3J7AM 2LUQA 1XMOI 4LFBE 3PYGA 1PKPA 3ZKBA 1RR9A 2OI2A 4FW9A 4JI6E 2UUBI 1H7SA 1XMQI 4DV4E 2AJ4A 3V2UC 5GMEA 4DV0E 4JV5E 2VQFE 1N32E 1N0UA 3VYXA 4X66I 3PYEA 1NHJA 4DXLA 3Q1QA 5FLXC 3J80C 2R42A 3ADIA 3B78A 2ZBKB 1X47A 3QT5A 5L3JA 4NXNI 3T1YE 2BV3A 2RTXA 3C4BA 1B63A 4LF5I 5LMUE 2DEJA 1H7UA 2UXBE 4M30A 4OX9I 1YYWA 4HACB 4P7AA 2UUCI 2ZM6I 2RSMA 2UU9E 4LFAE 1PIEA 4LF7I 2UUCE 4JYAI 1ELOA 4X65I 2LBSB 4MYUA 1EI1A 1MU5A 2L3JA 1ZM9A 1FJGE 4LF9I 4B3TE 2DIXA 2NA2A 1YZ9A 4DUYI 4LF9E 1FKAE 4DR4I 2VQEI 4P52A 4FN5A 4DR4E 1J26A 2F4VI 1I94I 3OTOE 5IT9Q 4JI5I 4DV6E 1Z0WA 1MX0A 4DR6I 4X64I 2NPFA 4DR5E 2LTSA 3ADJA 1HR0I 1XHKA 2HHHI 2LJPA 1B62A 2HKEA 2YT4A 4DR7E 1H73A 4Z7YA 2EZ6A 4DV1E 4JI4E 4M2ZA 3T1HE 3PYDA 1ZM4A 1S16A 4GKKE 4USKA 1IBLI 4LF6I 1N34E 5BR8E 2B7VA 2E1RA 1KTVA 4WYQB 4JI8I 2HK2A 4DU8A 2L3CA 4NXME 3WU6A 3GONA 3J7Yp 4GKJE 1IBKE 1XMOE 1Z59A 2N3HA 4LF4I 3LNUA 4EMDA 4DPWA 1S4EA 5IWAI 3B8HA 2UUBE 4ED4A 2JY9A 1XMQE 4OOGC 1Z0VA 4X66E 1NZ0A 5FLXQ 4B3RI 4HYMA 4JI0I 1XNRI 3J80Q 4B3MI 4B3RE 1H74A 4JI7I 2HFUA 2X36A 4DPYA 2HFSA 3J7AG 4DUZI 2CPNA 1VISA 3ZZUA 4NXNE 4FWDA 1N36I 1STUA 1YYOA 2BM1A 2V34A 4DPTA 1N33I 2UXCI 4JI1I 4YY3I 3ZKDA 4LF5E 4UTGA 1XNQI 4OX9E 2ZITA 4FWGA 5GMDA 2ZM6E 4B3SI 1RREA 3HTXA 4LF7E 2J7KA 1ZBTA 1U2RA 1WHQA 4JYAE 1Z5CA 2BM0A 4X65E 2DEIA 2L2NA 5A2QC 4X62I 1HNXI 2MDRA 1ZXMA 1HNXE 4DUYE 2V2QA 4WUBA 1Z0TA 2VQEE 4DR2I 2GS8A 4DV7I 2F4VE 4DR3I 4RPFA 1I94E 1Z5BA 1DI2A 4JI5E 3QT7A 4JG4A 4KHPI 4AQYI 4DPUA 3B82A 4DR6E 1WUUA 4X64E 4DPXA 2RS7A 4ZVIA 1FI4A 2V2VA 4LF8I 1UEKA 1HR0E 3LLHA 1RQ0A 2HHHE 1HNZI 4MYTA 4JI3I 1H72C 1J5EI 4DKKA 4JI3E 4WFTA 2A2DA 3ZM7A 2EFGA 3HULA 4HY1A 1YYKA 2JVAA 4I3HA 4PRVA 3F0NA 4PU9A 3JAMC 1HNWI 3ADGA 1ZM2A 2LTRA 2NUFA 1IBLE 4LF6E 4JI2I 1IBMI 2CZ9A 5LL6R 1GQEA
chains in the Genus database with same CATH superfamily
4JI8E 5K36E 4WXCA 2JT2A 2EMKA 3VK6A 1D6TA 3M85G 1KKHA 2GPIA 2LRSA 4LCHA 4AIMA 4K0KI 4U3BA 1X49A 2LUPB 2YRKA 4I8OA 4OO1A 3J81C 1SR9A 2UUAI 1Z0GA 2Z5CA 2R3VA 3QT8A 2O1VA 4LF4E 1FWLA 2YTPA 3KZYA 4DV2I 2NN6A 1DARA 3P3CA 1UN6B 3LTOA 3ZZ0A 2LJUA 3H4LA 2BA1G 5IWAE 3HKMA 4DV5I 2WP8A 2UXDI 2RS6A 2MKNA 3K1JA 2JWOA 3ZZTA 1PDAA 4BHBA 2E5LI 4IFDB 1QZRA 4LFBI 3PYFA 2E5LE 3H09A 3RMPA 2V8QB 2NN6F 3QT6A 4GEQB 2NUEA 3IWDA 4JI6I 2E72A 4FK5C 4WUDA 4DV4I 2EPUA 4JI0E 1XNRE 3M7ND 3K17A 2WW4A 4B3ME 4DV0I 4JV5I 4HEIA 4F54A 1UHZA 1X5WA 2VQFI 4BA2A 4ISAA 1N32I 2JP9A 3P1XA 4JI7E 3V5RA 4P78A 3ADLA 2O1UA 3UK3C 2EM9A 4TUGA 1BKNA 4O4KA 3GMEA 2K4VA 3WU4A 4DUZE 4Z7CA 1K47A 3DF6A 2M9AA 5A6BD 4LCFA 4IFDF 2HK3A 5JEAC 1T4NA 1O0WA 1YSAC 4UT4A 1N36E 1G2DC 4ZYGA 3DJWA 2CVEA 2PRTA 2B3TB 1ZU1A 1IMUA 1AAYA 5TSEA 1N33E 2A2CA 2WBSA 2UXCE 2JXPA 2JOXA 4YY3E 2L2KB 2IHR1 4JI1E 1OJ4A 2WBTA 2KHXA 4IS9A 2EPRA 2J65A 1HK7A 4MU3A 5IXMB 2L33A 1XNQE 5DNLA 3T1YI 3JU0A 3P3EA 2FTXB 2HKJA 2YTOA 2EOEA 4HXZA 1Z5AA 4GZNC 4B3SE 2V2ZA 4DV3I 1R6LA 4R2CA 2B9DA 5AE2A 5LMUI 1GTKA 2JEAA 4DV3E 3HXLA 2UXBI 2EPPA 4DR1I 2DLKA 1KIJA 1ZXNA 1G2FC 3BGHA 2A25A 2YTGA 4Q28A 4DR1E 5A2QQ 2PO2B 4WSPA 2UU9I 4LFAI 2PO1B 2L2MA 1F2IG 3ZM7A 5DRPA 4F9AB 2M4IA 4X62E 5C0XC 5A69A 2EMIA 4MQYA 2K7IA 4MU4A 1Y4UA 2R76A 1FNMA 2Q2EB 4OKGA 3L7ZB 5JEAA 4DMIA 1FWKA 2MC6A 4HACA 3WU3A 1NEIA 5ELWA 4R1FA 1Z0EA 4DR2E 3EPLA 4OO1C 1P42A 3CWVA 2BR2A 4DV7E 4DR3E 1PVGA 1QU6A 2DB2A 4AM3A 4DU7A 2GO3A 2PNZB 1FJGI 4YHHI 4B3TI 2KONA 1B69A 4KHPE 4AQYE 5K36A 1A6FA 2G7HA 4YHHE 2ENAA 1EA6A 4KQVA 2O3ZA 4OZEA 4IZJB 2NUGA 2EN2A 3D4JA 1Y6ZA 5CFFE 2O1WA 4IZJD 4URLA 5DNYA 2EMCA 4MLQA 2EL5A 4WXDA 2O1TA 1X48A 2RQLA 1BB8A 4LF8E 1NHIA 2VF3A 1MG7A 1UDOA 3OTOI 5LMNI 2XEXA 1QNTA 3C4TA 4MLVA 3TQMA 1HNZE 4DV6I 5LMNE 1J5EE 3WU5A 5IT9C 2ENHA 1T4LB 1NHHA 2C39B 2YRHA 4LFCI 3THOB 5C0XD 5C0XB 3EQ1A 4DR5I 2B7TA 1OYSA 1KVKA 3JAMQ 1RC7A 4LFCE 5A6JA 1WHNA 2IOPA 2CGEA 4MU1A 3P76A 3M6AA 3HPZA 1PJTA 1X6EA 1HNWE 2IOQA 4F2JC 1Z0CA 4OO1B 4JI2E 1IBME 2WZOA 4XTJA 4DR7I 5AASA 5DNXA 2NN6B 2NN6D 3LPSA 1Z0BA 4DV1I 4JI4I 2X7IA 2N3GA 3T1HI 3Q6MA 2EM5A 1EKZA 1RHYA 2V8PA 4X8WA 4PRXA 4LU9A 2WP8B 4F9BB 1USUA 1VI7A 4GKKI 5KL3A 3J81Q 1EH8A 2YPNA 2Q8UA 2ELZA 4N4RB 4IJDA 4K0KE 2ODRD 1OYPA 3PS2A 5BR8I 2YTDA 2DMYA 1IQOA 1N0VC 2EN8A 4M0VA 5C0XF 2UUAE 2F8BA 5DROA 2D9HA 2FV4B 3VYYA 1T4OA 1UILA 4DV2E 2LJHA 5A6KA 3PS3A 5KL5A 1ZM3A 4NXMI 2E1MA 4USMA 4DV5E 4FWHA 1TF3A 1UDSA 3LMLA 1ZR9A 4OO1F 2UXDE 2EM2A 4M1KA 4IFDD 4GKJI 4WUCA 2YSPA 1IBKI 3J7AM 3NZKA 2LUQA 2EQ0A 4LFBE 1E3HA 1XMOI 2EPXA 3PYGA 1PKPA 3ZKBA 1RR9A 2I13A 2EORA 2OI2A 4FW9A 4JI6E 1YHCA 3C6KA 2IESA 2YTQA 2JR1A 2UUBI 2N8XA 1ZBQA 1H7SA 1XMQI 4DV4E 2AJ4A 3V2UC 2EOOA 5GMEA 4DV0E 4JV5E 2VQFE 1X6HA 1N32E 4KZSA 1N0UA 3VYXA 4X66I 2BB8A 3PYEA 4IZKA 2EPKX 1NHJA 2V83A 4AIDA 1YPNA 4BCAA 4DXLA 2VF1A 2IERA 3Q1QA 5FLXC 2YTFA 3H1CA 5AC4A 4FW7A 5EKWA 1WXRA 3EPJA 2LT7A 2EMXA 3J80C 1UDQA 1T39A 2R42A 3CDIA 1A1IA 1PJSA 3ADIA 1YFHA 2DSYA 2PO0A 2BA0D 5K36C 3CDJA 3B78A 3UHMA 2ZBKB 1X47A 2EWLA 3QT5A 5L3JA 2GLIA 4BA1A 4NXNI 2EN6A 2NN6E 5IV8B 5KL7A 3T1YE 2BV3A 4R2DA 2YU8A 2HJJA 3KRNA 2EOFA 2RTXA 3C4BA 2V88A 1B63A 2Z5BA 2LO3A 2CT1A 2GHFA 5DRRA 4LF5I 5LMUE 1T38A 4KWYA 1OYRA 2C37A 2DEJA 1H7UA 1A1JA 2UXBE 4F9CB 2NABA 4L8NA 4M30A 4OX9I 2EL4A 1YYWA 5JEAB 5JEAD 4HACB 2L8TA 4P7AA 5AE3A 4ZYDA 4HTGA 4O24A 4R2QA 2ZM6I 2UUCI 2RSMA 3BIDA 2UU9E 1A1FA 4LFAE 1PIEA 4LF7I 4IFDE 2BR2B 2UUCE 1RMDA 3M85D 5AC5A 4JYAI 2EM7A 1A1LA 1ELOA 4X65I 3EPHA 5K36B 1LLMC 2LBSB 2ADRA 2F1DA 3HJCA 4MYUA 2M7QA 1EI1A 2DGCA 2GQ0A 4O43A 2EM4A 1MU5A 2L3JA 2BA1D 2WNRA 3M99B 3U1YA 1ZM9A 1SFEA 4NZVA 1WRJA 3MSWA 3VHTB 2BBGA 4Q35B 4B3TE 1FJGE 4LF9I 2DIXA 2NA2A 1YZ9A 5JEAF 2EN1A 4DUYI 3KZZA 4LF9E 1FKAE 4RHBB 4DR4I 2EOQA 2VQEI 2EMYA 4FN5A 4P52A 4DR4E 2JE6A 1J26A 4FW5A 2M1SA 2F4VI 1WJPA 2EM0A 2EOIA 2EPLX 2WBUA 3OTOE 2AE8A 1I94I 1YUJA 5IT9Q 3P3GA 5K36F 3GCMA 4DV6E 2EPMX 4JI5I 2JEBA 3C6MA 1Z0WA 2DRPA 3GLLA 4LOMA 3L00A 1MX0A 4DR6I 4FW3A 1KYQA 2YTJA 4X64I 2NPFA 4DR5E 4R2AA 2LTSA 4BC9A 3ADJA 1Z1BA 1HR0I 2EL6A 1XHKA 2EMLA 2PO1A 1A1KA 4P7DA 2HHHI 4OO1D 5AE1A 2LJPA 2JEAB 5FWKA 3AUZA 2CSHA 3ECRA 2Z5CB 3Q6NA 2LVHA 3K85A 1R6MA 1B62A 3HQ1A 2YT4A 4DR7E 2HC5A 1H73A 2HKEA 4BC7A 4Z7YA 5DRQA 2EMZA 2EZ6A 4DV1E 4JI4E 1BBOA 4M2ZA 2L92A 3T1HE 3PYDA 1ZM4A 1EH6A 1S16A 4GKKE 4USKA 4R03A 5JEAE 1IBLI 4LF6I 1N34E 1TN9A 1Y5YA 5BR8E 4MDTA 4X9JA 2B7VA 2E1RA 2EMHA 1KTVA 4WYQB 4BMJA 4BHCA 4JI8I 2R1FA 2HK2A 2EOJA 2L3CA 4DU8A 2HGHA 4WX9A 2MC5A 2C38A 4NXME 3PS1A 2EPCA 2JPAA 2GO4A 5A6AA 3WU6A 3GONA 3J7Yp 1A1GA 4GKJE 4BA2B 3F6GA 1IBKE 3IWBA 2EJ4A 2ELYA 2EQ3A 1XMOE 1Z59A 2N3HA 4LF4I 1MGTA 3LNUA 2EMFA 2VESA 4EMDA 4DPWA 3ZOQB 1S4EA 5IWAI 3PRYA 4IZKB 2EM6A 3B8HA 2EM8A 2UUBE 2V87A 4ED4A 2JY9A 4R2RA 1XMQE 4LPFA 2YTIA 2YZTA 2V86A 4OOGC 2EMGA 2EOZA 4N3OA 2PO0B 1Z0VA 2PNMA 2EMWA 4L5NC 2I9IA 2FGGA 4X66E 1NZ0A 1N3GA 5C0XE 4F6NA 2LV2A 5FLXQ 1PJQA 3QG5C 4R8OA 4B3RI 4BA1B 4HYMA 4JI0I 1XNRI 5ADZA 3J80Q 5KL6A 1P47A 2EOXA 4B3RE 4B3MI 3P06A 4IFDA 1N34I 1H74A 4JI7I 2EP3A 2HFUA 2Z5BB 4OO1E 5F3WA 4M9VC 2X36A 3OMLA 2HFSA 2RPCA 3DD6A 4DPYA 3J7AG 4DUZI 2C37B 3U1KA 2CPNA 1VISA 1UBDC 3ZZUA 1BBGA 2YWQA 4R2PA 4NXNE 1Y4SA 4FWDA 4MU0A 1IQSA 1N36I 1STUA 2WCC3 1YYOA 1AH5A 4TUIA 2BM1A 2V34A 4DPTA 1DGCA 2EN3A 1N33I 2UXCI 4JI1I 4YY3I 3ZKDA 4LF5E 4UTGA 2EPZA 2JOBA 5A6BA 1DQ3A 2YU5A 4O5GA 1XXEA 2VRDA 3IWCA 1XNQI 4OX9E 2DMIA 2ZITA 4FWGA 5GMDA 5T6JA 1JK2A 2YTEA 1MEYC 2LE2A 2ZM6E 1EH7A 4B3SI 1RREA 3HTXA 4LF7E 5KL2A 1L4SA 4WPYA 2J7KA 2WNRB 4FW4A 1ZBTA 1U2RA 1WHQA 3K6QA 4JYAE 5K36D 3THNA 2MDGA 1Z5CA 2BM0A 2EMBA 4X65E 5LLQA 4BS9A 1UDNA 2DEIA 2L2NA 4NBQA 3MHSC 4QNJA 4J8ZA 3FIGA 2JE6B 1GZ6A 2DLQA 5A2QC 3AV0A 2Z5EA 2EQ1A 4X62I 3F6HA 1TF6A 1HNXI 3M7NG 2VE7C 2MDRA 2YTNA 1USVA 2V85A 1ZXMA 2JEBB 2ENCA 2PNLA 1HNXE 2EN7A 4DUYE 2RSIA 2MKDA 2V2QA 2J7JA 4WSGA 1Z0TA 2PO2A 4WUBA 2LMZA 2VQEE 4DR2I 2GS8A 1E3PA 2EPAA 3KWRA 2EOYA 4QNKA 4BBYA 1JK1A 1NCSA 2YSOA 2F4VE 2CG9A 4RPFA 1I94E 4DV7I 4DR3I 1Z5BA 5EL9A 2KOUA 4R2SA 1DI2A 4IS1C 4JI5E 1KJKA 3QT7A 2EMAA 2EOMA 4JG4A 4F6MA 4AQYI 4KHPI 4DPUA 2CTDA 3HPSA 3EPKA 4DR6E 2NN6C 3B82A 1WUUA 4X64E 2JYAA 3L7ZA 4DPXA 2RS7A 1X6FA 4U3DA 4ZVIA 4LTYA 1YUIA 3BF2A 1FI4A 2BA0G 2V2VA 4LF8I 1UEKA 1HR0E 4RH8A 3JTZA 1X3CA 2EOSA 2ODRC 3LLHA 1RQ0A 2HHHE 4GQUA 2EOHA 2L6MA 4MYTA 1HNZI 4JI3I 1H72C 2EE8A 1YH8A 2PNZA 4LCGA 4ZYHA 1J5EI 1Y60A 4DKKA 1A1HA 4JI3E 2EM3A 3BBGA 3MHHC 4WFTA 2A2DA 4IZJA 2YRMA 2EFGA 2EPNA 3HULA 4NHRA 1YYKA 2JVAA 2H36X 1ZAAC 4HY1A 4I3HA 4PRVA 2C38B 3F0NA 4IFDC 3B4TA 3JAMC 4PU9A 1HNWI 3ADGA 1ZM2A 2LTRA 4J3DA 2NUFA 2LCEA 1IBLE 4LF6E 4JI2I 2EN4A 4FW6A 2EPOA 4R2EA 4ZYEA 1IBMI 2C39A 2V89A 5C0XA 5LL6R 2CZ9A 5KL4A 1GQEA
chains in the Genus database with same CATH topology
4JI8E 3VK6A 1D6TA 1KKHA 2LRSA 4K0KI 1X49A 2LUPB 4I8OA 3J81C 1SR9A 2UUAI 1Z0GA 2Z5CA 2R3VA 3QT8A 2O1VA 4LF4E 1FWLA 4DV2I 1DARA 3LTOA 3ZZ0A 3H4LA 5IWAE 4DV5I 2UXDI 2RS6A 2JWOA 3ZZTA 2E5LI 1QZRA 4LFBI 3PYFA 2E5LE 3H09A 3RMPA 2V8QB 3QT6A 4GEQB 2NUEA 3IWDA 4JI6I 4WUDA 4DV4I 4JI0E 1XNRE 3K17A 2WW4A 4B3ME 4DV0I 4JV5I 4F54A 2VQFI 1UHZA 1N32I 3P1XA 4JI7E 3V5RA 4P78A 3ADLA 2O1UA 4Z7CA 4TUGA 1BKNA 2K4VA 3WU4A 4DUZE 1K47A 3DF6A 2HK3A 1T4NA 1O0WA 4UT4A 1N36E 3DJWA 2B3TB 2A2CA 3K1JA 1N33E 2UXCE 4JI1E 2JOXA 4YY3E 2L2KB 2IHR1 1OJ4A 2KHXA 1HK7A 2L33A 1XNQE 3T1YI 3JU0A 2FTXB 2HKJA 4HXZA 1Z5AA 4B3SE 2V2ZA 4DV3I 2B9DA 5AE2A 5LMUI 4DV3E 3HXLA 2UXBI 4DR1I 1KIJA 1ZXNA 4Q28A 4DR1E 5A2QQ 4WSPA 2UU9I 4LFAI 2L2MA 4F9AB 2M4IA 4X62E 1Y4UA 1FNMA 2Q2EB 4DMIA 1FWKA 2MC6A 4HACA 3WU3A 4R1FA 1Z0EA 4DR2E 3CWVA 4DV7E 4DR3E 1PVGA 1QU6A 2DB2A 4DU7A 1FJGI 4YHHI 4B3TI 2KONA 4KHPE 4AQYE 1A6FA 1EA6A 2G7HA 4YHHE 4KQVA 4IZJB 2NUGA 4IZJD 3D4JA 1Y6ZA 5CFFE 2O1WA 4URLA 5DNYA 2O1TA 1X48A 1NHIA 4LF8E 2VF3A 1MG7A 3OTOI 5LMNI 2XEXA 3C4TA 1HNZE 4DV6I 5LMNE 1J5EE 3WU5A 5IT9C 1T4LB 1NHHA 4LFCI 4DR5I 2B7TA 1KVKA 3JAMQ 1RC7A 4LFCE 1WHNA 2IOPA 2CGEA 3M6AA 3HPZA 1HNWE 2IOQA 1Z0CA 4JI2E 1IBME 2WZOA 4XTJA 4DR7I 5AASA 4DV1I 3LPSA 1Z0BA 4JI4I 2X7IA 2N3GA 3T1HI 3Q6MA 1EKZA 2V8PA 4X8WA 4PRXA 4LU9A 4F9BB 1USUA 4GKKI 3J81Q 4K0KE 1N34I 2ODRD 5BR8I 2DMYA 1N0VC 4M0VA 2UUAE 2F8BA 2FV4B 3VYYA 1T4OA 1UILA 4DV2E 2LJHA 1ZM3A 4NXMI 2E1MA 4USMA 4DV5E 4FWHA 3LMLA 2UXDE 4M1KA 4GKJI 4WUCA 1IBKI 3J7AM 2LUQA 1XMOI 4LFBE 3PYGA 1PKPA 3ZKBA 1RR9A 2OI2A 4FW9A 4JI6E 2JR1A 2UUBI 1ZBQA 1H7SA 1XMQI 4DV4E 2AJ4A 3V2UC 5GMEA 4DV0E 4JV5E 2VQFE 1N32E 4KZSA 1N0UA 3VYXA 4X66I 3PYEA 4IZKA 1NHJA 2V83A 4BCAA 4DXLA 2VF1A 3Q1QA 5FLXC 1WXRA 3J80C 2R42A 3ADIA 2DSYA 3B78A 2ZBKB 1X47A 2EWLA 3QT5A 5L3JA 4NXNI 3T1YE 2BV3A 2RTXA 2V88A 3C4BA 1B63A 2Z5BA 4LF5I 5LMUE 2DEJA 1H7UA 2UXBE 4F9CB 4L8NA 4M30A 4OX9I 1YYWA 4HACB 2L8TA 4P7AA 5AE3A 2UUCI 2ZM6I 2RSMA 2UU9E 4LFAE 1PIEA 4LF7I 2UUCE 4JYAI 1ELOA 4X65I 2LBSB 3HJCA 4MYUA 2M7QA 1EI1A 2GQ0A 1MU5A 2L3JA 1ZM9A 1FJGE 3MSWA 4LF9I 4B3TE 2DIXA 2NA2A 1YZ9A 4DUYI 4LF9E 1FKAE 4DR4I 2VQEI 4P52A 4FN5A 4DR4E 1J26A 2M1SA 2F4VI 1I94I 3OTOE 5IT9Q 4JI5I 4DV6E 1Z0WA 1MX0A 4DR6I 4X64I 2NPFA 4DR5E 2LTSA 4BC9A 3ADJA 1HR0I 1XHKA 4P7DA 2HHHI 5AE1A 2LJPA 5FWKA 3AUZA 2Z5CB 3Q6NA 3K85A 1B62A 3HQ1A 2YT4A 4DR7E 1H73A 2HKEA 4BC7A 4Z7YA 2EZ6A 4DV1E 4JI4E 4M2ZA 2L92A 3T1HE 3PYDA 1ZM4A 1S16A 4GKKE 4USKA 4R03A 1IBLI 4LF6I 1N34E 5BR8E 2B7VA 2E1RA 1KTVA 4WYQB 4BMJA 4JI8I 2HK2A 4DU8A 2L3CA 2MC5A 4NXME 3WU6A 3GONA 3J7Yp 4GKJE 3F6GA 1IBKE 3IWBA 1XMOE 1Z59A 2N3HA 4LF4I 3LNUA 4EMDA 4DPWA 3ZOQB 1S4EA 5IWAI 3PRYA 4IZKB 3B8HA 2UUBE 2V87A 4ED4A 2JY9A 1XMQE 2YZTA 2V86A 4OOGC 4N3OA 1Z0VA 2PNMA 4L5NC 2FGGA 4X66E 1NZ0A 5FLXQ 4R8OA 4B3RI 4HYMA 4JI0I 1XNRI 5ADZA 3J80Q 4B3MI 4B3RE 3P06A 1H74A 4JI7I 2HFUA 2Z5BB 5F3WA 2X36A 3OMLA 2HFSA 4DPYA 3J7AG 4DUZI 2CPNA 1VISA 3ZZUA 4NXNE 4FWDA 1Y4SA 1N36I 1STUA 1YYOA 4TUIA 2BM1A 2V34A 4DPTA 1N33I 2UXCI 4JI1I 4YY3I 3ZKDA 4LF5E 4UTGA 2JOBA 1DQ3A 1XNQI 3IWCA 4OX9E 2ZITA 4FWGA 5GMDA 5T6JA 2LE2A 2ZM6E 4B3SI 1RREA 3HTXA 4LF7E 4WPYA 2J7KA 1ZBTA 1U2RA 1WHQA 3K6QA 4JYAE 1Z5CA 2BM0A 4X65E 4BS9A 2DEIA 2L2NA 4J8ZA 3FIGA 1GZ6A 5A2QC 3AV0A 2Z5EA 4X62I 3F6HA 1HNXI 2VE7C 2MDRA 2PNLA 1USVA 2V85A 1ZXMA 1HNXE 4DUYE 2V2QA 4WUBA 1Z0TA 2LMZA 2VQEE 4DR2I 2GS8A 3KWRA 4BBYA 2F4VE 2CG9A 4DV7I 4RPFA 4DR3I 1I94E 1Z5BA 2KOUA 1DI2A 4JI5E 3QT7A 4JG4A 4KHPI 4AQYI 4DPUA 3HPSA 4DR6E 3B82A 1WUUA 4X64E 4DPXA 2RS7A 4ZVIA 4LTYA 1FI4A 2V2VA 4LF8I 1UEKA 1HR0E 3JTZA 2ODRC 3LLHA 1RQ0A 2HHHE 1HNZI 2L6MA 4MYTA 4JI3I 1H72C 1J5EI 4DKKA 4JI3E 4WFTA 2A2DA 4IZJA 3ZM7A 2EFGA 3HULA 4HY1A 1YYKA 2JVAA 2H36X 4I3HA 4PRVA 3F0NA 4PU9A 3JAMC 1HNWI 3ADGA 1ZM2A 2LTRA 2NUFA 1IBLE 4LF6E 4JI2I 1IBMI 2V89A 5LL6R 2CZ9A 1GQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 E;  1D6T A;  1KKH A;  2LRS A;  4K0K I;  1X49 A;  2LUP B;  3J81 C;  2UUA I;  1Z0G A;  3QT8 A;  2R3V A;  4LF4 E;  1FWL A;  4DV2 I;  1DAR A;  3LTO A;  3ZZ0 A;  3H4L A;  5IWA E;  4DV5 I;  2UXD I;  2RS6 A;  3ZZT A;  2E5L I;  1QZR A;  4LFB I;  3PYF A;  2E5L E;  3QT6 A;  2NUE A;  4JI6 I;  4WUD A;  4DV4 I;  4JI0 E;  1XNR E;  3K17 A;  2WW4 A;  4B3M E;  4DV0 I;  4JV5 I;  2VQF I;  1UHZ A;  1N32 I;  3P1X A;  4JI7 E;  3V5R A;  3ADL A;  4Z7C A;  1BKN A;  3WU4 A;  4DUZ E;  1K47 A;  2HK3 A;  1T4N A;  1O0W A;  4UT4 A;  1N36 E;  2B3T B;  2A2C A;  3K1J A;  1N33 E;  2UXC E;  4JI1 E;  4YY3 E;  2L2K B;  2IHR 1;  1OJ4 A;  2KHX A;  2L33 A;  1XNQ E;  3T1Y I;  2HKJ A;  4HXZ A;  1Z5A A;  4B3S E;  2V2Z A;  4DV3 I;  5LMU I;  4DV3 E;  2UXB I;  4DR1 I;  1KIJ A;  1ZXN A;  4DR1 E;  5A2Q Q;  2UU9 I;  4LFA I;  2L2M A;  4X62 E;  1FNM A;  2Q2E B;  1FWK A;  4HAC A;  3WU3 A;  4R1F A;  1Z0E A;  4DR2 E;  3CWV A;  4DV7 E;  4DR3 E;  1PVG A;  1QU6 A;  2DB2 A;  4DU7 A;  1FJG I;  4YHH I;  4B3T I;  4KHP E;  4AQY E;  1A6F A;  1EA6 A;  4YHH E;  4KQV A;  2NUG A;  3D4J A;  5CFF E;  4URL A;  1X48 A;  1NHI A;  4LF8 E;  2VF3 A;  1MG7 A;  3OTO I;  5LMN I;  2XEX A;  3C4T A;  1HNZ E;  4DV6 I;  5LMN E;  1J5E E;  3WU5 A;  5IT9 C;  1T4L B;  1NHH A;  4LFC I;  4DR5 I;  2B7T A;  1KVK A;  3JAM Q;  1RC7 A;  4LFC E;  1WHN A;  3M6A A;  1HNW E;  1Z0C A;  4JI2 E;  1IBM E;  4XTJ A;  4DR7 I;  4DV1 I;  3LPS A;  1Z0B A;  4JI4 I;  2X7I A;  2N3G A;  3T1H I;  1EKZ A;  2V8P A;  4X8W A;  4PRX A;  4GKK I;  3J81 Q;  4K0K E;  1N34 I;  5BR8 I;  2DMY A;  1N0V C;  2UUA E;  3VYY A;  1T4O A;  1UIL A;  4DV2 E;  2LJH A;  1ZM3 A;  4NXM I;  4USM A;  4DV5 E;  4FWH A;  2UXD E;  4M1K A;  4GKJ I;  4WUC A;  1IBK I;  3J7A M;  2LUQ A;  1XMO I;  4LFB E;  3PYG A;  1PKP A;  3ZKB A;  1RR9 A;  2OI2 A;  4FW9 A;  4JI6 E;  2UUB I;  1H7S A;  1XMQ I;  4DV4 E;  2AJ4 A;  3V2U C;  5GME A;  4DV0 E;  4JV5 E;  2VQF E;  1N32 E;  1N0U A;  3VYX A;  4X66 I;  3PYE A;  1NHJ A;  4DXL A;  3Q1Q A;  5FLX C;  3J80 C;  2R42 A;  3ADI A;  3B78 A;  2ZBK B;  1X47 A;  3QT5 A;  5L3J A;  4NXN I;  3T1Y E;  2BV3 A;  2RTX A;  3C4B A;  1B63 A;  4LF5 I;  5LMU E;  2DEJ A;  1H7U A;  2UXB E;  4M30 A;  4OX9 I;  1YYW A;  4HAC B;  4P7A A;  2UUC I;  2ZM6 I;  2RSM A;  2UU9 E;  4LFA E;  1PIE A;  4LF7 I;  2UUC E;  4JYA I;  1ELO A;  4X65 I;  2LBS B;  4MYU A;  1EI1 A;  1MU5 A;  2L3J A;  1ZM9 A;  1FJG E;  4LF9 I;  4B3T E;  2DIX A;  2NA2 A;  1YZ9 A;  4DUY I;  4LF9 E;  1FKA E;  4DR4 I;  2VQE I;  4P52 A;  4FN5 A;  4DR4 E;  1J26 A;  2F4V I;  1I94 I;  3OTO E;  5IT9 Q;  4JI5 I;  4DV6 E;  1Z0W A;  1MX0 A;  4DR6 I;  4X64 I;  2NPF A;  4DR5 E;  2LTS A;  3ADJ A;  1HR0 I;  1XHK A;  2HHH I;  2LJP A;  1B62 A;  2HKE A;  2YT4 A;  4DR7 E;  1H73 A;  4Z7Y A;  2EZ6 A;  4DV1 E;  4JI4 E;  4M2Z A;  3T1H E;  3PYD A;  1ZM4 A;  1S16 A;  4GKK E;  4USK A;  1IBL I;  4LF6 I;  1N34 E;  5BR8 E;  2B7V A;  2E1R A;  1KTV A;  4WYQ B;  4JI8 I;  2HK2 A;  4DU8 A;  2L3C A;  4NXM E;  3WU6 A;  3GON A;  3J7Y p;  4GKJ E;  1IBK E;  1XMO E;  1Z59 A;  2N3H A;  4LF4 I;  3LNU A;  4EMD A;  4DPW A;  1S4E A;  5IWA I;  3B8H A;  2UUB E;  4ED4 A;  2JY9 A;  1XMQ E;  4OOG C;  1Z0V A;  4X66 E;  1NZ0 A;  5FLX Q;  4B3R I;  4HYM A;  4JI0 I;  1XNR I;  3J80 Q;  4B3M I;  4B3R E;  1H74 A;  4JI7 I;  2HFU A;  2X36 A;  4DPY A;  2HFS A;  3J7A G;  4DUZ I;  2CPN A;  1VIS A;  3ZZU A;  4NXN E;  4FWD A;  1N36 I;  1STU A;  1YYO A;  2BM1 A;  2V34 A;  4DPT A;  1N33 I;  2UXC I;  4JI1 I;  4YY3 I;  3ZKD A;  4LF5 E;  4UTG A;  1XNQ I;  4OX9 E;  2ZIT A;  4FWG A;  5GMD A;  2ZM6 E;  4B3S I;  1RRE A;  3HTX A;  4LF7 E;  2J7K A;  1ZBT A;  1U2R A;  1WHQ A;  4JYA E;  1Z5C A;  2BM0 A;  4X65 E;  2DEI A;  2L2N A;  5A2Q C;  4X62 I;  1HNX I;  2MDR A;  1ZXM A;  1HNX E;  4DUY E;  2V2Q A;  4WUB A;  1Z0T A;  2VQE E;  4DR2 I;  2GS8 A;  4DV7 I;  2F4V E;  4DR3 I;  4RPF A;  1I94 E;  1Z5B A;  1DI2 A;  4JI5 E;  3QT7 A;  4JG4 A;  4KHP I;  4AQY I;  4DPU A;  3B82 A;  4DR6 E;  1WUU A;  4X64 E;  4DPX A;  2RS7 A;  4ZVI A;  1FI4 A;  2V2V A;  4LF8 I;  1UEK A;  1HR0 E;  3LLH A;  1RQ0 A;  2HHH E;  1HNZ I;  4MYT A;  4JI3 I;  1H72 C;  1J5E I;  4DKK A;  4JI3 E;  4WFT A;  2A2D A;  3ZM7 A;  2EFG A;  3HUL A;  4HY1 A;  1YYK A;  2JVA A;  4I3H A;  4PRV A;  3F0N A;  4PU9 A;  3JAM C;  1HNW I;  3ADG A;  1ZM2 A;  2LTR A;  2NUF A;  1IBL E;  4LF6 E;  4JI2 I;  1IBM I;  2CZ9 A;  5LL6 R;  1GQE A; 
#chains in the Genus database with same CATH topology
 4JI8 E;  5K36 E;  4WXC A;  2JT2 A;  2EMK A;  3VK6 A;  1D6T A;  3M85 G;  1KKH A;  2GPI A;  2LRS A;  4LCH A;  4AIM A;  4K0K I;  4U3B A;  1X49 A;  2LUP B;  2YRK A;  4I8O A;  4OO1 A;  3J81 C;  1SR9 A;  2UUA I;  1Z0G A;  2Z5C A;  2R3V A;  3QT8 A;  2O1V A;  4LF4 E;  1FWL A;  2YTP A;  3KZY A;  4DV2 I;  2NN6 A;  1DAR A;  3P3C A;  1UN6 B;  3LTO A;  3ZZ0 A;  2LJU A;  3H4L A;  2BA1 G;  5IWA E;  3HKM A;  4DV5 I;  2WP8 A;  2UXD I;  2RS6 A;  2MKN A;  3K1J A;  2JWO A;  3ZZT A;  1PDA A;  4BHB A;  2E5L I;  4IFD B;  1QZR A;  4LFB I;  3PYF A;  2E5L E;  3H09 A;  3RMP A;  2V8Q B;  2NN6 F;  3QT6 A;  4GEQ B;  2NUE A;  3IWD A;  4JI6 I;  2E72 A;  4FK5 C;  4WUD A;  4DV4 I;  2EPU A;  4JI0 E;  1XNR E;  3M7N D;  3K17 A;  2WW4 A;  4B3M E;  4DV0 I;  4JV5 I;  4HEI A;  4F54 A;  1UHZ A;  1X5W A;  2VQF I;  4BA2 A;  4ISA A;  1N32 I;  2JP9 A;  3P1X A;  4JI7 E;  3V5R A;  4P78 A;  3ADL A;  2O1U A;  3UK3 C;  2EM9 A;  4TUG A;  1BKN A;  4O4K A;  3GME A;  2K4V A;  3WU4 A;  4DUZ E;  4Z7C A;  1K47 A;  3DF6 A;  2M9A A;  5A6B D;  4LCF A;  4IFD F;  2HK3 A;  5JEA C;  1T4N A;  1O0W A;  1YSA C;  4UT4 A;  1N36 E;  1G2D C;  4ZYG A;  3DJW A;  2CVE A;  2PRT A;  2B3T B;  1ZU1 A;  1IMU A;  1AAY A;  5TSE A;  1N33 E;  2A2C A;  2WBS A;  2UXC E;  2JXP A;  2JOX A;  4YY3 E;  2L2K B;  2IHR 1;  4JI1 E;  1OJ4 A;  2WBT A;  2KHX A;  4IS9 A;  2EPR A;  2J65 A;  1HK7 A;  4MU3 A;  5IXM B;  2L33 A;  1XNQ E;  5DNL A;  3T1Y I;  3JU0 A;  3P3E A;  2FTX B;  2HKJ A;  2YTO A;  2EOE A;  4HXZ A;  1Z5A A;  4GZN C;  4B3S E;  2V2Z A;  4DV3 I;  1R6L A;  4R2C A;  2B9D A;  5AE2 A;  5LMU I;  1GTK A;  2JEA A;  4DV3 E;  3HXL A;  2UXB I;  2EPP A;  4DR1 I;  2DLK A;  1KIJ A;  1ZXN A;  1G2F C;  3BGH A;  2A25 A;  2YTG A;  4Q28 A;  4DR1 E;  5A2Q Q;  2PO2 B;  4WSP A;  2UU9 I;  4LFA I;  2PO1 B;  2L2M A;  1F2I G;  3ZM7 A;  5DRP A;  4F9A B;  2M4I A;  4X62 E;  5C0X C;  5A69 A;  2EMI A;  4MQY A;  2K7I A;  4MU4 A;  1Y4U A;  2R76 A;  1FNM A;  2Q2E B;  4OKG A;  3L7Z B;  5JEA A;  4DMI A;  1FWK A;  2MC6 A;  4HAC A;  3WU3 A;  1NEI A;  5ELW A;  4R1F A;  1Z0E A;  4DR2 E;  3EPL A;  4OO1 C;  1P42 A;  3CWV A;  2BR2 A;  4DV7 E;  4DR3 E;  1PVG A;  1QU6 A;  2DB2 A;  4AM3 A;  4DU7 A;  2GO3 A;  2PNZ B;  1FJG I;  4YHH I;  4B3T I;  2KON A;  1B69 A;  4KHP E;  4AQY E;  5K36 A;  1A6F A;  2G7H A;  4YHH E;  2ENA A;  1EA6 A;  4KQV A;  2O3Z A;  4OZE A;  4IZJ B;  2NUG A;  2EN2 A;  3D4J A;  1Y6Z A;  5CFF E;  2O1W A;  4IZJ D;  4URL A;  5DNY A;  2EMC A;  4MLQ A;  2EL5 A;  4WXD A;  2O1T A;  1X48 A;  2RQL A;  1BB8 A;  4LF8 E;  1NHI A;  2VF3 A;  1MG7 A;  1UDO A;  3OTO I;  5LMN I;  2XEX A;  1QNT A;  3C4T A;  4MLV A;  3TQM A;  1HNZ E;  4DV6 I;  5LMN E;  1J5E E;  3WU5 A;  5IT9 C;  2ENH A;  1T4L B;  1NHH A;  2C39 B;  2YRH A;  4LFC I;  3THO B;  5C0X D;  5C0X B;  3EQ1 A;  4DR5 I;  2B7T A;  1OYS A;  1KVK A;  3JAM Q;  1RC7 A;  4LFC E;  5A6J A;  1WHN A;  2IOP A;  2CGE A;  4MU1 A;  3P76 A;  3M6A A;  3HPZ A;  1PJT A;  1X6E A;  1HNW E;  2IOQ A;  4F2J C;  1Z0C A;  4OO1 B;  4JI2 E;  1IBM E;  2WZO A;  4XTJ A;  4DR7 I;  5AAS A;  5DNX A;  2NN6 B;  2NN6 D;  3LPS A;  1Z0B A;  4DV1 I;  4JI4 I;  2X7I A;  2N3G A;  3T1H I;  3Q6M A;  2EM5 A;  1EKZ A;  1RHY A;  2V8P A;  4X8W A;  4PRX A;  4LU9 A;  2WP8 B;  4F9B B;  1USU A;  1VI7 A;  4GKK I;  5KL3 A;  3J81 Q;  1EH8 A;  2YPN A;  2Q8U A;  2ELZ A;  4N4R B;  4IJD A;  4K0K E;  2ODR D;  1OYP A;  3PS2 A;  5BR8 I;  2YTD A;  2DMY A;  1IQO A;  1N0V C;  2EN8 A;  4M0V A;  5C0X F;  2UUA E;  2F8B A;  5DRO A;  2D9H A;  2FV4 B;  3VYY A;  1T4O A;  1UIL A;  4DV2 E;  2LJH A;  5A6K A;  3PS3 A;  5KL5 A;  1ZM3 A;  4NXM I;  2E1M A;  4USM A;  4DV5 E;  4FWH A;  1TF3 A;  1UDS A;  3LML A;  1ZR9 A;  4OO1 F;  2UXD E;  2EM2 A;  4M1K A;  4IFD D;  4GKJ I;  4WUC A;  2YSP A;  1IBK I;  3J7A M;  3NZK A;  2LUQ A;  2EQ0 A;  4LFB E;  1E3H A;  1XMO I;  2EPX A;  3PYG A;  1PKP A;  3ZKB A;  1RR9 A;  2I13 A;  2EOR A;  2OI2 A;  4FW9 A;  4JI6 E;  1YHC A;  3C6K A;  2IES A;  2YTQ A;  2JR1 A;  2UUB I;  2N8X A;  1ZBQ A;  1H7S A;  1XMQ I;  4DV4 E;  2AJ4 A;  3V2U C;  2EOO A;  5GME A;  4DV0 E;  4JV5 E;  2VQF E;  1X6H A;  1N32 E;  4KZS A;  1N0U A;  3VYX A;  4X66 I;  2BB8 A;  3PYE A;  4IZK A;  2EPK X;  1NHJ A;  2V83 A;  4AID A;  1YPN A;  4BCA A;  4DXL A;  2VF1 A;  2IER A;  3Q1Q A;  5FLX C;  2YTF A;  3H1C A;  5AC4 A;  4FW7 A;  5EKW A;  1WXR A;  3EPJ A;  2LT7 A;  2EMX A;  3J80 C;  1UDQ A;  1T39 A;  2R42 A;  3CDI A;  1A1I A;  1PJS A;  3ADI A;  1YFH A;  2DSY A;  2PO0 A;  2BA0 D;  5K36 C;  3CDJ A;  3B78 A;  3UHM A;  2ZBK B;  1X47 A;  2EWL A;  3QT5 A;  5L3J A;  2GLI A;  4BA1 A;  4NXN I;  2EN6 A;  2NN6 E;  5IV8 B;  5KL7 A;  3T1Y E;  2BV3 A;  4R2D A;  2YU8 A;  2HJJ A;  3KRN A;  2EOF A;  2RTX A;  3C4B A;  2V88 A;  1B63 A;  2Z5B A;  2LO3 A;  2CT1 A;  2GHF A;  5DRR A;  4LF5 I;  5LMU E;  1T38 A;  4KWY A;  1OYR A;  2C37 A;  2DEJ A;  1H7U A;  1A1J A;  2UXB E;  4F9C B;  2NAB A;  4L8N A;  4M30 A;  4OX9 I;  2EL4 A;  1YYW A;  5JEA B;  5JEA D;  4HAC B;  2L8T A;  4P7A A;  5AE3 A;  4ZYD A;  4HTG A;  4O24 A;  4R2Q A;  2ZM6 I;  2UUC I;  2RSM A;  3BID A;  2UU9 E;  1A1F A;  4LFA E;  1PIE A;  4LF7 I;  4IFD E;  2BR2 B;  2UUC E;  1RMD A;  3M85 D;  5AC5 A;  4JYA I;  2EM7 A;  1A1L A;  1ELO A;  4X65 I;  3EPH A;  5K36 B;  1LLM C;  2LBS B;  2ADR A;  2F1D A;  3HJC A;  4MYU A;  2M7Q A;  1EI1 A;  2DGC A;  2GQ0 A;  4O43 A;  2EM4 A;  1MU5 A;  2L3J A;  2BA1 D;  2WNR A;  3M99 B;  3U1Y A;  1ZM9 A;  1SFE A;  4NZV A;  1WRJ A;  3MSW A;  3VHT B;  2BBG A;  4Q35 B;  4B3T E;  1FJG E;  4LF9 I;  2DIX A;  2NA2 A;  1YZ9 A;  5JEA F;  2EN1 A;  4DUY I;  3KZZ A;  4LF9 E;  1FKA E;  4RHB B;  4DR4 I;  2EOQ A;  2VQE I;  2EMY A;  4FN5 A;  4P52 A;  4DR4 E;  2JE6 A;  1J26 A;  4FW5 A;  2M1S A;  2F4V I;  1WJP A;  2EM0 A;  2EOI A;  2EPL X;  2WBU A;  3OTO E;  2AE8 A;  1I94 I;  1YUJ A;  5IT9 Q;  3P3G A;  5K36 F;  3GCM A;  4DV6 E;  2EPM X;  4JI5 I;  2JEB A;  3C6M A;  1Z0W A;  2DRP A;  3GLL A;  4LOM A;  3L00 A;  1MX0 A;  4DR6 I;  4FW3 A;  1KYQ A;  2YTJ A;  4X64 I;  2NPF A;  4DR5 E;  4R2A A;  2LTS A;  4BC9 A;  3ADJ A;  1Z1B A;  1HR0 I;  2EL6 A;  1XHK A;  2EML A;  2PO1 A;  1A1K A;  4P7D A;  2HHH I;  4OO1 D;  5AE1 A;  2LJP A;  2JEA B;  5FWK A;  3AUZ A;  2CSH A;  3ECR A;  2Z5C B;  3Q6N A;  2LVH A;  3K85 A;  1R6M A;  1B62 A;  3HQ1 A;  2YT4 A;  4DR7 E;  2HC5 A;  1H73 A;  2HKE A;  4BC7 A;  4Z7Y A;  5DRQ A;  2EMZ A;  2EZ6 A;  4DV1 E;  4JI4 E;  1BBO A;  4M2Z A;  2L92 A;  3T1H E;  3PYD A;  1ZM4 A;  1EH6 A;  1S16 A;  4GKK E;  4USK A;  4R03 A;  5JEA E;  1IBL I;  4LF6 I;  1N34 E;  1TN9 A;  1Y5Y A;  5BR8 E;  4MDT A;  4X9J A;  2B7V A;  2E1R A;  2EMH A;  1KTV A;  4WYQ B;  4BMJ A;  4BHC A;  4JI8 I;  2R1F A;  2HK2 A;  2EOJ A;  2L3C A;  4DU8 A;  2HGH A;  4WX9 A;  2MC5 A;  2C38 A;  4NXM E;  3PS1 A;  2EPC A;  2JPA A;  2GO4 A;  5A6A A;  3WU6 A;  3GON A;  3J7Y p;  1A1G A;  4GKJ E;  4BA2 B;  3F6G A;  1IBK E;  3IWB A;  2EJ4 A;  2ELY A;  2EQ3 A;  1XMO E;  1Z59 A;  2N3H A;  4LF4 I;  1MGT A;  3LNU A;  2EMF A;  2VES A;  4EMD A;  4DPW A;  3ZOQ B;  1S4E A;  5IWA I;  3PRY A;  4IZK B;  2EM6 A;  3B8H A;  2EM8 A;  2UUB E;  2V87 A;  4ED4 A;  2JY9 A;  4R2R A;  1XMQ E;  4LPF A;  2YTI A;  2YZT A;  2V86 A;  4OOG C;  2EMG A;  2EOZ A;  4N3O A;  2PO0 B;  1Z0V A;  2PNM A;  2EMW A;  4L5N C;  2I9I A;  2FGG A;  4X66 E;  1NZ0 A;  1N3G A;  5C0X E;  4F6N A;  2LV2 A;  5FLX Q;  1PJQ A;  3QG5 C;  4R8O A;  4B3R I;  4BA1 B;  4HYM A;  4JI0 I;  1XNR I;  5ADZ A;  3J80 Q;  5KL6 A;  1P47 A;  2EOX A;  4B3R E;  4B3M I;  3P06 A;  4IFD A;  1N34 I;  1H74 A;  4JI7 I;  2EP3 A;  2HFU A;  2Z5B B;  4OO1 E;  5F3W A;  4M9V C;  2X36 A;  3OML A;  2HFS A;  2RPC A;  3DD6 A;  4DPY A;  3J7A G;  4DUZ I;  2C37 B;  3U1K A;  2CPN A;  1VIS A;  1UBD C;  3ZZU A;  1BBG A;  2YWQ A;  4R2P A;  4NXN E;  1Y4S A;  4FWD A;  4MU0 A;  1IQS A;  1N36 I;  1STU A;  2WCC 3;  1YYO A;  1AH5 A;  4TUI A;  2BM1 A;  2V34 A;  4DPT A;  1DGC A;  2EN3 A;  1N33 I;  2UXC I;  4JI1 I;  4YY3 I;  3ZKD A;  4LF5 E;  4UTG A;  2EPZ A;  2JOB A;  5A6B A;  1DQ3 A;  2YU5 A;  4O5G A;  1XXE A;  2VRD A;  3IWC A;  1XNQ I;  4OX9 E;  2DMI A;  2ZIT A;  4FWG A;  5GMD A;  5T6J A;  1JK2 A;  2YTE A;  1MEY C;  2LE2 A;  2ZM6 E;  1EH7 A;  4B3S I;  1RRE A;  3HTX A;  4LF7 E;  5KL2 A;  1L4S A;  4WPY A;  2J7K A;  2WNR B;  4FW4 A;  1ZBT A;  1U2R A;  1WHQ A;  3K6Q A;  4JYA E;  5K36 D;  3THN A;  2MDG A;  1Z5C A;  2BM0 A;  2EMB A;  4X65 E;  5LLQ A;  4BS9 A;  1UDN A;  2DEI A;  2L2N A;  4NBQ A;  3MHS C;  4QNJ A;  4J8Z A;  3FIG A;  2JE6 B;  1GZ6 A;  2DLQ A;  5A2Q C;  3AV0 A;  2Z5E A;  2EQ1 A;  4X62 I;  3F6H A;  1TF6 A;  1HNX I;  3M7N G;  2VE7 C;  2MDR A;  2YTN A;  1USV A;  2V85 A;  1ZXM A;  2JEB B;  2ENC A;  2PNL A;  1HNX E;  2EN7 A;  4DUY E;  2RSI A;  2MKD A;  2V2Q A;  2J7J A;  4WSG A;  1Z0T A;  2PO2 A;  4WUB A;  2LMZ A;  2VQE E;  4DR2 I;  2GS8 A;  1E3P A;  2EPA A;  3KWR A;  2EOY A;  4QNK A;  4BBY A;  1JK1 A;  1NCS A;  2YSO A;  2F4V E;  2CG9 A;  4RPF A;  1I94 E;  4DV7 I;  4DR3 I;  1Z5B A;  5EL9 A;  2KOU A;  4R2S A;  1DI2 A;  4IS1 C;  4JI5 E;  1KJK A;  3QT7 A;  2EMA A;  2EOM A;  4JG4 A;  4F6M A;  4AQY I;  4KHP I;  4DPU A;  2CTD A;  3HPS A;  3EPK A;  4DR6 E;  2NN6 C;  3B82 A;  1WUU A;  4X64 E;  2JYA A;  3L7Z A;  4DPX A;  2RS7 A;  1X6F A;  4U3D A;  4ZVI A;  4LTY A;  1YUI A;  3BF2 A;  1FI4 A;  2BA0 G;  2V2V A;  4LF8 I;  1UEK A;  1HR0 E;  4RH8 A;  3JTZ A;  1X3C A;  2EOS A;  2ODR C;  3LLH A;  1RQ0 A;  2HHH E;  4GQU A;  2EOH A;  2L6M A;  4MYT A;  1HNZ I;  4JI3 I;  1H72 C;  2EE8 A;  1YH8 A;  2PNZ A;  4LCG A;  4ZYH A;  1J5E I;  1Y60 A;  4DKK A;  1A1H A;  4JI3 E;  2EM3 A;  3BBG A;  3MHH C;  4WFT A;  2A2D A;  4IZJ A;  2YRM A;  2EFG A;  2EPN A;  3HUL A;  4NHR A;  1YYK A;  2JVA A;  2H36 X;  1ZAA C;  4HY1 A;  4I3H A;  4PRV A;  2C38 B;  3F0N A;  4IFD C;  3B4T A;  3JAM C;  4PU9 A;  1HNW I;  3ADG A;  1ZM2 A;  2LTR A;  4J3D A;  2NUF A;  2LCE A;  1IBL E;  4LF6 E;  4JI2 I;  2EN4 A;  4FW6 A;  2EPO A;  4R2E A;  4ZYE A;  1IBM I;  2C39 A;  2V89 A;  5C0X A;  5LL6 R;  2CZ9 A;  5KL4 A;  1GQE A; 
#chains in the Genus database with same CATH homology
 4JI8 E;  3VK6 A;  1D6T A;  1KKH A;  2LRS A;  4K0K I;  1X49 A;  2LUP B;  4I8O A;  3J81 C;  1SR9 A;  2UUA I;  1Z0G A;  2Z5C A;  2R3V A;  3QT8 A;  2O1V A;  4LF4 E;  1FWL A;  4DV2 I;  1DAR A;  3LTO A;  3ZZ0 A;  3H4L A;  5IWA E;  4DV5 I;  2UXD I;  2RS6 A;  2JWO A;  3ZZT A;  2E5L I;  1QZR A;  4LFB I;  3PYF A;  2E5L E;  3H09 A;  3RMP A;  2V8Q B;  3QT6 A;  4GEQ B;  2NUE A;  3IWD A;  4JI6 I;  4WUD A;  4DV4 I;  4JI0 E;  1XNR E;  3K17 A;  2WW4 A;  4B3M E;  4DV0 I;  4JV5 I;  4F54 A;  2VQF I;  1UHZ A;  1N32 I;  3P1X A;  4JI7 E;  3V5R A;  4P78 A;  3ADL A;  2O1U A;  4Z7C A;  4TUG A;  1BKN A;  2K4V A;  3WU4 A;  4DUZ E;  1K47 A;  3DF6 A;  2HK3 A;  1T4N A;  1O0W A;  4UT4 A;  1N36 E;  3DJW A;  2B3T B;  2A2C A;  3K1J A;  1N33 E;  2UXC E;  4JI1 E;  2JOX A;  4YY3 E;  2L2K B;  2IHR 1;  1OJ4 A;  2KHX A;  1HK7 A;  2L33 A;  1XNQ E;  3T1Y I;  3JU0 A;  2FTX B;  2HKJ A;  4HXZ A;  1Z5A A;  4B3S E;  2V2Z A;  4DV3 I;  2B9D A;  5AE2 A;  5LMU I;  4DV3 E;  3HXL A;  2UXB I;  4DR1 I;  1KIJ A;  1ZXN A;  4Q28 A;  4DR1 E;  5A2Q Q;  4WSP A;  2UU9 I;  4LFA I;  2L2M A;  4F9A B;  2M4I A;  4X62 E;  1Y4U A;  1FNM A;  2Q2E B;  4DMI A;  1FWK A;  2MC6 A;  4HAC A;  3WU3 A;  4R1F A;  1Z0E A;  4DR2 E;  3CWV A;  4DV7 E;  4DR3 E;  1PVG A;  1QU6 A;  2DB2 A;  4DU7 A;  1FJG I;  4YHH I;  4B3T I;  2KON A;  4KHP E;  4AQY E;  1A6F A;  1EA6 A;  2G7H A;  4YHH E;  4KQV A;  4IZJ B;  2NUG A;  4IZJ D;  3D4J A;  1Y6Z A;  5CFF E;  2O1W A;  4URL A;  5DNY A;  2O1T A;  1X48 A;  1NHI A;  4LF8 E;  2VF3 A;  1MG7 A;  3OTO I;  5LMN I;  2XEX A;  3C4T A;  1HNZ E;  4DV6 I;  5LMN E;  1J5E E;  3WU5 A;  5IT9 C;  1T4L B;  1NHH A;  4LFC I;  4DR5 I;  2B7T A;  1KVK A;  3JAM Q;  1RC7 A;  4LFC E;  1WHN A;  2IOP A;  2CGE A;  3M6A A;  3HPZ A;  1HNW E;  2IOQ A;  1Z0C A;  4JI2 E;  1IBM E;  2WZO A;  4XTJ A;  4DR7 I;  5AAS A;  4DV1 I;  3LPS A;  1Z0B A;  4JI4 I;  2X7I A;  2N3G A;  3T1H I;  3Q6M A;  1EKZ A;  2V8P A;  4X8W A;  4PRX A;  4LU9 A;  4F9B B;  1USU A;  4GKK I;  3J81 Q;  4K0K E;  1N34 I;  2ODR D;  5BR8 I;  2DMY A;  1N0V C;  4M0V A;  2UUA E;  2F8B A;  2FV4 B;  3VYY A;  1T4O A;  1UIL A;  4DV2 E;  2LJH A;  1ZM3 A;  4NXM I;  2E1M A;  4USM A;  4DV5 E;  4FWH A;  3LML A;  2UXD E;  4M1K A;  4GKJ I;  4WUC A;  1IBK I;  3J7A M;  2LUQ A;  1XMO I;  4LFB E;  3PYG A;  1PKP A;  3ZKB A;  1RR9 A;  2OI2 A;  4FW9 A;  4JI6 E;  2JR1 A;  2UUB I;  1ZBQ A;  1H7S A;  1XMQ I;  4DV4 E;  2AJ4 A;  3V2U C;  5GME A;  4DV0 E;  4JV5 E;  2VQF E;  1N32 E;  4KZS A;  1N0U A;  3VYX A;  4X66 I;  3PYE A;  4IZK A;  1NHJ A;  2V83 A;  4BCA A;  4DXL A;  2VF1 A;  3Q1Q A;  5FLX C;  1WXR A;  3J80 C;  2R42 A;  3ADI A;  2DSY A;  3B78 A;  2ZBK B;  1X47 A;  2EWL A;  3QT5 A;  5L3J A;  4NXN I;  3T1Y E;  2BV3 A;  2RTX A;  2V88 A;  3C4B A;  1B63 A;  2Z5B A;  4LF5 I;  5LMU E;  2DEJ A;  1H7U A;  2UXB E;  4F9C B;  4L8N A;  4M30 A;  4OX9 I;  1YYW A;  4HAC B;  2L8T A;  4P7A A;  5AE3 A;  2UUC I;  2ZM6 I;  2RSM A;  2UU9 E;  4LFA E;  1PIE A;  4LF7 I;  2UUC E;  4JYA I;  1ELO A;  4X65 I;  2LBS B;  3HJC A;  4MYU A;  2M7Q A;  1EI1 A;  2GQ0 A;  1MU5 A;  2L3J A;  1ZM9 A;  1FJG E;  3MSW A;  4LF9 I;  4B3T E;  2DIX A;  2NA2 A;  1YZ9 A;  4DUY I;  4LF9 E;  1FKA E;  4DR4 I;  2VQE I;  4P52 A;  4FN5 A;  4DR4 E;  1J26 A;  2M1S A;  2F4V I;  1I94 I;  3OTO E;  5IT9 Q;  4JI5 I;  4DV6 E;  1Z0W A;  1MX0 A;  4DR6 I;  4X64 I;  2NPF A;  4DR5 E;  2LTS A;  4BC9 A;  3ADJ A;  1HR0 I;  1XHK A;  4P7D A;  2HHH I;  5AE1 A;  2LJP A;  5FWK A;  3AUZ A;  2Z5C B;  3Q6N A;  3K85 A;  1B62 A;  3HQ1 A;  2YT4 A;  4DR7 E;  1H73 A;  2HKE A;  4BC7 A;  4Z7Y A;  2EZ6 A;  4DV1 E;  4JI4 E;  4M2Z A;  2L92 A;  3T1H E;  3PYD A;  1ZM4 A;  1S16 A;  4GKK E;  4USK A;  4R03 A;  1IBL I;  4LF6 I;  1N34 E;  5BR8 E;  2B7V A;  2E1R A;  1KTV A;  4WYQ B;  4BMJ A;  4JI8 I;  2HK2 A;  4DU8 A;  2L3C A;  2MC5 A;  4NXM E;  3WU6 A;  3GON A;  3J7Y p;  4GKJ E;  3F6G A;  1IBK E;  3IWB A;  1XMO E;  1Z59 A;  2N3H A;  4LF4 I;  3LNU A;  4EMD A;  4DPW A;  3ZOQ B;  1S4E A;  5IWA I;  3PRY A;  4IZK B;  3B8H A;  2UUB E;  2V87 A;  4ED4 A;  2JY9 A;  1XMQ E;  2YZT A;  2V86 A;  4OOG C;  4N3O A;  1Z0V A;  2PNM A;  4L5N C;  2FGG A;  4X66 E;  1NZ0 A;  5FLX Q;  4R8O A;  4B3R I;  4HYM A;  4JI0 I;  1XNR I;  5ADZ A;  3J80 Q;  4B3M I;  4B3R E;  3P06 A;  1H74 A;  4JI7 I;  2HFU A;  2Z5B B;  5F3W A;  2X36 A;  3OML A;  2HFS A;  4DPY A;  3J7A G;  4DUZ I;  2CPN A;  1VIS A;  3ZZU A;  4NXN E;  4FWD A;  1Y4S A;  1N36 I;  1STU A;  1YYO A;  4TUI A;  2BM1 A;  2V34 A;  4DPT A;  1N33 I;  2UXC I;  4JI1 I;  4YY3 I;  3ZKD A;  4LF5 E;  4UTG A;  2JOB A;  1DQ3 A;  1XNQ I;  3IWC A;  4OX9 E;  2ZIT A;  4FWG A;  5GMD A;  5T6J A;  2LE2 A;  2ZM6 E;  4B3S I;  1RRE A;  3HTX A;  4LF7 E;  4WPY A;  2J7K A;  1ZBT A;  1U2R A;  1WHQ A;  3K6Q A;  4JYA E;  1Z5C A;  2BM0 A;  4X65 E;  4BS9 A;  2DEI A;  2L2N A;  4J8Z A;  3FIG A;  1GZ6 A;  5A2Q C;  3AV0 A;  2Z5E A;  4X62 I;  3F6H A;  1HNX I;  2VE7 C;  2MDR A;  2PNL A;  1USV A;  2V85 A;  1ZXM A;  1HNX E;  4DUY E;  2V2Q A;  4WUB A;  1Z0T A;  2LMZ A;  2VQE E;  4DR2 I;  2GS8 A;  3KWR A;  4BBY A;  2F4V E;  2CG9 A;  4DV7 I;  4RPF A;  4DR3 I;  1I94 E;  1Z5B A;  2KOU A;  1DI2 A;  4JI5 E;  3QT7 A;  4JG4 A;  4KHP I;  4AQY I;  4DPU A;  3HPS A;  4DR6 E;  3B82 A;  1WUU A;  4X64 E;  4DPX A;  2RS7 A;  4ZVI A;  4LTY A;  1FI4 A;  2V2V A;  4LF8 I;  1UEK A;  1HR0 E;  3JTZ A;  2ODR C;  3LLH A;  1RQ0 A;  2HHH E;  1HNZ I;  2L6M A;  4MYT A;  4JI3 I;  1H72 C;  1J5E I;  4DKK A;  4JI3 E;  4WFT A;  2A2D A;  4IZJ A;  3ZM7 A;  2EFG A;  3HUL A;  4HY1 A;  1YYK A;  2JVA A;  2H36 X;  4I3H A;  4PRV A;  3F0N A;  4PU9 A;  3JAM C;  1HNW I;  3ADG A;  1ZM2 A;  2LTR A;  2NUF A;  1IBL E;  4LF6 E;  4JI2 I;  1IBM I;  2V89 A;  5LL6 R;  2CZ9 A;  1GQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...