4DV4E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4E02
4KHPE 4LFBE 4DR2E 3QT5A 1UHZA 2E5LE 1WHQA 3B82A 2V2QA 4USKA 4DV6I 3J81C 4LF7I 2OI2A 2LTSA 1MX0A 1H72C 1DARA 4GKJI 1RC7A 1ZM3A 1N36I 1N0UA 3K17A 4JI4E 1ELOA 3B8HA 3WU6A 2B7VA 2HFSA 3ZZTA 2HHHI 1B63A 4OX9I 1FJGI 2UUCE 3K1JA 4JYAE 1ZXNA 1N32E 4DV5E 2ZM6E 2F4VI 2XEXA 4R1FA 1D6TA 4DU8A 1KTVA 1XNRE 4XTJA 4DV5I 4LF8E 1Z5AA 2UUBE 5CFFE 2X7IA 1J5EE 1XNRI 1ZM9A 1Z59A 5LMNI 3T1HE 4DPXA 2HK2A 5GMDA 4JI1E 1J5EI 4DV3E 2A2DA 2N3HA 2AJ4A 4DU7A 3T1HI 1S16A 3ZZ0A 4EMDA 1GQEA 4WUBA 4JV5E 4DV7E 4JI1I 4DV3I 4DPWA 4JI0I 1Z0CA 4KQVA 5LMUE 3ZZUA 3T1YE 4DV1I 4DUZI 3ADGA 4DR7E 1H7UA 1IBLI 4DV4E 4HY1A 3QT8A 1H7SA 4B3TE 1T4OA 4LF6E 4FN5A 4WUDA 1T4LB 4DV4I 2GS8A 5BR8E 1MU5A 1Z0EA 2B3TB 1QU6A 4LF4E 1XHKA 4LF9I 4WYQB 2UXBI 2UXCI 4YY3E 3HULA 2LTRA 1IBME 4JI6E 3F0NA 3QT6A 5A2QQ 2LUQA 4DV6E 1IBKI 2MDRA 2L33A 4LF7E 1IBMI 1PKPA 3QT7A 1OJ4A 1S4EA 2BV3A 4JI3I 4YHHE 4GKJE 4WFTA 1N36E 2L3CA 1B62A 3PYDA 2NA2A 1RR9A 4X8WA 3D4JA 4YHHI 3OTOI 3VYXA 1RREA 3ZKDA 1T4NA 2HHHE 3V2UC 4OX9E 4DUYI 1FJGE 2HFUA 5GMEA 3C4BA 1ZXMA 1YZ9A 2LJHA 4UTGA 4AQYI 2F4VE 2BM1A 4NXMI 3HTXA 4GKKE 1N33I 2LJPA 2NPFA 3M6AA 1Z5BA 1HNZE 4Z7CA 3ADIA 4GKKI 1X49A 3H4LA 4FW9A 2CZ9A 4DR3I 4X65I 5LMNE 1YYWA 2LBSB 1HNZI 3ZKBA 4DR6I 1U2RA 4M1KA 4LFCI 1H73A 1KIJA 3ADLA 3V5RA 1I94I 2VQEI 4JI0E 2ZITA 1UEKA 4JI8I 4DR4I 4DV1E 1XMQI 4DUZE 3VYYA 1IBLE 1J26A 2A2CA 2VF3A 4MYUA 3LNUA 2ZBKB 4K0KI 4PU9A 1KVKA 1ZBTA 4LFAI 4B3SI 3GONA 2RS6A 4DV0E 2DB2A 4X66E 1Z0WA 4HYMA 2NUGA 2DMYA 4LF9E 4Z7YA 4B3ME 1WHNA 4DV0I 2UXBE 4X66I 4LF5I 1YYKA 2UXCE 1XMOE 4B3RI 2L2NA 3ADJA 4B3MI 2BM0A 1XNQI 2X36A 2EFGA 1STUA 2B7TA 2UUAI 5IT9Q 4X64I 1XMOI 2L2MA 4DR5E 1K47A 1Z0TA 1Z0GA 1ZM2A 4JI3E 5L3JA 4URLA 4DXLA 4DR5I 2VQFI 1RQ0A 4HACB 3OTOE 2L2KB 1EI1A 1PIEA 1N34E 4JI7I 1HR0I 2UXDI 4OOGC 4DUYE 3PYEA 1FKAE 2CPNA 1FI4A 4HACA 4AQYE 4PRXA 1N34I 1WUUA 2NUFA 4DR1I 4FWGA 4NXME 3WU4A 1EKZA 2N3GA 2RTXA 3CWVA 1N33E 3J80Q 1FWLA 4WUCA 1HNWI 3B78A 4JG4A 4KHPI 4P7AA 4LFBI 4DR2I 2DIXA 2E5LI 2R42A 1N0VC 2V2VA 4DR3E 1Z0VA 4X65E 3J7Yp 4JI5E 2DEJA 2HK3A 2LRSA 4DR6E 4DKKA 1MG7A 4ZVIA 4P52A 4LFCE 4JI2E 2HKJA 4ED4A 4JI5I 3C4TA 3J7AM 2R3VA 5FLXQ 1I94E 2VQEE 4RPFA 2KHXA 5IT9C 4JI4I 3J7AG 2E1RA 4JI2I 1UILA 2L3JA 4JI8E 1NHIA 4DR4E 5A2QC 4DV2E 1XMQE 1EA6A 1X48A 2UUCI 3JAMQ 4JYAI 1YYOA 2JVAA 2J7KA 1N32I 1A6FA 4JI6I 2ZM6I 2Q2EB 2V2ZA 4DV2I 1FWKA 2EZ6A 4K0KE 1X47A 4LFAE 4NXNE 4B3SE 1O0WA 1NHHA 4LF8I 1H74A 2UUBI 1BKNA 2HKEA 1Z0BA 4NXNI 3J81Q 2RS7A 4LF5E 1NZ0A 3WU5A 1NHJA 3J80C 2RSMA 4B3RE 1DI2A 4FWDA 1XNQE 3P1XA 2UUAE 4M30A 4X64E 4JV5I 4DV7I 4HXZA 1VISA 2NUEA 2DEIA 5LMUI 4MYTA 3T1YI 1QZRA 1FNMA 4I3HA 4DR7I 1Z5CA 5LL6R 2VQFE 5FLXC 1ZM4A 2JY9A 2V34A 4B3TI 4LF6I 4PRVA 4USMA 3PYGA 4JI7E 5IWAE 1HR0E 2UXDE 5BR8I 2IHR1 3LPSA 3LTOA 2WW4A 3JAMC 2LUPB 4X62E 1HNXE 4FWHA 2UU9E 4UT4A 5IWAI 4DR1E 1IBKE 3Q1QA 2YT4A 1KKHA 4LF4I 4DPYA 4M2ZA 1PVGA 2V8PA 3LLHA 4YY3I 4X62I 3WU3A 1HNXI 1HNWE 2UU9I 3ZM7A 4DPUA 4DPTA 3PYFA
chains in the Genus database with same CATH superfamily
4KHPE 4LFBE 2V87A 4DR2E 1PDAA 1UHZA 5TSEA 2E5LE 3QT5A 3AV0A 1WHQA 2EOZA 2V2QA 3B82A 4N3OA 4USKA 2EM7A 2YTQA 2YSPA 4DV6I 3J81C 5T6JA 4AIMA 5C0XC 1MGTA 4LF7I 2OI2A 2EMLA 2Z5BA 2YU5A 2FGGA 4ZYGA 4J8ZA 4ZYHA 3P76A 3L00A 4IFDD 2LTSA 1MX0A 2DGCA 1HK7A 1A1GA 2MKDA 1H72C 2RPCA 3ZOQB 1DARA 2O1UA 4GKJI 1RC7A 2EPCA 1ZM3A 4MDTA 5K36D 2EM0A 4NBQA 1N36I 1N0UA 3K17A 2EWLA 2MC6A 4ISAA 2R76A 4JI4E 2VRDA 1ELOA 3B8HA 4F6NA 3WU6A 1AH5A 5DNLA 4ZYDA 2B7VA 2HFSA 3ZZTA 2EMYA 2F1DA 1GZ6A 3BF2A 2HHHI 1B63A 3THOB 4IFDB 4NHRA 3K85A 5EKWA 2FTXB 4R2RA 2EQ0A 4OX9I 1FJGI 2LCEA 2UUCE 3K1JA 2EN4A 2EMGA 2D9HA 2EQ3A 5K36B 4JYAE 1ZXNA 5F3WA 1N32E 2DLQA 2EPMX 4DV5E 2ZM6E 5KL3A 2F4VI 4I8OA 2XEXA 2ELYA 2EOYA 4F54A 4R1FA 2ENHA 3Q6NA 1RHYA 4IZJD 1D6TA 3CDJA 4DU8A 1KTVA 1XNRE 4XTJA 3C6MA 4DV5I 4Q28A 2E72A 4N4RB 4LF8E 1Z5AA 3PS3A 2ENAA 2UUBE 5DRPA 5CFFE 2X7IA 1R6MA 2HC5A 3TQMA 1J5EE 4OO1D 2BA0D 1VI7A 1XNRI 1ZM9A 1SR9A 2O1TA 2EMWA 1Z59A 1EH8A 3T1HE 4QNKA 4DPXA 5LMNI 2HK2A 2EMIA 2ENCA 2EM2A 1IMUA 2EPOA 3M85G 5GMDA 2N8XA 4F6MA 4JI1E 3MSWA 2PNZB 4DV3E 1J5EI 4IFDC 2YTJA 1PJQA 2A2DA 2M9AA 2N3HA 2EPAA 4F2JC 2I13A 2AJ4A 4DU7A 1RMDA 3T1HI 5K36C 1YHCA 1S16A 3ZZ0A 2M4IA 3P3GA 2EORA 2CGEA 2O1WA 4OO1B 2EMHA 4EMDA 2YRHA 1GQEA 2EQ1A 5JEAD 5AASA 4WUBA 4JV5E 4DV7E 4JI1I 5IV8B 4DV3I 4DPWA 4JI0I 2PNZA 1Z0CA 1BB8A 4KQVA 3UHMA 1KJKA 2EPRA 5LMUE 1Y6ZA 3ZZUA 3T1YE 4DV1I 2JWOA 3HPSA 4DUZI 2PO0B 3QG5C 2EOMA 3ADGA 2EM8A 4DR7E 4R2PA 3DF6A 1H7UA 1IBLI 2YRKA 4R03A 4DV4E 4P78A 4HY1A 1IQOA 3HKMA 2V89A 1A1KA 4WPYA 3QT8A 1UDNA 5JEAB 1H7SA 3MHSC 2C37A 5AC4A 2YSOA 5A6AA 4B3TE 2O3ZA 1T4OA 2EOQA 5DRRA 1A1HA 4LF6E 4FN5A 1OYRA 3F6HA 2PO0A 1T4LB 2PNMA 3BGHA 4WUDA 4DV4I 2GS8A 2WP8B 2J7JA 2EMZA 5BR8E 2JOXA 4R2SA 4LOMA 5C0XB 2DLKA 1MU5A 4LCHA 2EOSA 5JEAA 1Z0EA 2B3TB 2WCC3 2EJ4A 2JEBA 1QU6A 2EM3A 1BBGA 4U3DA 3FIGA 2EPUA 4OO1C 4LF4E 4M9VC 1XHKA 4LF9I 2B9DA 2MKNA 4WYQB 3H09A 5C0XA 2UXBI 1ZU1A 4MU1A 4YY3E 3HULA 2UXCI 2LTRA 3KWRA 4GEQB 1IBME 4JI6E 3M85D 4LTYA 1YPNA 2EPXA 3BBGA 1E3PA 4ZYEA 3F0NA 4L8NA 2KOUA 1ZAAC 3QT6A 1L4SA 4O24A 5A2QQ 2LUQA 4LU9A 1G2FC 4DV6E 1IBKI 2ELZA 2BB8A 2MDRA 4P7DA 2L33A 2LMZA 5LLQA 5JEAC 4LF7E 1IBMI 1PKPA 3QT7A 1UN6B 4IJDA 2LT7A 1OJ4A 1OYPA 4FW5A 2EOXA 1A1FA 1S4EA 3CDIA 2BV3A 4JI3I 4YHHE 4GKJE 4M0VA 2EMBA 4WFTA 2YTDA 1N36E 4R2EA 2YU8A 2L3CA 1B62A 1G2DC 3PYDA 2NA2A 3VK6A 1RR9A 1GTKA 4X8WA 3OMLA 3HPZA 2WBSA 3D4JA 4YHHI 4WXDA 3OTOI 1TN9A 3VYXA 3PRYA 2EL6A 5A69A 1RREA 3ZKDA 1T4NA 2HHHE 4BA1B 3V2UC 4F9CB 2V88A 3AUZA 2YZTA 3IWBA 2HGHA 4OX9E 2LJUA 3C4BA 1FJGE 2HFUA 5GMEA 2A25A 2RSIA 1YZ9A 1ZXMA 2J65A 3B4TA 2JPAA 3KZYA 1UDQA 2LJHA 4UTGA 4AQYI 5DROA 2F4VE 2BM1A 2NABA 4NXMI 3HTXA 4BA1A 5A6KA 4GKKE 4R2DA 2JE6B 3P06A 2FV4B 5A6JA 1N33I 2Z5CB 2V83A 2GQ0A 2LJPA 5DRQA 3M7NG 2EN6A 1YFHA 2NPFA 3F6GA 3M6AA 1Z5BA 4AM3A 1HNZE 1Y4UA 5C0XE 4Z7CA 2EPPA 4IFDA 3ADIA 1DQ3A 1Z1BA 1F2IG 4GKKI 2NN6D 3U1YA 1X49A 1P47A 2EMCA 3H4LA 2EP3A 4FW6A 4FW9A 5K36A 2CZ9A 2Z5CA 4DR3I 4X65I 5LMNE 1YYWA 1N3GA 2LBSB 1HNZI 3ZKBA 2EPKX 3P3CA 4DR6I 4BHCA 4X9JA 1U2RA 2EM9A 2IERA 2EE8A 1EH6A 2GPIA 4M1KA 4LFCI 1X6FA 1H73A 5AC5A 1KIJA 3ADLA 3V5RA 1B69A 3KZZA 4IZJB 2NN6B 2VE7C 2WNRB 2V8QB 4F9AB 2VQEI 1I94I 4WSGA 3P3EA 5KL6A 4JI0E 3MHHC 2M7QA 2ZITA 1OYSA 2GO4A 1UEKA 2EL5A 4JI8I 4U3BA 4DR4I 4DV1E 2EN7A 1XMQI 4DUZE 4IZJA 2NN6A 2WNRA 3VYYA 2EPNA 3EQ1A 1IBLE 1J26A 1NEIA 2A2CA 2H36X 1DGCA 2VF3A 4MYUA 2PO1B 2EOIA 2BR2B 3LNUA 1T38A 4MQYA 2EMAA 4F9BB 2ZBKB 4K0KI 2YTGA 4PU9A 4OO1A 4R2QA 4R8OA 3KRNA 4IS9A 2YRMA 1KVKA 1ZBTA 4WX9A 4LFAI 2LE2A 4B3SI 1R6LA 5KL5A 1JK2A 4BA2B 2I9IA 3GONA 2RS6A 2PO1A 2BR2A 4WXCA 2DB2A 4X66E 3UK3C 1KYQA 4DV0E 1Z0WA 4WSPA 2VESA 4HYMA 3M7ND 2NUGA 2JT2A 2BA1G 2NN6C 2JXPA 2DMYA 4LF9E 4IFDE 4Z7YA 4B3ME 4BA2A 1WHNA 4DV0I 2YTOA 2UXBE 4X66I 4LF5I 1YYKA 1X5WA 5K36E 2UXCE 2C39B 2PO2B 4MU0A 1XMOE 5A6BD 4B3RI 3IWCA 4R2AA 2L2NA 2CT1A 2WP8A 3THNA 2PRTA 3ADJA 1X6HA 2WZOA 2GLIA 2BM0A 2YWQA 4B3MI 2X36A 2EFGA 1XNQI 2F8BA 1STUA 4FW7A 2B7TA 2UUAI 1PJSA 2MC5A 4X64I 5IT9Q 2C39A 1XMOI 3BIDA 2PO2A 3EPHA 2EN3A 2L2MA 2YTPA 5KL2A 4DR5E 1K47A 1Z0TA 1Z0GA 1ZM2A 2EMKA 4JI3E 1A1LA 5L3JA 2HJJA 1LLMC 4URLA 3C6KA 4DXLA 4KWYA 4QNJA 4DR5I 5ELWA 5IXMB 2EPLX 2VQFI 1QNTA 3DD6A 2LO3A 1RQ0A 2DMIA 3ECRA 5AE1A 3OTOE 4HACB 2L2KB 5A6BA 3M99B 1EI1A 1PIEA 1N34E 4JI7I 1HR0I 2UXDI 2YPNA 4OOGC 5C0XF 4OZEA 4TUIA 4DUYE 3PYEA 4OO1E 1FKAE 2CPNA 4HEIA 1FI4A 2YTFA 2Z5EA 2IOQA 2JP9A 4HACA 4AQYE 4BBYA 4PRXA 1WUUA 4DUYI 1N34I 2NUFA 4DR1I 2WBUA 4MU3A 3JU0A 4NXME 4FWGA 3WU4A 3DJWA 1EKZA 2IESA 2BA1D 2N3GA 2RTXA 3CWVA 1WRJA 2KONA 2EOEA 1N33E 5KL4A 2MDGA 3J80Q 2EMXA 1FWLA 2YTEA 3K6QA 4WUCA 4OKGA 1HNWI 1ZBQA 4LPFA 3B78A 4JG4A 1XXEA 3H1CA 3PS1A 2BBGA 4FW4A 5JEAE 2JEAB 4KHPI 2EN2A 3JTZA 2EL4A 4P7AA 4DR2I 4LFBI 2DIXA 4KZSA 2E5LI 3HJCA 1EH7A 2E1MA 2K4VA 2R42A 1WXRA 1N0VC 2V2VA 5AE2A 4FW3A 4DR3E 1Z0VA 1PJTA 2M1SA 4X65E 2ADRA 2CTDA 4TUGA 3J7Yp 1P42A 4JI5E 2EOHA 2DEJA 2HK3A 2LRSA 5DNYA 4DR6E 4DMIA 2JEAA 2L6MA 4DKKA 2PNLA 1MG7A 4ZVIA 4P52A 2JE6A 2EM5A 4LFCE 4JI2E 2CVEA 2R1FA 2CG9A 2JR1A 2HKJA 4ED4A 4JI5I 3C4TA 4O4KA 3J7AM 3EPKA 2R3VA 5FLXQ 1I94E 2VQEE 4RPFA 2V86A 2KHXA 5IT9C 3J7AG 4JI4I 4BC7A 1X3CA 4BS9A 2E1RA 2EOFA 2YTIA 4JI2I 1UILA 2EOJA 2VF1A 1A1JA 5KL7A 2L3JA 1NCSA 4R2CA 4JI8E 4DR4E 5A2QC 4DV2E 1XMQE 1EA6A 2DRPA 1NHIA 1Y4SA 1X48A 2EN8A 2UUCI 1UDOA 4LCGA 4BHBA 2YTNA 2WBTA 4MU4A 3JAMQ 4JYAI 1YYOA 1A1IA 2IOPA 2JVAA 2J7KA 3PS2A 3HXLA 1N32I 1A6FA 4JI6I 2ZM6I 4IFDF 2Q2EB 1E3HA 4HTGA 2GHFA 1TF3A 1FWKA 2V2ZA 1YUJA 4DV2I 2EZ6A 1BBOA 4K0KE 5K36F 1X47A 4LFAE 4NXNE 1YSAC 2C38B 4B3SE 5FWKA 1IQSA 1O0WA 1NHHA 3U1KA 4LF8I 1H74A 2O1VA 2UUBI 1BKNA 3PYFA 2HKEA 1WJPA 3RMPA 1Z0BA 1MEYC 4NXNI 4BC9A 3J81Q 3EPLA 3L7ZB 2C38A 2RS7A 4O5GA 1X6EA 2ODRD 2EM6A 1JK1A 4LF5E 3VHTB 3GMEA 1NZ0A 2L8TA 1USUA 1NHJA 2AE8A 3J80C 3WU5A 4L5NC 5ADZA 2RSMA 1AAYA 4B3RE 1DI2A 2LV2A 4FK5C 2GO3A 4BCAA 3L7ZA 2C37B 4FWDA 2NN6F 4NZVA 1XNQE 1Y60A 3P1XA 2UUAE 5C0XD 4M30A 4X64E 4JV5I 4DV7I 1ZR9A 3NZKA 2RQLA 4RHBB 2K7IA 4BMJA 4GZNC 2EOOA 4HXZA 3LMLA 5EL9A 2EN1A 1VISA 4OO1F 2NUEA 2DEIA 5LMUI 3HQ1A 4MYTA 3T1YI 1QZRA 2EMFA 1FNMA 1Y5YA 4I3HA 2JEBB 4IZKB 1USVA 4DR7I 4GQUA 5LL6R 1Z5CA 2CSHA 2JYAA 2VQFE 3EPJA 5FLXC 1TF6A 2LVHA 1ZM4A 2JY9A 2V34A 4B3TI 4LF6I 4PRVA 4AIDA 3Q6MA 4USMA 1YUIA 3PYGA 4IZKA 4JI7E 5IWAE 5DNXA 1HR0E 4Q35B 2UXDE 5JEAF 5BR8I 2IHR1 2L92A 2NN6E 2G7HA 1UDSA 3LPSA 5AE3A 3IWDA 3LTOA 4MLQA 3JAMC 1T39A 2LUPB 2WW4A 3GCMA 4RH8A 1YH8A 4X62E 1HNXE 4FWHA 2UU9E 4J3DA 3GLLA 4UT4A 4LCFA 5IWAI 4DR1E 1IBKE 3Q1QA 1UBDC 2YT4A 1KKHA 4LF4I 2JOBA 4IS1C 4DPYA 2ODRC 4M2ZA 1PVGA 2DSYA 2V85A 2V8PA 1SFEA 3LLHA 2EM4A 2EPZA 4YY3I 4O43A 4X62I 3WU3A 1HNXI 1HNWE 2Z5BB 2UU9I 3ZM7A 2Q8UA 4DPUA 4DPTA 2BA0G 4MLVA
chains in the Genus database with same CATH topology
4KHPE 4LFBE 2V87A 4DR2E 3QT5A 1UHZA 2E5LE 3AV0A 1WHQA 3B82A 2V2QA 4N3OA 4USKA 4DV6I 3J81C 5T6JA 4LF7I 2OI2A 2Z5BA 2FGGA 4J8ZA 2LTSA 1MX0A 1HK7A 1H72C 3ZOQB 1DARA 2O1UA 4GKJI 1RC7A 1ZM3A 1N36I 1N0UA 3K17A 2EWLA 2MC6A 4JI4E 1ELOA 3B8HA 3WU6A 2B7VA 2HFSA 3ZZTA 1GZ6A 2HHHI 1B63A 3K85A 2FTXB 4OX9I 1FJGI 2UUCE 3K1JA 4JYAE 1ZXNA 5F3WA 1N32E 4DV5E 2ZM6E 2F4VI 4I8OA 2XEXA 4F54A 4R1FA 3Q6NA 4IZJD 1D6TA 4DU8A 1KTVA 1XNRE 4XTJA 4DV5I 4Q28A 4LF8E 1Z5AA 2UUBE 5CFFE 2X7IA 1J5EE 1XNRI 1ZM9A 1SR9A 2O1TA 1Z59A 5LMNI 3T1HE 4DPXA 2HK2A 5GMDA 4JI1E 3MSWA 1J5EI 4DV3E 2A2DA 2N3HA 2AJ4A 4DU7A 3T1HI 1S16A 3ZZ0A 2M4IA 2CGEA 2O1WA 4EMDA 1GQEA 5AASA 4WUBA 4JV5E 4DV7E 4JI1I 4DV3I 4DPWA 4JI0I 1Z0CA 4KQVA 5LMUE 1Y6ZA 3ZZUA 3T1YE 4DV1I 2JWOA 3HPSA 4DUZI 3ADGA 4DR7E 3DF6A 1H7UA 1IBLI 4R03A 4DV4E 4P78A 4HY1A 2V89A 4WPYA 3QT8A 1H7SA 4B3TE 1T4OA 4LF6E 4FN5A 4WUDA 3F6HA 1T4LB 2PNMA 4DV4I 2GS8A 5BR8E 2JOXA 1MU5A 1Z0EA 2B3TB 1QU6A 3FIGA 4LF4E 1XHKA 4LF9I 2B9DA 4WYQB 3H09A 2UXBI 2UXCI 4YY3E 3HULA 2LTRA 3KWRA 4GEQB 1IBME 4JI6E 4LTYA 3F0NA 4L8NA 2KOUA 3QT6A 5A2QQ 2LUQA 4LU9A 4DV6E 1IBKI 4P7DA 2MDRA 2LMZA 2L33A 4LF7E 1IBMI 1PKPA 3QT7A 1OJ4A 1S4EA 2BV3A 4JI3I 4YHHE 4GKJE 4M0VA 4WFTA 1N36E 2L3CA 1B62A 3PYDA 2NA2A 3VK6A 1RR9A 4X8WA 3OMLA 3HPZA 3D4JA 4YHHI 3OTOI 3VYXA 3PRYA 1RREA 3ZKDA 1T4NA 2HHHE 3V2UC 4F9CB 2V88A 3AUZA 2YZTA 3IWBA 4OX9E 1FJGE 2HFUA 3C4BA 5GMEA 4DUYI 1ZXMA 1YZ9A 2LJHA 4UTGA 4AQYI 2F4VE 2BM1A 4NXMI 3HTXA 4GKKE 3P06A 2FV4B 1N33I 2Z5CB 2V83A 2GQ0A 2LJPA 2NPFA 3F6GA 3M6AA 1Z5BA 1HNZE 1Y4UA 4Z7CA 3ADIA 1DQ3A 4GKKI 1X49A 3H4LA 4FW9A 2CZ9A 2Z5CA 4DR3I 4X65I 5LMNE 1YYWA 2LBSB 1HNZI 3ZKBA 4DR6I 1U2RA 4M1KA 4LFCI 1H73A 1KIJA 3ADLA 3V5RA 4IZJB 2VE7C 2V8QB 4F9AB 2VQEI 1I94I 4JI0E 2M7QA 2ZITA 1UEKA 4JI8I 4DR4I 4DV1E 1XMQI 4DUZE 4IZJA 3VYYA 1IBLE 1J26A 2A2CA 2H36X 2VF3A 4MYUA 3LNUA 4F9BB 2ZBKB 4K0KI 4PU9A 4R8OA 1KVKA 1ZBTA 4LFAI 2LE2A 4B3SI 3GONA 2RS6A 4DV0E 2DB2A 4X66E 1Z0WA 4HYMA 4WSPA 2NUGA 2DMYA 4LF9E 4Z7YA 4B3ME 1WHNA 4DV0I 2UXBE 4X66I 4LF5I 1YYKA 2UXCE 1XMOE 4B3RI 3IWCA 2L2NA 3ADJA 4B3MI 2WZOA 2BM0A 1XNQI 2X36A 2EFGA 2F8BA 1STUA 2B7TA 2UUAI 2MC5A 5IT9Q 4X64I 1XMOI 2L2MA 4DR5E 1K47A 1Z0TA 1Z0GA 1ZM2A 4JI3E 5L3JA 4URLA 4DXLA 4DR5I 2VQFI 1RQ0A 5AE1A 4HACB 3OTOE 2L2KB 1EI1A 1PIEA 1N34E 4JI7I 1HR0I 2UXDI 4OOGC 4TUIA 4DUYE 3PYEA 1FKAE 2CPNA 1FI4A 2Z5EA 2IOQA 4HACA 4AQYE 4BBYA 4PRXA 1WUUA 1N34I 2NUFA 4DR1I 3JU0A 4NXME 4FWGA 3WU4A 3DJWA 1EKZA 2N3GA 2RTXA 3CWVA 2KONA 1N33E 3J80Q 1FWLA 3K6QA 4WUCA 1HNWI 1ZBQA 3B78A 4JG4A 4KHPI 4P7AA 3JTZA 4LFBI 4DR2I 2DIXA 4KZSA 2E5LI 3HJCA 2E1MA 2K4VA 2R42A 1WXRA 1N0VC 2V2VA 5AE2A 4DR3E 1Z0VA 4X65E 2M1SA 4TUGA 3J7Yp 4JI5E 2DEJA 2HK3A 2LRSA 5DNYA 4DR6E 4DMIA 2L6MA 4DKKA 2PNLA 1MG7A 4ZVIA 4P52A 4LFCE 4JI2E 2HKJA 2CG9A 2JR1A 4ED4A 4JI5I 3C4TA 3J7AM 2R3VA 5FLXQ 1I94E 2VQEE 4RPFA 2V86A 2KHXA 5IT9C 3J7AG 4JI4I 4BC7A 4BS9A 2E1RA 4JI2I 1UILA 2VF1A 2L3JA 4JI8E 1NHIA 4DR4E 5A2QC 4DV2E 1XMQE 1EA6A 1Y4SA 1X48A 2UUCI 3JAMQ 4JYAI 1YYOA 2IOPA 2JVAA 2J7KA 3HXLA 1N32I 1A6FA 4JI6I 2ZM6I 2Q2EB 2V2ZA 4DV2I 1FWKA 2EZ6A 4K0KE 1X47A 4LFAE 4NXNE 4B3SE 5FWKA 1O0WA 1NHHA 4LF8I 1H74A 2O1VA 2UUBI 1BKNA 2HKEA 3RMPA 1Z0BA 4NXNI 4BC9A 3J81Q 2RS7A 2ODRD 4LF5E 1NZ0A 2L8TA 1USUA 1NHJA 3WU5A 3J80C 4L5NC 5ADZA 4B3RE 2RSMA 1DI2A 4FWDA 4BCAA 1XNQE 3P1XA 2UUAE 4M30A 4X64E 4JV5I 4DV7I 4BMJA 4HXZA 3LMLA 1VISA 2NUEA 2DEIA 5LMUI 3HQ1A 4MYTA 3T1YI 1QZRA 1FNMA 4I3HA 4IZKB 1USVA 4DR7I 5LL6R 1Z5CA 2VQFE 5FLXC 1ZM4A 2JY9A 2V34A 4B3TI 4LF6I 4PRVA 3Q6MA 4USMA 3PYGA 4IZKA 4JI7E 5IWAE 1HR0E 2UXDE 5BR8I 2IHR1 2L92A 2G7HA 3LPSA 5AE3A 3IWDA 3LTOA 2WW4A 3JAMC 2LUPB 4X62E 1HNXE 4FWHA 2UU9E 4UT4A 5IWAI 4DR1E 1IBKE 3Q1QA 2YT4A 1KKHA 4LF4I 2JOBA 4DPYA 2ODRC 4M2ZA 1PVGA 2DSYA 2V85A 2V8PA 3LLHA 4YY3I 4X62I 3WU3A 1HNXI 1HNWE 2Z5BB 2UU9I 3ZM7A 4DPUA 4DPTA 3PYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP E;  4LFB E;  4DR2 E;  3QT5 A;  1UHZ A;  2E5L E;  1WHQ A;  3B82 A;  2V2Q A;  4USK A;  4DV6 I;  3J81 C;  4LF7 I;  2OI2 A;  2LTS A;  1MX0 A;  1H72 C;  1DAR A;  4GKJ I;  1RC7 A;  1ZM3 A;  1N36 I;  1N0U A;  3K17 A;  4JI4 E;  1ELO A;  3B8H A;  3WU6 A;  2B7V A;  2HFS A;  3ZZT A;  2HHH I;  1B63 A;  4OX9 I;  1FJG I;  2UUC E;  3K1J A;  4JYA E;  1ZXN A;  1N32 E;  4DV5 E;  2ZM6 E;  2F4V I;  2XEX A;  4R1F A;  1D6T A;  4DU8 A;  1KTV A;  1XNR E;  4XTJ A;  4DV5 I;  4LF8 E;  1Z5A A;  2UUB E;  5CFF E;  2X7I A;  1J5E E;  1XNR I;  1ZM9 A;  1Z59 A;  5LMN I;  3T1H E;  4DPX A;  2HK2 A;  5GMD A;  4JI1 E;  1J5E I;  4DV3 E;  2A2D A;  2N3H A;  2AJ4 A;  4DU7 A;  3T1H I;  1S16 A;  3ZZ0 A;  4EMD A;  1GQE A;  4WUB A;  4JV5 E;  4DV7 E;  4JI1 I;  4DV3 I;  4DPW A;  4JI0 I;  1Z0C A;  4KQV A;  5LMU E;  3ZZU A;  3T1Y E;  4DV1 I;  4DUZ I;  3ADG A;  4DR7 E;  1H7U A;  1IBL I;  4DV4 E;  4HY1 A;  3QT8 A;  1H7S A;  4B3T E;  1T4O A;  4LF6 E;  4FN5 A;  4WUD A;  1T4L B;  4DV4 I;  2GS8 A;  5BR8 E;  1MU5 A;  1Z0E A;  2B3T B;  1QU6 A;  4LF4 E;  1XHK A;  4LF9 I;  4WYQ B;  2UXB I;  2UXC I;  4YY3 E;  3HUL A;  2LTR A;  1IBM E;  4JI6 E;  3F0N A;  3QT6 A;  5A2Q Q;  2LUQ A;  4DV6 E;  1IBK I;  2MDR A;  2L33 A;  4LF7 E;  1IBM I;  1PKP A;  3QT7 A;  1OJ4 A;  1S4E A;  2BV3 A;  4JI3 I;  4YHH E;  4GKJ E;  4WFT A;  1N36 E;  2L3C A;  1B62 A;  3PYD A;  2NA2 A;  1RR9 A;  4X8W A;  3D4J A;  4YHH I;  3OTO I;  3VYX A;  1RRE A;  3ZKD A;  1T4N A;  2HHH E;  3V2U C;  4OX9 E;  4DUY I;  1FJG E;  2HFU A;  5GME A;  3C4B A;  1ZXM A;  1YZ9 A;  2LJH A;  4UTG A;  4AQY I;  2F4V E;  2BM1 A;  4NXM I;  3HTX A;  4GKK E;  1N33 I;  2LJP A;  2NPF A;  3M6A A;  1Z5B A;  1HNZ E;  4Z7C A;  3ADI A;  4GKK I;  1X49 A;  3H4L A;  4FW9 A;  2CZ9 A;  4DR3 I;  4X65 I;  5LMN E;  1YYW A;  2LBS B;  1HNZ I;  3ZKB A;  4DR6 I;  1U2R A;  4M1K A;  4LFC I;  1H73 A;  1KIJ A;  3ADL A;  3V5R A;  1I94 I;  2VQE I;  4JI0 E;  2ZIT A;  1UEK A;  4JI8 I;  4DR4 I;  4DV1 E;  1XMQ I;  4DUZ E;  3VYY A;  1IBL E;  1J26 A;  2A2C A;  2VF3 A;  4MYU A;  3LNU A;  2ZBK B;  4K0K I;  4PU9 A;  1KVK A;  1ZBT A;  4LFA I;  4B3S I;  3GON A;  2RS6 A;  4DV0 E;  2DB2 A;  4X66 E;  1Z0W A;  4HYM A;  2NUG A;  2DMY A;  4LF9 E;  4Z7Y A;  4B3M E;  1WHN A;  4DV0 I;  2UXB E;  4X66 I;  4LF5 I;  1YYK A;  2UXC E;  1XMO E;  4B3R I;  2L2N A;  3ADJ A;  4B3M I;  2BM0 A;  1XNQ I;  2X36 A;  2EFG A;  1STU A;  2B7T A;  2UUA I;  5IT9 Q;  4X64 I;  1XMO I;  2L2M A;  4DR5 E;  1K47 A;  1Z0T A;  1Z0G A;  1ZM2 A;  4JI3 E;  5L3J A;  4URL A;  4DXL A;  4DR5 I;  2VQF I;  1RQ0 A;  4HAC B;  3OTO E;  2L2K B;  1EI1 A;  1PIE A;  1N34 E;  4JI7 I;  1HR0 I;  2UXD I;  4OOG C;  4DUY E;  3PYE A;  1FKA E;  2CPN A;  1FI4 A;  4HAC A;  4AQY E;  4PRX A;  1N34 I;  1WUU A;  2NUF A;  4DR1 I;  4FWG A;  4NXM E;  3WU4 A;  1EKZ A;  2N3G A;  2RTX A;  3CWV A;  1N33 E;  3J80 Q;  1FWL A;  4WUC A;  1HNW I;  3B78 A;  4JG4 A;  4KHP I;  4P7A A;  4LFB I;  4DR2 I;  2DIX A;  2E5L I;  2R42 A;  1N0V C;  2V2V A;  4DR3 E;  1Z0V A;  4X65 E;  3J7Y p;  4JI5 E;  2DEJ A;  2HK3 A;  2LRS A;  4DR6 E;  4DKK A;  1MG7 A;  4ZVI A;  4P52 A;  4LFC E;  4JI2 E;  2HKJ A;  4ED4 A;  4JI5 I;  3C4T A;  3J7A M;  2R3V A;  5FLX Q;  1I94 E;  2VQE E;  4RPF A;  2KHX A;  5IT9 C;  4JI4 I;  3J7A G;  2E1R A;  4JI2 I;  1UIL A;  2L3J A;  4JI8 E;  1NHI A;  4DR4 E;  5A2Q C;  4DV2 E;  1XMQ E;  1EA6 A;  1X48 A;  2UUC I;  3JAM Q;  4JYA I;  1YYO A;  2JVA A;  2J7K A;  1N32 I;  1A6F A;  4JI6 I;  2ZM6 I;  2Q2E B;  2V2Z A;  4DV2 I;  1FWK A;  2EZ6 A;  4K0K E;  1X47 A;  4LFA E;  4NXN E;  4B3S E;  1O0W A;  1NHH A;  4LF8 I;  1H74 A;  2UUB I;  1BKN A;  2HKE A;  1Z0B A;  4NXN I;  3J81 Q;  2RS7 A;  4LF5 E;  1NZ0 A;  3WU5 A;  1NHJ A;  3J80 C;  2RSM A;  4B3R E;  1DI2 A;  4FWD A;  1XNQ E;  3P1X A;  2UUA E;  4M30 A;  4X64 E;  4JV5 I;  4DV7 I;  4HXZ A;  1VIS A;  2NUE A;  2DEI A;  5LMU I;  4MYT A;  3T1Y I;  1QZR A;  1FNM A;  4I3H A;  4DR7 I;  1Z5C A;  5LL6 R;  2VQF E;  5FLX C;  1ZM4 A;  2JY9 A;  2V34 A;  4B3T I;  4LF6 I;  4PRV A;  4USM A;  3PYG A;  4JI7 E;  5IWA E;  1HR0 E;  2UXD E;  5BR8 I;  2IHR 1;  3LPS A;  3LTO A;  2WW4 A;  3JAM C;  2LUP B;  4X62 E;  1HNX E;  4FWH A;  2UU9 E;  4UT4 A;  5IWA I;  4DR1 E;  1IBK E;  3Q1Q A;  2YT4 A;  1KKH A;  4LF4 I;  4DPY A;  4M2Z A;  1PVG A;  2V8P A;  3LLH A;  4YY3 I;  4X62 I;  3WU3 A;  1HNX I;  1HNW E;  2UU9 I;  3ZM7 A;  4DPU A;  4DPT A;  3PYF A; 
#chains in the Genus database with same CATH topology
 4KHP E;  4LFB E;  2V87 A;  4DR2 E;  1PDA A;  1UHZ A;  5TSE A;  2E5L E;  3QT5 A;  3AV0 A;  1WHQ A;  2EOZ A;  2V2Q A;  3B82 A;  4N3O A;  4USK A;  2EM7 A;  2YTQ A;  2YSP A;  4DV6 I;  3J81 C;  5T6J A;  4AIM A;  5C0X C;  1MGT A;  4LF7 I;  2OI2 A;  2EML A;  2Z5B A;  2YU5 A;  2FGG A;  4ZYG A;  4J8Z A;  4ZYH A;  3P76 A;  3L00 A;  4IFD D;  2LTS A;  1MX0 A;  2DGC A;  1HK7 A;  1A1G A;  2MKD A;  1H72 C;  2RPC A;  3ZOQ B;  1DAR A;  2O1U A;  4GKJ I;  1RC7 A;  2EPC A;  1ZM3 A;  4MDT A;  5K36 D;  2EM0 A;  4NBQ A;  1N36 I;  1N0U A;  3K17 A;  2EWL A;  2MC6 A;  4ISA A;  2R76 A;  4JI4 E;  2VRD A;  1ELO A;  3B8H A;  4F6N A;  3WU6 A;  1AH5 A;  5DNL A;  4ZYD A;  2B7V A;  2HFS A;  3ZZT A;  2EMY A;  2F1D A;  1GZ6 A;  3BF2 A;  2HHH I;  1B63 A;  3THO B;  4IFD B;  4NHR A;  3K85 A;  5EKW A;  2FTX B;  4R2R A;  2EQ0 A;  4OX9 I;  1FJG I;  2LCE A;  2UUC E;  3K1J A;  2EN4 A;  2EMG A;  2D9H A;  2EQ3 A;  5K36 B;  4JYA E;  1ZXN A;  5F3W A;  1N32 E;  2DLQ A;  2EPM X;  4DV5 E;  2ZM6 E;  5KL3 A;  2F4V I;  4I8O A;  2XEX A;  2ELY A;  2EOY A;  4F54 A;  4R1F A;  2ENH A;  3Q6N A;  1RHY A;  4IZJ D;  1D6T A;  3CDJ A;  4DU8 A;  1KTV A;  1XNR E;  4XTJ A;  3C6M A;  4DV5 I;  4Q28 A;  2E72 A;  4N4R B;  4LF8 E;  1Z5A A;  3PS3 A;  2ENA A;  2UUB E;  5DRP A;  5CFF E;  2X7I A;  1R6M A;  2HC5 A;  3TQM A;  1J5E E;  4OO1 D;  2BA0 D;  1VI7 A;  1XNR I;  1ZM9 A;  1SR9 A;  2O1T A;  2EMW A;  1Z59 A;  1EH8 A;  3T1H E;  4QNK A;  4DPX A;  5LMN I;  2HK2 A;  2EMI A;  2ENC A;  2EM2 A;  1IMU A;  2EPO A;  3M85 G;  5GMD A;  2N8X A;  4F6M A;  4JI1 E;  3MSW A;  2PNZ B;  4DV3 E;  1J5E I;  4IFD C;  2YTJ A;  1PJQ A;  2A2D A;  2M9A A;  2N3H A;  2EPA A;  4F2J C;  2I13 A;  2AJ4 A;  4DU7 A;  1RMD A;  3T1H I;  5K36 C;  1YHC A;  1S16 A;  3ZZ0 A;  2M4I A;  3P3G A;  2EOR A;  2CGE A;  2O1W A;  4OO1 B;  2EMH A;  4EMD A;  2YRH A;  1GQE A;  2EQ1 A;  5JEA D;  5AAS A;  4WUB A;  4JV5 E;  4DV7 E;  4JI1 I;  5IV8 B;  4DV3 I;  4DPW A;  4JI0 I;  2PNZ A;  1Z0C A;  1BB8 A;  4KQV A;  3UHM A;  1KJK A;  2EPR A;  5LMU E;  1Y6Z A;  3ZZU A;  3T1Y E;  4DV1 I;  2JWO A;  3HPS A;  4DUZ I;  2PO0 B;  3QG5 C;  2EOM A;  3ADG A;  2EM8 A;  4DR7 E;  4R2P A;  3DF6 A;  1H7U A;  1IBL I;  2YRK A;  4R03 A;  4DV4 E;  4P78 A;  4HY1 A;  1IQO A;  3HKM A;  2V89 A;  1A1K A;  4WPY A;  3QT8 A;  1UDN A;  5JEA B;  1H7S A;  3MHS C;  2C37 A;  5AC4 A;  2YSO A;  5A6A A;  4B3T E;  2O3Z A;  1T4O A;  2EOQ A;  5DRR A;  1A1H A;  4LF6 E;  4FN5 A;  1OYR A;  3F6H A;  2PO0 A;  1T4L B;  2PNM A;  3BGH A;  4WUD A;  4DV4 I;  2GS8 A;  2WP8 B;  2J7J A;  2EMZ A;  5BR8 E;  2JOX A;  4R2S A;  4LOM A;  5C0X B;  2DLK A;  1MU5 A;  4LCH A;  2EOS A;  5JEA A;  1Z0E A;  2B3T B;  2WCC 3;  2EJ4 A;  2JEB A;  1QU6 A;  2EM3 A;  1BBG A;  4U3D A;  3FIG A;  2EPU A;  4OO1 C;  4LF4 E;  4M9V C;  1XHK A;  4LF9 I;  2B9D A;  2MKN A;  4WYQ B;  3H09 A;  5C0X A;  2UXB I;  1ZU1 A;  4MU1 A;  4YY3 E;  3HUL A;  2UXC I;  2LTR A;  3KWR A;  4GEQ B;  1IBM E;  4JI6 E;  3M85 D;  4LTY A;  1YPN A;  2EPX A;  3BBG A;  1E3P A;  4ZYE A;  3F0N A;  4L8N A;  2KOU A;  1ZAA C;  3QT6 A;  1L4S A;  4O24 A;  5A2Q Q;  2LUQ A;  4LU9 A;  1G2F C;  4DV6 E;  1IBK I;  2ELZ A;  2BB8 A;  2MDR A;  4P7D A;  2L33 A;  2LMZ A;  5LLQ A;  5JEA C;  4LF7 E;  1IBM I;  1PKP A;  3QT7 A;  1UN6 B;  4IJD A;  2LT7 A;  1OJ4 A;  1OYP A;  4FW5 A;  2EOX A;  1A1F A;  1S4E A;  3CDI A;  2BV3 A;  4JI3 I;  4YHH E;  4GKJ E;  4M0V A;  2EMB A;  4WFT A;  2YTD A;  1N36 E;  4R2E A;  2YU8 A;  2L3C A;  1B62 A;  1G2D C;  3PYD A;  2NA2 A;  3VK6 A;  1RR9 A;  1GTK A;  4X8W A;  3OML A;  3HPZ A;  2WBS A;  3D4J A;  4YHH I;  4WXD A;  3OTO I;  1TN9 A;  3VYX A;  3PRY A;  2EL6 A;  5A69 A;  1RRE A;  3ZKD A;  1T4N A;  2HHH E;  4BA1 B;  3V2U C;  4F9C B;  2V88 A;  3AUZ A;  2YZT A;  3IWB A;  2HGH A;  4OX9 E;  2LJU A;  3C4B A;  1FJG E;  2HFU A;  5GME A;  2A25 A;  2RSI A;  1YZ9 A;  1ZXM A;  2J65 A;  3B4T A;  2JPA A;  3KZY A;  1UDQ A;  2LJH A;  4UTG A;  4AQY I;  5DRO A;  2F4V E;  2BM1 A;  2NAB A;  4NXM I;  3HTX A;  4BA1 A;  5A6K A;  4GKK E;  4R2D A;  2JE6 B;  3P06 A;  2FV4 B;  5A6J A;  1N33 I;  2Z5C B;  2V83 A;  2GQ0 A;  2LJP A;  5DRQ A;  3M7N G;  2EN6 A;  1YFH A;  2NPF A;  3F6G A;  3M6A A;  1Z5B A;  4AM3 A;  1HNZ E;  1Y4U A;  5C0X E;  4Z7C A;  2EPP A;  4IFD A;  3ADI A;  1DQ3 A;  1Z1B A;  1F2I G;  4GKK I;  2NN6 D;  3U1Y A;  1X49 A;  1P47 A;  2EMC A;  3H4L A;  2EP3 A;  4FW6 A;  4FW9 A;  5K36 A;  2CZ9 A;  2Z5C A;  4DR3 I;  4X65 I;  5LMN E;  1YYW A;  1N3G A;  2LBS B;  1HNZ I;  3ZKB A;  2EPK X;  3P3C A;  4DR6 I;  4BHC A;  4X9J A;  1U2R A;  2EM9 A;  2IER A;  2EE8 A;  1EH6 A;  2GPI A;  4M1K A;  4LFC I;  1X6F A;  1H73 A;  5AC5 A;  1KIJ A;  3ADL A;  3V5R A;  1B69 A;  3KZZ A;  4IZJ B;  2NN6 B;  2VE7 C;  2WNR B;  2V8Q B;  4F9A B;  2VQE I;  1I94 I;  4WSG A;  3P3E A;  5KL6 A;  4JI0 E;  3MHH C;  2M7Q A;  2ZIT A;  1OYS A;  2GO4 A;  1UEK A;  2EL5 A;  4JI8 I;  4U3B A;  4DR4 I;  4DV1 E;  2EN7 A;  1XMQ I;  4DUZ E;  4IZJ A;  2NN6 A;  2WNR A;  3VYY A;  2EPN A;  3EQ1 A;  1IBL E;  1J26 A;  1NEI A;  2A2C A;  2H36 X;  1DGC A;  2VF3 A;  4MYU A;  2PO1 B;  2EOI A;  2BR2 B;  3LNU A;  1T38 A;  4MQY A;  2EMA A;  4F9B B;  2ZBK B;  4K0K I;  2YTG A;  4PU9 A;  4OO1 A;  4R2Q A;  4R8O A;  3KRN A;  4IS9 A;  2YRM A;  1KVK A;  1ZBT A;  4WX9 A;  4LFA I;  2LE2 A;  4B3S I;  1R6L A;  5KL5 A;  1JK2 A;  4BA2 B;  2I9I A;  3GON A;  2RS6 A;  2PO1 A;  2BR2 A;  4WXC A;  2DB2 A;  4X66 E;  3UK3 C;  1KYQ A;  4DV0 E;  1Z0W A;  4WSP A;  2VES A;  4HYM A;  3M7N D;  2NUG A;  2JT2 A;  2BA1 G;  2NN6 C;  2JXP A;  2DMY A;  4LF9 E;  4IFD E;  4Z7Y A;  4B3M E;  4BA2 A;  1WHN A;  4DV0 I;  2YTO A;  2UXB E;  4X66 I;  4LF5 I;  1YYK A;  1X5W A;  5K36 E;  2UXC E;  2C39 B;  2PO2 B;  4MU0 A;  1XMO E;  5A6B D;  4B3R I;  3IWC A;  4R2A A;  2L2N A;  2CT1 A;  2WP8 A;  3THN A;  2PRT A;  3ADJ A;  1X6H A;  2WZO A;  2GLI A;  2BM0 A;  2YWQ A;  4B3M I;  2X36 A;  2EFG A;  1XNQ I;  2F8B A;  1STU A;  4FW7 A;  2B7T A;  2UUA I;  1PJS A;  2MC5 A;  4X64 I;  5IT9 Q;  2C39 A;  1XMO I;  3BID A;  2PO2 A;  3EPH A;  2EN3 A;  2L2M A;  2YTP A;  5KL2 A;  4DR5 E;  1K47 A;  1Z0T A;  1Z0G A;  1ZM2 A;  2EMK A;  4JI3 E;  1A1L A;  5L3J A;  2HJJ A;  1LLM C;  4URL A;  3C6K A;  4DXL A;  4KWY A;  4QNJ A;  4DR5 I;  5ELW A;  5IXM B;  2EPL X;  2VQF I;  1QNT A;  3DD6 A;  2LO3 A;  1RQ0 A;  2DMI A;  3ECR A;  5AE1 A;  3OTO E;  4HAC B;  2L2K B;  5A6B A;  3M99 B;  1EI1 A;  1PIE A;  1N34 E;  4JI7 I;  1HR0 I;  2UXD I;  2YPN A;  4OOG C;  5C0X F;  4OZE A;  4TUI A;  4DUY E;  3PYE A;  4OO1 E;  1FKA E;  2CPN A;  4HEI A;  1FI4 A;  2YTF A;  2Z5E A;  2IOQ A;  2JP9 A;  4HAC A;  4AQY E;  4BBY A;  4PRX A;  1WUU A;  4DUY I;  1N34 I;  2NUF A;  4DR1 I;  2WBU A;  4MU3 A;  3JU0 A;  4NXM E;  4FWG A;  3WU4 A;  3DJW A;  1EKZ A;  2IES A;  2BA1 D;  2N3G A;  2RTX A;  3CWV A;  1WRJ A;  2KON A;  2EOE A;  1N33 E;  5KL4 A;  2MDG A;  3J80 Q;  2EMX A;  1FWL A;  2YTE A;  3K6Q A;  4WUC A;  4OKG A;  1HNW I;  1ZBQ A;  4LPF A;  3B78 A;  4JG4 A;  1XXE A;  3H1C A;  3PS1 A;  2BBG A;  4FW4 A;  5JEA E;  2JEA B;  4KHP I;  2EN2 A;  3JTZ A;  2EL4 A;  4P7A A;  4DR2 I;  4LFB I;  2DIX A;  4KZS A;  2E5L I;  3HJC A;  1EH7 A;  2E1M A;  2K4V A;  2R42 A;  1WXR A;  1N0V C;  2V2V A;  5AE2 A;  4FW3 A;  4DR3 E;  1Z0V A;  1PJT A;  2M1S A;  4X65 E;  2ADR A;  2CTD A;  4TUG A;  3J7Y p;  1P42 A;  4JI5 E;  2EOH A;  2DEJ A;  2HK3 A;  2LRS A;  5DNY A;  4DR6 E;  4DMI A;  2JEA A;  2L6M A;  4DKK A;  2PNL A;  1MG7 A;  4ZVI A;  4P52 A;  2JE6 A;  2EM5 A;  4LFC E;  4JI2 E;  2CVE A;  2R1F A;  2CG9 A;  2JR1 A;  2HKJ A;  4ED4 A;  4JI5 I;  3C4T A;  4O4K A;  3J7A M;  3EPK A;  2R3V A;  5FLX Q;  1I94 E;  2VQE E;  4RPF A;  2V86 A;  2KHX A;  5IT9 C;  3J7A G;  4JI4 I;  4BC7 A;  1X3C A;  4BS9 A;  2E1R A;  2EOF A;  2YTI A;  4JI2 I;  1UIL A;  2EOJ A;  2VF1 A;  1A1J A;  5KL7 A;  2L3J A;  1NCS A;  4R2C A;  4JI8 E;  4DR4 E;  5A2Q C;  4DV2 E;  1XMQ E;  1EA6 A;  2DRP A;  1NHI A;  1Y4S A;  1X48 A;  2EN8 A;  2UUC I;  1UDO A;  4LCG A;  4BHB A;  2YTN A;  2WBT A;  4MU4 A;  3JAM Q;  4JYA I;  1YYO A;  1A1I A;  2IOP A;  2JVA A;  2J7K A;  3PS2 A;  3HXL A;  1N32 I;  1A6F A;  4JI6 I;  2ZM6 I;  4IFD F;  2Q2E B;  1E3H A;  4HTG A;  2GHF A;  1TF3 A;  1FWK A;  2V2Z A;  1YUJ A;  4DV2 I;  2EZ6 A;  1BBO A;  4K0K E;  5K36 F;  1X47 A;  4LFA E;  4NXN E;  1YSA C;  2C38 B;  4B3S E;  5FWK A;  1IQS A;  1O0W A;  1NHH A;  3U1K A;  4LF8 I;  1H74 A;  2O1V A;  2UUB I;  1BKN A;  3PYF A;  2HKE A;  1WJP A;  3RMP A;  1Z0B A;  1MEY C;  4NXN I;  4BC9 A;  3J81 Q;  3EPL A;  3L7Z B;  2C38 A;  2RS7 A;  4O5G A;  1X6E A;  2ODR D;  2EM6 A;  1JK1 A;  4LF5 E;  3VHT B;  3GME A;  1NZ0 A;  2L8T A;  1USU A;  1NHJ A;  2AE8 A;  3J80 C;  3WU5 A;  4L5N C;  5ADZ A;  2RSM A;  1AAY A;  4B3R E;  1DI2 A;  2LV2 A;  4FK5 C;  2GO3 A;  4BCA A;  3L7Z A;  2C37 B;  4FWD A;  2NN6 F;  4NZV A;  1XNQ E;  1Y60 A;  3P1X A;  2UUA E;  5C0X D;  4M30 A;  4X64 E;  4JV5 I;  4DV7 I;  1ZR9 A;  3NZK A;  2RQL A;  4RHB B;  2K7I A;  4BMJ A;  4GZN C;  2EOO A;  4HXZ A;  3LML A;  5EL9 A;  2EN1 A;  1VIS A;  4OO1 F;  2NUE A;  2DEI A;  5LMU I;  3HQ1 A;  4MYT A;  3T1Y I;  1QZR A;  2EMF A;  1FNM A;  1Y5Y A;  4I3H A;  2JEB B;  4IZK B;  1USV A;  4DR7 I;  4GQU A;  5LL6 R;  1Z5C A;  2CSH A;  2JYA A;  2VQF E;  3EPJ A;  5FLX C;  1TF6 A;  2LVH A;  1ZM4 A;  2JY9 A;  2V34 A;  4B3T I;  4LF6 I;  4PRV A;  4AID A;  3Q6M A;  4USM A;  1YUI A;  3PYG A;  4IZK A;  4JI7 E;  5IWA E;  5DNX A;  1HR0 E;  4Q35 B;  2UXD E;  5JEA F;  5BR8 I;  2IHR 1;  2L92 A;  2NN6 E;  2G7H A;  1UDS A;  3LPS A;  5AE3 A;  3IWD A;  3LTO A;  4MLQ A;  3JAM C;  1T39 A;  2LUP B;  2WW4 A;  3GCM A;  4RH8 A;  1YH8 A;  4X62 E;  1HNX E;  4FWH A;  2UU9 E;  4J3D A;  3GLL A;  4UT4 A;  4LCF A;  5IWA I;  4DR1 E;  1IBK E;  3Q1Q A;  1UBD C;  2YT4 A;  1KKH A;  4LF4 I;  2JOB A;  4IS1 C;  4DPY A;  2ODR C;  4M2Z A;  1PVG A;  2DSY A;  2V85 A;  2V8P A;  1SFE A;  3LLH A;  2EM4 A;  2EPZ A;  4YY3 I;  4O43 A;  4X62 I;  3WU3 A;  1HNX I;  1HNW E;  2Z5B B;  2UU9 I;  3ZM7 A;  2Q8U A;  4DPU A;  4DPT A;  2BA0 G;  4MLV A; 
#chains in the Genus database with same CATH homology
 4KHP E;  4LFB E;  2V87 A;  4DR2 E;  3QT5 A;  1UHZ A;  2E5L E;  3AV0 A;  1WHQ A;  3B82 A;  2V2Q A;  4N3O A;  4USK A;  4DV6 I;  3J81 C;  5T6J A;  4LF7 I;  2OI2 A;  2Z5B A;  2FGG A;  4J8Z A;  2LTS A;  1MX0 A;  1HK7 A;  1H72 C;  3ZOQ B;  1DAR A;  2O1U A;  4GKJ I;  1RC7 A;  1ZM3 A;  1N36 I;  1N0U A;  3K17 A;  2EWL A;  2MC6 A;  4JI4 E;  1ELO A;  3B8H A;  3WU6 A;  2B7V A;  2HFS A;  3ZZT A;  1GZ6 A;  2HHH I;  1B63 A;  3K85 A;  2FTX B;  4OX9 I;  1FJG I;  2UUC E;  3K1J A;  4JYA E;  1ZXN A;  5F3W A;  1N32 E;  4DV5 E;  2ZM6 E;  2F4V I;  4I8O A;  2XEX A;  4F54 A;  4R1F A;  3Q6N A;  4IZJ D;  1D6T A;  4DU8 A;  1KTV A;  1XNR E;  4XTJ A;  4DV5 I;  4Q28 A;  4LF8 E;  1Z5A A;  2UUB E;  5CFF E;  2X7I A;  1J5E E;  1XNR I;  1ZM9 A;  1SR9 A;  2O1T A;  1Z59 A;  5LMN I;  3T1H E;  4DPX A;  2HK2 A;  5GMD A;  4JI1 E;  3MSW A;  1J5E I;  4DV3 E;  2A2D A;  2N3H A;  2AJ4 A;  4DU7 A;  3T1H I;  1S16 A;  3ZZ0 A;  2M4I A;  2CGE A;  2O1W A;  4EMD A;  1GQE A;  5AAS A;  4WUB A;  4JV5 E;  4DV7 E;  4JI1 I;  4DV3 I;  4DPW A;  4JI0 I;  1Z0C A;  4KQV A;  5LMU E;  1Y6Z A;  3ZZU A;  3T1Y E;  4DV1 I;  2JWO A;  3HPS A;  4DUZ I;  3ADG A;  4DR7 E;  3DF6 A;  1H7U A;  1IBL I;  4R03 A;  4DV4 E;  4P78 A;  4HY1 A;  2V89 A;  4WPY A;  3QT8 A;  1H7S A;  4B3T E;  1T4O A;  4LF6 E;  4FN5 A;  4WUD A;  3F6H A;  1T4L B;  2PNM A;  4DV4 I;  2GS8 A;  5BR8 E;  2JOX A;  1MU5 A;  1Z0E A;  2B3T B;  1QU6 A;  3FIG A;  4LF4 E;  1XHK A;  4LF9 I;  2B9D A;  4WYQ B;  3H09 A;  2UXB I;  2UXC I;  4YY3 E;  3HUL A;  2LTR A;  3KWR A;  4GEQ B;  1IBM E;  4JI6 E;  4LTY A;  3F0N A;  4L8N A;  2KOU A;  3QT6 A;  5A2Q Q;  2LUQ A;  4LU9 A;  4DV6 E;  1IBK I;  4P7D A;  2MDR A;  2LMZ A;  2L33 A;  4LF7 E;  1IBM I;  1PKP A;  3QT7 A;  1OJ4 A;  1S4E A;  2BV3 A;  4JI3 I;  4YHH E;  4GKJ E;  4M0V A;  4WFT A;  1N36 E;  2L3C A;  1B62 A;  3PYD A;  2NA2 A;  3VK6 A;  1RR9 A;  4X8W A;  3OML A;  3HPZ A;  3D4J A;  4YHH I;  3OTO I;  3VYX A;  3PRY A;  1RRE A;  3ZKD A;  1T4N A;  2HHH E;  3V2U C;  4F9C B;  2V88 A;  3AUZ A;  2YZT A;  3IWB A;  4OX9 E;  1FJG E;  2HFU A;  3C4B A;  5GME A;  4DUY I;  1ZXM A;  1YZ9 A;  2LJH A;  4UTG A;  4AQY I;  2F4V E;  2BM1 A;  4NXM I;  3HTX A;  4GKK E;  3P06 A;  2FV4 B;  1N33 I;  2Z5C B;  2V83 A;  2GQ0 A;  2LJP A;  2NPF A;  3F6G A;  3M6A A;  1Z5B A;  1HNZ E;  1Y4U A;  4Z7C A;  3ADI A;  1DQ3 A;  4GKK I;  1X49 A;  3H4L A;  4FW9 A;  2CZ9 A;  2Z5C A;  4DR3 I;  4X65 I;  5LMN E;  1YYW A;  2LBS B;  1HNZ I;  3ZKB A;  4DR6 I;  1U2R A;  4M1K A;  4LFC I;  1H73 A;  1KIJ A;  3ADL A;  3V5R A;  4IZJ B;  2VE7 C;  2V8Q B;  4F9A B;  2VQE I;  1I94 I;  4JI0 E;  2M7Q A;  2ZIT A;  1UEK A;  4JI8 I;  4DR4 I;  4DV1 E;  1XMQ I;  4DUZ E;  4IZJ A;  3VYY A;  1IBL E;  1J26 A;  2A2C A;  2H36 X;  2VF3 A;  4MYU A;  3LNU A;  4F9B B;  2ZBK B;  4K0K I;  4PU9 A;  4R8O A;  1KVK A;  1ZBT A;  4LFA I;  2LE2 A;  4B3S I;  3GON A;  2RS6 A;  4DV0 E;  2DB2 A;  4X66 E;  1Z0W A;  4HYM A;  4WSP A;  2NUG A;  2DMY A;  4LF9 E;  4Z7Y A;  4B3M E;  1WHN A;  4DV0 I;  2UXB E;  4X66 I;  4LF5 I;  1YYK A;  2UXC E;  1XMO E;  4B3R I;  3IWC A;  2L2N A;  3ADJ A;  4B3M I;  2WZO A;  2BM0 A;  1XNQ I;  2X36 A;  2EFG A;  2F8B A;  1STU A;  2B7T A;  2UUA I;  2MC5 A;  5IT9 Q;  4X64 I;  1XMO I;  2L2M A;  4DR5 E;  1K47 A;  1Z0T A;  1Z0G A;  1ZM2 A;  4JI3 E;  5L3J A;  4URL A;  4DXL A;  4DR5 I;  2VQF I;  1RQ0 A;  5AE1 A;  4HAC B;  3OTO E;  2L2K B;  1EI1 A;  1PIE A;  1N34 E;  4JI7 I;  1HR0 I;  2UXD I;  4OOG C;  4TUI A;  4DUY E;  3PYE A;  1FKA E;  2CPN A;  1FI4 A;  2Z5E A;  2IOQ A;  4HAC A;  4AQY E;  4BBY A;  4PRX A;  1WUU A;  1N34 I;  2NUF A;  4DR1 I;  3JU0 A;  4NXM E;  4FWG A;  3WU4 A;  3DJW A;  1EKZ A;  2N3G A;  2RTX A;  3CWV A;  2KON A;  1N33 E;  3J80 Q;  1FWL A;  3K6Q A;  4WUC A;  1HNW I;  1ZBQ A;  3B78 A;  4JG4 A;  4KHP I;  4P7A A;  3JTZ A;  4LFB I;  4DR2 I;  2DIX A;  4KZS A;  2E5L I;  3HJC A;  2E1M A;  2K4V A;  2R42 A;  1WXR A;  1N0V C;  2V2V A;  5AE2 A;  4DR3 E;  1Z0V A;  4X65 E;  2M1S A;  4TUG A;  3J7Y p;  4JI5 E;  2DEJ A;  2HK3 A;  2LRS A;  5DNY A;  4DR6 E;  4DMI A;  2L6M A;  4DKK A;  2PNL A;  1MG7 A;  4ZVI A;  4P52 A;  4LFC E;  4JI2 E;  2HKJ A;  2CG9 A;  2JR1 A;  4ED4 A;  4JI5 I;  3C4T A;  3J7A M;  2R3V A;  5FLX Q;  1I94 E;  2VQE E;  4RPF A;  2V86 A;  2KHX A;  5IT9 C;  3J7A G;  4JI4 I;  4BC7 A;  4BS9 A;  2E1R A;  4JI2 I;  1UIL A;  2VF1 A;  2L3J A;  4JI8 E;  1NHI A;  4DR4 E;  5A2Q C;  4DV2 E;  1XMQ E;  1EA6 A;  1Y4S A;  1X48 A;  2UUC I;  3JAM Q;  4JYA I;  1YYO A;  2IOP A;  2JVA A;  2J7K A;  3HXL A;  1N32 I;  1A6F A;  4JI6 I;  2ZM6 I;  2Q2E B;  2V2Z A;  4DV2 I;  1FWK A;  2EZ6 A;  4K0K E;  1X47 A;  4LFA E;  4NXN E;  4B3S E;  5FWK A;  1O0W A;  1NHH A;  4LF8 I;  1H74 A;  2O1V A;  2UUB I;  1BKN A;  2HKE A;  3RMP A;  1Z0B A;  4NXN I;  4BC9 A;  3J81 Q;  2RS7 A;  2ODR D;  4LF5 E;  1NZ0 A;  2L8T A;  1USU A;  1NHJ A;  3WU5 A;  3J80 C;  4L5N C;  5ADZ A;  4B3R E;  2RSM A;  1DI2 A;  4FWD A;  4BCA A;  1XNQ E;  3P1X A;  2UUA E;  4M30 A;  4X64 E;  4JV5 I;  4DV7 I;  4BMJ A;  4HXZ A;  3LML A;  1VIS A;  2NUE A;  2DEI A;  5LMU I;  3HQ1 A;  4MYT A;  3T1Y I;  1QZR A;  1FNM A;  4I3H A;  4IZK B;  1USV A;  4DR7 I;  5LL6 R;  1Z5C A;  2VQF E;  5FLX C;  1ZM4 A;  2JY9 A;  2V34 A;  4B3T I;  4LF6 I;  4PRV A;  3Q6M A;  4USM A;  3PYG A;  4IZK A;  4JI7 E;  5IWA E;  1HR0 E;  2UXD E;  5BR8 I;  2IHR 1;  2L92 A;  2G7H A;  3LPS A;  5AE3 A;  3IWD A;  3LTO A;  2WW4 A;  3JAM C;  2LUP B;  4X62 E;  1HNX E;  4FWH A;  2UU9 E;  4UT4 A;  5IWA I;  4DR1 E;  1IBK E;  3Q1Q A;  2YT4 A;  1KKH A;  4LF4 I;  2JOB A;  4DPY A;  2ODR C;  4M2Z A;  1PVG A;  2DSY A;  2V85 A;  2V8P A;  3LLH A;  4YY3 I;  4X62 I;  3WU3 A;  1HNX I;  1HNW E;  2Z5B B;  2UU9 I;  3ZM7 A;  4DPU A;  4DPT A;  3PYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...