4DV4E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4E02
2VF3A 1O0WA 4Z7YA 4NXNI 5L3JA 4DV5E 4DR5E 3J81C 4GKKI 4WUBA 2AJ4A 1PKPA 4EMDA 3OTOI 4P7AA 4DUZE 4DR2I 4OX9I 1WUUA 1WHQA 2RS7A 2BV3A 3ZZUA 1Z0EA 1NHHA 4LF5E 2BM0A 4JI0E 1NHJA 4AQYE 4DPTA 1KVKA 2B7TA 2VQFE 4FWGA 4PRXA 1KTVA 5FLXC 4KQVA 3PYDA 4JI4E 4DV2E 3ZZTA 1QU6A 4B3TI 1Z0VA 1Z0CA 1HNWE 2HFSA 1HNZE 2KHXA 1S4EA 1RC7A 3P1XA 2IHR1 4DPWA 1YZ9A 2UUAE 2X36A 4DV5I 4LF7E 1QZRA 1X47A 2Q2EB 4JI1E 4B3ME 2NPFA 1H7UA 1KIJA 3HTXA 4DPYA 2V2VA 2L2NA 4LF5I 1DARA 4JI0I 4JI3E 4AQYI 4JI7E 1EI1A 2VQFI 5IT9C 1ZM4A 2X7IA 4DR4I 5LL6R 2LJHA 4DV2I 1OJ4A 2DEJA 4LF8E 1HNWI 2DIXA 3VYYA 1MU5A 2LBSB 5FLXQ 1I94E 1ZM2A 3JAMQ 1HNZI 4WUDA 3K1JA 2HKEA 1YYKA 4USMA 2E5LE 1XNQE 2UUAI 4JI5E 3WU3A 4PU9A 3LTOA 4LF6E 1H73A 2JY9A 1T4LB 4JI1I 2N3GA 4B3MI 2R42A 4RPFA 4JI3I 1T4NA 2B3TB 2A2DA 4X65E 1H7SA 3ZM7A 4LF9E 4LF8I 1ZBTA 2RTXA 4X8WA 4WFTA 5CFFE 4DR1E 4DV3E 1XHKA 4I3HA 1NZ0A 2L3JA 1I94I 4P52A 4DV1E 1RREA 5GMEA 1FWLA 2HHHE 2E5LI 1XNQI 4DV0E 4JI5I 4X66I 3B8HA 1Z5BA 4LF6I 1J5EE 2V2ZA 2UXBE 4JV5E 3K17A 2DMYA 1EKZA 4ED4A 2LUQA 2YT4A 1H74A 2UXCE 4HYMA 4DXLA 3J7Yp 1X49A 4Z7CA 4HXZA 3JAMC 4M1KA 4B3SE 1MX0A 4DU7A 4X65I 4WUCA 4LF9I 2DB2A 4X64E 4LFBE 2DEIA 2VQEI 1FWKA 4DV3I 2NA2A 1HR0E 4XTJA 4JI8I 4DV1I 1N36E 1ZXNA 1IBKE 4NXME 1Z0TA 4DR5I 2R3VA 4DV0I 3LPSA 3WU5A 4DUZI 1J5EI 1HNXE 4WYQB 2LTRA 3T1HE 1Z0WA 4JI2E 4MYTA 1VISA 2UXBI 1STUA 4B3RE 1BKNA 4MYUA 3WU6A 4X62E 4LFAE 1IBLE 1XNRE 4R1FA 2EFGA 2OI2A 1FI4A 3T1YE 4JI4I 4B3SI 3QT5A 1Z5AA 4M30A 4X64I 4LFBI 5A2QC 1MG7A 3QT8A 1HR0I 2N3HA 1Z5CA 1N36I 2V2QA 3PYGA 1IBKI 1N33E 4NXMI 2LUPB 4LF7I 1GQEA 1Z0BA 2RS6A 2EZ6A 1HNXI 3T1HI 1RQ0A 2XEXA 3CWVA 4JI6E 1U2RA 5BR8E 1N32E 1N0UA 1ZM3A 4DKKA 4B3RI 2ZBKB 4JI7I 3PYFA 2BM1A 1K47A 4X62I 3HULA 4LFAI 4JG4A 1IBLI 2NUGA 1DI2A 1S16A 4LFCE 2HKJA 3J7AG 3T1YI 1YYWA 4DU8A 3D4JA 3H4LA 3ZZ0A 1XMQE 4KHPE 3WU4A 1UILA 4FWDA 4JI6I 1WHNA 4DV7E 1N34E 1J26A 1ELOA 1UHZA 2GS8A 3ZKBA 2E1RA 4GKJE 3F0NA 5A2QQ 2L2KB 2UU9E 2ZITA 1A6FA 2HFUA 2HK3A 3J7AM 3V5RA 3ADJA 5BR8I 2ZM6E 1N32I 2UUBE 4ZVIA 1XMOE 4HY1A 4DPXA 1ZM9A 4LFCI 1XMQI 2CPNA 4DR1I 4KHPI 4DV7I 3ADGA 4DV6E 4UTGA 1N34I 2HHHI 4M2ZA 1PIEA 4OOGC 4YY3E 4DR4E 1RR9A 3ZKDA 4UT4A 3LLHA 4DR6E 4GKJI 3B78A 2HK2A 2UU9I 3LNUA 1FNMA 1ZXMA 4DUYE 2F4VE 1UEKA 2MDRA 1FJGE 2L2MA 4JV5I 1D6TA 2ZM6I 2UXCI 2LJPA 4DR7E 4DR3E 2UUCE 2UUBI 3ADLA 3QT7A 1XMOI 3Q1QA 1X48A 2UXDE 4PRVA 1B63A 2LRSA 3PYEA 1KKHA 3GONA 4DV4E 3QT6A 3J81Q 5LMUE 3ADIA 4FN5A 4LF4E 2L3CA 4DPUA 4YHHE 2CZ9A 2NUEA 2LTSA 4DV6I 5LMNE 1N0VC 2L33A 4FW9A 5IWAE 4YY3I 2NUFA 3J80C 4DR6I 1IBME 2WW4A 4JYAE 4DUYI 2J7KA 2RSMA 3B82A 4JI2I 2F4VI 4K0KE 1T4OA 1EA6A 1FJGI 2V8PA 1Z59A 2JVAA 4FWHA 2A2CA 1Z0GA 4NXNE 4URLA 2B7VA 4USKA 4DR7I 4DR3I 2UUCI 4GKKE 1B62A 3OTOE 1XNRI 4X66E 4DR2E 4OX9E 3VYXA 2UXDI 1FKAE 3C4TA 4HACB 3V2UC 1YYOA 4DV4I 3C4BA 5LMUI 2V34A 3M6AA 1NHIA 4LF4I 1PVGA 4YHHI 1H72C 5LMNI 1N33I 5GMDA 4B3TE 5IWAI 1IBMI 5IT9Q 2VQEE 4JYAI 4K0KI 4JI8E 3J80Q 4HACA
chains in the Genus database with same CATH superfamily
4HEIA 4IFDF 2JE6B 2WP8B 2VF3A 4ZYEA 1O0WA 4Z7YA 1DQ3A 4NXNI 5L3JA 4DV5E 4DR5E 2I9IA 2EN4A 2EM8A 2K4VA 2JT2A 3J81C 5C0XD 4GKKI 1SFEA 3PS1A 4WUBA 2AJ4A 4I8OA 1PKPA 2V87A 3VK6A 4EMDA 5C0XB 1MGTA 4P7AA 3OTOI 4DUZE 1A1FA 4DR2I 4OX9I 2WNRB 1WUUA 5IV8B 2EPMX 1WHQA 2RS7A 2BV3A 4GZNC 4F54A 2JP9A 5C0XC 1PJQA 2YTPA 2JEBB 3ZZUA 5KL6A 1Z0EA 5JEAA 1NHHA 4LF5E 2BM0A 4JI0E 2F8BA 4AQYE 1NHJA 4MU0A 4QNJA 4DPTA 1KVKA 3F6GA 2B7TA 2VQFE 4FWGA 4PRXA 1KTVA 5DNLA 4ZYDA 5FLXC 3JU0A 3EPKA 4LTYA 4AIMA 4KQVA 3PYDA 1UBDC 2WBUA 4JI4E 4DV2E 2YTJA 3ZZTA 1QU6A 2JE6A 4B3TI 3PS2A 2EOSA 2WP8A 1Z0VA 1Z0CA 3CDJA 1HNWE 5K36D 2LE2A 2HFSA 4FW4A 4ISAA 3EQ1A 3THOB 3UK3C 1HNZE 2KHXA 5KL7A 2NN6D 5C0XA 5K36B 2A25A 1S4EA 1RC7A 1UDQA 2WNRA 2NN6B 3P1XA 2Q8UA 2IHR1 4DPWA 1GTKA 2YRMA 5K36C 2EP3A 2HC5A 1YZ9A 2JEBA 2UUAE 2GPIA 1JK1A 2X36A 4DV5I 4LF7E 4P7DA 2ENCA 4IJDA 4LU9A 2EMWA 2YSOA 4R2DA 1QZRA 2EM0A 1YH8A 4BHBA 4FW3A 4OO1D 2BA1D 1X47A 2Q2EB 2YTDA 1A1KA 4NHRA 4JI1E 4B3ME 2CGEA 1BB8A 2NPFA 1H7UA 1KIJA 2CVEA 3P06A 3GCMA 3HTXA 4DPYA 2V2VA 2L2NA 4LF5I 1DARA 2EM7A 4JI0I 3GMEA 3HKMA 4JI3E 5C0XF 4AQYI 1TF3A 3H1CA 4JI7E 3EPHA 1EI1A 3U1KA 2K7IA 2EM9A 1WJPA 5DNYA 5IT9C 2VQFI 1ZBQA 3AV0A 2EPUA 4NZVA 5KL5A 5K36A 1ZM4A 2X7IA 4DR4I 2NN6A 2V88A 5LL6R 2O3ZA 2LJHA 4OZEA 4DV2I 1OJ4A 4L8NA 2DEJA 4LF8E 3Q6MA 1HNWI 4F6NA 2DIXA 3VYYA 1MU5A 2LBSB 4L5NC 1HK7A 5FLXQ 1I94E 1ZM2A 1X6FA 2EOMA 3DF6A 2WBSA 3JAMQ 2DMIA 1HNZI 4WUDA 1E3PA 3K1JA 4LCHA 2BA1G 2HKEA 4OO1A 1YYKA 4USMA 4BA1B 3BF2A 2E5LE 1XNQE 4AM3A 1YHCA 2UUAI 4R03A 4JI5E 3WU3A 4PU9A 1Z1BA 2DGCA 3HPSA 4F6MA 5K36F 3LTOA 4LF6E 3BGHA 1H73A 2EMXA 2GHFA 2EPLX 2V8QB 5A6BD 2GLIA 2JY9A 1T4LB 4JI1I 2N3GA 2EMGA 2J7JA 2R42A 4B3MI 4MU4A 2JWOA 3LMLA 3Q6NA 4KZSA 4R2CA 1GZ6A 2EM4A 3ZOQB 4RPFA 2YTQA 4JI3I 4IZKB 1UDNA 2MKNA 2MDGA 2C38A 2YTIA 1T4NA 2PNZB 4GEQB 3F6HA 2B3TB 2A2DA 2LT7A 2YRHA 3VHTB 4X65E 1H7SA 4BA1A 1YUJA 3ZM7A 3MHSC 2YU8A 4O43A 4LF9E 3BBGA 4LF8I 1ZBTA 2MC5A 2RTXA 1EH6A 4X8WA 3B4TA 4WFTA 2PNLA 5CFFE 2ODRC 4ZYHA 4DV3E 4R2RA 2EJ4A 4DR1E 1NZ0A 1XHKA 4I3HA 2L3JA 1I94I 1Y4UA 1L4SA 4P52A 4DV1E 1RREA 1R6LA 4MU1A 5GMEA 1FWLA 2YSPA 2HHHE 5A6BA 2LVHA 2V83A 2EN8A 4NBQA 2E5LI 1XNQI 2EM2A 4DV0E 4JI5I 2EOZA 1UN6B 2KOUA 3JTZA 2YTFA 1Z5BA 3B8HA 3IWCA 4IZKA 2MC6A 4X66I 1J5EE 1TF6A 3RMPA 4LF6I 2D9HA 3QG5C 2V2ZA 1YUIA 2CSHA 2UXBE 2YU5A 4JV5E 2PNZA 3K17A 2DMYA 1EKZA 5F3WA 5AE1A 4ED4A 2RPCA 2LUQA 2YT4A 1PJTA 1H74A 2UXCE 5ELWA 1NEIA 4HYMA 4DXLA 3J7Yp 5DROA 1UDOA 1X49A 4BHCA 4Z7CA 2EQ0A 2M9AA 4HXZA 3JAMC 2EM3A 4B3SE 4M1KA 2ADRA 1MX0A 1PJSA 2EOOA 4DU7A 5JEAE 4X65I 5EKWA 1EH7A 4WUCA 4BA2B 2CT1A 1DGCA 2PRTA 1R6MA 4LF9I 2DB2A 4ZYGA 4X64E 4F9AB 3EPJA 4LFBE 1VI7A 2JXPA 5A69A 1YFHA 1KYQA 1FWKA 2DEIA 2VQEI 4DV3I 2EWLA 2NA2A 1HR0E 4BS9A 4XTJA 4FW6A 4JI8I 4DV1I 1N36E 1ZXNA 4R2QA 1IBKE 1X6HA 4NXME 1A1GA 3AUZA 1Z0TA 2LV2A 4DR5I 4FK5C 2R3VA 1USVA 2EOQA 4DV0I 3LPSA 4MQYA 2YPNA 4N3OA 3WU5A 2ENAA 4DUZI 2IESA 5KL4A 1J5EI 1HNXE 4WYQB 2LTRA 3T1HE 1IMUA 4JI2E 4O24A 1Z0WA 4O5GA 4MYTA 4WXCA 1VISA 2UXBI 1STUA 3KZYA 4B3RE 1EH8A 4BA2A 2RQLA 1BKNA 3C6MA 2EMKA 5AE3A 4MYUA 2PO0B 4X62E 4LFAE 3WU6A 1IBLE 4MDTA 4F9CB 1XNRE 4R1FA 1A1HA 3HPZA 2EPZA 2I13A 5AC5A 2EFGA 2OI2A 3HJCA 1FI4A 2JEAB 2EOFA 3T1YE 2F1DA 4JI4I 2PO1B 2VESA 4B3SI 3QT5A 1Y4SA 1Z5AA 2IOQA 4LOMA 1RMDA 4M0VA 5EL9A 2V86A 4X9JA 4M30A 4X64I 4HTGA 4LFBI 3PRYA 2GQ0A 2BBGA 5A2QC 1N3GA 4HACA 2LJUA 1MG7A 3QT8A 1HR0I 2N3HA 1Z5CA 2NN6E 1N36I 5IXMB 2V2QA 4U3BA 3PYGA 3L7ZB 1OYRA 1N33E 1USUA 1IBKI 2EMHA 2EOIA 2VRDA 2EPOA 4R2AA 2LUPB 2BR2B 3M85D 4LF7I 1Y6ZA 4BC9A 3IWDA 2V89A 1GQEA 1Z0BA 1A1LA 2RS6A 4F2JC 2PO0A 2EZ6A 4GQUA 4Q35B 3P3EA 2EQ1A 4J8ZA 2PO2B 5A6KA 1HNXI 2JEAA 2VE7C 3T1HI 1RQ0A 4OO1E 2XEXA 3MHHC 3CWVA 2VF1A 3K6QA 4JI6E 1U2RA 5BR8E 4TUGA 2EN3A 1N32E 1N0UA 1ZM3A 2Z5EA 4MLVA 4DKKA 2EMCA 2F4VI 5DRRA 4WX9A 4B3RI 1X6EA 2L92A 2ZBKB 4JI7I 3PYFA 2EL6A 2BM1A 1K47A 4X62I 3HULA 4LFAI 4JG4A 1IBLI 5AASA 1ZU1A 2EL4A 4P78A 2NUGA 2ODRD 1DI2A 1S16A 3MSWA 4LFCE 3J7AG 2C37B 2HKJA 3T1YI 4TUIA 4MU3A 2JR1A 1YYWA 4IFDE 4DU8A 2DLKA 4WSGA 2C39B 3D4JA 2EN2A 3H4LA 3L7ZA 2EPNA 1P47A 3TQMA 1A1JA 3ZZ0A 1XMQE 4KHPE 2BR2A 4O4KA 3M85G 3KZZA 3WU4A 1UILA 4FWDA 1JK2A 4Q28A 1OYSA 1BBOA 2EN1A 1WHNA 2YZTA 4DV7E 1N34E 4JI6I 2PO2A 1J26A 2ENHA 3M7ND 1ELOA 1AAYA 1UHZA 3THNA 4WXDA 5A6JA 1RHYA 2GS8A 2RSIA 2E1RA 2EN7A 2MKDA 4R2SA 4GKJE 3F0NA 3ZKBA 5JEAB 5A2QQ 2L2KB 2UU9E 3M99B 3PS3A 2DRPA 2ZITA 1BBGA 1A6FA 3U1YA 5JEAC 2O1UA 1XXEA 1X5WA 2HFUA 2HK3A 1QNTA 3J7AM 2EMIA 5T6JA 1ZAAC 2C37A 2EOJA 2EORA 4J3DA 3ADJA 3V5RA 2NABA 4LCFA 5BR8I 2V85A 2EPKX 2ZM6E 2C39A 1N32I 2UUBE 4ZVIA 5KL2A 1T39A 1XMOE 2ELYA 2N8XA 4HY1A 2EPAA 5DNXA 1YPNA 1P42A 2BB8A 4DPXA 2M1SA 4F9BB 1ZM9A 1Y5YA 2EMAA 2EM5A 1NCSA 2LCEA 4LFCI 2KONA 4DMIA 2H36X 4IS9A 2Z5BB 3M7NG 1XMQI 2CPNA 4DR1I 4KHPI 2EMFA 2UXCI 1MEYC 2EOHA 2EN6A 3DJWA 3UHMA 2JOXA 1G2DC 2YTGA 4DV7I 3ADGA 4DV6E 4UTGA 1N34I 3BIDA 2HHHI 3H09A 2EMZA 2LMZA 2J65A 4M2ZA 1PIEA 4OOGC 4YY3E 4DR4E 1RR9A 3ZKDA 4UT4A 3LLHA 4DR6E 4LCGA 4LPFA 2JYAA 3B78A 4GKJI 2HK2A 5C0XE 2O1VA 2UU9I 3LNUA 2WZOA 1AH5A 3C6KA 1WXRA 2LO3A 4DUYE 1FNMA 1ZXMA 3CDIA 2F4VE 4AIDA 1UEKA 2MDRA 1FJGE 2L2MA 4JV5I 4BBYA 1KJKA 2PNMA 1D6TA 4RH8A 5JEAF 3IWBA 2DLQA 2EMYA 5AC4A 4IS1C 3P3GA 2ZM6I 2LJPA 4DR7E 4DR3E 1IQSA 2UUCE 3ADLA 3P76A 2UUBI 1B69A 2Z5BA 3QT7A 1XMOI 2R76A 2NN6C 3Q1QA 2EPXA 1FJGI 1X48A 1F2IG 1X3CA 2UXDE 4FW7A 2Z5CB 4PRVA 1IQOA 1B63A 2EMBA 2LRSA 3PYEA 4OO1B 1KKHA 1YSAC 4RHBB 2BA0D 1A1IA 3GONA 2EE8A 4DV4E 2IOPA 3QT6A 2EQ3A 3J81Q 2YRKA 5LMUE 3ADIA 1UDSA 4IZJD 4OO1C 2GO4A 5AE2A 4FN5A 5K36E 4LF4E 2L3CA 2R1FA 4IZJB 2EOEA 4YHHE 2CZ9A 4QNKA 4DPUA 4BMJA 2NUEA 2CTDA 2LTSA 4NXMI 5TSEA 3NZKA 2YTNA 5DRPA 4DV6I 5LMNE 4IFDD 1LLMC 1N0VC 2L33A 2GO3A 2M4IA 1PDAA 5IWAE 4FW9A 4YY3I 2O1TA 2L6MA 2NUFA 4R2PA 3J80C 4FW5A 3K85A 5DRQA 4N4RB 4DR6I 4IFDB 1IBME 2M7QA 3DD6A 4U3DA 2WW4A 3OMLA 1T38A 4IFDC 1OYPA 4JYAE 4DUYI 2YTOA 2RSMA 2EPRA 2J7KA 3B82A 4JI2I 4K0KE 1T4OA 1EA6A 2O1WA 2C38B 2Z5CA 3KWRA 2V8PA 2E1MA 1TN9A 2JVAA 3FIGA 2EPPA 4WPYA 1G2FC 1Z59A 1SR9A 2L8TA 4FWHA 2A2CA 3GLLA 1Z0GA 2HJJA 4NXNE 4URLA 2B7VA 4USKA 4DR7I 4DR3I 2UUCI 4GKKE 2BA0G 2FV4B 1B62A 2EMLA 2G7HA 1WRJA 2JPAA 2EM6A 3OTOE 1XNRI 3ECRA 4X66E 4DR2E 4OX9E 3VYXA 4IZJA 1ZR9A 2E72A 5A6AA 5KL3A 1FKAE 2B9DA 2UXDI 3C4TA 2NN6F 2YTEA 4HACB 2EOXA 1E3HA 3V2UC 2EOYA 4R2EA 2FTXB 4WSPA 3HXLA 1Y60A 2IERA 5ADZA 4KWYA 1YYOA 2EL5A 5FWKA 4DV4I 2YWQA 4M9VC 4IFDA 3C4BA 5LMUI 3KRNA 2PO1A 2V34A 2HGHA 3M6AA 1NHIA 4LF4I 1PVGA 4YHHI 4OKGA 1H72C 5JEAD 2ELZA 2JOBA 4OO1F 2EPCA 5LMNI 1N33I 5GMDA 4MLQA 2DSYA 4B3TE 2FGGA 5IWAI 4R8OA 4BC7A 2WBTA 1IBMI 5LLQA 2CG9A 5IT9Q 3L00A 4BCAA 2VQEE 4JYAI 2AE8A 3P3CA 4K0KI 4JI8E 3J80Q 3HQ1A 2WCC3 3EPLA
chains in the Genus database with same CATH topology
2VF3A 1O0WA 4Z7YA 1DQ3A 4NXNI 5L3JA 4DV5E 4DR5E 2K4VA 3J81C 4GKKI 4WUBA 2AJ4A 4I8OA 1PKPA 2V87A 3VK6A 4EMDA 3OTOI 4P7AA 4DUZE 4DR2I 4OX9I 1WUUA 1WHQA 2RS7A 2BV3A 4F54A 3ZZUA 1Z0EA 1NHHA 4LF5E 2BM0A 4JI0E 2F8BA 4AQYE 1NHJA 4DPTA 1KVKA 3F6GA 2B7TA 2VQFE 4FWGA 4PRXA 1KTVA 5FLXC 3JU0A 4LTYA 4KQVA 3PYDA 4JI4E 4DV2E 3ZZTA 1QU6A 4B3TI 1Z0VA 1Z0CA 1HNWE 2LE2A 2HFSA 1HNZE 2KHXA 1S4EA 1RC7A 3P1XA 2IHR1 4DPWA 1YZ9A 2UUAE 2X36A 4DV5I 4LF7E 4P7DA 4LU9A 1QZRA 1X47A 2Q2EB 4JI1E 4B3ME 2CGEA 2NPFA 1H7UA 1KIJA 3P06A 3HTXA 4DPYA 2V2VA 2L2NA 4LF5I 1DARA 4JI0I 4JI3E 4AQYI 4JI7E 1EI1A 5DNYA 5IT9C 2VQFI 1ZBQA 3AV0A 1ZM4A 2X7IA 4DR4I 2V88A 5LL6R 2LJHA 4DV2I 1OJ4A 4L8NA 2DEJA 4LF8E 3Q6MA 1HNWI 2DIXA 3VYYA 1MU5A 2LBSB 4L5NC 1HK7A 5FLXQ 1I94E 1ZM2A 3DF6A 3JAMQ 1HNZI 4WUDA 3K1JA 2HKEA 1YYKA 4USMA 2E5LE 1XNQE 2UUAI 4R03A 4JI5E 3WU3A 4PU9A 3HPSA 3LTOA 4LF6E 1H73A 2V8QB 2JY9A 1T4LB 4JI1I 2N3GA 4B3MI 2R42A 2JWOA 3LMLA 3Q6NA 4KZSA 1GZ6A 3ZOQB 4RPFA 4JI3I 4IZKB 1T4NA 4GEQB 3F6HA 2B3TB 2A2DA 4X65E 1H7SA 3ZM7A 4LF9E 4LF8I 1ZBTA 2MC5A 2RTXA 4X8WA 4WFTA 2PNLA 5CFFE 2ODRC 4DV3E 4DR1E 1XHKA 4I3HA 1NZ0A 2L3JA 1I94I 1Y4UA 4P52A 4DV1E 1RREA 5GMEA 1FWLA 2HHHE 2V83A 2E5LI 1XNQI 4DV0E 4JI5I 2KOUA 3JTZA 3B8HA 1Z5BA 4IZKA 3IWCA 4X66I 2MC6A 4LF6I 1J5EE 3RMPA 2V2ZA 2UXBE 4JV5E 3K17A 2DMYA 1EKZA 5F3WA 5AE1A 4ED4A 2LUQA 2YT4A 1H74A 2UXCE 4HYMA 4DXLA 3J7Yp 1X49A 4Z7CA 4HXZA 3JAMC 4M1KA 4B3SE 1MX0A 4DU7A 4X65I 4WUCA 4LF9I 2DB2A 4X64E 4F9AB 4LFBE 2DEIA 2VQEI 1FWKA 4DV3I 2EWLA 2NA2A 1HR0E 4BS9A 4XTJA 4JI8I 4DV1I 1N36E 1ZXNA 1IBKE 4NXME 3AUZA 1Z0TA 4DR5I 2R3VA 4DV0I 1USVA 3LPSA 4N3OA 3WU5A 4DUZI 1J5EI 1HNXE 4WYQB 2LTRA 3T1HE 1Z0WA 4JI2E 4MYTA 1VISA 2UXBI 1STUA 4B3RE 1BKNA 5AE3A 4MYUA 3WU6A 4X62E 4LFAE 1IBLE 1XNRE 4R1FA 3HPZA 3HJCA 2EFGA 2OI2A 1FI4A 3T1YE 4JI4I 4B3SI 3QT5A 1Y4SA 1Z5AA 2IOQA 4M0VA 2V86A 4M30A 4X64I 4LFBI 3PRYA 2GQ0A 5A2QC 1MG7A 3QT8A 1HR0I 2N3HA 1Z5CA 1N36I 2V2QA 3PYGA 1IBKI 1N33E 1USUA 4NXMI 2LUPB 4LF7I 1Y6ZA 4BC9A 3IWDA 2V89A 1GQEA 1Z0BA 2RS6A 2EZ6A 4J8ZA 1HNXI 2VE7C 3T1HI 1RQ0A 2XEXA 3CWVA 2VF1A 3K6QA 4JI6E 1U2RA 5BR8E 4TUGA 1N32E 1N0UA 1ZM3A 2Z5EA 4DKKA 4B3RI 2L92A 2ZBKB 4JI7I 3PYFA 2BM1A 1K47A 4X62I 3HULA 4LFAI 4JG4A 1IBLI 5AASA 4P78A 2NUGA 2ODRD 1DI2A 1S16A 3MSWA 4LFCE 3J7AG 2HKJA 3T1YI 4TUIA 2JR1A 1YYWA 4DU8A 3D4JA 3H4LA 3ZZ0A 1XMQE 4KHPE 3WU4A 1UILA 4FWDA 4Q28A 2YZTA 1WHNA 4JI6I 4DV7E 1N34E 1J26A 1ELOA 1UHZA 2GS8A 3ZKBA 2E1RA 4GKJE 3F0NA 5A2QQ 2L2KB 2UU9E 2ZITA 1A6FA 2O1UA 2HFUA 2HK3A 3J7AM 5T6JA 3V5RA 3ADJA 5BR8I 2V85A 2ZM6E 1N32I 2UUBE 4ZVIA 1XMOE 4HY1A 4DPXA 2M1SA 4F9BB 1ZM9A 4LFCI 2KONA 4DMIA 2H36X 2Z5BB 1XMQI 2CPNA 4DR1I 4KHPI 3HQ1A 3DJWA 2JOXA 4DV7I 3ADGA 4DV6E 4UTGA 1N34I 2HHHI 3H09A 2LMZA 4M2ZA 1PIEA 4OOGC 4YY3E 4DR4E 1RR9A 3ZKDA 4UT4A 3LLHA 4DR6E 4GKJI 3B78A 2HK2A 2O1VA 2UU9I 3LNUA 2WZOA 1WXRA 1FNMA 1ZXMA 4DUYE 2F4VE 1UEKA 2MDRA 1FJGE 2L2MA 4JV5I 4BBYA 2PNMA 1D6TA 3IWBA 2ZM6I 2UXCI 2LJPA 4DR7E 4DR3E 2UUCE 2UUBI 3ADLA 2Z5BA 3QT7A 1XMOI 3Q1QA 1X48A 2UXDE 2Z5CB 4PRVA 1B63A 2LRSA 3PYEA 1KKHA 3GONA 2IOPA 4DV4E 3QT6A 3J81Q 5LMUE 3ADIA 4IZJD 5AE2A 4FN5A 4LF4E 2L3CA 4DPUA 4IZJB 4YHHE 2CZ9A 4BMJA 2NUEA 2LTSA 4DV6I 5LMNE 1N0VC 2L33A 2M4IA 5IWAE 4FW9A 4YY3I 2O1TA 2L6MA 2NUFA 3J80C 3K85A 4DR6I 1IBME 2M7QA 2WW4A 3OMLA 4JYAE 4DUYI 2J7KA 2RSMA 3B82A 4JI2I 2F4VI 4K0KE 1T4OA 1EA6A 2O1WA 1FJGI 2Z5CA 3KWRA 2V8PA 2E1MA 1Z59A 2JVAA 3FIGA 4WPYA 1SR9A 2L8TA 4FWHA 2A2CA 1Z0GA 4NXNE 4URLA 2B7VA 4USKA 4DR7I 4DR3I 2UUCI 4GKKE 2FV4B 1B62A 2G7HA 3OTOE 1XNRI 4X66E 4DR2E 4OX9E 3VYXA 4IZJA 2UXDI 1FKAE 2B9DA 3C4TA 4HACB 3V2UC 2FTXB 4WSPA 3HXLA 5ADZA 1YYOA 5FWKA 4DV4I 3C4BA 5LMUI 2V34A 3M6AA 1NHIA 4LF4I 1PVGA 4YHHI 1H72C 2JOBA 5LMNI 1N33I 5GMDA 2DSYA 4B3TE 2FGGA 5IWAI 4R8OA 4BC7A 1IBMI 2CG9A 5IT9Q 4BCAA 2VQEE 4JYAI 4K0KI 4JI8E 3J80Q 4F9CB 4HACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VF3 A;  1O0W A;  4Z7Y A;  4NXN I;  5L3J A;  4DV5 E;  4DR5 E;  3J81 C;  4GKK I;  4WUB A;  2AJ4 A;  1PKP A;  4EMD A;  3OTO I;  4P7A A;  4DUZ E;  4DR2 I;  4OX9 I;  1WUU A;  1WHQ A;  2RS7 A;  2BV3 A;  3ZZU A;  1Z0E A;  1NHH A;  4LF5 E;  2BM0 A;  4JI0 E;  1NHJ A;  4AQY E;  4DPT A;  1KVK A;  2B7T A;  2VQF E;  4FWG A;  4PRX A;  1KTV A;  5FLX C;  4KQV A;  3PYD A;  4JI4 E;  4DV2 E;  3ZZT A;  1QU6 A;  4B3T I;  1Z0V A;  1Z0C A;  1HNW E;  2HFS A;  1HNZ E;  2KHX A;  1S4E A;  1RC7 A;  3P1X A;  2IHR 1;  4DPW A;  1YZ9 A;  2UUA E;  2X36 A;  4DV5 I;  4LF7 E;  1QZR A;  1X47 A;  2Q2E B;  4JI1 E;  4B3M E;  2NPF A;  1H7U A;  1KIJ A;  3HTX A;  4DPY A;  2V2V A;  2L2N A;  4LF5 I;  1DAR A;  4JI0 I;  4JI3 E;  4AQY I;  4JI7 E;  1EI1 A;  2VQF I;  5IT9 C;  1ZM4 A;  2X7I A;  4DR4 I;  5LL6 R;  2LJH A;  4DV2 I;  1OJ4 A;  2DEJ A;  4LF8 E;  1HNW I;  2DIX A;  3VYY A;  1MU5 A;  2LBS B;  5FLX Q;  1I94 E;  1ZM2 A;  3JAM Q;  1HNZ I;  4WUD A;  3K1J A;  2HKE A;  1YYK A;  4USM A;  2E5L E;  1XNQ E;  2UUA I;  4JI5 E;  3WU3 A;  4PU9 A;  3LTO A;  4LF6 E;  1H73 A;  2JY9 A;  1T4L B;  4JI1 I;  2N3G A;  4B3M I;  2R42 A;  4RPF A;  4JI3 I;  1T4N A;  2B3T B;  2A2D A;  4X65 E;  1H7S A;  3ZM7 A;  4LF9 E;  4LF8 I;  1ZBT A;  2RTX A;  4X8W A;  4WFT A;  5CFF E;  4DR1 E;  4DV3 E;  1XHK A;  4I3H A;  1NZ0 A;  2L3J A;  1I94 I;  4P52 A;  4DV1 E;  1RRE A;  5GME A;  1FWL A;  2HHH E;  2E5L I;  1XNQ I;  4DV0 E;  4JI5 I;  4X66 I;  3B8H A;  1Z5B A;  4LF6 I;  1J5E E;  2V2Z A;  2UXB E;  4JV5 E;  3K17 A;  2DMY A;  1EKZ A;  4ED4 A;  2LUQ A;  2YT4 A;  1H74 A;  2UXC E;  4HYM A;  4DXL A;  3J7Y p;  1X49 A;  4Z7C A;  4HXZ A;  3JAM C;  4M1K A;  4B3S E;  1MX0 A;  4DU7 A;  4X65 I;  4WUC A;  4LF9 I;  2DB2 A;  4X64 E;  4LFB E;  2DEI A;  2VQE I;  1FWK A;  4DV3 I;  2NA2 A;  1HR0 E;  4XTJ A;  4JI8 I;  4DV1 I;  1N36 E;  1ZXN A;  1IBK E;  4NXM E;  1Z0T A;  4DR5 I;  2R3V A;  4DV0 I;  3LPS A;  3WU5 A;  4DUZ I;  1J5E I;  1HNX E;  4WYQ B;  2LTR A;  3T1H E;  1Z0W A;  4JI2 E;  4MYT A;  1VIS A;  2UXB I;  1STU A;  4B3R E;  1BKN A;  4MYU A;  3WU6 A;  4X62 E;  4LFA E;  1IBL E;  1XNR E;  4R1F A;  2EFG A;  2OI2 A;  1FI4 A;  3T1Y E;  4JI4 I;  4B3S I;  3QT5 A;  1Z5A A;  4M30 A;  4X64 I;  4LFB I;  5A2Q C;  1MG7 A;  3QT8 A;  1HR0 I;  2N3H A;  1Z5C A;  1N36 I;  2V2Q A;  3PYG A;  1IBK I;  1N33 E;  4NXM I;  2LUP B;  4LF7 I;  1GQE A;  1Z0B A;  2RS6 A;  2EZ6 A;  1HNX I;  3T1H I;  1RQ0 A;  2XEX A;  3CWV A;  4JI6 E;  1U2R A;  5BR8 E;  1N32 E;  1N0U A;  1ZM3 A;  4DKK A;  4B3R I;  2ZBK B;  4JI7 I;  3PYF A;  2BM1 A;  1K47 A;  4X62 I;  3HUL A;  4LFA I;  4JG4 A;  1IBL I;  2NUG A;  1DI2 A;  1S16 A;  4LFC E;  2HKJ A;  3J7A G;  3T1Y I;  1YYW A;  4DU8 A;  3D4J A;  3H4L A;  3ZZ0 A;  1XMQ E;  4KHP E;  3WU4 A;  1UIL A;  4FWD A;  4JI6 I;  1WHN A;  4DV7 E;  1N34 E;  1J26 A;  1ELO A;  1UHZ A;  2GS8 A;  3ZKB A;  2E1R A;  4GKJ E;  3F0N A;  5A2Q Q;  2L2K B;  2UU9 E;  2ZIT A;  1A6F A;  2HFU A;  2HK3 A;  3J7A M;  3V5R A;  3ADJ A;  5BR8 I;  2ZM6 E;  1N32 I;  2UUB E;  4ZVI A;  1XMO E;  4HY1 A;  4DPX A;  1ZM9 A;  4LFC I;  1XMQ I;  2CPN A;  4DR1 I;  4KHP I;  4DV7 I;  3ADG A;  4DV6 E;  4UTG A;  1N34 I;  2HHH I;  4M2Z A;  1PIE A;  4OOG C;  4YY3 E;  4DR4 E;  1RR9 A;  3ZKD A;  4UT4 A;  3LLH A;  4DR6 E;  4GKJ I;  3B78 A;  2HK2 A;  2UU9 I;  3LNU A;  1FNM A;  1ZXM A;  4DUY E;  2F4V E;  1UEK A;  2MDR A;  1FJG E;  2L2M A;  4JV5 I;  1D6T A;  2ZM6 I;  2UXC I;  2LJP A;  4DR7 E;  4DR3 E;  2UUC E;  2UUB I;  3ADL A;  3QT7 A;  1XMO I;  3Q1Q A;  1X48 A;  2UXD E;  4PRV A;  1B63 A;  2LRS A;  3PYE A;  1KKH A;  3GON A;  4DV4 E;  3QT6 A;  3J81 Q;  5LMU E;  3ADI A;  4FN5 A;  4LF4 E;  2L3C A;  4DPU A;  4YHH E;  2CZ9 A;  2NUE A;  2LTS A;  4DV6 I;  5LMN E;  1N0V C;  2L33 A;  4FW9 A;  5IWA E;  4YY3 I;  2NUF A;  3J80 C;  4DR6 I;  1IBM E;  2WW4 A;  4JYA E;  4DUY I;  2J7K A;  2RSM A;  3B82 A;  4JI2 I;  2F4V I;  4K0K E;  1T4O A;  1EA6 A;  1FJG I;  2V8P A;  1Z59 A;  2JVA A;  4FWH A;  2A2C A;  1Z0G A;  4NXN E;  4URL A;  2B7V A;  4USK A;  4DR7 I;  4DR3 I;  2UUC I;  4GKK E;  1B62 A;  3OTO E;  1XNR I;  4X66 E;  4DR2 E;  4OX9 E;  3VYX A;  2UXD I;  1FKA E;  3C4T A;  4HAC B;  3V2U C;  1YYO A;  4DV4 I;  3C4B A;  5LMU I;  2V34 A;  3M6A A;  1NHI A;  4LF4 I;  1PVG A;  4YHH I;  1H72 C;  5LMN I;  1N33 I;  5GMD A;  4B3T E;  5IWA I;  1IBM I;  5IT9 Q;  2VQE E;  4JYA I;  4K0K I;  4JI8 E;  3J80 Q;  4HAC A; 
#chains in the Genus database with same CATH topology
 4HEI A;  4IFD F;  2JE6 B;  2WP8 B;  2VF3 A;  4ZYE A;  1O0W A;  4Z7Y A;  1DQ3 A;  4NXN I;  5L3J A;  4DV5 E;  4DR5 E;  2I9I A;  2EN4 A;  2EM8 A;  2K4V A;  2JT2 A;  3J81 C;  5C0X D;  4GKK I;  1SFE A;  3PS1 A;  4WUB A;  2AJ4 A;  4I8O A;  1PKP A;  2V87 A;  3VK6 A;  4EMD A;  5C0X B;  1MGT A;  4P7A A;  3OTO I;  4DUZ E;  1A1F A;  4DR2 I;  4OX9 I;  2WNR B;  1WUU A;  5IV8 B;  2EPM X;  1WHQ A;  2RS7 A;  2BV3 A;  4GZN C;  4F54 A;  2JP9 A;  5C0X C;  1PJQ A;  2YTP A;  2JEB B;  3ZZU A;  5KL6 A;  1Z0E A;  5JEA A;  1NHH A;  4LF5 E;  2BM0 A;  4JI0 E;  2F8B A;  4AQY E;  1NHJ A;  4MU0 A;  4QNJ A;  4DPT A;  1KVK A;  3F6G A;  2B7T A;  2VQF E;  4FWG A;  4PRX A;  1KTV A;  5DNL A;  4ZYD A;  5FLX C;  3JU0 A;  3EPK A;  4LTY A;  4AIM A;  4KQV A;  3PYD A;  1UBD C;  2WBU A;  4JI4 E;  4DV2 E;  2YTJ A;  3ZZT A;  1QU6 A;  2JE6 A;  4B3T I;  3PS2 A;  2EOS A;  2WP8 A;  1Z0V A;  1Z0C A;  3CDJ A;  1HNW E;  5K36 D;  2LE2 A;  2HFS A;  4FW4 A;  4ISA A;  3EQ1 A;  3THO B;  3UK3 C;  1HNZ E;  2KHX A;  5KL7 A;  2NN6 D;  5C0X A;  5K36 B;  2A25 A;  1S4E A;  1RC7 A;  1UDQ A;  2WNR A;  2NN6 B;  3P1X A;  2Q8U A;  2IHR 1;  4DPW A;  1GTK A;  2YRM A;  5K36 C;  2EP3 A;  2HC5 A;  1YZ9 A;  2JEB A;  2UUA E;  2GPI A;  1JK1 A;  2X36 A;  4DV5 I;  4LF7 E;  4P7D A;  2ENC A;  4IJD A;  4LU9 A;  2EMW A;  2YSO A;  4R2D A;  1QZR A;  2EM0 A;  1YH8 A;  4BHB A;  4FW3 A;  4OO1 D;  2BA1 D;  1X47 A;  2Q2E B;  2YTD A;  1A1K A;  4NHR A;  4JI1 E;  4B3M E;  2CGE A;  1BB8 A;  2NPF A;  1H7U A;  1KIJ A;  2CVE A;  3P06 A;  3GCM A;  3HTX A;  4DPY A;  2V2V A;  2L2N A;  4LF5 I;  1DAR A;  2EM7 A;  4JI0 I;  3GME A;  3HKM A;  4JI3 E;  5C0X F;  4AQY I;  1TF3 A;  3H1C A;  4JI7 E;  3EPH A;  1EI1 A;  3U1K A;  2K7I A;  2EM9 A;  1WJP A;  5DNY A;  5IT9 C;  2VQF I;  1ZBQ A;  3AV0 A;  2EPU A;  4NZV A;  5KL5 A;  5K36 A;  1ZM4 A;  2X7I A;  4DR4 I;  2NN6 A;  2V88 A;  5LL6 R;  2O3Z A;  2LJH A;  4OZE A;  4DV2 I;  1OJ4 A;  4L8N A;  2DEJ A;  4LF8 E;  3Q6M A;  1HNW I;  4F6N A;  2DIX A;  3VYY A;  1MU5 A;  2LBS B;  4L5N C;  1HK7 A;  5FLX Q;  1I94 E;  1ZM2 A;  1X6F A;  2EOM A;  3DF6 A;  2WBS A;  3JAM Q;  2DMI A;  1HNZ I;  4WUD A;  1E3P A;  3K1J A;  4LCH A;  2BA1 G;  2HKE A;  4OO1 A;  1YYK A;  4USM A;  4BA1 B;  3BF2 A;  2E5L E;  1XNQ E;  4AM3 A;  1YHC A;  2UUA I;  4R03 A;  4JI5 E;  3WU3 A;  4PU9 A;  1Z1B A;  2DGC A;  3HPS A;  4F6M A;  5K36 F;  3LTO A;  4LF6 E;  3BGH A;  1H73 A;  2EMX A;  2GHF A;  2EPL X;  2V8Q B;  5A6B D;  2GLI A;  2JY9 A;  1T4L B;  4JI1 I;  2N3G A;  2EMG A;  2J7J A;  2R42 A;  4B3M I;  4MU4 A;  2JWO A;  3LML A;  3Q6N A;  4KZS A;  4R2C A;  1GZ6 A;  2EM4 A;  3ZOQ B;  4RPF A;  2YTQ A;  4JI3 I;  4IZK B;  1UDN A;  2MKN A;  2MDG A;  2C38 A;  2YTI A;  1T4N A;  2PNZ B;  4GEQ B;  3F6H A;  2B3T B;  2A2D A;  2LT7 A;  2YRH A;  3VHT B;  4X65 E;  1H7S A;  4BA1 A;  1YUJ A;  3ZM7 A;  3MHS C;  2YU8 A;  4O43 A;  4LF9 E;  3BBG A;  4LF8 I;  1ZBT A;  2MC5 A;  2RTX A;  1EH6 A;  4X8W A;  3B4T A;  4WFT A;  2PNL A;  5CFF E;  2ODR C;  4ZYH A;  4DV3 E;  4R2R A;  2EJ4 A;  4DR1 E;  1NZ0 A;  1XHK A;  4I3H A;  2L3J A;  1I94 I;  1Y4U A;  1L4S A;  4P52 A;  4DV1 E;  1RRE A;  1R6L A;  4MU1 A;  5GME A;  1FWL A;  2YSP A;  2HHH E;  5A6B A;  2LVH A;  2V83 A;  2EN8 A;  4NBQ A;  2E5L I;  1XNQ I;  2EM2 A;  4DV0 E;  4JI5 I;  2EOZ A;  1UN6 B;  2KOU A;  3JTZ A;  2YTF A;  1Z5B A;  3B8H A;  3IWC A;  4IZK A;  2MC6 A;  4X66 I;  1J5E E;  1TF6 A;  3RMP A;  4LF6 I;  2D9H A;  3QG5 C;  2V2Z A;  1YUI A;  2CSH A;  2UXB E;  2YU5 A;  4JV5 E;  2PNZ A;  3K17 A;  2DMY A;  1EKZ A;  5F3W A;  5AE1 A;  4ED4 A;  2RPC A;  2LUQ A;  2YT4 A;  1PJT A;  1H74 A;  2UXC E;  5ELW A;  1NEI A;  4HYM A;  4DXL A;  3J7Y p;  5DRO A;  1UDO A;  1X49 A;  4BHC A;  4Z7C A;  2EQ0 A;  2M9A A;  4HXZ A;  3JAM C;  2EM3 A;  4B3S E;  4M1K A;  2ADR A;  1MX0 A;  1PJS A;  2EOO A;  4DU7 A;  5JEA E;  4X65 I;  5EKW A;  1EH7 A;  4WUC A;  4BA2 B;  2CT1 A;  1DGC A;  2PRT A;  1R6M A;  4LF9 I;  2DB2 A;  4ZYG A;  4X64 E;  4F9A B;  3EPJ A;  4LFB E;  1VI7 A;  2JXP A;  5A69 A;  1YFH A;  1KYQ A;  1FWK A;  2DEI A;  2VQE I;  4DV3 I;  2EWL A;  2NA2 A;  1HR0 E;  4BS9 A;  4XTJ A;  4FW6 A;  4JI8 I;  4DV1 I;  1N36 E;  1ZXN A;  4R2Q A;  1IBK E;  1X6H A;  4NXM E;  1A1G A;  3AUZ A;  1Z0T A;  2LV2 A;  4DR5 I;  4FK5 C;  2R3V A;  1USV A;  2EOQ A;  4DV0 I;  3LPS A;  4MQY A;  2YPN A;  4N3O A;  3WU5 A;  2ENA A;  4DUZ I;  2IES A;  5KL4 A;  1J5E I;  1HNX E;  4WYQ B;  2LTR A;  3T1H E;  1IMU A;  4JI2 E;  4O24 A;  1Z0W A;  4O5G A;  4MYT A;  4WXC A;  1VIS A;  2UXB I;  1STU A;  3KZY A;  4B3R E;  1EH8 A;  4BA2 A;  2RQL A;  1BKN A;  3C6M A;  2EMK A;  5AE3 A;  4MYU A;  2PO0 B;  4X62 E;  4LFA E;  3WU6 A;  1IBL E;  4MDT A;  4F9C B;  1XNR E;  4R1F A;  1A1H A;  3HPZ A;  2EPZ A;  2I13 A;  5AC5 A;  2EFG A;  2OI2 A;  3HJC A;  1FI4 A;  2JEA B;  2EOF A;  3T1Y E;  2F1D A;  4JI4 I;  2PO1 B;  2VES A;  4B3S I;  3QT5 A;  1Y4S A;  1Z5A A;  2IOQ A;  4LOM A;  1RMD A;  4M0V A;  5EL9 A;  2V86 A;  4X9J A;  4M30 A;  4X64 I;  4HTG A;  4LFB I;  3PRY A;  2GQ0 A;  2BBG A;  5A2Q C;  1N3G A;  4HAC A;  2LJU A;  1MG7 A;  3QT8 A;  1HR0 I;  2N3H A;  1Z5C A;  2NN6 E;  1N36 I;  5IXM B;  2V2Q A;  4U3B A;  3PYG A;  3L7Z B;  1OYR A;  1N33 E;  1USU A;  1IBK I;  2EMH A;  2EOI A;  2VRD A;  2EPO A;  4R2A A;  2LUP B;  2BR2 B;  3M85 D;  4LF7 I;  1Y6Z A;  4BC9 A;  3IWD A;  2V89 A;  1GQE A;  1Z0B A;  1A1L A;  2RS6 A;  4F2J C;  2PO0 A;  2EZ6 A;  4GQU A;  4Q35 B;  3P3E A;  2EQ1 A;  4J8Z A;  2PO2 B;  5A6K A;  1HNX I;  2JEA A;  2VE7 C;  3T1H I;  1RQ0 A;  4OO1 E;  2XEX A;  3MHH C;  3CWV A;  2VF1 A;  3K6Q A;  4JI6 E;  1U2R A;  5BR8 E;  4TUG A;  2EN3 A;  1N32 E;  1N0U A;  1ZM3 A;  2Z5E A;  4MLV A;  4DKK A;  2EMC A;  2F4V I;  5DRR A;  4WX9 A;  4B3R I;  1X6E A;  2L92 A;  2ZBK B;  4JI7 I;  3PYF A;  2EL6 A;  2BM1 A;  1K47 A;  4X62 I;  3HUL A;  4LFA I;  4JG4 A;  1IBL I;  5AAS A;  1ZU1 A;  2EL4 A;  4P78 A;  2NUG A;  2ODR D;  1DI2 A;  1S16 A;  3MSW A;  4LFC E;  3J7A G;  2C37 B;  2HKJ A;  3T1Y I;  4TUI A;  4MU3 A;  2JR1 A;  1YYW A;  4IFD E;  4DU8 A;  2DLK A;  4WSG A;  2C39 B;  3D4J A;  2EN2 A;  3H4L A;  3L7Z A;  2EPN A;  1P47 A;  3TQM A;  1A1J A;  3ZZ0 A;  1XMQ E;  4KHP E;  2BR2 A;  4O4K A;  3M85 G;  3KZZ A;  3WU4 A;  1UIL A;  4FWD A;  1JK2 A;  4Q28 A;  1OYS A;  1BBO A;  2EN1 A;  1WHN A;  2YZT A;  4DV7 E;  1N34 E;  4JI6 I;  2PO2 A;  1J26 A;  2ENH A;  3M7N D;  1ELO A;  1AAY A;  1UHZ A;  3THN A;  4WXD A;  5A6J A;  1RHY A;  2GS8 A;  2RSI A;  2E1R A;  2EN7 A;  2MKD A;  4R2S A;  4GKJ E;  3F0N A;  3ZKB A;  5JEA B;  5A2Q Q;  2L2K B;  2UU9 E;  3M99 B;  3PS3 A;  2DRP A;  2ZIT A;  1BBG A;  1A6F A;  3U1Y A;  5JEA C;  2O1U A;  1XXE A;  1X5W A;  2HFU A;  2HK3 A;  1QNT A;  3J7A M;  2EMI A;  5T6J A;  1ZAA C;  2C37 A;  2EOJ A;  2EOR A;  4J3D A;  3ADJ A;  3V5R A;  2NAB A;  4LCF A;  5BR8 I;  2V85 A;  2EPK X;  2ZM6 E;  2C39 A;  1N32 I;  2UUB E;  4ZVI A;  5KL2 A;  1T39 A;  1XMO E;  2ELY A;  2N8X A;  4HY1 A;  2EPA A;  5DNX A;  1YPN A;  1P42 A;  2BB8 A;  4DPX A;  2M1S A;  4F9B B;  1ZM9 A;  1Y5Y A;  2EMA A;  2EM5 A;  1NCS A;  2LCE A;  4LFC I;  2KON A;  4DMI A;  2H36 X;  4IS9 A;  2Z5B B;  3M7N G;  1XMQ I;  2CPN A;  4DR1 I;  4KHP I;  2EMF A;  2UXC I;  1MEY C;  2EOH A;  2EN6 A;  3DJW A;  3UHM A;  2JOX A;  1G2D C;  2YTG A;  4DV7 I;  3ADG A;  4DV6 E;  4UTG A;  1N34 I;  3BID A;  2HHH I;  3H09 A;  2EMZ A;  2LMZ A;  2J65 A;  4M2Z A;  1PIE A;  4OOG C;  4YY3 E;  4DR4 E;  1RR9 A;  3ZKD A;  4UT4 A;  3LLH A;  4DR6 E;  4LCG A;  4LPF A;  2JYA A;  3B78 A;  4GKJ I;  2HK2 A;  5C0X E;  2O1V A;  2UU9 I;  3LNU A;  2WZO A;  1AH5 A;  3C6K A;  1WXR A;  2LO3 A;  4DUY E;  1FNM A;  1ZXM A;  3CDI A;  2F4V E;  4AID A;  1UEK A;  2MDR A;  1FJG E;  2L2M A;  4JV5 I;  4BBY A;  1KJK A;  2PNM A;  1D6T A;  4RH8 A;  5JEA F;  3IWB A;  2DLQ A;  2EMY A;  5AC4 A;  4IS1 C;  3P3G A;  2ZM6 I;  2LJP A;  4DR7 E;  4DR3 E;  1IQS A;  2UUC E;  3ADL A;  3P76 A;  2UUB I;  1B69 A;  2Z5B A;  3QT7 A;  1XMO I;  2R76 A;  2NN6 C;  3Q1Q A;  2EPX A;  1FJG I;  1X48 A;  1F2I G;  1X3C A;  2UXD E;  4FW7 A;  2Z5C B;  4PRV A;  1IQO A;  1B63 A;  2EMB A;  2LRS A;  3PYE A;  4OO1 B;  1KKH A;  1YSA C;  4RHB B;  2BA0 D;  1A1I A;  3GON A;  2EE8 A;  4DV4 E;  2IOP A;  3QT6 A;  2EQ3 A;  3J81 Q;  2YRK A;  5LMU E;  3ADI A;  1UDS A;  4IZJ D;  4OO1 C;  2GO4 A;  5AE2 A;  4FN5 A;  5K36 E;  4LF4 E;  2L3C A;  2R1F A;  4IZJ B;  2EOE A;  4YHH E;  2CZ9 A;  4QNK A;  4DPU A;  4BMJ A;  2NUE A;  2CTD A;  2LTS A;  4NXM I;  5TSE A;  3NZK A;  2YTN A;  5DRP A;  4DV6 I;  5LMN E;  4IFD D;  1LLM C;  1N0V C;  2L33 A;  2GO3 A;  2M4I A;  1PDA A;  5IWA E;  4FW9 A;  4YY3 I;  2O1T A;  2L6M A;  2NUF A;  4R2P A;  3J80 C;  4FW5 A;  3K85 A;  5DRQ A;  4N4R B;  4DR6 I;  4IFD B;  1IBM E;  2M7Q A;  3DD6 A;  4U3D A;  2WW4 A;  3OML A;  1T38 A;  4IFD C;  1OYP A;  4JYA E;  4DUY I;  2YTO A;  2RSM A;  2EPR A;  2J7K A;  3B82 A;  4JI2 I;  4K0K E;  1T4O A;  1EA6 A;  2O1W A;  2C38 B;  2Z5C A;  3KWR A;  2V8P A;  2E1M A;  1TN9 A;  2JVA A;  3FIG A;  2EPP A;  4WPY A;  1G2F C;  1Z59 A;  1SR9 A;  2L8T A;  4FWH A;  2A2C A;  3GLL A;  1Z0G A;  2HJJ A;  4NXN E;  4URL A;  2B7V A;  4USK A;  4DR7 I;  4DR3 I;  2UUC I;  4GKK E;  2BA0 G;  2FV4 B;  1B62 A;  2EML A;  2G7H A;  1WRJ A;  2JPA A;  2EM6 A;  3OTO E;  1XNR I;  3ECR A;  4X66 E;  4DR2 E;  4OX9 E;  3VYX A;  4IZJ A;  1ZR9 A;  2E72 A;  5A6A A;  5KL3 A;  1FKA E;  2B9D A;  2UXD I;  3C4T A;  2NN6 F;  2YTE A;  4HAC B;  2EOX A;  1E3H A;  3V2U C;  2EOY A;  4R2E A;  2FTX B;  4WSP A;  3HXL A;  1Y60 A;  2IER A;  5ADZ A;  4KWY A;  1YYO A;  2EL5 A;  5FWK A;  4DV4 I;  2YWQ A;  4M9V C;  4IFD A;  3C4B A;  5LMU I;  3KRN A;  2PO1 A;  2V34 A;  2HGH A;  3M6A A;  1NHI A;  4LF4 I;  1PVG A;  4YHH I;  4OKG A;  1H72 C;  5JEA D;  2ELZ A;  2JOB A;  4OO1 F;  2EPC A;  5LMN I;  1N33 I;  5GMD A;  4MLQ A;  2DSY A;  4B3T E;  2FGG A;  5IWA I;  4R8O A;  4BC7 A;  2WBT A;  1IBM I;  5LLQ A;  2CG9 A;  5IT9 Q;  3L00 A;  4BCA A;  2VQE E;  4JYA I;  2AE8 A;  3P3C A;  4K0K I;  4JI8 E;  3J80 Q;  3HQ1 A;  2WCC 3;  3EPL A; 
#chains in the Genus database with same CATH homology
 2VF3 A;  1O0W A;  4Z7Y A;  1DQ3 A;  4NXN I;  5L3J A;  4DV5 E;  4DR5 E;  2K4V A;  3J81 C;  4GKK I;  4WUB A;  2AJ4 A;  4I8O A;  1PKP A;  2V87 A;  3VK6 A;  4EMD A;  3OTO I;  4P7A A;  4DUZ E;  4DR2 I;  4OX9 I;  1WUU A;  1WHQ A;  2RS7 A;  2BV3 A;  4F54 A;  3ZZU A;  1Z0E A;  1NHH A;  4LF5 E;  2BM0 A;  4JI0 E;  2F8B A;  4AQY E;  1NHJ A;  4DPT A;  1KVK A;  3F6G A;  2B7T A;  2VQF E;  4FWG A;  4PRX A;  1KTV A;  5FLX C;  3JU0 A;  4LTY A;  4KQV A;  3PYD A;  4JI4 E;  4DV2 E;  3ZZT A;  1QU6 A;  4B3T I;  1Z0V A;  1Z0C A;  1HNW E;  2LE2 A;  2HFS A;  1HNZ E;  2KHX A;  1S4E A;  1RC7 A;  3P1X A;  2IHR 1;  4DPW A;  1YZ9 A;  2UUA E;  2X36 A;  4DV5 I;  4LF7 E;  4P7D A;  4LU9 A;  1QZR A;  1X47 A;  2Q2E B;  4JI1 E;  4B3M E;  2CGE A;  2NPF A;  1H7U A;  1KIJ A;  3P06 A;  3HTX A;  4DPY A;  2V2V A;  2L2N A;  4LF5 I;  1DAR A;  4JI0 I;  4JI3 E;  4AQY I;  4JI7 E;  1EI1 A;  5DNY A;  5IT9 C;  2VQF I;  1ZBQ A;  3AV0 A;  1ZM4 A;  2X7I A;  4DR4 I;  2V88 A;  5LL6 R;  2LJH A;  4DV2 I;  1OJ4 A;  4L8N A;  2DEJ A;  4LF8 E;  3Q6M A;  1HNW I;  2DIX A;  3VYY A;  1MU5 A;  2LBS B;  4L5N C;  1HK7 A;  5FLX Q;  1I94 E;  1ZM2 A;  3DF6 A;  3JAM Q;  1HNZ I;  4WUD A;  3K1J A;  2HKE A;  1YYK A;  4USM A;  2E5L E;  1XNQ E;  2UUA I;  4R03 A;  4JI5 E;  3WU3 A;  4PU9 A;  3HPS A;  3LTO A;  4LF6 E;  1H73 A;  2V8Q B;  2JY9 A;  1T4L B;  4JI1 I;  2N3G A;  4B3M I;  2R42 A;  2JWO A;  3LML A;  3Q6N A;  4KZS A;  1GZ6 A;  3ZOQ B;  4RPF A;  4JI3 I;  4IZK B;  1T4N A;  4GEQ B;  3F6H A;  2B3T B;  2A2D A;  4X65 E;  1H7S A;  3ZM7 A;  4LF9 E;  4LF8 I;  1ZBT A;  2MC5 A;  2RTX A;  4X8W A;  4WFT A;  2PNL A;  5CFF E;  2ODR C;  4DV3 E;  4DR1 E;  1XHK A;  4I3H A;  1NZ0 A;  2L3J A;  1I94 I;  1Y4U A;  4P52 A;  4DV1 E;  1RRE A;  5GME A;  1FWL A;  2HHH E;  2V83 A;  2E5L I;  1XNQ I;  4DV0 E;  4JI5 I;  2KOU A;  3JTZ A;  3B8H A;  1Z5B A;  4IZK A;  3IWC A;  4X66 I;  2MC6 A;  4LF6 I;  1J5E E;  3RMP A;  2V2Z A;  2UXB E;  4JV5 E;  3K17 A;  2DMY A;  1EKZ A;  5F3W A;  5AE1 A;  4ED4 A;  2LUQ A;  2YT4 A;  1H74 A;  2UXC E;  4HYM A;  4DXL A;  3J7Y p;  1X49 A;  4Z7C A;  4HXZ A;  3JAM C;  4M1K A;  4B3S E;  1MX0 A;  4DU7 A;  4X65 I;  4WUC A;  4LF9 I;  2DB2 A;  4X64 E;  4F9A B;  4LFB E;  2DEI A;  2VQE I;  1FWK A;  4DV3 I;  2EWL A;  2NA2 A;  1HR0 E;  4BS9 A;  4XTJ A;  4JI8 I;  4DV1 I;  1N36 E;  1ZXN A;  1IBK E;  4NXM E;  3AUZ A;  1Z0T A;  4DR5 I;  2R3V A;  4DV0 I;  1USV A;  3LPS A;  4N3O A;  3WU5 A;  4DUZ I;  1J5E I;  1HNX E;  4WYQ B;  2LTR A;  3T1H E;  1Z0W A;  4JI2 E;  4MYT A;  1VIS A;  2UXB I;  1STU A;  4B3R E;  1BKN A;  5AE3 A;  4MYU A;  3WU6 A;  4X62 E;  4LFA E;  1IBL E;  1XNR E;  4R1F A;  3HPZ A;  3HJC A;  2EFG A;  2OI2 A;  1FI4 A;  3T1Y E;  4JI4 I;  4B3S I;  3QT5 A;  1Y4S A;  1Z5A A;  2IOQ A;  4M0V A;  2V86 A;  4M30 A;  4X64 I;  4LFB I;  3PRY A;  2GQ0 A;  5A2Q C;  1MG7 A;  3QT8 A;  1HR0 I;  2N3H A;  1Z5C A;  1N36 I;  2V2Q A;  3PYG A;  1IBK I;  1N33 E;  1USU A;  4NXM I;  2LUP B;  4LF7 I;  1Y6Z A;  4BC9 A;  3IWD A;  2V89 A;  1GQE A;  1Z0B A;  2RS6 A;  2EZ6 A;  4J8Z A;  1HNX I;  2VE7 C;  3T1H I;  1RQ0 A;  2XEX A;  3CWV A;  2VF1 A;  3K6Q A;  4JI6 E;  1U2R A;  5BR8 E;  4TUG A;  1N32 E;  1N0U A;  1ZM3 A;  2Z5E A;  4DKK A;  4B3R I;  2L92 A;  2ZBK B;  4JI7 I;  3PYF A;  2BM1 A;  1K47 A;  4X62 I;  3HUL A;  4LFA I;  4JG4 A;  1IBL I;  5AAS A;  4P78 A;  2NUG A;  2ODR D;  1DI2 A;  1S16 A;  3MSW A;  4LFC E;  3J7A G;  2HKJ A;  3T1Y I;  4TUI A;  2JR1 A;  1YYW A;  4DU8 A;  3D4J A;  3H4L A;  3ZZ0 A;  1XMQ E;  4KHP E;  3WU4 A;  1UIL A;  4FWD A;  4Q28 A;  2YZT A;  1WHN A;  4JI6 I;  4DV7 E;  1N34 E;  1J26 A;  1ELO A;  1UHZ A;  2GS8 A;  3ZKB A;  2E1R A;  4GKJ E;  3F0N A;  5A2Q Q;  2L2K B;  2UU9 E;  2ZIT A;  1A6F A;  2O1U A;  2HFU A;  2HK3 A;  3J7A M;  5T6J A;  3V5R A;  3ADJ A;  5BR8 I;  2V85 A;  2ZM6 E;  1N32 I;  2UUB E;  4ZVI A;  1XMO E;  4HY1 A;  4DPX A;  2M1S A;  4F9B B;  1ZM9 A;  4LFC I;  2KON A;  4DMI A;  2H36 X;  2Z5B B;  1XMQ I;  2CPN A;  4DR1 I;  4KHP I;  3HQ1 A;  3DJW A;  2JOX A;  4DV7 I;  3ADG A;  4DV6 E;  4UTG A;  1N34 I;  2HHH I;  3H09 A;  2LMZ A;  4M2Z A;  1PIE A;  4OOG C;  4YY3 E;  4DR4 E;  1RR9 A;  3ZKD A;  4UT4 A;  3LLH A;  4DR6 E;  4GKJ I;  3B78 A;  2HK2 A;  2O1V A;  2UU9 I;  3LNU A;  2WZO A;  1WXR A;  1FNM A;  1ZXM A;  4DUY E;  2F4V E;  1UEK A;  2MDR A;  1FJG E;  2L2M A;  4JV5 I;  4BBY A;  2PNM A;  1D6T A;  3IWB A;  2ZM6 I;  2UXC I;  2LJP A;  4DR7 E;  4DR3 E;  2UUC E;  2UUB I;  3ADL A;  2Z5B A;  3QT7 A;  1XMO I;  3Q1Q A;  1X48 A;  2UXD E;  2Z5C B;  4PRV A;  1B63 A;  2LRS A;  3PYE A;  1KKH A;  3GON A;  2IOP A;  4DV4 E;  3QT6 A;  3J81 Q;  5LMU E;  3ADI A;  4IZJ D;  5AE2 A;  4FN5 A;  4LF4 E;  2L3C A;  4DPU A;  4IZJ B;  4YHH E;  2CZ9 A;  4BMJ A;  2NUE A;  2LTS A;  4DV6 I;  5LMN E;  1N0V C;  2L33 A;  2M4I A;  5IWA E;  4FW9 A;  4YY3 I;  2O1T A;  2L6M A;  2NUF A;  3J80 C;  3K85 A;  4DR6 I;  1IBM E;  2M7Q A;  2WW4 A;  3OML A;  4JYA E;  4DUY I;  2J7K A;  2RSM A;  3B82 A;  4JI2 I;  2F4V I;  4K0K E;  1T4O A;  1EA6 A;  2O1W A;  1FJG I;  2Z5C A;  3KWR A;  2V8P A;  2E1M A;  1Z59 A;  2JVA A;  3FIG A;  4WPY A;  1SR9 A;  2L8T A;  4FWH A;  2A2C A;  1Z0G A;  4NXN E;  4URL A;  2B7V A;  4USK A;  4DR7 I;  4DR3 I;  2UUC I;  4GKK E;  2FV4 B;  1B62 A;  2G7H A;  3OTO E;  1XNR I;  4X66 E;  4DR2 E;  4OX9 E;  3VYX A;  4IZJ A;  2UXD I;  1FKA E;  2B9D A;  3C4T A;  4HAC B;  3V2U C;  2FTX B;  4WSP A;  3HXL A;  5ADZ A;  1YYO A;  5FWK A;  4DV4 I;  3C4B A;  5LMU I;  2V34 A;  3M6A A;  1NHI A;  4LF4 I;  1PVG A;  4YHH I;  1H72 C;  2JOB A;  5LMN I;  1N33 I;  5GMD A;  2DSY A;  4B3T E;  2FGG A;  5IWA I;  4R8O A;  4BC7 A;  1IBM I;  2CG9 A;  5IT9 Q;  4BCA A;  2VQE E;  4JYA I;  4K0K I;  4JI8 E;  3J80 Q;  4F9C B;  4HAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...