4DV4E

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dv4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4E02
4DPXA 4DR1I 1FJGI 5A2QQ 1Z0GA 4B3RI 2LJPA 2L2KB 3B78A 4DR2E 2L33A 1N32E 1A6FA 2NUEA 2LRSA 1Z5CA 4X64E 5IT9Q 4LF8E 2RSMA 3WU5A 4OOGC 2BM0A 4JI8I 3PYGA 2VQEE 1H7SA 2N3GA 5FLXQ 4GKJI 2F4VE 1HNXI 3JAMQ 4DXLA 1WHNA 1D6TA 1N0VC 4X62E 4DV2E 5IWAI 4DV5E 3F0NA 4DV7I 2AJ4A 2XEXA 3D4JA 1HNWE 1H74A 1EA6A 3ADIA 1T4LB 4JI0I 4JI5I 4JI7I 1T4OA 2WW4A 4P7AA 1Z5BA 1RQ0A 4NXNI 1Z0WA 2B3TB 3T1HI 1N36E 2HFSA 3P1XA 4LF6I 4JV5E 4JI4E 2NA2A 1DI2A 4B3SE 1H7UA 4LF9I 2A2CA 4LF5E 2X36A 4JI1I 1N34I 4FWHA 3ZZUA 4DV3E 4HXZA 1STUA 4NXME 4M2ZA 2DIXA 1GQEA 4Z7CA 1K47A 3LNUA 3B82A 1IBMI 3J7Yp 4LF4I 1HNWI 4R1FA 4JI2I 4B3TE 2UXDI 2DEIA 3OTOI 1MU5A 1I94E 1IBKI 1H72C 5BR8I 1Z59A 2L3JA 4NXNE 4LF5I 4JI2E 1S16A 2EFGA 2V2ZA 1MX0A 2KHXA 3QT8A 4PRVA 1J5EI 4LFAI 3HULA 2LUQA 3J80C 2NUGA 3T1YE 3C4TA 4B3RE 1YZ9A 4DPTA 1B62A 4JG4A 1ZM2A 2UUCE 2L2NA 2LUPB 2HKJA 4DV3I 1HR0I 1EKZA 1B63A 4JI8E 3Q1QA 3J7AM 4HY1A 4DV6E 4LFCE 1HNZE 1Z0BA 3V5RA 4DR4I 1ELOA 1FWLA 3PYEA 4HYMA 4LF6E 1XMOI 3ZM7A 1X48A 4DV1E 2A2DA 1S4EA 3JAMC 2ZITA 1N0UA 4OX9E 4LFAE 4DR7E 2VQFE 4DV0E 4DUZI 1Z0EA 1NHIA 5LMNE 2HK2A 5GMEA 1XMQE 2N3HA 3H4LA 4B3MI 4RPFA 2ZM6E 2L3CA 1XNRE 1N33E 3K1JA 4YHHI 4LF4E 3LTOA 5LMNI 3J81C 5CFFE 4GKJE 1MG7A 4YY3I 4JI3I 2UXCE 2RTXA 1HR0E 4DR1E 1XHKA 1UEKA 2LJHA 1U2RA 4LFCI 4Z7YA 1N32I 5LMUI 4DKKA 1FNMA 1NHHA 4X8WA 2VQFI 4DV0I 4WUCA 4JYAE 1Z0CA 4OX9I 1HNXE 5GMDA 2JVAA 4KHPI 4DUZE 4DV6I 1RC7A 2HFUA 5A2QC 2EZ6A 1N34E 1FJGE 3K17A 1UHZA 2V2VA 1J26A 2V8PA 2ZM6I 4KHPE 1XNRI 1KTVA 5L3JA 4LFBI 5LMUE 2UXCI 2UUCI 5FLXC 4B3SI 4DR5I 2UUAE 4DV7E 2HK3A 4LFBE 1XMQI 1Z0VA 2RS6A 3VYXA 2ZBKB 1N33I 1NZ0A 4DR2I 5BR8E 4FWGA 4NXMI 1YYOA 1DARA 2Q2EB 1J5EE 1VISA 4WUBA 1YYKA 1RREA 3J80Q 4ED4A 2RS7A 3LPSA 2IHR1 1KVKA 3J7AG 4LF9E 2OI2A 2LTSA 4M30A 1ZM4A 4XTJA 4MYUA 1FI4A 3ZZ0A 3HTXA 4UT4A 2X7IA 2HHHE 1X47A 4WYQB 4DR3I 2E1RA 4FN5A 2CZ9A 1HNZI 4DR6E 1RR9A 2UUAI 4JYAI 2JY9A 4DU7A 4JI0E 4JI5E 2LTRA 1KKHA 4EMDA 5IT9C 4DR3E 4LF7E 2UU9E 4HACB 1N36I 4K0KI 2UXDE 2YT4A 1FWKA 4B3TI 1XNQE 2B7TA 1IBLI 1H73A 4JI4I 1PVGA 4DV5I 2UXBE 2UU9I 2BV3A 3QT6A 4USMA 3ADJA 4PU9A 4JI7E 1Z0TA 3QT7A 4AQYE 2V2QA 1IBLE 4DV1I 4YHHE 1IBKE 3T1YI 4PRXA 3J81Q 1ZM9A 2E5LI 1PKPA 2LBSB 3QT5A 3V2UC 4DPUA 2BM1A 2HKEA 4P52A 2VF3A 1UILA 4UTGA 2DMYA 4DR7I 4JV5I 4GKKE 4JI6I 2MDRA 3PYDA 1X49A 2DB2A 3VYYA 2B7VA 2DEJA 1XNQI 2J7KA 3ZZTA 1T4NA 4WFTA 5IWAE 4DV2I 3PYFA 4DV4E 2L2MA 4LF7I 4URLA 1FKAE 1NHJA 1WUUA 4M1KA 4DPYA 4AQYI 4MYTA 4DPWA 4X65I 3GONA 4DV4I 2E5LE 2NUFA 1QU6A 1ZBTA 1BKNA 2F4VI 1ZXMA 2GS8A 2V34A 4WUDA 3OTOE 3ZKDA 3ADLA 1I94I 4X62I 4DUYI 2UUBI 3ADGA 2R42A 1YYWA 4JI6E 1ZXNA 4USKA 2NPFA 4JI1E 4YY3E 2R3VA 4DR4E 5LL6R 1OJ4A 2HHHI 1XMOE 4ZVIA 4B3ME 4DR6I 2UXBI 1PIEA 3LLHA 3T1HE 3CWVA 1ZM3A 1KIJA 4LF8I 3WU4A 3ZKBA 3M6AA 4KQVA 4I3HA 1IBME 2VQEI 4X66I 1Z5AA 1QZRA 3WU6A 3B8HA 4FW9A 1EI1A 2CPNA 4K0KE 1O0WA 4DU8A 3WU3A 3C4BA 4X65E 4X66E 4GKKI 4HACA 4DUYE 2UUBE 4FWDA 1WHQA 4DR5E 4JI3E 4X64I
chains in the Genus database with same CATH superfamily
2EPXA 2K7IA 3ZOQB 1R6LA 4DPXA 4DR1I 1USVA 1FJGI 1B69A 5A2QQ 1T39A 1Z0GA 4B3RI 2LJPA 2JPAA 2O1TA 2L2KB 2WP8B 3B78A 3Q6NA 4DR2E 2L33A 3EQ1A 3MHSC 1N32E 1A6FA 2NUEA 2LRSA 2LT7A 2JE6A 1Z5CA 3C6MA 2M7QA 4X64E 3DJWA 5IT9Q 4LF8E 2RSMA 2M1SA 4OOGC 2BM0A 5KL2A 4BBYA 4JI8I 3WU5A 4R8OA 4R2QA 2WNRA 3PYGA 1EH8A 1ZBQA 2VQEE 2EQ1A 2JEBA 4FW4A 1H7SA 2N3GA 5FLXQ 4GQUA 3KZZA 3L7ZB 4BHBA 4GKJI 2J65A 2EOJA 1N3GA 2F4VE 4R03A 1HNXI 2EPPA 3JAMQ 4DXLA 1YHCA 1EH6A 1WHNA 1D6TA 1N0VC 4X62E 4DV2E 2YTGA 4J3DA 2ENHA 4DV5E 4LU9A 3F0NA 5F3WA 4MDTA 5IWAI 4DV7I 2AJ4A 2XEXA 3D4JA 1HNWE 2EMGA 3KRNA 5LLQA 1H74A 5FWKA 2JOBA 1EA6A 4AM3A 3ADIA 1T4LB 1Y4SA 2C37B 4JI0I 4MU0A 4JI5I 4JI7I 1T4OA 2Z5CA 1E3PA 4IFDC 2WW4A 2YSOA 5A6AA 2ADRA 1TF6A 2D9HA 2PO1B 4ZYHA 1DGCA 4O24A 3B4TA 4P7AA 1Z5BA 1RQ0A 1A1FA 4NXNI 1Z0WA 3PS2A 2B3TB 5A6BD 2EL6A 3T1HI 3HKMA 2EPKX 1N36E 2HFSA 2C39B 3P1XA 3HQ1A 4LF6I 4OO1A 2EJ4A 4LTYA 3Q6MA 2Z5EA 4JV5E 2YTFA 4JI4E 2NA2A 1DI2A 5DNYA 2DRPA 4B3SE 1H7UA 2G7HA 2GO3A 4LF9I 2A2CA 2BA0G 4LF5E 3EPHA 4O5GA 2O1UA 2X36A 2F1DA 5C0XB 2EOHA 4I8OA 1A1GA 4JI1I 4WX9A 3PS1A 4BA2B 2PNMA 4L8NA 2NABA 1N34I 4FWHA 3ZZUA 2YTOA 2EMLA 4DV3E 1A1KA 4HXZA 5A69A 2PO0B 1P42A 3UK3C 1STUA 4NXME 2Q8UA 5A6KA 4M2ZA 2RQLA 3GLLA 2DIXA 1GQEA 2EM9A 4Z7CA 2MKDA 2DMIA 4R2DA 1K47A 1UDNA 3LNUA 2V85A 2JEAB 2V89A 1HK7A 2AE8A 2EPOA 4GEQB 2LVHA 4IZKA 1ZAAC 5ELWA 3B82A 1IBMI 2C38A 3M99B 3J7Yp 4LF4I 1HNWI 4R1FA 4JI2I 2L6MA 3P76A 4R2SA 4B3TE 2UXDI 2DEIA 2JOXA 4Q28A 1ZU1A 3HXLA 2O1WA 3OTOI 1MU5A 2EP3A 1I94E 1YSAC 2EWLA 4F6MA 1G2FC 1IBKI 1LLMC 1H72C 5BR8I 1Z59A 4LPFA 2L3JA 3HPSA 4NXNE 4LF5I 4JI2E 2JR1A 1R6MA 3H09A 1S16A 2EFGA 2V2ZA 1MX0A 2EOEA 2KHXA 3QT8A 4PRVA 1J5EI 1Y5YA 4LFAI 3HULA 3P06A 2LUQA 4BC7A 3J80C 2NUGA 3T1YE 3C4TA 2BB8A 2ENCA 4B3RE 1YUJA 2EM2A 2EMAA 3THOB 1YZ9A 4U3BA 4QNKA 4DPTA 1B62A 4JG4A 1A1LA 1ZM2A 2UUCE 2L2NA 2LUPB 2HKJA 2V8QB 4DV3I 1HR0I 3CDJA 1EKZA 2YTNA 2EQ3A 1B63A 4JI8E 3Q1QA 4R2EA 2Z5CB 3J7AM 4HY1A 2I9IA 4DV6E 4NBQA 2WBUA 4LFCE 1HNZE 4FW7A 1Z0BA 2GLIA 1BBOA 5KL4A 3V5RA 4DR4I 1ELOA 4AIDA 2EMFA 2EMIA 1FWLA 3PYEA 4WPYA 4HYMA 2EOMA 2EN1A 4LF6E 2PNZA 1XMOI 3ZM7A 3NZKA 1X48A 4DV1E 2A2DA 3L7ZA 4IJDA 5TSEA 4R2AA 2L8TA 1S4EA 2KOUA 3JAMC 2ZITA 4KZSA 5IXMB 1N0UA 5C0XA 2L92A 2EMKA 4OX9E 2EN6A 2EQ0A 4WSGA 2ODRD 4LFAE 2EL5A 3EPLA 4R2CA 2E1MA 2RSIA 2BR2B 2ENAA 4DR7E 2VQFE 4DV0E 2PO0A 3DD6A 1Z0EA 4DUZI 2YSPA 2YTDA 1NHIA 5LMNE 4OO1D 5T6JA 3UHMA 3IWBA 3VHTB 4OKGA 2HK2A 2YRKA 4N4RB 5GMEA 3TQMA 1XMQE 2H36X 4IS9A 2N3HA 3M7NG 3H4LA 1GTKA 3JTZA 2R76A 3FIGA 4OO1F 4B3MI 2M9AA 1UN6B 4IFDD 2HC5A 4RPFA 2ZM6E 2L3CA 1XNRE 1N33E 3K1JA 4ZYGA 4YHHI 4LF4E 3LTOA 5LMNI 4N3OA 3J81C 2IESA 5CFFE 4GKJE 1MG7A 4YY3I 4LCFA 4JI3I 5DNXA 4IFDA 4LCHA 3ECRA 4ZYEA 2UXCE 2RTXA 1HR0E 5DRQA 1KYQA 4ZYDA 4DR1E 1XHKA 1YFHA 1UEKA 3M85D 2LJHA 1U2RA 2VE7C 2IOPA 2LE2A 3K85A 4LFCI 3AUZA 5A6JA 2O3ZA 4MLQA 4Z7YA 2EPLX 1UBDC 5EL9A 1N32I 2EORA 2EOFA 2CG9A 5LMUI 1BBGA 4DMIA 1PJTA 1Y6ZA 1USUA 2ELZA 2EOIA 2EOZA 2HJJA 2VF1A 2YTIA 5K36D 4DKKA 5AE2A 1FNMA 4IZJA 3H1CA 1G2DC 1NHHA 4F2JC 4X8WA 2VQFI 1PJQA 1VI7A 2EOYA 4DV0I 5K36A 4J8ZA 2NN6D 2BA0D 1A1IA 4JYAE 1Z0CA 4WUCA 4OX9I 1PJSA 4RHBB 1HNXE 2DGCA 5GMDA 3IWDA 2JVAA 2YTPA 4QNJA 4KHPI 4DUZE 4DV6I 5AASA 3KWRA 4F54A 1RC7A 2HFUA 4U3DA 2EM8A 5A2QC 2PNZB 2EOQA 2EZ6A 4X9JA 5AC4A 3RMPA 2MKNA 2EM4A 5KL7A 2ODRC 1N34E 1FJGE 3K17A 1UHZA 2V2VA 1J26A 2V8PA 2EPCA 4KHPE 2ZM6I 1XNRI 1KTVA 1UDSA 2EM3A 2EL4A 5DRRA 5L3JA 4OO1B 1IMUA 2JEAA 4LFBI 3M7ND 5LMUE 2UXCI 4HEIA 4LOMA 2UUCI 4L5NC 2FTXB 5FLXC 2NN6C 4HTGA 2GPIA 4BCAA 1F2IG 1Y60A 4AIMA 5KL5A 2EN8A 4B3SI 3HPZA 4M9VC 2PO2A 4DR5I 2UUAE 4DV7E 3U1KA 4F6NA 2LV2A 4BHCA 2HK3A 4OZEA 2EM7A 2JYAA 4IFDF 4LFBE 1TF3A 1XMQI 2IERA 1A1JA 1JK2A 2NN6E 2YTJA 1Z0VA 1RMDA 2JP9A 2YZTA 2RS6A 3BIDA 4P7DA 3U1YA 5JEAE 3VYXA 2ZBKB 1N33I 1NZ0A 4DR2I 5BR8E 4FWGA 2CGEA 4NXMI 1UDOA 1YYOA 5C0XE 1DARA 1DQ3A 2Q2EB 4IFDB 4LCGA 1J5EE 3BBGA 1VISA 1YYKA 4WUBA 1RREA 3J80Q 1MEYC 2YPNA 2ELYA 4ED4A 2RS7A 1MGTA 3LPSA 4BS9A 2FGGA 4IZKB 2IHR1 1SFEA 2EE8A 3J7AG 1KVKA 3K6QA 2V86A 4LF9E 2LTSA 2OI2A 4M30A 2JWOA 2KONA 1ZM4A 4XTJA 2CSHA 1WXRA 1FI4A 4MYUA 4BA1B 5C0XC 3ZZ0A 3THNA 3HTXA 4UT4A 1X6EA 2JEBB 2HHHE 2X7IA 2R1FA 1X47A 2JXPA 4WYQB 4DR3I 2DSYA 2E1RA 2EOOA 4FN5A 2BA1G 4IFDE 5JEAB 2CT1A 2CZ9A 1HNZI 1TN9A 4DR6E 2YTEA 3BGHA 1NCSA 1RR9A 5K36B 2UUAI 4JYAI 2JY9A 2VESA 4LF8I 4DU7A 4FW5A 4RH8A 4JI0E 2LTRA 4JI5E 1KKHA 4EMDA 3DF6A 1NEIA 5IT9C 3BF2A 4DR3E 5K36C 5JEAA 4WXDA 5C0XF 4BA1A 5KL3A 4F9AB 1JK1A 1X5WA 2C37A 2F8BA 3IWCA 2Z5BB 2GHFA 4LF7E 1RHYA 1T38A 2UU9E 2C39A 5EKWA 1A1HA 4HACB 1N36I 4K0KI 2UXDE 2YT4A 1FWKA 4Q35B 1YH8A 1WJPA 1XNQE 2B7TA 4O4KA 4MU1A 2NN6A 5K36E 4GZNC 1IBLI 1H73A 1KJKA 2GQ0A 4IZJD 4JI4I 1PVGA 4R2RA 2EMYA 2NN6F 2PNLA 2EPZA 2EN7A 4DV5I 4OO1E 2LO3A 2UXBE 4ISAA 2UU9I 1X3CA 2IOQA 3OMLA 2BV3A 3QT6A 4USMA 5JEAF 2YRHA 3ADJA 3JU0A 3EPKA 4NZVA 3P3CA 4MU4A 4PU9A 4JI7E 1PDAA 2EM0A 1Z0TA 4AQYE 2CVEA 4R2PA 3QT7A 3HJCA 2V2QA 1IBLE 2WBTA 4TUIA 4DV1I 4YHHE 2LMZA 3EPJA 1IBKE 1XXEA 3T1YI 4PRXA 3J81Q 3F6GA 1ZM9A 2E5LI 2EPAA 1PKPA 2NN6B 4FW3A 1YPNA 2EPNA 2LBSB 1IQOA 1OYPA 3QT5A 3V2UC 4DPUA 2BM1A 2HKEA 4P52A 1GZ6A 2VF3A 2EMZA 1UILA 4UTGA 2E72A 2DMYA 4DR7I 4JV5I 5JEAC 4BC9A 4GKKE 3MHHC 4JI6I 4FK5C 3GMEA 2GO4A 2MDRA 4B3TI 2EMCA 4MLVA 1X49A 1X6HA 3PYDA 5DNLA 2EPRA 2V88A 2DB2A 2B7VA 2N8XA 3VYYA 2DEJA 5DRPA 1XNQI 1BB8A 2VRDA 2YRMA 1AAYA 2J7KA 1T4NA 2LJUA 3ZZTA 2WP8A 1IQSA 4WFTA 5IWAE 1ZR9A 4DV2I 2YTQA 3MSWA 2EN3A 3P3EA 3PYFA 5K36F 4DV4E 2L2MA 4LF7I 3PS3A 2HGHA 3KZYA 2WZOA 4URLA 2M4IA 1FKAE 1NHJA 5KL6A 2EOSA 4P78A 1WUUA 4MQYA 4M1KA 4M0VA 1OYSA 4DPYA 2B9DA 4AQYI 2FV4B 3F6HA 1QNTA 4KWYA 2DLKA 4MYTA 4DPWA 5AE1A 4IS1C 2EPUA 4BMJA 4X65I 2CTDA 3GONA 4DV4I 2E5LE 5C0XD 5DROA 2NUFA 4TUGA 1QU6A 1ZBTA 3LMLA 1BKNA 1AH5A 2F4VI 5AE3A 2WBSA 4F9BB 2EN4A 1ZXMA 2GS8A 2V34A 4WUDA 5IV8B 3PRYA 3OTOE 3ZKDA 3ADLA 4BA2A 1I94I 4X62I 4DUYI 5A6BA 4IZJB 2UUBI 3ADGA 2R42A 1YYWA 3C6KA 4O43A 1P47A 4JI6E 1ZXNA 4USKA 1YUIA 2NPFA 2EM5A 4JI1E 4YY3E 4NHRA 2R3VA 4DR4E 2Z5BA 2JT2A 4WXCA 4FW6A 5LL6R 1OJ4A 4OO1C 2HHHI 1XMOE 4ZVIA 4B3ME 2PO1A 2MC6A 2EMWA 2BBGA 2PO2B 3VK6A 5ADZA 1X6FA 2EMBA 4DR6I 2UXBI 1SR9A 3QG5C 1OYRA 1PIEA 2C38B 3LLHA 2EMHA 3T1HE 1ZM3A 1KIJA 3CWVA 1UDQA 1EH7A 2RPCA 2YU5A 4WSPA 1E3HA 2EMXA 3GCMA 3WU4A 3ZKBA 3M6AA 4KQVA 1Z1BA 4MU3A 4I3HA 2EN2A 2LCEA 2MDGA 2EOXA 1IBME 5JEAD 4X66I 2VQEI 1Z5AA 1QZRA 4F9CB 2J7JA 3WU6A 3B8HA 4FW9A 2YU8A 1EI1A 2BR2A 2PRTA 2O1VA 2YWQA 2CPNA 2I13A 5AC5A 4K0KE 1Y4UA 2BA1D 1O0WA 4DU8A 3WU3A 3M85G 3C4BA 1WRJA 2JE6B 4X65E 2MC5A 3P3GA 4X66E 4GKKI 4DUYE 2V87A 2UUBE 4HACA 3AV0A 4FWDA 1WHQA 2EM6A 4DR5E 3L00A 1L4SA 2WCC3 2K4VA 3CDIA 2DLQA 4JI3E 2V83A 2EPMX 2A25A 2WNRB 4X64I
chains in the Genus database with same CATH topology
3ZOQB 4DPXA 4DR1I 1USVA 1FJGI 5A2QQ 1Z0GA 4B3RI 2LJPA 2O1TA 2L2KB 3B78A 3Q6NA 4DR2E 2L33A 1N32E 1A6FA 2NUEA 2LRSA 1Z5CA 2M7QA 4X64E 3DJWA 5IT9Q 4LF8E 2RSMA 2M1SA 4OOGC 2BM0A 3WU5A 4BBYA 4JI8I 4R8OA 3PYGA 2VQEE 1ZBQA 1H7SA 2N3GA 5FLXQ 4GKJI 2F4VE 4R03A 1HNXI 3JAMQ 4DXLA 1WHNA 1D6TA 1N0VC 4X62E 4DV2E 5IWAI 4DV5E 3F0NA 4LU9A 5F3WA 4DV7I 2AJ4A 2XEXA 3D4JA 1HNWE 1H74A 5FWKA 2JOBA 1EA6A 3ADIA 1T4LB 1Y4SA 4JI0I 4JI5I 4JI7I 1T4OA 2Z5CA 2WW4A 4P7AA 1Z5BA 1RQ0A 4NXNI 1Z0WA 2B3TB 3T1HI 1N36E 2HFSA 3P1XA 3HQ1A 4LF6I 4LTYA 3Q6MA 2Z5EA 4JV5E 4JI4E 2NA2A 1DI2A 5DNYA 4B3SE 1H7UA 4LF9I 2G7HA 2A2CA 4LF5E 2O1UA 2X36A 4I8OA 4JI1I 2PNMA 4L8NA 1N34I 4FWHA 3ZZUA 4DV3E 4HXZA 1STUA 4NXME 4M2ZA 2DIXA 1GQEA 4Z7CA 1K47A 3LNUA 2V85A 2V89A 1HK7A 4IZKA 4GEQB 3B82A 1IBMI 3J7Yp 4LF4I 1HNWI 4R1FA 4JI2I 2L6MA 4B3TE 2UXDI 2DEIA 2JOXA 4Q28A 3HXLA 2O1WA 3OTOI 1MU5A 1I94E 2EWLA 1IBKI 1H72C 5BR8I 1Z59A 2L3JA 3HPSA 4NXNE 4LF5I 4JI2E 2JR1A 1S16A 3H09A 2EFGA 2V2ZA 1MX0A 2KHXA 3QT8A 4PRVA 1J5EI 4LFAI 3HULA 3P06A 2LUQA 4BC7A 3J80C 2NUGA 3T1YE 3C4TA 4B3RE 1YZ9A 4DPTA 1B62A 4JG4A 1ZM2A 2UUCE 2L2NA 2LUPB 2HKJA 2V8QB 4DV3I 1HR0I 1EKZA 1B63A 4JI8E 3Q1QA 2Z5CB 3J7AM 4HY1A 4DV6E 4LFCE 1HNZE 1Z0BA 3V5RA 4DR4I 1ELOA 1FWLA 3PYEA 4HYMA 4WPYA 4LF6E 1XMOI 3ZM7A 1X48A 4DV1E 2A2DA 1S4EA 2L8TA 2KOUA 3JAMC 2ZITA 4KZSA 1N0UA 2L92A 4OX9E 2ODRD 4LFAE 2E1MA 4DR7E 2VQFE 4DV0E 4DUZI 1Z0EA 1NHIA 5LMNE 5T6JA 3IWBA 2HK2A 5GMEA 1XMQE 2H36X 2N3HA 3H4LA 3JTZA 3FIGA 4B3MI 4RPFA 2ZM6E 2L3CA 1XNRE 1N33E 3K1JA 4YHHI 4LF4E 3LTOA 5LMNI 4N3OA 3J81C 5CFFE 4GKJE 1MG7A 4YY3I 4JI3I 2UXCE 2RTXA 1HR0E 4DR1E 1XHKA 1UEKA 2LJHA 1U2RA 2VE7C 2IOPA 2LE2A 3K85A 4LFCI 3AUZA 4Z7YA 1N32I 2CG9A 5LMUI 4DMIA 1Y6ZA 1USUA 2VF1A 4DKKA 5AE2A 1FNMA 4IZJA 1NHHA 4X8WA 2VQFI 4DV0I 4J8ZA 4WUCA 4JYAE 1Z0CA 4OX9I 1HNXE 5GMDA 3IWDA 2JVAA 4KHPI 4DUZE 4DV6I 5AASA 3KWRA 4F54A 1RC7A 2HFUA 5A2QC 2EZ6A 3RMPA 1N34E 2ODRC 1FJGE 3K17A 1UHZA 2V2VA 1J26A 2V8PA 2ZM6I 4KHPE 1XNRI 1KTVA 5L3JA 4LFBI 5LMUE 2UXCI 2UUCI 4L5NC 2FTXB 5FLXC 4BCAA 4B3SI 3HPZA 4DR5I 2UUAE 4DV7E 2HK3A 4LFBE 1XMQI 1Z0VA 2YZTA 2RS6A 4P7DA 3VYXA 2ZBKB 1N33I 1NZ0A 4DR2I 5BR8E 4FWGA 2CGEA 4NXMI 1YYOA 1DARA 1DQ3A 2Q2EB 1J5EE 1VISA 4WUBA 1YYKA 1RREA 3J80Q 4ED4A 2RS7A 3LPSA 4IZKB 4BS9A 2FGGA 2IHR1 1KVKA 3J7AG 3K6QA 2V86A 4LF9E 2LTSA 2OI2A 4M30A 2JWOA 2KONA 1ZM4A 4XTJA 4MYUA 1WXRA 1FI4A 3ZZ0A 3HTXA 4UT4A 2HHHE 2X7IA 1X47A 4WYQB 4DR3I 2DSYA 2E1RA 4FN5A 2CZ9A 1HNZI 4DR6E 1RR9A 2UUAI 4JYAI 2JY9A 4DU7A 4JI0E 4JI5E 2LTRA 1KKHA 4EMDA 3DF6A 5IT9C 4DR3E 4F9AB 2F8BA 3IWCA 2Z5BB 4LF7E 2UU9E 4HACB 1N36I 4K0KI 2UXDE 2YT4A 1FWKA 4B3TI 1XNQE 2B7TA 1IBLI 1H73A 2GQ0A 4IZJD 4JI4I 1PVGA 2PNLA 4DV5I 2UXBE 2UU9I 2IOQA 3OMLA 2BV3A 3QT6A 4USMA 3ADJA 3JU0A 4PU9A 4JI7E 1Z0TA 3QT7A 4AQYE 3HJCA 2V2QA 1IBLE 4TUIA 4DV1I 4YHHE 2LMZA 1IBKE 3T1YI 4PRXA 3J81Q 3F6GA 1ZM9A 2E5LI 1PKPA 2LBSB 3QT5A 3V2UC 4DPUA 2BM1A 2HKEA 4P52A 1GZ6A 2VF3A 1UILA 4UTGA 2DMYA 4DR7I 4JV5I 4BC9A 4GKKE 4JI6I 2MDRA 3PYDA 1X49A 2V88A 2DB2A 2B7VA 3VYYA 2DEJA 1XNQI 2J7KA 3ZZTA 1T4NA 4WFTA 5IWAE 4DV2I 3MSWA 3PYFA 4DV4E 2L2MA 4LF7I 2WZOA 4URLA 2M4IA 1FKAE 1NHJA 4P78A 1WUUA 4M1KA 4M0VA 4DPYA 2B9DA 4AQYI 2FV4B 3F6HA 4MYTA 4DPWA 5AE1A 4BMJA 4X65I 3GONA 4DV4I 2E5LE 2NUFA 4TUGA 1QU6A 1ZBTA 3LMLA 1BKNA 2F4VI 5AE3A 1ZXMA 4F9BB 2GS8A 2V34A 4WUDA 3PRYA 3OTOE 3ZKDA 3ADLA 1I94I 4X62I 4DUYI 4IZJB 2UUBI 3ADGA 2R42A 1YYWA 4JI6E 1ZXNA 4USKA 2NPFA 4JI1E 2Z5BA 4YY3E 2R3VA 4DR4E 5LL6R 1OJ4A 2HHHI 1XMOE 4ZVIA 4B3ME 2MC6A 3VK6A 5ADZA 4DR6I 2UXBI 1SR9A 1PIEA 3LLHA 3T1HE 3CWVA 1ZM3A 1KIJA 4LF8I 4WSPA 3WU4A 3ZKBA 3M6AA 4KQVA 4I3HA 1IBME 2VQEI 4X66I 1Z5AA 1QZRA 4F9CB 3WU6A 3B8HA 4FW9A 1EI1A 2O1VA 2CPNA 4K0KE 1Y4UA 1O0WA 4DU8A 3WU3A 3C4BA 4X65E 2MC5A 4X66E 4GKKI 4DUYE 2V87A 2UUBE 4HACA 3AV0A 4FWDA 1WHQA 4DR5E 2K4VA 4JI3E 2V83A 4X64I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPX A;  4DR1 I;  1FJG I;  5A2Q Q;  1Z0G A;  4B3R I;  2LJP A;  2L2K B;  3B78 A;  4DR2 E;  2L33 A;  1N32 E;  1A6F A;  2NUE A;  2LRS A;  1Z5C A;  4X64 E;  5IT9 Q;  4LF8 E;  2RSM A;  3WU5 A;  4OOG C;  2BM0 A;  4JI8 I;  3PYG A;  2VQE E;  1H7S A;  2N3G A;  5FLX Q;  4GKJ I;  2F4V E;  1HNX I;  3JAM Q;  4DXL A;  1WHN A;  1D6T A;  1N0V C;  4X62 E;  4DV2 E;  5IWA I;  4DV5 E;  3F0N A;  4DV7 I;  2AJ4 A;  2XEX A;  3D4J A;  1HNW E;  1H74 A;  1EA6 A;  3ADI A;  1T4L B;  4JI0 I;  4JI5 I;  4JI7 I;  1T4O A;  2WW4 A;  4P7A A;  1Z5B A;  1RQ0 A;  4NXN I;  1Z0W A;  2B3T B;  3T1H I;  1N36 E;  2HFS A;  3P1X A;  4LF6 I;  4JV5 E;  4JI4 E;  2NA2 A;  1DI2 A;  4B3S E;  1H7U A;  4LF9 I;  2A2C A;  4LF5 E;  2X36 A;  4JI1 I;  1N34 I;  4FWH A;  3ZZU A;  4DV3 E;  4HXZ A;  1STU A;  4NXM E;  4M2Z A;  2DIX A;  1GQE A;  4Z7C A;  1K47 A;  3LNU A;  3B82 A;  1IBM I;  3J7Y p;  4LF4 I;  1HNW I;  4R1F A;  4JI2 I;  4B3T E;  2UXD I;  2DEI A;  3OTO I;  1MU5 A;  1I94 E;  1IBK I;  1H72 C;  5BR8 I;  1Z59 A;  2L3J A;  4NXN E;  4LF5 I;  4JI2 E;  1S16 A;  2EFG A;  2V2Z A;  1MX0 A;  2KHX A;  3QT8 A;  4PRV A;  1J5E I;  4LFA I;  3HUL A;  2LUQ A;  3J80 C;  2NUG A;  3T1Y E;  3C4T A;  4B3R E;  1YZ9 A;  4DPT A;  1B62 A;  4JG4 A;  1ZM2 A;  2UUC E;  2L2N A;  2LUP B;  2HKJ A;  4DV3 I;  1HR0 I;  1EKZ A;  1B63 A;  4JI8 E;  3Q1Q A;  3J7A M;  4HY1 A;  4DV6 E;  4LFC E;  1HNZ E;  1Z0B A;  3V5R A;  4DR4 I;  1ELO A;  1FWL A;  3PYE A;  4HYM A;  4LF6 E;  1XMO I;  3ZM7 A;  1X48 A;  4DV1 E;  2A2D A;  1S4E A;  3JAM C;  2ZIT A;  1N0U A;  4OX9 E;  4LFA E;  4DR7 E;  2VQF E;  4DV0 E;  4DUZ I;  1Z0E A;  1NHI A;  5LMN E;  2HK2 A;  5GME A;  1XMQ E;  2N3H A;  3H4L A;  4B3M I;  4RPF A;  2ZM6 E;  2L3C A;  1XNR E;  1N33 E;  3K1J A;  4YHH I;  4LF4 E;  3LTO A;  5LMN I;  3J81 C;  5CFF E;  4GKJ E;  1MG7 A;  4YY3 I;  4JI3 I;  2UXC E;  2RTX A;  1HR0 E;  4DR1 E;  1XHK A;  1UEK A;  2LJH A;  1U2R A;  4LFC I;  4Z7Y A;  1N32 I;  5LMU I;  4DKK A;  1FNM A;  1NHH A;  4X8W A;  2VQF I;  4DV0 I;  4WUC A;  4JYA E;  1Z0C A;  4OX9 I;  1HNX E;  5GMD A;  2JVA A;  4KHP I;  4DUZ E;  4DV6 I;  1RC7 A;  2HFU A;  5A2Q C;  2EZ6 A;  1N34 E;  1FJG E;  3K17 A;  1UHZ A;  2V2V A;  1J26 A;  2V8P A;  2ZM6 I;  4KHP E;  1XNR I;  1KTV A;  5L3J A;  4LFB I;  5LMU E;  2UXC I;  2UUC I;  5FLX C;  4B3S I;  4DR5 I;  2UUA E;  4DV7 E;  2HK3 A;  4LFB E;  1XMQ I;  1Z0V A;  2RS6 A;  3VYX A;  2ZBK B;  1N33 I;  1NZ0 A;  4DR2 I;  5BR8 E;  4FWG A;  4NXM I;  1YYO A;  1DAR A;  2Q2E B;  1J5E E;  1VIS A;  4WUB A;  1YYK A;  1RRE A;  3J80 Q;  4ED4 A;  2RS7 A;  3LPS A;  2IHR 1;  1KVK A;  3J7A G;  4LF9 E;  2OI2 A;  2LTS A;  4M30 A;  1ZM4 A;  4XTJ A;  4MYU A;  1FI4 A;  3ZZ0 A;  3HTX A;  4UT4 A;  2X7I A;  2HHH E;  1X47 A;  4WYQ B;  4DR3 I;  2E1R A;  4FN5 A;  2CZ9 A;  1HNZ I;  4DR6 E;  1RR9 A;  2UUA I;  4JYA I;  2JY9 A;  4DU7 A;  4JI0 E;  4JI5 E;  2LTR A;  1KKH A;  4EMD A;  5IT9 C;  4DR3 E;  4LF7 E;  2UU9 E;  4HAC B;  1N36 I;  4K0K I;  2UXD E;  2YT4 A;  1FWK A;  4B3T I;  1XNQ E;  2B7T A;  1IBL I;  1H73 A;  4JI4 I;  1PVG A;  4DV5 I;  2UXB E;  2UU9 I;  2BV3 A;  3QT6 A;  4USM A;  3ADJ A;  4PU9 A;  4JI7 E;  1Z0T A;  3QT7 A;  4AQY E;  2V2Q A;  1IBL E;  4DV1 I;  4YHH E;  1IBK E;  3T1Y I;  4PRX A;  3J81 Q;  1ZM9 A;  2E5L I;  1PKP A;  2LBS B;  3QT5 A;  3V2U C;  4DPU A;  2BM1 A;  2HKE A;  4P52 A;  2VF3 A;  1UIL A;  4UTG A;  2DMY A;  4DR7 I;  4JV5 I;  4GKK E;  4JI6 I;  2MDR A;  3PYD A;  1X49 A;  2DB2 A;  3VYY A;  2B7V A;  2DEJ A;  1XNQ I;  2J7K A;  3ZZT A;  1T4N A;  4WFT A;  5IWA E;  4DV2 I;  3PYF A;  4DV4 E;  2L2M A;  4LF7 I;  4URL A;  1FKA E;  1NHJ A;  1WUU A;  4M1K A;  4DPY A;  4AQY I;  4MYT A;  4DPW A;  4X65 I;  3GON A;  4DV4 I;  2E5L E;  2NUF A;  1QU6 A;  1ZBT A;  1BKN A;  2F4V I;  1ZXM A;  2GS8 A;  2V34 A;  4WUD A;  3OTO E;  3ZKD A;  3ADL A;  1I94 I;  4X62 I;  4DUY I;  2UUB I;  3ADG A;  2R42 A;  1YYW A;  4JI6 E;  1ZXN A;  4USK A;  2NPF A;  4JI1 E;  4YY3 E;  2R3V A;  4DR4 E;  5LL6 R;  1OJ4 A;  2HHH I;  1XMO E;  4ZVI A;  4B3M E;  4DR6 I;  2UXB I;  1PIE A;  3LLH A;  3T1H E;  3CWV A;  1ZM3 A;  1KIJ A;  4LF8 I;  3WU4 A;  3ZKB A;  3M6A A;  4KQV A;  4I3H A;  1IBM E;  2VQE I;  4X66 I;  1Z5A A;  1QZR A;  3WU6 A;  3B8H A;  4FW9 A;  1EI1 A;  2CPN A;  4K0K E;  1O0W A;  4DU8 A;  3WU3 A;  3C4B A;  4X65 E;  4X66 E;  4GKK I;  4HAC A;  4DUY E;  2UUB E;  4FWD A;  1WHQ A;  4DR5 E;  4JI3 E;  4X64 I; 
#chains in the Genus database with same CATH topology
 2EPX A;  2K7I A;  3ZOQ B;  1R6L A;  4DPX A;  4DR1 I;  1USV A;  1FJG I;  1B69 A;  5A2Q Q;  1T39 A;  1Z0G A;  4B3R I;  2LJP A;  2JPA A;  2O1T A;  2L2K B;  2WP8 B;  3B78 A;  3Q6N A;  4DR2 E;  2L33 A;  3EQ1 A;  3MHS C;  1N32 E;  1A6F A;  2NUE A;  2LRS A;  2LT7 A;  2JE6 A;  1Z5C A;  3C6M A;  2M7Q A;  4X64 E;  3DJW A;  5IT9 Q;  4LF8 E;  2RSM A;  2M1S A;  4OOG C;  2BM0 A;  5KL2 A;  4BBY A;  4JI8 I;  3WU5 A;  4R8O A;  4R2Q A;  2WNR A;  3PYG A;  1EH8 A;  1ZBQ A;  2VQE E;  2EQ1 A;  2JEB A;  4FW4 A;  1H7S A;  2N3G A;  5FLX Q;  4GQU A;  3KZZ A;  3L7Z B;  4BHB A;  4GKJ I;  2J65 A;  2EOJ A;  1N3G A;  2F4V E;  4R03 A;  1HNX I;  2EPP A;  3JAM Q;  4DXL A;  1YHC A;  1EH6 A;  1WHN A;  1D6T A;  1N0V C;  4X62 E;  4DV2 E;  2YTG A;  4J3D A;  2ENH A;  4DV5 E;  4LU9 A;  3F0N A;  5F3W A;  4MDT A;  5IWA I;  4DV7 I;  2AJ4 A;  2XEX A;  3D4J A;  1HNW E;  2EMG A;  3KRN A;  5LLQ A;  1H74 A;  5FWK A;  2JOB A;  1EA6 A;  4AM3 A;  3ADI A;  1T4L B;  1Y4S A;  2C37 B;  4JI0 I;  4MU0 A;  4JI5 I;  4JI7 I;  1T4O A;  2Z5C A;  1E3P A;  4IFD C;  2WW4 A;  2YSO A;  5A6A A;  2ADR A;  1TF6 A;  2D9H A;  2PO1 B;  4ZYH A;  1DGC A;  4O24 A;  3B4T A;  4P7A A;  1Z5B A;  1RQ0 A;  1A1F A;  4NXN I;  1Z0W A;  3PS2 A;  2B3T B;  5A6B D;  2EL6 A;  3T1H I;  3HKM A;  2EPK X;  1N36 E;  2HFS A;  2C39 B;  3P1X A;  3HQ1 A;  4LF6 I;  4OO1 A;  2EJ4 A;  4LTY A;  3Q6M A;  2Z5E A;  4JV5 E;  2YTF A;  4JI4 E;  2NA2 A;  1DI2 A;  5DNY A;  2DRP A;  4B3S E;  1H7U A;  2G7H A;  2GO3 A;  4LF9 I;  2A2C A;  2BA0 G;  4LF5 E;  3EPH A;  4O5G A;  2O1U A;  2X36 A;  2F1D A;  5C0X B;  2EOH A;  4I8O A;  1A1G A;  4JI1 I;  4WX9 A;  3PS1 A;  4BA2 B;  2PNM A;  4L8N A;  2NAB A;  1N34 I;  4FWH A;  3ZZU A;  2YTO A;  2EML A;  4DV3 E;  1A1K A;  4HXZ A;  5A69 A;  2PO0 B;  1P42 A;  3UK3 C;  1STU A;  4NXM E;  2Q8U A;  5A6K A;  4M2Z A;  2RQL A;  3GLL A;  2DIX A;  1GQE A;  2EM9 A;  4Z7C A;  2MKD A;  2DMI A;  4R2D A;  1K47 A;  1UDN A;  3LNU A;  2V85 A;  2JEA B;  2V89 A;  1HK7 A;  2AE8 A;  2EPO A;  4GEQ B;  2LVH A;  4IZK A;  1ZAA C;  5ELW A;  3B82 A;  1IBM I;  2C38 A;  3M99 B;  3J7Y p;  4LF4 I;  1HNW I;  4R1F A;  4JI2 I;  2L6M A;  3P76 A;  4R2S A;  4B3T E;  2UXD I;  2DEI A;  2JOX A;  4Q28 A;  1ZU1 A;  3HXL A;  2O1W A;  3OTO I;  1MU5 A;  2EP3 A;  1I94 E;  1YSA C;  2EWL A;  4F6M A;  1G2F C;  1IBK I;  1LLM C;  1H72 C;  5BR8 I;  1Z59 A;  4LPF A;  2L3J A;  3HPS A;  4NXN E;  4LF5 I;  4JI2 E;  2JR1 A;  1R6M A;  3H09 A;  1S16 A;  2EFG A;  2V2Z A;  1MX0 A;  2EOE A;  2KHX A;  3QT8 A;  4PRV A;  1J5E I;  1Y5Y A;  4LFA I;  3HUL A;  3P06 A;  2LUQ A;  4BC7 A;  3J80 C;  2NUG A;  3T1Y E;  3C4T A;  2BB8 A;  2ENC A;  4B3R E;  1YUJ A;  2EM2 A;  2EMA A;  3THO B;  1YZ9 A;  4U3B A;  4QNK A;  4DPT A;  1B62 A;  4JG4 A;  1A1L A;  1ZM2 A;  2UUC E;  2L2N A;  2LUP B;  2HKJ A;  2V8Q B;  4DV3 I;  1HR0 I;  3CDJ A;  1EKZ A;  2YTN A;  2EQ3 A;  1B63 A;  4JI8 E;  3Q1Q A;  4R2E A;  2Z5C B;  3J7A M;  4HY1 A;  2I9I A;  4DV6 E;  4NBQ A;  2WBU A;  4LFC E;  1HNZ E;  4FW7 A;  1Z0B A;  2GLI A;  1BBO A;  5KL4 A;  3V5R A;  4DR4 I;  1ELO A;  4AID A;  2EMF A;  2EMI A;  1FWL A;  3PYE A;  4WPY A;  4HYM A;  2EOM A;  2EN1 A;  4LF6 E;  2PNZ A;  1XMO I;  3ZM7 A;  3NZK A;  1X48 A;  4DV1 E;  2A2D A;  3L7Z A;  4IJD A;  5TSE A;  4R2A A;  2L8T A;  1S4E A;  2KOU A;  3JAM C;  2ZIT A;  4KZS A;  5IXM B;  1N0U A;  5C0X A;  2L92 A;  2EMK A;  4OX9 E;  2EN6 A;  2EQ0 A;  4WSG A;  2ODR D;  4LFA E;  2EL5 A;  3EPL A;  4R2C A;  2E1M A;  2RSI A;  2BR2 B;  2ENA A;  4DR7 E;  2VQF E;  4DV0 E;  2PO0 A;  3DD6 A;  1Z0E A;  4DUZ I;  2YSP A;  2YTD A;  1NHI A;  5LMN E;  4OO1 D;  5T6J A;  3UHM A;  3IWB A;  3VHT B;  4OKG A;  2HK2 A;  2YRK A;  4N4R B;  5GME A;  3TQM A;  1XMQ E;  2H36 X;  4IS9 A;  2N3H A;  3M7N G;  3H4L A;  1GTK A;  3JTZ A;  2R76 A;  3FIG A;  4OO1 F;  4B3M I;  2M9A A;  1UN6 B;  4IFD D;  2HC5 A;  4RPF A;  2ZM6 E;  2L3C A;  1XNR E;  1N33 E;  3K1J A;  4ZYG A;  4YHH I;  4LF4 E;  3LTO A;  5LMN I;  4N3O A;  3J81 C;  2IES A;  5CFF E;  4GKJ E;  1MG7 A;  4YY3 I;  4LCF A;  4JI3 I;  5DNX A;  4IFD A;  4LCH A;  3ECR A;  4ZYE A;  2UXC E;  2RTX A;  1HR0 E;  5DRQ A;  1KYQ A;  4ZYD A;  4DR1 E;  1XHK A;  1YFH A;  1UEK A;  3M85 D;  2LJH A;  1U2R A;  2VE7 C;  2IOP A;  2LE2 A;  3K85 A;  4LFC I;  3AUZ A;  5A6J A;  2O3Z A;  4MLQ A;  4Z7Y A;  2EPL X;  1UBD C;  5EL9 A;  1N32 I;  2EOR A;  2EOF A;  2CG9 A;  5LMU I;  1BBG A;  4DMI A;  1PJT A;  1Y6Z A;  1USU A;  2ELZ A;  2EOI A;  2EOZ A;  2HJJ A;  2VF1 A;  2YTI A;  5K36 D;  4DKK A;  5AE2 A;  1FNM A;  4IZJ A;  3H1C A;  1G2D C;  1NHH A;  4F2J C;  4X8W A;  2VQF I;  1PJQ A;  1VI7 A;  2EOY A;  4DV0 I;  5K36 A;  4J8Z A;  2NN6 D;  2BA0 D;  1A1I A;  4JYA E;  1Z0C A;  4WUC A;  4OX9 I;  1PJS A;  4RHB B;  1HNX E;  2DGC A;  5GMD A;  3IWD A;  2JVA A;  2YTP A;  4QNJ A;  4KHP I;  4DUZ E;  4DV6 I;  5AAS A;  3KWR A;  4F54 A;  1RC7 A;  2HFU A;  4U3D A;  2EM8 A;  5A2Q C;  2PNZ B;  2EOQ A;  2EZ6 A;  4X9J A;  5AC4 A;  3RMP A;  2MKN A;  2EM4 A;  5KL7 A;  2ODR C;  1N34 E;  1FJG E;  3K17 A;  1UHZ A;  2V2V A;  1J26 A;  2V8P A;  2EPC A;  4KHP E;  2ZM6 I;  1XNR I;  1KTV A;  1UDS A;  2EM3 A;  2EL4 A;  5DRR A;  5L3J A;  4OO1 B;  1IMU A;  2JEA A;  4LFB I;  3M7N D;  5LMU E;  2UXC I;  4HEI A;  4LOM A;  2UUC I;  4L5N C;  2FTX B;  5FLX C;  2NN6 C;  4HTG A;  2GPI A;  4BCA A;  1F2I G;  1Y60 A;  4AIM A;  5KL5 A;  2EN8 A;  4B3S I;  3HPZ A;  4M9V C;  2PO2 A;  4DR5 I;  2UUA E;  4DV7 E;  3U1K A;  4F6N A;  2LV2 A;  4BHC A;  2HK3 A;  4OZE A;  2EM7 A;  2JYA A;  4IFD F;  4LFB E;  1TF3 A;  1XMQ I;  2IER A;  1A1J A;  1JK2 A;  2NN6 E;  2YTJ A;  1Z0V A;  1RMD A;  2JP9 A;  2YZT A;  2RS6 A;  3BID A;  4P7D A;  3U1Y A;  5JEA E;  3VYX A;  2ZBK B;  1N33 I;  1NZ0 A;  4DR2 I;  5BR8 E;  4FWG A;  2CGE A;  4NXM I;  1UDO A;  1YYO A;  5C0X E;  1DAR A;  1DQ3 A;  2Q2E B;  4IFD B;  4LCG A;  1J5E E;  3BBG A;  1VIS A;  1YYK A;  4WUB A;  1RRE A;  3J80 Q;  1MEY C;  2YPN A;  2ELY A;  4ED4 A;  2RS7 A;  1MGT A;  3LPS A;  4BS9 A;  2FGG A;  4IZK B;  2IHR 1;  1SFE A;  2EE8 A;  3J7A G;  1KVK A;  3K6Q A;  2V86 A;  4LF9 E;  2LTS A;  2OI2 A;  4M30 A;  2JWO A;  2KON A;  1ZM4 A;  4XTJ A;  2CSH A;  1WXR A;  1FI4 A;  4MYU A;  4BA1 B;  5C0X C;  3ZZ0 A;  3THN A;  3HTX A;  4UT4 A;  1X6E A;  2JEB B;  2HHH E;  2X7I A;  2R1F A;  1X47 A;  2JXP A;  4WYQ B;  4DR3 I;  2DSY A;  2E1R A;  2EOO A;  4FN5 A;  2BA1 G;  4IFD E;  5JEA B;  2CT1 A;  2CZ9 A;  1HNZ I;  1TN9 A;  4DR6 E;  2YTE A;  3BGH A;  1NCS A;  1RR9 A;  5K36 B;  2UUA I;  4JYA I;  2JY9 A;  2VES A;  4LF8 I;  4DU7 A;  4FW5 A;  4RH8 A;  4JI0 E;  2LTR A;  4JI5 E;  1KKH A;  4EMD A;  3DF6 A;  1NEI A;  5IT9 C;  3BF2 A;  4DR3 E;  5K36 C;  5JEA A;  4WXD A;  5C0X F;  4BA1 A;  5KL3 A;  4F9A B;  1JK1 A;  1X5W A;  2C37 A;  2F8B A;  3IWC A;  2Z5B B;  2GHF A;  4LF7 E;  1RHY A;  1T38 A;  2UU9 E;  2C39 A;  5EKW A;  1A1H A;  4HAC B;  1N36 I;  4K0K I;  2UXD E;  2YT4 A;  1FWK A;  4Q35 B;  1YH8 A;  1WJP A;  1XNQ E;  2B7T A;  4O4K A;  4MU1 A;  2NN6 A;  5K36 E;  4GZN C;  1IBL I;  1H73 A;  1KJK A;  2GQ0 A;  4IZJ D;  4JI4 I;  1PVG A;  4R2R A;  2EMY A;  2NN6 F;  2PNL A;  2EPZ A;  2EN7 A;  4DV5 I;  4OO1 E;  2LO3 A;  2UXB E;  4ISA A;  2UU9 I;  1X3C A;  2IOQ A;  3OML A;  2BV3 A;  3QT6 A;  4USM A;  5JEA F;  2YRH A;  3ADJ A;  3JU0 A;  3EPK A;  4NZV A;  3P3C A;  4MU4 A;  4PU9 A;  4JI7 E;  1PDA A;  2EM0 A;  1Z0T A;  4AQY E;  2CVE A;  4R2P A;  3QT7 A;  3HJC A;  2V2Q A;  1IBL E;  2WBT A;  4TUI A;  4DV1 I;  4YHH E;  2LMZ A;  3EPJ A;  1IBK E;  1XXE A;  3T1Y I;  4PRX A;  3J81 Q;  3F6G A;  1ZM9 A;  2E5L I;  2EPA A;  1PKP A;  2NN6 B;  4FW3 A;  1YPN A;  2EPN A;  2LBS B;  1IQO A;  1OYP A;  3QT5 A;  3V2U C;  4DPU A;  2BM1 A;  2HKE A;  4P52 A;  1GZ6 A;  2VF3 A;  2EMZ A;  1UIL A;  4UTG A;  2E72 A;  2DMY A;  4DR7 I;  4JV5 I;  5JEA C;  4BC9 A;  4GKK E;  3MHH C;  4JI6 I;  4FK5 C;  3GME A;  2GO4 A;  2MDR A;  4B3T I;  2EMC A;  4MLV A;  1X49 A;  1X6H A;  3PYD A;  5DNL A;  2EPR A;  2V88 A;  2DB2 A;  2B7V A;  2N8X A;  3VYY A;  2DEJ A;  5DRP A;  1XNQ I;  1BB8 A;  2VRD A;  2YRM A;  1AAY A;  2J7K A;  1T4N A;  2LJU A;  3ZZT A;  2WP8 A;  1IQS A;  4WFT A;  5IWA E;  1ZR9 A;  4DV2 I;  2YTQ A;  3MSW A;  2EN3 A;  3P3E A;  3PYF A;  5K36 F;  4DV4 E;  2L2M A;  4LF7 I;  3PS3 A;  2HGH A;  3KZY A;  2WZO A;  4URL A;  2M4I A;  1FKA E;  1NHJ A;  5KL6 A;  2EOS A;  4P78 A;  1WUU A;  4MQY A;  4M1K A;  4M0V A;  1OYS A;  4DPY A;  2B9D A;  4AQY I;  2FV4 B;  3F6H A;  1QNT A;  4KWY A;  2DLK A;  4MYT A;  4DPW A;  5AE1 A;  4IS1 C;  2EPU A;  4BMJ A;  4X65 I;  2CTD A;  3GON A;  4DV4 I;  2E5L E;  5C0X D;  5DRO A;  2NUF A;  4TUG A;  1QU6 A;  1ZBT A;  3LML A;  1BKN A;  1AH5 A;  2F4V I;  5AE3 A;  2WBS A;  4F9B B;  2EN4 A;  1ZXM A;  2GS8 A;  2V34 A;  4WUD A;  5IV8 B;  3PRY A;  3OTO E;  3ZKD A;  3ADL A;  4BA2 A;  1I94 I;  4X62 I;  4DUY I;  5A6B A;  4IZJ B;  2UUB I;  3ADG A;  2R42 A;  1YYW A;  3C6K A;  4O43 A;  1P47 A;  4JI6 E;  1ZXN A;  4USK A;  1YUI A;  2NPF A;  2EM5 A;  4JI1 E;  4YY3 E;  4NHR A;  2R3V A;  4DR4 E;  2Z5B A;  2JT2 A;  4WXC A;  4FW6 A;  5LL6 R;  1OJ4 A;  4OO1 C;  2HHH I;  1XMO E;  4ZVI A;  4B3M E;  2PO1 A;  2MC6 A;  2EMW A;  2BBG A;  2PO2 B;  3VK6 A;  5ADZ A;  1X6F A;  2EMB A;  4DR6 I;  2UXB I;  1SR9 A;  3QG5 C;  1OYR A;  1PIE A;  2C38 B;  3LLH A;  2EMH A;  3T1H E;  1ZM3 A;  1KIJ A;  3CWV A;  1UDQ A;  1EH7 A;  2RPC A;  2YU5 A;  4WSP A;  1E3H A;  2EMX A;  3GCM A;  3WU4 A;  3ZKB A;  3M6A A;  4KQV A;  1Z1B A;  4MU3 A;  4I3H A;  2EN2 A;  2LCE A;  2MDG A;  2EOX A;  1IBM E;  5JEA D;  4X66 I;  2VQE I;  1Z5A A;  1QZR A;  4F9C B;  2J7J A;  3WU6 A;  3B8H A;  4FW9 A;  2YU8 A;  1EI1 A;  2BR2 A;  2PRT A;  2O1V A;  2YWQ A;  2CPN A;  2I13 A;  5AC5 A;  4K0K E;  1Y4U A;  2BA1 D;  1O0W A;  4DU8 A;  3WU3 A;  3M85 G;  3C4B A;  1WRJ A;  2JE6 B;  4X65 E;  2MC5 A;  3P3G A;  4X66 E;  4GKK I;  4DUY E;  2V87 A;  2UUB E;  4HAC A;  3AV0 A;  4FWD A;  1WHQ A;  2EM6 A;  4DR5 E;  3L00 A;  1L4S A;  2WCC 3;  2K4V A;  3CDI A;  2DLQ A;  4JI3 E;  2V83 A;  2EPM X;  2A25 A;  2WNR B;  4X64 I; 
#chains in the Genus database with same CATH homology
 3ZOQ B;  4DPX A;  4DR1 I;  1USV A;  1FJG I;  5A2Q Q;  1Z0G A;  4B3R I;  2LJP A;  2O1T A;  2L2K B;  3B78 A;  3Q6N A;  4DR2 E;  2L33 A;  1N32 E;  1A6F A;  2NUE A;  2LRS A;  1Z5C A;  2M7Q A;  4X64 E;  3DJW A;  5IT9 Q;  4LF8 E;  2RSM A;  2M1S A;  4OOG C;  2BM0 A;  3WU5 A;  4BBY A;  4JI8 I;  4R8O A;  3PYG A;  2VQE E;  1ZBQ A;  1H7S A;  2N3G A;  5FLX Q;  4GKJ I;  2F4V E;  4R03 A;  1HNX I;  3JAM Q;  4DXL A;  1WHN A;  1D6T A;  1N0V C;  4X62 E;  4DV2 E;  5IWA I;  4DV5 E;  3F0N A;  4LU9 A;  5F3W A;  4DV7 I;  2AJ4 A;  2XEX A;  3D4J A;  1HNW E;  1H74 A;  5FWK A;  2JOB A;  1EA6 A;  3ADI A;  1T4L B;  1Y4S A;  4JI0 I;  4JI5 I;  4JI7 I;  1T4O A;  2Z5C A;  2WW4 A;  4P7A A;  1Z5B A;  1RQ0 A;  4NXN I;  1Z0W A;  2B3T B;  3T1H I;  1N36 E;  2HFS A;  3P1X A;  3HQ1 A;  4LF6 I;  4LTY A;  3Q6M A;  2Z5E A;  4JV5 E;  4JI4 E;  2NA2 A;  1DI2 A;  5DNY A;  4B3S E;  1H7U A;  4LF9 I;  2G7H A;  2A2C A;  4LF5 E;  2O1U A;  2X36 A;  4I8O A;  4JI1 I;  2PNM A;  4L8N A;  1N34 I;  4FWH A;  3ZZU A;  4DV3 E;  4HXZ A;  1STU A;  4NXM E;  4M2Z A;  2DIX A;  1GQE A;  4Z7C A;  1K47 A;  3LNU A;  2V85 A;  2V89 A;  1HK7 A;  4IZK A;  4GEQ B;  3B82 A;  1IBM I;  3J7Y p;  4LF4 I;  1HNW I;  4R1F A;  4JI2 I;  2L6M A;  4B3T E;  2UXD I;  2DEI A;  2JOX A;  4Q28 A;  3HXL A;  2O1W A;  3OTO I;  1MU5 A;  1I94 E;  2EWL A;  1IBK I;  1H72 C;  5BR8 I;  1Z59 A;  2L3J A;  3HPS A;  4NXN E;  4LF5 I;  4JI2 E;  2JR1 A;  1S16 A;  3H09 A;  2EFG A;  2V2Z A;  1MX0 A;  2KHX A;  3QT8 A;  4PRV A;  1J5E I;  4LFA I;  3HUL A;  3P06 A;  2LUQ A;  4BC7 A;  3J80 C;  2NUG A;  3T1Y E;  3C4T A;  4B3R E;  1YZ9 A;  4DPT A;  1B62 A;  4JG4 A;  1ZM2 A;  2UUC E;  2L2N A;  2LUP B;  2HKJ A;  2V8Q B;  4DV3 I;  1HR0 I;  1EKZ A;  1B63 A;  4JI8 E;  3Q1Q A;  2Z5C B;  3J7A M;  4HY1 A;  4DV6 E;  4LFC E;  1HNZ E;  1Z0B A;  3V5R A;  4DR4 I;  1ELO A;  1FWL A;  3PYE A;  4HYM A;  4WPY A;  4LF6 E;  1XMO I;  3ZM7 A;  1X48 A;  4DV1 E;  2A2D A;  1S4E A;  2L8T A;  2KOU A;  3JAM C;  2ZIT A;  4KZS A;  1N0U A;  2L92 A;  4OX9 E;  2ODR D;  4LFA E;  2E1M A;  4DR7 E;  2VQF E;  4DV0 E;  4DUZ I;  1Z0E A;  1NHI A;  5LMN E;  5T6J A;  3IWB A;  2HK2 A;  5GME A;  1XMQ E;  2H36 X;  2N3H A;  3H4L A;  3JTZ A;  3FIG A;  4B3M I;  4RPF A;  2ZM6 E;  2L3C A;  1XNR E;  1N33 E;  3K1J A;  4YHH I;  4LF4 E;  3LTO A;  5LMN I;  4N3O A;  3J81 C;  5CFF E;  4GKJ E;  1MG7 A;  4YY3 I;  4JI3 I;  2UXC E;  2RTX A;  1HR0 E;  4DR1 E;  1XHK A;  1UEK A;  2LJH A;  1U2R A;  2VE7 C;  2IOP A;  2LE2 A;  3K85 A;  4LFC I;  3AUZ A;  4Z7Y A;  1N32 I;  2CG9 A;  5LMU I;  4DMI A;  1Y6Z A;  1USU A;  2VF1 A;  4DKK A;  5AE2 A;  1FNM A;  4IZJ A;  1NHH A;  4X8W A;  2VQF I;  4DV0 I;  4J8Z A;  4WUC A;  4JYA E;  1Z0C A;  4OX9 I;  1HNX E;  5GMD A;  3IWD A;  2JVA A;  4KHP I;  4DUZ E;  4DV6 I;  5AAS A;  3KWR A;  4F54 A;  1RC7 A;  2HFU A;  5A2Q C;  2EZ6 A;  3RMP A;  1N34 E;  2ODR C;  1FJG E;  3K17 A;  1UHZ A;  2V2V A;  1J26 A;  2V8P A;  2ZM6 I;  4KHP E;  1XNR I;  1KTV A;  5L3J A;  4LFB I;  5LMU E;  2UXC I;  2UUC I;  4L5N C;  2FTX B;  5FLX C;  4BCA A;  4B3S I;  3HPZ A;  4DR5 I;  2UUA E;  4DV7 E;  2HK3 A;  4LFB E;  1XMQ I;  1Z0V A;  2YZT A;  2RS6 A;  4P7D A;  3VYX A;  2ZBK B;  1N33 I;  1NZ0 A;  4DR2 I;  5BR8 E;  4FWG A;  2CGE A;  4NXM I;  1YYO A;  1DAR A;  1DQ3 A;  2Q2E B;  1J5E E;  1VIS A;  4WUB A;  1YYK A;  1RRE A;  3J80 Q;  4ED4 A;  2RS7 A;  3LPS A;  4IZK B;  4BS9 A;  2FGG A;  2IHR 1;  1KVK A;  3J7A G;  3K6Q A;  2V86 A;  4LF9 E;  2LTS A;  2OI2 A;  4M30 A;  2JWO A;  2KON A;  1ZM4 A;  4XTJ A;  4MYU A;  1WXR A;  1FI4 A;  3ZZ0 A;  3HTX A;  4UT4 A;  2HHH E;  2X7I A;  1X47 A;  4WYQ B;  4DR3 I;  2DSY A;  2E1R A;  4FN5 A;  2CZ9 A;  1HNZ I;  4DR6 E;  1RR9 A;  2UUA I;  4JYA I;  2JY9 A;  4DU7 A;  4JI0 E;  4JI5 E;  2LTR A;  1KKH A;  4EMD A;  3DF6 A;  5IT9 C;  4DR3 E;  4F9A B;  2F8B A;  3IWC A;  2Z5B B;  4LF7 E;  2UU9 E;  4HAC B;  1N36 I;  4K0K I;  2UXD E;  2YT4 A;  1FWK A;  4B3T I;  1XNQ E;  2B7T A;  1IBL I;  1H73 A;  2GQ0 A;  4IZJ D;  4JI4 I;  1PVG A;  2PNL A;  4DV5 I;  2UXB E;  2UU9 I;  2IOQ A;  3OML A;  2BV3 A;  3QT6 A;  4USM A;  3ADJ A;  3JU0 A;  4PU9 A;  4JI7 E;  1Z0T A;  3QT7 A;  4AQY E;  3HJC A;  2V2Q A;  1IBL E;  4TUI A;  4DV1 I;  4YHH E;  2LMZ A;  1IBK E;  3T1Y I;  4PRX A;  3J81 Q;  3F6G A;  1ZM9 A;  2E5L I;  1PKP A;  2LBS B;  3QT5 A;  3V2U C;  4DPU A;  2BM1 A;  2HKE A;  4P52 A;  1GZ6 A;  2VF3 A;  1UIL A;  4UTG A;  2DMY A;  4DR7 I;  4JV5 I;  4BC9 A;  4GKK E;  4JI6 I;  2MDR A;  3PYD A;  1X49 A;  2V88 A;  2DB2 A;  2B7V A;  3VYY A;  2DEJ A;  1XNQ I;  2J7K A;  3ZZT A;  1T4N A;  4WFT A;  5IWA E;  4DV2 I;  3MSW A;  3PYF A;  4DV4 E;  2L2M A;  4LF7 I;  2WZO A;  4URL A;  2M4I A;  1FKA E;  1NHJ A;  4P78 A;  1WUU A;  4M1K A;  4M0V A;  4DPY A;  2B9D A;  4AQY I;  2FV4 B;  3F6H A;  4MYT A;  4DPW A;  5AE1 A;  4BMJ A;  4X65 I;  3GON A;  4DV4 I;  2E5L E;  2NUF A;  4TUG A;  1QU6 A;  1ZBT A;  3LML A;  1BKN A;  2F4V I;  5AE3 A;  1ZXM A;  4F9B B;  2GS8 A;  2V34 A;  4WUD A;  3PRY A;  3OTO E;  3ZKD A;  3ADL A;  1I94 I;  4X62 I;  4DUY I;  4IZJ B;  2UUB I;  3ADG A;  2R42 A;  1YYW A;  4JI6 E;  1ZXN A;  4USK A;  2NPF A;  4JI1 E;  2Z5B A;  4YY3 E;  2R3V A;  4DR4 E;  5LL6 R;  1OJ4 A;  2HHH I;  1XMO E;  4ZVI A;  4B3M E;  2MC6 A;  3VK6 A;  5ADZ A;  4DR6 I;  2UXB I;  1SR9 A;  1PIE A;  3LLH A;  3T1H E;  3CWV A;  1ZM3 A;  1KIJ A;  4LF8 I;  4WSP A;  3WU4 A;  3ZKB A;  3M6A A;  4KQV A;  4I3H A;  1IBM E;  2VQE I;  4X66 I;  1Z5A A;  1QZR A;  4F9C B;  3WU6 A;  3B8H A;  4FW9 A;  1EI1 A;  2O1V A;  2CPN A;  4K0K E;  1Y4U A;  1O0W A;  4DU8 A;  3WU3 A;  3C4B A;  4X65 E;  2MC5 A;  4X66 E;  4GKK I;  4DUY E;  2V87 A;  2UUB E;  4HAC A;  3AV0 A;  4FWD A;  1WHQ A;  4DR5 E;  2K4V A;  4JI3 E;  2V83 A;  4X64 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...