4DXLA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
VSDWVPTGAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 97
structure length 304
sequence length 304
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4dxlA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dxlA01
3D4JA 4DR6E 1PIEA 3CWVA 1N36E 2UUAE 1WUUA 4DV5I 1DARA 4JI4I 1FI4A 2BM1A 1IBLE 4X62E 2ZITA 5FLXQ 4LF9E 2WW4A 5LMUI 4LF8I 4DR7E 1FKAE 1K47A 3OTOI 4B3RI 4JG4A 1H7SA 4DV4I 3Q1QA 2HHHE 4JI3I 4LFAI 1ZXNA 3B8HA 5IWAE 1N33I 4DUYE 4HACA 1XNRI 4DV2E 4DR2E 4JI8E 3T1YE 1Z0TA 1N32E 2UXBI 5IT9Q 4GKKE 3K1JA 2UXCI 2XEXA 4LFBI 1KTVA 2BM0A 1HNXI 4YHHI 4DV5E 4URLA 4JI4E 4HACB 3V2UC 3J7AG 4FN5A 5LMUE 4JI7E 2ZM6E 3ZZUA 1Z0EA 3OTOE 1IBKI 1EA6A 4UT4A 1KKHA 1XNQI 3J81C 1FWLA 3ZKBA 4B3RE 4RPFA 4DV4E 4JI3E 4WUCA 4LFAE 1N33E 1XNRE 4WUDA 5FLXC 4I3HA 2UUAI 4HY1A 2HFSA 3J80Q 4DV7I 2UXBE 1A6FA 4AQYI 2A2DA 4LFCI 4LF9I 4GKJI 2UXCE 4FWDA 4LFBE 1HNXE 4YY3I 4YHHE 2HK3A 4Z7YA 4DPXA 4DV3I 1N0VC 1PVGA 5BR8I 4M1KA 4DV0I 2V2VA 1Z0WA 5LMNI 4DV2I 5IT9C 4LF5I 4P52A 2LJPA 3QT5A 4PRVA 1IBKE 1XNQE 1N32I 1FWKA 2HKJA 1B63A 2CZ9A 3ZM7A 3J81Q 5LL6R 3PYDA 1MG7A 4USMA 4DV7E 2E5LI 4AQYE 2VQEI 4LFCE 4OX9I 4LF7I 2R42A 4GKJE 4JI7I 2ZM6I 5GMDA 1XMOI 4YY3E 1J5EI 3LNUA 2HFUA 4DV3E 4DV6I 4JI0I 5BR8E 3J80C 4DV0E 2VQFI 1Z59A 3F0NA 4DR5I 5LMNE 1FJGI 4LF5E 4DPUA 2X36A 3WU6A 1ZXMA 2V8PA 4DR4I 2OI2A 3B82A 1IBMI 4DPWA 4FWHA 1RREA 1NZ0A 1VISA 2Q2EB 2E5LE 1H73A 1NHIA 3PYGA 2VQEE 4OX9E 1ZM9A 4LF7E 5A2QC 3H4LA 3ZZ0A 3ZKDA 2AJ4A 1XMOE 4LF4I 1Z5CA 1J5EE 1B62A 4B3MI 5GMEA 4R1FA 3QT8A 1H74A 4DV6E 4MYUA 4JI1I 4JI0E 4JI2I 2VQFE 2UUCI 4DUZI 1H72C 1NHJA 4DR5E 1FJGE 1Z5AA 3ZZTA 4WUBA 1KIJA 4DR4E 4HYMA 1MX0A 1D6TA 2EFGA 4DV1I 3HULA 3LTOA 1IBME 3QT6A 1HR0I 1OJ4A 4KHPI 1Z5BA 4NXMI 2X7IA 2UXDI 1PKPA 4JV5E 3J7AM 1ZM3A 3WU4A 4UTGA 4B3TI 4JI6E 1FNMA 4JYAI 4LF4E 1BKNA 4X64I 4B3ME 3WU5A 1Z0CA 1I94I 5A2QQ 1NHHA 1XMQI 4JI1E 4JI2E 2BV3A 2UUCE 4DUZE 4LF6I 4X65I 1HNWI 3T1HI 2UU9I 4P7AA 4DPTA 4PRXA 1HNZI 3V5RA 1N34I 4JI5E 4PU9A 1XHKA 4HXZA 4KQVA 1UEKA 4DV1E 3PYFA 4DR3I 3JAMQ 1HR0E 4KHPE 4NXME 2UXDE 4Z7CA 4DPYA 2R3VA 4B3TE 2HK2A 4JYAE 1ZM2A 2HKEA 4X64E 3GONA 4DR1E 1I94E 4B3SI 1XMQE 1Z0GA 3B78A 4ZVIA 4LF6E 4FWGA 4X65E 1HNWE 3T1HE 2UU9E 4MYTA 2V34A 2ZBKB 1S16A 1HNZE 1EI1A 1U2RA 1MU5A 1N34E 4JV5I 4USKA 2NPFA 2UUBI 2V2QA 4EMDA 2A2CA 4JI6I 2F4VI 4DR3E 4FW9A 3PYEA 1Z0VA 4ED4A 3K17A 4DU8A 4X66I 2DEJA 1RR9A 4LF8E 1Z0BA 4NXNI 3JAMC 4B3SE 3LPSA 4JI5I 2VF3A 4K0KI 4DR6I 2J7KA 1N36I 2E1RA 4DU7A 1QZRA 1IBLI 4X62I 2UUBE 1ELOA 2F4VE 3M6AA 2GS8A 4DR7I 5L3JA 1N0UA 4DR1I 1S4EA 2V2ZA 4DXLA 4X66E 2HHHI 5IWAI 3WU3A 4DUYI 3QT7A 4DR2I 1H7UA 4XTJA 4NXNE 4JI8I 3T1YI 1ZM4A 2DEIA 4K0KE 4GKKI 1KVKA
chains in the Genus database with same CATH superfamily
2QC3A 5HQLA 1KP6A 1CULB 3JYTA 2HHPA 2KG1A 2DGWA 3TAPA 1DQAA 3I31A 1X8DA 4J9LA 2PO4A 4FXDA 3KOAA 1NDCA 5CA5A 4DV4I 3FSYA 3LP0A 3B8HA 4DL5A 2ZKTA 2R7OA 4O23A 1WJ9A 4B17A 3OL9A 2HFVA 3PX4A 1UDQA 5KFJA 2EWHA 4U8YA 1XNRF 1RHKB 3D0GE 3IBFB 3PRDA 1RABB 2BW2A 3UN5A 4B08A 2C2NA 2Q1LA 4CLUA 1NLKL 2KU7A 2XULA 3KJFB 3HSZA 2R7XA 1S10A 4F7VA 5L8RC 1S1WA 1REVB 5IXUA 1XR7A 4Q45A 1X5PA 1LWEB 4X64J 4KSEB 4NBQA 5A0YB 1J27A 4J9UE 2B6AB 3C14A 4B9MA 4EGLA 1OSDA 1HNIB 2J0SD 4ZK7M 4NI2B 1N0VC 2WAQD 2FVQA 1K8AT 3TUZC 1N6QB 2J6SA 2YKAA 4M5KA 1UCNA 1NSPA 2XTJP 2ZC4A 1T9WA 5SZTA 3ZM7A 1VLYA 1Q78A 1GXTA 2RRNA 3VQTA 1SXLA 4UF4A 4ZPWR 2DR5A 2PI5A 2GIFA 2VKRA 1L5UA 4Y2IA 3OL7A 1HNZF 1Y4UA 4QIWD 5A8KB 2AT1B 3M2RB 1Z59A 3EYZA 4J9VA 3W2VB 3GIIA 1GMUA 1IM4A 1F9HA 4YR3A 3J7Z5 1NH8A 5GAEI 4A8XA 4AL7A 1TKZA 2O5DA 2VC1A 3QBCA 1FDBA 5JXSA 5EN1A 1YIJS 1VRUB 4O3NA 2VQEE 2F9DA 4R1FA 3PKYA 2WOMA 2YTCA 3A8EA 4JI1I 4JI0E 3A1YG 3M6UA 4DWIA 2W9BA 1HWLA 1R8CA 3DYAA 4BBYA 4DR7J 3UVJB 4B3MF 2G0JA 4LSZB 1SUQA 4DR1J 3ENAA 1JLAB 4I2PA 3S6EA 5HJYA 5T7LA 2QA2A 2LEPA 1JX4A 3H90A 1VC0A 3UNGC 3KJNB 1G3OA 5EX0A 1SL2A 4WTOB 3DLGA 5HROA 2ZHOA 2EG1A 2FUG9 1N36F 2JE6B 1CJTA 2UUCE 2BE7D 4DS5A 3PACA 2A3JA 1R6YA 3CDUA 1IN0A 2ZH8A 3VTIA 1VQ7S 1HI1A 1RTIA 3WX8A 2L48A 4JI5E 2OTLS 4PU9A 3ZZOA 1Q81T 2VJVA 4DV4J 2RUGA 4DR3I 3P8BB 4H4OA 1HBOB 2Y0SD 2RF2A 3K57A 2R3VA 1HBMB 4B3TE 3CCSS 4MMOA 3QIPB 2LLZA 3ZZPA 2XG8A 1XMQE 5DQGA 1KR4A 3BZQA 1LXJA 1URRA 4IFVB 4H54A 2EBGA 3MR7A 1HNWE 2Y0BB 2OPRA 3BB5A 3DOLA 4J9PA 3MEDB 3TEGA 3B6BA 1JLCB 2CRLA 3H42A 4F67A 4FW9A 3PYEA 1RAIB 1Z0VA 1IKVB 2LXUA 3SDEA 1QTNB 3LOUA 4DF4A 1S6UA 4FYWB 2Z5CB 1SH0A 1Q8KA 1MSWD 2YY3A 2HFZA 4KV8A 4NMLA 2O1VA 1LW0B 3D9BA 3FBBA 2E1RA 2VPXB 2YQ1A 4FVMA 2KZZA 2UUBE 2IJRA 1U1RA 1ELOA 3DDIA 4TLQA 1Y5YA 1N0UA 3KLFB 2IAJA 2VG7A 3CDIA 1IWGA 4ZP7A 1VBZA 1S4EA 1SKWA 1FCAA 1Z1ZA 1A9NB 4WP9A 3M8RA 2EG2A 5CZXA 3WU3A 3SYZA 3OD2A 1H7UA 4KYZA 2OEJA 4PG5A 2IM1A 5D3GB 4YY3F 2XY5A 4KPYA 2Q6CA 5LL6d 4GKKI 2WNRA 4I0WA 2OPSA 3D4JA 1FK9B 3PIPQ 3I96A 1U02A 1ZPVA 3EGVA 5F0UA 3IBCB 2OP5A 2GC8A 3KMQA 3VF0B 3AXKA 3LP1B 1QAXA 3P3CA 1IKWA 3I0SB 4DDFA 3MUTP 2LXIA 2BE2B 3I0RB 3NNHA 3WZ0A 5G0RB 4DUYE 4MKAA 2DNMA 1XNRI 4QU7A 4O4GB 5C2CA 1J5EF 3CUNA 3BS9A 4JI1J 2F63A 2O1TA 1UVMA 2E29A 4ED3A 4ZVSB 4DL4A 4ZPVR 4FZVA 1GK8A 3GJTB 1I6JA 5AE3A 4A8QA 5KT2A 4LFBF 3M8PB 1U6FA 1HNXF 1N56A 1R6VA 3J81C 3ZKBA 4B3RE 5GMKa 4J9KA 3MPDA 1F9EB 4FKXA 2H3EB 2AYMA 1FD8A 4DL0C 3PFOA 1S72S 2V8VA 2QL7B 3PO5A 1OSCA 1NHVA 4IZKA 1JXLA 2UXCE 1NNDA 4FXVA 3W66A 1HHTP 2NN6B 4DV3I 5ITHA 1PVGA 1MWZA 1LV5A 1D8ZA 2CADA 4ETZA 2XYGB 2QGFB 1JKHB 2C42A 4DR3J 2YVSA 3QWPA 1Z2LA 4WCEQ 1WOPA 5BR8F 3GIJA 2LECA 2D41A 5C0XA 3TX8A 2QSWA 2Z5EA 4AQYE 4KO0A 4OX9I 2CQCA 4GKJE 5K36E 4JI7I 1W2IA 2KJVA 2PNZB 1QUVA 3UDVA 3QWUA 4C8OA 2FHJA 3Q24A 2HAIA 2MQNA 4K5SA 1H2UX 2O1PA 4GVBA 3EZ5A 4C8YA 1ZAVA 4CLYA 1SJ3P 2G1HA 1RT1A 3NL0A 4ED2A 1SKUB 3V6DA 3LGMA 1FRMA 4B02A 1HBUA 2PO1B 1PG5B 2E5LE 4X84A 4IS9A 1C1CB 3ZZ0A 3E8OA 2VDHA 4B3MI 4CO3A 4O3QA 4AIDA 4A8WA 4J9NA 4CT9A 4U3DA 1WF0A 3UDCA 2NXUA 4LUBA 2CJYB 4JI6F 2YKMA 5A8WA 3ICLA 4UUWA 4C11B 2ZDOA 4H4KC 2ZBIA 4P72A 1NK4A 4PR6A 3DGPB 3UQSA 4OHZA 5A6PA 2CVIA 1RJJA 3P96A 3CJ8A 1G6BA 1QTMA 4GKKJ 4BCAA 4AUKA 4IO1A 1TV6B 2HG4A 4KKOB 4RKUC 4JI2E 3DRPA 3M8YA 4OHWA 3VVUA 3THPA 1I1GA 3BQ0A 4NX9A 3HD1A 3SXLA 2CG8A 2CZ4A 2JEAB 2VASA 1KWMA 1RISA 4F2RA 4ID8A 2WTFA 4IH7A 1NK7A 4DV1E 3FFIB 1D1UA 2HGMA 1U0HB 1XNRJ 4KHPE 5BXIA 1HI0P 2WHOA 4OO1B 4OJHA 2IOQA 2D74B 1N88A 1ZM2A 3H40A 2MB0B 3NZKA 2VDIA 3W8PA 2CJBA 2VBXA 3SCKE 2FHOB 2RB7A 3PXGa 2X1FA 2UU9E 2M2BA 3N4WA 1RTHB 1FO1A 5KT3A 4K59A 4QNKA 1Y7PA 3MM6A 3OXGA 4Y65A 2A2CA 4JI3F 3GLJA 3MCOA 3T6BA 3GR0A 1XJWB 1WD6A 5DDOC 2BACA 4E8UA 4UUXA 1HI8A 2G1DA 3NY0A 1X4GA 2F4VF 3CC4S 3HJCA 4OX8A 3EXYA 1USUA 3FSXA 2IJNA 1RA7A 2WP8A 4DV3J 4JUZA 1HBNA 1BQMA 1M1KT 1OY9A 2J7KA 2DNQA 3FQLA 3T9NA 4RNFA 3SCIE 1QAJA 4RW9B 2BKPA 3ZZZA 2KB2A 3GE9A 2HQFA 1TL3B 2QA4S 4X66E 2AJ0A 4IRDA 3FQKA 4OX9J 3DOKA 2QEXS 4JI7J 2GVZB 3MCSA 2EEYA 3HMJG 2NXNA 1ZM4A 4HYKA 2HHHF 1BXNA 3KHRA 1AA1B 1PCAA 3MGJA 1HFEL 1EKSA 1ZTWA 2VL1A 1FI4A 5K36D 2L9NA 3BGUA 3MM9B 4ECXA 3CJKA 2E7XA 5CCLA 4WIIA 3EX7B 3SQGB 2ZH1A 1TMMA 4DV2E 4ZHRB 3OTDA 1KQFB 1RBOB 4B3MJ 1QE1A 5AXLA 1S1XA 4LFBI 5B0EA 3QZ8A 2AD9A 2ACYA 4QIVA 1HNXI 4ECTA 1S9FA 2F8HA 4NLWA 2R7TA 3OFGA 1IXKA 3H0PA 1Q7LB 1CLFA 3OTOE 1IBMF 5HBMA 4RPFA 1Q82T 2RDDA 3QQCD 2IESA 3DLEB 4W98A 3G8TA 1BUXA 2JEIA 2UUAI 2B0GA 3UDLA 3TAMB 2R8GA 2Q66A 1U1OA 5DDRC 1RA6A 3GCXP 5IOLA 4ES2A 1WTBA 3TWZA 2VA2A 5BR8I 3EUNA 3U1KA 1SCJB 3LANA 2VU5A 3W9HA 5CD4H 2VC0A 1HR0F 1RT2A 1XNQE 3IR6B 3FUYA 4USTA 2OJ3A 2XSJA 1A0OB 2VFRA 5KFHA 1JNRB 2F1DA 1T94A 4NLOA 3Q6MA 2IM0A 5IV3A 3LWLA 1WWHA 3GLLA 4K4TA 3HVAA 1EZZB 4LF7I 2JSXA 1JLGA 4F0KA 4IZJA 3CJ0A 3DLBA 1M5KC 1YJVA 2FJEB 2A0FB 4C2MA 4IUFA 2IRXA 4F25A 4B9SA 3OV7A 4FKYA 3QATA 1XMOF 2V8PA 1YJ7A 1VRTB 3G8QA 2JWNA 3NEKA 5IM0B 9RUBA 4PWUA 1DTQA 2LP4A 2MZSA 2WVEA 3MEGA 4DR4F 3TVYA 2DGUA 5A2QC 5GAHU 2RHQB 4DSEA 4F3QA 5GMEA 1X9WA 4DV6E 4PQUA 3QGIA 1NAQA 1VQKS 1NHJA 4Y2AA 5EHHA 5D0EA 2BOPA 3I4HX 3GSDA 4QZVB 4O3RA 1ZTTA 4NYPA 3V6KA 7AT1B 2HURA 4DUZF 2GO9A 5KFSA 1Q95G 2V69A 4EO8A 1RLCL 2XCPA 1Q8IA 1PKUA 4LRBA 3PHTA 3NRBA 1NDPA 1T9YA 2YX4A 1WC5A 1RAAB 1BMQB 4RUHA 4IFDB 3MECB 2YH0A 4RW6B 4X62F 1NB2A 2KXFA 1FJ7A 1B70B 3P3EA 3QJLA 3GSIA 3AD7C 3GQCA 1HWIA 4NLTA 2FVSA 4I6YA 1SV5A 5HP1A 3GPAA 1TU0B 4NXME 1RT3A 2UXDE 3VAFA 2C3YA 1YI2S 1N34F 5F0WA 1WKKA 3M8QB 2HHXA 2HNDA 3C15B 3BYRA 4OZLA 3W8GA 5KFBA 5KT6A 1M5SA 1FTRA 4LFBJ 4DR1E 3RB3A 3HVWA 1HNXJ 1SC3B 4J90A 1NK5A 3L7ZB 3MOZA 3K2YA 4MYTA 3TUJC 1JB0C 2HQGA 1S16A 4KR0B 2J7UA 3JS9A 2N4DA 1U1MA 1JIHA 2BA1D 4OZJA 2R7SA 2HQDA 3FEYB 2F4VI 3MMCA 3W62A 3DXBA 5DDQC 4ES3A 2ZZNA 2MQLA 2UUAJ 3CJ4A 1CVJA 5D8HB 4P6QA 5KFCA 4EU0A 1SQFA 3H1CA 1RWWB 3NGDA 2HWTA 2MJNA 3F41A 4CLFA 2UVRA 1KLMA 3H5UA 4XDCA 4U67Q 2AMCB 5E33A 5BR8J 2QYCA 2YKOA 1YRUA 1CS4A 4ED6A 4LVNP 1CJUA 4K2JA 1U1NA 1OYEA 4KQZA 2ASJA 1V5IB 3VZHA 2R8HA 1S9EB 2V68A 4NASA 2MKYA 2VPYB 2JX2A 4YDDB 2HHHI 1TP7A 5IWAI 2GMLA 4LR8A 4U7UD 4LF7J 3BF4A 3QT7A 2MQOA 4XTJA 3CC7S 2BRKA 3LALA 4PG4A 2C37B 4WF9Q 1SKSA 2PE8A 4K2XA 1XEZA 4K0KE 1MLAA 4DR6E 3KLIA 4YB6A 3RBEA 3DXSX 2BM1A 2B9XA 4C4WA 4MKYA 3RBZA 2MKKA 3A3PB 5KFTA 1K47A 4A8SA 4NLDA 1R8BA 4AD6A 2HHTA 5ETSA 3ENQA 2COLA 4QU6A 3PJXA 2DH8A 1RZMA 1ZA1B 2DNHA 3W5YA 5JEAE 4KPCA 1S0MA 2G0CA 1RU1A 2GO4A 1T03B 3HKWA 4CLZA 2A18A 1Y0HA 1U6ZA 5AJ3F 2VJUA 2V9WA 5EWFA 4TVAB 3Q2TC 4FS1A 2AEFA 3G6ES 2JEFA 2VPZB 3L7OA 1CBKA 2MKSA 2C2OB 3R27A 5ETRA 3V2UC 4HT7A 6AT1B 4FN5A 3SSQA 1SC4B 2HNZA 1EA6A 4IOBA 2HGNA 1G7CB 1IR1A 1LWCA 4C3LA 4WUCA 3NCRA 1MMDA 2XWYA 4ZVOB 5SUHA 3V4MA 3J7YU 4I67A 3MOJB 3KHGA 1U24A 2FY8A 4FWDA 5DS7A 3H2UB 1PBAA 4TN2A 4Z7YA 4B9VA 3D0HE 2DITA 2VKZG 4QWAA 4PWWA 3CD5A 5IT9C 5E7OB 2AEJA 4QBUA 2KM8C 4DX5A 1IBKE 2LXFA 4CYUA 1CJVB 2GX8A 3K85A 1MMLA 3MF5A 2IBKA 2VV5A 1FTCA 1S99A 1MROA 5G4DA 3M30B 3ET6B 1FNOA 1FEHA 1NH7A 4OV1A 2D9OA 2J6UA 1I94F 2B4UA 2YNIA 2ZUGA 2O67A 1X0FA 3WX4A 1XMOI 4G65A 4CRJA 2NUUG 3UPFA 3Q89A 3QJJA 2CQDA 2HQ3A 3F0NA 4EI2A 1KS2A 2YNFB 2F4VJ 2HVHA 2Z5BB 4DR4I 1ZS6A 1CSJA 3X1LB 4JI0F 4HTIA 2R8KA 1FRIA 4O3OA 1B7FA 1F1BB 1RREA 1T05B 1H73A 3AQPA 3HVTB 1PJ5A 2E1PA 2DR7A 3HFVA 4TU9A 4WFBQ 1S12A 3OTCA 2ZFHA 3MHYA 4DUZI 4PUOB 3MM5A 1KHVA 3MMBB 2B8QA 1KIJA 1MU2A 2GQQA 3LP2A 3CF5Q 2EKNA 2XI2A 2R7RA 2UUCF 5J1NA 2HHHJ 1C0TB 2GHPA 5IWAJ 1T02A 1OJ4A 4FW6A 3CGIA 3HHDA 3NS7B 1PKPA 1HHSA 2KT2A 4EYHB 4JI5F 1Q0NA 3I6PA 3G4SS 3PO4A 4UY85 3D6MB 1E6VB 1BKNA 1FERA 1HKAA 4UZCA 2AV5A 1RHRB 3R7BB 4CNZA 1U45A 1IBLF 4B3TF 4CM0A 2E7VA 2ZC3A 1E6YA 3MPVA 1N34I 4J9OA 4DZDA 2EFNA 4EZ9A 3RU0A 4M5DB 4CTAA 2K3IA 3ETMA 4AT1B 1HNWF 2NYIA 3ZTOA 1SL1A 3RRHA 4LJMA 5CQGA 4Z7CA 1YHQS 4OJ1A 5IV4A 2IDLA 1MW7A 3NXZA 4JYAE 1OYDA 1S1VB 1KDNA 4HHHA 4USUA 1VOMA 2JOQA 2Y9HA 4R8UB 4LF6E 4IDKB 5F9LA 2QZ8A 4G1PA 5JEAD 3MM8B 4DQPA 2Z8QA 4WFAQ 4DF8A 2FD2A 2PFFB 1EI1A 2V6AA 3LO3A 3V81A 4CH0S 3GIRA 2JH3A 1W2BR 1CC7A 4WYLA 1FKPA 5HVGA 4EMDA 4RW8B 5A8RA 1DQ9A 1D9DA 2G2ZA 2M4MA 3TR5A 1TZ0A 1MWYA 2D7SA 2BX6A 2FJWA 2UUBF 5DLFA 5M2RA 3D5MA 4ED0A 5CH7B 4K4VA 3LPSA 1X5OA 3GCWP 2DO4A 1OS5A 2MMYA 4ID5A 3PW7A 3H2LA 5LM7E 2QJ3A 2H51B 4KTQA 5HN0A 4B3OB 2WW8A 3MFIA 1U25A 2WVCA 3IMQJ 3WDOA 2BKNA 3E01B 2B43A 1CULA 2DISA 3RW7A 1LQ9A 1UJ5A 1X0PA 2H65B 2DY1A 1RACB 5KFFA 1XMOJ 2MZJA 4OZ2A 2VOPA 4NCBA 1T95A 1B0TA 1L3VA 4LF5F 4A8KA 4FF4A 5KAKA 3KJQB 1HYSB 3BSAA 4DR4J 1JLEA 2WW4A 3CCMS 4GRSA 2D3OR 3W2WB 5L1JA 4LQ3A 2A1BA 2I5JA 2QRRA 5K36B 4OL8A 3DM2B 3U1YA 4KGMA 3SBMA 4DR2E 5HLFB 3BH7B 4AE5A 2ZOFA 3OFFA 3T1YE 4HI1A 4K4YA 3H98A 3NGRA 4DUZJ 2E1CA 3VAGA 4K4WA 1EETB 1IKYB 4Q8EA 5KFRA 3GYXB 1ZZNA 4JI4E 4HACB 1YH8A 3KLGA 5A0YA 4JI7E 3ZZUA 2UXCF 2K1RB 4UT4A 1ZA2B 4I7FA 3SEOA 1UJ6A 3P76A 1N6QA 3LWMA 2ZOGA 1ZAXA 1Q8LA 1NKEA 1UKUA 3K5PA 3PW4A 2DH9A 1PYTA 3PS3A 1S97A 3EPIA 2PT0A 1NPRA 4DPXA 4WYWA 4O3SA 5B0BA 1N34J 4AQYF 2MY8A 5L1LA 1CPZA 3PR4A 5C0XF 1FWKA 1I51B 4A46A 2V8GA 5E3QA 2XSFA 5I3UB 3M2RA 1CJKB 4XTTA 1D9AA 3BM7A 3W2VA 3CJRA 4USMA 4ZN1A 2IMOA 3KRNA 3BGFA 2I0XA 3QJPA 2VQEI 4LFCE 2VFSA 1GTEA 3DD6A 4PKDB 1WF1A 4ELTA 4KFBB 4F4AA 4C8LA 4JI0I 2E5LF 2PA3A 4V19X 4C0BA 5D0RA 2CPIA 2MSSA 1LXNA 1PO6A 4WU2A 3C2PA 3PNIA 2F5GA 2C3PA 3IM8A 2X3DA 2IRYA 2G9OA 1YX2A 4P10A 2CFXA 4B3SF 3Q83A 3UVJA 4EO6A 3OFHA 2OSQA 2IM2A 1J5OB 4QWDA 4MYUA 4CO5A 1VJQA 3DC2A 3TEHB 1MNEA 2VQFE 2UUCI 1NSAA 4MU3A 1Z5AA 1Y10A 5KFZA 2PD1A 1YBTA 4LMZA 5EGYA 1TK5A 1W7WA 2E9ZA 2CG9A 4ETXA 4NLGA 3LTOA 2B8PA 2CNLB 2LFVA 2MHEA 1OY6A 2MJUA 4YR0A 3CCUS 2QLFB 3F56A 2WONA 1S1TB 4B3TI 4HHJA 1M1GA 4O4RA 4N7TA 1ZETA 4LF4E 3BV8A 5DNXA 3WU5A 3CCRS 2FZKB 3PEHA 2XM3A 5KFLA 1XMQI 3KLVA 1RT4B 3OR1B 2MKHA 4LOMA 3ZZRA 1HNWI 4FW5A 2XB2D 1HBMA 2RIJA 2YWFA 3P06A 3QIPA 5I42B 4J91A 5DM7Q 4Q7AA 2PNLA 4HXZA 4QWBA 1ROFA 1R7IA 3N6MA 3M32A 1CEZA 4Y34A 3MEDA 2M5YA 5LOQA 4C3KA 2MLYA 3L4BC 4RNNA 1KQGB 5CAAA 1IKVA 4A8YA 4NLSA 2ZJPQ 1TVRB 2CA9A 3T1HE 1L3UA 3U7JA 3M7NG 4KAIA 5D78A 1HNVB 1Y5IB 3MR2A 2A6MA 2UUBI 2EI5A 2H5IB 3ISNC 3UCUP 1O8BA 1VS3A 5K8OA 4N56A 4EBCA 4U7CA 1RU2A 5D4PA 1TL7B 3BPDA 3ADAC 5D77A 1WELA 3EZOA 1UDNA 3JAMC 3CJQA 2AHOB 4X66F 2OFHX 4Y0FA 4Y2KA 5KFYA 3W1YC 4Q0BB 1M1HA 3BGRA 2DHSA 2ZWOA 2JLEA 3DLKB 3T3FA 4OI6A 5JUMA 4NLXA 1HA1A 1SJRA 1VBYA 3T41A 3DRRA 1IJEB 1FK9A 1NPKA 1U1PA 1WKLA 3W9IA 1LFPA 4DUYI 2VQEJ 5FLXU 2RU9A 3I0SA 3QLHA 2OSRA 4KB7A 2KO1A 2OUGA 4JI0J 2BE2A 3I0RA 4DV2F 2UUAE 4O4GA 1S48A 1OY8A 2W2PP 4MDTA 3D2WA 1PYSB 2VUGA 3DRSB 4B3RI 3MTJA 3MMAB 3SMZA 1TKXA 3NP5A 1WTFA 5DQIA 1FRKA 3HPOA 3OTOF 2EC0A 1R0CB 1WC0A 4HDGA 3AFGA 2UUCJ 2UXCI 5KFWA 4F50A 3FZBA 3TA0A 4CNYA 5JVGQ 1HQEB 2BOAA 4CLPA 1S6QA 1XIQA 3W9JA 3DOMB 4ZPCA 1FESA 4MTPA 4F4KA 2GCFA 2YPYA 1B3TA 2OFGX 2YKPA 2DT9A 4F36A 2L41A 2KYZA 2ZDPA 4MIAA 3EXCX 4B3TJ 2OPPB 2C39B 2EKYA 2ZWPA 4DBQA 1XNQF 4L72B 5B09A 1JKHA 4YDXA 4CCHA 4AQYI 1XMQJ 2NN6E 4IH6A 1F5BA 4GKJI 2KJWA 2CWXA 4IO9Q 4IQMA 4MH8A 1HNWJ 4F8RA 1WEXA 3J81j 2JL9A 3J81U 3PX0A 3WBZA 3HHLD 1FRXA 2IC3B 2BKOA 5HQMA 1EHWA 5DGAA 2PNZA 1P8GA 4ELVA 1GNKA 4UOHA 4BLGA 2E5LI 1LFWA 1XK8A 4X4QA 3TVKA 1AT1B 1KFDA 1Y3KA 2PSZA 3A8IA 2V4RA 4GVLA 2AJQA 3CCVS 4LRDA 2PO1A 1U8SA 4KC5A 3HFZB 1SQGA 1L3TA 2UUBJ 3GZ7A 1C1CA 3BO2A 1PGZA 1U09A 2LQJA 2BJ7A 4DV6F 4CIOA 5DZ7A 1SC1B 2DY9A 2KFZA 2DO0A 3Q86A 4NMXA 4B9UA 3LP0B 1QJHA 2RQCA 5U47A 3BSOA 2CQ2A 4XPEA 4N8OA 2BQ3A 2KXNB 4C11A 2MGZB 1APSA 2V63A 1GH8A 3D0IE 3J80Y 1RWMB 1LK7A 2UVVA 1TK8A 1HL6A 4JI2I 3UD4P 1BE4A 4RU9A 1FJGE 5D4OA 3GCMA 2DNLA 2OH2A 3JTOA 3MCNA 1WC1A 3VALA 2EFGA 4KKOA 3KG4A 2POKA 4IOCQ 4DV1I 1FWPA 3MEEA 3THTA 1JK9B 3IS9A 4DUYJ 2ZBPA 4KHPI 1RAEB 4DL7A 3BQ1A 1EQ0A 3CB4A 2JEAA 2VG6B 4PXBA 2F7VA 2MQPA 4NXMF 5GVQA 1U0HA 2K7JA 1M5PC 1FHTA 2PA8D 3UHMA 2UU9I 4OO1A 3ULHA 2RQKA 1XR5A 4DR1F 2VESA 1S6PB 4BS2A 4KQVA 4B3RJ 3PM9A 4ER8A 3CCLS 2P9EA 3P3GA 2YX7A 1QSSA 3H5SA 1RTHA 2VD3A 3ISZA 3N5FA 3UO0A 1RAJA 1JMTA 3GONA 3JQJA 2UXCJ 1UWBB 4YFUA 2WB1D 4QR1A 3QYYA 4LRAA 1YJUA 3K59A 2JFKA 4TKTA 3P5TL 4FF2A 3ZNJ1 4NYZA 2LA4A 4ATNA 3ETOA 1Q8BA 2ZVIA 4DL3A 5JEAB 2QMUB 1UP1A 2W2NP 4ED4A 1X4AA 5D0HA 3SZ2A 2XYPB 3KTQA 3A4TA 3G96A 4X66I 3PIOQ 1E3PA 1RR9A 2DHHA 4AQYJ 3J7A1 1D9FA 3DDNA 2EK1A 5H9FJ 4GKJJ 4RW9A 4Q43A 1Z0BA 2C3UA 3I9V9 3NWRA 2W9CA 4ZDNA 1HW9A 5ELWA 1UPPA 2MLXA 2DXFA 2JEBA 2DNPA 1YBAA 3PTWA 3GV7B 2WOMB 3KK1B 1F60B 2B7BB 1RK8A 1TL1B 4UOGA 1TAUA 3DKDA 4DU7A 2NN6D 3L7UA 3HK2A 3OQ2A 2SXLA 1JWWA 4K0KF 2NXJA 3HX9A 5L3JA 4MU4A 4DR6F 4AIMA 2FLPA 1FDAA 2E5LJ 2HHQA 3JSRA 2HS3A 1WC4A 1OMSA 1HQUA 5DG8A 3MM9A 2HQIA 1R43A 2UVWA 3KLEA 3DLGB 5HROB 4W90B 4NWBA 1Y4SA 5JEAF 3QO9A 3GV8B 2EXUA 1S59A 4ZHRA 3OT9A 3JSYA 1RWOB 2GJIA 2YKQA 3CIMA 2DCLA 4IKAA 2PEHA 3H4DA 4LF8I 3IC1A 1RTIB 4FYXB 3OTOI 4P2XA 1H7SA 4H4OB 2E1MC 3N79A 3MXHP 1ZXNA 1JJHA 3G86A 3UWTA 2VFUA 4JI8E 1U0SA 3GFHA 5IT9Q 1YGYA 2QIFA 3W63A 4JI2J 2AW0A 4ZPBA 1RKJA 4IYQA 4WWSA 4KGZB 4HKQA 1IBCB 2Y1IA 2BABA 4HLBA 1U2FA 3FEXB 3J7AG 2CQBA 3DOLB 1TTHB 4AXIA 2W2QP 4DV1J 4DCPB 2YWHA 1XNQI 4KHPJ 2VBWA 2QA4G 4LFAE 1PAUB 1SC6A 5IS2A 1IBKF 4RLEA 2LYVA 3GU0A 2DPIA 4JI1F 1X4EA 2DR9A 2KN4A 3SSSA 2UU9J 2EC2A 2VODA 4I56A 2QG9B 4PG7A 2RDJA 4ZP6A 1HK7A 1XMBA 4ED5A 2N7CA 4P52A 5KFNA 1N32I 5EL9A 1UMJA 2FHMA 1X7VA 5KFXA 1T9XA 3GG1A 2ZH7A 4RBTA 3GJSB 4PG6A 2Q3PA 4NLUA 3I56S 2VHGA 3AD8C 1OYPA 1S0NA 4F26A 2ZM6I 1VRTA 3U1MA 4ZVUB 2RILA 5F8GA 3LNUA 5IM0A 2WNRB 4NA3A 4DV6I 2OPSB 2DHAA 3W5ZA 4DV0E 3GYGA 5FD1A 2KYXA 3WU6A 2ZD1B 4J37A 1VBXA 2MQMA 4DHVA 4P7TA 3Q8YA 2D3UA 4X66J 1P1LA 3R5JB 3MFHA 2BA0G 3R6LB 5BYSA 1VISA 3KHHA 4QWEA 1USVA 3IXQA 3I9ZA 3PYGA 1NJYA 4ERDA 4NCAA 3H4LA 2AJ4A 2N3OA 4TU7A 2ABYA 2CJKA 1N5YB 4Q44A 2K8GA 2CQ3A 3L95X 2PMZD 4I2QA 2HSEB 3KJVA 1F2GA 5A2QU 2HFNA 3RR7A 3NNAA 3MECA 4RW6A 4NXMI 3U1NA 3HJVA 2UXDI 4ZVQB 4NEYA 2YNHB 3Q6NA 1QVGR 1YRTA 4IFDE 1K9MT 3ILOA 1FNMA 2PMWA 4DX7A 4DS4A 2JVRA 2XHCA 1WORA 1AXQA 2Y8YA 5DDPC 4M94A 1R27B 2XI3A 3M8QA 3TAQA 3C15A 4LF8J 5M2PA 3FCVA 2C2ZB 2WVFA 2AYBA 3OTOJ 4R0JA 4LF6F 3PYFA 2NR0A 3L7ZA 4U7UK 1UA0A 1QAYA 1NHKL 2LQ9A 1J2VA 3FKBA 5IC6B 4OZ5A 3KK2B 2B5JB 5IT0A 4DPOA 4GKKF 1R8HA 3OVAA 1IWAA 3IRXA 4RNMA 1HLWA 3DLLQ 5KFQA 4A47A 3OL8A 1LWFB 1Z0GA 3CWJA 1A6LA 4IG0B 1NSQA 3NBPB 2WBMA 1HNZE 2W9AA 1U2RA 1FRJA 4GVBB 2YPZA 4URSA 1XNQJ 2GA7A 3CCJS 2FY1A 1RHJB 3EZUA 4N3OA 2KI2A 3M8SA 2XNQA 2B7CB 4CLLA 5FIIA 4UY8T 3DMJA 2R7VA 2NCKL 5KG1A 5GAGI 3H25A 4F2SA 2IFXA 1EX8A 1IJFB 2ASYA 2AX1A 2M3DA 3SQOP 4ZVTB 2ZHAA 2VF3A 2KM8B 3HI9A 1UVLA 4K0KI 1R0AA 2C2KB 4HH1A 5J1PA 2HBQB 4DR6I 3SIPB 1YKWA 4WPAA 1QZRA 4A8OA 4DFJA 5A8WB 1N32J 2RKIB 4K7QA 3RRKA 3TJAA 5FJ4A 2DRBA 4X4OA 4NRUA 1PJ6A 2WRMA 3N28A 4IRCA 1AYEA 2WBRA 2YNGB 2ZM6J 3FBFA 1F2HA 5GADI 4ZA1A 3BQ2A 4DV3F 4DV6J 1UVKA 1PC4A 4LBIA 2ROEA 1FKOB 3DRPB 4LCFA 3S1TA 3PDNA 1N36E 4LSLA 4YOEA 3T1YF 2VONA 1I5OB 4J9RA 3GILA 3I5BA 2NPIA 2KDOA 2QLJB 4JV2A 4OJGA 4YQWA 2Y1RI 5J1EA 1Q86T 1RTDB 4OX9F 2J9DE 4ZITA 3OXFA 4JI7F 1UFWA 4ZJLA 5ADZA 1S7HA 1UETA 2IVFB 1UA1A 2ZH2A 4MK9A 4ECQA 1NKBA 3TA2A 2BM0A 1R8AA 2CPJA 4R25A 3DFEA 4DI6A 3KK3B 3RAQA 1SB6A 2F8MA 2FZGB 3NOGA 4ECVA 2HHUA 3UW1A 4R5PA 4KT0C 1XXEA 2XZWA 2PN6A 3P3DA 3MM6B 2BANA 1DHMA 3PS1A 2KRBA 1IBKI 3H20A 3PW0A 3H59A 1WF2A 3PCOB 4NXMJ 2UXDJ 1WI8A 1H98A 2O3ZA 5I4MA 3Q23A 1SH2A 1CJVA 1K0TA 5C24B 3ZC4A 3M30A 3ET6A 4Q2MA 2DNYA 4IFDD 1HBNB 1BQMB 3HZGA 2PO2B 4XAKA 4CLSA 4DMZA 1OQ3A 1LEOA 2OPQA 4RW4B 2DYAA 1G2EA 3HHLB 2VB6A 4F0MA 3PW2A 4X4UA 4I68A 3PYDA 1R0BG 2ZBCA 4DV7E 1CG2A 1X9MA 2Z2ZA 3DOKB 1KHWA 1GT8A 2KRRA 2XMVA 3W64A 5IT9U 3DNCA 5GMDA 4YY3E 3KUHA 1U2CA 4RBVA 3JQMA 3CTRA 1T05A 5HO4A 4DPUA 4OHXA 2C3MA 2ZUAA 1B7YB 5CD4A 2MY7A 3H8YA 3B82A 2CNNB 4WFZA 2M7SA 1KC8T 4DSIA 3T6JA 2VQFF 2XNRA 4OYOA 3BKFA 4OO1C 4PUOA 3HZEA 4G1IA 1FJCA 3NNCA 1NUEA 2MKIA 4G6VB 3CSKA 3T5KA 1KD1T 3FBCA 4K0KJ 2C38A 1Z5CA 3CCZA 1J5EE 4RR5A 3C6TA 4DR6J 1C0TA 1IR0A 3C19A 4LIWA 4IG3A 3QGPA 1VHFA 3CDAA 3RB0A 2Z2MA 1E6VA 1UZDA 3R8YA 1YWXA 2APOA 4CZCA 4PAAA 5IQ6A 4DX8H 4NZ0A 4LCHA 2MKCA 1S57A 1OQ6A 5T14A 4DL2A 4JYAI 5HATA 2AF6A 2EPIA 4M5DA 2MQQA 2JNJA 1UW4A 1GX5A 2LMIA 4LF6I 4BDPA 3EM1A 3PEJA 4F04B 5L39A 3JAMY 1S1VA 1VI7A 2RSQA 2YX1A 2W1BA 2R7QA 4R8UA 2AZ1A 4IDKA 3JAMQ 2XSJB 3MM8A 5MAOA 3UR3C 1VQMS 2QFJA 3H7HB 5EUHA 2JLFA 3RBXA 3IWLA 1GTHA 1K0VA 4M5NA 3W3SA 2PDAA 1JLGB 1JLBA 1RBLA 2LU1A 2IIHA 2M0GB 3G87A 5I3QA 3BBCA 2Z2YB 4OZNA 4ECSA 2W7AA 3C6UB 4PG8A 1P9QC 3CD7A 1IBKJ 2ZHBA 1RTJA 4NA2A 1MWQA 3PKMA 4IH5A 3D6FB 3MAQA 5ETQA 1N5QA 3AB2B 1SJQA 3JTPA 2K3KA 2CJQA 2MHNA 4XK8C 2AGPA 1DTQB 2WSFC 1WG4A 2BE9B 3WIVA 1YJWS 1NB7A 1URNA 4B3OA 1SKRA 5E3PA 4A4JA 5K8MA 3EJMA 3ITHB 1FFGB 1G1XA 3AD9C 4FS2A 2VZ9A 3B54A 4PABA 1TFYA 2HRTA 3VHQA 4JP8A 1NK0A 3HSGA 2CUYA 2V67A 4BA2A 3BKTA 2UUAF 3NCPA 3OLBA 5AT1B 2RD5C 4PCQA 4EUVA 5DJBA 4DR2I 4TQRA 1C2PA 4QNJA 2E44A 3T1YI 4ILMA 3R5CA 4ZS6A 2DEIA 3AODA 3Q8PB 1KVKA 1VK8A 3A12A 2L9WA 5K36A 1X9SA 3D28A 4CO1A 2DJWA 5HLFA 4CDIA 5EKWA 2DCUB 4JI4I 1FXRA 1BLUA 5KFOA 3UN2A 2YWWA 3NMAA 2GVDB 4OYAA 1SV5B 1FFSB 5CCMA 1IKYA 3OXLA 1RHYA 3TA1A 3LAMA 1DLOA 1RT3B 3QPIA 4HACA 4LF7F 2WZ1A 5KT7A 4LF1A 1JLFA 3PX6A 3IM9A 2HNDB 1GMWD 2K1RA 5KG3A 2AJFE 1S76D 1KTVA 3HFKA 3CCTA 5MLCV 1FRHA 2IYGA 1DTTA 2WCXA 4NZ6A 2NN6F 5LMUE 2JLGA 4UOFA 2ZH6A 1P27B 1S0OA 2CQ4A 3BBFA 5ETKA 3M9MB 4BC9A 4TY8A 4WE1B 1C4CA 2Y1LB 2W01A 3MMCB 1RWPB 2AYEA 4JI3E 3Q8SB 2MXYA 2RRBA 4FBTA 3MD3A 3OR2A 4JYAJ 3POTB 2YQ3A 4HY1A 5CYMB 1TFWA 3W7BA 2J9EA 4LFCI 4LF9I 1ULRA 4LF6J 2XY6A 2O3DA 1TKDA 5I3UA 2DGQA 3D6HB 2ZNZA 2HK3A 4ISAA 4ANCA 4M1KA 1Z0WA 1NZAA 1GMVA 1CJUB 4ZLNA 1Q5YA 3R7NB 2HKJA 5BYRA 4DN0A 1TELA 2P9GA 2ADCA 5K5MA 5BYQA 4IR9A 1B0PA 3KNAA 2DGTA 3SI8A 2N7YA 3B4MA 3N6LA 2OMOA 2M8DB 5DZ6A 2V4JA 2YKNB 3UNYA 4D3GA 2KZMA 4O44B 4RW7B 2VQFI 1AFIA 5J2MB 2RAQA 2GFFA 4F3OA 2X36A 1VQPS 1J5OA 5IT4A 5K14A 1XERA 4MT1A 4HHUA 1EIYB 4QYZJ 1FJGF 3LW5C 2FJDB 3ILLA 4J9QA 3CDJA 3SFUA 2RS8A 2G13A 2AGQA 2VIHA 4M5HA 1U1QA 8AT1B 4LF4I 3M1VB 3NWGA 4IFYB 3MAAB 2ILYA 4ZVPB 2GMJA 4ITSA 4WUBA 4PPZA 4WXWA 4LREA 1U1KA 2R2TA 1T9UA 1LW2B 2QL5B 3OR1A 2RJZA 3KKFA 1LWCB 1IBME 5ETNA 1AB8A 4C8ZA 3P6YC 5EWEA 4DR2J 2BVZA 2HVIA 1D09B 4KIAA 2QN6B 3J7AM 3T1YJ 3KUGA 5I42A 5HQ8A 1WOOA 2Z0GA 4OO1F 2LCWA 5T41A 4LT6A 1HW8A 3G6VA 4WZMA 5CYQA 5ETMA 3UN3A 4JI4J 4RBUA 3T1HI 1H2VZ 4GO7X 4PRXA 3LAKA 2JC0A 1Z4UA 2ASLA 3T1AA 1UEKA 3WC2A 5IZHA 2MQ8A 4CYUB 2J5AA 5IWAF 2KH9A 1HR0E 4ES1A 4XPCA 2CQGA 2CNKB 4TLRA 1S7IA 2EW9A 2ALYB 5ETTA 3TRGA 5DO2A 3LGHA 5KOXA 3Q22A 4LSNA 1P1TA 5H1SV 2YNIB 2XYHB 4Y00A 2K06A 5FDLA 2IY5B 2LKZA 3QSYB 3MR5A 3V6JA 3TW0A 4JOUA 4DJBA 1TL7A 5KTQA 3Q8VA 3RTVA 2K7KA 4PWDB 1BQXA 4N77A 1XN9A 2NPFA 2LQ8A 3PRBA 4WP8A 2QLXA 3GFZA 1RBAA 2DIVA 5F8IA 1QY7A 4L76A 4DU8A 5J2PA 5IQQA 4LF9J 4LFCJ 4LF8E 2PI4A 1HD0A 1OYRA 4FDFA 1A7GE 2FB0A 2ZBRA 3C16A 1EP4A 1FE4A 4I4BA 2ZJQQ 4KH0B 4BA1A 3MM5B 1KBRA 3HM9A 1FF2A 1TAQA 1BQNB 1YK9A 5ETVA 2IERA 1YJRA 1T0TV 4A8MP 3A8JA 3QRQA 4ILRA 2GAGC 2BR2B 2W4DA 4U8VA 1TR0A 1WEZA 2WB4A 3D66A 3PHEA 3VAKA 1WG1A 1NMEB 2AP6A 1UAWA 2M8HA 2QMWA 5C42A 4FF3A 2VQFJ 5I3PA 2W7PA 4LBHA 1PIEA 1FFWB 4JI8F 1IUJA 2P6TA 3M05A 4X62E 2ZITA 3Q8UA 2HGLA 2HZCA 1WDTA 4QW8A 3RB6A 2ATLA 4LPFA 2CPYA 2XS7A 4CTAB 5GAEU 1SQEA 1RI7A 1KVJA 4LF4J 4M5GA 3MM7A 1N32E 4E98A 4ECZA 2AJ2A 4LFAF 1JXVA 3DLJA 3RAXA 3HSDA 1JLQB 5HANA 2OPPA 4OFZA 2AYGA 4H4MB 3OBIA 2C39A 3WC0A 3AA9A 2ZH9A 1GQEA 1Y3JA 1SJ4P 1F6TA 2ZM6E 3V81B 3CDWA 4N76A 2PO0A 1NJXA 1TUGB 4EEYA 1WG5A 2LA6A 4ICLA 3UCZP 3M85D 5RUBA 3O3LA 4CO2A 4ZIWA 3M2VA 3FGVA 1VQ4S 4WUDA 2O1WA 2H9ZA 4ZP8A 2W2MP 1FVQA 5LJ3Y 4C8MA 2F1FA 3CIZA 3HF5A 1HWJA 4FXWA 4TYBA 3T1HJ 2BA1G 4TY9A 4ID5B 2FJAB 2L3MA 1VC5A 1YTYA 5FWKA 4X4VA 1F3VA 2YWGA 3W65A 3TQ1A 3HHNB 2BXJA 1S79A 1OYSA 2XHWA 4DV0F 4CM2A 1S9GB 2E9TA 2PGCA 3DCAA 5LL6R 3SV3A 2KXHA 3K58A 3OPKA 2E1AA 3OFEA 4NZ7A 3SCLE 4DQSA 3CW2C 5CYJA 3QFWA 2R42A 4FP9A 2E5JA 2OO4A 3VGTA 2ZEJA 4X4PA 1NEEA 5KFDA 2W24A 3J80C 1Y00A 3H2VE 3I5CA 5LMNE 1FJGI 2PMHA 2QE5A 4PEOA 3FMBA 2B4PA 3D1OA 2D1CA 1JLEB 2MGZA 4C98A 2FVPA 2HIQA 4K4UA 1NXIA 4QYRA 3NMRA 2U2FA 1KVIA 1R3NA 2QL9B 2E5IA 3AXMA 3ZTRA 2I5JB 4WU3A 4EK2A 1BWVA 5DROA 2HZAA 2PIIA 1F0XA 2C2RA 2GGPA 3GV5B 2HZVA 1B62A 3MDFA 5KFUA 1UVIA 1RAFB 3QGHA 4DR5E 4IFDF 1RKIA 4PZVA 4Q5VA 2VG6A 3KLGB 2MPUA 4KRWA 5KT5A 3JSMA 5BJRA 5M2UA 4C8NA 2DHXA 1YJNS 3P49B 4I7FB 1BWEA 3CNQP 4DCOB 2KL8A 3BO3A 5D6GA 3EE3A 1VQ5S 1V3RA 1S6PA 4CP5A 2IBOA 4LIRA 1JQGA 2QLBB 1NJIT 2V2KA 4FYVB 1ZPWX 4UZBA 2VFTA 4KGVB 5DETA 4OI1A 4OYMA 2FVCA 3M6WA 2F8EX 1WHYA 2IM3A 1UWBA 2JJ4D 1XHKA 1AUDA 5JVHQ 3R5AA 4DSFA 1KEKA 3IP0A 4LCGA 2ZH3A 5IFMA 3CJ3A 3U02A 2JEGA 4C9DA 4ECYA 4IOAQ 3EWGA 3G82B 1FT8A 2HK2A 4Z2XA 3BDEA 2FVRA 4Y2MA 5JEAA 1ZBTA 1I94E 1YZ7A 3KUEA 4JV1A 2F3JA 4F02A 4Z37A 3U27A 1UJ4A 1BD6A 5KG4A 4NCGA 4JV5I 1NDKA 3M2UB 3AAWB 3NG8A 4USIA 3QSIA 1CC8A 3AOAA 3PR5B 5K36C 2FLOA 3FK4A 2I8EA 2FTRA 5C0XC 1PBUA 4M5IA 1LWXA 4HR2A 3A13A 3KK1A 2L9DA 4M5MA 4RUBA 1TL1A 1FDDA 1FD2A 5GAHI 3BPSP 2HHWA 1DURA 1XQIA 3BSNA 2W8LA 3PJWA 3MCMA 1IVZA 2LDIA 3F44A 4URGA 4UW2A 3O44A 3PRYA 1RTZA 2XO6A 1R6LA 2CJXB 2XWXA 3GG0A 3KG0A 1NRKA 3MD1A 2BW7A 1HPZB 1RQ0A 2GJ2A 2CPZA 3I87A 2HIYA 1AUSL 3CXCR 3CE8A 4CT8A 3D1QA 1SH3A 2WONB 3OSNA 4G1QB 4JI8I 3NLCA 4MJKA 3KLHB 2QT7A 3VGVA 3NS5A 3BH6B 1WKJA 1FJGJ 1RT5A 2G2OA 6FDRA 5D4NA 1Q7YT 2GIQA 1IBLE 1ZZFA 1REGX 3PFEA 4DEZA 1F9FA 3G8SA 1K44A 4RWXA 1X5TA 1VQYA 4U96A 3N5BA 2J7WA 3PG9A 2GJFA 2CVEA 3TI0A 1VQ8S 3VVTA 4LFAI 4ZOSA 2VQEF 1BHNA 4P74A 1TKTB 3M32B 4KY3A 3U1LA 4ZPDA 2C1EB 1UEVA 1N4LA 1WNEA 1UFKA 3K1JA 5C25A 4J3DA 2DPJA 2E7WA 4DX6A 3CPWR 1T9VA 4CLKA 1KN6A 4AYBD 1ZAWA 4X2BA 2LU2A 3FRZA 5KOWA 4RUCA 1R8PA 4ZVFA 1NM2A 2RNEA 1EQMA 3MR3A 5AXNA 5FLXC 2NSCA 4PYDA 1AZSB 2RE1A 2UXBE 2EFOA 2XLIA 4DSKA 1AFJA 2B4OA 1C0UA 1KOHA 1YHCA 2GQ2A 2AZ3A 4OZ3A 4YHHE 4LRFA 2JHEA 1XWLA 4DV7F 2DH7A 4DV0I 2XGQA 4RWWA 4YS2A 4PXDA 5B0CA 4F4XA 4XDDA 2OGUA 3BGRB 1RSCA 2LJPA 3HCXA 2H5EA 3QT5A 3H4BA 2E5GA 1RT6A 3R5DA 2IOPA 3KG1A 2ZKUA 5HL7Q 2IRUA 3DRRB 1U6BA 1YSJA 2NLWA 3TUIC 1UTAA 3J7ZT 1RP5A 2ZD1A 3D3CJ 1GEHA 1NBEB 1XMQF 4YN3B 2W7OA 3QLHB 2KFYA 2QFIA 1YQHA 4JV5J 1RAHB 4LF5E 3BYPA 2ZJRQ 1VQ9S 3DI6B 2KVIA 1HHQA 1VDHA 1P42A 5E3CA 3OUYB 3OHAA 1N5YA 2GO3A 1TKXB 2QA1A 3LUYA 1TL4A 1X4CA 4RNHA 3R3TA 2KT5A 2MKJA 1WC3A 2JZ5A 4U9RA 5JJBA 2RHSB 2BRLA 5KFEA 5KFIA 2FHKA 1UVNA 4TU8A 2LVWA 2YNHA 4ZP9A 2OD6A 3FJ2A 1N48A 3L3CA 5F3ZA 3KFWX 4I6WA 1S6QB 1HMVB 3FC9A 1RWKB 2HBRB 3AOCA 2BR0A 1QM9A 1C1BB 2J0XA 4UOCA 5L38A 2Z56B 1RYSA 4QR0A 4I1TA 3PW5A 4QIEA 3J7YI 2CQPA 2H4YB 2HWHA 4JI8J 4CI0B 1IKXB 2JDJA 5LXYA 1K73T 3ENWA 2B51A 5B0AA 2I2YA 2UZAA 1RHQB 4KJIA 4GC7A 3HP6A 4UQTA 3X3UA 3KK2A 4ZCKA 1HNZI 2B5JA 1X4DA 4WP3A 2CQIA 2EFVA 3NKYA 3AJDA 1LWFA 2X51A 2JVOA 4ANDA 4IG0A 5C0XE 4LFAJ 3NBPA 4DUYF 1IR2A 1FNXH 4K4XA 2DGSA 2IVMA 3M8WA 1D0EA 2FPHX 4DPYA 5KG6A 1H0HB 4OYZA 1VQOS 5L1IA 4N41A 2DNRA 3FDSA 2EVZA 3B78A 1X4BA 3QZ7A 4FPRA 1TUVA 3N0VA 2GO8A 4X65E 4DG1B 3GIKA 3VR1A 3Q8QB 4YUDA 5DRKA 4MFBB 4LR7A 3UR0A 4DCJB 2QX0A 2D3ZA 2P8IA 3LA0A 4WBFA 4B3RF 4DQRA 3G9CA 4XO0A 4FW3A 2HYIB 1REVA 2F40A 2BJDA 2OLWA 3B4DA 3M8ZA 2ZH4A 3K17A 5CXTA 1PYOB 1LWEA 2VG5B 5EX3A 5AE2A 5KFGA 1NZ8A 1VK3A 2RKIA 4B3SE 2B6AA 2KKHA 2YWEA 1HNIA 2Y3YA 5F8LA 2EFPA 4NI2A 4DV0J 1M5VC 3TQEA 4QPXA 4P71A 1N36I 2YNGA 1LOUA 3TJ9A 3HJFA 2HRYA 1U4BA 3R2DJ 3L7PA 3AB4B 1OWXA 4C3MA 1H3DA 5ETOA 2CNOB 2PFDA 2P5VA 3Q0AA 1FKOA 2X1AA 3E2EA 2FJXA 2F65A 1Q79A 2CYYA 3MEEB 4DXLA 3IS9B 4DSJA 1WC6A 2QTWA 3CO9A 5LJ5Y 4GKJF 5K36F 2FC9A 1CQMA 4NXNE 3V4IB 5CHCB 2BYCA 3CEDA 5AXMA 3EVMA 3VZIA 3A3NB 3PV8A 3EGNA 3CCES 4ANEA 5A8KA 1RTDA 3MPUB 3CWVA 4JB8B 4MKBA 4LF9E 1X4HA 3AY0A 1FKAE 3CVKA 3KK3A 3Q1QA 2ZE2B 4FW7A 2K2PA 1S1UB 1VRUA 5LMUF 1SL0A 1Q53A 2AKWB 3OHBA 2HFOA 3QFHA 4NE9C 1U8WA 1Z0TA 1F5AA 4QR2A 2QSFA 4FBUA 4ZVHA 2DHGA 3ZFVA 4OI2A 4DV5E 4DOZA 2WK4A 2KT3A 3CJTA 3TJ8A 2O66A 3BDPA 2RVJA 2HHSA 4L74A 5AXKA 2CAJA 1JLAA 2MSTA 5C24A 1OO0B 4URQU 3AT1B 2XO7A 1N33E 4ECWA 2NZ4A 2C3OA 2NXEA 3L09A 4C97A 2PO2A 2BJ8A 3UE2A 1XBWA 2OMLA 4DV7I 4OI3A 4KE5A 4ED7A 5CZVA 4JI2F 4RW4A 2JE6A 2W9CB 4YY3I 3QGGA 4MQYA 3WIUA 4M95A 3HHLA 2JEBB 1HNZJ 5LSLA 3T5JA 1ICEB 1FXLA 4DV1F 1FA0A 2V94A 4KHPF 3FZ2A 1B63A 1UDOA 1HBOA 5HK4A 2CZ9A 1UW9A 3UFCX 4QPTA 1V5VA 3KDNA 4G3IA 4R0EA 3LGNA 3DU5A 1HQUB 3O2IA 1M5HA 5C0XD 4CH7A 3RB4A 4IFVA 2HMIB 3KLEB 2E5HA 3JB9k 1J5EI 4OZ0A 2UU9F 3K0JA 2RRAA 5J2QB 2HVEA 2CIMA 3GR1A 3IR5B 3QO9B 4HDHA 3SSRA 3GJQB 1JLCA 3O8WA 2FHJD 3TZXA 1U1LA 2DRAA 2MTLA 2R8IA 3ZTQA 4W92B 2Z5CA 5F8HA 3C66A 1RWXB 4DQIA 4O0IA 3CDEA 5A6WA 3ZKDA 3ONQA 4OQJA 3GFYA 2IMWP 4ILLA 3UDEA 3QT8A 1LW0A 4USVA 1N36J 4HT5A 3TANA 1UDSA 1H72C 3OL6A 3IG1B 3KWMA 5JEAC 3BR8A 4GQUA 2AIRB 3KLFA 1RAGB 2V50A 2ZZTA 2ERRA 2GHVC 4OI0A 3O6QA 3S8SA 2CQ1A 3QT6A 3FCWA 2BJEA 1DAXA 3DN9A 4P2SA 5D3GA 3CDBA 4P9SA 2H54B 3IGVA 3G71S 3M6XA 1Z0CA 2OELA 1N54B 3M9NB 4ED1A 4OYWA 1Q1KA 2CPFA 5J2NB 4P7AA 4KHMA 1FRLA 3V5RA 2J0QD 3LP1A 5F9NA 3PJ9A 1JNZB 4QIGA 3BN7A 5KG7A 3KDOA 3KNGA 5G0RA 3CJ2A 4HL9A 3S01A 1VGYA 1L3SA 3TUPA 4JBCA 3C6UA 1FX2A 1BY9A 2M70A 2GZOA 1FVSA 2MYFA 5F8JA 4X64E 2IDEA 2ALZA 2XLKA 1NK9A 2HNYB 2DNKA 2DGVA 2DNGA 4WFNQ 2BZ2A 1VIOA 4IQXA 4LF8F 3D54A 2HPUA 3IAM9 4TYAA 2HBZB 5HMXA 3M8PA 1PILA 4USKA 4JI6I 3ITHA 1HARA 1YRXA 1RADB 3MPWA 4AXJA 4ZCIA 3SFGA 3NGSA 5HMYA 2IA0A 3RG6A 4DV7J 5C5JA 2DEJA 4WXOA 3DRXA 3IAS9 4X4SA 3M4XA 4ECUA 2J9CA 4A48A 4YY3J 2MZTA 1YLXA 3EVOA 4PRFA 2V8HA 2NN6A 5HJXA 1R31A 3K8VA 3WQPA 2XMWA 1YJTA 2CQ0A 2LQ5A 4RL1A 2IVYA 3VAMA 1UVJA 1BC6A 4HH0A 1KONA 4MKVA 4I2QB 4FW4A 4NRTA 2FIUA 3QMQA 3KJVB 1RDRA 2GIRA 3A8KA 3VAJA 3S7RA 1O0PA 1NHUA 4EFAC 1J5EJ 1RHMB 2GVDA 2Q43A 3RBDA 2C2DA 1GX6A 3IGNA 5B08A 4ZLJA 4LVOP 4RU2A 2Q79A 1AROP 3VAIA 4GMKA 1N32F 1RT7B 2VOOA 3SCJE 5LMUI 4DR7E 3D67A 4ZJQA 3FNNA 4N47A 1PSDA 3KYLA 4ZN3A 4JI3I 3JYTB 2DBBA 4DFKA 3AOBA 2ZM6F 1XTZA 2DNNA 2W8KA 4WE1A 3IRXB 4TQSA 1IM6A 4DL6A 1F5CA 3C8YA 1S4FA 3IWNC 3I55S 2A10A 1O5JA 3MZIA 4URLA 3D7SB 6FD1A 3K5NA 5B0FA 2W25A 2H1YA 3POTA 3OLAA 4DLGA 5CYMA 1H7WA 4ZCMA 4P73A 1WSRA 2NS1B 1DBDA 1T3NA 3DGPA 3OVBA 4DV4E 1NK8A 2DVIA 4QWCA 2HFSA 3J80Q 1D3WA 3DMJB 3QIDA 5EWGA 2CQHA 3D3BJ 4WK1A 4YB1P 1TV6A 2QO3A 1KFSA 1TUWA 1VR6A 2GNKA 2MDAA 4C48A 4RX6A 4P2MA 5E5NA 1R0AB 4MK7A 1S1WB 2DD8S 4MIBA 1MN7A 3FFIA 2R7UA 3T5HA 2UXDF 2YKNA 3C14B 4ZPAA 4O44A 1KQSR 4F0HA 1F3FA 4RW7A 3RZAA 5L46A 5LMNF 1N5SA 1YDLA 4OIXA 4AFFA 5J2MA 4OLPA 5C7PA 3DU6A 2NREA 2IYIA 3HDSA 5K8NA 2CPEA 1NU4A 2O1UA 3HHEA 4C7QA 2DR8A 1OIAA 3RGIA 5HMWA 3HSJA 1DRZA 1ITPA 2J8SA 5C2GA 4IZJD 4LSLB 3K7RA 4JI6J 3PRVA 3GMGA 3TZWA 5DRPA 1B4SA 5LSOA 3M1VA 3UD5A 2HLUA 4QQBA 5E0OA 4IFYA 2ROGA 2NUHA 4DR5F 2FYXA 2GHWA 5H9FK 3MAAA 5J1EB 1IBMI 4DPWA 1PJ7A 1NZ0A 3CMES 1JJ2R 2H48B 4CLWA 1B64A 4HEA9 1LW2A 3CO0P 3TNVA 2V5HG 5D15A 1UL3A 3BO4A 1TKZB 3VCDA 1KNZA 3OVSA 1UZHA 4HVZA 4QCLA 3CD0A 3TZYA 2YH1A 4R5PB 1X4FA 1SI9A 1MX0A 2BANB 1QLNA 2ZBQA 2W4PA 4L6V3 1TL3A 1U47A 1HR0I 5KFMA 1FJEB 4HTJA 3R1HA 4Y2CA 1Y4ZB 1VRQC 4JV5E 2W9BB 2DXEA 1KLNA 4OYIA 3WU4A 2GVZA 3DYAB 1YBUA 2F4FA 1SUQB 3N01A 3BREA 3D6TB 4CWBA 2X3GA 4JI1E 3T19A 4OI4A 4I2PB 3JXOA 5T7LB 5DG7A 3J7AN 4M63A 5LMUJ 1IQZA 1YVFA 2QV6A 3TZZA 4S0MA 2HBYB 4WKRA 2P9CA 3ENVA 5HAOA 2RH3A 4JI3J 3SQGA 2OPQB 2XBPA 1CJTB 3GP9A 2CWKA 4XIUA 2NXCA 3OJSA 4PWDA 4WK3A 8RUCA 2HKEA 2XMAA 2V9KA 3ZO7A 5F41A 2FZCB 4L73A 1T11A 2Z57B 5HSPA 2VICA 2RF2B 3CJ5A 3K5OA 4I64A 5HI7A 1RWVB 2VH7A 4L3NA 4AM3A 3W60A 1RUSA 2FJVA 4DR3E 1UFLA 4BC7A 3DLEA 4PPDA 5F8NA 2ZNYA 3EICA 4ZVGA 2C2EA 2OPRB 2UUWA 3TAMA 5E3AA 3CD6S 1BQNA 3AA8A 1WI6A 1WHWA 1T7PA 2C38B 4ENOA 2NYHA 3WHIA 1D8YA 2WSCC 4FYYB 2BR2A 3C6TB 3CULA 1U7LA 2FGOA 3SDEB 2AJ1A 3G2XA 4X4TA 1KSPA 1NPPA 4IG3B 4X62I 4U3BA 3FVYA 2LQBA 4KV8B 3UD3P 2LEBA 2XMMA 1JXEA 4ZKAA 4KH1B 1O6XA 1GFWB 4FNHA 2NZCA 4CLTA 2HW3A 4YP3A 4DQQA 1GXLA 2IAJB 2VG7B 5FLXY 3MAHA 1SJFA 4Q8FA 1CQNA 1PAEX 1G4CA 1VJWA 1DARA 1TQLA 2A6OA 3ISND 5FLXQ 3IBWA 3M7VA 4ZJOA 4AL5A 3HHLC 2C22A 1IBMJ 1JLQA 3Q8RB 2BJ1A 4O0NA 5KFKA 3DHXA 4H4MA 2NQPA 1S77D 2RDIA 1MN9A 3HXMA 4EWTA 1WOSA 5K8PA 2YBVA 1IKWB 4GKKE 2HVZA 1JLBB 4V1Ak 1NO8A 1TMJA 2BJ9A 4PQAA 2UXBF 1SVDA 3EGZA 4O3PA 1UEUA 3GTYX 4WIQA 3T9ZA 4F4ZA 1Z0EA 1RTJB 2VPWB 3BBBA 1KKHA 4YHHF 1HR0J 5L1KA 4WJBA 1XNRE 2RU3A 3VV2B 2RUSA 4NLQA 1U26A 5DNLA 2GMHA 4IFDA 4CO4A 1S9GA 4USHA 3IFEA 3AJ2A 2R4FA 3E51A 1T8EA 2V2VA 4OJ3A 3RAMA 3IRWP 4ZLLA 5LMNI 1FXDA 4N8NA 2O01C 2CPHA 4PRVA 3J81Y 2UUTA 2GAHC 3CT9A 1K1QA 4IZKB 1QD1A 3EDRB 4BA2B 3DDKA 3FBEA 1HIYA 3CCWA 3R1LA 3TX0A 2CJAA 3J81Q 4JYAF 1MG7A 1WHVA 4GC6A 1GXUA 1LNQA 3R5GA 1KQKA 4DV3E 2VBYA 4FYDA 2CGEA 3QRPA 4DR5I 5C0XB 1DJ0A 3TARA 2I1RA 3CJSA 3TVZA 1ZXMA 2DXDA 4KO0B 1T3OA 4YMEA 4ZIVA 3UI3A 4OHYA 4PXEA 2AEMA 2G2YA 4OHVA 3NGUA 3IR7B 1KOOA 1DLOB 1M0SA 3J80U 4OX9E 4OX6A 2AU0A 1JLFB 4M8LA 5IC4B 2R8JA 4NEZA 1T9TA 4LR9A 3B4TA 1RCXB 4NL5A 3Q2SC 1H74A 1JJ4A 3OW2R 1RT1B 1Y5NB 3V6DB 1QVFR 1HBUB 4X62J 1N5TA 1RWNB 1DTTB 5H9EK 3GWCA 3L9ZA 1DZ5A 1VCTA 1S9EA 3ELHA 5LXRA 2NSBA 3A3OB 4TY8B 4EBEA 3HKMA 2LDYA 2X7IA 2ZZMA 4F4YA 1ZM3A 1SIWB 3OR2B 2YKMB 2C37A 4FNIA 1Z2ZA 2RQ4A 5B0GA 4B3ME 3FEZA 1I94I 4X4NA 2Z58B 5H9EJ 3W61A 2IPOB 3GB0A 2BV3A 2XMTA 2M88A 4DSLA 3G82A 3I5AA 3DLHA 1NK6A 2YWKA 1WACA 3NGKA 2NN6C 2KHDA 4X65F 2CPXA 3TYTA 2AQ4A 2E66A 4DR2F 2UVUA 5B0DA 4NPOA 2DTJA 4KGKA 3MTKA 1Y6ZA 3M2UA 1T03A 2HAFA 5K20B 2J9DA 3K89A 4LRCA 3H5YA 2G0IA 2V4JB 4JI4F 3M6VA 2IHR1 4FWGA 1ZH5A 4DZ6A 1UWAA 4OX7A 1DQ8A 2AGOA 3ZTPA 3MEKA 4USJC 1N5VA 5K14B 4FPIA 1YG0A 2V8DA 3SV4A 3G6YA 4QOTA 3E3XA 3EGWB 2Y8WA 3OTBA 1HPZA 2ACMA 3BGOP 3O1LA 5L9XA 4K50A 1WEYA 2BBEA 4JI5I 5ETLA 1SIZA 7FD1A 3ZXWA 4LBPA 4DN9A 5KG2A 1SPBP 1RYRA 1M90T 2HHVA 4Y3CA 3LPYA 5LMNJ 2PEBA 4E0DA 4NXNF 2MZQA 3H5XA 1IBLI 4G1QA 3MUVP 2WSEC 3R5BA 3M6AA 3KLHA 3N9UC 4M5JA 2WVDA 4D3HA 5A76A 2WP8B 1IQTA 4B9NA 3IO1A 1RLDA 2Y1JA 4LF9F 4LFCF 2OIHA 2XC9A 2YXLA 2H4WB 2XQCA 1FKAF 2L08A 1WSVA 2XY7A 2GW8A 4OV6A 1VQ6S 3MMJA 4I69A 2JEJA 2HLTA 1N8RT 5AJ3J 1NJWA 4DR5J 2AX0A 4NYOA 5CYQB 1TKTA 2YNFA 4UQGA 5D4LA 2Z5BA 2JC1A 1R89A 4ZPTR 3NAHA 2OAUA 3OJUA 1H2TZ 2FJBB 3VGUA 1XR6A 3M9OB 2DRDA 4DV5F 4JG4A 3R9LA 3C46A 3FRYA 3V6HA 1GMWA 3LQVA 3QRRA 4B9LA 3IN5A 3HVTA 3LH2S 2DNZA 2R2SA 2UXBI 4LSNB 5D0GA 2QYGA 3CJKB 1NCLA 3BEGB 2XMJA 2HWIA 1N33F 2W4CA 5FDLB 1NKCA 3ZZYA 4YHHI 4RUAA 5E2QA 2XMKA 3MMBA 4AL6A 1AZSA 1R6MA 3KMSA 5ETPA 3JSBA 1QE1B 5HVFA 4BWJA 2F9JA 1S1XB 5AE1A 2P6SA 4DLEA 1JJCB 3OSPA 4F3MA 2QMXA 4ZVEA 4I3HA 2PC6A 4NLPA 4IRKA 2UV8A 1B99A 4LF4F 3RJMB 5J2PB 2FDNA 1I94J 1A6FA 2GQ0A 3NCQA 3GMEA 1L3KA 3I4PA 4BHQA 2B3TB 4LFBE 5HBMB 4WFYA 3VGSA 3C16B 1HNXE 3PS2A 1UPMB 4YR2A 1EP4B 3MI7X 4BA1B 2ZOMA 4LF5I 3M7ND 4ECRA 1YZ6A 4P2FA 3P4UB 3G6XA 4C8KA 3BKUA 2HEKA 2R9LA 3O5TB 4EYIB 1SJ1A 3DI6A 4NLYA 4J9SA 2BJ3A 5KG0A 5KFPA 3QAEA 3NGTA 5THWA 4IR1A 1RT2B 3NAIA 3T1HF 3OUYA 5C42B 2HFUA 2R2UA 5BR8E 2PNMA 3UCGA 2J8AA 4TXSA 1W25A 2MZRA 1X5SA 4K4ZA 2R2RA 3FMWA 4RW8A 3QAUA 2J76E 2KHCA 5DRRA 1VFJA 4IZJB 4F4WA 4HI2A 3HT0A 4C0HA 2ATCB 4JV0A 2FLLA 4K8RA 4FWHA 2N82B 3AHPA 2GV1A 2Q2EB 3DRYA 4JI5J 4LF7E 1HMVA 4WFXA 1S49A 3BGLA 5DM6Q 1C1BA 3MM7B 3JQKA 1ZYQA 1RXOB 2ZVSA 4J7CA 3EDQB 4ZCLA 1X60A 2OEMA 3MPYA 1IBLJ 3ZZTA 3GYNA 3K5MA 3MEGB 2BQRA 1IKXA 1AW0A 1H6KX 2OEKA 3GJRB 3MURP 3E01A 3HHKA 3P45B 2EK6A 3ZTSA 2PO0B 2XS2A 3MR6A 3HULA 3OTEA 4ICLB 4PQUB 5F8MA 3M2VB 1GAOA 3HVRA 5A2QY 4M5LA 3LF0A 4UTGA 1Q16B 4ED8A 4JI6E 4EBDA 2CZVC 4YEAA 3LPEA 1Y5LB 5A2QQ 3RRGA 4Y28C 2D3O1 1V3SA 3EMTA 4U95A 1HYSA 4MU0A 4X65I 4OYBA 5DLGA 4DPTA 4X64F 2FGCA 3W2WA 2MZ1A 3ILIA 1HQ2A 3VWSA 2KTQA 3EVWA 4DG1A 4QW9A 3R2CJ 2V4QA 3DM2A 2P2CB 2E9RX 1FE0A 2DGOA 4MFBA 2DNOA 1V3ZA 2XGPA 2UXBJ 2UV8G 5KG5A 3FCHA 2HVDA 5KFVA 4NLRA 1QUPA 1H38A 3PY8A 4B3SI 1ACMB 3BSCA 4YHHJ 1EETA 5DRQA 4N5SA 5HP1B 4ELUA 2VG5A 2ZBKB 2CDRB 3T5LA 7FDRA 3I82A 2HS4A 1S6OA 2CPDA 4B9TA 3QNWB 2HQCA 9ATCB 2BQUA 2OKQA 1E3HA 1WDDA 2B9EA 4KBIA 5HVHA 2BDPA 4MK8A 1FX4A 4DFMA 1W26A 4NXNI 5F3TA 2RMLA 2GGPB 2OTJS 2DIUA 5DGBA 1OPIA 2XZTB 1QSLA 4LF5J 4A8FA 2VA3A 1Q5VA 3V4IA 1B0VA 1EAYC 2YQ0A 1K1SA 2F4VE 3CMQA 1KLMB 2GS8A 3JSMB 5E41A 1DFDA 1CJKA 1VQNS 2RQMA 3K8WA 1CS4B 2KFNA 1S5ZA 4RNOA 4DR7F 2I9SA 1VC6A 4OKGA 1NSKL 3KXDA 2UP1A 4QJVA 2DB1A 2FC8A 4KFBA 1RGVA 4OO1E 2ZE2A 1VIXA 3EPGA 4CH1A 1S1UA 2HS0A 2GQCA 2JFDA 1WUUA 1TL5A 4DV5I 3FSIA 3US5A 1QDUB 4QYZK 4OYXA 4WZQA 1EB0A 4IFDC 1Y9OA 3CMAS 1QSYA 1I3OB 2B4VA 3D1HA 4KGXB 2HHHE 1U48A 4RO0A 1RWUA 3KLIB 2CDQA 5IWAE 2JT2A 1N33I 2XZDB 1Q4RA 4QIFA 5HMZA 2J65A 3HT3A 2X1BA 4W4MA 2VBZA 2OD4A 4DV4F 1LK5A 2I6WA 2Z30B 4OZEA 2XEXA 4OYPA 5E3RA 3P5BP 1M5OC 1OPZA 1EJ7L 4X4RA 5DG9A 3TO8A 2DGXA 4YB7A 2H5JB 3PVXA 1PC5A 4NCGB 2EBEA 1EARA 4MU1A 2ROPA 4ZMMA 2Z4PA 2FLNA 3PZPA 3MUMP 1VQLS 4P7VA 1NDLA 5LSRA 3AJ1A 2KVQE 1U49A 1FWLA 2XMUA 1VQSA 2FQQB 1HWKA 4PYAA 4GO5X 1S1TA 1RAOA 3W5XA 1RB0A 2B9WA 3GFXA 2AE8A 8ATCB 2CXEA 4NOHA 3CCQS 2A2DA 4WTYA 2HNZB 3R97A 2XLJA 2EFQA 1RT4A 4K4SA 4X65J 3BJYA 3AQOA 3GIMA 4L75A 5KFAA 3CC2S 3VQSA 3TOQA 2CJ9A 4DV2I 2DKOB 2C2MB 2HMIA 4ZVRB 2JRSA 4I6AA 5J2QA 3JTNA 1KRPA 4EZ6A 3TP2A 4FF1A 3ILJA 2BA9A 1P6TA 3HLUA 4YB5A 4B3SJ 1ZOTA 2ADBA 1KTQA 2Q6BA 1Y11A 1H7XA 1TVRA 2AWZA 3DHWC 1MROB 2Z2LA 2BEFA 2X1GA 2WVBA 1RT5B 5IT9Y 3C3LA 4NA1A 3RR8A 1HNVA 1Y60A 2D69A 4J5OA 1BGXT 2OI2A 2W2OP 2IJFA 1VLOA 4TNOA 1RHUB 2B9YA 4MAKA 4DUTA 4U6PA 3IG1A 3THVA 1V6HA 2N4CA 1NHIA 2BMBA 4NXNJ 1RCOB 1ZM9A 2M9KA 1SBRA 3IWXA 2R7WA 1VMBA 1EKRA 5GAGU 1XMOE 2RS2A 4USWA 4MIWA 5C25B 3DGVA 4JV5F 4Q0BA 1VHIA 2B56A 3RUBL 1YITS 2KG0A 2OHDA 3DLKA 1TK0A 3NOCA 4DR4E 1XC9A 4HYMA 3HO1A 1D6TA 2M52A 2MEWA 1HD1A 2G4BA 2I38A 3KHLA 1MMNA 2QLWA 1Z5BA 5J2NA 1X31C 5DQHA 4KHRA 5LT5A 1MU2B 1S0VA 4X64I 1FEEA 3AH6A 3LP2B 3IA0A 1C0UB 5GADU 3JAMU 2ASDA 1NHHA 1HWUA 4DV5J 4DUZE 5B7WA 3D68A 5EDWA 4ZLPA 2ZH5A 1FDNA 3M85G 4OO1D 2HNYA 1RT6B 5K9FA 5CABA 3DRSA 4CO0A 1DY3A 1N33J 1N52B 3MMAA 3HD2A 4OLOA 3R7SB 3VAHA 2VFVA 1E6YB 4DR3F 2U1AA 1NJZA 2IA6A 4WKYA 4ZVIA 4OZ1A 4FVCA 4H4KA 1HQEA 2V34A 4Q2LA 4OMFG 1YJ9S 1QAIA 1MU5A 1N34E 3RYLA 3DOMA 2ILZA 2CKWA 1WHXA 3MWBA 2V2QA 1VBKA 5L9NA 4RJVA 4LQ9A 5JMNA 2J0WA 3I32A 2N3LA 4LF2A 4C0OC 1RE1B 4L3KA 2DR6A 4P75A 3BN4A 2LEAA 3N6NA 2CG4A 4CQ1A 2MLZA 1FKPB 2BUNA 4C6AA 5A8RB 2XCAA 4BWMA 1P9YA 4J9MA 4RZRA 3HKZD 2J6TA 4DV2J 2C28A 1LKZA 4DFPA 2IC3A 1V9OA 4DR7I 3F73A 4Y6IA 4NLVA 4V19J 4DR1I 2V2ZA 1O51A 2V0NA 3BR9A 2DK2A 1VYAA 3ZNUA 1RT7A 4K5RA 2XS5A 2BA0D 4ALZA 3R6GB 2HRUA 4PXCA 1C4AA 2D9PA 3NS6A 3K5LA 5KT4A 2RT3A 4E2FB 3RW6A
chains in the Genus database with same CATH topology
3D4JA 4DR6E 1Y4SA 1PIEA 3CWVA 1N36E 2UUAE 1WUUA 4DV5I 1DARA 4JI4I 1FI4A 2BM1A 1IBLE 4X62E 2ZITA 5FLXQ 2Z5BA 4LF9E 2WW4A 5LMUI 4LF8I 4DR7E 1FKAE 1K47A 3OTOI 4B3RI 4JG4A 1H7SA 4DV4I 3Q1QA 2HHHE 4JI3I 4LFAI 1ZXNA 3B8HA 5IWAE 1N33I 4DUYE 4HACA 1XNRI 4DV2E 4DR2E 4JI8E 3T1YE 1Z0TA 1N32E 2UXBI 5IT9Q 2O1TA 4GKKE 3K1JA 2UXCI 2XEXA 4LFBI 1KTVA 2BM0A 1HNXI 4YHHI 4DV5E 4URLA 4JI4E 4HACB 3V2UC 3J7AG 4FN5A 5LMUE 4JI7E 2ZM6E 3ZZUA 1Z0EA 3OTOE 1IBKI 1EA6A 4UT4A 1KKHA 1XNQI 3J81C 1FWLA 3ZKBA 4B3RE 4RPFA 4DV4E 4JI3E 4WUCA 4LFAE 1N33E 1XNRE 4WUDA 5FLXC 2O1WA 4I3HA 2UUAI 4HY1A 2HFSA 3J80Q 4DV7I 2UXBE 1A6FA 4AQYI 2A2DA 4LFCI 4LF9I 2GQ0A 4IZKA 4GKJI 2UXCE 4FWDA 4LFBE 4YY3I 1HNXE 4YHHE 2HK3A 4Z7YA 4DPXA 4DV3I 1N0VC 1PVGA 5BR8I 4M1KA 4DV0I 2V2VA 1Z0WA 1HK7A 5LMNI 4DV2I 5IT9C 5FWKA 4LF5I 4P52A 2LJPA 3QT5A 4PRVA 1IBKE 2IOPA 1XNQE 1N32I 1FWKA 2HKJA 3K85A 4IZKB 1B63A 2CZ9A 3ZM7A 3J81Q 5LL6R 3Q6MA 3PYDA 1MG7A 4USMA 4DV7E 2E5LI 2Z5EA 4AQYE 2VQEI 4LFCE 4OX9I 4LF7I 2R42A 4GKJE 2O1UA 4JI7I 2ZM6I 5GMDA 4IZJA 1XMOI 4YY3E 1J5EI 3LNUA 2HFUA 4DV3E 4DV6I 1Y4UA 4JI0I 2CGEA 5BR8E 3J80C 4DV0E 2PNMA 4IZJD 2VQFI 1Z59A 3F0NA 4DR5I 5LMNE 1FJGI 4LF5E 4DPUA 2X36A 3WU6A 1ZXMA 2V8PA 2Z5BB 4DR4I 2OI2A 3B82A 4IZJB 1IBMI 4DPWA 4FWHA 1RREA 1NZ0A 1VISA 2Q2EB 2E5LE 1H73A 1NHIA 1USVA 2Z5CA 3PYGA 2VQEE 4OX9E 1ZM9A 4LF7E 5A2QC 3H4LA 3ZZ0A 3ZKDA 2AJ4A 1XMOE 4LF4I 1Z5CA 1J5EE 1B62A 4B3MI 5GMEA 4R1FA 3QT8A 1H74A 4DV6E 4MYUA 4JI1I 4JI0E 4JI2I 2VQFE 2UUCI 4DUZI 1H72C 1NHJA 4DR5E 1FJGE 1Z5AA 3ZZTA 4WUBA 1KIJA 4DR4E 4HYMA 1MX0A 1D6TA 2CG9A 2EFGA 4DV1I 3HULA 3LTOA 1IBME 3QT6A 1HR0I 1OJ4A 4KHPI 1Z5BA 4NXMI 2X7IA 2UXDI 1PKPA 3Q6NA 4JV5E 3J7AM 1ZM3A 3WU4A 4UTGA 4B3TI 4JI6E 1FNMA 4JYAI 4LF4E 1BKNA 4X64I 4B3ME 3WU5A 1Z0CA 1I94I 5A2QQ 1NHHA 1XMQI 4JI1E 4JI2E 2BV3A 2UUCE 4DUZE 4LF6I 4X65I 1HNWI 3T1HI 2UU9I 4P7AA 4DPTA 3P06A 4PRXA 1HNZI 3V5RA 1N34I 4JI5E 2PNLA 4PU9A 1XHKA 4HXZA 4KQVA 1UEKA 4DV1E 3PYFA 4DR3I 3JAMQ 1HR0E 4KHPE 4NXME 2UXDE 4Z7CA 4DPYA 2R3VA 4B3TE 1Y6ZA 2IOQA 2HK2A 4JYAE 1ZM2A 2HKEA 4X64E 3GONA 4DR1E 1I94E 4B3SI 1XMQE 1Z0GA 3B78A 4ZVIA 4LF6E 4FWGA 4X65E 1HNWE 3T1HE 2UU9E 4MYTA 2V34A 2ZBKB 1S16A 1HNZE 1EI1A 1U2RA 1MU5A 1N34E 4JV5I 4USKA 2NPFA 2UUBI 2V2QA 4EMDA 2A2CA 4JI6I 2F4VI 4DR3E 4N3OA 4FW9A 3PYEA 1Z0VA 4ED4A 3K17A 4DU8A 4X66I 2DEJA 1RR9A 4LF8E 3HJCA 2Z5CB 1USUA 1Z0BA 4NXNI 3JAMC 4B3SE 3LPSA 4JI5I 2VF3A 2O1VA 4K0KI 3PRYA 4DR6I 2J7KA 1N36I 2E1RA 4DU7A 1QZRA 1IBLI 4X62I 2UUBE 1ELOA 2F4VE 3M6AA 2GS8A 4DR7I 5L3JA 1N0UA 4DR1I 1S4EA 2V2ZA 4DXLA 4X66E 2HHHI 5IWAI 3WU3A 4DUYI 3QT7A 4DR2I 1H7UA 4XTJA 4NXNE 4JI8I 3T1YI 1ZM4A 2DEIA 4K0KE 4GKKI 1KVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4J A;  4DR6 E;  1PIE A;  3CWV A;  1N36 E;  2UUA E;  1WUU A;  4DV5 I;  1DAR A;  4JI4 I;  1FI4 A;  2BM1 A;  1IBL E;  4X62 E;  2ZIT A;  5FLX Q;  4LF9 E;  2WW4 A;  5LMU I;  4LF8 I;  4DR7 E;  1FKA E;  1K47 A;  3OTO I;  4B3R I;  4JG4 A;  1H7S A;  4DV4 I;  3Q1Q A;  2HHH E;  4JI3 I;  4LFA I;  1ZXN A;  3B8H A;  5IWA E;  1N33 I;  4DUY E;  4HAC A;  1XNR I;  4DV2 E;  4DR2 E;  4JI8 E;  3T1Y E;  1Z0T A;  1N32 E;  2UXB I;  5IT9 Q;  4GKK E;  3K1J A;  2UXC I;  2XEX A;  4LFB I;  1KTV A;  2BM0 A;  1HNX I;  4YHH I;  4DV5 E;  4URL A;  4JI4 E;  4HAC B;  3V2U C;  3J7A G;  4FN5 A;  5LMU E;  4JI7 E;  2ZM6 E;  3ZZU A;  1Z0E A;  3OTO E;  1IBK I;  1EA6 A;  4UT4 A;  1KKH A;  1XNQ I;  3J81 C;  1FWL A;  3ZKB A;  4B3R E;  4RPF A;  4DV4 E;  4JI3 E;  4WUC A;  4LFA E;  1N33 E;  1XNR E;  4WUD A;  5FLX C;  4I3H A;  2UUA I;  4HY1 A;  2HFS A;  3J80 Q;  4DV7 I;  2UXB E;  1A6F A;  4AQY I;  2A2D A;  4LFC I;  4LF9 I;  4GKJ I;  2UXC E;  4FWD A;  4LFB E;  1HNX E;  4YY3 I;  4YHH E;  2HK3 A;  4Z7Y A;  4DPX A;  4DV3 I;  1N0V C;  1PVG A;  5BR8 I;  4M1K A;  4DV0 I;  2V2V A;  1Z0W A;  5LMN I;  4DV2 I;  5IT9 C;  4LF5 I;  4P52 A;  2LJP A;  3QT5 A;  4PRV A;  1IBK E;  1XNQ E;  1N32 I;  1FWK A;  2HKJ A;  1B63 A;  2CZ9 A;  3ZM7 A;  3J81 Q;  5LL6 R;  3PYD A;  1MG7 A;  4USM A;  4DV7 E;  2E5L I;  4AQY E;  2VQE I;  4LFC E;  4OX9 I;  4LF7 I;  2R42 A;  4GKJ E;  4JI7 I;  2ZM6 I;  5GMD A;  1XMO I;  4YY3 E;  1J5E I;  3LNU A;  2HFU A;  4DV3 E;  4DV6 I;  4JI0 I;  5BR8 E;  3J80 C;  4DV0 E;  2VQF I;  1Z59 A;  3F0N A;  4DR5 I;  5LMN E;  1FJG I;  4LF5 E;  4DPU A;  2X36 A;  3WU6 A;  1ZXM A;  2V8P A;  4DR4 I;  2OI2 A;  3B82 A;  1IBM I;  4DPW A;  4FWH A;  1RRE A;  1NZ0 A;  1VIS A;  2Q2E B;  2E5L E;  1H73 A;  1NHI A;  3PYG A;  2VQE E;  4OX9 E;  1ZM9 A;  4LF7 E;  5A2Q C;  3H4L A;  3ZZ0 A;  3ZKD A;  2AJ4 A;  1XMO E;  4LF4 I;  1Z5C A;  1J5E E;  1B62 A;  4B3M I;  5GME A;  4R1F A;  3QT8 A;  1H74 A;  4DV6 E;  4MYU A;  4JI1 I;  4JI0 E;  4JI2 I;  2VQF E;  2UUC I;  4DUZ I;  1H72 C;  1NHJ A;  4DR5 E;  1FJG E;  1Z5A A;  3ZZT A;  4WUB A;  1KIJ A;  4DR4 E;  4HYM A;  1MX0 A;  1D6T A;  2EFG A;  4DV1 I;  3HUL A;  3LTO A;  1IBM E;  3QT6 A;  1HR0 I;  1OJ4 A;  4KHP I;  1Z5B A;  4NXM I;  2X7I A;  2UXD I;  1PKP A;  4JV5 E;  3J7A M;  1ZM3 A;  3WU4 A;  4UTG A;  4B3T I;  4JI6 E;  1FNM A;  4JYA I;  4LF4 E;  1BKN A;  4X64 I;  4B3M E;  3WU5 A;  1Z0C A;  1I94 I;  5A2Q Q;  1NHH A;  1XMQ I;  4JI1 E;  4JI2 E;  2BV3 A;  2UUC E;  4DUZ E;  4LF6 I;  4X65 I;  1HNW I;  3T1H I;  2UU9 I;  4P7A A;  4DPT A;  4PRX A;  1HNZ I;  3V5R A;  1N34 I;  4JI5 E;  4PU9 A;  1XHK A;  4HXZ A;  4KQV A;  1UEK A;  4DV1 E;  3PYF A;  4DR3 I;  3JAM Q;  1HR0 E;  4KHP E;  4NXM E;  2UXD E;  4Z7C A;  4DPY A;  2R3V A;  4B3T E;  2HK2 A;  4JYA E;  1ZM2 A;  2HKE A;  4X64 E;  3GON A;  4DR1 E;  1I94 E;  4B3S I;  1XMQ E;  1Z0G A;  3B78 A;  4ZVI A;  4LF6 E;  4FWG A;  4X65 E;  1HNW E;  3T1H E;  2UU9 E;  4MYT A;  2V34 A;  2ZBK B;  1S16 A;  1HNZ E;  1EI1 A;  1U2R A;  1MU5 A;  1N34 E;  4JV5 I;  4USK A;  2NPF A;  2UUB I;  2V2Q A;  4EMD A;  2A2C A;  4JI6 I;  2F4V I;  4DR3 E;  4FW9 A;  3PYE A;  1Z0V A;  4ED4 A;  3K17 A;  4DU8 A;  4X66 I;  2DEJ A;  1RR9 A;  4LF8 E;  1Z0B A;  4NXN I;  3JAM C;  4B3S E;  3LPS A;  4JI5 I;  2VF3 A;  4K0K I;  4DR6 I;  2J7K A;  1N36 I;  2E1R A;  4DU7 A;  1QZR A;  1IBL I;  4X62 I;  2UUB E;  1ELO A;  2F4V E;  3M6A A;  2GS8 A;  4DR7 I;  5L3J A;  1N0U A;  4DR1 I;  1S4E A;  2V2Z A;  4DXL A;  4X66 E;  2HHH I;  5IWA I;  3WU3 A;  4DUY I;  3QT7 A;  4DR2 I;  1H7U A;  4XTJ A;  4NXN E;  4JI8 I;  3T1Y I;  1ZM4 A;  2DEI A;  4K0K E;  4GKK I;  1KVK A; 
#chains in the Genus database with same CATH topology
 2QC3 A;  5HQL A;  1KP6 A;  1CUL B;  3JYT A;  2HHP A;  2KG1 A;  2DGW A;  3TAP A;  1DQA A;  3I31 A;  1X8D A;  4J9L A;  2PO4 A;  4FXD A;  3KOA A;  1NDC A;  5CA5 A;  4DV4 I;  3FSY A;  3LP0 A;  3B8H A;  4DL5 A;  2ZKT A;  2R7O A;  4O23 A;  1WJ9 A;  4B17 A;  3OL9 A;  2HFV A;  3PX4 A;  1UDQ A;  5KFJ A;  2EWH A;  4U8Y A;  1XNR F;  1RHK B;  3D0G E;  3IBF B;  3PRD A;  1RAB B;  2BW2 A;  3UN5 A;  4B08 A;  2C2N A;  2Q1L A;  4CLU A;  1NLK L;  2KU7 A;  2XUL A;  3KJF B;  3HSZ A;  2R7X A;  1S10 A;  4F7V A;  5L8R C;  1S1W A;  1REV B;  5IXU A;  1XR7 A;  4Q45 A;  1X5P A;  1LWE B;  4X64 J;  4KSE B;  4NBQ A;  5A0Y B;  1J27 A;  4J9U E;  2B6A B;  3C14 A;  4B9M A;  4EGL A;  1OSD A;  1HNI B;  2J0S D;  4ZK7 M;  4NI2 B;  1N0V C;  2WAQ D;  2FVQ A;  1K8A T;  3TUZ C;  1N6Q B;  2J6S A;  2YKA A;  4M5K A;  1UCN A;  1NSP A;  2XTJ P;  2ZC4 A;  1T9W A;  5SZT A;  3ZM7 A;  1VLY A;  1Q78 A;  1GXT A;  2RRN A;  3VQT A;  1SXL A;  4UF4 A;  4ZPW R;  2DR5 A;  2PI5 A;  2GIF A;  2VKR A;  1L5U A;  4Y2I A;  3OL7 A;  1HNZ F;  1Y4U A;  4QIW D;  5A8K B;  2AT1 B;  3M2R B;  1Z59 A;  3EYZ A;  4J9V A;  3W2V B;  3GII A;  1GMU A;  1IM4 A;  1F9H A;  4YR3 A;  3J7Z 5;  1NH8 A;  5GAE I;  4A8X A;  4AL7 A;  1TKZ A;  2O5D A;  2VC1 A;  3QBC A;  1FDB A;  5JXS A;  5EN1 A;  1YIJ S;  1VRU B;  4O3N A;  2VQE E;  2F9D A;  4R1F A;  3PKY A;  2WOM A;  2YTC A;  3A8E A;  4JI1 I;  4JI0 E;  3A1Y G;  3M6U A;  4DWI A;  2W9B A;  1HWL A;  1R8C A;  3DYA A;  4BBY A;  4DR7 J;  3UVJ B;  4B3M F;  2G0J A;  4LSZ B;  1SUQ A;  4DR1 J;  3ENA A;  1JLA B;  4I2P A;  3S6E A;  5HJY A;  5T7L A;  2QA2 A;  2LEP A;  1JX4 A;  3H90 A;  1VC0 A;  3UNG C;  3KJN B;  1G3O A;  5EX0 A;  1SL2 A;  4WTO B;  3DLG A;  5HRO A;  2ZHO A;  2EG1 A;  2FUG 9;  1N36 F;  2JE6 B;  1CJT A;  2UUC E;  2BE7 D;  4DS5 A;  3PAC A;  2A3J A;  1R6Y A;  3CDU A;  1IN0 A;  2ZH8 A;  3VTI A;  1VQ7 S;  1HI1 A;  1RTI A;  3WX8 A;  2L48 A;  4JI5 E;  2OTL S;  4PU9 A;  3ZZO A;  1Q81 T;  2VJV A;  4DV4 J;  2RUG A;  4DR3 I;  3P8B B;  4H4O A;  1HBO B;  2Y0S D;  2RF2 A;  3K57 A;  2R3V A;  1HBM B;  4B3T E;  3CCS S;  4MMO A;  3QIP B;  2LLZ A;  3ZZP A;  2XG8 A;  1XMQ E;  5DQG A;  1KR4 A;  3BZQ A;  1LXJ A;  1URR A;  4IFV B;  4H54 A;  2EBG A;  3MR7 A;  1HNW E;  2Y0B B;  2OPR A;  3BB5 A;  3DOL A;  4J9P A;  3MED B;  3TEG A;  3B6B A;  1JLC B;  2CRL A;  3H42 A;  4F67 A;  4FW9 A;  3PYE A;  1RAI B;  1Z0V A;  1IKV B;  2LXU A;  3SDE A;  1QTN B;  3LOU A;  4DF4 A;  1S6U A;  4FYW B;  2Z5C B;  1SH0 A;  1Q8K A;  1MSW D;  2YY3 A;  2HFZ A;  4KV8 A;  4NML A;  2O1V A;  1LW0 B;  3D9B A;  3FBB A;  2E1R A;  2VPX B;  2YQ1 A;  4FVM A;  2KZZ A;  2UUB E;  2IJR A;  1U1R A;  1ELO A;  3DDI A;  4TLQ A;  1Y5Y A;  1N0U A;  3KLF B;  2IAJ A;  2VG7 A;  3CDI A;  1IWG A;  4ZP7 A;  1VBZ A;  1S4E A;  1SKW A;  1FCA A;  1Z1Z A;  1A9N B;  4WP9 A;  3M8R A;  2EG2 A;  5CZX A;  3WU3 A;  3SYZ A;  3OD2 A;  1H7U A;  4KYZ A;  2OEJ A;  4PG5 A;  2IM1 A;  5D3G B;  4YY3 F;  2XY5 A;  4KPY A;  2Q6C A;  5LL6 d;  4GKK I;  2WNR A;  4I0W A;  2OPS A;  3D4J A;  1FK9 B;  3PIP Q;  3I96 A;  1U02 A;  1ZPV A;  3EGV A;  5F0U A;  3IBC B;  2OP5 A;  2GC8 A;  3KMQ A;  3VF0 B;  3AXK A;  3LP1 B;  1QAX A;  3P3C A;  1IKW A;  3I0S B;  4DDF A;  3MUT P;  2LXI A;  2BE2 B;  3I0R B;  3NNH A;  3WZ0 A;  5G0R B;  4DUY E;  4MKA A;  2DNM A;  1XNR I;  4QU7 A;  4O4G B;  5C2C A;  1J5E F;  3CUN A;  3BS9 A;  4JI1 J;  2F63 A;  2O1T A;  1UVM A;  2E29 A;  4ED3 A;  4ZVS B;  4DL4 A;  4ZPV R;  4FZV A;  1GK8 A;  3GJT B;  1I6J A;  5AE3 A;  4A8Q A;  5KT2 A;  4LFB F;  3M8P B;  1U6F A;  1HNX F;  1N56 A;  1R6V A;  3J81 C;  3ZKB A;  4B3R E;  5GMK a;  4J9K A;  3MPD A;  1F9E B;  4FKX A;  2H3E B;  2AYM A;  1FD8 A;  4DL0 C;  3PFO A;  1S72 S;  2V8V A;  2QL7 B;  3PO5 A;  1OSC A;  1NHV A;  4IZK A;  1JXL A;  2UXC E;  1NND A;  4FXV A;  3W66 A;  1HHT P;  2NN6 B;  4DV3 I;  5ITH A;  1PVG A;  1MWZ A;  1LV5 A;  1D8Z A;  2CAD A;  4ETZ A;  2XYG B;  2QGF B;  1JKH B;  2C42 A;  4DR3 J;  2YVS A;  3QWP A;  1Z2L A;  4WCE Q;  1WOP A;  5BR8 F;  3GIJ A;  2LEC A;  2D41 A;  5C0X A;  3TX8 A;  2QSW A;  2Z5E A;  4AQY E;  4KO0 A;  4OX9 I;  2CQC A;  4GKJ E;  5K36 E;  4JI7 I;  1W2I A;  2KJV A;  2PNZ B;  1QUV A;  3UDV A;  3QWU A;  4C8O A;  2FHJ A;  3Q24 A;  2HAI A;  2MQN A;  4K5S A;  1H2U X;  2O1P A;  4GVB A;  3EZ5 A;  4C8Y A;  1ZAV A;  4CLY A;  1SJ3 P;  2G1H A;  1RT1 A;  3NL0 A;  4ED2 A;  1SKU B;  3V6D A;  3LGM A;  1FRM A;  4B02 A;  1HBU A;  2PO1 B;  1PG5 B;  2E5L E;  4X84 A;  4IS9 A;  1C1C B;  3ZZ0 A;  3E8O A;  2VDH A;  4B3M I;  4CO3 A;  4O3Q A;  4AID A;  4A8W A;  4J9N A;  4CT9 A;  4U3D A;  1WF0 A;  3UDC A;  2NXU A;  4LUB A;  2CJY B;  4JI6 F;  2YKM A;  5A8W A;  3ICL A;  4UUW A;  4C11 B;  2ZDO A;  4H4K C;  2ZBI A;  4P72 A;  1NK4 A;  4PR6 A;  3DGP B;  3UQS A;  4OHZ A;  5A6P A;  2CVI A;  1RJJ A;  3P96 A;  3CJ8 A;  1G6B A;  1QTM A;  4GKK J;  4BCA A;  4AUK A;  4IO1 A;  1TV6 B;  2HG4 A;  4KKO B;  4RKU C;  4JI2 E;  3DRP A;  3M8Y A;  4OHW A;  3VVU A;  3THP A;  1I1G A;  3BQ0 A;  4NX9 A;  3HD1 A;  3SXL A;  2CG8 A;  2CZ4 A;  2JEA B;  2VAS A;  1KWM A;  1RIS A;  4F2R A;  4ID8 A;  2WTF A;  4IH7 A;  1NK7 A;  4DV1 E;  3FFI B;  1D1U A;  2HGM A;  1U0H B;  1XNR J;  4KHP E;  5BXI A;  1HI0 P;  2WHO A;  4OO1 B;  4OJH A;  2IOQ A;  2D74 B;  1N88 A;  1ZM2 A;  3H40 A;  2MB0 B;  3NZK A;  2VDI A;  3W8P A;  2CJB A;  2VBX A;  3SCK E;  2FHO B;  2RB7 A;  3PXG a;  2X1F A;  2UU9 E;  2M2B A;  3N4W A;  1RTH B;  1FO1 A;  5KT3 A;  4K59 A;  4QNK A;  1Y7P A;  3MM6 A;  3OXG A;  4Y65 A;  2A2C A;  4JI3 F;  3GLJ A;  3MCO A;  3T6B A;  3GR0 A;  1XJW B;  1WD6 A;  5DDO C;  2BAC A;  4E8U A;  4UUX A;  1HI8 A;  2G1D A;  3NY0 A;  1X4G A;  2F4V F;  3CC4 S;  3HJC A;  4OX8 A;  3EXY A;  1USU A;  3FSX A;  2IJN A;  1RA7 A;  2WP8 A;  4DV3 J;  4JUZ A;  1HBN A;  1BQM A;  1M1K T;  1OY9 A;  2J7K A;  2DNQ A;  3FQL A;  3T9N A;  4RNF A;  3SCI E;  1QAJ A;  4RW9 B;  2BKP A;  3ZZZ A;  2KB2 A;  3GE9 A;  2HQF A;  1TL3 B;  2QA4 S;  4X66 E;  2AJ0 A;  4IRD A;  3FQK A;  4OX9 J;  3DOK A;  2QEX S;  4JI7 J;  2GVZ B;  3MCS A;  2EEY A;  3HMJ G;  2NXN A;  1ZM4 A;  4HYK A;  2HHH F;  1BXN A;  3KHR A;  1AA1 B;  1PCA A;  3MGJ A;  1HFE L;  1EKS A;  1ZTW A;  2VL1 A;  1FI4 A;  5K36 D;  2L9N A;  3BGU A;  3MM9 B;  4ECX A;  3CJK A;  2E7X A;  5CCL A;  4WII A;  3EX7 B;  3SQG B;  2ZH1 A;  1TMM A;  4DV2 E;  4ZHR B;  3OTD A;  1KQF B;  1RBO B;  4B3M J;  1QE1 A;  5AXL A;  1S1X A;  4LFB I;  5B0E A;  3QZ8 A;  2AD9 A;  2ACY A;  4QIV A;  1HNX I;  4ECT A;  1S9F A;  2F8H A;  4NLW A;  2R7T A;  3OFG A;  1IXK A;  3H0P A;  1Q7L B;  1CLF A;  3OTO E;  1IBM F;  5HBM A;  4RPF A;  1Q82 T;  2RDD A;  3QQC D;  2IES A;  3DLE B;  4W98 A;  3G8T A;  1BUX A;  2JEI A;  2UUA I;  2B0G A;  3UDL A;  3TAM B;  2R8G A;  2Q66 A;  1U1O A;  5DDR C;  1RA6 A;  3GCX P;  5IOL A;  4ES2 A;  1WTB A;  3TWZ A;  2VA2 A;  5BR8 I;  3EUN A;  3U1K A;  1SCJ B;  3LAN A;  2VU5 A;  3W9H A;  5CD4 H;  2VC0 A;  1HR0 F;  1RT2 A;  1XNQ E;  3IR6 B;  3FUY A;  4UST A;  2OJ3 A;  2XSJ A;  1A0O B;  2VFR A;  5KFH A;  1JNR B;  2F1D A;  1T94 A;  4NLO A;  3Q6M A;  2IM0 A;  5IV3 A;  3LWL A;  1WWH A;  3GLL A;  4K4T A;  3HVA A;  1EZZ B;  4LF7 I;  2JSX A;  1JLG A;  4F0K A;  4IZJ A;  3CJ0 A;  3DLB A;  1M5K C;  1YJV A;  2FJE B;  2A0F B;  4C2M A;  4IUF A;  2IRX A;  4F25 A;  4B9S A;  3OV7 A;  4FKY A;  3QAT A;  1XMO F;  2V8P A;  1YJ7 A;  1VRT B;  3G8Q A;  2JWN A;  3NEK A;  5IM0 B;  9RUB A;  4PWU A;  1DTQ A;  2LP4 A;  2MZS A;  2WVE A;  3MEG A;  4DR4 F;  3TVY A;  2DGU A;  5A2Q C;  5GAH U;  2RHQ B;  4DSE A;  4F3Q A;  5GME A;  1X9W A;  4DV6 E;  4PQU A;  3QGI A;  1NAQ A;  1VQK S;  1NHJ A;  4Y2A A;  5EHH A;  5D0E A;  2BOP A;  3I4H X;  3GSD A;  4QZV B;  4O3R A;  1ZTT A;  4NYP A;  3V6K A;  7AT1 B;  2HUR A;  4DUZ F;  2GO9 A;  5KFS A;  1Q95 G;  2V69 A;  4EO8 A;  1RLC L;  2XCP A;  1Q8I A;  1PKU A;  4LRB A;  3PHT A;  3NRB A;  1NDP A;  1T9Y A;  2YX4 A;  1WC5 A;  1RAA B;  1BMQ B;  4RUH A;  4IFD B;  3MEC B;  2YH0 A;  4RW6 B;  4X62 F;  1NB2 A;  2KXF A;  1FJ7 A;  1B70 B;  3P3E A;  3QJL A;  3GSI A;  3AD7 C;  3GQC A;  1HWI A;  4NLT A;  2FVS A;  4I6Y A;  1SV5 A;  5HP1 A;  3GPA A;  1TU0 B;  4NXM E;  1RT3 A;  2UXD E;  3VAF A;  2C3Y A;  1YI2 S;  1N34 F;  5F0W A;  1WKK A;  3M8Q B;  2HHX A;  2HND A;  3C15 B;  3BYR A;  4OZL A;  3W8G A;  5KFB A;  5KT6 A;  1M5S A;  1FTR A;  4LFB J;  4DR1 E;  3RB3 A;  3HVW A;  1HNX J;  1SC3 B;  4J90 A;  1NK5 A;  3L7Z B;  3MOZ A;  3K2Y A;  4MYT A;  3TUJ C;  1JB0 C;  2HQG A;  1S16 A;  4KR0 B;  2J7U A;  3JS9 A;  2N4D A;  1U1M A;  1JIH A;  2BA1 D;  4OZJ A;  2R7S A;  2HQD A;  3FEY B;  2F4V I;  3MMC A;  3W62 A;  3DXB A;  5DDQ C;  4ES3 A;  2ZZN A;  2MQL A;  2UUA J;  3CJ4 A;  1CVJ A;  5D8H B;  4P6Q A;  5KFC A;  4EU0 A;  1SQF A;  3H1C A;  1RWW B;  3NGD A;  2HWT A;  2MJN A;  3F41 A;  4CLF A;  2UVR A;  1KLM A;  3H5U A;  4XDC A;  4U67 Q;  2AMC B;  5E33 A;  5BR8 J;  2QYC A;  2YKO A;  1YRU A;  1CS4 A;  4ED6 A;  4LVN P;  1CJU A;  4K2J A;  1U1N A;  1OYE A;  4KQZ A;  2ASJ A;  1V5I B;  3VZH A;  2R8H A;  1S9E B;  2V68 A;  4NAS A;  2MKY A;  2VPY B;  2JX2 A;  4YDD B;  2HHH I;  1TP7 A;  5IWA I;  2GML A;  4LR8 A;  4U7U D;  4LF7 J;  3BF4 A;  3QT7 A;  2MQO A;  4XTJ A;  3CC7 S;  2BRK A;  3LAL A;  4PG4 A;  2C37 B;  4WF9 Q;  1SKS A;  2PE8 A;  4K2X A;  1XEZ A;  4K0K E;  1MLA A;  4DR6 E;  3KLI A;  4YB6 A;  3RBE A;  3DXS X;  2BM1 A;  2B9X A;  4C4W A;  4MKY A;  3RBZ A;  2MKK A;  3A3P B;  5KFT A;  1K47 A;  4A8S A;  4NLD A;  1R8B A;  4AD6 A;  2HHT A;  5ETS A;  3ENQ A;  2COL A;  4QU6 A;  3PJX A;  2DH8 A;  1RZM A;  1ZA1 B;  2DNH A;  3W5Y A;  5JEA E;  4KPC A;  1S0M A;  2G0C A;  1RU1 A;  2GO4 A;  1T03 B;  3HKW A;  4CLZ A;  2A18 A;  1Y0H A;