4DV4E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4E02
4UTGA 2X36A 2HK3A 3PYDA 3T1YI 1PVGA 2KHXA 1NHHA 3M6AA 3J7AM 3ADGA 3CWVA 1HNXE 1H7SA 1YYWA 1T4NA 4DKKA 5LMUE 3VYYA 1ZM4A 3LNUA 4FWHA 2HFUA 5IWAI 4LFBE 1Z59A 3VYXA 2UUCI 5LMNI 3ADJA 4DV3I 1IBMI 4DXLA 1WHNA 2UXBE 2BM1A 4YHHE 2L3JA 4DPYA 2VQEE 3Q1QA 4WFTA 1IBLE 1B62A 4WYQB 1XMQI 3WU6A 1GQEA 4LF5I 2V2QA 1Z0WA 4OX9E 4DV7I 4DUZI 3B82A 1H73A 1Z0TA 3ADIA 1I94I 1ZXMA 4DV5E 2L2KB 4Z7CA 4JI4I 1ZM9A 2N3GA 2VQFI 4HY1A 2B3TB 5LMNE 1UEKA 4USKA 4DV3E 1BKNA 1H74A 1FNMA 1J26A 1MU5A 2V2ZA 4DV1I 1IBKI 1XNQI 4DV6E 4JI6I 1KTVA 1RREA 1KKHA 1J5EI 4GKJI 4JI7E 4LF5E 4DUYI 2NUEA 2LTRA 4JI1I 3P1XA 2AJ4A 4HXZA 2UUAI 3J81C 4LF9I 1D6TA 4LFCI 3OTOE 2V2VA 1HR0I 4DR1E 4LF8E 2WW4A 1WUUA 2MDRA 5BR8E 1Z5AA 1NZ0A 4XTJA 2NA2A 3ZKDA 4JI4E 2VQFE 1HNXI 5IT9Q 1Z0CA 2L33A 1T4OA 5LMUI 4NXMI 4LF4I 1XNQE 1X48A 2EFGA 4JI6E 1QZRA 3J7Yp 1XHKA 4UT4A 5GMDA 4ZVIA 3LLHA 1ZXNA 4YHHI 2J7KA 4JI0I 1Z5BA 3WU4A 2VQEI 3ZKBA 4LF9E 3B78A 2CZ9A 1VISA 3C4TA 4OX9I 4JI3E 1EI1A 1N0UA 3B8HA 2JY9A 3QT6A 4HACA 2EZ6A 2LBSB 4LF4E 4NXME 4DV5I 3PYEA 4JI8I 1YZ9A 4PRVA 4FWGA 4PU9A 1N0VC 1ELOA 5CFFE 1STUA 2LUPB 2UXDI 2HK2A 4JI0E 1O0WA 4DV6I 4X62I 2E5LI 2BV3A 4LF6I 4Z7YA 2B7VA 4JI7I 2X7IA 1H72C 2N3HA 2CPNA 4FWDA 3ZZUA 4X65E 4JYAE 2UUBE 2UU9E 4B3MI 3T1HE 4M30A 3OTOI 4DR1I 4YY3I 1UILA 3J80Q 4LF8I 4LFAI 5BR8I 2HKEA 1H7UA 4URLA 4JI8E 4WUCA 4EMDA 4DR4E 4LF7I 3ZZTA 1X49A 2LRSA 2UXDE 4X62E 2A2DA 2HKJA 4JI2E 2E5LE 4LF6E 1OJ4A 2R42A 3QT8A 1UHZA 1ZM3A 1PIEA 5FLXQ 4X66I 3WU5A 4B3ME 4HYMA 4RPFA 2DIXA 4DR5I 4YY3E 4KQVA 2HHHI 4NXNI 4DR6I 4LFAE 4X64E 1FI4A 1N32I 4JI3I 2NPFA 3K1JA 5A2QQ 4LF7E 4JV5E 3JAMQ 3QT5A 1B63A 1Z0GA 1HNZI 4DV2I 4AQYE 1YYKA 2ZM6I 4KHPE 2NUFA 1KIJA 2OI2A 3ZM7A 4B3SE 2DB2A 4DR7I 4FW9A 1N34E 2XEXA 2JVAA 1Z5CA 4DR3I 4X66E 2A2CA 4B3TI 4DR5E 4X8WA 1N36E 4R1FA 5FLXC 2HHHE 4NXNE 4DR6E 3HULA 1N32E 1Z0VA 4X65I 4WUDA 4MYUA 4JYAI 2UUBI 2LJPA 2UU9I 2LJHA 3T1HI 1YYOA 1QU6A 1FJGE 4DPWA 2ZBKB 1HNZE 5GMEA 4DV2E 4B3RI 3F0NA 5A2QC 5IT9C 2ZM6E 1RR9A 3JAMC 3H4LA 4DV0E 4DR4I 3J7AG 2F4VE 4DU7A 4K0KI 4DR7E 2V34A 3PYFA 2L2NA 4HACB 2RS7A 1KVKA 4DR3E 1MG7A 4JI2I 4B3TE 3ADLA 3GONA 1Z0BA 4PRXA 2L3CA 4FN5A 1ZM2A 1XMOI 2B7TA 1HNWE 1N33I 4JG4A 3PYGA 1XNRE 2E1RA 2GS8A 1T4LB 2L2MA 4P7AA 4X64I 4DPTA 4P52A 4B3RE 4K0KE 3ZZ0A 3J81Q 4JV5I 2VF3A 2YT4A 3T1YE 1S4EA 1FKAE 1S16A 1RQ0A 4AQYI 4ED4A 2V8PA 4KHPI 1EA6A 4DPXA 2DEIA 3LTOA 3K17A 1FWLA 4B3SI 4DV4I 2DEJA 4OOGC 3LPSA 5IWAE 1N34I 1U2RA 1XMOE 1MX0A 2HFSA 1N33E 2UUCE 2NUGA 1IBME 4GKKI 1N36I 2BM0A 1RC7A 3WU3A 1DARA 1DI2A 1ZBTA 2Q2EB 1XMQE 3J80C 2LTSA 1NHIA 4JI5I 1FJGI 4DR2I 2UXCI 4DV7E 4DUZE 4I3HA 4DV0I 2F4VI 1I94E 4DV4E 4DU8A 3V5RA 2R3VA 4M1KA 5L3JA 2IHR1 5LL6R 4M2ZA 2RTXA 4GKKE 1FWKA 4DV1E 1IBKE 3D4JA 3V2UC 3QT7A 1PKPA 1NHJA 3HTXA 4WUBA 4DPUA 4LFBI 1HNWI 3C4BA 2DMYA 1J5EE 1WHQA 4GKJE 1X47A 1XNRI 4USMA 1EKZA 1Z0EA 4JI5E 4DUYE 2UXBI 2RS6A 4DR2E 2RSMA 2UXCE 4JI1E 1A6FA 1K47A 2UUAE 1IBLI 2ZITA 2LUQA 4MYTA 4LFCE 1HR0E
chains in the Genus database with same CATH superfamily
4UTGA 2EMBA 2EN6A 2BA1D 2VESA 2X36A 3UHMA 3MSWA 1B69A 4IFDB 4BCAA 2HK3A 3PYDA 2K4VA 5K36A 3T1YI 4LCFA 4TUIA 1PVGA 4MU3A 2KHXA 2EOZA 2I9IA 1NHHA 3PS1A 3M6AA 4MU4A 2GPIA 3J7AM 1UBDC 3ADGA 2HKJA 2JEBA 3GMEA 3CWVA 1HNXE 4M9VC 1H7SA 4FW7A 2Z5CA 2UXDI 1YYWA 4OO1E 2EMXA 1T4NA 2JYAA 2C39A 4DKKA 5LMUE 3VYYA 1ZM4A 1UDSA 3LNUA 2EQ3A 4FWHA 2HFUA 5IWAI 3M99B 2YZTA 4LFBE 1Z59A 3P3GA 2EP3A 5DROA 3VYXA 2WCC3 5JEAB 2UUCI 5LMNI 3ADJA 2MKDA 4QNKA 4DV3I 2JP9A 1IBMI 2DSYA 2EE8A 1WHNA 2V8QB 1T38A 4DXLA 1ZR9A 5A69A 2UXBE 2BM1A 4YHHE 5F3WA 2L3JA 2EOSA 4J3DA 4DPYA 3C6KA 4WX9A 4R2AA 2VQEE 1OYPA 2WZOA 4WFTA 3Q1QA 3HQ1A 1IBLE 4IFDF 2CTDA 1B62A 2EORA 2CVEA 4WYQB 1XMQI 2B9DA 1PDAA 3LMLA 2PNZA 4IZJA 5DNXA 3WU6A 4Q35B 1GQEA 2LVHA 4LF5I 2V2QA 3HPSA 4BC9A 1YFHA 1Z0WA 4OX9E 2MC6A 4DV7I 1UDOA 4ZYGA 4HTGA 2VE7C 2BR2B 4DUZI 3B82A 4MDTA 2EN1A 3EPKA 4MU1A 1H73A 1Z0TA 5AC5A 1A1IA 3ADIA 2M7QA 2YPNA 2EN3A 1I94I 1ZXMA 2WP8B 1Y4UA 3C6MA 4FW3A 1UN6B 4DV5E 3L00A 2L2KB 2EOFA 5JEAF 2EPCA 2EPNA 4Z7CA 4JI4I 4O24A 2PO1B 1ZM9A 1KJKA 2N3GA 4N4RB 2NN6A 2VQFI 4HY1A 5KL2A 2B3TB 5LMNE 1UEKA 3CDJA 5JEAD 1G2FC 1X6EA 4DV3E 2O3ZA 4USKA 2I13A 3U1YA 1BKNA 1H74A 1FNMA 1J26A 1MU5A 2ADRA 2EOYA 2E72A 5AE3A 2V2ZA 2JXPA 4DV1I 1IBKI 1XNQI 2FTXB 5DNLA 2DMIA 3AUZA 3EPHA 4DV6E 1BB8A 4JI6I 1KTVA 1EH7A 2EOJA 1RREA 1KKHA 1J5EI 3PS2A 3L7ZA 2J65A 4GKJI 2WBUA 5IXMB 4JI7E 4F6MA 2EN4A 4LF5E 4DUYI 5LLQA 2NUEA 2G7HA 2LTRA 1IQOA 4JI1I 4LTYA 2JE6B 2YTOA 3P1XA 2AJ4A 1USUA 4HXZA 2UUAI 2ODRD 2LCEA 4X9JA 3J81C 4LF9I 4FW5A 1D6TA 4F9AB 3OTOE 2V2VA 4LFCI 4DR1E 5ADZA 1HR0I 4FW4A 4LU9A 1TF6A 5AE2A 4LF8E 2WW4A 1WUUA 1Y5YA 2MDRA 5BR8E 2JEAA 1Z5AA 2EPRA 1NZ0A 4XTJA 2YTGA 2NA2A 3ZKDA 4JI4E 3K6QA 2O1WA 4BA1A 2RPCA 2DRPA 4BS9A 2VQFE 2HC5A 2N8XA 1HNXI 5IT9Q 2PO0B 1ZBQA 2LJUA 2ELZA 1Z0CA 4OO1B 2EPUA 1T4OA 2L33A 2NABA 5LMUI 2PO2B 4NXMI 4LF4I 1XNQE 2O1TA 4HEIA 1X48A 1Z1BA 2EFGA 4MQYA 4MU0A 4JI6E 2C38B 2Z5BA 5A6BD 2EOMA 1QZRA 4BA2A 2PNMA 3J7Yp 2MC5A 1XHKA 2NN6E 2NN6C 4UT4A 5GMDA 4ZVIA 4ZYEA 1UDQA 3LLHA 1ZXNA 4YHHI 2J7KA 4JI0I 1IMUA 4F9CB 2V87A 1Z5BA 3WU4A 2VQEI 3B4TA 2EM2A 3ZKBA 4O5GA 4LF9E 3EPLA 1T39A 4IJDA 2LV2A 4F54A 4LCHA 3B78A 2FGGA 1VISA 2CZ9A 2Z5BB 3C4TA 3DJWA 1ZU1A 4IS9A 4OX9I 4JI3E 2V85A 1A1KA 1EI1A 2RQLA 2CGEA 3NZKA 5A6AA 1N0UA 3BF2A 1NCSA 2JR1A 2M1SA 3B8HA 4OKGA 3M7ND 2JY9A 4ZYHA 3QT6A 4HACA 4OO1F 2EZ6A 4GZNC 4OO1C 2LBSB 4LF4E 4NXME 2EM6A 2YTFA 4DV5I 2EOIA 3PYEA 4JI8I 4IS1C 1YZ9A 4PRVA 5K36B 1RMDA 2YRKA 2YWQA 4LOMA 4FWGA 4J8ZA 4PU9A 1N0VC 1ELOA 2JEBB 5CFFE 1STUA 3QG5C 2FV4B 5KL7A 2LUPB 2Z5CB 2HK2A 4R8OA 4JI0E 1O0WA 2ELYA 1YUIA 2EM5A 4BC7A 2C39B 4DV6I 2JOXA 2L92A 4X62I 4BHCA 2E5LI 2BV3A 4LF6I 2YTPA 2EM9A 2AE8A 2B7VA 4Z7YA 4JI7I 2X7IA 4R2RA 1H72C 2N3HA 1GTKA 2CPNA 4QNJA 4FWDA 4IFDD 2EN7A 2EL6A 3M85G 3ZZUA 2MDGA 1A1FA 4X65E 3HXLA 4JYAE 2UUBE 2UU9E 4U3DA 4B3MI 3T1HE 1MGTA 4LCGA 4GQUA 4M30A 3OTOI 2YRHA 3KZYA 4DR1I 4YY3I 1UILA 3FIGA 2HGHA 3J80Q 4LF8I 5C0XA 2YTNA 1PJTA 2C37A 5BR8I 2HKEA 1H7UA 4URLA 5KL3A 4WXDA 4IZJB 2PNZB 2EM8A 4R2QA 1EH6A 3MHSC 2YTDA 4JI8E 5K36E 4L8NA 5K36C 4WUCA 3HPZA 3TQMA 3P76A 4EMDA 4DR4E 4LF7I 1R6LA 1DQ3A 1AAYA 1X6HA 3ZZTA 1X49A 4KWYA 2LRSA 2GO4A 2WBTA 2UXDE 3GLLA 2O1UA 2EQ1A 1R6MA 4X62E 3BGHA 1G2DC 2R76A 2EPLX 2A2DA 2YTQA 2BA0G 2E5LE 3IWDA 4JI2E 3F6HA 3OMLA 4LF6E 1OJ4A 2D9HA 3IWBA 5A6BA 5KL5A 2R42A 3QT8A 1L4SA 2NN6B 3P3CA 4N3OA 1UHZA 2EWLA 4R2PA 2BA1G 1ZM3A 5KL4A 2R1FA 1PIEA 3H1CA 5FLXQ 4X66I 3WU5A 4B3ME 2E1MA 2GLIA 4HYMA 4RPFA 2DIXA 4DR5I 2EPAA 4P78A 4YY3E 1HK7A 4KQVA 2V89A 1QNTA 2GQ0A 3DD6A 2HHHI 4NXNI 3JU0A 4DR6I 3L7ZB 4LFAE 4X64E 2EL5A 1FI4A 5IV8B 4JI3I 1N32I 2NPFA 2YRMA 3K1JA 1UDNA 4O4KA 3EPJA 1AH5A 5A2QQ 4LF7E 4JV5E 3JAMQ 3QT5A 1B63A 1Z0GA 5ELWA 3CDIA 1HNZI 3DF6A 5AE1A 2VF1A 2EPOA 4DV2I 2EMKA 4AQYE 2EMAA 5C0XE 1YYKA 5C0XC 2ZM6I 4KHPE 2NUFA 1KIJA 3GCMA 4O43A 2JEAB 4MLVA 2OI2A 3U1KA 2NN6F 3ZM7A 4BHBA 4B3SE 2DB2A 2EPPA 4BA1B 2EMGA 4DR7I 4FW9A 3THNA 1N3GA 1N34E 1TF3A 2WNRA 2XEXA 2EM7A 1Y60A 2JVAA 2VRDA 4TUGA 2CG9A 1Z5CA 3Q6NA 4DR3I 2YSPA 2LT7A 4X66E 2A2CA 3IWCA 2V88A 3Q6MA 4IZKA 4B3TI 2YTJA 2LE2A 1P47A 4DR5E 4X8WA 1N36E 4WSPA 3UK3C 4DMIA 4R1FA 4NHRA 5DRPA 5FLXC 2HHHE 4NXNE 4DR6E 3HULA 1X3CA 4BA2B 4ZYDA 1N32E 1Z0VA 4X65I 4IFDA 2A25A 4WUDA 2V86A 4MYUA 4JYAI 2UUBI 2LJPA 2UU9I 2LJHA 2HJJA 3T1HI 1BBOA 1YYOA 1QU6A 3KZZA 4ISAA 1FJGE 2IOQA 4DPWA 3K85A 1NEIA 2CT1A 2ZBKB 2EMIA 1HNZE 3HKMA 3JTZA 5DRQA 5GMEA 4DV2E 4OO1D 1GZ6A 2YTEA 1A1JA 4B3RI 3F0NA 5A2QC 1WXRA 5IT9C 4OZEA 2ZM6E 2Q8UA 3JAMC 1RR9A 3H4LA 2L6MA 2EOQA 4GEQB 4DV0E 4DR4I 3J7AG 2F4VE 2BBGA 1USVA 5EKWA 2EOHA 3PRYA 4R2DA 4DU7A 4K0KI 4DR7E 5JEAA 2V34A 3PYFA 3RMPA 2L2NA 4HACB 2WBSA 2YTIA 2KOUA 2RS7A 4F9BB 4DR3E 1KVKA 1MG7A 1Y4SA 4FW6A 4JI2I 4B3TE 3ADLA 3VHTB 3ZOQB 1YPNA 3GONA 1Z0BA 4PRXA 2L3CA 4FN5A 2EMHA 2EMWA 1EH8A 4RHBB 1OYSA 2J7JA 1ZM2A 1XMOI 2B7TA 1HNWE 2IERA 1N33I 2JPAA 1BBGA 2M9AA 1E3PA 3PYGA 4JG4A 2KONA 1XNRE 4AM3A 1P42A 2BR2A 2E1RA 2GS8A 2ENCA 1T4LB 2EMZA 2L2MA 2L8TA 2YSOA 2EOXA 1JK1A 3PS3A 1A1HA 2EPZA 4P7AA 4X64I 2H36X 5K36F 2EMYA 1VI7A 4DPTA 4P52A 4NBQA 4B3RE 4K0KE 2WP8A 2JWOA 5A6KA 4R2EA 3ZZ0A 4IFDE 5AC4A 4IFDC 5K36D 3J81Q 3P3EA 4BMJA 1ZAAC 2PNLA 2PO1A 4RH8A 5DNYA 4JV5I 4WXCA 2VF3A 2YT4A 3T1YE 3KWRA 1S4EA 2IOPA 4LPFA 5AASA 1FKAE 1S16A 4WPYA 1RQ0A 2YU8A 2YU5A 4AQYI 4ED4A 2V8PA 4KHPI 1EA6A 5C0XB 4DPXA 2C37B 2DEIA 4WSGA 2EMCA 3LTOA 3P06A 3K17A 1FWLA 4B3SI 2EM4A 4DV4I 2DEJA 4OOGC 3LPSA 5IWAE 3VK6A 2EN2A 3AV0A 4R2CA 1N34I 5TSEA 1LLMC 1YSAC 2MKNA 1U2RA 1XMOE 1MX0A 2HFSA 5JEAE 5JEAC 1N33E 2UUCE 2NUGA 2GO3A 5FWKA 2GHFA 1KYQA 1JK2A 1IBME 2JE6A 4GKKI 2EOOA 1YHCA 3F6GA 1N36I 3BIDA 4R03A 1Y6ZA 2M4IA 1IQSA 2EM3A 2BM0A 1RC7A 2O1VA 5DRRA 2EPXA 1DARA 3WU3A 1PJQA 2EOEA 2EPMX 1DI2A 3M7NG 1ZBTA 4IZJD 5KL6A 2IESA 2EMLA 2Q2EB 1XMQE 3J80C 3BBGA 2LTSA 4BBYA 4L5NC 1NHIA 1YH8A 4AIMA 4JI5I 1FJGI 1F2IG 5T6JA 1RHYA 2ENHA 3ECRA 4FK5C 4F6NA 4DR2I 2UXCI 4DV7E 2JOBA 2LMZA 2ODRC 2ENAA 4DUZE 4I3HA 2PO0A 4I8OA 5C0XF 4LFAI 2DLQA 2EJ4A 3H09A 1E3HA 4OO1A 2F1DA 2PO2A 2PRTA 1PJSA 1XXEA 5C0XD 3M85D 4F2JC 1A1GA 4NZVA 4DV0I 2F4VI 1I94E 2C38A 4DV4E 4DU8A 1MEYC 2F8BA 2Z5EA 1X5WA 3V5RA 2R3VA 4M1KA 2NN6D 3THOB 3KRNA 5EL9A 2LO3A 1WRJA 2IHR1 5L3JA 2EM0A 2EMFA 4AIDA 5LL6R 2EL4A 4MLQA 5A6JA 4M2ZA 2RTXA 3EQ1A 3MHHC 4GKKE 4DV1E 1IBKE 1TN9A 1FWKA 3D4JA 3V2UC 4P7DA 1OYRA 3QT7A 2EPKX 1PKPA 2BB8A 2DLKA 4M0VA 3HTXA 1NHJA 4WUBA 4DPUA 4LFBI 1DGCA 4Q28A 1HNWI 3C4BA 1A1LA 1SFEA 2DMYA 2V83A 1J5EE 1WHQA 2EQ0A 4GKJE 1X47A 2WNRB 4USMA 1XNRI 1SR9A 1EKZA 1Z0EA 3HJCA 4JI5E 1X6FA 4DUYE 1YUJA 2UXBI 2BA0D 2RS6A 4IZKB 4DR2E 2RSMA 2DGCA 4JI1E 2UXCE 1A6FA 4U3BA 1WJPA 4R2SA 4KZSA 2EN8A 1K47A 2UUAE 1IBLI 2K7IA 2JT2A 2LUQA 2ZITA 4MYTA 2CSHA 4LFCE 2RSIA 1HR0E
chains in the Genus database with same CATH topology
4UTGA 2X36A 3MSWA 4BCAA 2HK3A 3PYDA 2K4VA 3T1YI 4TUIA 1PVGA 2KHXA 1NHHA 3M6AA 3J7AM 3ADGA 3CWVA 1HNXE 1H7SA 2Z5CA 1YYWA 1T4NA 4DKKA 5LMUE 3VYYA 1ZM4A 3LNUA 4FWHA 2HFUA 5IWAI 2YZTA 4LFBE 1Z59A 3VYXA 2UUCI 5LMNI 3ADJA 4DV3I 1IBMI 2DSYA 4DXLA 1WHNA 2V8QB 2UXBE 2BM1A 4YHHE 5F3WA 2L3JA 4DPYA 2VQEE 3Q1QA 2WZOA 4WFTA 3HQ1A 1IBLE 1B62A 4WYQB 1XMQI 2B9DA 3LMLA 4IZJA 3WU6A 1GQEA 4LF5I 2V2QA 3HPSA 4BC9A 1Z0WA 4OX9E 2MC6A 4DV7I 2VE7C 4DUZI 3B82A 1H73A 1Z0TA 3ADIA 2M7QA 1I94I 1ZXMA 1Y4UA 4DV5E 2L2KB 4Z7CA 4JI4I 1ZM9A 2N3GA 2VQFI 4HY1A 2B3TB 5LMNE 1UEKA 4USKA 4DV3E 1BKNA 1H74A 1FNMA 1J26A 1MU5A 2V2ZA 4DV1I 1IBKI 5AE3A 1XNQI 2FTXB 3AUZA 4DV6E 4JI6I 1KTVA 1RREA 1KKHA 1J5EI 4GKJI 4JI7E 4LF5E 4DUYI 2NUEA 2G7HA 2LTRA 4JI1I 4LTYA 3P1XA 2AJ4A 1USUA 4HXZA 2UUAI 2ODRD 3J81C 4LF9I 1D6TA 4F9AB 3OTOE 2V2VA 4LFCI 4DR1E 5ADZA 1HR0I 4LU9A 5AE2A 4LF8E 2WW4A 1WUUA 2MDRA 5BR8E 1Z5AA 1NZ0A 4XTJA 2NA2A 3ZKDA 4JI4E 3K6QA 2O1WA 4BS9A 2VQFE 1HNXI 5IT9Q 1ZBQA 1Z0CA 2L33A 1T4OA 5LMUI 4NXMI 4LF4I 1XNQE 2O1TA 1X48A 2EFGA 4JI6E 2Z5BA 1QZRA 2PNMA 3J7Yp 2MC5A 1XHKA 4UT4A 5GMDA 4ZVIA 3LLHA 1ZXNA 4YHHI 2J7KA 4JI0I 4F9CB 2V87A 1Z5BA 3WU4A 2VQEI 3ZKBA 4LF9E 4F54A 3B78A 2FGGA 1VISA 2CZ9A 2Z5BB 3C4TA 3DJWA 4OX9I 4JI3E 2V85A 1EI1A 2CGEA 1N0UA 3B8HA 2JR1A 2M1SA 2JY9A 3QT6A 4HACA 2EZ6A 2LBSB 4LF4E 4NXME 4DV5I 3PYEA 4JI8I 1YZ9A 4PRVA 4FWGA 4J8ZA 4PU9A 1N0VC 1ELOA 5CFFE 1STUA 2FV4B 2LUPB 2Z5CB 2UXDI 2HK2A 4R8OA 4JI0E 1O0WA 4BC7A 4DV6I 2JOXA 2L92A 4X62I 2E5LI 2BV3A 4LF6I 4Z7YA 2B7VA 4JI7I 2X7IA 1H72C 2N3HA 2CPNA 4FWDA 3ZZUA 4X65E 3HXLA 4JYAE 2UUBE 2UU9E 4B3MI 3T1HE 4M30A 3OTOI 4DR1I 4YY3I 1UILA 3FIGA 3J80Q 4LF8I 4LFAI 5BR8I 2HKEA 1H7UA 4URLA 4IZJB 4JI8E 4L8NA 4WUCA 3HPZA 4EMDA 4DR4E 4LF7I 1DQ3A 3ZZTA 1X49A 2LRSA 2UXDE 2O1UA 4X62E 2A2DA 2HKJA 4JI2E 2E5LE 3IWDA 4LF6E 3OMLA 3F6HA 1OJ4A 3IWBA 2R42A 3QT8A 4N3OA 1UHZA 2EWLA 1ZM3A 1PIEA 5FLXQ 4X66I 3WU5A 4B3ME 2E1MA 4HYMA 4RPFA 2DIXA 4DR5I 4P78A 4YY3E 1HK7A 4KQVA 2V89A 2GQ0A 2HHHI 4NXNI 3JU0A 4DR6I 4LFAE 4X64E 1FI4A 1N32I 4JI3I 2NPFA 3K1JA 5A2QQ 4LF7E 4JV5E 3JAMQ 3QT5A 1B63A 1Z0GA 1HNZI 3DF6A 5AE1A 2VF1A 4DV2I 4AQYE 1YYKA 2ZM6I 4KHPE 2NUFA 1KIJA 2OI2A 3ZM7A 4B3SE 2DB2A 4DR7I 4FW9A 1N34E 2XEXA 2JVAA 4TUGA 2CG9A 1Z5CA 3Q6NA 4DR3I 4X66E 2A2CA 3IWCA 2V88A 3Q6MA 4IZKA 4B3TI 2LE2A 4DR5E 4X8WA 1N36E 4WSPA 4DMIA 4R1FA 5FLXC 2HHHE 4NXNE 4DR6E 3HULA 1N32E 1Z0VA 4X65I 4WUDA 2V86A 4MYUA 4JYAI 2UUBI 2LJPA 2UU9I 2LJHA 3T1HI 1YYOA 1QU6A 1FJGE 2IOQA 4DPWA 3K85A 2ZBKB 1HNZE 3JTZA 5GMEA 4DV2E 1GZ6A 4B3RI 3F0NA 5A2QC 1WXRA 5IT9C 2ZM6E 1RR9A 3JAMC 3H4LA 2L6MA 4GEQB 4DV0E 4DR4I 3J7AG 2F4VE 1USVA 3PRYA 4DU7A 4K0KI 4DR7E 2V34A 3PYFA 3RMPA 2L2NA 4HACB 2KOUA 2RS7A 4F9BB 4DR3E 1KVKA 1MG7A 1Y4SA 4JI2I 4B3TE 3ADLA 3ZOQB 3GONA 1Z0BA 4PRXA 2L3CA 4FN5A 1ZM2A 1XMOI 2B7TA 1HNWE 1N33I 4JG4A 3PYGA 2KONA 1XNRE 2E1RA 2GS8A 1T4LB 2L2MA 2L8TA 4P7AA 4X64I 2H36X 4DPTA 4P52A 4B3RE 4K0KE 2JWOA 3ZZ0A 3J81Q 4BMJA 2PNLA 5DNYA 4JV5I 2VF3A 2YT4A 3T1YE 3KWRA 1S4EA 2IOPA 5AASA 1FKAE 1S16A 4WPYA 1RQ0A 4AQYI 4ED4A 2V8PA 4KHPI 1EA6A 4DPXA 2DEIA 3LTOA 3P06A 3K17A 1FWLA 4B3SI 4DV4I 2DEJA 4OOGC 3LPSA 5IWAE 3VK6A 3AV0A 1N34I 1U2RA 1XMOE 1MX0A 2HFSA 1N33E 2UUCE 2NUGA 5FWKA 1IBME 4GKKI 3F6GA 1N36I 4R03A 1Y6ZA 2M4IA 2BM0A 1RC7A 2O1VA 3WU3A 1DARA 1DI2A 1ZBTA 4IZJD 2Q2EB 1XMQE 3J80C 4BBYA 2LTSA 4L5NC 1NHIA 4JI5I 1FJGI 5T6JA 4DR2I 2UXCI 4DV7E 2ODRC 2JOBA 2LMZA 4DUZE 4I3HA 4I8OA 3H09A 4DV0I 2F4VI 1I94E 4DV4E 4DU8A 2F8BA 2Z5EA 3V5RA 2R3VA 4M1KA 5L3JA 2IHR1 5LL6R 4M2ZA 2RTXA 4GKKE 1FWKA 4DV1E 1IBKE 3D4JA 3V2UC 4P7DA 3QT7A 1PKPA 4M0VA 3HTXA 1NHJA 4WUBA 4DPUA 4LFBI 4Q28A 1HNWI 3C4BA 2DMYA 2V83A 1J5EE 1WHQA 4GKJE 1X47A 1XNRI 4USMA 1SR9A 1EKZA 1Z0EA 3HJCA 4JI5E 4DUYE 2UXBI 2RS6A 4IZKB 4DR2E 2RSMA 2UXCE 4JI1E 1A6FA 4KZSA 1K47A 2UUAE 1IBLI 2ZITA 2LUQA 4MYTA 4LFCE 1HR0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UTG A;  2X36 A;  2HK3 A;  3PYD A;  3T1Y I;  1PVG A;  2KHX A;  1NHH A;  3M6A A;  3J7A M;  3ADG A;  3CWV A;  1HNX E;  1H7S A;  1YYW A;  1T4N A;  4DKK A;  5LMU E;  3VYY A;  1ZM4 A;  3LNU A;  4FWH A;  2HFU A;  5IWA I;  4LFB E;  1Z59 A;  3VYX A;  2UUC I;  5LMN I;  3ADJ A;  4DV3 I;  1IBM I;  4DXL A;  1WHN A;  2UXB E;  2BM1 A;  4YHH E;  2L3J A;  4DPY A;  2VQE E;  3Q1Q A;  4WFT A;  1IBL E;  1B62 A;  4WYQ B;  1XMQ I;  3WU6 A;  1GQE A;  4LF5 I;  2V2Q A;  1Z0W A;  4OX9 E;  4DV7 I;  4DUZ I;  3B82 A;  1H73 A;  1Z0T A;  3ADI A;  1I94 I;  1ZXM A;  4DV5 E;  2L2K B;  4Z7C A;  4JI4 I;  1ZM9 A;  2N3G A;  2VQF I;  4HY1 A;  2B3T B;  5LMN E;  1UEK A;  4USK A;  4DV3 E;  1BKN A;  1H74 A;  1FNM A;  1J26 A;  1MU5 A;  2V2Z A;  4DV1 I;  1IBK I;  1XNQ I;  4DV6 E;  4JI6 I;  1KTV A;  1RRE A;  1KKH A;  1J5E I;  4GKJ I;  4JI7 E;  4LF5 E;  4DUY I;  2NUE A;  2LTR A;  4JI1 I;  3P1X A;  2AJ4 A;  4HXZ A;  2UUA I;  3J81 C;  4LF9 I;  1D6T A;  4LFC I;  3OTO E;  2V2V A;  1HR0 I;  4DR1 E;  4LF8 E;  2WW4 A;  1WUU A;  2MDR A;  5BR8 E;  1Z5A A;  1NZ0 A;  4XTJ A;  2NA2 A;  3ZKD A;  4JI4 E;  2VQF E;  1HNX I;  5IT9 Q;  1Z0C A;  2L33 A;  1T4O A;  5LMU I;  4NXM I;  4LF4 I;  1XNQ E;  1X48 A;  2EFG A;  4JI6 E;  1QZR A;  3J7Y p;  1XHK A;  4UT4 A;  5GMD A;  4ZVI A;  3LLH A;  1ZXN A;  4YHH I;  2J7K A;  4JI0 I;  1Z5B A;  3WU4 A;  2VQE I;  3ZKB A;  4LF9 E;  3B78 A;  2CZ9 A;  1VIS A;  3C4T A;  4OX9 I;  4JI3 E;  1EI1 A;  1N0U A;  3B8H A;  2JY9 A;  3QT6 A;  4HAC A;  2EZ6 A;  2LBS B;  4LF4 E;  4NXM E;  4DV5 I;  3PYE A;  4JI8 I;  1YZ9 A;  4PRV A;  4FWG A;  4PU9 A;  1N0V C;  1ELO A;  5CFF E;  1STU A;  2LUP B;  2UXD I;  2HK2 A;  4JI0 E;  1O0W A;  4DV6 I;  4X62 I;  2E5L I;  2BV3 A;  4LF6 I;  4Z7Y A;  2B7V A;  4JI7 I;  2X7I A;  1H72 C;  2N3H A;  2CPN A;  4FWD A;  3ZZU A;  4X65 E;  4JYA E;  2UUB E;  2UU9 E;  4B3M I;  3T1H E;  4M30 A;  3OTO I;  4DR1 I;  4YY3 I;  1UIL A;  3J80 Q;  4LF8 I;  4LFA I;  5BR8 I;  2HKE A;  1H7U A;  4URL A;  4JI8 E;  4WUC A;  4EMD A;  4DR4 E;  4LF7 I;  3ZZT A;  1X49 A;  2LRS A;  2UXD E;  4X62 E;  2A2D A;  2HKJ A;  4JI2 E;  2E5L E;  4LF6 E;  1OJ4 A;  2R42 A;  3QT8 A;  1UHZ A;  1ZM3 A;  1PIE A;  5FLX Q;  4X66 I;  3WU5 A;  4B3M E;  4HYM A;  4RPF A;  2DIX A;  4DR5 I;  4YY3 E;  4KQV A;  2HHH I;  4NXN I;  4DR6 I;  4LFA E;  4X64 E;  1FI4 A;  1N32 I;  4JI3 I;  2NPF A;  3K1J A;  5A2Q Q;  4LF7 E;  4JV5 E;  3JAM Q;  3QT5 A;  1B63 A;  1Z0G A;  1HNZ I;  4DV2 I;  4AQY E;  1YYK A;  2ZM6 I;  4KHP E;  2NUF A;  1KIJ A;  2OI2 A;  3ZM7 A;  4B3S E;  2DB2 A;  4DR7 I;  4FW9 A;  1N34 E;  2XEX A;  2JVA A;  1Z5C A;  4DR3 I;  4X66 E;  2A2C A;  4B3T I;  4DR5 E;  4X8W A;  1N36 E;  4R1F A;  5FLX C;  2HHH E;  4NXN E;  4DR6 E;  3HUL A;  1N32 E;  1Z0V A;  4X65 I;  4WUD A;  4MYU A;  4JYA I;  2UUB I;  2LJP A;  2UU9 I;  2LJH A;  3T1H I;  1YYO A;  1QU6 A;  1FJG E;  4DPW A;  2ZBK B;  1HNZ E;  5GME A;  4DV2 E;  4B3R I;  3F0N A;  5A2Q C;  5IT9 C;  2ZM6 E;  1RR9 A;  3JAM C;  3H4L A;  4DV0 E;  4DR4 I;  3J7A G;  2F4V E;  4DU7 A;  4K0K I;  4DR7 E;  2V34 A;  3PYF A;  2L2N A;  4HAC B;  2RS7 A;  1KVK A;  4DR3 E;  1MG7 A;  4JI2 I;  4B3T E;  3ADL A;  3GON A;  1Z0B A;  4PRX A;  2L3C A;  4FN5 A;  1ZM2 A;  1XMO I;  2B7T A;  1HNW E;  1N33 I;  4JG4 A;  3PYG A;  1XNR E;  2E1R A;  2GS8 A;  1T4L B;  2L2M A;  4P7A A;  4X64 I;  4DPT A;  4P52 A;  4B3R E;  4K0K E;  3ZZ0 A;  3J81 Q;  4JV5 I;  2VF3 A;  2YT4 A;  3T1Y E;  1S4E A;  1FKA E;  1S16 A;  1RQ0 A;  4AQY I;  4ED4 A;  2V8P A;  4KHP I;  1EA6 A;  4DPX A;  2DEI A;  3LTO A;  3K17 A;  1FWL A;  4B3S I;  4DV4 I;  2DEJ A;  4OOG C;  3LPS A;  5IWA E;  1N34 I;  1U2R A;  1XMO E;  1MX0 A;  2HFS A;  1N33 E;  2UUC E;  2NUG A;  1IBM E;  4GKK I;  1N36 I;  2BM0 A;  1RC7 A;  3WU3 A;  1DAR A;  1DI2 A;  1ZBT A;  2Q2E B;  1XMQ E;  3J80 C;  2LTS A;  1NHI A;  4JI5 I;  1FJG I;  4DR2 I;  2UXC I;  4DV7 E;  4DUZ E;  4I3H A;  4DV0 I;  2F4V I;  1I94 E;  4DV4 E;  4DU8 A;  3V5R A;  2R3V A;  4M1K A;  5L3J A;  2IHR 1;  5LL6 R;  4M2Z A;  2RTX A;  4GKK E;  1FWK A;  4DV1 E;  1IBK E;  3D4J A;  3V2U C;  3QT7 A;  1PKP A;  1NHJ A;  3HTX A;  4WUB A;  4DPU A;  4LFB I;  1HNW I;  3C4B A;  2DMY A;  1J5E E;  1WHQ A;  4GKJ E;  1X47 A;  1XNR I;  4USM A;  1EKZ A;  1Z0E A;  4JI5 E;  4DUY E;  2UXB I;  2RS6 A;  4DR2 E;  2RSM A;  2UXC E;  4JI1 E;  1A6F A;  1K47 A;  2UUA E;  1IBL I;  2ZIT A;  2LUQ A;  4MYT A;  4LFC E;  1HR0 E; 
#chains in the Genus database with same CATH topology
 4UTG A;  2EMB A;  2EN6 A;  2BA1 D;  2VES A;  2X36 A;  3UHM A;  3MSW A;  1B69 A;  4IFD B;  4BCA A;  2HK3 A;  3PYD A;  2K4V A;  5K36 A;  3T1Y I;  4LCF A;  4TUI A;  1PVG A;  4MU3 A;  2KHX A;  2EOZ A;  2I9I A;  1NHH A;  3PS1 A;  3M6A A;  4MU4 A;  2GPI A;  3J7A M;  1UBD C;  3ADG A;  2HKJ A;  2JEB A;  3GME A;  3CWV A;  1HNX E;  4M9V C;  1H7S A;  4FW7 A;  2Z5C A;  2UXD I;  1YYW A;  4OO1 E;  2EMX A;  1T4N A;  2JYA A;  2C39 A;  4DKK A;  5LMU E;  3VYY A;  1ZM4 A;  1UDS A;  3LNU A;  2EQ3 A;  4FWH A;  2HFU A;  5IWA I;  3M99 B;  2YZT A;  4LFB E;  1Z59 A;  3P3G A;  2EP3 A;  5DRO A;  3VYX A;  2WCC 3;  5JEA B;  2UUC I;  5LMN I;  3ADJ A;  2MKD A;  4QNK A;  4DV3 I;  2JP9 A;  1IBM I;  2DSY A;  2EE8 A;  1WHN A;  2V8Q B;  1T38 A;  4DXL A;  1ZR9 A;  5A69 A;  2UXB E;  2BM1 A;  4YHH E;  5F3W A;  2L3J A;  2EOS A;  4J3D A;  4DPY A;  3C6K A;  4WX9 A;  4R2A A;  2VQE E;  1OYP A;  2WZO A;  4WFT A;  3Q1Q A;  3HQ1 A;  1IBL E;  4IFD F;  2CTD A;  1B62 A;  2EOR A;  2CVE A;  4WYQ B;  1XMQ I;  2B9D A;  1PDA A;  3LML A;  2PNZ A;  4IZJ A;  5DNX A;  3WU6 A;  4Q35 B;  1GQE A;  2LVH A;  4LF5 I;  2V2Q A;  3HPS A;  4BC9 A;  1YFH A;  1Z0W A;  4OX9 E;  2MC6 A;  4DV7 I;  1UDO A;  4ZYG A;  4HTG A;  2VE7 C;  2BR2 B;  4DUZ I;  3B82 A;  4MDT A;  2EN1 A;  3EPK A;  4MU1 A;  1H73 A;  1Z0T A;  5AC5 A;  1A1I A;  3ADI A;  2M7Q A;  2YPN A;  2EN3 A;  1I94 I;  1ZXM A;  2WP8 B;  1Y4U A;  3C6M A;  4FW3 A;  1UN6 B;  4DV5 E;  3L00 A;  2L2K B;  2EOF A;  5JEA F;  2EPC A;  2EPN A;  4Z7C A;  4JI4 I;  4O24 A;  2PO1 B;  1ZM9 A;  1KJK A;  2N3G A;  4N4R B;  2NN6 A;  2VQF I;  4HY1 A;  5KL2 A;  2B3T B;  5LMN E;  1UEK A;  3CDJ A;  5JEA D;  1G2F C;  1X6E A;  4DV3 E;  2O3Z A;  4USK A;  2I13 A;  3U1Y A;  1BKN A;  1H74 A;  1FNM A;  1J26 A;  1MU5 A;  2ADR A;  2EOY A;  2E72 A;  5AE3 A;  2V2Z A;  2JXP A;  4DV1 I;  1IBK I;  1XNQ I;  2FTX B;  5DNL A;  2DMI A;  3AUZ A;  3EPH A;  4DV6 E;  1BB8 A;  4JI6 I;  1KTV A;  1EH7 A;  2EOJ A;  1RRE A;  1KKH A;  1J5E I;  3PS2 A;  3L7Z A;  2J65 A;  4GKJ I;  2WBU A;  5IXM B;  4JI7 E;  4F6M A;  2EN4 A;  4LF5 E;  4DUY I;  5LLQ A;  2NUE A;  2G7H A;  2LTR A;  1IQO A;  4JI1 I;  4LTY A;  2JE6 B;  2YTO A;  3P1X A;  2AJ4 A;  1USU A;  4HXZ A;  2UUA I;  2ODR D;  2LCE A;  4X9J A;  3J81 C;  4LF9 I;  4FW5 A;  1D6T A;  4F9A B;  3OTO E;  2V2V A;  4LFC I;  4DR1 E;  5ADZ A;  1HR0 I;  4FW4 A;  4LU9 A;  1TF6 A;  5AE2 A;  4LF8 E;  2WW4 A;  1WUU A;  1Y5Y A;  2MDR A;  5BR8 E;  2JEA A;  1Z5A A;  2EPR A;  1NZ0 A;  4XTJ A;  2YTG A;  2NA2 A;  3ZKD A;  4JI4 E;  3K6Q A;  2O1W A;  4BA1 A;  2RPC A;  2DRP A;  4BS9 A;  2VQF E;  2HC5 A;  2N8X A;  1HNX I;  5IT9 Q;  2PO0 B;  1ZBQ A;  2LJU A;  2ELZ A;  1Z0C A;  4OO1 B;  2EPU A;  1T4O A;  2L33 A;  2NAB A;  5LMU I;  2PO2 B;  4NXM I;  4LF4 I;  1XNQ E;  2O1T A;  4HEI A;  1X48 A;  1Z1B A;  2EFG A;  4MQY A;  4MU0 A;  4JI6 E;  2C38 B;  2Z5B A;  5A6B D;  2EOM A;  1QZR A;  4BA2 A;  2PNM A;  3J7Y p;  2MC5 A;  1XHK A;  2NN6 E;  2NN6 C;  4UT4 A;  5GMD A;  4ZVI A;  4ZYE A;  1UDQ A;  3LLH A;  1ZXN A;  4YHH I;  2J7K A;  4JI0 I;  1IMU A;  4F9C B;  2V87 A;  1Z5B A;  3WU4 A;  2VQE I;  3B4T A;  2EM2 A;  3ZKB A;  4O5G A;  4LF9 E;  3EPL A;  1T39 A;  4IJD A;  2LV2 A;  4F54 A;  4LCH A;  3B78 A;  2FGG A;  1VIS A;  2CZ9 A;  2Z5B B;  3C4T A;  3DJW A;  1ZU1 A;  4IS9 A;  4OX9 I;  4JI3 E;  2V85 A;  1A1K A;  1EI1 A;  2RQL A;  2CGE A;  3NZK A;  5A6A A;  1N0U A;  3BF2 A;  1NCS A;  2JR1 A;  2M1S A;  3B8H A;  4OKG A;  3M7N D;  2JY9 A;  4ZYH A;  3QT6 A;  4HAC A;  4OO1 F;  2EZ6 A;  4GZN C;  4OO1 C;  2LBS B;  4LF4 E;  4NXM E;  2EM6 A;  2YTF A;  4DV5 I;  2EOI A;  3PYE A;  4JI8 I;  4IS1 C;  1YZ9 A;  4PRV A;  5K36 B;  1RMD A;  2YRK A;  2YWQ A;  4LOM A;  4FWG A;  4J8Z A;  4PU9 A;  1N0V C;  1ELO A;  2JEB B;  5CFF E;  1STU A;  3QG5 C;  2FV4 B;  5KL7 A;  2LUP B;  2Z5C B;  2HK2 A;  4R8O A;  4JI0 E;  1O0W A;  2ELY A;  1YUI A;  2EM5 A;  4BC7 A;  2C39 B;  4DV6 I;  2JOX A;  2L92 A;  4X62 I;  4BHC A;  2E5L I;  2BV3 A;  4LF6 I;  2YTP A;  2EM9 A;  2AE8 A;  2B7V A;  4Z7Y A;  4JI7 I;  2X7I A;  4R2R A;  1H72 C;  2N3H A;  1GTK A;  2CPN A;  4QNJ A;  4FWD A;  4IFD D;  2EN7 A;  2EL6 A;  3M85 G;  3ZZU A;  2MDG A;  1A1F A;  4X65 E;  3HXL A;  4JYA E;  2UUB E;  2UU9 E;  4U3D A;  4B3M I;  3T1H E;  1MGT A;  4LCG A;  4GQU A;  4M30 A;  3OTO I;  2YRH A;  3KZY A;  4DR1 I;  4YY3 I;  1UIL A;  3FIG A;  2HGH A;  3J80 Q;  4LF8 I;  5C0X A;  2YTN A;  1PJT A;  2C37 A;  5BR8 I;  2HKE A;  1H7U A;  4URL A;  5KL3 A;  4WXD A;  4IZJ B;  2PNZ B;  2EM8 A;  4R2Q A;  1EH6 A;  3MHS C;  2YTD A;  4JI8 E;  5K36 E;  4L8N A;  5K36 C;  4WUC A;  3HPZ A;  3TQM A;  3P76 A;  4EMD A;  4DR4 E;  4LF7 I;  1R6L A;  1DQ3 A;  1AAY A;  1X6H A;  3ZZT A;  1X49 A;  4KWY A;  2LRS A;  2GO4 A;  2WBT A;  2UXD E;  3GLL A;  2O1U A;  2EQ1 A;  1R6M A;  4X62 E;  3BGH A;  1G2D C;  2R76 A;  2EPL X;  2A2D A;  2YTQ A;  2BA0 G;  2E5L E;  3IWD A;  4JI2 E;  3F6H A;  3OML A;  4LF6 E;  1OJ4 A;  2D9H A;  3IWB A;  5A6B A;  5KL5 A;  2R42 A;  3QT8 A;  1L4S A;  2NN6 B;  3P3C A;  4N3O A;  1UHZ A;  2EWL A;  4R2P A;  2BA1 G;  1ZM3 A;  5KL4 A;  2R1F A;  1PIE A;  3H1C A;  5FLX Q;  4X66 I;  3WU5 A;  4B3M E;  2E1M A;  2GLI A;  4HYM A;  4RPF A;  2DIX A;  4DR5 I;  2EPA A;  4P78 A;  4YY3 E;  1HK7 A;  4KQV A;  2V89 A;  1QNT A;  2GQ0 A;  3DD6 A;  2HHH I;  4NXN I;  3JU0 A;  4DR6 I;  3L7Z B;  4LFA E;  4X64 E;  2EL5 A;  1FI4 A;  5IV8 B;  4JI3 I;  1N32 I;  2NPF A;  2YRM A;  3K1J A;  1UDN A;  4O4K A;  3EPJ A;  1AH5 A;  5A2Q Q;  4LF7 E;  4JV5 E;  3JAM Q;  3QT5 A;  1B63 A;  1Z0G A;  5ELW A;  3CDI A;  1HNZ I;  3DF6 A;  5AE1 A;  2VF1 A;  2EPO A;  4DV2 I;  2EMK A;  4AQY E;  2EMA A;  5C0X E;  1YYK A;  5C0X C;  2ZM6 I;  4KHP E;  2NUF A;  1KIJ A;  3GCM A;  4O43 A;  2JEA B;  4MLV A;  2OI2 A;  3U1K A;  2NN6 F;  3ZM7 A;  4BHB A;  4B3S E;  2DB2 A;  2EPP A;  4BA1 B;  2EMG A;  4DR7 I;  4FW9 A;  3THN A;  1N3G A;  1N34 E;  1TF3 A;  2WNR A;  2XEX A;  2EM7 A;  1Y60 A;  2JVA A;  2VRD A;  4TUG A;  2CG9 A;  1Z5C A;  3Q6N A;  4DR3 I;  2YSP A;  2LT7 A;  4X66 E;  2A2C A;  3IWC A;  2V88 A;  3Q6M A;  4IZK A;  4B3T I;  2YTJ A;  2LE2 A;  1P47 A;  4DR5 E;  4X8W A;  1N36 E;  4WSP A;  3UK3 C;  4DMI A;  4R1F A;  4NHR A;  5DRP A;  5FLX C;  2HHH E;  4NXN E;  4DR6 E;  3HUL A;  1X3C A;  4BA2 B;  4ZYD A;  1N32 E;  1Z0V A;  4X65 I;  4IFD A;  2A25 A;  4WUD A;  2V86 A;  4MYU A;  4JYA I;  2UUB I;  2LJP A;  2UU9 I;  2LJH A;  2HJJ A;  3T1H I;  1BBO A;  1YYO A;  1QU6 A;  3KZZ A;  4ISA A;  1FJG E;  2IOQ A;  4DPW A;  3K85 A;  1NEI A;  2CT1 A;  2ZBK B;  2EMI A;  1HNZ E;  3HKM A;  3JTZ A;  5DRQ A;  5GME A;  4DV2 E;  4OO1 D;  1GZ6 A;  2YTE A;  1A1J A;  4B3R I;  3F0N A;  5A2Q C;  1WXR A;  5IT9 C;  4OZE A;  2ZM6 E;  2Q8U A;  3JAM C;  1RR9 A;  3H4L A;  2L6M A;  2EOQ A;  4GEQ B;  4DV0 E;  4DR4 I;  3J7A G;  2F4V E;  2BBG A;  1USV A;  5EKW A;  2EOH A;  3PRY A;  4R2D A;  4DU7 A;  4K0K I;  4DR7 E;  5JEA A;  2V34 A;  3PYF A;  3RMP A;  2L2N A;  4HAC B;  2WBS A;  2YTI A;  2KOU A;  2RS7 A;  4F9B B;  4DR3 E;  1KVK A;  1MG7 A;  1Y4S A;  4FW6 A;  4JI2 I;  4B3T E;  3ADL A;  3VHT B;  3ZOQ B;  1YPN A;  3GON A;  1Z0B A;  4PRX A;  2L3C A;  4FN5 A;  2EMH A;  2EMW A;  1EH8 A;  4RHB B;  1OYS A;  2J7J A;  1ZM2 A;  1XMO I;  2B7T A;  1HNW E;  2IER A;  1N33 I;  2JPA A;  1BBG A;  2M9A A;  1E3P A;  3PYG A;  4JG4 A;  2KON A;  1XNR E;  4AM3 A;  1P42 A;  2BR2 A;  2E1R A;  2GS8 A;  2ENC A;  1T4L B;  2EMZ A;  2L2M A;  2L8T A;  2YSO A;  2EOX A;  1JK1 A;  3PS3 A;  1A1H A;  2EPZ A;  4P7A A;  4X64 I;  2H36 X;  5K36 F;  2EMY A;  1VI7 A;  4DPT A;  4P52 A;  4NBQ A;  4B3R E;  4K0K E;  2WP8 A;  2JWO A;  5A6K A;  4R2E A;  3ZZ0 A;  4IFD E;  5AC4 A;  4IFD C;  5K36 D;  3J81 Q;  3P3E A;  4BMJ A;  1ZAA C;  2PNL A;  2PO1 A;  4RH8 A;  5DNY A;  4JV5 I;  4WXC A;  2VF3 A;  2YT4 A;  3T1Y E;  3KWR A;  1S4E A;  2IOP A;  4LPF A;  5AAS A;  1FKA E;  1S16 A;  4WPY A;  1RQ0 A;  2YU8 A;  2YU5 A;  4AQY I;  4ED4 A;  2V8P A;  4KHP I;  1EA6 A;  5C0X B;  4DPX A;  2C37 B;  2DEI A;  4WSG A;  2EMC A;  3LTO A;  3P06 A;  3K17 A;  1FWL A;  4B3S I;  2EM4 A;  4DV4 I;  2DEJ A;  4OOG C;  3LPS A;  5IWA E;  3VK6 A;  2EN2 A;  3AV0 A;  4R2C A;  1N34 I;  5TSE A;  1LLM C;  1YSA C;  2MKN A;  1U2R A;  1XMO E;  1MX0 A;  2HFS A;  5JEA E;  5JEA C;  1N33 E;  2UUC E;  2NUG A;  2GO3 A;  5FWK A;  2GHF A;  1KYQ A;  1JK2 A;  1IBM E;  2JE6 A;  4GKK I;  2EOO A;  1YHC A;  3F6G A;  1N36 I;  3BID A;  4R03 A;  1Y6Z A;  2M4I A;  1IQS A;  2EM3 A;  2BM0 A;  1RC7 A;  2O1V A;  5DRR A;  2EPX A;  1DAR A;  3WU3 A;  1PJQ A;  2EOE A;  2EPM X;  1DI2 A;  3M7N G;  1ZBT A;  4IZJ D;  5KL6 A;  2IES A;  2EML A;  2Q2E B;  1XMQ E;  3J80 C;  3BBG A;  2LTS A;  4BBY A;  4L5N C;  1NHI A;  1YH8 A;  4AIM A;  4JI5 I;  1FJG I;  1F2I G;  5T6J A;  1RHY A;  2ENH A;  3ECR A;  4FK5 C;  4F6N A;  4DR2 I;  2UXC I;  4DV7 E;  2JOB A;  2LMZ A;  2ODR C;  2ENA A;  4DUZ E;  4I3H A;  2PO0 A;  4I8O A;  5C0X F;  4LFA I;  2DLQ A;  2EJ4 A;  3H09 A;  1E3H A;  4OO1 A;  2F1D A;  2PO2 A;  2PRT A;  1PJS A;  1XXE A;  5C0X D;  3M85 D;  4F2J C;  1A1G A;  4NZV A;  4DV0 I;  2F4V I;  1I94 E;  2C38 A;  4DV4 E;  4DU8 A;  1MEY C;  2F8B A;  2Z5E A;  1X5W A;  3V5R A;  2R3V A;  4M1K A;  2NN6 D;  3THO B;  3KRN A;  5EL9 A;  2LO3 A;  1WRJ A;  2IHR 1;  5L3J A;  2EM0 A;  2EMF A;  4AID A;  5LL6 R;  2EL4 A;  4MLQ A;  5A6J A;  4M2Z A;  2RTX A;  3EQ1 A;  3MHH C;  4GKK E;  4DV1 E;  1IBK E;  1TN9 A;  1FWK A;  3D4J A;  3V2U C;  4P7D A;  1OYR A;  3QT7 A;  2EPK X;  1PKP A;  2BB8 A;  2DLK A;  4M0V A;  3HTX A;  1NHJ A;  4WUB A;  4DPU A;  4LFB I;  1DGC A;  4Q28 A;  1HNW I;  3C4B A;  1A1L A;  1SFE A;  2DMY A;  2V83 A;  1J5E E;  1WHQ A;  2EQ0 A;  4GKJ E;  1X47 A;  2WNR B;  4USM A;  1XNR I;  1SR9 A;  1EKZ A;  1Z0E A;  3HJC A;  4JI5 E;  1X6F A;  4DUY E;  1YUJ A;  2UXB I;  2BA0 D;  2RS6 A;  4IZK B;  4DR2 E;  2RSM A;  2DGC A;  4JI1 E;  2UXC E;  1A6F A;  4U3B A;  1WJP A;  4R2S A;  4KZS A;  2EN8 A;  1K47 A;  2UUA E;  1IBL I;  2K7I A;  2JT2 A;  2LUQ A;  2ZIT A;  4MYT A;  2CSH A;  4LFC E;  2RSI A;  1HR0 E; 
#chains in the Genus database with same CATH homology
 4UTG A;  2X36 A;  3MSW A;  4BCA A;  2HK3 A;  3PYD A;  2K4V A;  3T1Y I;  4TUI A;  1PVG A;  2KHX A;  1NHH A;  3M6A A;  3J7A M;  3ADG A;  3CWV A;  1HNX E;  1H7S A;  2Z5C A;  1YYW A;  1T4N A;  4DKK A;  5LMU E;  3VYY A;  1ZM4 A;  3LNU A;  4FWH A;  2HFU A;  5IWA I;  2YZT A;  4LFB E;  1Z59 A;  3VYX A;  2UUC I;  5LMN I;  3ADJ A;  4DV3 I;  1IBM I;  2DSY A;  4DXL A;  1WHN A;  2V8Q B;  2UXB E;  2BM1 A;  4YHH E;  5F3W A;  2L3J A;  4DPY A;  2VQE E;  3Q1Q A;  2WZO A;  4WFT A;  3HQ1 A;  1IBL E;  1B62 A;  4WYQ B;  1XMQ I;  2B9D A;  3LML A;  4IZJ A;  3WU6 A;  1GQE A;  4LF5 I;  2V2Q A;  3HPS A;  4BC9 A;  1Z0W A;  4OX9 E;  2MC6 A;  4DV7 I;  2VE7 C;  4DUZ I;  3B82 A;  1H73 A;  1Z0T A;  3ADI A;  2M7Q A;  1I94 I;  1ZXM A;  1Y4U A;  4DV5 E;  2L2K B;  4Z7C A;  4JI4 I;  1ZM9 A;  2N3G A;  2VQF I;  4HY1 A;  2B3T B;  5LMN E;  1UEK A;  4USK A;  4DV3 E;  1BKN A;  1H74 A;  1FNM A;  1J26 A;  1MU5 A;  2V2Z A;  4DV1 I;  1IBK I;  5AE3 A;  1XNQ I;  2FTX B;  3AUZ A;  4DV6 E;  4JI6 I;  1KTV A;  1RRE A;  1KKH A;  1J5E I;  4GKJ I;  4JI7 E;  4LF5 E;  4DUY I;  2NUE A;  2G7H A;  2LTR A;  4JI1 I;  4LTY A;  3P1X A;  2AJ4 A;  1USU A;  4HXZ A;  2UUA I;  2ODR D;  3J81 C;  4LF9 I;  1D6T A;  4F9A B;  3OTO E;  2V2V A;  4LFC I;  4DR1 E;  5ADZ A;  1HR0 I;  4LU9 A;  5AE2 A;  4LF8 E;  2WW4 A;  1WUU A;  2MDR A;  5BR8 E;  1Z5A A;  1NZ0 A;  4XTJ A;  2NA2 A;  3ZKD A;  4JI4 E;  3K6Q A;  2O1W A;  4BS9 A;  2VQF E;  1HNX I;  5IT9 Q;  1ZBQ A;  1Z0C A;  2L33 A;  1T4O A;  5LMU I;  4NXM I;  4LF4 I;  1XNQ E;  2O1T A;  1X48 A;  2EFG A;  4JI6 E;  2Z5B A;  1QZR A;  2PNM A;  3J7Y p;  2MC5 A;  1XHK A;  4UT4 A;  5GMD A;  4ZVI A;  3LLH A;  1ZXN A;  4YHH I;  2J7K A;  4JI0 I;  4F9C B;  2V87 A;  1Z5B A;  3WU4 A;  2VQE I;  3ZKB A;  4LF9 E;  4F54 A;  3B78 A;  2FGG A;  1VIS A;  2CZ9 A;  2Z5B B;  3C4T A;  3DJW A;  4OX9 I;  4JI3 E;  2V85 A;  1EI1 A;  2CGE A;  1N0U A;  3B8H A;  2JR1 A;  2M1S A;  2JY9 A;  3QT6 A;  4HAC A;  2EZ6 A;  2LBS B;  4LF4 E;  4NXM E;  4DV5 I;  3PYE A;  4JI8 I;  1YZ9 A;  4PRV A;  4FWG A;  4J8Z A;  4PU9 A;  1N0V C;  1ELO A;  5CFF E;  1STU A;  2FV4 B;  2LUP B;  2Z5C B;  2UXD I;  2HK2 A;  4R8O A;  4JI0 E;  1O0W A;  4BC7 A;  4DV6 I;  2JOX A;  2L92 A;  4X62 I;  2E5L I;  2BV3 A;  4LF6 I;  4Z7Y A;  2B7V A;  4JI7 I;  2X7I A;  1H72 C;  2N3H A;  2CPN A;  4FWD A;  3ZZU A;  4X65 E;  3HXL A;  4JYA E;  2UUB E;  2UU9 E;  4B3M I;  3T1H E;  4M30 A;  3OTO I;  4DR1 I;  4YY3 I;  1UIL A;  3FIG A;  3J80 Q;  4LF8 I;  4LFA I;  5BR8 I;  2HKE A;  1H7U A;  4URL A;  4IZJ B;  4JI8 E;  4L8N A;  4WUC A;  3HPZ A;  4EMD A;  4DR4 E;  4LF7 I;  1DQ3 A;  3ZZT A;  1X49 A;  2LRS A;  2UXD E;  2O1U A;  4X62 E;  2A2D A;  2HKJ A;  4JI2 E;  2E5L E;  3IWD A;  4LF6 E;  3OML A;  3F6H A;  1OJ4 A;  3IWB A;  2R42 A;  3QT8 A;  4N3O A;  1UHZ A;  2EWL A;  1ZM3 A;  1PIE A;  5FLX Q;  4X66 I;  3WU5 A;  4B3M E;  2E1M A;  4HYM A;  4RPF A;  2DIX A;  4DR5 I;  4P78 A;  4YY3 E;  1HK7 A;  4KQV A;  2V89 A;  2GQ0 A;  2HHH I;  4NXN I;  3JU0 A;  4DR6 I;  4LFA E;  4X64 E;  1FI4 A;  1N32 I;  4JI3 I;  2NPF A;  3K1J A;  5A2Q Q;  4LF7 E;  4JV5 E;  3JAM Q;  3QT5 A;  1B63 A;  1Z0G A;  1HNZ I;  3DF6 A;  5AE1 A;  2VF1 A;  4DV2 I;  4AQY E;  1YYK A;  2ZM6 I;  4KHP E;  2NUF A;  1KIJ A;  2OI2 A;  3ZM7 A;  4B3S E;  2DB2 A;  4DR7 I;  4FW9 A;  1N34 E;  2XEX A;  2JVA A;  4TUG A;  2CG9 A;  1Z5C A;  3Q6N A;  4DR3 I;  4X66 E;  2A2C A;  3IWC A;  2V88 A;  3Q6M A;  4IZK A;  4B3T I;  2LE2 A;  4DR5 E;  4X8W A;  1N36 E;  4WSP A;  4DMI A;  4R1F A;  5FLX C;  2HHH E;  4NXN E;  4DR6 E;  3HUL A;  1N32 E;  1Z0V A;  4X65 I;  4WUD A;  2V86 A;  4MYU A;  4JYA I;  2UUB I;  2LJP A;  2UU9 I;  2LJH A;  3T1H I;  1YYO A;  1QU6 A;  1FJG E;  2IOQ A;  4DPW A;  3K85 A;  2ZBK B;  1HNZ E;  3JTZ A;  5GME A;  4DV2 E;  1GZ6 A;  4B3R I;  3F0N A;  5A2Q C;  1WXR A;  5IT9 C;  2ZM6 E;  1RR9 A;  3JAM C;  3H4L A;  2L6M A;  4GEQ B;  4DV0 E;  4DR4 I;  3J7A G;  2F4V E;  1USV A;  3PRY A;  4DU7 A;  4K0K I;  4DR7 E;  2V34 A;  3PYF A;  3RMP A;  2L2N A;  4HAC B;  2KOU A;  2RS7 A;  4F9B B;  4DR3 E;  1KVK A;  1MG7 A;  1Y4S A;  4JI2 I;  4B3T E;  3ADL A;  3ZOQ B;  3GON A;  1Z0B A;  4PRX A;  2L3C A;  4FN5 A;  1ZM2 A;  1XMO I;  2B7T A;  1HNW E;  1N33 I;  4JG4 A;  3PYG A;  2KON A;  1XNR E;  2E1R A;  2GS8 A;  1T4L B;  2L2M A;  2L8T A;  4P7A A;  4X64 I;  2H36 X;  4DPT A;  4P52 A;  4B3R E;  4K0K E;  2JWO A;  3ZZ0 A;  3J81 Q;  4BMJ A;  2PNL A;  5DNY A;  4JV5 I;  2VF3 A;  2YT4 A;  3T1Y E;  3KWR A;  1S4E A;  2IOP A;  5AAS A;  1FKA E;  1S16 A;  4WPY A;  1RQ0 A;  4AQY I;  4ED4 A;  2V8P A;  4KHP I;  1EA6 A;  4DPX A;  2DEI A;  3LTO A;  3P06 A;  3K17 A;  1FWL A;  4B3S I;  4DV4 I;  2DEJ A;  4OOG C;  3LPS A;  5IWA E;  3VK6 A;  3AV0 A;  1N34 I;  1U2R A;  1XMO E;  1MX0 A;  2HFS A;  1N33 E;  2UUC E;  2NUG A;  5FWK A;  1IBM E;  4GKK I;  3F6G A;  1N36 I;  4R03 A;  1Y6Z A;  2M4I A;  2BM0 A;  1RC7 A;  2O1V A;  3WU3 A;  1DAR A;  1DI2 A;  1ZBT A;  4IZJ D;  2Q2E B;  1XMQ E;  3J80 C;  4BBY A;  2LTS A;  4L5N C;  1NHI A;  4JI5 I;  1FJG I;  5T6J A;  4DR2 I;  2UXC I;  4DV7 E;  2ODR C;  2JOB A;  2LMZ A;  4DUZ E;  4I3H A;  4I8O A;  3H09 A;  4DV0 I;  2F4V I;  1I94 E;  4DV4 E;  4DU8 A;  2F8B A;  2Z5E A;  3V5R A;  2R3V A;  4M1K A;  5L3J A;  2IHR 1;  5LL6 R;  4M2Z A;  2RTX A;  4GKK E;  1FWK A;  4DV1 E;  1IBK E;  3D4J A;  3V2U C;  4P7D A;  3QT7 A;  1PKP A;  4M0V A;  3HTX A;  1NHJ A;  4WUB A;  4DPU A;  4LFB I;  4Q28 A;  1HNW I;  3C4B A;  2DMY A;  2V83 A;  1J5E E;  1WHQ A;  4GKJ E;  1X47 A;  1XNR I;  4USM A;  1SR9 A;  1EKZ A;  1Z0E A;  3HJC A;  4JI5 E;  4DUY E;  2UXB I;  2RS6 A;  4IZK B;  4DR2 E;  2RSM A;  2UXC E;  4JI1 E;  1A6F A;  4KZS A;  1K47 A;  2UUA E;  1IBL I;  2ZIT A;  2LUQ A;  4MYT A;  4LFC E;  1HR0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...