4DXLA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
VSDWVPTGAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 97
structure length 304
sequence length 304
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4dxlA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dxlA01
3ZM7A 2VQEI 2VQEE 4K0KI 3J81C 5L3JA 1FKAE 4LF8I 4LF5E 4B3RE 3ZKBA 1S4EA 1NZ0A 1ZXNA 1RREA 4FN5A 1N32I 1B62A 1XNRE 1Z0TA 1HNZI 3QT7A 2DEJA 1HNWI 3WU6A 1H7UA 3PYGA 4WUDA 4GKKE 3J7AM 3K17A 1XMOI 1XNQI 4DR6I 4DV7I 1OJ4A 2BM1A 5LMNI 5IWAI 1N36I 1EI1A 3T1YE 4LF7I 4JG4A 4R1FA 2UXDE 4NXME 4WUBA 1Z0CA 4JI7E 4LF9E 2V2ZA 5BR8E 1WUUA 2X36A 4LF4I 4X66I 4B3MI 4DU7A 1A6FA 3B78A 4NXNI 4B3TE 4JI4E 4M1KA 4DR1I 4HYMA 4DV1E 3T1HI 2UU9E 1Z0EA 3ZZUA 4DR4I 1ELOA 2E1RA 2UUBE 1NHIA 4DV0E 1D6TA 1Z5CA 1Z0GA 4GKJI 4DV5I 2UUCI 3Q1QA 1I94E 2V34A 2HHHI 4JI6E 2EFGA 4X64I 1H73A 2Q2EB 1FJGE 1KVKA 4JYAI 5IT9C 2R42A 3JAMC 4JI2E 4JV5I 4LFBE 4AQYE 4DR6E 2ZM6E 1J5EE 3CWVA 3WU3A 4JI0E 1FI4A 4DUZI 1PIEA 1IBKI 4FWGA 4DR1E 1MU5A 4P52A 1FWLA 4JYAE 1MG7A 2HK3A 4LF5I 2WW4A 5IT9Q 5IWAE 5A2QC 4WUCA 1XMOE 4PRVA 4PU9A 4ZVIA 4JI5I 2UXCE 3B82A 4GKKI 3J81Q 1U2RA 1Z0WA 4I3HA 4DPUA 4DR5E 4JI8I 4DV1I 2HFSA 3LNUA 4JV5E 1KKHA 4JI2I 1ZM4A 1FJGI 1H72C 2CZ9A 3QT6A 4GKJE 1ZM2A 4DPXA 2HK2A 4Z7YA 4LFCI 3J80Q 4DU8A 1FNMA 3V2UC 1ZM9A 1IBME 4DPTA 4JI8E 1UEKA 2BM0A 2DEIA 2UXBE 1QZRA 1N0UA 4JI4I 4B3TI 4JI5E 4DR2E 4YY3I 2A2CA 1B63A 2OI2A 2HFUA 3QT5A 4OX9I 1BKNA 1H7SA 2V2QA 4HY1A 2VQFE 3T1YI 4RPFA 3PYEA 4FW9A 1ZM3A 5LMUE 1N33E 3B8HA 1I94I 4DV5E 2UUCE 4DR2I 5FLXC 2UXBI 1IBKE 3H4LA 4USKA 2A2DA 4DR4E 1MX0A 3LPSA 2V8PA 3F0NA 1N0VC 4LFBI 4HACA 2ZBKB 2E5LI 4JI1E 4X64E 5BR8I 4JI6I 1EA6A 2UXDI 2V2VA 3K1JA 1VISA 4KQVA 1KTVA 4DV3E 4X62I 2XEXA 1HR0I 3GONA 3OTOE 4DR5I 1K47A 2VF3A 1N34I 3ZZTA 2UUAE 2GS8A 4LF6I 3WU4A 4DV6E 3T1HE 4KHPE 2HKJA 2ZM6I 1J5EI 4DR3E 1PVGA 4DPYA 4LF6E 1S16A 1Z5BA 4DV2E 1XMQI 1ZXMA 5GMDA 4XTJA 4JI7I 4JI3E 4FWHA 1HR0E 2HHHE 4LF7E 4DV3I 4DV0I 2UUBI 1XHKA 2J7KA 4DUZE 2F4VE 4DUYE 4JI0I 4USMA 3J7AG 4DV4E 4LFAE 2UU9I 4HXZA 4AQYI 1DARA 1Z0VA 4KHPI 3J80C 1NHJA 5LL6R 2UUAI 1N34E 4X66E 4B3ME 2AJ4A 2F4VI 2X7IA 2ZITA 3OTOI 4NXMI 4LF8E 1Z5AA 1N36E 4YHHE 4DV7E 4B3SE 3PYDA 3M6AA 4JI3I 5GMEA 3HULA 4JI1I 2E5LE 1XMQE 2VQFI 1HNWE 1IBLE 4DXLA 4DR7E 1FWKA 1H74A 4MYTA 4HACB 3ZZ0A 4NXNE 4DV6I 3WU5A 1PKPA 3PYFA 4ED4A 4LF4E 3ZKDA 3QT8A 4LF9I 1HNXE 1NHHA 4B3RI 4X62E 2R3VA 5LMNE 4EMDA 4LFCE 4YHHI 4Z7CA 1XNQE 3V5RA 5LMUI 1N33I 4UT4A 4MYUA 3D4JA 1HNXI 4UTGA 4DPWA 4DV2I 1HNZE 5FLXQ 4X65E 1Z0BA 4OX9E 4FWDA 4URLA 4DR3I 1XNRI 4YY3E 3JAMQ 2LJPA 1N32E 3LTOA 1KIJA 4X65I 4LFAI 4DV4I 1IBLI 2NPFA 4DR7I 4P7AA 4DUYI 2BV3A 1RR9A 1Z59A 1IBMI 2HKEA 5A2QQ 2UXCI 4B3SI 4K0KE 4PRXA
chains in the Genus database with same CATH superfamily
4WFNQ 1C0TA 1AT1B 3DC2A 1HLWA 5D3GB 2YNIA 1LW2B 2LLZA 2JDJA 2XG8A 1M1GA 3CNQP 3HD1A 1H2TZ 2GFFA 3HHLC 1PC4A 4DSLA 1OO0B 1FKAE 2KRRA 3TJ8A 3H5YA 4K0KF 2CXEA 2K1RA 1NB7A 3RYLA 3TA1A 4QR2A 4DX6A 2MZSA 4A48A 1S4EA 4CZCA 3T5JA 4PXDA 2BE2A 2GVDB 3KJNB 4DFJA 4IFYA 1WTBA 2HLTA 4G6VB 2XNRA 2UU9J 4CI0B 1IKWA 1FO1A 3CXCR 3Q0AA 2H5JB 2WOMB 3AB4B 1DHMA 2B9EA 3CD0A 2QJ3A 5AXNA 1WKJA 1N32I 1FJEB 4ZP8A 5KFQA 5K8NA 5A2QY 1U1LA 1B62A 1DTQB 1O0PA 2EC2A 3BN7A 4W92B 4AD6A 2JEIA 3OJSA 4AXIA 4Q8EA 2HS4A 3DLJA 1N88A 1FDBA 2MLXA 4R0JA 3RG6A 2BYCA 3BSCA 2W4PA 2XHCA 3UVJA 4Z2XA 4WTOB 1Z0TA 3QT7A 4RWXA 1VQSA 3WU6A 4TXSA 2YWEA 2L48A 2YWWA 3T1YJ 2LP4A 1SKSA 4WUDA 1RAAB 2O01C 3K17A 3HJVA 1EAYC 1NKCA 1YHCA 3M8RA 5KOWA 3KRNA 5KT5A 2G0CA 1TL7A 4NL5A 2XO6A 1TUVA 2NXCA 5IM0B 1OJ4A 4YN3B 3J81j 1WEZA 4DR1J 2L9DA 4UUXA 5E7OB 1DRZA 1H6KX 2CNNB 4LF6J 4G1PA 3QWPA 5DLGA 2BABA 1GAOA 3POTA 3JAMU 4A8QA 2EK6A 2G4BA 3AOAA 4HDGA 4LF7I 2P6SA 2XMKA 1F0XA 1HD0A 4OI3A 3M8QB 3MPYA 2JJ4D 5KFEA 1RB0A 4ECZA 1HNXJ 4TLRA 1N5SA 4OZ3A 3SDEB 4F4XA 4WYLA 4AL7A 2ATLA 2UUAJ 5BR8E 4LF9E 4NCGB 1WUUA 2HFVA 4LF4I 1HQUB 4TQSA 3OHBA 2YBVA 1RBAA 3BH6B 4CLFA 4DU7A 2E44A 2GHVC 5F8JA 5ETOA 3PKYA 4MKAA 3BKTA 4K4YA 1IJEB 2FY1A 1YJRA 3AJDA 1SBRA 2FJAB 2JT2A 2DRDA 3FKBA 1S76D 2XC9A 1S1VB 2AP6A 4B3TE 5KFZA 5IV3A 2OMOA 1WG4A 2E1PA 4A47A 4WXWA 2OHDA 2ILZA 2ZEJA 1YBAA 3IS9B 1HQEB 2QLJB 5A8WB 2DXFA 5ETSA 4DV0J 5IT9C 4ES3A 2F5GA 4WCEQ 1SC6A 1TTHB 1VJQA 3SQGB 5CA5A 3FSIA 1TQLA 1XERA 1GEHA 2YPZA 2R7WA 2FJBB 2HBZB 1HBUA 3ILLA 1HHSA 3JSYA 1RACB 2YWKA 5HMWA 1SH0A 1X9SA 3ULHA 2HZVA 3Q2SC 4LPFA 4NLQA 4CT9A 1GQEA 1VRUB 4DV0E 3Q86A 2B7CB 1OPZA 1Z0GA 2HG4A 2QL7B 4OI2A 2ZOGA 3DHXA 3SSQA 4HDHA 4NYZA 2DHHA 2Y0BB 2ZJRQ 4MU0A 2KXFA 1I94E 4YB1P 2GNKA 5DJBA 5D3GA 2HHHI 4WXOA 2GVZA 2E5IA 4LBIA 4ELVA 1N5YB 4C4WA 1U02A 5D15A 1JJ4A 4NCAA 4ISAA 2IOPA 1WHXA 2J6TA 4BS2A 3ISZA 2Q2EB 1N5TA 3VR1A 3QRPA 4JYAI 3NWRA 4X4PA 2HWTA 2XS7A 4QIGA 5K14A 4JI2E 4PXBA 3TVYA 2XGQA 4N56A 4V1Ak 2Q6CA 2RNEA 3H4DA 4DV2F 2ASYA 5CH7B 4ZPAA 3S7RA 4QU6A 3PHTA 4LFBE 1MU2B 5CYQB 2PE8A 3L7UA 1NSQA 3SEOA 3FBCA 2RKIA 4JOUA 3PJ9A 4LIWA 4MIBA 5KFBA 2W8KA 2J6UA 3BSOA 4C2MA 2X3DA 1GX5A 1MLAA 2MKJA 4H4KC 3EGWB 3GIRA 4XO0A 2XLIA 2RQCA 4YDDB 3T1HF 1R0AB 5KFYA 3VZIA 3OSNA 1FCAA 2PO1A 1CJVB 3M2RB 5KG2A 5JEAE 4JI0E 3R7BB 2RILA 2MSTA 3I32A 3R7SB 1IBKI 3R5AA 3I0RB 4BWJA 4EI2A 4PWDA 1R6VA 3M8YA 2FLPA 3NBPA 1OYSA 2E9ZA 3PR5B 5IXUA 4LRFA 4O44A 3K58A 1HWIA 1W25A 2VFVA 2W2QP 4DFPA 2W4CA 3DLEB 2C1EB 4B9LA 2KXHA 2IBKA 4QCLA 3QGHA 2JHEA 1FWLA 1S6QA 2HLUA 2HHQA 2MQ8A 1NH8A 5LSOA 1N32F 2CVEA 1MG7A 3EM1A 3NNHA 2AJQA 2O1WA 2IIHA 3H7HB 1GMUA 2VICA 4K4VA 2M8HA 4LF4J 3PX6A 1L3KA 4NLXA 5L38A 2PNLA 2B5JB 3NWGA 2EW9A 3R5CA 2ZBIA 2NN6A 3DI6B 4Y2KA 1W2IA 3HVTA 5IQ6A 4M94A 1QY7A 1Y0HA 2W7AA 1Q5VA 1WHYA 2MLYA 2QLWA 2W25A 3AHPA 5SZTA 3MAQA 1J5EF 3ILOA 2D69A 3M8ZA 1WC0A 2VQEJ 1XC9A 5A2QC 4J3DA 2ZWPA 4M5DB 4R25A 4TYAA 3GYNA 1RK8A 2BZ2A 4X4TA 3LF0A 4JI5I 3CCWA 4RW9B 1ZZNA 3LALA 2IVMA 4B3SF 1HHTP 4GKKI 4DQSA 5EL9A 2CWXA 1RHRB 2CQ2A 2LEAA 5EX3A 1ZH5A 2M5YA 2IOQA 2DGOA 1SB6A 5C24A 4DPUA 2E66A 3BPSP 4NMLA 3SZ2A 4ILLA 4IH5A 2YKPA 2MKYA 2OLWA 3A3NB 3OPKA 5B08A 4FW7A 1JLEB 3M8SA 1GTHA 3MM5A 4DV1I 2IJFA 1ZA1B 1FRLA 1RHUB 1M1KT 3LNUA 2LMIA 3NBPB 2UUCJ 1Q7YT 3FZBA 1VQLS 2GHPA 1KKHA 1N36J 2BA1G 2XYPB 4ZVQB 2R2TA 2LECA 2Z58B 5B0DA 3H42A 3PW7A 3NMAA 3CMAS 2CZ9A 4DR5F 1NRKA 4DX7A 3BO2A 1Q81T 3ZZPA 4NASA 2HGMA 2Y1RI 2ALZA 2UUBE 2Z57B 1S7IA 2G2ZA 4PYAA 1DJ0A 1TP7A 3DN9A 3JS9A 4LSNA 1FKOA 2XYGB 3D0IE 3T1AA 4X66J 1SIZA 4UZBA 4IR1A 2PO1B 5DG8A 4DLGA 4OJGA 3E01B 3BQ1A 2M2BA 3L9ZA 3GG0A 4GKJE 1ZM2A 4YY3J 4MU4A 4RNFA 3LPYA 1WC3A 3RAXA 1Y3KA 2MDAA 2NZCA 2C22A 4Z7YA 4DSKA 5HK4A 1MN9A 4CP5A 4DU8A 2CG9A 1FNMA 1QAYA 4H4MB 3NGUA 4CO5A 4X2BA 5B0CA 3UPFA 3QBCA 2X1GA 1P6TA 3VGUA 3WC0A 4DL0C 3CD6S 4KJIA 2HNDB 3GCXP 1LWXA 4DPTA 2HYIB 3ITHB 3KJQB 2BM0A 1F5AA 3MEKA 3TNVA 1RTIB 5DDRC 1U09A 2DEIA 3GYXB 2GO8A 4ETXA 4UZCA 5HMYA 4AIMA 1VR6A 5KAKA 3V6JA 1XNRF 3IWNC 4WFYA 2UXBE 1CQNA 1CLFA 4X4RA 3LGMA 2ZUAA 1SKRA 5IT4A 2WHOA 2A2CA 3IM8A 1B63A 4YY3I 2C3YA 2VKRA 2DRBA 4O3NA 2J9CA 5DGAA 2GQQA 2DO0A 4TU7A 3VHQA 2CPFA 3QT5A 1TL1B 3JB9k 2AEFA 2KG0A 4F3QA 4KHPJ 3A8KA 1DQ9A 3ADAC 1FJ7A 2BOAA 4ED2A 1JLCB 2CQPA 2QYGA 2RH3A 1H7SA 4OO1F 3JSMB 1XMQJ 5A8RB 1HARA 2ZOMA 3HX9A 1EARA 1RTHA 2O5DA 2MXYA 3AOCA 1PO6A 4M5IA 3T1YI 1HQEA 5A8WA 1TV6B 3GJSB 1Y5NB 1JXVA 2C3PA 1KOHA 1ZM3A 2XMMA 3MPUB 3ZTPA 5A2QU 4DQQA 3OFEA 3B8HA 3SCKE 1N36F 3MM9A 1HBMA 4IFDA 1YSJA 2JEAB 4DV5E 1QDUB 2VPYB 3TAPA 1RHYA 5CQGA 4ZCLA 5BYRA 1TK5A 2BMBA 3I0SA 3KG1A 1IBLJ 4DR7J 1PAUB 2J0QD 2FVCA 3ZTOA 3HK2A 1OMSA 3ONQA 4G1QA 5CD4H 2UXBI 5KG1A 3DDIA 1T8EA 1N5QA 3KNGA 4GRSA 5B7WA 4USKA 2C37A 2BW2A 3M8QA 3N4WA 5JUMA 1VQ8S 2E7WA 1WDTA 3DOLB 5EUHA 5KFMA 2LKZA 1NHUA 1RLDA 5D0GA 1YIJS 4WZMA 4MDTA 4B3SJ 4DR4E 1LK5A 3WX4A 2MSSA 2PMWA 3RJMB 4K5RA 1U48A 2AV5A 2G2YA 2B6AA 2C3MA 3M2VA 2IVFB 3TZYA 1U6ZA 5IM0A 4BC9A 2A0FB 4CLTA 1TK8A 1UAWA 1T9VA 2V8PA 3JAMY 4LFAF 3AD8C 4ILMA 4LRAA 3F0NA 4RL1A 3HD2A 3PR4A 1N0VC 2HQDA 2ZH6A 1IR0A 1NBEB 3FVYA 3KLFA 1YRUA 3KLIB 4F26A 4QPXA 5IC4B 5C25B 4C0OC 5IZHA 4OLOA 3FBBA 5CABA 1S0VA 1EP4B 1XR7A 2VPWB 3Q23A 2B43A 3FQKA 1SQEA 2PSZA 2KN4A 4WIIA 3CCRS 2CVIA 3I0SB 4X64E 5C0XB 4NLRA 4C8NA 3MUTP 4RW6B 2YH1A 1X4BA 1RP5A 1N32J 2KT3A 4ZN1A 3CCJS 5F41A 4I4BA 1LWCA 1SIWB 1UW9A 4FW3A 2UXDI 4ZP7A 5BYSA 3VWSA 3US5A 4O3PA 3IWXA 5KFNA 4QR0A 2HQ3A 5DZ7A 5H9EJ 3GG1A 1JWWA 1RWPB 1VISA 1C1BA 1KTVA 2QO3A 4JUZA 1E6VA 2HZAA 4C0BA 5F8LA 2BR0A 5F9NA 1BXNA 4F2RA 3NAHA 4C9DA 3N9UC 3VAIA 4G3IA 4NCBA 1NNDA 3L7OA 1Y4UA 4ZPWR 5A8RA 2HHHJ 2UV8G 4EZ6A 2J7WA 3GONA 2UVRA 3MR3A 3PFEA 1IKWB 1U45A 4YS2A 1IR1A 1NDLA 4X66F 2KH9A 4B3MF 5JEAD 2XMTA 3NGKA 3I87A 3R97A 2BE2B 2GVDA 1KR4A 2F9JA 1EETA 2BVZA 2ROGA 1AUSL 3NGRA 1PBAA 1WF1A 4C6AA 4F7VA 6FD1A 3DHWC 8AT1B 2R7QA 5FLXU 4DZ6A 3KK3A 9RUBA 3I56S 1NUEA 3HO1A 4LVOP 3RGIA 5CCLA 4LF6I 5KT4A 3T1HE 5E33A 3J7ZT 3FK4A 4F04B 1WF0A 1EQ0A 2HKJA 1J5EI 1XN9A 3Q8VA 2HVZA 3VF0B 4WFXA 1YITS 5EKWA 1U4BA 1UVJA 3HDSA 3TANA 2V6AA 4DN9A 2JEGA 4DV6J 3BKUA 1RTIA 1EX8A 4P10A 4EGLA 2JLFA 1FHTA 1Z5BA 3TZXA 4LFBF 4QNKA 1OPIA 3C15A 4RW7A 4DV2E 1XMQI 2HNDA 3DLEA 4PG7A 2EPIA 4QWBA 3I9ZA 1MMDA 2GCFA 3MM6A 3N6MA 4JI7I 2IMOA 3PRYA 3SSRA 3NCPA 2P9CA 4USVA 4A8FA 4FYWB 5HBMB 2PI4A 4ZLPA 3ISNC 5DRRA 4WYWA 2AIRB 2JVOA 1IBMJ 1HR0E 4IDKA 2FVPA 3AOBA 2CJAA 4NX9A 3TP2A 3MI7X 2MQOA 3PKMA 1J5EJ 1TKDA 4Y65A 4JI8F 3AA9A 4GC7A 3BM7A 3MPVA 3UCGA 3D3CJ 2I1RA 3S01A 4IS9A 2QE5A 2YY3A 2CIMA 2OPPB 4ZA1A 2J7KA 3BBFA 2C2OB 4DQPA 4QWCA 3VAFA 4LR8A 3RZAA 3L3CA 2QA4S 4JI0I 2F4VE 5KG0A 3IRXA 4GQUA 2NN6C 2HFZA 2FGCA 2IPOB 3EVMA 1ULRA 4QPTA 4UF4A 2IDEA 1WKKA 3CB4A 1X4EA 3BYRA 3C15B 3DU5A 3KXDA 3MM5B 4IG3B 4CLSA 2UU9I 5F8MA 3D1OA 5JEAB 1QAXA 4PRFA 3LWLA 3J7YU 4BHQA 4EO6A 1DARA 4OJHA 2BQ3A 4PQUA 1FWPA 3DLLQ 4N3OA 2NR0A 4OX8A 2B0GA 3ETOA 3NP5A 1TKZB 2E7XA 4CO4A 4ED8A 1N34E 1F9HA 2NSBA 4X66E 4B3ME 2J9EA 4ED1A 3EYZA 1HNXF 2K7JA 4U96A 3U1MA 3VVTA 3BR9A 2CGEA 2X7IA 3G4SS 1U1PA 4G1IA 2XB2D 3UQSA 1OIAA 1QVGR 1E3PA 1ZTWA 4LF8E 1KQFB 2UUCF 4O3QA 3M6UA 2DVIA 2QSWA 1Y4ZB 3SYZA 2FHOB 4A8XA 2E9TA 4JV5J 3IBFB 2UXCJ 2CJKA 5K36B 1BMQB 2K06A 1VRTA 1FESA 1WC1A 3CJ0A 1GH8A 2YTCA 3M85G 2ACMA 4JI4J 4DV7E 3W8PA 4FXVA 5HSPA 2I9SA 2HAFA 2E1CA 4DR4J 4JI3I 1ZBTA 2Z2MA 3C14A 3DRPB 3GB0A 2V63A 3IGNA 2B8PA 4BWMA 4URSA 3FSXA 4YP3A 2FD2A 2K7KA 3A3PB 4OYMA 3KUGA 3G6XA 3C66A 3IG1B 5C42B 3DRXA 4UQTA 2CNOB 4XDCA 1Y60A 3NS6A 1TKXA 3EMTA 3FFIA 2HS0A 1FWKA 4TY8B 2KYXA 4OYBA 5KFRA 3A8IA 4YUDA 2ZH4A 4FS1A 3QO9B 1HQUA 4HACB 4CRJA 4ICLB 3Q8PB 3R7NB 2XSJA 4AM3A 4CH0S 2DNNA 3MUMP 4J9KA 4Q7AA 3H25A 4DV6I 5L1IA 3P96A 1O8BA 4FYVB 3UN3A 2QLFB 4XK8C 2GGPB 2B6AB 3KLEB 1RXOB 4ECXA 3QMQA 3GV7B 4LF4E 4AE5A 4JI3F 3P06A 3ZKDA 5H9EK 1REVB 4LF9I 2D3O1 5I3UB 4N5SA 3M9NB 2VKZG 4ID8A 1VQ4S 2D3UA 2VC1A 2C3OA 1HNXE 4J9LA 4JI6I 4JV0A 4DV0F 4DR3J 3GQCA 3TYTA 5B0AA 3ICLA 4ZLLA 2HBYB 5GMKa 4JI5J 2VD3A 2ACYA 3HF5A 4ZIVA 3H4BA 5I3PA 4YMEA 3EZ5A 5EN1A 4LFCE 4IO1A 4YHHI 4X4SA 4IRDA 1R0CB 1VYAA 1XWLA 2YXLA 3SCJE 5ADZA 3GIKA 5J2PA 4EEYA 3PW2A 1ZAVA 1Y5IB 1FTCA 3K5LA 4IKAA 1AFIA 4KE5A 3D4JA 1BQNB 1U1RA 3HSDA 3GLJA 4TQRA 3M2UB 2EK1A 4CO2A 5GAEI 1L3SA 5CXTA 4DV2I 4S0MA 1XIQA 1URRA 1XNRI 1JKHA 3UD4P 3JSMA 5FLXQ 4O3RA 4DF4A 4EBEA 1SJ4P 1B0PA 4C8YA 4OX9E 4B3RJ 2V69A 5CZVA 3GJRB 4FNIA 2F8HA 4CYUB 2A18A 3KHLA 4FF3A 1FJGF 4OO1B 4P2SA 3RB4A 1X5PA 2JRSA 4ERDA 2K3KA 3OVBA 2ZKUA 3IAS9 5KG4A 3VCDA 1UL3A 4JI2J 3Q2TC 2L3MA 4RW8A 2ADBA 1K73T 2HVHA 1N32E 2JOQA 1FK9A 2IM2A 2JX2A 2HZCA 1KTQA 3FJ2A 3PHEA 2XLKA 2IERA 2BKOA 4LR7A 1LW2A 2FHJD 3IS9A 4MK9A 1D09B 1QE1B 2F1FA 3SMZA 4ZITA 5HJXA 4J7CA 4LF8J 2GMLA 4P7AA 2VG6A 1T02A 3J81U 3TZZA 1RTJB 2MJNA 1OY6A 2Z5BB 4NYOA 5KFUA 4DUYI 1RR9A 3O3LA 4FP9A 3CD7A 2DO4A 2XS5A 1Z59A 3RW7A 5AE1A 1VK3A 4B9TA 1IM6A 1UDNA 5L9NA 3W66A 3Q8QB 3G71S 1HD1A 4OX7A 4PRXA 2O66A 3GJQB 1VOMA 4H4MA 3V81A 2ZBQA 3C6TA 1KS2A 2XYHB 5HAOA 4M5HA 2JVRA 5IQQA 4QW8A 4CNZA 1RYSA 2UUBJ 1S5ZA 3FUYA 3HT0A 3MGJA 1FEHA 4USWA 2UU9F 3CDJA 1ZETA 2VG5A 3E01A 1FNXH 1D9DA 2GIRA 2RRNA 7FD1A 1RWUA 1SJFA 3TQ1A 1PYTA 3BGRB 4M5NA 5AXMA 3FMBA 4DV4J 1V9OA 1VIOA 4TY9A 4Y28C 3AQOA 4KKOB 1C4CA 3CIMA 3VAHA 4P6QA 2ZJPQ 4EBCA 5DM7Q 3BGLA 2XZTB 4OQJA 2MZJA 1RSCA 9ATCB 4WFBQ 1RREA 3OT9A 4WE1A 4DR2F 2A6OA 4JV1A 4OYIA 2QGFB 2VFTA 5HJYA 2VPZB 4ECVA 4HHJA 1DTTA 3LANA 3EPIA 1Q8KA 3QO9A 5GADU 2MLZA 1Q4RA 4RX6A 5D4PA 4J5OA 4IOAQ 2GJIA 2QA4G 4IFVB 4ID5A 3EDRB 2VUGA 4LF7F 1IJFB 4KY3A 1U6FA 4K8RA 5DLFA 1X4GA 1F9FA 1VDHA 5FJ4A 4OLPA 1W2BR 4J9QA 1VCTA 3MD1A 1S72S 1HNZI 2WAQD 1JJHA 2P6TA 1N6QA 2V8VA 3FDSA 3DMJB 1VIXA 3MM7A 4J91A 1FDAA 3MMCA 1XMOF 1WORA 4ZVFA 3T6JA 1F60B 2DK2A 3MECA 4DZDA 4DJBA 2D3ZA 5KTQA 1HNIA 3EGVA 3M6VA 4DSIA 4DV7I 2VFRA 3HP6A 1SJRA 2CWKA 3TW0A 4QU7A 1DAXA 1F6TA 2JLEA 1S9GB 2PO4A 4IFYB 3IN5A 2MKCA 2OPSB 2Z30B 2MGZA 3G6YA 2DR7A 2H48B 4ZPCA 3RW6A 4B3OB 4FW5A 1R3NA 2VB6A 5BYQA 3T1YE 1PGZA 3MR7A 3DCAA 4WUBA 3GFZA 5A0YB 1X4DA 2FZKB 2LQ5A 1KRPA 5FLXY 1HNWJ 2JE6A 4IFDF 4I1TA 1JJ2R 3R8YA 4B9UA 2DXDA 4X66I 4B3MI 3CJ4A 2E1MC 4KGXB 2O3ZA 2X1AA 5ETVA 2POKA 1HI1A 5ETNA 3DRRA 1S6QB 3ZZZA 2KM8B 3PCOB 5DS7A 3OW2R 2V50A 4PQUB 4WIQA 2PO0A 1WI8A 1X60A 4LF9F 2F40A 4Y2MA 3PEJA 3DGPB 1X0PA 4M1KA 4YR3A 2DNRA 3J7A1 2KFNA 1HL6A 1CJKB 2B56A 4IFVA 1KQKA 4LRBA 4OX6A 3HHLD 3FEXB 2R8IA 2QFJA 2XY6A 5HP1A 4DSJA 4FXDA 3ZZUA 1Z0EA 1MROA 4IRCA 2E5LJ 2G2OA 3GYGA 2HBQB 4KFBB 1OQ6A 3W60A 2VJVA 2PNZB 3G6VA 2D7SA 3R3TA 2DH7A 3BF4A 3SCIE 4DHVA 4HYKA 1CJVA 3M2RA 2Q6BA 3EICA 1I94J 3AJ2A 4I6WA 1Q5YA 3WDOA 2CG4A 2ROPA 4I56A 4ANDA 4KKOA 3UCUP 3JTPA 4X64J 4D3GA 3E2EA 3VAJA 1HQ2A 3BREA 4DUYF 1D6TA 2YQ0A 5DDOC 2ZE2A 3EVWA 2VOPA 5L1KA 1Z5CA 3MOZA 3LP2A 1WELA 4JV2A 1N8RT 3EVOA 4GKJI 3O2IA 1UVIA 2PFDA 1SCJB 3BGOP 4L74A 3HCXA 3KFWX 2AJ1A 2OFHX 2YNHA 2CQ1A 3D28A 2G1HA 4HI1A 3EJMA 4L3KA 2ZBRA 4OX9J 2D3OR 1FVSA 1LFWA 3K59A 2OO4A 2PI5A 1SV5A 4YDXA 5H9FJ 1BKNA 2DH9A 2EFGA 1RT5A 4QIEA 4RW7B 5JMNA 1F3VA 3THTA 1KVKA 3PEHA 4LIRA 5J2MB 4IG0A 4P74A 1NJIT 2NXNA 2R42A 1SVDA 3FZ2A 3IMQJ 4AUKA 2L9WA 1YJWS 1KLMA 2IM0A 4RW4B 3W5ZA 1IBKJ 3TUJC 4P2MA 3ENQA 3R1HA 4PR6A 2H3EB 1WOPA 5KFPA 1BQMB 2RU3A 1U47A 1UVMA 4NLWA 1J5EE 4NYPA 4DR6E 1V6HA 2BW7A 1KHWA 2PD1A 5I42B 5DETA 5BR8J 4NEYA 1QM9A 3UHMA 4WFAQ 4RWWA 4TVAB 1SUQA 1NSAA 4YHHF 2GMJA 1C0UA 3UO0A 3CO9A 4DUZI 1ZS6A 3BO3A 2V9WA 2ASJA 4PUOA 2KU7A 1Q53A 2OELA 3MAHA 4AQYF 3DRSA 2WONB 1C1CA 3MMCB 3CMES 1RABB 1S79A 2PGCA 3CTRA 3VQTA 2KHDA 4DR1E 1RT3A 2QC3A 3AA8A 1C1BB 1LFPA 3LPEA 1JLGB 2YKOA 2Z56B 3OUYA 1EKSA 3V6HA 4J9RA 1X5OA 5E41A 3RR7A 4N76A 4U8VA 4URGA 4O0IA 4Q0BB 1YBTA 1RT6A 5HANA 4E2FB 3C46A 1GNKA 2WSCC 1L5UA 2RJZA 5FDLB 5EWFA 3M8PA 4LF5F 1WEYA 2IAJB 3CJ8A 5T7LB 1ZAWA 2KTQA 3DLKA 1R89A 4JP8A 1RWXB 1NEEA 3OV7A 2GMHA 3BKFA 3I82A 2ZBCA 2BJ8A 2LDYA 4KPCA 1SJQA 4AQYJ 4YR2A 4K4XA 5I3UA 2C38A 4OZEA 2Y9HA 2PA3A 5E3QA 3L95X 3ZZRA 8RUCA 3ET6A 1JLAB 3ZXWA 4U7CA 4YHHJ 3KLEA 1R8PA 3PNIA 1XMOE 4PU9A 1G4CA 2V8GA 3FMWA 3H40A 2WNRA 2UXCE 2IBOA 1RA7A 3AFGA 1T9XA 2YNFB 1QJHA 3H2LA 3M32B 2KG1A 2IMWP 2XQCA 4PYDA 3MEDB 3QPIA 2DGQA 3M1VB 1IXKA 1FXDA 2BE7D 2FB0A 5JJBA 2DR8A 1MSWD 2WSFC 3NS5A 4ZJQA 1RT6B 1FD2A 2CA9A 4M63A 3ZTRA 4J9SA 3VAMA 1LNQA 1UPMB 2B4OA 3T19A 1UA1A 5J2NB 3DD6A 3EE3A 3MMBA 4OIXA 3CC4S 5D4NA 1TMJA 2VFUA 4C3KA 3AODA 5DQGA 2R8GA 4Q0BA 2CPEA 3A1YG 3BBBA 2BXJA 2DIUA 1T3NA 4JI2I 1ZM4A 2F7VA 4MIAA 5IFMA 4JI7F 2VBXA 2L41A 3L7ZA 3R1LA 2W2OP 3M6XA 1X9WA 5HQMA 3T5LA 3EXCX 4L3NA 1BE4A 4RUHA 1BD6A 1RISA 2GAGC 1C0UB 2VC0A 4AT1B 4DUYJ 4DV1J 2V68A 5DGBA 1GXTA 4X64F 1RAEB 1T03B 4LFCF 1R8AA 4UQGA 4Q2MA 4DPXA 4ZK7M 1OYEA 1QLNA 3JQMA 2HBRB 3PDNA 3GTYX 4ZPVR 1R8HA 2HHSA 5C0XD 3J80Q 4OJ1A 3SBMA 1A0OB 4DS4A 2BUNA 2R2UA 3QGGA 3VVUA 5J2MA 4P7TA 2AJFE 3CJ5A 1TAQA 2GAHC 3HXMA 1RT5B 5J1NA 2FZCB 2LXFA 4ELUA 3CDIA 2C42A 3AAWB 3NNCA 4OO1A 3M30B 4ZCIA 4IO9Q 3P76A 1UFKA 1T11A 4YB5A 1QZRA 2R7SA 1TAUA 1D8YA 2OGUA 2HPUA 1IKVB 1H3DA 1CG2A 1YJUA 2CKWA 2IA0A 2HNYB 2WVEA 4A8OA 2UP1A 1S77D 1JLQB 2BR2B 4B3TI 2OAUA 1LEOA 2OEKA 5CYJA 1REVA 2OI2A 2VESA 1VJWA 1M90T 3CD5A 2O67A 5D8HB 3D68A 1E6YA 1XMQF 2Q66A 3CJSA 2JH3A 3I6PA 2JEBA 4KYZA 1N52B 4RBVA 5LMNI 2CQBA 2V2QA 3K89A 1T0TV 4F3OA 2VQFE 4N8NA 1SH2A 4V19X 3IGVA 4M5MA 4NI2B 2QFIA 3UI3A 4DL2A 1N5VA 2DNOA 2W2PP 5D78A 1VI7A 1S6PB 4C7QA 1N56A 4FYDA 1RYRA 3SIPB 2R8JA 2NN6E 3THVA 5D0RA 3QAEA 3B6BA 1A7GE 2B9YA 3U1KA 1NHKL 2M4MA 3NMRA 5GAHU 2ZNZA 2F65A 1F3FA 1P9QC 1WF2A 2D9OA 2UUCE 4NA1A 2KYZA 4XIUA 2WBMA 3MM8B 3TEGA 1X4AA 3CF5Q 2PC6A 4DUZF 4ECUA 2F1DA 4IFDC 5CYMB 3MEGB 5E3AA 4KO0A 2PO0B 2RHSB 1YRXA 4WK1A 3GJTB 4UOHA 3SFGA 4GKJJ 1JX4A 4QWAA 4MTPA 2MHEA 1UETA 3H4LA 2A2DA 3LP0B 4L6V3 5IS2A 1YHQS 3HFVA 2B3TB 5LOQA 2UXBF 2AX1A 4YEAA 1U24A 3V6KA 3KK3B 3NGSA 3W5YA 1FFGB 2M52A 1S12A 1T9YA 3M7VA 4PQAA 4ZOSA 1XEZA 5T41A 1FE4A 2C2KB 4YY3F 1S9GA 4LUBA 1NHIA 1MN7A 3KUEA 1VC6A 3FRYA 2W1BA 4ZVPB 5HQLA 1SQFA 2RT3A 2CZVC 1RAFB 1VHIA 2VDHA 3I4PA 4O0NA 3P5BP 4DV4F 2OPSA 2D1CA 3MPWA 2RQKA 3FC9A 2BX6A 2E5LF 2MY7A 1RT4A 3HVTB 1TKZA 4A8YA 4PG5A 4MJKA 3T6BA 4A46A 1MMLA 1NJZA 5C0XC 4KIAA 3GU0A 4TU8A 3BN4A 3MEGA 4ZVRB 4NBQA 2IYGA 3H59A 2N82B 1JXEA 2V9KA 3QIPA 2AX0A 2KKHA 2XBPA 4I2PA 2WBRA 2QEXS 3L4BC 3KJFB 3HPOA 1HBNB 2KRBA 2G1DA 4OL8A 3F56A 3PRBA 3I9V9 4HEA9 2QZ8A 4F67A 2YX1A 3W61A 1R6YA 4LBHA 2WB1D 1YI2S 4ZJOA 2FLLA 4X65J 2AU0A 4PWDB 1HNZJ 1D3WA 1WSVA 2XEXA 2H51B 5HVFA 4RZRA 1U8WA 5C2CA 3LGHA 3MD3A 4OKGA 3TA0A 5DNXA 4DR5I 2HFNA 2PMZD 3IM9A 2QL5B 4YB6A 3PS3A 3CCTA 1E6YB 4C48A 2JEBB 3W65A 4NLYA 1RT1B 4OI6A 1C4AA 3SSSA 1JLAA 1T95A 3ZZTA 4K4WA 4DEZA 4B3RF 2UUAE 2HQFA 1YJNS 1USUA 1JXLA 3N28A 4DV6E 4JYAJ 4KHPE 1R43A 4OYOA 3IRWP 2Y1JA 3TJAA 1EJ7L 5HI7A 4DL7A 1XMOJ 2LEBA 2J6SA 5FWKA 3O8WA 1ACMB 3C6TB 4NWBA 4HVZA 4DPYA 2B7BB 3DOMA 4Y00A 4RNMA 2Z5BA 4OO1E 4WPAA 3BS9A 4HY1A 2B4VA 3GFYA 5M2PA 1KEKA 2LQ9A 4MAKA 3D66A 3NKYA 3GE9A 4OMFG 5KFIA 4O23A 5GMDA 1H38A 1BUXA 1TU0B 3CCES 1ZAXA 2ATCB 4JI5F 2N7YA 2OD6A 4IZJA 4JI3E 1SL1A 3AXMA 3ENWA 2B4PA 2HHHE 1EETB 2KJWA 1C1CB 3D6TB 2FJWA 3PXGa 2DHSA 4PUOB 1U2FA 1LKZA 1WWHA 2WVDA 1M0SA 4QQBA 2NS1B 4DV3I 4OHWA 2ZM6J 4QYZJ 2VG7B 2R7RA 5DRQA 4CLYA 1KVJA 1WOSA 1SXLA 4DX5A 1U8SA 3UDVA 1HNZF 4X65F 4DV0I 2UUBI 3LAMA 2I6WA 3GCWP 4AL5A 1I1GA 2CQ4A 4OHXA 3LQVA 1FX4A 1BWVA 3P5TL 1YH8A 2Q43A 1PKUA 4WU3A 4ZVSB 4F0KA 1Q16B 1BQNA 2O1VA 5JEAC 5J2PB 4JI0F 5JEAF 4LFAE 3OFGA 4OHZA 3MMBB 1LOUA 1Y9OA 4GMKA 4LR9A 4DV7F 4DR6J 2GJFA 4DFMA 2I5JB 3Q6MA 3QIDA 5CZXA 2DXEA 2XMUA 2YKNA 2MQQA 2HNZB 5LMNF 1HR0F 2BDPA 4KHPI 1SV5B 3DGVA 1S1XB 5RUBA 1NK5A 3IXQA 4DR4F 1NHJA 5LSLA 1FRKA 2DNMA 5F3ZA 3OJUA 2V4RA 2UUAI 4NCGA 1PJ5A 4NZ6A 1FE0A 2EXUA 2WVCA 4ZPBA 4JI2F 3SDEA 5ETPA 4ENOA 4M95A 4P71A 2F4VI 3FBFA 3HKZD 4EO8A 3HHEA 2KDOA 3MR2A 3ET6B 5AT1B 4DV5F 3MTJA 4FF1A 5EWGA 1Z5AA 2O1UA 3R2DJ 2W9AA 3BSNA 4OI1A 1LW0A 1I5OB 1NK0A 4NA3A 3H2UB 4PABA 3EGNA 2Y8YA 4RLEA 1H2UX 1TL7B 4NPOA 4TY8A 2HW3A 2ZZMA 2C39B 4BA2B 4B3TJ 4PZVA 3DLKB 3CGIA 1CSJA 4ICLA 1IWAA 3K7RA 3PYDA 4E0DA 2E5HA 1Q8BA 1QUPA 2P5VA 2GHWA 4HH0A 4DUZJ 2CQGA 1GXLA 3TX8A 4F25A 1NXIA 3QIPB 2FGOA 5F8GA 3U02A 3HULA 2BA0G 1HNVA 2OEMA 5BXIA 4LSLB 3LA0A 2H65B 2UUTA 1HIYA 3RBZA 4OYAA 1FEEA 2F4VF 1RQ0A 4I2QA 2PT0A 3OUYB 1XMQE 1RWNB 1VQOS 3DKDA 3K85A 4DR3F 3DRRB 2RVJA 3BYPA 4NXMJ 2CQIA 3UDEA 1HYSB 4CO0A 2GA7A 4DS5A 3KNAA 1RTHB 3A13A 4MYTA 3EXYA 2FYXA 2VZ9A 1Y3JA 4WJBA 1JLCA 2UUAF 2Z4PA 5A0YA 3W62A 4C97A 3EUNA 1RBOB 3D1QA 1TL1A 2DH8A 2YWHA 1X4HA 4FVCA 3UR0A 4JI3J 2W9CB 1PKPA 1Q0NA 1PG5B 4TU9A 4WFZA 1V5VA 3PJWA 3U1NA 3L09A 5DNLA 2BA1D 1RZMA 3OTEA 5M2UA 5I4MA 3CC7S 4Q2LA 1LXJA 4GO7X 1OQ3A 1PJ6A 2ROEA 3Q24A 2H5IB 4FZVA 4DR1F 2ADCA 1DQAA 1UWBB 4USUA 4L75A 4ANCA 4UW2A 2MHNA 2ZKTA 2BQRA 2P9EA 2D41A 2YQ1A 3DDKA 4NZ0A 3AY0A 3IA0A 3LO3A 3MCOA 4IG0B 5E2QA 3T1YF 1BLUA 1HMVA 3ITHA 1TZ0A 2QYCA 3F41A 4CDIA 1HBOB 4XPEA 4F50A 1VBZA 4F02A 4J90A 3H0PA 4KRWA 5ETTA 2J0SD 5HLFB 4LFBJ 1YJ7A 2BJ3A 1ICEB 4MYUA 1FT8A 1B7FA 4KV8A 2O1PA 6FDRA 3KHRA 1D8ZA 5ETKA 3KLGB 2B8QA 3GIJA 1RADB 2RB7A 1V3ZA 3N79A 3HHNB 1HNXI 1RHQB 3I0RA 5KFFA 2FQQB 1XXEA 3MPDA 4X65E 2C2NA 4CM0A 1IKXA 4ZHRA 2ZE2B 3HT3A 3HSZA 3BSAA 2CQ0A 3D0GE 2OPPA 2V8DA 3LUYA 4J9VA 4KC5A 4OZ5A 4O3OA 2Z2YB 3RAMA 3VGSA 5LXRA 2EFNA 2YKAA 3PO4A 3Q8RB 4RO0A 1X4CA 3HM9A 3K5MA 2Y8WA 1NCLA 3JAMQ 3QFHA 1S1TB 2AT1B 3CJ3A 2CPHA 3M05A 1OWXA 5F8IA 1K44A 3LTOA 1MMNA 3QYYA 3V4IB 2HHHF 4BDPA 2RD5C 1T3OA 1MU2A 1MNEA 2AYMA 2DGUA 3HZGA 5DQIA 4LFAI 2BRKA 5THWA 3K5PA 1AUDA 3QJPA 3CDEA 3V81B 4WU2A 3MM6B 4I64A 1ITPA 3GZ7A 5HLFA 4KGMA 3DRYA 1RKIA 2KJVA 3ETMA 3KK2B 4F4AA 1HMVB 3GIMA 5F0WA 2KB2A 1GMWA 3OR2B 4JB8B 1X8DA 2A3JA 4K4TA 3ZM7A 1I3OB 2VQEE 1WG5A 3W5XA 4K0KI 3HVAA 2BJDA 1AA1B 1YK9A 2ZZTA 4RW9A 2CQCA 4LOMA 1XBWA 1RWMB 1Y5LB 5L3JA 4HKQA 2DGTA 4MMOA 4LF8I 4M5DA 4LF5E 3NLCA 4OHYA 1VLYA 1J27A 2I8EA 4PG8A 4LFAJ 3Q8YA 1QAJA 5DDQC 4DI6A 4DPOA 4DL5A 1KFSA 4IQMA 4O4GA 3S1TA 1NZ0A 4GVBB 2W9CA 1Y7PA 2DGXA 1PYSB 2F8EX 4NLVA 3T5KA 4OYZA 4FN5A 2Z5EA 2Z8QA 4U3BA 1V5IB 3G86A 1AZSA 3M7NG 2FPHX 3G8QA 3DOKB 3G8SA 2LQBA 4C8LA 1XNQJ 4FW6A 4I69A 1DZ5A 3J81C 2YH0A 1E6VB 5D4LA 4F4YA 1GTEA 3P8BB 3Q8SB 2OTJS 3OQ2A 2I38A 5HVHA 3PW5A 3R5JB 2DD8S 3BDPA 1UVKA 2XO7A 1XQIA 3UW1A 4Y0FA 3OVSA 2YKMA 1RAHB 3D0HE 4KPYA 2Z2LA 4KR0B 2MZQA 2HRUA 3LGNA 3PYGA 1H7UA 3A8EA 2HSEB 3KDOA 4XAKA 4A8WA 3J7AM 2DIVA 2X1BA 1UMJA 4MH8A 1TK0A 2MJUA 2LQ8A 2RF2A 2ZFHA 3G82A 3Q22A 2ZH2A 3H8YA 4MQYA 1XMOI 3QRQA 2WNRB 4U6PA 2HVEA 4B9VA 2FJXA 1N54B 5KT6A 2ERRA 1RWWB 1J5OB 1UTAA 2DCUB 3BZQA 5GAEU 1S0OA 1K1QA 4W90B 1T9UA 1FX2A 1UP1A 3TWZA 1OYRA 2IJNA 1JB0C 2AKWB 4DR7I 2CNKB 1UCNA 3PO5A 2W8LA 1EI1A 4R1FA 1WEXA 1YGYA 2LXUA 4P75A 4NXME 2C37B 2XLJA 2YNGA 1USVA 4JI7E 2H9ZA 4MIWA 1WDDA 1F1BB 1G6BA 4G1QB 4K7QA 4PWUA 1IBKF 4HR2A 3G6ES 1JQGA 2IAJA 4Q8FA 2X36A 4ZLNA 4R0EA 3DDNA 3W1YC 4IUFA 3HKMA 1NK7A 2APOA 1XNRJ 1A6FA 2HNZA 1CPZA 2XMJA 1IQZA 3NG8A 2I5JA 2HHPA 4JBCA 4ZVOB 2ZBPA 3MEEA 3B4TA 4NXNI 4IZKB 4KAIA 4ZKAA 4NLUA 4DR1I 4DV1E 2W9BB 5SUHA 4CT8A 5KFDA 2Z5CB 3T1HI 1FKAF 2GV1A 1XJWB 2ASLA 4DQRA 1OY9A 3FSYA 3EZOA 3HMJG 1NK4A 1WTFA 3G9CA 4U95A 3MAAB 1NM2A 5LJ3Y 3JYTB 2WOMA 1ELOA 3CMQA 3R27A 4F4KA 3VAGA 2IM3A 1NZAA 2CZ4A 3TAMB 1NH7A 2E1RA 3AT1B 3AXKA 2A6MA 2W4DA 3C19A 4O4GB 1HBUB 2HWHA 2VG7A 3TAMA 5L46A 5DROA 4ATNA 2XSFA 1X5SA 5K36E 2J8SA 1IR2A 2VPXB 4OO1C 3CVKA 4HL9A 1ZA2B 4CM2A 2EC0A 5IT9U 2UUWA 3SI8A 5D6GA 4DR5J 3R6LB 2UUCI 3Q1QA 2MPUA 2YNIB 3MWBA 2DNKA 3SV4A 1KLMB 4J9UE 4IZJB 5K36C 1EB0A 2K2PA 5EDWA 3QQCD 4ZP9A 2XTJP 2KVQE 1X7VA 1S9EB 1SKUB 4LF9J 1UFLA 2NXJA 2CJXB 4JI6E 2WZ1A 3D54A 5B0FA 3HHKA 4I7FA 4LCFA 2AGPA 4X64I 1FJGE 2D9PA 4ZVGA 2F9DA 1ZXMA 2DNGA 3JAMC 5KFSA 4UY85 3HSGA 1H2VZ 1HNWF 1LWEA 4OYXA 2D74B 4U67Q 4HHUA 4AQYE 2JEFA 2ZM6E 1VK8A 2RE1A 2JEJA 1Q8LA 3KK1A 4Y2CA 4KH1B 8ATCB 1YZ7A 4KHPF 4LRDA 2ZD1A 2AZ1A 3MTKA 2VQEF 4MFBA 2B9WA 2CDRB 3VALA 2QT7A 4RNHA 4NLOA 2MZ1A 2RS2A 2XMVA 4I6AA 3C3LA 2NN6D 1U7LA 2CPIA 5KG7A 2CQ3A 3FCHA 2R8HA 3H1CA 1O6XA 2GO3A 3IP0A 4IH7A 3ZNUA 1T05A 5ITHA 4FW4A 2YKMB 4K59A 1JNRB 1VHFA 2AEJA 2MQLA 1S7HA 2GQ2A 4WKRA 2XNQA 3PY8A 2IHR1 3KKFA 4GO5X 4LF7J 3ELHA 4GKKJ 2XMWA 1CVJA 2C28A 4LCHA 4JYAE 3U1LA 1JNZB 2J0XA 3A12A 3OXFA 3BB5A 3UD5A 5A8KB 1YDLA 1NJXA 2B4UA 3FEZA 4X4NA 2HK3A 1X0FA 3M9MB 4CO1A 3DU6A 4LF5I 3LP1B 2AYGA 2BACA 3TOQA 2PDAA 2RDIA 3B4DA 2QL9B 3D6MB 4YR0A 3PIOQ 3NS7B 3BGUA 5HL7Q 1BWEA 3U27A 4H4KA 4G65A 2ZH8A 3CDBA 3DLBA 1S97A 5IWAE 3PJXA 4IFDD 2GJ2A 3MXHP 2E1AA 1ROFA 1IKYB 4ZPDA 3T1HJ 4PRVA 2QLXA 1S4FA 2W01A 1F5BA 1WKLA 2YKQA 3T41A 3ENVA 4WKYA 5HVGA 1VQMS 3J7AN 3B82A 1NJWA 3J81Q 1VQ9S 2EFPA 1U2RA 2MEWA 3B4MA 4QZVB 1NK6A 2FZGB 2V67A 3RR8A 3AQPA 3KK2A 1SC3B 2KT2A 1VQNS 1B3TA 3PV8A 4CLWA 4QYRA 4I2QB 2DTJA 2JC1A 2M88A 5A8KA 1SC4B 1YX2A 2G9OA 4IYQA 3CJ2A 2PNMA 4AYBD 3ILIA 4OV1A 4CTAA 1RHKB 1YRTA 1T05B 4TYBA 4JV5E 4ZVTB 5C0XA 4USTA 4IR9A 1MWQA 5KT7A 2XGPA 2F8MA 2DNLA 4U8YA 3RB3A 3CPWR 1UWAA 3UNYA 2H5EA 2FC8A 3ZTQA 3X1LB 1R6MA 2ZVIA 3TVZA 5KFHA 4DF8A 4P73A 4FBTA 1YVFA 3QT6A 1KNZA 4P2XA 5E3CA 4N47A 4ZVUB 4MFBB 3BJYA 5KG3A 1HHQA 4PCQA 4WK3A 2MZRA 3W2VB 1FXLA 5BJRA 1HI8A 4OZNA 3VGVA 4X4UA 1R0AA 3AD9C 4KHRA 5K36D 3MOJB 1HPZB 3W9HA 2LEPA 4ZJLA 5A6PA 4BLGA 4DCJB 4ER8A 2IY5B 3OL9A 1R0BG 5GADI 2HK2A 2FVQA 3PIPQ 3DOLA 4FS2A 5CYQA 4OZ2A 1JJCB 2QG9B 2R4FA 2ZDPA 5K9FA 7FDRA 3R6GB 1Q8IA 4I7FB 2YKNB 3BGFA 1UEKA 5E5NA 1TL5A 1ZYQA 1NKBA 2I2YA 3W7BA 2F4VJ 4DV3F 2DR5A 4WBFA 3P3CA 4P72A 4HH1A 3ISND 1RTZA 4DSEA 4DWIA 1JK9B 2BRLA 1CJTB 1JLBB 2OPQA 5GVQA 3PZPA 4BBYA 4OYWA 3N5BA 4PXEA 3I96A 2PMHA 1VQKS 4JI4I 5DZ6A 5J1PA 4JI5E 4DR2E 3MURP 2DHAA 5IT9Y 5D4OA 3OR1B 2HFUA 1WOOA 2OH2A 1PJ7A 4UOGA 1AXQA 3OTDA 3QAUA 4YFUA 2H4YB 2DY9A 4OX9I 3PW4A 1XNQI 3JXOA 4LF2A 2DY1A 3TO8A 3NCRA 2C38B 2C2MB 2IM1A 2XHWA 4EK2A 5E0OA 5LMUF 2BANA 2IVYA 1R31A 1VQ5S 1EIYB 4U7UD 3QGPA 1N33F 2BKNA 3OR1A 1Q1KA 5L39A 2XCPA 4DV2J 2QRRA 3FQLA 3P49B 3PYEA 1DLOB 3D5MA 4CH1A 4AFFA 3SQGA 2LFVA 2QIFA 3PRVA 2ASDA 3CCZA 1VC5A 3TR5A 4DG1A 4LSLA 1KQSR 3G87A 1SH3A 1UKUA 2N4CA 1FRJA 2ZHAA 4TN2A 3F73A 1T9WA 1HWLA 1NZ8A 5L1JA 5FLXC 4DR2I 2WK4A 4ZN3A 1D1UA 1NK8A 4A4JA 2OPRB 4U7UK 1EP4A 1RWOB 1S10A 3N6LA 1IVZA 2I0XA 3JTNA 1IBKE 3V6DA 2NSCA 3KLIA 1YTYA 4ZMMA 3HLUA 1NK9A 3HJCA 2OSQA 4C11A 1MX0A 1NHVA 3Q89A 2W7OA 1V3RA 4Y3CA 4JI1J 3LPSA 2N3OA 1UEVA 1RDRA 3HVRA 1J5OA 3P3GA 2NYIA 3GFHA 4LF1A 4NZ7A 4BC7A 4LJMA 4N77A 1I51B 1KHVA 4ITSA 5FIIA 2DGSA 2R7OA 3QNWB 5F0UA 4C11B 5FD1A 4ED7A 4LFBI 4HACA 4PXCA 2DB1A 1XR5A 5KT2A 4H54A 4ED3A 1S49A 2ZBKB 4P2FA 2Y3YA 2OPRA 3WQPA 3EDQB 4O4RA 1TFWA 1QD1A 2AJ0A 4QR1A 4C3MA 4ECWA 4CTAB 2E7VA 3C6UB 1QTMA 3QZ8A 1EA6A 3FBEA 1HBMB 3M9OB 4ANEA 3CJTA 1DTQA 2R9LA 4USHA 3M85D 4UOFA 3KJVB 2YX7A 1QVFR 4K4SA 4B3TF 2EKYA 5C24B 1Z4UA 1RT3B 3BEGB 4DV3E 3K2YA 5K36A 1M5HA 4QIWD 3TUPA 3WZ0A 2BANB 4WZQA 5HMXA 2BA0D 3NCQA 3PX0A 4OJ3A 3TZWA 2CYYA 5K36F 4M5JA 1HFEL 2UXCF 4MT1A 3C2PA 1IKYA 1T9TA 1QAIA 4LF6F 1WC6A 2Y1LB 2PEHA 2G0JA 2RUSA 2B9XA 2BJ1A 3ZO7A 2HHVA 4IZJD 1N34I 2VQFJ 4J9NA 3NOGA 2C2DA 1L3VA 5E3PA 3WU4A 3DI6A 1C0TB 2X3GA 4NEZA 3SQOP 3ZNJ1 4X4VA 3R5BA 2IESA 4IH6A 3IWLA 3K57A 1YJTA 4DR3E 4HT5A 1HR0J 4DQIA 2IDLA 1XTZA 2BBEA 4J9MA 1X4FA 1VFJA 4DR6F 1HWKA 3HFKA 2CG8A 1F5CA 1SJ1A 4M5GA 5A6WA 3VAKA 3IAM9 1DY3A 1VQ6S 2UU9E 2OUGA 1FRMA 5DDPC 1UJ6A 4EWTA 2AE8A 2J65A 4XTJA 2WSEC 2BJEA 5LJ5Y 2CAJA 2XZDB 2J8AA 4B9MA 4NRUA 3P3DA 3H98A 4O44B 2YPYA 4CLLA 2EKNA 2J9DE 4NXNJ 1R8CA 3JTOA 2VA2A 4LF7E 5DRKA 3CJRA 4FW9A 4IOBA 3D67A 2XWXA 2F3JA 2ZC4A 3QLHB 2UXDF 2R7XA 3CW2C 3BV8A 3FCVA 3OTCA 4Y2IA 3V4IA 1DBDA 1S1TA 2IRYA 4W98A 2ZD1B 1LV5A 1P1TA 4ES1A 1LWFA 2K8GA 2KT5A 3GR0A 4FNHA 2DR9A 4FPIA 1XHKA 1U1KA 1G3OA 2CUYA 4DUYE 3CWJA 1XNRE 3D6HB 4USMA 2P2CB 3TX0A 4HTJA 1LWEB 4N41A 5HO4A 3GCMA 4GKJF 3KLGA 2RAQA 3G8TA 4DSFA 1CJKA 1HBOA 2DBBA 3QSYB 3KHHA 1H98A 1JLEA 2NN6F 4KH0B 1EZZB 3M30A 2LU1A 1IM4A 2RDJA 4AQYI 4K50A 1U1QA 4QJVA 1RAOA 4K2JA 4F3MA 2JSXA 2PEBA 1S9EA 2H54B 2RMLA 3HHLB 4BA1A 2QLBB 3P45B 1UWBA 4RUBA 4JYAF 1N5YA 1RT4B 2OIHA 3D3BJ 4B9SA 2SXLA 4CLKA 2HQIA 5DQHA 3OXGA 3VQSA 1W7WA 2AYEA 3A3OB 3E3XA 2FIUA 2IC3B 3DM2B 3U7JA 2FY8A 4MK8A 3EWGA 3NXZA 1UDQA 2VBWA 1U1NA 1U2CA 1F9EB 2AJ2A 2ZVSA 3DYAB 1M5OC 1N36E 4QOTA 4RNOA 2F63A 4HI2A 2BJ7A 4R5PA 1BY9A 2B5JA 1BQXA 4OHVA 3ZFVA 4YHHE 1P8GA 4DBQA 2KZZA 1YG0A 4XPCA 4ECYA 5KFJA 4B3SE 5C0XE 1IBLF 3MM7B 4DR7F 1F2GA 4LCGA 1VBKA 5GMEA 1CQMA 3Q83A 3MFHA 3C6UA 3PRDA 1TL3B 4XDDA 3CDUA 2KVIA 3F44A 4N8OA 1D9AA 2KO1A 2W9BA 1KOOA 1AB8A 3LAKA 1S1VA 2VV5A 2AW0A 2VQFI 1HNWE 2HFOA 2HQGA 4F8RA 1IBLE 4DR7E 4ZVEA 3ILJA 1Y11A 2NREA 1YZ6A 1OSCA 3RRHA 2RUGA 1H74A 1RHMB 5IV4A 1XNQF 3PTWA 1DTTB 5F8HA 3FRZA 3ZZ0A 3S8SA 2GO4A 2UVUA 1VS3A 3BR8A 2VU5A 4NXNE 3A4TA 3JQJA 5C0XF 3VV2B 1D0EA 4LFCJ 3HVWA 3H20A 4QWEA 1Y5YA 3QT8A 1S1WB 5EGYA 3QFWA 2XI2A 3GIIA 2XWYA 2HNYA 2CQDA 2BR2A 4LQ3A 1ZZFA 5KOXA 1Q79A 1NHHA 1VC0A 4B3RI 3U1YA 1S0MA 2RF2B 3G82B 5KFXA 4X62E 2NUHA 3IR7B 2DITA 3UN2A 3K5OA 5GAHI 2M8DB 4NA2A 1FRIA 2R3VA 4B17A 1UDSA 1AROP 5FDLA 4DV4E 1XMBA 1ZTTA 1S99A 4I68A 4Z7CA 4KGZB 1NJYA 1G7CB 3V5RA 1KQGB 1X9MA 3NEKA 1E3HA 1IQTA 1NAQA 1REGX 3GLLA 1FD8A 4DG1B 2HRTA 4PWWA 1H7XA 4TLQA 4DUZE 4URLA 2MKIA 4IRKA 1H7WA 1Z2LA 2GO9A 2CJ9A 4EYHB 5C2GA 4OFZA 2BA9A 4UTGA 4ELTA 4DPWA 2BOPA 2WONA 3CJQA 5IWAF 1B99A 4IQXA 4J9PA 3P6YC 2HVIA 2HIQA 3HSJA 4FWDA 4DLEA 4CLUA 4EU0A 2ZH7A 1RT2A 3KHGA 1KWMA 2KZMA 2DGVA 2GC8A 4DR3I 3RTVA 2HIYA 5L1LA 3CIZA 2DISA 2DNZA 5J2QA 4ZVHA 5LT5A 4YY3E 4IFDE 1HWJA 3M4XA 1A9NB 2K1RB 4X84A 4BCAA 4EFAC 1KSPA 1KVIA 5K5MA 1KIJA 3OL8A 3OLAA 3P3EA 1BQMA 2QA1A 4I0WA 1FNOA 2C2ZB 2ZDOA 4RUAA 1M5KC 4QIVA 2NPFA 5D77A 4DV4I 1WHWA 1CS4B 1TFYA 3FCWA 3H2VE 2J0WA 2YVSA 3ZZOA 1UDOA 4LF5J 4RNNA 4IZKA 1TMMA 2BV3A 1N34F 3MMJA 5LM7E 2HKEA 4FYYB 2HWIA 3UDLA 1I6JA 2CADA 2UXCI 2J7UA 2EFOA 5EWEA 4X4OA 1N34J 3DLHA 4K0KE 2VQEI 1S48A 2MQNA 3CCSS 2AHOB 4QIFA 1IBCB 1N48A 2BE9B 4PG4A 2V5HG 2YNFA 4Y34A 2R2RA 2C3UA 2AD9A 2AMCB 4JI7J 3QRRA 1RCOB 1B7YB 1RT1A 1VQPS 5C5JA 4DL4A 4B3RE 5JVHQ 3WIVA 1FF2A 2WVFA 2QN6B 4DV1F 2PIIA 3ZKBA 4F0HA 5KFCA 2LDIA 2NXUA 1S1WA 2LCWA 3NOCA 4MK7A 4NLSA 4RUCA 3GV8B 3KOAA 5AE3A 2GGPA 2Y1IA 1ZXNA 5ETMA 3CDWA 3RRKA 3GMGA 4CH7A 4NLPA 2UV8A 4C8ZA 5JXSA 5F8NA 3ZTSA 2PFFB 2HURA 4Q43A 2GX8A 1IKXB 1TL4A 4ZHRB 4LF4F 1CC8A 3H90A 4KFBA 4F2SA 2HHTA 1BC6A 3UCZP 5IWAJ 3OSPA 4KGVB 4EZ9A 3M8PB 1B0TA 1YLXA 3C8YA 2MTLA 3I5CA 4DDFA 1KD1T 1ZPVA 2IJRA 2N7CA 2Q1LA 4B3MJ 3W9JA 4NXMF 3S6EA 1TKXB 2XCAA 3HHDA 5D0HA 3UD3P 3TARA 5K8PA 2EVZA 1VMBA 5KFTA 4B02A 4KB7A 5AE2A 1G1XA 4X62J 2MB0B 2MQMA 1FFSB 2DEJA 2CPZA 3UWTA 3KMQA 3MCSA 1HNWI 3LOUA 2QV6A 1CULA 1RT7A 3C14B 1IWGA 3DRPA 4ZCKA 3K8WA 5J1EA 2E9RX 3NL0A 4PPZA 4GKKE 4R8UA 1UEUA 5D0EA 3DRSB 4J9OA 4QYZK 2AYBA 1MW7A 5KFLA 3GFXA 1TKTB 3PFOA 2F4FA 2XZWA 4FPRA 5ELWA 2GIQA 5MAOA 4DR6I 1YQHA 2P8IA 2DGWA 3FNNA 2W2NP 4C98A 1SUQB 5F9LA 4GVBA 2BM1A 2DYAA 4XTTA 2H1YA 2C2RA 4KTQA 2R2SA 2RQMA 4U9RA 1N36I 3KLHA 3QJLA 4W4MA 3OFHA 5HROB 2IC3A 2MGZB 1FERA 1Y4SA 3OL6A 2FC9A 2VDIA 4I67A 4JG4A 3CJKB 2UXDE 1CJUA 1Q78A 2JFDA 3LP0A 4I6YA 1HNIB 1Z0CA 1DQ8A 1FFWB 2ZZNA 4K5SA 2V2ZA 2V0NA 3MECB 3GSIA 4KO0B 2P9GA 3QWUA 3WC2A 2LQJA 3R5DA 3DMJA 1NB2A 2HHUA 1RAJA 2AF6A 4LQ9A 1S0NA 3B78A 3HI9A 1NU4A 1UZDA 1KONA 1TVRB 2M7SA 3AB2B 4DV7J 4JI4E 3E8OA 3IFEA 3MM8A 5HATA 2KXNB 4HYMA 3G96A 2YNHB 1HK7A 2QTWA 1CC7A 3GV5B 3VGTA 5AXKA 3QJJA 2ALYB 2K3IA 3DXBA 2HHXA 4NXNF 1GX6A 1WACA 4NI2A 3J80C 3N0VA 4ES2A 3UN5A 4ZIWA 2Z2ZA 1UVNA 3NZKA 2RIJA 4WE1B 1SKWA 4DR4I 1LW0B 2EWHA 3N6NA 2A1BA 3CUNA 3R5GA 1OS5A 4RJVA 4C3LA 1FTRA 2PO2A 3C16B 1CBKA 2VHGA 1L3UA 2HS3A 2N4DA 2MYFA 1P1LA 1IKVA 4DV5I 2OSRA 3I31A 4DOZA 1NPKA 2M0GB 5DG9A 2AZ3A 2COLA 2V4QA 2V34A 2OD4A 2W2MP 4ZCMA 1UZHA 1U6BA 1FKPB 3W64A 1RI7A 3PVXA 2AWZA 1S1XA 1TVRA 2XI3A 4F4WA 3CE8A 3IR5B 4P7VA 5KFVA 3R2CJ 1LXNA 2HMIA 1H73A 5LSRA 4KBIA 1IUJA 1U0SA 1BGXT 2JC0A 2EFVA 1YWXA 2BQUA 2X1FA 3B54A 4OX9F 1AFJA 3WHIA 3OHAA 1B64A 2GVZB 3I55S 1VQYA 1QE1A 4JV5I 3Q8UA 4HHHA 3OL7A 1NKEA 4FYXB 1HI0P 4PPDA 1RTDB 2AQ4A 3L7PA 1FK9B 4K4UA 4CLPA 1KP6A 2MKSA 1RLCL 1KDNA 4F0MA 4DX8H 1SQGA 4DV5J 5L8RC 3Q6NA 1ZOTA 1RBLA 1Y10A 3NRBA 1WC5A 3AD7C 3ENAA 4C8OA 1T03A 4GVLA 3CWVA 1S1UA 4MU1A 3WU3A 3KDNA 3UDCA 3CCMS 1RE1B 2M3DA 4WF9Q 1FI4A 2IRUA 3WX8A 4E98A 1PIEA 1R8BA 3JYTA 1QSYA 2R7UA 3NGDA 2ZOFA 3L7ZB 1HKAA 2RDDA 4NRTA 4R8UB 5IOLA 3UR3C 2NYHA 4OI0A 4FWGA 3CCQS 4FBUA 3KUHA 5JVGQ 2Z5CA 4OO1D 1N6QB 5LMNJ 3BH7B 1YKWA 3PM9A 2U1AA 4RR5A 2OFGX 3MEEB 2E5GA 5ETQA 2QMXA 3KMSA 1HNVB 3KJVA 1DFDA 1MU5A 4P52A 4JI0J 1QTNB 3T9ZA 4ZLJA 3M1VA 1K0TA 2MKHA 4J37A 2HGLA 2QMUB 3DOMB 4OZLA 3TAQA 1OY8A 4V19J 1IN0A 2NPIA 3GPAA 5KG5A 1B70B 5AXLA 5H1SV 2C39A 2M70A 3PS1A 4BA2A 1RKJA 3MEDA 2WW4A 2DT9A 3X3UA 3TRGA 3LW5C 4DCOB 2ZH3A 5H9FK 5IT9Q 2VQFF 4KSEB 2ZM6F 2QX0A 2CPXA 2VOOA 3KG0A 5CHCB 5F3TA 5CCMA 1SL0A 3GMEA 4WUCA 1NO8A 2VG5B 3IO1A 1URNA 4K0KJ 5EHHA 4ZVIA 3HJFA 1FJGJ 3M8WA 4QNJA 4WTYA 2YWGA 3W2WA 2HHWA 2GZOA 1VLOA 3MR6A 2GW8A 4ECQA 4CWBA 2R7TA 4CCHA 1K9MT 3TJ9A 3WBZA 4OYPA 1C2PA 1SPBP 3BDEA 3OD2A 3PACA 3D2WA 1Z0WA 3BO4A 4I3HA 2NQPA 1RJJA 2ZWOA 3AH6A 3NAIA 3OTOJ 1KC8T 2ZJQQ 4DR5E 1HBNA 4JI8I 4CLZA 1FRHA 3UVJB 1NPPA 2HFSA 3QGIA 2VBYA 3EGZA 1JLGA 1GXUA 4DL3A 1OSDA 3OTOF 3TQEA 2GQ0A 4LSZB 1R7IA 1U1OA 2KHCA 1VQ7S 2VBZA 4IFDB 3DOKA 1NDPA 5DRPA 4AXJA 2JL9A 1TV6A 5LXYA 1AZSB 1DLOA 4RW8B 4UUWA 5I3QA 4FDFA 1H72C 1FJGI 2CJQA 1VRTB 1VRQC 4R5PB 4E8UA 3LWMA 3BQ2A 1FDDA 3CDAA 1P27B 4DN0A 1FJCA 3O6QA 2UZAA 3DYAA 2FJVA 5U47A 3SCLE 1RHJB 4RBTA 3T5HA 2VH7A 5G0RA 2EEYA 3TA2A 2XS2A 3G2XA 4KGKA 1B0VA 4USIA 1S1UB 2LA4A 2VIHA 2RRAA 2YX4A 4JI1F 3M2UA 4H4OB 1QUVA 2WVBA 3J80Y 1AW0A 1SJ3P 3TVKA 4YQWA 5MLCV 4LFCI 2CDQA 3DFEA 1NDCA 1YJ9S 1ZM9A 1P9YA 3V2UC 1RTDA 2EG1A 1JMTA 3OR2A 5KFWA 1IBME 1WI6A 2HMIB 4RW4A 3TUIC 1X5TA 1UVLA 4JI8E 2Q79A 2DJWA 3MFIA 3J81Y 1PBUA 1YBUA 2ZH1A 5JEAA 2V4JA 2Z0GA 4OZ0A 4PEOA 4NOHA 4ECSA 4PKDB 2Q3PA 3SV3A 1Z1ZA 1Y00A 1U49A 4EBDA 4IOCQ 3LP2B 1N0UA 1KBRA 4Q44A 3EX7B 4KHMA 2V2KA 3C16A 4OZJA 2WW8A 1UJ5A 4ED6A 1S6PA 2HVDA 2WP8B 1HPZA 1NLKL 3AJ1A 3MR5A 1TUGB 3OVAA 1FRXA 1LWFB 1VBXA 2CRLA 4USJC 5LMUJ 3MZIA 1X31C 1N33J 1U0HB 3P4UB 1D9FA 3OBIA 2FLNA 3RBDA 3QATA 4HT7A 1TR0A 2LVWA 3T3FA 4ZP6A 2YWFA 1RAIB 4L72B 4GC6A 4A8SA 2UXBJ 2JZ5A 3RAQA 2NUUG 5KT3A 1U25A 3LH2S 2DRAA 5HP1B 4TKTA 2WP8A 2JWNA 2ZUGA 3FFIB 1JLQA 1RU1A 4RPFA 2ZH9A 4KV8B 2J9DA 1S57A 1R6LA 5LMUE 3GP9A 1FVQA 1N33E 2MQPA 1GMVA 1M1HA 1TUWA 3O1LA 4I2PB 1I94I 3BQ0A 1TL3A 3N5FA 5L9XA 2IFXA 1PAEX 2E5JA 5T14A 3DGPA 4DV3J 2U2FA 3EPGA 5A76A 1WHVA 1S9FA 2RU9A 5B0GA 3I5AA 5GAGU 4RU9A 4K2XA 4ILRA 4F4ZA 2FHJA 1NPRA 1DURA 4WWSA 2DNYA 1SI9A 3KWMA 1A6LA 4DCPB 3KLVA 2XULA 1UFWA 3CJKA 3H5UA 1UA0A 1RCXB 2EG2A 4ED0A 2VJUA 1S59A 2JE6B 1T94A 3I4HX 2JLGA 5B0BA 5KFKA 5HROA 2AGQA 3O5TB 4H4OA 2UVWA 1HWUA 1T7PA 5AJ3J 2QSFA 1CJUB 2X51A 4JI6J 2HGNA 1O51A 4FKYA 4D3HA 2XM3A 3KYLA 1GMWD 3K0JA 3KLHB 1EQMA 1UPPA 1BHNA 5G0RB 4CQ1A 5K8MA 3W3SA 4LT6A 3CCVS 4TNOA 3PG9A 2UVVA 1MWYA 2PN6A 4N7TA 3UFCX 3HHLA 3HKWA 1HYSA 3IBCB 3IC1A 2E5LI 2FDNA 3PX4A 4JI1E 1RU2A 2ILYA 2DNHA 3DLGA 1EHWA 1R27B 4NMXA 5BR8I 1PYOB 2IYIA 5J1EB 2VODA 1LWCB 1WSRA 3CSKA 2E29A 2V94A 4RW6A 2V2VA 1B4SA 3OTBA 2MKKA 1HA1A 1ZPWX 3K1JA 3GILA 3NNAA 2O1TA 1GFWB 2FUG9 4KQVA 4JI4F 4C8KA 2CFXA 1JLFB 1WG1A 5ETRA 5EX0A 1RUSA 1PSDA 1GT8A 1K8AT 1G2EA 1Y6ZA 2FJDB 1UW4A 4X62I 2L08A 4F36A 1HR0I 3D7SB 4JV5F 3H5SA 4OV6A 3M32A 1QSSA 2NXEA 3CULA 4A8MP 3OTOE 4CO3A 2BJ9A 1U0HA 3DNCA 2IA6A 4OZ1A 1K47A 1NSPA 2DCLA 2VASA 2CPYA 2DKOB 2RQ4A 3DXSX 2VF3A 5IC6B 1M5PC 4ZDNA 5HBMA 3TEHB 2AEMA 1K1SA 1NMEB 1PCAA 2BEFA 1UJ4A 2GS8A 3BGRA 2RKIB 2RHQB 2VL1A 5KFGA 1NSKL 3PW0A 2C2EA 4M5LA 4FF2A 1CEZA 3OLBA 1WNEA 1P42A 3V6DB 1OYDA 3FEYB 4HTIA 2FLOA 4ETZA 1M5VC 2ZM6I 3IBWA 2KL8A 3VTIA 3RRGA 1PVGA 2DHGA 6AT1B 1WD6A 5K14B 2OP5A 5T7LA 2V4JB 3T9NA 4X62F 4LF6E 1RTJA 2DNQA 4URQU 2LXIA 4LREA 3K5NA 2DPJA 1S16A 2WCXA 4GKKF 4NE9C 2CPDA 4ECRA 2FJEB 2A10A 4WP9A 1Q82T 3KG4A 1KLNA 4C8MA 1YJVA 2FHKA 2HEKA 2VG6B 4L73A 2OEJA 3RBXA 3QZ7A 2XMAA 4DFKA 1CS4A 2MZTA 2NCKL 5G4DA 2PA8D 4L76A 3KTQA 4FWHA 3UNGC 2ZHBA 3J7AG 1PILA 2EFQA 5J2QB 4Q5VA 3SFUA 1RGVA 7AT1B 3MMAA 1RT2B 2CPJA 3MMAB 1VRUA 4M8LA 2HRYA 4QWDA 4C0HA 1JKHB 2CJBA 2J5AA 2NLWA 3EZUA 5KFAA 1IBMF 4CYUA 3MCNA 1PC5A 4U3DA 2Y0SD 4X4QA 1FXRA 1LK7A 3MAAA 3THPA 4DUTA 4ZS6A 3D9BA 4Z37A 2KM8C 3UE2A 3MUVP 3N01A 3J7Z5 1Z2ZA 2CNLB 3ZC4A 2ZHOA 1RWKB 3D6FB 2VA3A 2DNPA 1JLBA 1CJTA 2LU2A 3CEDA 2IRXA 2B51A 2EBEA 2N3LA 3NY0A 4B08A 5DM6Q 3RB0A 3VZHA 3H5XA 4AL6A 4HXZA 5J2NA 2WB4A 4NLDA 4DV6F 1XK8A 4LVNP 1M5SA 2RRBA 4LBPA 1FDNA 2ZNYA 3A8JA 2KI2A 4NLGA 4UY8T 4YOEA 2O3DA 3MHYA 5C25A 1Z0VA 3MCMA 4Y2AA 5KG6A 2WTFA 4KT0C 3CC2S 4MKYA 3KLFB 4JI8J 5LL6R 4RBUA 1LQ9A 1Q95G 4B9NA 2R8KA 4ED5A 3W2WB 2J76E 2AJ4A 2AGOA 2YNGB 4EYIB 1L3TA 1EKRA 1Q7LB 2FTRA 3CT9A 1O5JA 2ABYA 2ZITA 3M2VB 4PAAA 3OTOI 1KFDA 2DR6A 4NXMI 2KFZA 5AJ3F 5BR8F 2XY7A 4JI6F 3POTB 4M5KA 5LL6d 3SXLA 4A8KA 4MKBA 2H4WB 2XSJB 3OXLA 3E51A 2MY8A 2GQCA 2CJYB 2WRMA 5HN0A 4HLBA 2DHXA 2W24A 4Y6IA 3RB6A 2JFKA 1JLFA 2OMLA 3NGTA 2CQHA 3K8VA 4Q45A 2PNZA 4ZPTR 4QBUA 5CD4A 3M6AA 2DPIA 2QMWA 2V8HA 3FGVA 2JEAA 5CAAA 4OI4A 3IG1A 1MWZA 3MM9B 4P9SA 5C42A 1OYPA 4JI1I 3DLGB 2VONA 2E5LE 2MMYA 5DO2A 1H0HB 4DXLA 4MKVA 3M7ND 2FVRA 4WP3A 1RWVB 2GIFA 2NZ4A 2HAIA 3JSBA 2G13A 4ALZA 3JQKA 3RBEA 1NDKA 3TI0A 1FA0A 1S6UA 3GSDA 1GK8A 4WP8A 5B0EA 3W9IA 2EBGA 5K20B 2KFYA 4DR2J 3WU5A 5E3RA 2RS8A 1U26A 3CCUS 4QW9A 4ECTA 4O3SA 2JNJA 4K4ZA 1I94F 3PYFA 4ED4A 3M6WA 1SL2A 3HFZB 4NLTA 5I42A 4B3OA 3DM2A 4LMZA 3OFFA 4DMZA 5ETLA 4CNYA 2UXDJ 1VGYA 2NN6B 3LP1A 1V3SA 3MF5A 5C7PA 4BA1B 1F2HA 1TELA 2UUBF 2OPQB 1TKTA 2BKPA 2RSQA 3J80U 2OTLS 4RKUC 4LF8F 1HW8A 1APSA 1S6OA 5CYMA 1KN6A 4FVMA 5LMNE 4EMDA 1RA6A 1XR6A 2XY5A 4IG3A 5IWAI 1CULB 1RT7B 5HMZA 5K8OA 5LMUI 1JIHA 3CCLS 1XNQE 1N33I 1RAGB 5HQ8A 4DL6A 4UT4A 3V4MA 5GAGI 2QA2A 1FKPA 4UOCA 3D1HA 3W8GA 5IT0A 3GR1A 2FVSA 3QSIA 1N4LA 2ZC3A 4ID5B 5B09A 2OJ3A 3HZEA 3MDFA 4CIOA 3IR6B 4EUVA 4RU2A 3IRXB 3ZZYA 2G0IA 3WIUA 2FHMA 1HNZE 2YQ3A 3W2VA 1Z0BA 3I5BA 4FF4A 3RU0A 1FKOB 4LSNB 2HQCA 3GWCA 2OKQA 3PS2A 1QSLA 3W63A 4FKXA 1AYEA 1U1MA 3JSRA 2LJPA 1WC4A 2L9NA 3KK1B 1VBYA 2PO2B 4IDKB 3QLHA 1MROB 3CO0P 3TUZC 3J7YI 2R7VA 1WJ9A 4X65I 1IBLI 2LYVA 4LRCA 4PG6A 5DG7A 2EI5A 5M2RA 1SC1B 4FXWA 2VFSA 1Q86T 4MU3A 3O44A 4YB7A 2W7PA 3RUBL 1K0VA 3BBCA 2LA6A 3BPDA 3R9LA 5KFOA 4AIDA 2M9KA 1IBMI 5A2QQ 1W26A 4KQZA 2ZH5A 4B3SI 1HW9A 1J2VA
chains in the Genus database with same CATH topology
3ZM7A 2VQEI 2VQEE 4K0KI 3J81C 5L3JA 1FKAE 4LF8I 4LF5E 4B3RE 3ZKBA 1S4EA 1NZ0A 1ZXNA 1RREA 2Z5EA 4FN5A 1N32I 2PNLA 1B62A 1XNRE 1Z0TA 1HNZI 3QT7A 2DEJA 1HNWI 3WU6A 1H7UA 3PYGA 4WUDA 4GKKE 3J7AM 3K17A 1XMOI 1XNQI 4DR6I 4DV7I 1OJ4A 2O1TA 2BM1A 5LMNI 5IWAI 1N36I 1EI1A 3T1YE 1Y4SA 4LF7I 4JG4A 4R1FA 2UXDE 4NXME 4WUBA 1Z0CA 1USVA 4JI7E 4LF9E 2V2ZA 5BR8E 1WUUA 2X36A 4LF4I 4X66I 4B3MI 4DU7A 1A6FA 3B78A 4NXNI 4IZKB 4B3TE 4JI4E 4M1KA 4DR1I 4HYMA 4DV1E 1HK7A 2Z5CB 3T1HI 2UU9E 1Z0EA 3ZZUA 4DR4I 1ELOA 2E1RA 2UUBE 1NHIA 4DV0E 1D6TA 1Z5CA 1Z0GA 4GKJI 4DV5I 2UUCI 3Q1QA 1I94E 2V34A 2HHHI 4IZJB 2IOPA 4JI6E 2EFGA 4X64I 1H73A 2Q2EB 1FJGE 1KVKA 4JYAI 5IT9C 2R42A 3JAMC 4JI2E 4JV5I 4LFBE 4AQYE 4DR6E 2ZM6E 1J5EE 3Q6NA 3CWVA 3WU3A 4JI0E 1FI4A 4DUZI 1PIEA 1IBKI 4FWGA 4DR1E 2Z5CA 1MU5A 4P52A 1FWLA 4JYAE 1MG7A 2O1WA 2HK3A 4LF5I 2WW4A 5IT9Q 5IWAE 5A2QC 4WUCA 1XMOE 4PRVA 4PU9A 4ZVIA 4JI5I 2UXCE 3B82A 4GKKI 3J81Q 2IOQA 1U2RA 1Z0WA 4I3HA 4DPUA 4DR5E 4JI8I 4DV1I 2HFSA 2PNMA 2GQ0A 3LNUA 4JV5E 1KKHA 4JI2I 1ZM4A 1FJGI 1H72C 2CZ9A 3QT6A 4GKJE 1ZM2A 4DPXA 2HK2A 4Z7YA 4LFCI 3J80Q 4DU8A 2CG9A 1FNMA 3V2UC 1ZM9A 1IBME 4DPTA 4JI8E 1UEKA 2BM0A 2DEIA 2UXBE 1QZRA 1N0UA 4B3TI 4JI4I 4JI5E 4DR2E 4YY3I 2A2CA 1B63A 2OI2A 2HFUA 3QT5A 4OX9I 1BKNA 1H7SA 2V2QA 4HY1A 2VQFE 3T1YI 4RPFA 3PYEA 4FW9A 1ZM3A 5LMUE 1N33E 3B8HA 1I94I 4DV5E 2UUCE 4DR2I 5FLXC 2UXBI 1IBKE 3H4LA 4USKA 2A2DA 3Q6MA 3HJCA 4DR4E 1MX0A 3LPSA 2V8PA 3F0NA 1N0VC 4LFBI 4HACA 2ZBKB 2E5LI 4JI1E 4X64E 5BR8I 4JI6I 1EA6A 2UXDI 2V2VA 3K1JA 1VISA 4KQVA 1KTVA 4DV3E 1Y6ZA 4X62I 2XEXA 1HR0I 1Y4UA 3GONA 3OTOE 4DR5I 1K47A 2VF3A 1N34I 4IZJD 3ZZTA 2GS8A 2UUAE 1USUA 4LF6I 3WU4A 4DV6E 3T1HE 4KHPE 2HKJA 2ZM6I 5FWKA 1J5EI 4DR3E 1PVGA 4DPYA 2Z5BA 4LF6E 1S16A 1Z5BA 4DV2E 1XMQI 1ZXMA 5GMDA 4XTJA 4JI7I 3PRYA 4IZJA 4JI3E 4FWHA 1HR0E 2HHHE 4LF7E 4DV3I 4DV0I 2UUBI 1XHKA 2J7KA 4DUZE 2F4VE 4DUYE 4JI0I 4USMA 3J7AG 2O1VA 4DV4E 4LFAE 2UU9I 4HXZA 4AQYI 1DARA 1Z0VA 4KHPI 4N3OA 3J80C 1NHJA 5LL6R 2UUAI 1N34E 4X66E 4B3ME 2AJ4A 2F4VI 2CGEA 2X7IA 2ZITA 3OTOI 4NXMI 4LF8E 2O1UA 1Z5AA 1N36E 4YHHE 4DV7E 4B3SE 3PYDA 3M6AA 4JI3I 5GMEA 3HULA 4JI1I 2E5LE 1XMQE 2VQFI 1HNWE 1IBLE 4DXLA 4DR7E 3K85A 1FWKA 1H74A 4MYTA 4HACB 3ZZ0A 4NXNE 4DV6I 3WU5A 1PKPA 3PYFA 4ED4A 4LF4E 3ZKDA 3QT8A 3P06A 4LF9I 1HNXE 1NHHA 4B3RI 4X62E 2R3VA 5LMNE 4EMDA 4LFCE 4YHHI 4Z7CA 1XNQE 3V5RA 5LMUI 1N33I 4UT4A 4MYUA 3D4JA 1HNXI 4UTGA 4DPWA 4DV2I 1HNZE 5FLXQ 4X65E 1Z0BA 4OX9E 4FWDA 4URLA 4DR3I 1XNRI 4YY3E 3JAMQ 2LJPA 1N32E 3LTOA 1KIJA 4X65I 4DV4I 4LFAI 1IBLI 2NPFA 4DR7I 4P7AA 4IZKA 4DUYI 2Z5BB 2BV3A 1RR9A 1Z59A 1IBMI 2HKEA 5A2QQ 2UXCI 4B3SI 4K0KE 4PRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZM7 A;  2VQE I;  2VQE E;  4K0K I;  3J81 C;  5L3J A;  1FKA E;  4LF8 I;  4LF5 E;  4B3R E;  3ZKB A;  1S4E A;  1NZ0 A;  1ZXN A;  1RRE A;  4FN5 A;  1N32 I;  1B62 A;  1XNR E;  1Z0T A;  1HNZ I;  3QT7 A;  2DEJ A;  1HNW I;  3WU6 A;  1H7U A;  3PYG A;  4WUD A;  4GKK E;  3J7A M;  3K17 A;  1XMO I;  1XNQ I;  4DR6 I;  4DV7 I;  1OJ4 A;  2BM1 A;  5LMN I;  5IWA I;  1N36 I;  1EI1 A;  3T1Y E;  4LF7 I;  4JG4 A;  4R1F A;  2UXD E;  4NXM E;  4WUB A;  1Z0C A;  4JI7 E;  4LF9 E;  2V2Z A;  5BR8 E;  1WUU A;  2X36 A;  4LF4 I;  4X66 I;  4B3M I;  4DU7 A;  1A6F A;  3B78 A;  4NXN I;  4B3T E;  4JI4 E;  4M1K A;  4DR1 I;  4HYM A;  4DV1 E;  3T1H I;  2UU9 E;  1Z0E A;  3ZZU A;  4DR4 I;  1ELO A;  2E1R A;  2UUB E;  1NHI A;  4DV0 E;  1D6T A;  1Z5C A;  1Z0G A;  4GKJ I;  4DV5 I;  2UUC I;  3Q1Q A;  1I94 E;  2V34 A;  2HHH I;  4JI6 E;  2EFG A;  4X64 I;  1H73 A;  2Q2E B;  1FJG E;  1KVK A;  4JYA I;  5IT9 C;  2R42 A;  3JAM C;  4JI2 E;  4JV5 I;  4LFB E;  4AQY E;  4DR6 E;  2ZM6 E;  1J5E E;  3CWV A;  3WU3 A;  4JI0 E;  1FI4 A;  4DUZ I;  1PIE A;  1IBK I;  4FWG A;  4DR1 E;  1MU5 A;  4P52 A;  1FWL A;  4JYA E;  1MG7 A;  2HK3 A;  4LF5 I;  2WW4 A;  5IT9 Q;  5IWA E;  5A2Q C;  4WUC A;  1XMO E;  4PRV A;  4PU9 A;  4ZVI A;  4JI5 I;  2UXC E;  3B82 A;  4GKK I;  3J81 Q;  1U2R A;  1Z0W A;  4I3H A;  4DPU A;  4DR5 E;  4JI8 I;  4DV1 I;  2HFS A;  3LNU A;  4JV5 E;  1KKH A;  4JI2 I;  1ZM4 A;  1FJG I;  1H72 C;  2CZ9 A;  3QT6 A;  4GKJ E;  1ZM2 A;  4DPX A;  2HK2 A;  4Z7Y A;  4LFC I;  3J80 Q;  4DU8 A;  1FNM A;  3V2U C;  1ZM9 A;  1IBM E;  4DPT A;  4JI8 E;  1UEK A;  2BM0 A;  2DEI A;  2UXB E;  1QZR A;  1N0U A;  4JI4 I;  4B3T I;  4JI5 E;  4DR2 E;  4YY3 I;  2A2C A;  1B63 A;  2OI2 A;  2HFU A;  3QT5 A;  4OX9 I;  1BKN A;  1H7S A;  2V2Q A;  4HY1 A;  2VQF E;  3T1Y I;  4RPF A;  3PYE A;  4FW9 A;  1ZM3 A;  5LMU E;  1N33 E;  3B8H A;  1I94 I;  4DV5 E;  2UUC E;  4DR2 I;  5FLX C;  2UXB I;  1IBK E;  3H4L A;  4USK A;  2A2D A;  4DR4 E;  1MX0 A;  3LPS A;  2V8P A;  3F0N A;  1N0V C;  4LFB I;  4HAC A;  2ZBK B;  2E5L I;  4JI1 E;  4X64 E;  5BR8 I;  4JI6 I;  1EA6 A;  2UXD I;  2V2V A;  3K1J A;  1VIS A;  4KQV A;  1KTV A;  4DV3 E;  4X62 I;  2XEX A;  1HR0 I;  3GON A;  3OTO E;  4DR5 I;  1K47 A;  2VF3 A;  1N34 I;  3ZZT A;  2UUA E;  2GS8 A;  4LF6 I;  3WU4 A;  4DV6 E;  3T1H E;  4KHP E;  2HKJ A;  2ZM6 I;  1J5E I;  4DR3 E;  1PVG A;  4DPY A;  4LF6 E;  1S16 A;  1Z5B A;  4DV2 E;  1XMQ I;  1ZXM A;  5GMD A;  4XTJ A;  4JI7 I;  4JI3 E;  4FWH A;  1HR0 E;  2HHH E;  4LF7 E;  4DV3 I;  4DV0 I;  2UUB I;  1XHK A;  2J7K A;  4DUZ E;  2F4V E;  4DUY E;  4JI0 I;  4USM A;  3J7A G;  4DV4 E;  4LFA E;  2UU9 I;  4HXZ A;  4AQY I;  1DAR A;  1Z0V A;  4KHP I;  3J80 C;  1NHJ A;  5LL6 R;  2UUA I;  1N34 E;  4X66 E;  4B3M E;  2AJ4 A;  2F4V I;  2X7I A;  2ZIT A;  3OTO I;  4NXM I;  4LF8 E;  1Z5A A;  1N36 E;  4YHH E;  4DV7 E;  4B3S E;  3PYD A;  3M6A A;  4JI3 I;  5GME A;  3HUL A;  4JI1 I;  2E5L E;  1XMQ E;  2VQF I;  1HNW E;  1IBL E;  4DXL A;  4DR7 E;  1FWK A;  1H74 A;  4MYT A;  4HAC B;  3ZZ0 A;  4NXN E;  4DV6 I;  3WU5 A;  1PKP A;  3PYF A;  4ED4 A;  4LF4 E;  3ZKD A;  3QT8 A;  4LF9 I;  1HNX E;  1NHH A;  4B3R I;  4X62 E;  2R3V A;  5LMN E;  4EMD A;  4LFC E;  4YHH I;  4Z7C A;  1XNQ E;  3V5R A;  5LMU I;  1N33 I;  4UT4 A;  4MYU A;  3D4J A;  1HNX I;  4UTG A;  4DPW A;  4DV2 I;  1HNZ E;  5FLX Q;  4X65 E;  1Z0B A;  4OX9 E;  4FWD A;  4URL A;  4DR3 I;  1XNR I;  4YY3 E;  3JAM Q;  2LJP A;  1N32 E;  3LTO A;  1KIJ A;  4X65 I;  4LFA I;  4DV4 I;  1IBL I;  2NPF A;  4DR7 I;  4P7A A;  4DUY I;  2BV3 A;  1RR9 A;  1Z59 A;  1IBM I;  2HKE A;  5A2Q Q;  2UXC I;  4B3S I;  4K0K E;  4PRX A; 
#chains in the Genus database with same CATH topology
 4WFN Q;  1C0T A;  1AT1 B;  3DC2 A;  1HLW A;  5D3G B;  2YNI A;  1LW2 B;  2LLZ A;  2JDJ A;  2XG8 A;  1M1G A;  3CNQ P;  3HD1 A;  1H2T Z;  2GFF A;  3HHL C;  1PC4 A;  4DSL A;  1OO0 B;  1FKA E;  2KRR A;  3TJ8 A;  3H5Y A;  4K0K F;  2CXE A;  2K1R A;  1NB7 A;  3RYL A;  3TA1 A;  4QR2 A;  4DX6 A;  2MZS A;  4A48 A;  1S4E A;  4CZC A;  3T5J A;  4PXD A;  2BE2 A;  2GVD B;  3KJN B;  4DFJ A;  4IFY A;  1WTB A;  2HLT A;  4G6V B;  2XNR A;  2UU9 J;  4CI0 B;  1IKW A;  1FO1 A;  3CXC R;  3Q0A A;  2H5J B;  2WOM B;  3AB4 B;  1DHM A;  2B9E A;  3CD0 A;  2QJ3 A;  5AXN A;  1WKJ A;  1N32 I;  1FJE B;  4ZP8 A;  5KFQ A;  5K8N A;  5A2Q Y;  1U1L A;  1B62 A;  1DTQ B;  1O0P A;  2EC2 A;  3BN7 A;  4W92 B;  4AD6 A;  2JEI A;  3OJS A;  4AXI A;  4Q8E A;  2HS4 A;  3DLJ A;  1N88 A;  1FDB A;  2MLX A;  4R0J A;  3RG6 A;  2BYC A;  3BSC A;  2W4P A;  2XHC A;  3UVJ A;  4Z2X A;  4WTO B;  1Z0T A;  3QT7 A;  4RWX A;  1VQS A;  3WU6 A;  4TXS A;  2YWE A;  2L48 A;  2YWW A;  3T1Y J;  2LP4 A;  1SKS A;  4WUD A;  1RAA B;  2O01 C;  3K17 A;  3HJV A;  1EAY C;  1NKC A;  1YHC A;  3M8R A;  5KOW A;  3KRN A;  5KT5 A;  2G0C A;  1TL7 A;  4NL5 A;  2XO6 A;  1TUV A;  2NXC A;  5IM0 B;  1OJ4 A;  4YN3 B;  3J81 j;  1WEZ A;  4DR1 J;  2L9D A;  4UUX A;  5E7O B;  1DRZ A;  1H6K X;  2CNN B;  4LF6 J;  4G1P A;  3QWP A;  5DLG A;  2BAB A;  1GAO A;  3POT A;  3JAM U;  4A8Q A;  2EK6 A;  2G4B A;  3AOA A;  4HDG A;  4LF7 I;  2P6S A;  2XMK A;  1F0X A;  1HD0 A;  4OI3 A;  3M8Q B;  3MPY A;  2JJ4 D;  5KFE A;  1RB0 A;  4ECZ A;  1HNX J;  4TLR A;  1N5S A;  4OZ3 A;  3SDE B;  4F4X A;  4WYL A;  4AL7 A;  2ATL A;  2UUA J;  5BR8 E;  4LF9 E;  4NCG B;  1WUU A;  2HFV A;  4LF4 I;  1HQU B;  4TQS A;  3OHB A;  2YBV A;  1RBA A;  3BH6 B;  4CLF A;  4DU7 A;  2E44 A;  2GHV C;  5F8J A;  5ETO A;  3PKY A;  4MKA A;  3BKT A;  4K4Y A;  1IJE B;  2FY1 A;  1YJR A;  3AJD A;  1SBR A;  2FJA B;  2JT2 A;  2DRD A;  3FKB A;  1S76 D;  2XC9 A;  1S1V B;  2AP6 A;  4B3T E;  5KFZ A;  5IV3 A;  2OMO A;  1WG4 A;  2E1P A;  4A47 A;  4WXW A;  2OHD A;  2ILZ A;  2ZEJ A;  1YBA A;  3IS9 B;  1HQE B;  2QLJ B;  5A8W B;  2DXF A;  5ETS A;  4DV0 J;  5IT9 C;  4ES3 A;  2F5G A;  4WCE Q;  1SC6 A;  1TTH B;  1VJQ A;  3SQG B;  5CA5 A;  3FSI A;  1TQL A;  1XER A;  1GEH A;  2YPZ A;  2R7W A;  2FJB B;  2HBZ B;  1HBU A;  3ILL A;  1HHS A;  3JSY A;  1RAC B;  2YWK A;  5HMW A;  1SH0 A;  1X9S A;  3ULH A;  2HZV A;  3Q2S C;  4LPF A;  4NLQ A;  4CT9 A;  1GQE A;  1VRU B;  4DV0 E;  3Q86 A;  2B7C B;  1OPZ A;  1Z0G A;  2HG4 A;  2QL7 B;  4OI2 A;  2ZOG A;  3DHX A;  3SSQ A;  4HDH A;  4NYZ A;  2DHH A;  2Y0B B;  2ZJR Q;  4MU0 A;  2KXF A;  1I94 E;  4YB1 P;  2GNK A;  5DJB A;  5D3G A;  2HHH I;  4WXO A;  2GVZ A;  2E5I A;  4LBI A;  4ELV A;  1N5Y B;  4C4W A;  1U02 A;  5D15 A;  1JJ4 A;  4NCA A;  4ISA A;  2IOP A;  1WHX A;  2J6T A;  4BS2 A;  3ISZ A;  2Q2E B;  1N5T A;  3VR1 A;  3QRP A;  4JYA I;  3NWR A;  4X4P A;  2HWT A;  2XS7 A;  4QIG A;  5K14 A;  4JI2 E;  4PXB A;  3TVY A;  2XGQ A;  4N56 A;  4V1A k;  2Q6C A;  2RNE A;  3H4D A;  4DV2 F;  2ASY A;  5CH7 B;  4ZPA A;  3S7R A;  4QU6 A;  3PHT A;  4LFB E;  1MU2 B;  5CYQ B;  2PE8 A;  3L7U A;  1NSQ A;  3SEO A;  3FBC A;  2RKI A;  4JOU A;  3PJ9 A;  4LIW A;  4MIB A;  5KFB A;  2W8K A;  2J6U A;  3BSO A;  4C2M A;  2X3D A;  1GX5 A;  1MLA A;  2MKJ A;  4H4K C;  3EGW B;  3GIR A;  4XO0 A;  2XLI A;  2RQC A;  4YDD B;  3T1H F;  1R0A B;  5KFY A;  3VZI A;  3OSN A;  1FCA A;  2PO1 A;  1CJV B;  3M2R B;  5KG2 A;  5JEA E;  4JI0 E;  3R7B B;  2RIL A;  2MST A;  3I32 A;  3R7S B;  1IBK I;  3R5A A;  3I0R B;  4BWJ A;  4EI2 A;  4PWD A;  1R6V A;  3M8Y A;  2FLP A;  3NBP A;  1OYS A;  2E9Z A;  3PR5 B;  5IXU A;  4LRF A;  4O44 A;  3K58 A;  1HWI A;  1W25 A;  2VFV A;  2W2Q P;  4DFP A;  2W4C A;  3DLE B;  2C1E B;  4B9L A;  2KXH A;  2IBK A;  4QCL A;  3QGH A;  2JHE A;  1FWL A;  1S6Q A;  2HLU A;  2HHQ A;  2MQ8 A;  1NH8 A;  5LSO A;  1N32 F;  2CVE A;  1MG7 A;  3EM1 A;  3NNH A;  2AJQ A;  2O1W A;  2IIH A;  3H7H B;  1GMU A;  2VIC A;  4K4V A;  2M8H A;  4LF4 J;  3PX6 A;  1L3K A;  4NLX A;  5L38 A;  2PNL A;  2B5J B;  3NWG A;  2EW9 A;  3R5C A;  2ZBI A;  2NN6 A;  3DI6 B;  4Y2K A;  1W2I A;  3HVT A;  5IQ6 A;  4M94 A;  1QY7 A;  1Y0H A;  2W7A A;  1Q5V A;  1WHY A;  2MLY A;  2QLW A;  2W25 A;  3AHP A;  5SZT A;  3MAQ A;  1J5E F;  3ILO A;  2D69 A;  3M8Z A;  1WC0 A;  2VQE J;  1XC9 A;  5A2Q C;  4J3D A;  2ZWP A;  4M5D B;  4R25 A;  4TYA A;  3GYN A;  1RK8 A;  2BZ2 A;  4X4T A;  3LF0 A;  4JI5 I;  3CCW A;  4RW9 B;  1ZZN A;  3LAL A;  2IVM A;  4B3S F;  1HHT P;  4GKK I;  4DQS A;  5EL9 A;  2CWX A;  1RHR B;  2CQ2 A;  2LEA A;  5EX3 A;  1ZH5 A;  2M5Y A;  2IOQ A;  2DGO A;  1SB6 A;  5C24 A;  4DPU A;  2E66 A;  3BPS P;  4NML A;  3SZ2 A;  4ILL A;  4IH5 A;  2YKP A;  2MKY A;  2OLW A;  3A3N B;  3OPK A;  5B08 A;  4FW7 A;  1JLE B;  3M8S A;  1GTH A;  3MM5 A;  4DV1 I;  2IJF A;  1ZA1 B;  1FRL A;  1RHU B;  1M1K T;  3LNU A;  2LMI A;  3NBP B;  2UUC J;  1Q7Y T;  3FZB A;  1VQL S;  2GHP A;  1KKH A;  1N36 J;  2BA1 G;  2XYP B;  4ZVQ B;  2R2T A;  2LEC A;  2Z58 B;  5B0D A;  3H42 A;  3PW7 A;  3NMA A;  3CMA S;  2CZ9 A;  4DR5 F;  1NRK A;  4DX7 A;  3BO2 A;  1Q81 T;  3ZZP A;  4NAS A;  2HGM A;  2Y1R I;  2ALZ A;  2UUB E;  2Z57 B;  1S7I A;  2G2Z A;  4PYA A;  1DJ0 A;  1TP7 A;  3DN9 A;  3JS9 A;  4LSN A;  1FKO A;  2XYG B;  3D0I E;  3T1A A;  4X66 J;  1SIZ A;  4UZB A;  4IR1 A;  2PO1 B;  5DG8 A;  4DLG A;  4OJG A;  3E01 B;  3BQ1 A;  2M2B A;  3L9Z A;  3GG0 A;  4GKJ E;  1ZM2 A;  4YY3 J;  4MU4 A;  4RNF A;  3LPY A;  1WC3 A;  3RAX A;  1Y3K A;  2MDA A;  2NZC A;  2C22 A;  4Z7Y A;  4DSK A;  5HK4 A;  1MN9 A;  4CP5 A;  4DU8 A;  2CG9 A;  1FNM A;  1QAY A;  4H4M B;  3NGU A;  4CO5 A;  4X2B A;  5B0C A;  3UPF A;  3QBC A;  2X1G A;  1P6T A;  3VGU A;  3WC0 A;  4DL0 C;  3CD6 S;  4KJI A;  2HND B;  3GCX P;  1LWX A;  4DPT A;  2HYI B;  3ITH B;  3KJQ B;  2BM0 A;  1F5A A;  3MEK A;  3TNV A;  1RTI B;  5DDR C;  1U09 A;  2DEI A;  3GYX B;  2GO8 A;  4ETX A;  4UZC A;  5HMY A;  4AIM A;  1VR6 A;  5KAK A;  3V6J A;  1XNR F;  3IWN C;  4WFY A;  2UXB E;  1CQN A;  1CLF A;  4X4R A;  3LGM A;  2ZUA A;  1SKR A;  5IT4 A;  2WHO A;  2A2C A;  3IM8 A;  1B63 A;  4YY3 I;  2C3Y A;  2VKR A;  2DRB A;  4O3N A;  2J9C A;  5DGA A;  2GQQ A;  2DO0 A;  4TU7 A;  3VHQ A;  2CPF A;  3QT5 A;  1TL1 B;  3JB9 k;  2AEF A;  2KG0 A;  4F3Q A;  4KHP J;  3A8K A;  1DQ9 A;  3ADA C;  1FJ7 A;  2BOA A;  4ED2 A;  1JLC B;  2CQP A;  2QYG A;  2RH3 A;  1H7S A;  4OO1 F;  3JSM B;  1XMQ J;  5A8R B;  1HAR A;  2ZOM A;  3HX9 A;  1EAR A;  1RTH A;  2O5D A;  2MXY A;  3AOC A;  1PO6 A;  4M5I A;  3T1Y I;  1HQE A;  5A8W A;  1TV6 B;  3GJS B;  1Y5N B;  1JXV A;  2C3P A;  1KOH A;  1ZM3 A;  2XMM A;  3MPU B;  3ZTP A;  5A2Q U;  4DQQ A;  3OFE A;  3B8H A;  3SCK E;  1N36 F;  3MM9 A;  1HBM A;  4IFD A;  1YSJ A;  2JEA B;  4DV5 E;  1QDU B;  2VPY B;  3TAP A;  1RHY A;  5CQG A;  4ZCL A;  5BYR A;  1TK5 A;  2BMB A;  3I0S A;  3KG1 A;  1IBL J;  4DR7 J;  1PAU B;  2J0Q D;  2FVC A;  3ZTO A;  3HK2 A;  1OMS A;  3ONQ A;  4G1Q A;  5CD4 H;  2UXB I;  5KG1 A;  3DDI A;  1T8E A;  1N5Q A;  3KNG A;  4GRS A;  5B7W A;  4USK A;  2C37 A;  2BW2 A;  3M8Q A;  3N4W A;  5JUM A;  1VQ8 S;  2E7W A;  1WDT A;  3DOL B;  5EUH A;  5KFM A;  2LKZ A;  1NHU A;  1RLD A;  5D0G A;  1YIJ S;  4WZM A;  4MDT A;  4B3S J;  4DR4 E;  1LK5 A;  3WX4 A;  2MSS A;  2PMW A;  3RJM B;  4K5R A;  1U48 A;  2AV5 A;  2G2Y A;  2B6A A;  2C3M A;  3M2V A;  2IVF B;  3TZY A;  1U6Z A;  5IM0 A;  4BC9 A;  2A0F B;  4CLT A;  1TK8 A;  1UAW A;  1T9V A;  2V8P A;  3JAM Y;  4LFA F;  3AD8 C;  4ILM A;  4LRA A;  3F0N A;  4RL1 A;  3HD2 A;  3PR4 A;  1N0V C;  2HQD A;  2ZH6 A;  1IR0 A;  1NBE B;  3FVY A;  3KLF A;  1YRU A;  3KLI B;  4F26 A;  4QPX A;  5IC4 B;  5C25 B;  4C0O C;  5IZH A;  4OLO A;  3FBB A;  5CAB A;  1S0V A;  1EP4 B;  1XR7 A;  2VPW B;  3Q23 A;  2B43 A;  3FQK A;  1SQE A;  2PSZ A;  2KN4 A;  4WII A;  3CCR S;  2CVI A;  3I0S B;  4X64 E;  5C0X B;  4NLR A;  4C8N A;  3MUT P;  4RW6 B;  2YH1 A;  1X4B A;  1RP5 A;  1N32 J;  2KT3 A;  4ZN1 A;  3CCJ S;  5F41 A;  4I4B A;  1LWC A;  1SIW B;  1UW9 A;  4FW3 A;  2UXD I;  4ZP7 A;  5BYS A;  3VWS A;  3US5 A;  4O3P A;  3IWX A;  5KFN A;  4QR0 A;  2HQ3 A;  5DZ7 A;  5H9E J;  3GG1 A;  1JWW A;  1RWP B;  1VIS A;  1C1B A;  1KTV A;  2QO3 A;  4JUZ A;  1E6V A;  2HZA A;  4C0B A;  5F8L A;  2BR0 A;  5F9N A;  1BXN A;  4F2R A;  3NAH A;  4C9D A;  3N9U C;  3VAI A;  4G3I A;  4NCB A;  1NND A;  3L7O A;  1Y4U A;  4ZPW R;  5A8R A;  2HHH J;  2UV8 G;  4EZ6 A;  2J7W A;  3GON A;  2UVR A;  3MR3 A;  3PFE A;  1IKW B;  1U45 A;  4YS2 A;  1IR1 A;  1NDL A;  4X66 F;  2KH9 A;  4B3M F;  5JEA D;  2XMT A;  3NGK A;  3I87 A;  3R97 A;  2BE2 B;  2GVD A;  1KR4 A;  2F9J A;  1EET A;  2BVZ A;  2ROG A;  1AUS L;  3NGR A;  1PBA A;  1WF1 A;  4C6A A;  4F7V A;  6FD1 A;  3DHW C;  8AT1 B;  2R7Q A;  5FLX U;  4DZ6 A;  3KK3 A;  9RUB A;  3I56 S;  1NUE A;  3HO1 A;  4LVO P;  3RGI A;  5CCL A;  4LF6 I;  5KT4 A;  3T1H E;  5E33 A;  3J7Z T;  3FK4 A;  4F04 B;  1WF0 A;  1EQ0 A;  2HKJ A;  1J5E I;  1XN9 A;  3Q8V A;  2HVZ A;  3VF0 B;  4WFX A;  1YIT S;  5EKW A;  1U4B A;  1UVJ A;  3HDS A;  3TAN A;  2V6A A;  4DN9 A;  2JEG A;  4DV6 J;  3BKU A;  1RTI A;  1EX8 A;  4P10 A;  4EGL A;  2JLF A;  1FHT A;  1Z5B A;  3TZX A;  4LFB F;  4QNK A;  1OPI A;  3C15 A;  4RW7 A;  4DV2 E;  1XMQ I;  2HND A;  3DLE A;  4PG7 A;  2EPI A;  4QWB A;  3I9Z A;  1MMD A;  2GCF A;  3MM6 A;  3N6M A;  4JI7 I;  2IMO A;  3PRY A;  3SSR A;  3NCP A;  2P9C A;  4USV A;  4A8F A;  4FYW B;  5HBM B;  2PI4 A;  4ZLP A;  3ISN C;  5DRR A;  4WYW A;  2AIR B;  2JVO A;  1IBM J;  1HR0 E;  4IDK A;  2FVP A;  3AOB A;  2CJA A;  4NX9 A;  3TP2 A;  3MI7 X;  2MQO A;  3PKM A;  1J5E J;  1TKD A;  4Y65 A;  4JI8 F;  3AA9 A;  4GC7 A;  3BM7 A;  3MPV A;  3UC