4DXLA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
VSDWVPTGAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 97
structure length 304
sequence length 304
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4dxlA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dxlA01
4LF6I 4DV1E 4JI0I 4X62I 1A6FA 4DR3E 5L3JA 4DV0E 1EA6A 4X65I 4DR1I 1FKAE 4LF9E 1FNMA 1S4EA 5A2QC 1NHIA 1IBME 4GKKE 4DU7A 3J7AM 2VQFE 2UXBE 4RPFA 1HNZI 4B3TI 1N0UA 2R42A 1KKHA 4DPUA 3OTOE 1PVGA 4HY1A 1H7SA 3JAMC 1H7UA 1PIEA 4LF8I 1N32I 2UXCE 4LF7E 4YY3I 4DUZI 4DV5E 4DV6I 1N0VC 1XHKA 1XNRE 4B3RI 3J81C 3GONA 3J80C 4JV5E 2UU9I 4DUYI 4GKJI 4DPXA 1S16A 2V2VA 1N36E 1KIJA 1IBLI 2WW4A 3ZZUA 1IBKE 4JI1I 2UUBI 4X64E 2DEIA 4DV2I 4DR2E 4LF5E 5FLXC 3ZZTA 1KTVA 4FWGA 3QT8A 4KQVA 2DEJA 1U2RA 1Z5CA 4FW9A 4B3MI 4GKKI 1XMQI 1N34I 1XNQI 4ED4A 1WUUA 3B82A 4JI7E 4NXME 1NZ0A 2UUCE 4DR5E 1Z5BA 4LFAI 2E5LI 4Z7YA 3WU5A 4FWDA 4JI6I 1NHJA 4USMA 3WU3A 1FJGI 4K0KI 3LPSA 3QT6A 4MYUA 3PYGA 2V34A 4OX9E 1Z0GA 5LMUE 3T1HE 3HULA 4Z7CA 2V2QA 4FWHA 2ZM6E 1N33I 5GMEA 4LFCE 4HACB 1DARA 1NHHA 4JI5I 1K47A 3Q1QA 1HNXI 1FWLA 1H74A 4HYMA 2F4VI 2VQEE 4DR6I 4WUBA 4JI2E 1MX0A 1HNWE 3T1YI 4KHPI 1ZM9A 2BM1A 4NXNE 4LFBE 4DV4I 3K1JA 3ZZ0A 4PRXA 4JYAI 4NXMI 1QZRA 4DR7E 4LF4E 3K17A 4JI8I 4USKA 4B3SI 4YHHE 4JI4I 4DR4E 4HACA 2HHHI 4WUCA 4JI3E 5BR8E 3ZKDA 4DV3E 4XTJA 2UXDI 4X66E 1J5EI 2E1RA 2A2DA 4AQYE 4DV7E 4PRVA 1FI4A 1H73A 1XMOE 2V2ZA 4UTGA 1I94E 5LMNE 4DPWA 4DV1I 4LF6E 3ZM7A 4JI0E 4P52A 4DR3I 4X62E 2ZBKB 4DV0I 3PYFA 3V2UC 1B62A 1PKPA 3PYDA 2EFGA 4X65E 1ELOA 4LF9I 2HKJA 4DR1E 1IBMI 3WU6A 2GS8A 2VQFI 2UXBI 1HNZE 3OTOI 4LF8E 1N32E 1MG7A 2UXCI 4LF7I 1Z0BA 1Z0EA 4YY3E 1VISA 4DUZE 4DV5I 2VF3A 4DV6E 1XNRI 4B3RE 1KVKA 2X36A 4JV5I 2UU9E 4DUYE 4GKJE 4I3HA 1Z0TA 1N36I 1H72C 1EI1A 1Z5AA 1IBLE 1IBKI 4JI1E 4X64I 2BV3A 3V5RA 2HFSA 4HXZA 1BKNA 5IT9Q 4DV2E 1MU5A 4DR2I 4LF5I 3PYEA 5GMDA 2NPFA 1RREA 4P7AA 1D6TA 5IWAE 1ZXMA 4ZVIA 2J7KA 2UUAE 4M1KA 1HR0E 4URLA 2HFUA 2BM0A 4B3ME 1XMQE 1N34E 1XNQE 3QT7A 4JI7I 2UUCI 4UT4A 4DR5I 1UEKA 3H4LA 3ZKBA 4DPTA 4LFAE 4R1FA 2E5LE 5A2QQ 1ZXNA 4DU8A 4WUDA 4PU9A 4JI6E 1RR9A 1FWKA 1FJGE 4K0KE 1Z0VA 2A2CA 3CWVA 4FN5A 3JAMQ 4OX9I 2HK3A 5LMUI 4EMDA 3T1HI 3F0NA 2HKEA 3J7AG 2ZM6I 3B78A 4LFCI 1N33E 3J81Q 3J80Q 1ZM2A 2ZITA 4JI5E 1HNXE 1Z0WA 2LJPA 3LNUA 1OJ4A 3B8HA 1Z0CA 2F4VE 2VQEI 2CZ9A 4B3TE 3WU4A 4DR6E 2X7IA 5IWAI 3QT5A 4JI2I 1HNWI 3D4JA 3T1YE 4KHPE 2UUAI 4MYTA 4JG4A 1HR0I 3LTOA 2AJ4A 5FLXQ 4NXNI 4LFBI 4DV4E 3M6AA 2OI2A 4JYAE 4DR7I 2HK2A 4LF4I 5IT9C 4JI8E 2V8PA 1ZM3A 4B3SE 4YHHI 4DR4I 4JI4E 1ZM4A 4DXLA 2HHHE 4JI3I 2Q2EB 5BR8I 4DV3I 2UUBE 4X66I 1Z59A 2UXDE 5LL6R 1J5EE 2XEXA 4DPYA 4AQYI 4DV7I 1B63A 1XMOI 5LMNI 1I94I 2R3VA
chains in the Genus database with same CATH superfamily
4JI0I 3PFOA 3DU5A 2HHHJ 3DLHA 3EZUA 1S4EA 3QIDA 3J7AM 2F9JA 1HBOA 5JXSA 5IS2A 3PR4A 4C7QA 2IIHA 2VFRA 2W7AA 4DR4F 4DR3J 3VGVA 3W8GA 4YY3I 1SIWB 3T5KA 4PG4A 1XK8A 4K4XA 2YH0A 4I2PA 5FJ4A 5T14A 2B8PA 4JV5E 4IFVA 3R2DJ 5LSRA 3EZOA 3GZ7A 4RW7A 2RQCA 3MDFA 1RT3B 2PC6A 4X64E 3CJQA 3DRRA 3IBWA 1PBAA 2V2KA 3UNGC 3PRVA 3M85D 1RADB 3WHIA 2PN6A 4Y3CA 3RAMA 1B4SA 1U0HB 4D3GA 3G6XA 3R5DA 4HDHA 3EGVA 3KHGA 1YJWS 4B3MI 3K59A 3SMZA 3OSPA 3KTQA 3AFGA 2QMXA 4DR2J 1RLDA 5DLGA 1E6YA 4QIVA 1RWOB 2J6UA 3DI6A 3VWSA 5F8HA 5L38A 3VAFA 2LP4A 2K1RA 2R7OA 2EFPA 1JLFA 4R0EA 1Z2LA 3CD0A 4I6WA 2Q3PA 2F9DA 4J9LA 4G1QA 4HACB 1KD1T 4AT1B 3F56A 2N4DA 3AH6A 1H74A 2KI2A 1KNZA 1JLBA 2F4VI 5J2PB 5DETA 4OJGA 2JSXA 5L9NA 4H4MB 5KFRA 1YG0A 5I3QA 4KHPI 1N56A 3KLFB 1ZM9A 3MM8B 4PXDA 2PD1A 1S9GA 3TAQA 3D2WA 3H59A 1AA1B 3WX8A 4IFDA 2PO4A 4IH5A 4X66F 2ZJPQ 2FQQB 3QFWA 2MQ8A 3PX6A 1MROB 3PV8A 1KEKA 4LF6F 1UKUA 5ETPA 4WUCA 4IG3B 5DZ6A 4FYVB 1J5EI 2W9BB 1C0UA 1IWAA 2CQBA 2MB0B 3KJFB 3FBCA 5D15A 2AD9A 1U7LA 1HNZF 2GO8A 4DR6F 3E8OA 3GJQB 4KH1B 3CCQS 1RT5B 3T1YF 2WW8A 3EXYA 3TVYA 4HHUA 4EFAC 2QFJA 2VBWA 1C1CA 4J37A 1CULB 4YN3B 4DV3J 2VBZA 5EWEA 1XQIA 3AB4B 2V4QA 1RHQB 2VOOA 3R7BB 2EC0A 4F4YA 5KFSA 2HRTA 3DGVA 5DQGA 2LQ5A 2BA0G 4DF8A 5F8MA 2LEPA 1OY6A 3HVTA 3RAXA 4B3TJ 5M2PA 2YH1A 4TVAB 4JUZA 1HQEA 2NUUG 1TL7B 5KT7A 1RU2A 2GCFA 3C14B 1XMQF 2M88A 4YP3A 3PYEA 3UD3P 3I0RB 5LOQA 1FK9A 4ZVQB 3BV8A 2Q6CA 4PQUA 5KT4A 1WNEA 1MMDA 2B4PA 3M9OB 5EWGA 1FJGF 3G8QA 5JEAF 2AT1B 2B9YA 2MHEA 1QDUB 4O3OA 2G0JA 2H65B 2WVBA 3W2VA 2J8SA 5A2QQ 1CJUA 3K57A 1RR9A 2CQDA 3T9ZA 1USUA 3MOZA 1PG5B 5JEAB 2JE6A 2OTLS 2Q79A 2JEFA 4IZKA 4P7TA 1VQLS 3Q6MA 1M90T 3UN5A 2N3OA 4EMDA 1HI0P 1R89A 4C0HA 4CNYA 1NKEA 1RCOB 4RJVA 2AE8A 2ACMA 1ZM2A 2MPUA 4U7CA 5BJRA 2PEBA 4AYBD 2R7VA 4JYAF 3DMJA 1SH3A 3H2UB 2FD2A 2DHXA 1Y5IB 4BCAA 4NXNI 4LFBI 2RB7A 2RF2A 1JK9B 1UCNA 2DTJA 3CC2S 4DN9A 2AW0A 2V8PA 3IG1B 1SKRA 2VG6B 1X5PA 2M9KA 1ZM4A 2CJ9A 1NDCA 1NB2A 4ZVTB 3T1HF 2K3KA 5JVGQ 5HVGA 3QPIA 3RRKA 2CPZA 4A8WA 1NSKL 2B51A 2V63A 4JI8J 1QLNA 1A6FA 4OO1A 3PS2A 3V81A 1FKAE 4LF9E 3EXCX 3ZTSA 3V6KA 1IBME 1BUXA 2ASLA 1UW9A 4M5HA 1NHVA 1N0UA 5DNXA 3AAWB 1WEZA 1KKHA 1Y5LB 4DPUA 3MCMA 3AOCA 4HY1A 4DV1J 2KVQE 4LF8I 1N32I 3HSJA 1Q16B 4DL6A 2WHOA 2KJVA 2BJ9A 4FNHA 4IKAA 4H4OA 4FS2A 2C2NA 2QN6B 5D3GB 2I2YA 3J81C 2IVMA 4MMOA 3PX0A 1KIJA 3P4UB 2YBVA 2J6TA 3R2CJ 1Q81T 3TZZA 4DV2I 4ZDNA 4CQ1A 1QJHA 3TA1A 1VBYA 3DOMB 3LW5C 4NA2A 1TELA 2DEJA 2GVDA 3MD1A 5ETLA 1URRA 5KT3A 1HARA 2VG5A 2CQ2A 1N34I 2VG7B 4QOTA 1KC8T 3SCJE 4LF5J 4G3IA 4DR5E 1VHIA 3BH7B 5E41A 5ADZA 2GA7A 2E5LI 2P9CA 4F36A 1FO1A 3WX4A 2ASYA 5K14A 1UPMB 5KG0A 3CCMS 4OYXA 1S1XA 3P45B 3SDEA 2D69A 3EX7B 1CS4A 2EI5A 2NN6C 2DHAA 2VFVA 2XI3A 4MJKA 5D77A 4Y28C 1Q82T 5IZHA 3GV7B 4ED5A 1SV5B 2R8IA 5KG4A 4HYMA 1G2EA 1TKDA 3QNWB 4JI2E 1P27B 3RBDA 4GKJJ 3DRPB 3NMAA 4HVZA 3JYTB 3ISNC 4K4ZA 2ALYB 4ECXA 2AP6A 2DNGA 3CJSA 4YUDA 3NGDA 3ZZ0A 1A0OB 4KKOB 4DLGA 1PGZA 1BWEA 1SVDA 1NZ8A 4P71A 2HGMA 5HMWA 3EM1A 1I94F 4C8OA 5IWAJ 3TWZA 3R5AA 1RT7B 4WF9Q 4CLKA 3S1TA 3NS5A 1YJ9S 2XMAA 3IA0A 3IR5B 4MU0A 1FVQA 5GAEU 1JLAA 1BLUA 4ZVGA 2HZVA 3LP1B 4OZ0A 3HKMA 1FXLA 5EN1A 1UWAA 4DR4J 1WOOA 3FGVA 1N8RT 4LRCA 4OLPA 2W9CA 4P2FA 1T0TV 2PO0B 1TMJA 1UWBB 1XMBA 3W9IA 2JEJA 2ZHOA 5EHHA 3MMBA 3LANA 5H9FJ 3HM9A 4JI4F 3M7VA 2EFOA 4IFYB 1Z4UA 2UXDF 1IWGA 4KYZA 1VQ4S 3H2LA 2HWIA 1W2BR 2FLOA 5AXKA 2ZHAA 2UU9E 4DUYE 4NEYA 3R5CA 4JBCA 5K36D 1GXLA 2FY8A 4JI1E 3TZYA 5C0XC 4M5JA 2AYGA 1RDRA 1MU5A 1RTIA 1GMUA 2G2OA 4WYWA 5CHCB 4DV6J 2N3LA 3CEDA 1SC3B 3I55S 1IM6A 2OPSB 3RB3A 2XY6A 4UQTA 4IRCA 5J1EA 2L3MA 1S9FA 4AXJA 2ZH2A 1FJCA 1M1HA 1WHVA 2EBGA 3IM8A 1QTNB 1UEKA 3D68A 3S8SA 3G9CA 2BA1G 3UN3A 2MDAA 3P6YC 4XDCA 3POTA 5CZVA 2VPZB 4PU9A 1IBKF 3DM2B 4BBYA 4ZVPB 4K0KE 3BO4A 3D28A 1CC8A 4TYBA 1HNXF 3MAAA 4B9MA 1G1XA 2W2QP 4OX9I 4P9SA 5LMUI 4M5MA 2RDJA 2BE9B 1FRIA 3F44A 1D0EA 3ETMA 2GJIA 4Q43A 5K9FA 2G1DA 5IQ6A 4DV4F 3IM9A 1WKKA 2OH2A 4I68A 1T03B 3OVBA 2D74B 1NJZA 5KFUA 3I5AA 2GQQA 3C8YA 4QWBA 4JG4A 4ZLJA 3HFVA 1SI9A 2DKOB 5B09A 2W1BA 3Q6NA 4JI5J 3D0GE 2ZUAA 3HXMA 1U8SA 1D9FA 5F9LA 3NMRA 3BO3A 1HBOB 1TP7A 4DR6J 2HIYA 3T1YJ 5THWA 2V94A 1FTRA 4DS4A 3WC0A 4DX8H 4DQRA 2I0XA 1TK8A 2J0QD 2GNKA 4NZ7A 1O6XA 1F9HA 2P9EA 2HNDA 3CW2C 4I2PB 1ZAXA 1AUSL 4IFVB 1X9MA 4CCHA 1Y4UA 2GQ0A 4RW7B 4DR1I 3GP9A 1Y0HA 2DPIA 3DRRB 3WBZA 1S48A 3HHNB 4K2JA 3D0HE 2LDYA 3MAQA 3UWTA 5AJ3J 5ETOA 4AUKA 3QJPA 5HVFA 5IV4A 5EL9A 4KTQA 4JI3F 1JIHA 3CJ0A 3H42A 1XNRE 4F0MA 1S9EA 4WP3A 1IKVA 1XEZA 1CJTA 1RT6A 2V2VA 4XPEA 1NMEB 2L48A 1GMWD 2DR8A 1E6YB 4WP8A 1SJRA 2EG1A 3KHRA 1KTVA 4LT6A 3DI6B 3RGIA 4CT8A 3HSZA 3QJJA 2K1RB 3ZZZA 1JLFB 3DYAA 3EGNA 2HNZA 2FDNA 1YJVA 2V8HA 5LXYA 1UA1A 3MEGA 4G1QB 4PXEA 2AEJA 1JQGA 4ZOSA 2UUCE 4IFDF 3IRXA 2ABYA 1HPZA 3PJWA 2F1DA 3O6QA 5D0GA 1JLBB 4FYDA 1KTQA 3LOUA 5A8WA 3WU5A 4HLBA 1WDDA 2B8QA 1TAUA 3WIUA 3EZ5A 5FWKA 2GO9A 1S9GB 4ECYA 4OZ3A 4FF2A 4IFDB 3WQPA 4HL9A 1U6ZA 2EK6A 2HRYA 1WF2A 2KM8C 5ETTA 2CJXB 2EK1A 2UUAF 3R5GA 2W7OA 4LFCE 2RSQA 2CNNB 1RBLA 2ZBRA 4DCJB 2NN6E 3M6XA 3EWGA 1C0UB 2VQEE 3KG0A 3OFGA 1OYRA 2VICA 3VAMA 1V6HA 3T1HJ 1KSPA 3WC2A 2ZZNA 1C1CB 2XQCA 1BY9A 1BE4A 4DL2A 2WVCA 5KG6A 4DI6A 1AB8A 1TUVA 2YKQA 2YWHA 4DV7E 3W60A 1GTEA 2QC3A 2FHMA 3BBFA 3AJ1A 3G4SS 3CIMA 4NA1A 4X62E 1SQGA 3H90A 3PYFA 4I69A 2LKZA 3HVTB 3BKTA 2WBMA 3H2VE 1HQEB 3WU6A 4KPCA 4B3OA 5A8KA 2RRAA 3OLBA 1XMOJ 3R7SB 1OY8A 1FK9B 2FJWA 2QYCA 4Y6IA 3GIRA 3FQLA 4AIMA 4K4UA 4PQUB 4X4SA 2CPEA 4MIBA 1DFDA 2DHGA 3A8KA 2HFNA 1V5IB 1EI1A 4PXCA 1SBRA 4TLRA 4TU8A 3W2VB 1CJUB 3QGGA 1FESA 4ZVRB 4QJVA 2YNGA 3H98A 1UW4A 3WZ0A 4GO7X 4LQ9A 2JE6B 1D6TA 1RHYA 5E7OB 3ZTRA 4IZKB 4M1KA 4ECSA 4UUWA 4CIOA 4DLEA 2UUBJ 4R5PA 2YWEA 1HWKA 2BXJA 2AEFA 4F50A 2DB1A 1VRTA 4CTAA 3DMJB 1KP6A 1ZXNA 2I5JA 3THVA 1X4BA 4JI6E 1YJUA 4ANCA 5DRPA 3PM9A 2KZMA 3A8EA 3I4PA 3QSIA 3EMTA 1RCXB 1YKWA 3L7UA 2DY1A 2RF2B 2CQGA 3K0JA 1RHMB 3M1VA 1VRQC 5HMYA 2CXEA 3OTCA 1WKJA 4WU2A 3MPUB 2IC3A 4OHYA 4OO1F 3G87A 2LJPA 2CZ9A 3T6BA 2LMIA 2J9DE 3PXGa 5JMNA 2F4FA 3ZC4A 4RNMA 3Q23A 2E1AA 3MPDA 3LTOA 3VQSA 1BQMA 2C1EB 3LALA 4OO1B 3CT9A 2ZH1A 3V81B 2POKA 2EVZA 4HTIA 3EE3A 4NLPA 2MZJA 4DZ6A 1K0VA 2DGTA 1YX2A 1NLKL 4X66I 4I6AA 3CD6S 2WP8A 1KLMA 1F6TA 4KSEB 1U25A 1DQ8A 4ZPDA 4H4OB 2AJQA 4LF6I 1QAYA 3KMQA 4JI4J 2UXCF 3BQ2A 4MKYA 2UXDJ 3RW6A 1S59A 2VQFE 3M7NG 4RPFA 1HNZI 2UXBE 2H5EA 1WF1A 1N36F 2H48B 4Y65A 4CYUA 2VZ9A 3DLGA 2GVDB 3CCVS 2DR5A 3J80C 1U02A 2OAUA 2VG5B 3MF5A 3HVWA 4DF4A 1S16A 5HROA 2APOA 4HH1A 2DNLA 4Y2IA 2J0SD 1VS3A 4RZRA 1VQ5S 1UTAA 3KLHA 3FZBA 4U6PA 3HP6A 5F8NA 1GEHA 1M0SA 3P96A 5K14B 2AYBA 5FDLA 5HANA 3IBFB 1S1XB 4OFZA 1S10A 5CAAA 1VQSA 3HHLA 3DDIA 3SDEB 2N82B 4J5OA 3BR8A 2ZBPA 3FEXB 3FRZA 1IBKJ 3R3TA 3TW0A 5DZ7A 2AJFE 1XMQI 3W61A 2D3UA 3PHEA 4JI7E 4I64A 5ETKA 2RU9A 5F8GA 1TUWA 1Y4ZB 4BHQA 2DT9A 2B4OA 3OL6A 4Z37A 2Z5BA 2GMHA 2VPYB 1FJGI 1NM2A 1TAQA 3QBCA 1RBAA 3GIJA 3BH6B 1Y6ZA 5JEAD 1U1RA 1T02A 1R0AA 1RAFB 1NH7A 3MCOA 4MYUA 4J9RA 1TMMA 1WOSA 1OYEA 3TA2A 4DL0C 2PDAA 4FYWB 2MLZA 2VBYA 3UI3A 5D0RA 4ZITA 1NAQA 2ZM6E 4I7FA 5HQLA 1F5BA 4OL8A 1GX5A 1KDNA 2BZ2A 4O3QA 2X3GA 3JQJA 4O3PA 5HBMA 2KB2A 1Q8BA 4LF4F 4J9MA 1MX0A 1HNWE 3R1HA 3CDEA 4L76A 4YHHF 1JLAB 1D9AA 3KK3A 4EYIB 5K36C 5BR8F 3OBIA 3HJVA 3CJKA 3BSNA 4ZCKA 4JYAI 4YR3A 3A8JA 2BE7D 3LAKA 3RB6A 2LDIA 2W9CB 2QLBB 2HSEB 1VC0A 4QR2A 2WB1D 4NA3A 4ECRA 1VC6A 4ER8A 1WTBA 1VC5A 3DGPA 3MMBB 2YKNA 3JAMU 8RUCA 2KT3A 4AQYE 1GNKA 1UVLA 1YITS 2RU3A 1OSDA 4DPWA 3DXBA 3RU0A 3H4BA 2ZBKB 4X84A 3H8YA 1IM4A 4JI3J 4NLGA 1NHUA 3MM9A 2I1RA 1RT2B 1RTIB 3HFKA 5EGYA 2R2TA 4CLTA 2HS0A 4B3SF 5AE2A 1VQOS 4ANEA 2OMLA 3AA9A 4LCHA 1R8AA 4X65J 2Y1RI 3TQ1A 4WZQA 4RR5A 1JJHA 1LWEA 5J1EB 5ETMA 1IN0A 4ED1A 4O44A 1L3SA 2BJ1A 1FD8A 2RRNA 2WONA 4ZVSB 1T9TA 4GVBA 2DXFA 3POTB 4DUZJ 2CQ0A 4HKQA 4WWSA 3CXCR 1S1UA 1K9MT 1IVZA 1RREA 3AQOA 2DJWA 1BWVA 1DTQA 3MAAB 3BEGB 1IBLJ 1RA6A 3QATA 3U02A 3W5YA 1VLYA 3CJ2A 4G6VB 1K73T 2MZQA 1MU2A 2VFUA 3TVZA 5DRRA 4NLWA 3Q8UA 2ACYA 1CEZA 2QLJB 2VD3A 1EETA 4A47A 2OPRA 4PYDA 2FVSA 3JTNA 1B99A 5KFGA 3CJRA 3UCGA 1S5ZA 3OFEA 2QV6A 1FD2A 4UW2A 3UCZP 3PW4A 3F0NA 2ZH6A 2HS3A 2J7UA 4F2SA 4LFAJ 5DDPC 3J81U 2IJRA 4EGLA 3J81Q 2IRYA 2J6SA 2BKOA 1RI7A 1J27A 1OJ4A 4RUHA 3LWLA 1TL1A 4NE9C 3QT5A 3JTPA 4GVLA 2FHOB 2WVDA 3FFIA 2GIFA 1N5TA 4HT5A 3SYZA 1OWXA 2BX6A 2MKHA 3CNQP 2MGZA 3TNVA 3TQEA 2HHHE 1LEOA 3C15A 3TO8A 2W01A 1HMVA 1TFYA 1Z59A 8ATCB 3PS3A 4IG0A 1I94I 1SL1A 2JH3A 1S1VA 2NXJA 1PJ5A 3W7BA 1H7WA 5KG3A 1S9EB 4DR3E 2W4DA 4CM0A 1URNA 1IKVB 5HI7A 1BQNA 1NB7A 3A4TA 1CJTB 1RT6B 1OPZA 2GV1A 4QIWD 2BMBA 1OQ6A 1EX8A 3F73A 2VL1A 3JB9k 1SB6A 1RUSA 4DG1A 4JV5F 3ZZPA 2HGLA 4P2XA 4MKBA 1UDNA 4NLOA 1LW2A 4CO0A 4X64F 1ZZFA 4RBTA 2W7PA 4M63A 2HNZB 3PG9A 2BABA 3HSDA 4OLOA 1H3DA 3K7RA 3MEGB 2KL8A 4MKAA 4WPAA 1L3UA 2LQ8A 4JI0F 3IRXB 2E1PA 1HPZB 4KGXB 3S6EA 4EUVA 4B08A 5A8WB 1TV6A 1YHQS 4DR2E 1HBMA 4DV5J 1NPPA 3PZPA 5CD4H 1W7WA 4MU4A 3V4IA 2CQ1A 1VQNS 2OMOA 3PY8A 1DRZA 3D6TB 1H6KX 3PNIA 3NXZA 2VFSA 2XLJA 2KO1A 4CM2A 3ENAA 2CPIA 2E66A 4L3KA 4YB5A 1RTDA 1TKZA 1T94A 2QLWA 2AJ2A 3PIOQ 1SL2A 2HHSA 1Y5YA 1KQKA 1PAUB 3UCUP 3H5XA 3FDSA 4U3BA 2V34A 4K5RA 4OJ1A 3IAM9 4OHWA 4ETXA 1PBUA 4O4GA 1WEYA 4CLFA 3DRXA 4B3MF 1HNXI 1HFEL 4ILRA 4J9UE 2BDPA 2DH7A 1MN9A 3G8SA 2J8AA 2DGSA 5D6GA 1CQNA 4OQJA 4IRKA 4HR2A 1HA1A 4PG8A 4DV4I 1RP5A 4P2MA 1J2VA 3VV2B 2D41A 2AYEA 3KNAA 5J2MA 1RWKB 3KXDA 4B3OB 4BWJA 5A8KB 3HKWA 3JQMA 5H9FK 5K36E 5HVHA 2P9GA 4C97A 1NK6A 4DV3E 2NXUA 5KFBA 3IWLA 4M5DA 2XMWA 1YRTA 2A2DA 1VK8A 3D6MB 4LJMA 4C8MA 4PRVA 1TKTB 3CMQA 4UTGA 4DV0I 2QSFA 3MPVA 4MIAA 4KHPF 4Y00A 1UETA 2MZSA 3PYDA 1WEXA 3AY0A 2OD4A 3MGJA 4PWUA 4Q8EA 5IC4B 2X1AA 4PUOA 1HWLA 2NR0A 2YNGB 4KQZA 2EBEA 2HAFA 4LF7I 4U7UD 3QWUA 1HW8A 4FP9A 3RBZA 4FW7A 2WK4A 1EZZB 3KUHA 4PYAA 3NGKA 1CVJA 4R5PB 5E3CA 4F2RA 1X9WA 3THTA 2IESA 4X4NA 2KHDA 4CO3A 2ZNYA 3LP2A 2BV3A 1VRTB 2E5HA 4CTAB 4M5KA 2EXUA 2I5JB 3EGZA 4FBUA 1G4CA 3CCUS 1VQKS 1I6JA 4B3RJ 1VK3A 4P7AA 3OLAA 2AJ0A 1RAIB 4ZVIA 3IR6B 5DDOC 4CRJA 3W66A 2BA9A 2ZNZA 1YJTA 3M1VB 1FFGB 4ISAA 2RVJA 3IC1A 1RAHB 3DLEA 4I67A 3CCES 1X4GA 2HZCA 4UT4A 4EBEA 2IC3B 4OKGA 5DM6Q 1S7HA 1NJIT 3MR5A 2B9EA 2OO4A 2YNHA 1LWFA 1YH8A 2QT7A 3BGOP 1FWKA 3KJQB 5L1KA 4QNKA 3U1LA 4N77A 1BQMB 4FN5A 4IFDD 1E3HA 1XNQJ 2DNQA 1TZ0A 4BWMA 1LXJA 2HHWA 2MQPA 4RUBA 2IDEA 2A6MA 2V4JA 3EDQB 3BGRA 2NXNA 3BJYA 3A8IA 1WG4A 2OSRA 1HBNA 2OHDA 5K8NA 5KFQA 4TQRA 3U1MA 2O1WA 1N52B 2WP8B 1KLMB 3GV8B 1N54B 3AODA 1JB0C 2UUAI 2GC8A 1YJRA 3PS1A 1RWNB 1N33J 2R8KA 4ZVHA 2BQUA 2D7SA 4DR7I 1WJ9A 2I8EA 3DFEA 4JI8E 4KBIA 2UUTA 3SV4A 2KHCA 3SFGA 2D1CA 1KFDA 2BW7A 2J7WA 1CSJA 2ASJA 2AGQA 3KJVA 1FKAF 4LF9F 2Y8YA 4NCBA 4A46A 5F0UA 1SJFA 1IBMF 2W8KA 2J9DA 4H4KA 1IR2A 1RWUA 4CYUB 2HFOA 3DLGB 4DV1E 2BEFA 1FX4A 3L09A 4B3SJ 2HVDA 2VB6A 4WXOA 5HROB 4Y2MA 2R7QA 5D4LA 4LFBF 2D3ZA 2OPPA 6FDRA 4F7VA 3BM7A 3ILOA 1IJFB 3KLHB 2KFYA 5JEAC 5E3RA 2R42A 4B9VA 4LCFA 4WK1A 5FDLB 2AZ3A 2Z0GA 1YLXA 3HHLB 1RYRA 4FKYA 4Q2MA 2ZE2A 1X0FA 4GKJI 3OXLA 4I1TA 3SCKE 3OTOJ 4HH0A 1RKJA 4UZBA 3KK1A 3P06A 4DOZA 4DN0A 3GCXP 2DISA 2KXFA 3L9ZA 4ZP6A 4LF5E 2Z5BB 1G7CB 2FIUA 4MAKA 1R0AB 5BXIA 5A76A 4DR5F 4CO5A 2FJEB 2ZBCA 4DFMA 1D3WA 4MU3A 2KZZA 3M2VA 4U95A 3MR3A 1FNXH 4KT0C 3ZNJ1 3QQCD 4I7FB 5I3UA 4M5NA 4IUFA 3NLCA 4C8KA 3PCOB 5HBMB 3HI9A 3C2PA 2CVEA 3NS6A 4KGMA 4USMA 2AIRB 3M8ZA 3QT6A 2RQ4A 4TKTA 3HKZD 3EYZA 2CKWA 3KK3B 4ZCLA 3CDIA 1U8WA 1EAYC 3IP0A 2ROPA 2F8EX 5F8LA 4OI6A 1GAOA 4JI2F 4AFFA 4Z7CA 3UPFA 5IT9U 4FWHA 2OEMA 1DARA 2XMUA 2E9TA 2E1MC 4LRAA 3DGPB 1DZ5A 2YKNB 5LSLA 3HZEA 3NNAA 1R6MA 2XZTB 3PIPQ 4E0DA 3OXFA 4OO1D 2CQPA 4RU2A 3PRDA 4USKA 2Z4PA 3M8PA 2JEGA 3MM9B 4XO0A 4DR4E 1LOUA 1LWXA 3GTYX 4YEAA 1WI6A 3ELHA 5JJBA 4UUXA 5I3PA 1ROFA 2QO3A 5RUBA 2QYGA 1FI4A 1Y9OA 1N4LA 1FDAA 1HNIA 1LWEB 2NYIA 4O44B 3GJSB 1EB0A 4CH1A 4Q2LA 2WONB 4QZVB 2K7JA 4GVBB 2CAJA 2GAHC 2GHVC 2C39A 1U1NA 2B5JA 5FLXU 4JI0J 2UXCI 1DTQB 4UOHA 3MCSA 4JI1F 3RJMB 3OL9A 1N6QA 4DV6E 1RYSA 4KGVB 2PNLA 3H4DA 2DR6A 4USWA 1MU2B 2F8HA 4I3HA 1N36I 1F2HA 2M7SA 3FVYA 1Z5AA 1EARA 1D9DA 2OIHA 4GKKF 4YY3J 1EETB 1U26A 2PE8A 2OPRB 1SXLA 3M2RA 5HK4A 2ATCB 4ZLNA 2QA2A 3SBMA 2J0XA 1UVKA 2K3IA 2IOQA 4I2QA 1V3RA 4C8YA 4K0KF 3EVOA 3QT7A 3G6ES 3IS9A 2CPYA 4EBCA 5K8PA 3TX8A 1TL1B 3NWGA 2EWHA 3R8YA 2AF6A 1SC4B 2CUYA 4BS2A 2WSEC 3FFIB 2JJ4D 4IH7A 2BKPA 2AMCB 4B3MJ 1JJ4A 2IBKA 2XYGB 3HVRA 5KT6A 4DQSA 3M6VA 3TI0A 5LT5A 3D5MA 5SZTA 3ITHA 2MGZB 5CH7B 4RLEA 3J80Q 3C15B 4JI5E 1PYTA 4LUBA 4F4XA 1HI8A 2ZD1A 3RG6A 3NKYA 3Q83A 1HMVB 4DL4A 3FCHA 4OJHA 2JFDA 3PACA 4NXMF 4X4TA 2PSZA 2X7IA 4DR6E 3J7Z5 2E5GA 3QGHA 3T1YE 3MPYA 1NSPA 3N6NA 3VZIA 1S1VB 2JX2A 4OX7A 3TJ9A 3OUYA 1BQNB 2V6AA 1D09B 2HK2A 4LF4I 3NG8A 3MM5A 2F4VJ 1X31C 4YHHI 4KIAA 5LMUF 3QZ7A 2R7UA 3VVTA 4DG1B 4KHPJ 2Q2EB 3BGFA 4JOUA 3BKFA 5BR8I 2BJ8A 4ZPAA 2VA2A 2QL9B 2Q43A 3TA0A 2CADA 2EFQA 4DDFA 4DPYA 4LVOP 5D0EA 2A6OA 2DRBA 1LW2B 5LMNI 4C3MA 3MURP 2ALZA 4J90A 3M6WA 3GILA 1FNMA 4ZN1A 2OTJS 1WC6A 1J5EJ 1L3TA 3P49B 3M8WA 1GFWB 1TV6B 2CQCA 2C2OB 4C0BA 1HBMB 1W2IA 4DSEA 2XCPA 3P3DA 4OHXA 3G6YA 4NPOA 2J65A 4AD6A 3V4IB 4GC6A 3SCIE 3BQ1A 3QSYB 5JEAE 1TKXA 3CCLS 3AXKA 2WSCC 4OI3A 2Y8WA 3OD2A 3AD9C 1VCTA 4ID5A 1GTHA 2IJNA 3KWMA 1RTDB 3J81Y 1TKZB 3CTRA 1DQ9A 1U48A 1T9VA 2B56A 1FRHA 5C2CA 3T5LA 4G1PA 2Y9HA 2JEAA 3TYTA 3MI7X 4FW9A 1NK9A 2VC1A 3ULHA 2PGCA 1KRPA 2QIFA 4LIRA 2V9KA 4O4GB 3B82A 3VF0B 2HHQA 4A4JA 3TANA 1Z5BA 3MUMP 1PILA 2RT3A 4PG6A 2QE5A 4NX9A 3C6TA 1R8HA 3IAS9 1UL3A 2VQEF 3H1CA 4CI0B 3T1HE 4GO5X 3HULA 2KG1A 5GAEI 5J2MB 5F3TA 3KKFA 3PO4A 1QSSA 2GQ2A 4U7UK 1HR0F 1NHHA 1K47A 2UVWA 4QWAA 3CPWR 1JWWA 3SFUA 2W24A 4M5DB 3BB5A 2XTJP 4OV1A 1UA0A 3BF4A 1WWHA 2FPHX 2M52A 3MR2A 3M8RA 4NEZA 1PYSB 4ETZA 1XR6A 4DV7F 4QIGA 2IRXA 4FVMA 1TL4A 2BKNA 4KV8A 4CLUA 2V8VA 4PUOB 1C0TA 4X62F 3FEYB 4XTJA 2XMTA 3OJSA 2M8DB 3GFHA 3MEKA 3BSAA 1U1MA 4NXNJ 4LFBJ 3HLUA 2KVIA 2XC9A 1XMOE 3A12A 2Q6BA 4BLGA 4C98A 2M0GB 2ZWPA 2EFGA 4MTPA 2MMYA 5ITHA 4E8UA 3LP2B 5DG7A 2DGWA 4N41A 2DNNA 4IFDC 2G0IA 3IXQA 4GRSA 2EKNA 1RT1A 1T8EA 4TQSA 1TK0A 1Z0BA 2FTRA 1S6QA 1NO8A 1Z0EA 2VV5A 5B0BA 2CIMA 1GQEA 3NAIA 4JV5I 2EFVA 1RAJA 3V6HA 4YQWA 2DK2A 3DLEB 4V19J 4DZDA 4LSLA 3GSIA 2DPJA 1ZZNA 4FW3A 2VDIA 5KFCA 4X64I 2YNHB 4LF8J 2Z30B 2ZOFA 1N32J 2PMWA 1LWFB 4IH6A 5C42A 3LP0A 2OEKA 4P2SA 1YIJS 2RJZA 1K0TA 1F3FA 2E1CA 3G6VA 2MJNA 3CUNA 3K58A 3GE9A 2AKWB 3KFWX 1DURA 2N7YA 4JI6F 3SI8A 2J9EA 2V4JB 2Z58B 1HK7A 4DV2J 3UDEA 3BGRB 3VGTA 4W90B 3ZNUA 1HBNB 2KJWA 4ES1A 5HL7Q 2LVWA 1KR4A 1HL6A 4IR1A 4LBHA 3OVSA 2FC9A 4QNJA 3QWPA 2G2ZA 1N34J 3N9UC 2FUG9 4ED6A 3KHLA 3NZKA 2M2BA 5B0AA 4YDDB 5HJXA 2E5LJ 1S77D 2ZITA 2CWKA 3B4DA 3CDJA 2EG2A 1VIOA 1U0SA 4USHA 4Q45A 5I42A 1A9NB 2R7SA 3GCWP 3KJVB 1Q7YT 1RU1A 2XCAA 3NNCA 4NBQA 2ADCA 4MYTA 1REVA 3I87A 1JJ2R 2C2KB 2KG0A 3ETOA 3NGUA 4V19X 2OI2A 1SH2A 4X4PA 3KG4A 2OPPB 4Q8FA 2DVIA 3R9LA 1ZM3A 2HYIB 5E33A 3ZTOA 4JI4E 2V8DA 3D3BJ 1RAOA 2UXDE 2YNFA 3UNYA 4AM3A 3L7ZA 3HZGA 1SC6A 3I4HX 4CLPA 2VQFF 2UXBF 4WZMA 1ZETA 2AEMA 2ZE2B 5E5NA 1AROP 3R7NB 2QZ8A 2BE2A 3KG1A 2XNRA 3WDOA 2UP1A 3OR2A 4J3DA 3KK1B 4LIWA 3K5PA 3GG1A 4FW4A 5SUHA 1R43A 3UD4P 3R6LB 3T6JA 1N5VA 3LQVA 1PIEA 1IBCB 3HCXA 4N8NA 3CC7S 3ILLA 3TJ8A 3M2VB 4I56A 3GFXA 1CQMA 3PW7A 3PKMA 1JLEA 1G6BA 5I3UB 1P8GA 2HLTA 2FJDB 1IBKE 1NPRA 1ZPWX 4QW9A 5DRQA 4PABA 4OO1C 4JI7F 4P73A 1M5SA 2KXNB 1FF2A 1QE1A 3OTEA 3PW2A 4JV1A 4CLYA 2IVFB 2ILZA 3D3CJ 1OS5A 4KRWA 2DGOA 1QSLA 3LGHA 5AE3A 1TFWA 1ZA2B 4K4YA 4M5IA 4EZ9A 1OYDA 2SXLA 3EUNA 1F3VA 2O1UA 1X4DA 3CJTA 3FEZA 4OI4A 4YMEA 4KGKA 4NWBA 2DY9A 2DHSA 1Z0GA 4A48A 4TU7A 1WC4A 4S0MA 5CYMA 3M8PB 4B9SA 1KVJA 3E01A 4WXWA 3H7HB 3K5NA 1ZTWA 1CJKA 3FBBA 3N0VA 3U1YA 3CCTA 4ES3A 3CB4A 2KTQA 2MKYA 3MCNA 1YBUA 4OX9J 5LMUJ 1HNIB 3R97A 1Q0NA 4UY85 2MZRA 2CG4A 3GSDA 4PRXA 5KAKA 2HHTA 2IRUA 5A2QU 3GIIA 1JLGA 2C2EA 3Q0AA 5B7WA 4C11A 4JI3E 2C39B 2B5JB 3W63A 2BUNA 2HRUA 3Q2TC 4C4WA 1VJQA 2RMLA 2MZTA 5LL6d 3GV5B 1N6QB 1WD6A 3OHBA 1PC4A 3ZM7A 1HHQA 3NP5A 4M5LA 1VRUA 1CJVA 4X65E 4NYPA 2HZAA 4LF9I 5G4DA 2QMWA 1IBMI 5HAOA 4L75A 4ZVFA 3AHPA 5F41A 3VVUA 4J9KA 2XS2A 3M2RB 2MEWA 5CA5A 1Z1ZA 2VKZG 4P75A 2J5AA 3FC9A 2XWXA 1VQ6S 3HHLD 4DUZE 2H5IB 4DR1J 1GMVA 2HLUA 1PJ6A 4IFDE 4MK8A 4NI2A 2MLYA 4I2QB 2JT2A 4F4AA 4ZHRA 2VIHA 2DIVA 3UFCX 3T5JA 3FK4A 5KFVA 3IS9B 4LRFA 1IBLE 7FD1A 2FVRA 3NOGA 3MMJA 5IT9Y 4DX6A 1BKNA 4IO9Q 3DLJA 5G0RA 2M70A 4UQGA 5CD4A 2CYYA 2F63A 2I6WA 2F40A 2M4MA 2VONA 3NGSA 1LNQA 1W26A 2XMKA 1KBRA 2UUAE 2W2PP 2HFVA 3ITHB 3NOCA 1B3TA 1W25A 4C8LA 3QAEA 4DR5I 3ZTPA 2ZD1B 4KPYA 2MKCA 4OYAA 3CCWA 4LFAE 4R1FA 2P6SA 1S97A 3BN7A 1FA0A 1K1SA 2RQMA 3CJ8A 2AX0A 1OSCA 3OUYB 2CJYB 4CH7A 2DR9A 2HKEA 7AT1B 3MM5B 2HGNA 1S1WA 4URGA 3MAHA 1T7PA 1Q95G 2ZUGA 4MKVA 4EK2A 2XLKA 5L46A 3V6DB 2XSJA 2B4UA 3H5SA 4HHHA 4JI2I 4QU6A 2WNRA 4A8XA 3IWNC 3HT3A 2GGPA 3KLGA 2Y3YA 2HHHF 5FLXY 2Z5CA 4EBDA 5CQGA 3OQ2A 5B0EA 4CNZA 1YZ6A 2BJEA 3U1NA 3A1YG 5E3PA 4ITSA 1NK8A 5L9XA 1SQFA 2CA9A 1VJWA 2HHUA 2NUHA 4DXLA 1DTTB 3ZFVA 5K8MA 4DR3F 3O1LA 2BA0D 3W5XA 2FHJA 3Q8YA 2HWHA 4YDXA 1NCLA 2JEBA 1TKXB 1IQZA 2VBXA 3E2EA 1FRMA 3BS9A 4CLLA 3DC2A 1KWMA 5IT4A 5C5JA 4WP9A 2ZOGA 4ID5B 1GXTA 4KR0B 4DU7A 9RUBA 1D8YA 3ZO7A 1AFJA 1BXNA 4ELVA 1HLWA 3HD1A 2NS1B 3I31A 3WIVA 2RDIA 3O3LA 3LO3A 4L73A 1X60A 1H7UA 1REGX 5L8RC 4NLXA 1C1BA 2DCUB 2V67A 2JEAB 4DV5E 4JB8B 5BYRA 1HWUA 4DR2F 1VQ8S 4PPZA 4ZVUB 1VOMA 5HP1A 2UU9I 4DUYI 3AOAA 3RB0A 3D1OA 1X5OA 2W25A 4JI1I 1GH8A 1ZOTA 4ILLA 2IERA 4J9VA 4FPRA 3MEEA 4KQVA 2Z8QA 1UEVA 4FYXB 2BACA 3C6TB 4BC9A 5B0GA 1YRUA 3MMAA 1RABB 4GKKI 3G2XA 2V5HG 2IOPA 4KAIA 4ED4A 4RKUC 3OFHA 3UDVA 3DOLA 1MNEA 1DBDA 4DL5A 1DQAA 1U47A 4K0KI 1RTHA 2COLA 4QQBA 4LRBA 1APSA 2P8IA 4RBVA 2C3OA 3JQKA 3M30B 3BSCA 1F5AA 2AQ4A 4TY8A 1MMLA 4ZPTR 3J7AN 3O5TB 4KV8B 1C0TB 3ZZOA 2A0FB 2JVOA 1TVRA 1M5VC 4Q5VA 2HQCA 4ZK7M 1BD6A 3BPDA 3EVMA 4MFBA 3MUTP 2O1TA 2PT0A 1PO6A 5K36F 3DU6A 4FPIA 1P9YA 4Q44A 1Q5VA 1EKRA 4DV3F 1R6YA 4NXMI 1Q53A 2PMHA 2B7BB 4ANDA 3QGIA 5KFOA 3W1YC 1DAXA 3OPKA 3IR7B 1RT1B 2Q1LA 1WSRA 4ENOA 3IWXA 4CZCA 1L3KA 3W9HA 3AD8C 1S6QB 3GJTB 1U6BA 4DSKA 2RD5C 4RW4A 1E6VA 4K7QA 1PAEX 4B3TF 4P52A 3HVAA 2GVZA 3PFEA 1PKPA 4OHVA 3BPSP 4LSLB 1F9EB 2XY7A 5GAGU 4QIEA 4UOGA 1QY7A 1IJEB 2BANA 4X66J 2NREA 2DNYA 2JWNA 2BR2A 4DSJA 5C42B 3LP0B 5ETQA 4CWBA 1QAXA 1IR1A 4LF6J 2YKPA 3GWCA 4WFXA 2H54B 1RAEB 4B17A 2VF3A 4CLZA 1XNRI 5KG5A 2R7XA 4B3RE 2X36A 3JSBA 4OYPA 3RB4A 4WFNQ 2YPYA 1HNZJ 2YKOA 2PIIA 3CE8A 4DV0F 4U8YA 2AU0A 3V5RA 3ZZYA 3HSGA 4IS9A 4NLYA 4PWDA 5K8OA 1ZXMA 3CULA 1JXVA 4WU3A 1F2GA 2CVIA 1GX6A 2ZH9A 1JJCB 1RT4A 1UDSA 4LF7F 4PR6A 3FZ2A 1XNQE 3K8VA 2FZCB 4KH0B 2UUCI 3GYNA 3RRHA 3FQKA 3MEDA 3JSYA 3PDNA 4F3OA 5I42B 4ZMMA 3TARA 1SIZA 1D1UA 3RW7A 1OIAA 2W4PA 3ET6A 1REVB 4X2BA 3M85G 1XMQJ 2O3DA 3MPWA 1RXOB 3SSSA 2DCLA 2B43A 2NXCA 4LFCI 1N33E 4OZ2A 1FJGJ 2IMOA 3ILIA 1SKWA 2H4YB 2A1BA 4ED0A 2VQEI 3QRRA 2YNFB 3V6JA 1ZBTA 2JDJA 4JI8F 2MY7A 3GU0A 3THPA 3D4JA 4J7CA 3L7ZB 3H5YA 2XMMA 1HR0I 1R3NA 3A3PB 3UHMA 4ILMA 4Z2XA 4RWXA 1XXEA 3NRBA 1ULRA 2V68A 3DDNA 2BE2B 1I3OB 5C7PA 3IO1A 3IMQJ 3OR2B 4B3SE 1B7FA 2YNIA 4DV1F 1XR7A 2XG8A 3HHDA 2U2FA 1KQFB 3P5TL 2Y1LB 4DV7I 1HNVA 4JYAJ 3D54A 3BDEA 4X62I 2MQMA 4W4MA 1KVIA 5L3JA 4M95A 4QWDA 2IVYA 3M8YA 1JLEB 2HW3A 5GMKa 5D4PA 1FJ7A 1JLQA 2J0WA 1EP4A 1UPPA 2CWXA 2KRBA 5CYQA 4J9PA 4DR7F 1XIQA 3MECA 5EDWA 3OTOE 1Y00A 4Q7AA 3ADAC 2YQ0A 2KFNA 2GO3A 3M9MB 3DLBA 1QE1B 4ZP7A 1T3OA 3BKUA 2FJVA 1H38A 4LF5F 3GONA 5DM7Q 1XC9A 2J9CA 2BA1D 2CJQA 2YWKA 1IKWA 4R0JA 2VA3A 2WW4A 4K50A 1FRKA 4FBTA 2DEIA 1R0BG 2MHNA 5E2QA 2FJBB 3ZZTA 3DRYA 1NHKL 2BR0A 1YQHA 2ZZMA 1H0HB 5KFEA 1U2RA 1WDTA 4CO2A 2PFDA 5U47A 1Q4RA 4LQ3A 1KQGB 2C2MB 5CYMB 5EX0A 4MT1A 1RAGB 3E01B 3PO5A 3U27A 4RBUA 2OP5A 4ID8A 1CJKB 2C3YA 4GKJF 4ATNA 4R25A 3VGSA 2H4WB 2XGQA 4JI6I 2HBRB 5CXTA 4KY3A 5I4MA 3PYGA 3ENWA 4IQMA 3KOAA 3VHQA 4DCOB 5IM0A 2VJVA 2R2UA 5IWAF 3DCAA 1JLGB 2ZWOA 3LH2S 1U2FA 3W62A 4FKXA 2Z56B 1O5JA 4C11B 4C8NA 2LXFA 3HHLC 4C9DA 1FXRA 2R8GA 2AHOB 5C0XE 2PO1A 1QSYA 5E3AA 3R1LA 4QYZK 1WG5A 2IM3A 2XS7A 3ENVA 4KGZB 2DNRA 4AIDA 2FY1A 2NQPA 3EPIA 1Y5NB 3M2UA 4K4WA 1VRUB 4C8ZA 2I9SA 1T9UA 1CJVB 2MSTA 1ITPA 3K5MA 3RBEA 2DO0A 4ES2A 2GMLA 2PI4A 1VBKA 4FF1A 2E7XA 2R9LA 3TUIC 1OY9A 4KHRA 4N7TA 1RTZA 2V8GA 1SJQA 2HQDA 2YX4A 4PXBA 4AXIA 1FWPA 1RB0A 4JI0E 4NI2B 1YGYA 4HDGA 3EJMA 4PZVA 3HF5A 1RWMB 4ZHRB 1ELOA 1FE4A 2QEXS 4C3LA 5DNLA 5KFWA 1NK0A 1AZSA 4PQAA 4O3SA 4DV6F 5BYSA 2ILYA 3FBFA 2O66A 2VQFI 2UXBI 5G0RB 1SL0A 4XTTA 2QA1A 1I94J 4RNNA 2DNZA 3LWMA 4ZP9A 1ZA1B 3CC4S 4YY3E 4QPXA 4NLQA 2UVRA 4RNOA 2OFHX 4WTYA 4L74A 2ZOMA 3D0IE 4OYIA 4OYBA 2DNHA 1FKOA 6FD1A 5F9NA 2BBEA 2JHEA 3NGRA 1PC5A 3Q24A 1S0NA 1EIYB 3TOQA 2DIUA 3GMGA 4U8VA 2R7TA 1TU0B 2HNYA 4B3ME 4XIUA 3VAJA 2HVZA 1S1WB 2OSQA 4ECTA 2D3OR 1MWZA 4JI7I 2VU5A 5KFDA 4K4VA 4DPTA 4NZ6A 2IJFA 5A2QY 4W92B 4RW9A 2XSJB 4WUDA 3NGTA 2WNRB 1VR6A 1S57A 2GGPB 5KFIA 2HVHA 1JXLA 3KLGB 4JI5F 1QAIA 2Z5CB 3KRNA 2RS8A 3G96A 2JLFA 1UJ4A 3IGVA 4EO6A 2ZM6I 3MHYA 4HYKA 2QRRA 1Y7PA 3PX4A 2R8HA 2F4VE 4EYHB 1XBWA 1HNWI 1RWWB 2RNEA 2FVQA 2EC2A 1Q86T 4KHPE 2DH8A 1CS4B 2X3DA 2JEBB 5KG7A 4DX7A 2HBQB 5HLFA 2X1BA 3SSQA 2ZDOA 1HNXJ 1O8BA 2F1FA 1JNZB 4DSLA 5AJ3F 1QAJA 4O3RA 3I5BA 1Y10A 3GLJA 3NNHA 1JMTA 2FHKA 1HIYA 1J5EE 2NYHA 1JLCA 4AQYI 2WVFA 4OZNA 1LK7A 2H3EB 3GJRB 1R0CB 4DV4J 1C1BB 3VAIA 1X4AA 1S0OA 3H40A 3TZWA 5KOWA 1H7XA 3PEHA 4M8LA 4ZJQA 1P1TA 5HP1B 2A18A 1RA7A 1Q7LB 1FFWB 2XYHB 3J7YI 3LPYA 4FS1A 3MR7A 2GFFA 1G3OA 4HI2A 2YWGA 3MEEB 4F8RA 3JAMC 4PG5A 4ZPVR 1X9SA 3QO9A 4DV0J 3I9ZA 4IR9A 2CQ4A 2R4FA 1UZDA 3CIZA 3MMAB 2DH9A 2X51A 5LMNF 3NS7B 3VGUA 2FLPA 2DGQA 1UVMA 4Q0BA 3DOLB 3MTJA 2GQCA 5E0OA 1HQ2A 1VHFA 4MH8A 3HX9A 4LF7J 3CD5A 4RWWA 1RTHB 1NJXA 3FUYA 1NZAA 1RBOB 3ISZA 2E9RX 4TY8B 2LQBA 4F4KA 3CDAA 1TK5A 1VQ7S 3G71S 2NSBA 2NZCA 1WUUA 5T7LA 1FRXA 1QUVA 3MZIA 3OJUA 1TVRB 2XO6A 1XWLA 3PW0A 4Z7YA 1DY3A 4NLTA 2ZC4A 3WU3A 4MFBB 2AZ1A 3I32A 1Y3JA 2QA4S 2VH7A 1B0PA 2J76E 2QSWA 1BC6A 4J9OA 3B54A 2G4BA 3VALA 3SZ2A 2B3TB 4L6V3 2DXEA 2FB0A 2HWTA 3A3NB 4WUBA 1VFJA 4A8OA 4RW4B 1E6VB 1I51B 3Q8RB 3JTOA 4NXNE 4LFBE 3PHTA 3K1JA 2GVZB 4BA1A 1K44A 3M7ND 1QVGR 2EW9A 2NXEA 1XMOF 2BANB 3BYRA 2HHHI 3RYLA 2BR2B 1KONA 1NJWA 2UUAJ 4HT7A 4F4WA 4NMLA 1R7IA 2KYXA 1NK4A 2IM1A 2MKKA 2IM0A 3LAMA 1FERA 1H73A 3MFIA 4BDPA 2V2ZA 2RUSA 4DR7J 2GJ2A 3GYXB 5LXRA 4DR3I 4QR0A 2N7CA 4P74A 1BMQB 1H98A 3RR7A 1U1KA 2UV8G 3GR1A 4U9RA 2KFZA 2CG8A 1UDQA 4PWDB 1OPIA 1FXDA 2HNDB 4LF8E 4YB6A 2EKYA 1N32E 1YI2S 1AT1B 2UUBF 2YTCA 2WOMA 4A8MP 1RT4B 1BHNA 1KVKA 5DDQC 4QW8A 1QUPA 2VUGA 1SJ4P 1PYOB 4P10A 3OTBA 2VESA 3LGNA 2HMIA 1UJ6A 2DNPA 3TUJC 3MEDB 3I96A 4KJIA 4RUCA 1U1QA 4DV2E 4DR2I 2LXIA 3ET6B 4WKRA 3B4TA 2NPFA 3C66A 1WKLA 1WC3A 2J7KA 1Q8LA 4LF1A 4MU1A 2QTWA 1FTCA 1N34E 2KH9A 3BQ0A 5DG9A 2D9OA 4LCGA 1UJ5A 2BOAA 3E3XA 4DX5A 3S7RA 2E5LE 2ZZTA 5EKWA 1RTJA 1VBXA 1I1GA 4M94A 2G9OA 3UE2A 3X1LB 3DYAB 1LWCA 4IZJA 3MD3A 2JLEA 3QZ8A 4OHZA 5DDRC 1OMSA 5EWFA 1Q1KA 5HSPA 3B78A 2YNIB 4LREA 5GAHI 2VHGA 3LNUA 2LYVA 4A8YA 3CO9A 3L4BC 2RHSB 3G82A 1HNVB 5C25A 2C22A 2IYIA 3KLEA 5HO4A 2IM2A 3HK2A 3EVWA 3HT0A 3MR6A 1YDLA 3DXSX 4X4OA 4O0IA 2GJFA 3H20A 1RWXB 2L41A 1JLQB 3TZXA 1EP4B 1FVSA 4NCGA 1PKUA 1YWXA 5CYQB 3D66A 3MECB 2N4CA 4J9SA 4DV3I 5D0HA 4N5SA 5EX3A 5E3QA 1RT2A 2VASA 3P3GA 1S4FA 3JS9A 3KLIA 1B63A 5H9EK 1FKPA 4RO0A 2YQ3A 4IQXA 3Q89A 2M5YA 4TYAA 3J7A1 3H5UA 5DGBA 4EWTA 1IKWB 3CDWA 4E98A 4GKKE 5DROA 4B9NA 3MM6A 4TNOA 5DLFA 4B3TI 4G1IA 3KUEA 3CCJS 1PVGA 4PPDA 3F41A 5JVHQ 2JC1A 3OL8A 3ONQA 4K59A 1H7SA 3HJCA 3HPOA 2LU1A 3DKDA 3RR8A 1RISA 2JC0A 1HHSA 4PCQA 4N47A 1FDDA 2F5GA 2DNKA 1MWYA 3AB2B 2V50A 1NBEB 2B4VA 4R8UA 4C48A 3DLKA 4H4KC 3N6LA 3NAHA 4J91A 2NN6A 2UXCJ 4X4RA 2C37A 4ZCIA 4C3KA 2OPQA 4FWGA 1UVJA 4RW8A 1NNDA 2EFNA 4B9UA 1U49A 1WORA 2H9ZA 3GFZA 4Y2CA 1N36J 3U7JA 5IM0B 2NZ4A 2WAQD 4PEOA 1FRLA 3MWBA 4A8SA 1X4EA 2IFXA 4EEYA 3GCMA 4NXME 2YVSA 5J2NA 3QJLA 5KFLA 2Z2ZA 3Q86A 1I5OB 3LF0A 2GW8A 3D67A 5F0WA 3QLHA 4LMZA 1EJ7L 2PO1B 3C19A 3W8PA 1FDBA 3M2UB 4ZKAA 2ZEJA 3SXLA 4F04B 4MIWA 4OX9E 2XB2D 1AW0A 5LMUE 2D3O1 3T41A 2V2QA 1KLNA 1FEEA 3W64A 3N01A 1RLCL 2I38A 1P9QC 4EZ6A 1GT8A 1X0PA 4K4SA 3RUBL 2DBBA 3IFEA 1VIXA 2E29A 3BN4A 2W9AA 4HI1A 4RW6A 4IOAQ 2QLFB 3M32A 2OLWA 5L1JA 1T3NA 4JI8I 2KU7A 3CJ5A 3W3SA 2ZHBA 1AZSB 2XO7A 1B64A 2UUWA 1RHRB 3PEJA 2GIRA 2OJ3A 4OX6A 4X65F 1Z2ZA 5KFMA 5T41A 2E1RA 1R27B 2C3PA 2FGOA 2RUGA 2FLLA 2CQ3A 5C0XA 1NDPA 4O3NA 4LF4J 4DV1I 4OI1A 3UO0A 2B7CB 5HJYA 4YHHJ 4TN2A 5K5MA 4DR1E 4FXDA 5BR8J 2XHWA 4DUZF 4RU9A 1FKOB 1ZS6A 2WRMA 1HD1A 4WYLA 3PRYA 1X4CA 5LMNJ 3P8BB 1P42A 3O2IA 4XDDA 3TUPA 3R6GB 1KOOA 4TU9A 1HD0A 2LEAA 3IBCB 4IO1A 1IBLF 1VISA 4ZPCA 2HNYB 4I4BA 3TR5A 5LJ5Y 4WE1A 3UN2A 1Z0TA 4CP5A 4IDKA 5KTQA 4JV2A 1R6LA 3FNNA 4RW9B 2AYMA 1TL5A 4LF5I 2ZH8A 2VJUA 4ZA1A 4XPCA 1R8BA 4A8KA 3DNCA 2HURA 4LFAF 1HR0E 5D78A 1MW7A 1ZYQA 2L9WA 2CNOB 4FDFA 4B9LA 2OUGA 1U1PA 2F7VA 1B70B 4F67A 3SQGA 2FLNA 3FCWA 5AXMA 3CMAS 3GB0A 1T9WA 1FE0A 3DHWC 2DRAA 2M8HA 4ECUA 2HAIA 2FZKB 1Z0VA 4KO0A 3VR1A 5F8IA 4DQQA 1Y60A 5HLFB 2QL7B 2MKSA 4WFBQ 4PAAA 3G86A 4DL3A 2AJ1A 1Z0CA 1D8ZA 2LXUA 1JLCB 5IWAI 1S1TA 3NEKA 5L1LA 3J7YU 2AJ4A 4LSNA 3V4MA 4FW5A 1TKTA 5LSOA 2GAGC 2V9WA 5IT9C 5HQ8A 1YHCA 3LA0A 4DR4I 1T11A 5J1NA 3SSRA 3NCQA 1IQTA 2BJ7A 1B0TA 1CG2A 4UOCA 3QO9B 1O0PA 4OYMA 3C46A 1U09A 3CJKB 2ZKUA 4NOHA 1IXKA 4NLUA 3SQOP 2DNOA 4YR0A 4PRFA 3QRQA 5L39A 1QM9A 1RJJA 4Q0BB 1NHIA 3VAHA 4DV5F 2MQOA 3L7PA 3IN5A 1O51A 2RILA 2GHPA 4DS5A 3UVJA 2ZKTA 1FCAA 1YBTA 4DV6I 3QAUA 4WK3A 1XHKA 2PNMA 2ZC3A 2R2SA 4BC7A 2HS4A 4F3QA 2K2PA 5T7LB 1QD1A 3SV3A 5B0FA 1BGXT 5KT5A 1IKXA 3BO2A 5F3ZA 4FF3A 2BVZA 4DBQA 5C2GA 2W2OP 2FYXA 1YTYA 2C2ZB 5FLXC 3T9NA 4QYRA 1M5HA 4JV5J 1NRKA 2O1PA 3RZAA 1LQ9A 2LU2A 3NY0A 3C16A 4X64J 3PRBA 4ICLA 1RK8A 5KFTA 3Q8PB 4F02A 4OYZA 3M6UA 1Q5YA 5LM7E 2IHR1 2PA3A 2UU9F 4DUYF 1S1UB 3M9NB 3L95X 5KFHA 3CJ4A 4HEA9 3VCDA 5K20B 4MK7A 3LPSA 3DD6A 2YXLA 1UP1A 1T05A 4WIQA 3A3OB 2ZH7A 1SKSA 4BA1B 2P5VA 2W4CA 1WHXA 3MMCA 2MXYA 2RS2A 5KFKA 3N5BA 2RQKA 4QWCA 2DYAA 4DWIA 5KFJA 1RZMA 4JI5I 3UW1A 2LQJA 3ENQA 1LXNA 3OXGA 5A0YA 1ZH5A 2CQHA 4DFJA 2FHJD 2XS5A 4DR6I 2LQ9A 4WFYA 1F0XA 3T1YI 2MLXA 2RAQA 4HTJA 4FVCA 4I0WA 3CD7A 3W5ZA 1R31A 1CPZA 1WHWA 1HQUA 1M1GA 1Q79A 2B9XA 4DL7A 2OELA 4X66E 1B7YB 3TRGA 2FVCA 3D9BA 3C3LA 5KFFA 5CZXA 4OYOA 2ZH3A 4LF6E 2WOMB 1FX2A 3HHEA 3NCPA 5D4OA 1EHWA 2B6AA 1B62A 2BW2A 2HFZA 3J80U 2HMIB 3W9JA 2CJAA 2YKMA 3I5CA 3I82A 4LPFA 1RAAB 3AJ2A 2BJDA 1HNZE 4B3RF 4IG0B 4OZEA 3IGNA 5C24A 4L72B 3D1HA 1U45A 4NRTA 1NDKA 4U96A 1E3PA 2JFKA 1T9XA 2QMUB 4WIIA 4Y34A 1MWQA 2VPWB 2XHCA 1V3SA 2RRBA 4LF2A 2V69A 3O44A 4CLWA 2AGPA 1XR5A 3BZQA 1VGYA 1RTJB 5KFNA 2DITA 1XNQF 1S72S 5GMDA 2NSCA 4OZ5A 4KC5A 1Y4SA 1LWCB 4IZJB 1NK7A 2XMJA 3BR9A 3GLLA 2YQ1A 3J7ZT 5GAHU 5AXNA 4URLA 1FDNA 1WC1A 4EO8A 1XMQE 2E5JA 3D6HB 1XNRF 3H4LA 4USTA 1RSCA 1M5OC 3RTVA 2AGOA 1XERA 2LA6A 3G82B 1H2UX 4RL1A 4DFPA 5C25B 1FJGE 3KLEB 3CVKA 4W98A 1N33F 1ZAWA 2QA4G 3JAMQ 4DQIA 2K8GA 3H0PA 2ATLA 2CPXA 4O4RA 2VODA 1OYSA 1MSWD 2O01C 3GPAA 3T1HI 4QU7A 4L3NA 4F4ZA 3UR3C 3AQPA 2W2NP 3R5JB 4NCGB 1NSQA 1Q8IA 3TEHB 4YFUA 3DRSA 2YWFA 2HG4A 1K1QA 2U1AA 2RHQB 4KHMA 2R7RA 2UUCF 4LR8A 2IDLA 2Y0BB 2IYGA 3KLIB 3CDUA 1FKPB 2CNLB 3PTWA 3KK2A 2XNQA 4JYAE 1LW0A 2CRLA 5DS7A 3P5BP 1NK5A 5IFMA 3MM6B 4QCLA 2YX7A 3EGWB 1N5YA 5F8JA 5KG1A 4LFCF 3TUZC 2CFXA 2HQIA 1N5QA 2LLZA 1XMOI 2NN6F 3K2YA 4B9TA 1YVFA 3OTOF 1LFWA 3QGPA 2F8MA 1S0VA 1JKHA 2XGPA 4R8UB 4OIXA 1A7GE 3DLKB 1N88A 3JSMA 2NN6B 4LR9A 3J81j 1LV5A 1EQMA 5IQQA 2WB4A 1GK8A 1M5PC 2C37B 2ROEA 3EICA 4KFBA 2OPQB 3NBPA 1IKYA 2ERRA 4ZPWR 1DLOA 4RW8B 1YSJA 4F0HA 2ADBA 4OMFG 2DGVA 3A13A 4LF9J 3BREA 1TTHB 3BDPA 1N0VC 2IBOA 1IBMJ 1SUQA 2MKIA 3PJ9A 6AT1B 2LECA 4TY9A 4UF4A 5J2NB 4URQU 2UUBI 2E5IA 1SKUB 2YY3A 2QFIA 3QLHB 2CPHA 3FMBA 9ATCB 3QT8A 2OKQA 3FSYA 2GIQA 4WCEQ 1H2VZ 3CO0P 4QWEA 2K7KA 4A8QA 2HHXA 4ECWA 1USVA 2E7VA 2Z2YB 1FHTA 4QYZJ 1ACMB 4ZLLA 4ZJLA 1ZAVA 3SIPB 4QPTA 1RE1B 2DO4A 1HWIA 2XZDB 4FXWA 2QJ3A 5DG8A 5K36A 2XZWA 3RBXA 3G8TA 1NDLA 2JLGA 4FNIA 4FWDA 3Q2SC 3AD7C 4K4TA 3OR1A 2BRLA 4ZVOB 3OHAA 2CDQA 2AWZA 2KKHA 4RW6B 1ZPVA 3B6BA 1UAWA 3M32B 4DR5J 3BYPA 4X4VA 3GQCA 4LBPA 5C0XF 1NEEA 4P72A 3I0SA 2ZJRQ 3ZZRA 3KDNA 5GAGI 1EKSA 4AE5A 4O23A 2C38A 3BSOA 4MDTA 1LFPA 3KHHA 5KG2A 3FKBA 5C0XB 4NMXA 3ZTQA 3AJDA 2QLXA 3D7SB 3D6FB 3PJXA 2G13A 1H2TZ 1QZRA 3K17A 2MQQA 2WBRA 1RWPB 1OYPA 2L08A 3QMQA 4JI4I 3VTIA 4JI2J 2DXDA 1UVIA 1R8PA 4P7VA 1U1LA 3MTKA 2UXDI 2X1GA 2P2CB 4KB7A 4USJC 1VYAA 1V9OA 1S79A 5B0DA 2HHVA 1I94E 3B4MA 1XN9A 5M2UA 2C3UA 5DO2A 1OO0B 1GXUA 2LEBA 3X3UA 5J2QA 3V2UC 1TL3A 2MKJA 5A8RA 4URSA 2UV8A 4WE1B 1F9FA 3EDRB 2HKJA 1HBUA 4IDKB 2YKAA 1J5OA 4YY3F 4QIFA 2R8JA 4UZCA 4OZJA 3HJFA 2FVPA 2JOQA 3SCLE 2KDOA 4JV0A 2HEKA 2RH3A 4I6YA 1MG7A 1MN7A 1P6TA 2JZ5A 5M2RA 4X4UA 1FRJA 3CJ3A 2HVIA 1F1BB 2FJAB 4F25A 3K5LA 4FYYB 4NYOA 5D8HB 1S6UA 4G65A 1CC7A 3NWRA 4RX6A 2VC0A 1IBKI 4BA2A 3SQGB 4HXZA 3C6UA 3MUVP 4CH0S 2BRKA 5HATA 3UDLA 3BBCA 3DOKA 1HHTP 4KO0B 2UU9J 1TQLA 3W2WA 4DUYJ 2UZAA 2E44A 2CPDA 2YX1A 4ZN3A 2HFUA 2IA6A 1C4CA 4JI1J 1HYSA 1YJ7A 3M8QA 3GIMA 5ETNA 1LK5A 2RDDA 3ZKBA 4B02A 3UQSA 1GMWA 2XSFA 4F3MA 4DU8A 2Y1IA 3UR0A 1S1TB 2YWWA 2A10A 3H25A 4K8RA 4NLVA 1DHMA 4GKKJ 3CWVA 4NZ0A 4LSNB 1R8CA 5IV3A 2KT2A 2F4VF 2OD6A 1L3VA 5HMZA 5KT2A 2R7WA 1U6FA 3GMEA 5KFZA 4ZVEA 4Y0FA 1VI7A 5MLCV 3GFYA 3TAMA 1HNXE 1JNRB 4K0KJ 2AX1A 2HPUA 3VQTA 2QG9B 4B3TE 3WU4A 2BQRA 2CDRB 5D4NA 1V5VA 3ILJA 3MM7A 1NPKA 2W8LA 3PVXA 5CCMA 4U3DA 4ZJOA 3BBBA 3L3CA 5GADI 4DV4E 2O67A 2X1FA 4RNHA 1J5EF 1KN6A 5AXLA 2PO2A 1A6LA 2HHPA 1KFSA 2G1HA 3HO1A 3P3EA 2RKIA 4JI3I 4ELUA 2Q66A 2LA4A 2RE1A 2ZM6F 3UVJB 2Y0SD 4YR2A 3FMWA 1C2PA 4PG7A 2XM3A 3TVKA 3OTDA 4PWWA 1KS2A 2Z5EA 2PNZA 4NRUA 4NXMJ 3CSKA 3LPEA 2IAJA 5ETRA 1HNWF 4DV0E 2DGXA 3JSRA 1EA6A 4X65I 1S6OA 2C3MA 2GMJA 3HDSA 5A2QC 4ECVA 1IKXB 2JVRA 5B0CA 1MLAA 2CGEA 2CQIA 2KM8B 4IRDA 2GO4A 1XTZA 1UFWA 1S6PA 4UOFA 4ALZA 1U4BA 3KUGA 4LRDA 3OSNA 4LF7E 4A8FA 4DUZI 3QIPA 1UDOA 4AQYF 4FZVA 3UD5A 3C16B 5KFXA 4DEZA 3TX0A 1NU4A 4N8OA 4ICLB 3L7OA 3N4WA 3CCSS 4LSZB 1WELA 1NH8A 2F65A 1UEUA 1IBLI 8AT1B 1X7VA 2CZVC 4F0KA 2D9PA 2BJ3A 2IPOB 1XNRJ 1T9YA 4OJ3A 4DSIA 1NKBA 4XK8C 1T05B 5MAOA 4OYWA 1KHWA 5J1PA 4GMKA 1JXEA 3TJAA 3MMCB 3KLVA 2PMZD 3US5A 2G2YA 2WZ1A 3E51A 1RGVA 3PW5A 4NL5A 4UY8T 1VBZA 2JEIA 4P6QA 1RT3A 1WACA 4LFAI 3TP2A 5A0YB 2HBZB 3OW2R 5ELWA 3FJ2A 3M05A 5HN0A 4OZ1A 3HD2A 5IC6B 1NKCA 2KYZA 1NUEA 4AL5A 1BQXA 3S01A 5KOXA 2CG9A 1U0HA 2CJKA 3OL7A 1HKAA 2KN4A 2HVEA 2UUCJ 1FJEB 3KNGA 2DGUA 3BGLA 3Q22A 1HQUB 2G0CA 3FSIA 2DHHA 4ECQA 3Q1QA 3HHKA 4NXNF 2GHWA 4ED7A 4DSFA 4FW6A 1X5SA 5DJBA 4ED2A 4DPOA 3T1AA 4YS2A 2EPIA 1WC0A 3VAKA 3N5FA 2ZBQA 1X4HA 4ERDA 2B6AB 4LFCJ 4MQYA 4FXVA 3CCZA 4DR7E 2OEJA 2BQ3A 2YKMB 4TLQA 2ROGA 4CT9A 2VQEJ 1TUGB 4HACA 2ZVIA 5C24B 3UDCA 2B0GA 1HR0J 5J2PA 4H4MA 4DHVA 1SQEA 2JNJA 2MTLA 3KLFA 2L9NA 3K89A 4NASA 4USIA 3MM8A 2W2MP 1YRXA 1AXQA 5CYJA 1S12A 4EU0A 4ED3A 2MQLA 4LF8F 1N32F 1WSVA 2ZDPA 2Y1JA 1MROA 2GS8A 2QGFB 4DV7J 4IG3A 1IUJA 4E2FB 4YB1P 2W9BA 5ETVA 4X62J 1YK9A 2RIJA 1DJ0A 2WTFA 4DCPB 1VDHA 4DV5I 4LR7A 2YPZA 2MJUA 4ZIVA 2MQNA 4CDIA 4DV2F 2H51B 1RT5A 2DD8S 4GKJE 2XI2A 1Y11A 1CULA 1H72C 4F26A 4QBUA 2BYCA 2HBYB 3MOJB 5IT9Q 1UMJA 2Z57B 3M8SA 1Q78A 4OX8A 1N34F 3CCRS 2C42A 1YJNS 3R5BA 4D3HA 5ETSA 3GIKA 5IWAE 1WOPA 2E5LF 1WTFA 2WCXA 2R2RA 3MXHP 1XJWB 4USUA 3K85A 5IXUA 3SEOA 3VZHA 4C2MA 3DLLQ 3OVAA 1M5KC 3GG0A 2ZJQQ 2VDHA 1M1KT 2CZ4A 3DRSB 1SC1B 1TL7A 1ICEB 2JRSA 3K8WA 5CCLA 1MMNA 3C14A 3PR5B 2V4RA 4X4QA 3I0RA 1WG1A 2A2CA 2CNKB 1FFSB 1FEHA 4ZLPA 3VAGA 2XBPA 5H9EJ 2H1YA 3KK2B 1LW0B 2HK3A 2IY5B 4LVNP 1VQYA 5HQMA 4CO4A 4ZP8A 2E9ZA 2IA0A 3J80Y 2ZVSA 1HWJA 4JI6J 3N79A 3DN9A 3ICLA 1N5YB 3B8HA 1YBAA 4ZIWA 2IMWP 1Y3KA 1KOHA 4LBIA 2XY5A 1RQ0A 2CPJA 2ASDA 4QR1A 1WC5A 5JEAA 4DQPA 5FLXQ 4OO1E 4OI2A 3N6MA 4V1Ak 2CPFA 1JKHB 2CJBA 5IOLA 4NYZA 4NLRA 2WVEA 3JSMB 3KJNB 1S7IA 3AT1B 3QFHA 1VQ9S 1CBKA 4KFBB 3NBPB 1IKYB 4PKDB 1DLOB 1JX4A 5LL6R 4GC7A 1N5SA 4OZLA 1VQMS 1EQ0A 2M3DA 1F5CA 2R3VA 1F60B 5A6PA 3P3CA 2ZH4A 2O3ZA 1WHYA 3GR0A 1SUQB 3OFFA 2HQGA 3T3FA 1X4FA 3IG1A 3CMES 4WTOB 2VG6A 4EI2A 3I6PA 5HMXA 4O0NA 3EPGA 3FSXA 4DJBA 5B08A 2UXCE 3P76A 4B3RI 3W65A 3JAMY 2WSFC 2XYPB 2L9DA 3LGMA 2XLIA 1IR0A 2VQFJ 2UXBJ 4DPXA 1N36E 4ECZA 4WFZA 5K36B 3ZZUA 3AOBA 1SPBP 1S0MA 3DDKA 1CLFA 1AYEA 1U24A 4KE5A 1S76D 3OR1B 3MFHA 4N56A 4IZJD 1QTMA 1Z5CA 3IRWP 2HQ3A 1OQ3A 5D3GA 5AT1B 4FF4A 3I0SB 3N28A 1Q8KA 3D1QA 2Z2MA 1XNQI 3AA8A 2MY8A 2KRRA 3HMJG 2K06A 3FRYA 1NZ0A 4OV6A 2NLWA 4LOMA 4M5GA 4OX9F 2C38B 2H5JB 1X8DA 1QVFR 1NHJA 2A3JA 3T5HA 4K2XA 3V6DA 2DR7A 1SJ3P 1HW9A 3DOMA 2O1VA 3NL0A 4CLSA 4JI7J 1P1LA 1KHVA 3PKYA 2HIQA 1ZTTA 2VG7A 1N33I 5GMEA 3GYGA 3I9V9 1FWLA 3KMSA 4YOEA 2BOPA 2FGCA 4ZPBA 4AL6A 2KT5A 5DQHA 2ZFHA 1DTTA 5KFPA 4MK9A 5IT0A 1UFLA 5DRKA 2Z2LA 3CF5Q 3KYLA 2BM1A 1L5UA 2C28A 5J2QB 1TL3B 2ZM6J 4WJBA 5A8RB 1WF0A 1HBUB 4LF4E 5KFYA 1J5OB 4B3SI 1C4AA 4H54A 4YHHE 5AE1A 1X5TA 5L1IA 1FT8A 1YZ7A 1HNWJ 5FIIA 2PFFB 3O8WA 1SV5A 5BR8E 3ZKDA 1SH0A 1SCJB 5LJ3Y 4J9QA 5CABA 3JXOA 2AV5A 2OFGX 4DR1F 4Y2AA 3U1KA 4IYQA 3FBEA 1WI8A 3DRPA 2C2DA 5LMNE 3JYTA 5DGAA 4IOCQ 4DUTA 2LFVA 2OGUA 3ZXWA 3TAPA 1PCAA 4K5SA 4IOBA 1SJ1A 4WKYA 3I56S 4KKOA 2GZOA 4YB7A 4DMZA 1VMBA 2VPXB 4XAKA 1U2CA 1RACB 4BA2B 1UVNA 2NN6D 3CGIA 1UFKA 3C6UB 4AQYJ 1RHUB 4ELTA 3OTOI 1RT7A 1T95A 2B9WA 3DOKB 2ZBIA 4RNFA 1VQPS 2PEHA 7FDRA 2MZ1A 3Q8VA 1RWVB 3W2WB 4CO1A 1TR0A 3RAQA 3TEGA 5JUMA 1HI1A 3LP1A 4Y2KA 2EEYA 3BGUA 1HYSB 5EUHA 4RUAA 3ISND 3M8QB 5DQIA 2E7WA 2FZGB 4N3OA 2PO0A 2MSSA 1UWBA 2HFSA 2XWYA 2XULA 4WBFA 2FJXA 1NXIA 4DFKA 2NCKL 2HQFA 4JP8A 2P6TA 2VFTA 4ZCMA 4WFAQ 1V3ZA 5KFAA 4IFYA 2NPIA 4NLDA 3KDOA 2BM0A 2GX8A 2DRDA 3LUYA 3M30A 1S99A 2V0NA 2VOPA 2DNMA 3TAMB 5A6WA 5GADU 1FNOA 3DHXA 2KXHA 1U1OA 3MM7B 2UVVA 1AFIA 1RHKB 3OT9A 1RKIA 1N48A 2OPSA 2F3JA 2FC8A 1VLOA 1PSDA 1S49A 2O5DA 4GQUA 4NLSA 3FCVA 4U67Q 2PO2B 1NJYA 4AL7A 3J7AG 2PA8D 2QX0A 1PJ7A 3QYYA 2PI5A 3Q8SB 2RKIB 1Z0WA 4ED8A 1UZHA 1R6VA 3AXMA 3CWJA 5H1SV 2QL5B 2C2RA 2MYFA 2XMVA 2VKRA 3DM2A 4C6AA 5C0XD 2PNZB 4ZS6A 1NSAA 4USVA 2IAJB 3K5OA 3RRGA 3M6AA 4N76A 1LKZA 3R27A 1K8AT 3CDBA 5BYQA 2ZH5A 3QRPA 2UVUA 4OI0A 2LCWA 3OV7A 2UUBE 4HHJA 5GVQA 1S6PB 4J9NA 1T03A 3T19A 2JL9A 1B0VA 3NCRA 4TXSA 4NCAA 2XEXA 3M4XA 5FD1A 1KQSR 1AUDA 1RHJB 4C0OC 3Q8QB 3QIPB 3HFZB
chains in the Genus database with same CATH topology
4LF6I 4DV1E 4JI0I 4X62I 1A6FA 4DR3E 5L3JA 4DV0E 1EA6A 4X65I 1Y4UA 2GQ0A 4DR1I 1FKAE 4LF9E 1FNMA 1S4EA 5A2QC 1NHIA 1IBME 4GKKE 4DU7A 3J7AM 2VQFE 2CGEA 2UXBE 4RPFA 1HNZI 4B3TI 1N0UA 2R42A 1KKHA 4DPUA 3OTOE 1PVGA 4HY1A 1H7SA 3JAMC 3HJCA 1H7UA 1PIEA 4LF8I 1N32I 2UXCE 4LF7E 4YY3I 4DUZI 4DV5E 4DV6I 1N0VC 1XHKA 1XNRE 2PNMA 4B3RI 3J81C 3GONA 3J80C 4JV5E 2UU9I 4DUYI 4GKJI 4DPXA 1S16A 2V2VA 1N36E 1KIJA 1IBLI 2WW4A 3ZZUA 1IBKE 4JI1I 2UUBI 4X64E 2DEIA 3P06A 4DV2I 4DR2E 4LF5E 2Z5BB 5FLXC 3ZZTA 1KTVA 4FWGA 3QT8A 4KQVA 4IZJD 1USVA 2DEJA 1U2RA 1Z5CA 4FW9A 4B3MI 4GKKI 2IOPA 1XMQI 1N34I 1XNQI 4ED4A 1WUUA 3B82A 4JI7E 4NXME 1NZ0A 2UUCE 4DR5E 1Z5BA 4LFAI 2E5LI 4Z7YA 3WU5A 4FWDA 4JI6I 1NHJA 2Z5BA 4USMA 3WU3A 1FJGI 4K0KI 3LPSA 2O1UA 1Y6ZA 5FWKA 3QT6A 2CG9A 4MYUA 3PYGA 2V34A 2O1VA 4OX9E 1Z0GA 5LMUE 3T1HE 3HULA 4Z7CA 2V2QA 4FWHA 2ZM6E 1N33I 5GMEA 4LFCE 4HACB 1DARA 1NHHA 4JI5I 1K47A 3Q1QA 1HNXI 1FWLA 1H74A 4HYMA 2F4VI 2VQEE 4DR6I 4WUBA 4JI2E 1MX0A 1HNWE 3T1YI 4KHPI 1ZM9A 2BM1A 2O1TA 4NXNE 4LFBE 4DV4I 3K1JA 3ZZ0A 4PRXA 4JYAI 4NXMI 1QZRA 4DR7E 4LF4E 3K17A 4JI8I 4USKA 4B3SI 4YHHE 4JI4I 4DR4E 4HACA 2HHHI 4WUCA 4JI3E 5BR8E 3ZKDA 4DV3E 4XTJA 2UXDI 4X66E 1J5EI 2E1RA 2A2DA 4AQYE 4DV7E 4PRVA 1FI4A 1H73A 1XMOE 2V2ZA 4UTGA 5LMNE 1I94E 4DPWA 4DV1I 4LF6E 3ZM7A 4JI0E 4P52A 4DR3I 4X62E 2ZBKB 4DV0I 3PYFA 3V2UC 1B62A 1PKPA 3PYDA 2EFGA 4X65E 1ELOA 4LF9I 2HKJA 4DR1E 1IBMI 3WU6A 2GS8A 2VQFI 2UXBI 1HNZE 3OTOI 3PRYA 4LF8E 1N32E 1MG7A 2UXCI 4LF7I 1Z0BA 1Z0EA 4YY3E 1VISA 4DUZE 4DV5I 2VF3A 4DV6E 1XNRI 4B3RE 1KVKA 2PNLA 2X36A 4JV5I 2UU9E 4DUYE 4GKJE 4I3HA 1Z0TA 1N36I 1H72C 1EI1A 1Z5AA 1IBLE 4N3OA 1IBKI 4JI1E 4X64I 2BV3A 3V5RA 2HFSA 4HXZA 1BKNA 5IT9Q 4DV2E 1MU5A 4DR2I 4LF5I 3PYEA 5GMDA 2NPFA 1RREA 1Y4SA 4IZJB 4P7AA 1D6TA 5IWAE 1ZXMA 4ZVIA 4IZKB 2J7KA 2UUAE 4M1KA 1HR0E 4URLA 2HFUA 2BM0A 4B3ME 3K85A 2IOQA 1XMQE 1N34E 1XNQE 1HK7A 3QT7A 4JI7I 2UUCI 4UT4A 4DR5I 1UEKA 3H4LA 3ZKBA 4DPTA 4LFAE 4R1FA 2E5LE 5A2QQ 1ZXNA 4DU8A 4WUDA 4PU9A 4JI6E 1RR9A 1FWKA 1FJGE 4K0KE 1USUA 1Z0VA 2A2CA 3CWVA 2Z5CB 4FN5A 4IZJA 3JAMQ 4IZKA 4OX9I 3Q6MA 2HK3A 5LMUI 4EMDA 3T1HI 3F0NA 2HKEA 3J7AG 2ZM6I 3B78A 4LFCI 1N33E 3J81Q 3J80Q 1ZM2A 2ZITA 4JI5E 1HNXE 1Z0WA 2LJPA 3LNUA 1OJ4A 3B8HA 1Z0CA 2F4VE 2VQEI 2CZ9A 4B3TE 2O1WA 3WU4A 4DR6E 2X7IA 5IWAI 3QT5A 4JI2I 1HNWI 3D4JA 3T1YE 4KHPE 2UUAI 4MYTA 4JG4A 1HR0I 3LTOA 2AJ4A 2Z5CA 5FLXQ 4NXNI 4LFBI 4DV4E 3M6AA 2OI2A 4JYAE 3Q6NA 4DR7I 2HK2A 4LF4I 5IT9C 4JI8E 2V8PA 1ZM3A 4B3SE 4YHHI 4DR4I 4JI4E 1ZM4A 4DXLA 2HHHE 4JI3I 2Q2EB 5BR8I 4DV3I 2UUBE 4X66I 1Z59A 2UXDE 5LL6R 1J5EE 2XEXA 4DPYA 4AQYI 4DV7I 1B63A 1XMOI 5LMNI 1I94I 2Z5EA 2R3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 I;  4DV1 E;  4JI0 I;  4X62 I;  1A6F A;  4DR3 E;  5L3J A;  4DV0 E;  1EA6 A;  4X65 I;  4DR1 I;  1FKA E;  4LF9 E;  1FNM A;  1S4E A;  5A2Q C;  1NHI A;  1IBM E;  4GKK E;  4DU7 A;  3J7A M;  2VQF E;  2UXB E;  4RPF A;  1HNZ I;  4B3T I;  1N0U A;  2R42 A;  1KKH A;  4DPU A;  3OTO E;  1PVG A;  4HY1 A;  1H7S A;  3JAM C;  1H7U A;  1PIE A;  4LF8 I;  1N32 I;  2UXC E;  4LF7 E;  4YY3 I;  4DUZ I;  4DV5 E;  4DV6 I;  1N0V C;  1XHK A;  1XNR E;  4B3R I;  3J81 C;  3GON A;  3J80 C;  4JV5 E;  2UU9 I;  4DUY I;  4GKJ I;  4DPX A;  1S16 A;  2V2V A;  1N36 E;  1KIJ A;  1IBL I;  2WW4 A;  3ZZU A;  1IBK E;  4JI1 I;  2UUB I;  4X64 E;  2DEI A;  4DV2 I;  4DR2 E;  4LF5 E;  5FLX C;  3ZZT A;  1KTV A;  4FWG A;  3QT8 A;  4KQV A;  2DEJ A;  1U2R A;  1Z5C A;  4FW9 A;  4B3M I;  4GKK I;  1XMQ I;  1N34 I;  1XNQ I;  4ED4 A;  1WUU A;  3B82 A;  4JI7 E;  4NXM E;  1NZ0 A;  2UUC E;  4DR5 E;  1Z5B A;  4LFA I;  2E5L I;  4Z7Y A;  3WU5 A;  4FWD A;  4JI6 I;  1NHJ A;  4USM A;  3WU3 A;  1FJG I;  4K0K I;  3LPS A;  3QT6 A;  4MYU A;  3PYG A;  2V34 A;  4OX9 E;  1Z0G A;  5LMU E;  3T1H E;  3HUL A;  4Z7C A;  2V2Q A;  4FWH A;  2ZM6 E;  1N33 I;  5GME A;  4LFC E;  4HAC B;  1DAR A;  1NHH A;  4JI5 I;  1K47 A;  3Q1Q A;  1HNX I;  1FWL A;  1H74 A;  4HYM A;  2F4V I;  2VQE E;  4DR6 I;  4WUB A;  4JI2 E;  1MX0 A;  1HNW E;  3T1Y I;  4KHP I;  1ZM9 A;  2BM1 A;  4NXN E;  4LFB E;  4DV4 I;  3K1J A;  3ZZ0 A;  4PRX A;  4JYA I;  4NXM I;  1QZR A;  4DR7 E;  4LF4 E;  3K17 A;  4JI8 I;  4USK A;  4B3S I;  4YHH E;  4JI4 I;  4DR4 E;  4HAC A;  2HHH I;  4WUC A;  4JI3 E;  5BR8 E;  3ZKD A;  4DV3 E;  4XTJ A;  2UXD I;  4X66 E;  1J5E I;  2E1R A;  2A2D A;  4AQY E;  4DV7 E;  4PRV A;  1FI4 A;  1H73 A;  1XMO E;  2V2Z A;  4UTG A;  1I94 E;  5LMN E;  4DPW A;  4DV1 I;  4LF6 E;  3ZM7 A;  4JI0 E;  4P52 A;  4DR3 I;  4X62 E;  2ZBK B;  4DV0 I;  3PYF A;  3V2U C;  1B62 A;  1PKP A;  3PYD A;  2EFG A;  4X65 E;  1ELO A;  4LF9 I;  2HKJ A;  4DR1 E;  1IBM I;  3WU6 A;  2GS8 A;  2VQF I;  2UXB I;  1HNZ E;  3OTO I;  4LF8 E;  1N32 E;  1MG7 A;  2UXC I;  4LF7 I;  1Z0B A;  1Z0E A;  4YY3 E;  1VIS A;  4DUZ E;  4DV5 I;  2VF3 A;  4DV6 E;  1XNR I;  4B3R E;  1KVK A;  2X36 A;  4JV5 I;  2UU9 E;  4DUY E;  4GKJ E;  4I3H A;  1Z0T A;  1N36 I;  1H72 C;  1EI1 A;  1Z5A A;  1IBL E;  1IBK I;  4JI1 E;  4X64 I;  2BV3 A;  3V5R A;  2HFS A;  4HXZ A;  1BKN A;  5IT9 Q;  4DV2 E;  1MU5 A;  4DR2 I;  4LF5 I;  3PYE A;  5GMD A;  2NPF A;  1RRE A;  4P7A A;  1D6T A;  5IWA E;  1ZXM A;  4ZVI A;  2J7K A;  2UUA E;  4M1K A;  1HR0 E;  4URL A;  2HFU A;  2BM0 A;  4B3M E;  1XMQ E;  1N34 E;  1XNQ E;  3QT7 A;  4JI7 I;  2UUC I;  4UT4 A;  4DR5 I;  1UEK A;  3H4L A;  3ZKB A;  4DPT A;  4LFA E;  4R1F A;  2E5L E;  5A2Q Q;  1ZXN A;  4DU8 A;  4WUD A;  4PU9 A;  4JI6 E;  1RR9 A;  1FWK A;  1FJG E;  4K0K E;  1Z0V A;  2A2C A;  3CWV A;  4FN5 A;  3JAM Q;  4OX9 I;  2HK3 A;  5LMU I;  4EMD A;  3T1H I;  3F0N A;  2HKE A;  3J7A G;  2ZM6 I;  3B78 A;  4LFC I;  1N33 E;  3J81 Q;  3J80 Q;  1ZM2 A;  2ZIT A;  4JI5 E;  1HNX E;  1Z0W A;  2LJP A;  3LNU A;  1OJ4 A;  3B8H A;  1Z0C A;  2F4V E;  2VQE I;  2CZ9 A;  4B3T E;  3WU4 A;  4DR6 E;  2X7I A;  5IWA I;  3QT5 A;  4JI2 I;  1HNW I;  3D4J A;  3T1Y E;  4KHP E;  2UUA I;  4MYT A;  4JG4 A;  1HR0 I;  3LTO A;  2AJ4 A;  5FLX Q;  4NXN I;  4LFB I;  4DV4 E;  3M6A A;  2OI2 A;  4JYA E;  4DR7 I;  2HK2 A;  4LF4 I;  5IT9 C;  4JI8 E;  2V8P A;  1ZM3 A;  4B3S E;  4YHH I;  4DR4 I;  4JI4 E;  1ZM4 A;  4DXL A;  2HHH E;  4JI3 I;  2Q2E B;  5BR8 I;  4DV3 I;  2UUB E;  4X66 I;  1Z59 A;  2UXD E;  5LL6 R;  1J5E E;  2XEX A;  4DPY A;  4AQY I;  4DV7 I;  1B63 A;  1XMO I;  5LMN I;  1I94 I;  2R3V A; 
#chains in the Genus database with same CATH topology
 4JI0 I;  3PFO A;  3DU5 A;  2HHH J;  3DLH A;  3EZU A;  1S4E A;  3QID A;  3J7A M;  2F9J A;  1HBO A;  5JXS A;  5IS2 A;  3PR4 A;  4C7Q A;  2IIH A;  2VFR A;  2W7A A;  4DR4 F;  4DR3 J;  3VGV A;  3W8G A;  4YY3 I;  1SIW B;  3T5K A;  4PG4 A;  1XK8 A;  4K4X A;  2YH0 A;  4I2P A;  5FJ4 A;  5T14 A;  2B8P A;  4JV5 E;  4IFV A;  3R2D J;  5LSR A;  3EZO A;  3GZ7 A;  4RW7 A;  2RQC A;  3MDF A;  1RT3 B;  2PC6 A;  4X64 E;  3CJQ A;  3DRR A;  3IBW A;  1PBA A;  2V2K A;  3UNG C;  3PRV A;  3M85 D;  1RAD B;  3WHI A;  2PN6 A;  4Y3C A;  3RAM A;  1B4S A;  1U0H B;  4D3G A;  3G6X A;  3R5D A;  4HDH A;  3EGV A;  3KHG A;  1YJW S;  4B3M I;  3K59 A;  3SMZ A;  3OSP A;  3KTQ A;  3AFG A;  2QMX A;  4DR2 J;  1RLD A;  5DLG A;  1E6Y A;  4QIV A;  1RWO B;  2J6U A;  3DI6 A;  3VWS A;  5F8H A;  5L38 A;  3VAF A;  2LP4 A;  2K1R A;  2R7O A;  2EFP A;  1JLF A;  4R0E A;  1Z2L A;  3CD0 A;  4I6W A;  2Q3P A;  2F9D A;  4J9L A;  4G1Q A;  4HAC B;  1KD1 T;  4AT1 B;  3F56 A;  2N4D A;  3AH6 A;  1H74 A;  2KI2 A;  1KNZ A;  1JLB A;  2F4V I;  5J2P B;  5DET A;  4OJG A;  2JSX A;  5L9N A;  4H4M B;  5KFR A;  1YG0 A;  5I3Q A;  4KHP I;  1N56 A;  3KLF B;  1ZM9 A;  3MM8 B;  4PXD A;  2PD1 A;  1S9G A;  3TAQ A;  3D2W A;  3H59 A;  1AA1 B;  3WX8 A;  4IFD A;  2PO4 A;  4IH5 A;  4X66 F;  2ZJP Q;  2FQQ B;  3QFW A;  2MQ8 A;  3PX6 A;  1MRO B;  3PV8 A;  1KEK A;  4LF6 F;  1UKU A;  5ETP A;  4WUC A;  4IG3 B;  5DZ6 A;  4FYV B;  1J5E I;  2W9B B;  1C0U A;  1IWA A;  2CQB A;  2MB0 B;  3KJF B;  3FBC A;  5D15 A;  2AD9 A;  1U7L A;  1HNZ F;  2GO8 A;  4DR6 F;  3E8O A;  3GJQ B;  4KH1 B;  3CCQ S;  1RT5 B;  3T1Y F;  2WW8 A;  3EXY A;  3TVY A;  4HHU A;  4EFA C;  2QFJ A;  2VBW A;  1C1C A;  4J37 A;  1CUL B;  4YN3 B;  4DV3 J;  2VBZ A;  5EWE A;  1XQI A;  3AB4 B;  2V4Q A;  1RHQ B;  2VOO A;  3R7B B;  2EC0 A;  4F4Y A;  5KFS A;  2HRT A;  3DGV A;  5DQG A;  2LQ5 A;  2BA0 G;  4DF8 A;  5F8M A;  2LEP A;  1OY6 A;  3HVT A;  3RAX A;  4B3T J;  5M2P A;  2YH1 A;  4TVA B;  4JUZ A;  1HQE A;  2NUU G;  1TL7 B;  5KT7 A;  1RU2 A;  2GCF A;  3C14 B;  1XMQ F;  2M88 A;  4YP3 A;  3PYE A;  3UD3 P;  3I0R B;  5LOQ A;  1FK9 A;  4ZVQ B;  3BV8 A;  2Q6C A;  4PQU A;  5KT4 A;  1WNE A;  1MMD A;  2B4P A;  3M9O B;  5EWG A;  1FJG F;  3G8Q A;  5JEA F;  2AT1 B;  2B9Y A;  2MHE A;  1QDU B;  4O3O A;  2G0J A;  2H65 B;  2WVB A;  3W2V A;  2J8S A;  5A2Q Q;  1CJU A;  3K57 A;  1RR9 A;  2CQD A;  3T9Z A;  1USU A;  3MOZ A;  1PG5 B;  5JEA B;  2JE6 A;  2OTL S;  2Q79 A;  2JEF A;  4IZK A;  4P7T A;  1VQL S;  3Q6M A;  1M90 T;  3UN5 A;  2N3O A;  4EMD A;  1HI0 P;  1R89 A;  4C0H A;  4CNY A;  1NKE A;  1RCO B;  4RJV A;  2AE8 A;  2ACM A;  1ZM2 A;  2MPU A;  4U7C A;  5BJR A;  2PEB A;  4AYB D;  2R7V A;  4JYA F;  3DMJ A;  1SH3 A;  3H2U B;  2FD2 A;  2DHX A;  1Y5I B;  4BCA A;  4NXN I;  4LFB I;  2RB7 A;  2RF2 A;  1JK9 B;  1UCN A;  2DTJ A;  3CC2 S;  4DN9 A;  2AW0 A;  2V8P A;  3IG1 B;  1SKR A;  2VG6 B;  1X5P A;  2M9K A;  1ZM4 A;  2CJ9 A;  1NDC A;  1NB2 A;  4ZVT B;  3T1H F;  2K3K A;  5JVG Q;  5HVG A;  3QPI A;  3RRK A;  2CPZ A;  4A8W A;  1NSK L;  2B51 A;  2V63 A;  4JI8 J;  1QLN A;  1A6F A;  4OO1 A;  3PS2 A;  3V81 A;  1FKA E;  4LF9 E;  3EXC X;  3ZTS A;  3V6K A;  1IBM E;  1BUX A;  2ASL A;  1UW9 A;  4M5H A;  1NHV A;  1N0U A;  5DNX A;  3AAW B;  1WEZ A;  1KKH A;  1Y5L B;  4DPU A;  3MCM A;  3AOC A;  4HY1 A;  4DV1 J;  2KVQ E;  4LF8 I;  1N32 I;  3HSJ A;  1Q16 B;  4DL6 A;  2WHO A;  2KJV A;  2BJ9 A;  4FNH A;  4IKA A;  4H4O A;  4FS2 A;  2C2N A;  2QN6 B;  5D3G B;  2I2Y A;  3J81 C;  2IVM A;  4MMO A;  3PX0 A;  1KIJ A;  3P4U B;  2YBV A;  2J6T A;  3R2C J;  1Q81 T;  3TZZ A;  4DV2 I;  4ZDN A;  4CQ1 A;  1QJH A;  3TA1 A;  1VBY A;  3DOM B;  3LW5 C;  4NA2 A;  1TEL A;  2DEJ A;  2GVD A;  3MD1 A;  5ETL A;  1URR A;  5KT3 A;  1HAR A;  2VG5 A;  2CQ2 A;  1N34 I;  2VG7 B;  4QOT A;  1KC8 T;  3SCJ E;  4LF5 J;  4G3I A;  4DR5 E;  1VHI A;  3BH7 B;  5E41 A;  5ADZ A;  2GA7 A;  2E5L I;  2P9C A;  4F36 A;  1FO1 A;  3WX4 A;  2ASY A;  5K14 A;  1UPM B;  5KG0 A;  3CCM S;  4OYX A;  1S1X A;  3P45 B;  3SDE A;  2D69 A;  3EX7 B;  1CS4 A;  2EI5 A;  2NN6 C;  2DHA A;  2VFV A;  2XI3 A;  4MJK A;  5D77 A;  4Y28 C;  1Q82 T;  5IZH A;  3GV7 B;  4ED5 A;  1SV5 B;  2R8I A;  5KG4 A;  4HYM A;  1G2E A;  1TKD A;  3QNW B;  4JI2 E;  1P27 B;  3RBD A;  4GKJ J;  3DRP B;  3NMA A;  4HVZ A;  3JYT B;  3ISN C;  4K4Z A;  2ALY B;  4ECX A;  2AP6 A;  2DNG A;  3CJS A;  4YUD A;  3NGD A;  3ZZ0 A;  1A0O B;  4KKO B;  4DLG A;  1PGZ A;  1BWE A;  1SVD A;  1NZ8 A;  4P71 A;  2HGM A;  5HMW A;  3EM1 A;  1I94 F;  4C8O A;  5IWA J;  3TWZ A;  3R5A A;  1RT7 B;  4WF9 Q;  4CLK A;  3S1T A;  3NS5 A;  1YJ9 S;  2XMA A;  3IA0 A;  3IR5 B;  4MU0 A;  1FVQ A;  5GAE U;  1JLA A;  1BLU A;  4ZVG A;  2HZV A;  3LP1 B;  4OZ0 A;  3HKM A;  1FXL A;  5EN1 A;  1UWA A;  4DR4 J;  1WOO A;  3FGV A;  1N8R T;  4LRC A;  4OLP A;  2W9C A;  4P2F A;  1T0T V;  2PO0 B;  1TMJ A;  1UWB B;  1XMB A;  3W9I A;  2JEJ A;  2ZHO A;  5EHH A;  3MMB A;  3LAN A;  5H9F J;  3HM9 A;  4JI4 F;  3M7V A;  2EFO A;  4IFY B;  1Z4U A;  2UXD F;  1IWG A;  4KYZ A;  1VQ4 S;  3H2L A;  2HWI A;  1W2B R;  2FLO A;  5AXK A;  2ZHA A;  2UU9 E;  4DUY E;  4NEY A;  3R5C A;  4JBC A;  5K36 D;  1GXL A;  2FY8 A;  4JI1 E;  3TZY A;  5C0X C;  4M5J A;  2AYG A;  1RDR A;  1MU5 A;  1RTI A;  1GMU A;  2G2O A;  4WYW A;  5CHC B;  4DV6 J;  2N3L A;  3CED A;  1SC3 B;  3I55 S;  1IM6 A;  2OPS B;  3RB3 A;  2XY6 A;  4UQT A;  4IRC A;  5J1E A;  2L3M A;  1S9F A;  4AXJ A;  2ZH2 A;  1FJC A;  1M1H A;  1WHV A;  2EBG A;  3IM8 A;  1QTN B;  1UEK A;  3D68 A;  3S8S A;  3G9C A;  2BA1 G;  3UN3 A;  2MDA A;  3P6Y C;  4XDC A;  3POT A;  5CZV A;  2VPZ B;  4PU9 A;  1IBK F;  3DM2 B;  4BBY A;  4ZVP B;  4K0K E;  3BO4 A;  3D28 A;  1CC8 A;  4TYB A;  1HNX F;  3MAA A;  4B9M A;  1G1X A;  2W2Q P;  4OX9 I;  4P9S A;  5LMU I;  4M5M A;  2RDJ A;  2BE9 B;  1FRI A;  3F44 A;  1D0E A;  3ETM A;  2GJI A;  4Q43 A;  5K9F A;  2G1D A;  5IQ6 A;  4DV4 F;  3IM9 A;  1WKK A;  2OH2 A;  4I68 A;  1T03 B;  3OVB A;  2D74 B;  1NJZ A;  5KFU A;  3I5A A;  2GQQ A;  3C8Y A;  4QWB A;  4JG4 A;  4ZLJ A;  3HFV A;  1SI9 A;  2DKO B;  5B09 A;  2W1B A;  3Q6N A;  4JI5 J;  3D0G E;  2ZUA A;  3HXM A;  1U8S A;  1D9F A;  5F9L A;  3NMR A;  3BO3 A;  1HBO B;  1TP7 A;  4DR6 J;  2HIY A;  3T1Y J;  5THW A;  2V94 A;  1FTR A;  4DS4 A;  3WC0 A;  4DX8 H;  4DQR A;  2I0X A;  1TK8 A;  2J0Q D;  2GNK A;  4NZ7 A;  1O6X A;  1F9H A;  2P9E A;  2HND A;  3CW2 C;  4I2P B;  1ZAX A;  1AUS L;  4IFV B;  1X9M A;  4CCH A;  1Y4U A;  2GQ0 A;  4RW7 B;  4DR1 I;  3GP9 A;  1Y0H A;  2DPI A;  3DRR B;  3WBZ A;  1S48 A;  3HHN B;  4K2J A;  3D0H E;  2LDY A;  3MAQ A;  3UWT A;  5AJ3 J;  5ETO A;  4AUK A;  3QJP A;  5HVF A;  5IV4 A;  5EL9 A;  4KTQ A;  4JI3 F;  1JIH A;  3CJ0 A;  3H42 A;  1XNR E;  4F0M A;  1S9E A;  4WP3 A;  1IKV A;  1XEZ A;  1CJT A;  1RT6 A;  2V2V A;  4XPE A;  1NME B;  2L48 A;  1GMW D;  2DR8 A;  1E6Y B;  4WP8 A;  1SJR A;  2EG1 A;  3KHR A;  1KTV A;  4LT6 A;  3DI6 B;  3RGI A;  4CT8 A;  3HSZ A;  3QJJ A;  2K1R B;  3ZZZ A;  1JLF B;  3DYA A;  3EGN A;  2HNZ A;  2FDN A;  1YJV A;  2V8H A;  5LXY A;  1UA1 A;  3MEG A;  4G1Q B;  4PXE A;  2AEJ A;  1JQG A;  4ZOS A;  2UUC E;  4IFD F;  3IRX A;  2ABY A;  1HPZ A;  3PJW A;  2F1D A;  3O6Q A;  5D0G A;  1JLB B;  4FYD A;  1KTQ A;  3LOU A;  5A8W A;  3WU5 A;  4HLB A;  1WDD A;  2B8Q A;  1TAU A;  3WIU A;  3EZ5 A;  5FWK A;  2GO9 A;  1S9G B;  4ECY A;  4OZ3 A;  4FF2 A;  4IFD B;  3WQP A;  4HL9 A;  1U6Z A;  2EK6 A;  2HRY A;  1WF2 A;  2KM8 C;  5ETT A;  2CJX B;  2EK1 A;  2UUA F;  3R5G A;  2W7O A;  4LFC E;  2RSQ A;  2CNN B;  1RBL A;  2ZBR A;  4DCJ B;  2NN6 E;  3M6X A;  3EWG A;  1C0U B;  2VQE E;  3KG0 A;  3OFG A;  1OYR A;  2VIC A;  3VAM A;  1V6H A;  3T1H J;  1KSP A;  3WC2 A;  2ZZN A;  1C1C B;  2XQC A;  1BY9 A;  1BE4 A;  4DL2 A;  2WVC A;  5KG6 A;  4DI6 A;  1AB8 A;  1TUV A;  2YKQ A;  2YWH A;  4DV7 E;  3W60 A;  1GTE A;  2QC3 A;  2FHM A;  3BBF A;  3AJ1 A;  3G4S S;  3CIM A;  4NA1 A;  4X62 E;  1SQG A;  3H90 A;  3PYF A;  4I69 A;  2LKZ A;  3HVT B;  3BKT A;  2WBM A;  3H2V E;  1HQE B;  3WU6 A;  4KPC A;  4B3O A;  5A8K A;  2RRA A;  3OLB A;  1XMO J;  3R7S B;  1OY8 A;  1FK9 B;  2FJW A;  2QYC A;  4Y6I A;  3GIR A;  3FQL A;  4AIM A;  4K4U A;  4PQU B;  4X4S A;  2CPE A;  4MIB A;  1DFD A;  2DHG A;  3A8K A;  2HFN A;  1V5I B;  1EI1 A;  4PXC A;  1SBR A;  4TLR A;  4TU8 A;  3W2V B;  1CJU B;  3QGG A;  1FES A;  4ZVR B;  4QJV A;  2YNG A;  3H98 A;  1UW4 A;  3WZ0 A;  4GO7 X;  4LQ9 A;  2JE6 B;  1D6T A;  1RHY A;  5E7O B;  3ZTR A;  4IZK B;  4M1K A;  4ECS A;  4UUW A;  4CIO A;  4DLE A;  2UUB J;  4R5P A;  2YWE A;  1HWK A;  2BXJ A;  2AEF A;  4F50 A;  2DB1 A;  1VRT A;  4CTA A;  3DMJ B;  1KP6 A;  1ZXN A;  2I5J A;  3THV A;  1X4B A;  4JI6 E;  1YJU A;  4ANC A;  5DRP A;  3PM9 A;  2KZM A;  3A8E A;  3I4P A;  3QSI A;  3EMT A;  1RCX B;  1YKW A;  3L7U A;  2DY1 A;  2RF2 B;  2CQG A;  3K0J A;  1RHM B;  3M1V A;  1VRQ C;  5HMY A;  2CXE A;  3OTC A;  1WKJ A;  4WU2 A;  3MPU B;  2IC3 A;  4OHY A;  4OO1 F;  3G87 A;  2LJP A;  2CZ9 A;  3T6B A;  2LMI A;  2J9D E;  3PXG a;  5JMN A;  2F4F A;  3ZC4 A;  4RNM A;  3Q23 A;  2E1A A;  3MPD A;  3LTO A;  3VQS A;  1BQM A;  2C1E B;  3LAL A;  4OO1 B;  3CT9 A;  2ZH1 A;  3V81 B;  2POK A;  2EVZ A;  4HTI A;  3EE3 A;  4NLP A;  2MZJ A;  4DZ6 A;  1K0V A;  2DGT A;  1YX2 A;  1NLK L;  4X66 I;  4I6A A;  3CD6 S;  2WP8 A;  1KLM A;  1F6T A;  4KSE B;  1U25 A;  1DQ8 A;  4ZPD A;  4H4O B;  2AJQ A;  4LF6 I;  1QAY A;  3KMQ A;  4JI4 J;  2UXC F;  3BQ2 A;  4MKY A;  2UXD J;  3RW6 A;  1S59 A;  2VQF E;  3M7N G;  4RPF A;  1HNZ I;  2UXB E;  2H5E A;  1WF1 A;  1N36 F;  2H48 B;  4Y65 A;  4CYU A;  2VZ9 A;  3DLG A;  2GVD B;  3CCV S;  2DR5 A;  3J80 C;  1U02 A;  2OAU A;