4DXLA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
VSDWVPTGAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 97
structure length 304
sequence length 304
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4dxlA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dxlA01
4DV7E 4DV7I 3ZM7A 1IBLI 1Z0BA 4DPWA 2EFGA 4DPTA 5IT9C 1ZM3A 4DR1E 5GMDA 4FW9A 4WUDA 2UUAI 4DV6I 4LF4E 1D6TA 2UU9E 2V34A 2F4VE 4B3TI 2UUBI 1MU5A 4JI4I 1ZXMA 1N34E 2R42A 1ZM2A 1IBLE 1RREA 1IBKE 3F0NA 4YY3E 5GMEA 2X36A 2OI2A 4DV2E 1Z0GA 4JI1I 4DR6I 1ZM9A 4R1FA 4I3HA 3WU6A 1Z0CA 2A2DA 4AQYI 5BR8E 4DV4E 4JI6I 4JI6E 3M6AA 4DUYI 1MG7A 3K17A 2GS8A 3B8HA 4HACA 2E1RA 4P7AA 5A2QQ 4JI5E 4JI3I 4DV6E 1DARA 2HHHE 2HHHI 1H72C 3J80C 3Q1QA 4K0KE 1N32E 3B82A 1FNMA 4PRVA 1KVKA 1Z0EA 4LF6I 1PIEA 4X64E 3K1JA 1XMOI 1HR0I 1Z0WA 1RR9A 1N36I 4JI5I 1H7UA 5LMUI 1N36E 2HK2A 1MX0A 4WUBA 1QZRA 4DUZE 4OX9I 1Z0VA 4LF6E 2J7KA 2VQEE 3WU5A 2LJPA 4LFBI 4LF7E 3PYGA 4JI7E 5LMUE 4LF4I 4DXLA 4LF8I 2NPFA 1OJ4A 4LF8E 1Z0TA 2UU9I 4DU7A 2F4VI 4USKA 4DR2E 4DV4I 5BR8I 4FN5A 3LTOA 4DPYA 1NHJA 2VQEI 4YY3I 4HACB 2HFUA 3LNUA 1XNQI 2UUCE 2UUCI 4Z7CA 2CZ9A 1N32I 4B3TE 3PYDA 3J7AM 4X62I 4DU8A 4NXNI 4DR2I 4OX9E 1IBKI 4DV1E 4X64I 1FKAE 1K47A 3ZKBA 4DR1I 4YHHI 2UXCE 3WU4A 4DPUA 3ZZTA 2Q2EB 2V2ZA 4JI7I 2AJ4A 1HNXI 1WUUA 5IT9Q 4K0KI 4GKJI 2ZBKB 2BM1A 4X66E 5FLXC 4FWGA 3J7AG 4X62E 4DUZI 3GONA 4DR7E 1N33E 4M1KA 2VF3A 4EMDA 1EA6A 3H4LA 4JI3E 4LF7I 3PYFA 2BV3A 1I94E 4DV3E 3CWVA 1I94I 4LF5E 3QT8A 4GKJE 4NXNE 2X7IA 4URLA 4XTJA 5IWAE 1FWLA 4RPFA 1XHKA 1Z59A 4X65I 2R3VA 4HXZA 4DV2I 1HNXE 4PU9A 4LF5I 3B78A 3QT6A 1IBME 4DV5E 1Z5BA 1H7SA 4AQYE 1NHIA 4JI0I 3J80Q 4JG4A 4DUYE 4WUCA 4JV5E 1VISA 2ZITA 1HR0E 4DR3I 4GKKI 3D4JA 4LFBE 4FWHA 3T1HE 3V5RA 1J5EE 2DEIA 1Z5AA 4JI2E 3J81C 4B3RE 3WU3A 4ZVIA 4LFAI 4B3RI 1ELOA 4B3SI 4DPXA 1KTVA 4DR4E 3ZZUA 1HNZI 4LFCI 2UXBI 1N33I 4DV1I 4HY1A 3ZKDA 1S16A 4JI8I 1Z5CA 2UUAE 3T1HI 2UXDI 3T1YE 1N0UA 2A2CA 3QT5A 4B3MI 3OTOE 4KHPI 4B3ME 3ZZ0A 2HKJA 5L3JA 2BM0A 1H74A 1HNWI 2V2VA 1BKNA 4UTGA 3JAMQ 2VQFI 4DR3E 4GKKE 4MYTA 1EI1A 4KQVA 3V2UC 2E5LE 4ED4A 2UXDE 1FI4A 1PVGA 2E5LI 4DV3I 1XMQI 1A6FA 4B3SE 1S4EA 4JI4E 4JYAI 2ZM6E 1FJGE 4MYUA 4FWDA 1B63A 1FWKA 1XMOE 2VQFE 1XNRE 1XNQE 1KIJA 3QT7A 4PRXA 1KKHA 4DR6E 4LFAE 1N0VC 4DV5I 1N34I 2HKEA 4NXME 4DV0I 2ZM6I 1FJGI 4LFCE 2UXBE 4JI0E 3J81Q 2HK3A 1UEKA 4JI8E 4YHHE 4LF9E 2UXCI 1ZM4A 4X65E 4JI1E 1XMQE 4Z7YA 2UUBE 4X66I 5LMNI 4USMA 5LL6R 2XEXA 5IWAI 3HULA 4DR7I 4HYMA 4LF9I 1H73A 3JAMC 1IBMI 3OTOI 4KHPE 2DEJA 4DR5E 4DR5I 4JYAE 5LMNE 2WW4A 4NXMI 1NHHA 4DV0E 3LPSA 4DR4I 5A2QC 1HNZE 1HNWE 5FLXQ 3PYEA 4JV5I 2HFSA 2V2QA 2V8PA 1XNRI 1U2RA 4UT4A 1B62A 1NZ0A 1J5EI 4P52A 1PKPA 1ZXNA 3T1YI 4JI2I
chains in the Genus database with same CATH superfamily
4LRAA 1S77D 5ETRA 3LWMA 3MI7X 2VQEE 3SV3A 1REVB 1S6QB 1UJ6A 3K85A 2HHWA 3CCJS 1JNZB 4R25A 2EFGA 3BZQA 2AHOB 4LCFA 2IVFB 3P3GA 2MQMA 2OPRA 3M7VA 3PEJA 3KUGA 1E6VA 3N6MA 2XMVA 3A8EA 5ETPA 1ZPVA 4JOUA 4KGZB 5GMDA 5KFWA 4KPYA 3JSBA 2C38A 4WUDA 4AUKA 5KT2A 2RQ4A 4CZCA 4LF4E 5EX0A 4RNFA 2CG8A 2ZNYA 4X4PA 5I3UA 5D4OA 1LW0B 2D74B 2EPIA 2H5EA 2JSXA 2ZBIA 2AZ1A 3NGTA 2BW2A 1W26A 4P71A 1SJFA 2HHVA 2NXJA 2UU9E 1JNRB 3PHEA 4OYIA 1QUVA 3D6FB 1RLDA 1WHVA 3PZPA 2W2PP 4Q43A 4JI4I 2PO1A 3NLCA 2ADBA 3HHLD 1X5PA 3V6HA 1A9NB 2EFVA 4DF8A 4EZ9A 1ZM2A 1IKXB 3ZO7A 3DDKA 3GCMA 4LFCJ 1RAAB 3LUYA 2VKZG 3O2IA 4A8SA 4G3IA 2K7KA 4N5SA 2R8IA 1RADB 2Q6CA 2ZEJA 4KR0B 3DOMA 5EWEA 2AYBA 2YKPA 5IOLA 5F9NA 2XWXA 3GYXB 3PACA 1UPMB 4LBPA 3KLHA 3V81B 3THTA 1N48A 1RHUB 3R2DJ 3DRSA 4B3RJ 4F02A 4MU4A 3QGHA 2M70A 1Y00A 3FCVA 2E9TA 4NLSA 4DV2E 4OI6A 3KHHA 1Z0GA 3NWRA 4PRXA 3VAMA 2VUGA 1ZM9A 3O8WA 5E3AA 2FJEB 3AJDA 2PMWA 2ALYB 4NXNF 4QU6A 4I3HA 1TZ0A 3MMCB 3H0PA 3A12A 5A0YB 2NZCA 4ZPAA 3H25A 4OI0A 4O3RA 1TL7B 3MM8A 4BA1B 2HEKA 3ULHA 1RT7B 4B3OB 2WB4A 5H9EK 3K5OA 4FF1A 1H2TZ 3CCLS 1CQNA 1FNOA 3JYTA 3EYZA 1YG0A 3TVZA 3EGWB 2KTQA 4JI0J 4Q2LA 4QW8A 5F8IA 3VAFA 2PNLA 3NGUA 5HP1A 1R0AA 3FMWA 2Q1LA 2L48A 5KFIA 2JLEA 2MHNA 2RS2A 4EZ6A 3SYZA 4DV6E 1AA1B 1DARA 4R0JA 2DGUA 3OR1A 2JVRA 1X5SA 5AXKA 4B02A 1O5JA 1YITS 4LF5J 3HHNB 2BR2A 3J80C 2YWGA 3SBMA 4FW6A 4ED6A 5BXIA 2BA0G 4WKYA 2MQLA 1T03B 3E01B 3DD6A 2OPPB 4CT8A 4B3TF 4TQRA 4O0IA 3M30A 1C0TA 4X4SA 1BQMA 4ZP6A 2F40A 5DO2A 4EBDA 1TK5A 1KVKA 4F4YA 1FJGF 4PRVA 1NSKL 2FZKB 4DSKA 4NZ7A 1KVIA 4AYBD 4B9SA 1EKRA 1FX2A 4C2MA 3LGHA 1UDQA 1R6MA 3KJQB 4QU7A 1TKXA 4TU8A 2VQEF 1GMWD 5F8GA 4H4MB 1RTJB 1HNXF 3GFHA 4EO6A 2FJWA 1LW2B 2CQ0A 4ZVOB 3ZNJ1 4M5DB 3MOZA 4PAAA 1MMDA 4F2RA 5F8JA 1Z0WA 1RWUA 5FWKA 2K3IA 4OHZA 1TV6A 2NSBA 3PJWA 4ZPWR 1TKTB 4AIDA 4YR3A 4EWTA 4F3QA 2DNPA 1I94J 4BA2A 4L75A 1TK0A 4UOGA 2VG5B 2DIVA 4QIWD 1I94F 2DPJA 1D9FA 1CJVB 4XDCA 3ILJA 4H4OA 2HBZB 2LDIA 3I4HX 5LSOA 2VZ9A 4FYXB 2H48B 4KT0C 5HVFA 2XYGB 4P2XA 1N88A 3AXKA 2JEBA 2GZOA 3OHAA 1IKXA 1APSA 4DUZE 3R1HA 1QAJA 4DV7F 2KHDA 4BCAA 2BJ3A 1MW7A 2QLBB 3C66A 3HSJA 3A3PB 2B56A 4DL6A 1UVIA 2J7KA 4PPZA 4WF9Q 3WU5A 1SJQA 3EVOA 2VFVA 3FQLA 4M5KA 5F3TA 1PSDA 2OLWA 2JHEA 3SMZA 5C7PA 8AT1B 4P75A 3G6XA 4DUZJ 1PO6A 4JI7F 5EWFA 4Q0BA 3CB4A 4LFBI 4U8VA 1VRUB 2DR7A 4ZVQB 1A6LA 3V4MA 3KLGB 2VQEJ 1TKDA 1RUSA 1X4CA 3ADAC 3R9LA 3T5KA 3BN4A 1SPBP 4FF2A 2K1RB 4M5IA 1BQMB 1RT3B 2Z2MA 5L9XA 3WX4A 4ED0A 1JJ2R 1IBMF 2UUBF 1U2CA 2ACMA 2ZZTA 3P45B 2BKPA 1PJ5A 3MR7A 4USKA 3UCUP 1UFWA 3JTOA 2FJDB 3C14A 3ISZA 4LR7A 5BR8J 4M5JA 3SZ2A 4OZEA 4DR2E 5BR8I 1U1OA 4B3OA 4DR1J 4DWIA 2ZHOA 1P9YA 1QUPA 4IQMA 1R8BA 1FKAF 2DYAA 4N47A 2N82B 5D77A 2HWTA 3LTOA 5F9LA 3NMAA 4DZDA 4CH1A 2V8DA 1TAQA 1MN7A 3NKYA 2BXJA 2R7WA 4YY3I 2C39B 1CJKA 5HMXA 4DR2J 1JLFA 2YQ1A 3PRVA 1P27B 2HFOA 1WF1A 4C3KA 5KT3A 5E3PA 2GFFA 5ETTA 4EBCA 4ZCIA 3VTIA 1VGYA 5LMUF 1ZZFA 1S1TB 1S79A 4RUBA 2UVWA 3EGZA 4IZJD 2HNYB 5CAAA 2CJKA 4B3TE 4NA1A 1IWAA 2CQ1A 4OYZA 4FXVA 1VI7A 3H98A 5KFBA 1N5VA 2HGNA 1QVGR 4DU8A 1YJTA 1S6UA 3WBZA 2C38B 4ZLLA 1REVA 3UN2A 3SCLE 3I5CA 3EZ5A 3DU6A 2U1AA 4O4RA 3KLEB 3K8WA 4DV1E 3NEKA 4URGA 3QFHA 2BRKA 3D6TB 4USHA 2J6TA 3T6BA 1HYSB 4X64I 1QVFR 4NMLA 5EN1A 4DR1I 4YHHI 5DRPA 4JI3F 3ZZTA 2RQKA 2ZNZA 4MIWA 1N36J 3CD6S 3KK1B 3GIKA 2YWWA 2RNEA 3FUYA 1XMOJ 4JI7I 3D54A 3MR3A 2BOPA 3OD2A 2PNZA 3HDSA 2WCXA 3FNNA 2W9CA 3G6VA 1OQ6A 2LP4A 1OY6A 1UW9A 1V3ZA 1WUUA 3MTKA 4MKBA 1YKWA 3OUYB 3H1CA 1Q5YA 3ZC4A 5IT9Q 2D7SA 1DY3A 3D67A 3ETOA 4I69A 1AT1B 3PXGa 4ILLA 1SIZA 2U2FA 3IAS9 3DGPA 1WNEA 4P7VA 2WBRA 2NCKL 3D2WA 3J7AG 1VJQA 2XS7A 2V8HA 4HI1A 1FJCA 5K36E 1IKVB 4X4RA 4RNHA 1A0OB 5E5NA 2J8SA 2HURA 4YN3B 5F3ZA 2Y9HA 3FBEA 2D1CA 3LH2S 2XMWA 3NBPB 4OHVA 2DNHA 3GONA 2XLKA 1IBCB 2LECA 2HHHJ 5DG8A 2FGCA 4EMDA 3BKTA 2B0GA 3UPFA 3ENQA 4LRDA 4NZ6A 5KT4A 5JJBA 1EA6A 3H4LA 5B0GA 1VR6A 4NYZA 2B8QA 4BC9A 2AQ4A 2UXCF 1JLCB 3MM8B 4QR0A 3RR7A 1FFSB 1HNXE 2OPPA 2Z57B 3HD2A 2XZTB 4WE1A 5KFLA 1D09B 2UZAA 4TN2A 3W5ZA 4FNIA 5HMWA 3M8QB 1S10A 4B9NA 3CWVA 5DRQA 4USJC 1F2GA 4LF5E 4PWWA 5J2PA 3THVA 2UVRA 3L7ZA 3BS9A 2CPFA 4EBEA 3DLGA 5LMUJ 2KRRA 3M2RA 2IDEA 2KZMA 4MK9A 2R2UA 2ZZNA 1NPRA 2OPQA 2X7IA 3PM9A 3PEHA 4DV2F 4HTJA 3HKMA 2HFNA 3EJMA 2KI2A 4RW6A 4A8QA 1YJ9S 1DFDA 2ROEA 1FWLA 3BREA 3WZ0A 3JAMU 1EP4B 1R0BG 4GRSA 2D3O1 4LF6J 2DHGA 4RPFA 4RWWA 1VLOA 3EZOA 1T9WA 3QRRA 4N8OA 1X8DA 1Z59A 4F4WA 1NKBA 3U1KA 2F1DA 4NLDA 2WNRB 3M9NB 3RB4A 4HXZA 4LF5F 1Q5VA 2KT5A 1X4DA 2O01C 3J7Z5 2MZQA 2RKIA 1VHIA 2ZUGA 4FPRA 4WPAA 4CO2A 1TAUA 4LSNB 1K73T 2IY5B 1OYPA 2AEFA 2JH3A 3HD1A 4UW2A 3QT6A 1R8AA 3FSIA 1FKOB 3SSSA 2HZVA 1Z5BA 4G1QB 2K8GA 4DV5E 1NHUA 1Y7PA 3OTCA 1C1CA 2MZSA 4TXSA 1RT6A 2DNNA 3GIIA 3CJ2A 1KONA 2JRSA 1NXIA 3AODA 1WORA 3F73A 3MGJA 3OJSA 3QSYB 1X9SA 3QBCA 1OPZA 3RBZA 4HL9A 4OYAA 4WFNQ 2J0SD 4Q0BB 1B7FA 3CEDA 3KLIB 1UFLA 1VISA 1R8CA 4KGKA 1HI1A 2ZDOA 3ZTSA 2OD6A 4ECVA 5H9FK 5GAEI 2MGZB 2FJXA 2DNKA 1RT3A 3IBCB 1LKZA 4MKAA 4NX9A 2HNDB 2AJQA 4LFBE 4ES1A 5CA5A 4RBUA 3V5RA 4ECUA 3ZZRA 1KHVA 3Q8RB 1J5EE 1LWCA 4NLYA 3OVAA 4ETXA 4Y0FA 4J3DA 3BDEA 1HARA 5F41A 3T3FA 4MFBA 4WK1A 2DGVA 1IM6A 2GMLA 2D3ZA 2VDIA 4LFAI 2NLWA 3PS3A 1VLYA 3KG4A 2RQMA 2ZH6A 1ZA2B 5KT6A 2E5HA 4DPXA 4JV5J 3BYPA 1SJ1A 1UCNA 1P1TA 1S99A 2B9EA 2G2YA 2GW8A 3CCWA 2R7OA 3HHLC 3PFOA 3ZZUA 4CYUA 1KS2A 2RVJA 3CNQP 4ZK7M 1JX4A 4LFCI 1IBKF 1I51B 4O3OA 4MJKA 4ICLB 3T1YJ 3AB2B 1BGXT 1IKWA 4CQ1A 3SSQA 2ZWPA 2QYCA 1CULA 3CJ5A 4DQRA 3A13A 3RAXA 2X1AA 3HXMA 1KRPA 4MAKA 3ENVA 3CMES 5K36C 2XULA 4RBTA 4DG1B 2OGUA 5GAEU 3EVWA 3PW2A 3IG1A 1UMJA 4NCGB 2A2CA 4GMKA 4WCEQ 2H4YB 2QX0A 3DMJA 3KJFB 3QT5A 3IM8A 4CI0B 3FK4A 3HT3A 3Q8PB 5HVGA 4B3ME 4KHPI 3ZZ0A 1S1VB 2DY1A 2JOQA 2M0GB 3VGUA 5HJXA 4NXMJ 5L3JA 2DRDA 5A6WA 4R5PA 3B6BA 2BM0A 2RMLA 3BO4A 2XMKA 3LALA 4IFDC 1RXOB 5EGYA 5K36B 1RWXB 4W98A 4F0MA 2BQ3A 3EVMA 3VZHA 3A8IA 3T1AA 1SVDA 2HWIA 2K3KA 1NH8A 1VRTB 2P6TA 4NLQA 1T02A 1CQMA 1GXUA 2QSFA 4UTGA 1IBLJ 4JI4J 3JAMQ 1VOMA 4DR3E 4URQU 7FDRA 4A47A 3GFYA 1YHCA 3IXQA 1PG5B 1UDOA 3UCGA 3ITHB 3M2UA 3V2UC 3D0IE 2F4VJ 1AB8A 1REGX 4F26A 3I6PA 2MEWA 1S7IA 1TUWA 4KFBB 2E5LE 1FI4A 2RDDA 3HHEA 3PTWA 2JEGA 1EQMA 4AT1B 3TA2A 2HQGA 5KOXA 4KJIA 3GJQB 3U1LA 5E2QA 2GGPA 3OXGA 4HLBA 2W9AA 4DG1A 1WACA 4QW9A 3OL7A 4I67A 1BQXA 2NUHA 3JSMA 1RQ0A 2R2TA 5IWAF 3X3UA 4IQXA 2ZM6E 4DV1I 3W5XA 4V1Ak 3UO0A 1N34I 2WOMA 3DM2A 2G2OA 3SQGA 3BKUA 1TKZB 1FWKA 2JE6A 1HQUA 4DR1F 4FZVA 1CSJA 4ISAA 1VYAA 2GVZB 4M5HA 4WFYA 1VQ9S 4NOHA 1XMOE 2XS5A 1UWBB 5CCLA 2AD9A 1WKJA 1TR0A 5M2RA 2QA4S 4DSIA 4IFDF 2YNFA 2FC8A 4ZPBA 2C2EA 3BBBA 4TY9A 1D9DA 2DJWA 4V19J 5GAHI 1NJIT 1U8SA 4PWUA 3FBBA 4RW9A 4KE5A 4MH8A 2YKNA 3KG0A 3U7JA 3WHIA 5HVHA 2B5JA 2NUUG 3FCHA 3LAKA 5GAGI 2Z2YB 2DBBA 3KLFA 2JVOA 1ZPWX 2IC3B 3LF0A 3PO4A 4LF6E 4MIBA 1NB7A 2BE2B 5J2NB 2XMJA 2XZWA 3CCZA 1DJ0A 2VU5A 1N0VC 2Y0BB 1N34J 4DV5I 4M5NA 5GVQA 4GO5X 1N8RT 1WSRA 4OFZA 2D41A 3UWTA 1RTDB 3DKDA 4OHYA 3MURP 2FQQB 1VQPS 2UXBE 1E6VB 4K5RA 5D0RA 2ZE2A 2MB0B 3PV8A 4Y28C 3P3DA 1UEKA 4IZKB 1C2PA 2XWYA 4PXBA 2CQBA 3MM7A 1GEHA 4RR5A 4IO1A 3ZZPA 1PJ6A 1ZM4A 2WOMB 2PFFB 2DTJA 2HBYB 4I2QB 5AT1B 2BJ7A 1NHVA 3D66A 4DZ6A 4RW7A 2LU1A 1FKOA 2VPYB 2ZJQQ 1XMQE 3CT9A 1R3NA 5KFZA 3UVJB 4ZVRB 2WSCC 3W66A 2G0CA 4R8UB 1BWVA 1Y0HA 5CD4A 2R2RA 3L7ZB 3FKBA 2UUBE 2FTRA 4YOEA 3R6GB 2XMMA 2AU0A 3K5PA 4QZVB 3M4XA 2E1MC 4A8XA 4B3RE 5LL6R 1RT4A 1UVKA 4CO0A 2QN6B 3MM5A 3J80U 2A18A 4PYAA 4PXDA 1WF2A 4FYWB 5THWA 1U48A 1FJGJ 2DR6A 3NNAA 1AFIA 3D3CJ 4CIOA 4C3LA 1KLNA 1Y5IB 2UUAF 1OYSA 5F0WA 4LF9I 1IM4A 5C42B 4L3KA 4ENOA 4TLRA 5EL9A 2V5HG 2C3MA 2P9GA 4RZRA 1HLWA 4DL2A 1AZSB 2JT2A 4I56A 2IFXA 5ETMA 3SXLA 1WTFA 5IQ6A 3OVSA 4KHPF 5K8OA 2KRBA 1SC6A 2MKHA 4P9SA 2GVDB 4DFPA 2FLNA 1U0SA 4NRUA 2Z5CA 4TY8A 4IH6A 1YBUA 1M5SA 3B4DA 2K06A 2AMCB 5L46A 5IZHA 3M8RA 4F3OA 2CPYA 5I42A 3NNCA 1NHHA 4JV0A 2OFGX 3NAHA 2IM2A 4Y2MA 2HBRB 4RW4B 2GJFA 1S5ZA 2KKHA 2OUGA 4J9PA 3SI8A 2VONA 1CULB 1GX5A 4ZLJA 4LR8A 4JV5I 2JC1A 3BN7A 5D4PA 3L7OA 1X31C 5ETLA 3W62A 5L9NA 1CJUA 3PIOQ 4A8YA 3V4IA 4ECRA 1HR0F 3DOKA 1WEXA 1E3PA 2IOQA 4C11A 3UN5A 3H5XA 2XO6A 4JYAJ 1E3HA 1XNRI 1JLEA 3NXZA 4UT4A 1R8HA 2P5VA 1NZ0A 1HBMB 1S7HA 1U6ZA 3UVJA 2NXNA 4XIUA 4IZKA 3HFKA 3OL8A 3OJUA 2Z8QA 4J9QA 5FD1A 3IRXB 1N33E 1SQGA 2CWKA 2E5LJ 5H9FJ 3H4BA 3VAGA 4JI2I 4MTPA 3OUYA 4ECSA 4ALZA 3GG0A 2BA1D 3H40A 1HL6A 2GAHC 3OSNA 3VAJA 3V81A 2VESA 4B3SJ 1OSDA 2KJVA 4AQYF 1L3VA 3C6UB 1X0FA 5DM6Q 4TYBA 3H5YA 2LKZA 1U1PA 2CQGA 5LMNF 4PWDB 1S1XB 3BBCA 2RDJA 2HPUA 3ZM7A 1Z0BA 2B8PA 1MU2A 4DPWA 4ZJOA 3TRGA 4RNMA 3GIJA 1C0TB 2QGFB 3OBIA 4DPTA 2F8EX 3KWMA 4X64F 3DLKB 1ZM3A 3M8SA 2E5GA 3G6ES 2FVRA 3KLEA 3D9BA 2BE9B 4OYWA 4LFBF 1V5VA 4LRBA 1F3FA 4GKKJ 4YDDB 1GTEA 3H2UB 3H2LA 2H51B 4RW7B 2OD4A 3FVYA 1JLAA 1SH2A 2ZD1B 4AD6A 1VQKS 4DV6I 5L1KA 5KFHA 4ZP9A 3OW2R 3M6UA 1QSSA 3HZEA 3MUVP 2YNFB 4A8WA 1S0MA 1TMMA 1VRTA 2KYXA 5FDLA 1GTHA 4F0HA 2Q66A 4B3TI 2F4VE 5CABA 3A1YG 4AL7A 4GKJF 1MU5A 3EPIA 4K50A 4UY8T 2HHUA 1XBWA 2ZH9A 5C0XC 2LA4A 4DOZA 2GQQA 3MAHA 4DV5F 3U1YA 4N7TA 3GILA 2IRUA 1RA6A 4I6WA 5IC6B 2L41A 2NN6D 2BACA 1RREA 1XTZA 1SJ3P 1IBKE 4HI2A 4RLEA 3TZXA 5C0XD 2ZC4A 3RTVA 4DV2J 1ZAVA 1FRLA 2X36A 4YY3E 2XSJA 1TTHB 4A8MP 2Z0GA 2LQJA 3A3NB 1EETA 2DGXA 2GGPB 3PW5A 5CYMA 2LXFA 4FKYA 1WI6A 3W7BA 1KOHA 1JJCB 5D4LA 4PUOB 4FW5A 2OI2A 3EGVA 2NN6F 2K2PA 4KFBA 1IWGA 3HSDA 1RCXB 1HQEA 4DN9A 4YQWA 3AD8C 2IVMA 3C6UA 3MR5A 1Y6ZA 1F5CA 4ZPTR 2DNYA 1GX6A 3BEGB 3EUNA 4NLOA 5AE2A 4I2PB 2OPRB 4ECTA 1YI2S 1YJNS 5JEAA 2JEAA 1NZAA 3ZTOA 4R1FA 5G0RA 2KJWA 3RBEA 2GO3A 2VL1A 3CJSA 2CVIA 1QM9A 5B0CA 1MWYA 1Z0CA 2RIJA 2XMUA 5JVHQ 2A2DA 4AQYI 2CPIA 5BR8E 1E6YB 2OTLS 2RS8A 4JI6E 3IO1A 4CH0S 3R1LA 3BPSP 1RKIA 3MEGB 4DUYI 3FEZA 2AV5A 3J81j 1S6OA 1UA0A 1ACMB 3K17A 5CHCB 4C0OC 5IT4A 1S59A 2NS1B 3RR8A 5A6PA 3TARA 3A8JA 1UPPA 4YB6A 1ZAWA 2QSWA 4QIGA 2DO0A 3D0HE 4OLPA 1QSLA 4P7AA 2VPZB 4QWAA 4JI3I 3KHLA 1A7GE 4A8OA 4OKGA 3NGKA 4RW9B 3TAMA 3TR5A 1FK9B 1WKLA 1H98A 1YVFA 2P9EA 2WSEC 4F50A 2BA0D 1FTRA 2HHHI 4K0KE 2QIFA 2KL8A 1YH8A 1KN6A 2V6AA 3M7ND 2UV8G 3B82A 4YB5A 3BDPA 1R31A 4IOCQ 1IVZA 2CWXA 3EDRB 1HMVB 1N5SA 2QZ8A 5J1EA 4N76A 1FNMA 2G2ZA 1BWEA 3IFEA 2ZM6F 3HFZB 1KBRA 2POKA 3R5AA 1GMWA 2I38A 3N79A 3KJVB 1R7IA 3PW0A 2DY9A 2VC0A 4QYZJ 3M1VB 1N6QB 1FHTA 1U2FA 2B4PA 4LF6I 2KFNA 1PIEA 2MPUA 4DV0F 4ANDA 4ED8A 3L4BC 3KK2B 3CC7S 5DM7Q 4YFUA 4AM3A 2E1CA 1X60A 4WBFA 5KG3A 4JB8B 1X5TA 3K1JA 3MEGA 2W9CB 2HWHA 2ASJA 1HNVB 3CGIA 2UUCF 3BPDA 3MR2A 4GO7X 4QYRA 2XCPA 5ETNA 5LMUI 1SH0A 3LPEA 3MCNA 3PY8A 3C8YA 3EXCX 2CRLA 5KFJA 2X3GA 3ZZOA 1MX0A 3NCRA 2C2NA 1EP4A 2PEBA 3DRYA 1RBLA 5IXUA 4EEYA 2DH9A 2HVDA 1IQTA 2HVZA 4P7TA 1C4AA 2XM3A 4J9NA 1RISA 3IS9B 3M8ZA 3PJXA 3RB3A 1RHRB 3B4TA 1SB6A 2J9DE 4OZLA 5K8NA 4O23A 4O4GB 2YX1A 2DNGA 5SUHA 3D1HA 1X4EA 2BR2B 4OX9I 1AZSA 3HHLA 2GHPA 3DLEB 1BMQB 4F4XA 3PVXA 3W9IA 3M8PB 3GIMA 4TYAA 2GAGC 2R4FA 2MSSA 3F41A 3GMGA 3HZGA 1Y5YA 1T11A 3S01A 4A48A 4C3MA 4ETZA 5T14A 5L1LA 2BA1G 4DCOB 2C3PA 4C4WA 2CUYA 4FXDA 5IT9Y 1GFWB 3H5UA 3OTDA 3AH6A 1RWKB 1D3WA 5KG6A 1UL3A 3QLHA 4A4JA 4ZVSB 2N3OA 3BO3A 1FRIA 3PYGA 2IYIA 1RT5B 2BOAA 1N5YA 1AUDA 1FEEA 4LF8I 2HZCA 2NPFA 2WVFA 3Q89A 1VQNS 2BEFA 4CNYA 3DYAB 4LSLB 4DU7A 2ZOFA 3EZUA 1Z0TA 3K89A 3AOAA 1VC0A 3CD0A 4TLQA 1VIXA 3P49B 4WZQA 1KNZA 4DQQA 5A8KB 2CPJA 2ZVIA 4M5MA 3K5LA 2R7TA 3MDFA 1NKEA 1B99A 2AX0A 3D7SB 1TU0B 4O44B 4YHHJ 2BABA 1G4CA 1FE0A 1X5OA 3UDVA 4O0NA 2Z5BB 2X1GA 3T41A 2DGQA 2MY7A 3FRZA 4FN5A 1FXDA 2YPZA 2LQBA 4MIAA 3US5A 4DPYA 4ES2A 3AOCA 1NHJA 2HGMA 3LNUA 1SJRA 4LFBJ 1FXLA 1WKKA 5BYQA 1Z2LA 3JYTB 3VAHA 1KLMB 3FEXB 3W1YC 4X62J 3QAUA 1OMSA 5IV4A 2J6UA 4Y2IA 3T1YF 3IMQJ 3FSYA 1RTHB 2CVEA 4Z7CA 1EARA 3VCDA 1N32I 2KHCA 1KWMA 3GQCA 1VQ7S 1W25A 2I0XA 4OQJA 2FLOA 4ANCA 4QWDA 3EX7B 5C25B 5DDPC 2MZ1A 4X4OA 1XMQF 3RU0A 4DR6F 4LPFA 3J7AM 2ZH8A 5KFMA 2KM8B 3RBXA 1XNQJ 3AD9C 1S0NA 1RAEB 4DR2I 3IR5B 3MAAB 2BJ9A 2J5AA 3C19A 4CCHA 5IT9U 2NXEA 3AAWB 3KJVA 1C1BB 1G1XA 4OX9E 1Y10A 3CCVS 1HFEL 3SDEA 1RHYA 1F9FA 1N5TA 4Q44A 4UUWA 4F36A 1K47A 1U24A 2AE8A 3ONQA 4PG8A 2UXCE 1M5HA 2F8HA 2XC9A 1TKXB 2Q2EB 2OEKA 2DNRA 2V2ZA 4OYOA 2VIHA 1HR0J 3MPDA 2L08A 1EQ0A 3GG1A 1B0VA 2EK1A 3PX6A 1SL0A 1F60B 2DGOA 1IJEB 4NEYA 4BBYA 1YTYA 2JWNA 3EDQB 4FKXA 2WK4A 2X1BA 4QIFA 5JVGQ 3T1HF 1HWUA 2J6SA 4K0KI 4DSJA 4GKJI 1QD1A 2G0IA 1ZOTA 1C4CA 1RT1B 1Y4ZB 3BF4A 4C6AA 3I0SB 1F5AA 2C42A 1S1WA 3NL0A 1S12A 2IC3A 4HDGA 1ICEB 2B7BB 4EI2A 2WW8A 2AF6A 2QYGA 2P8IA 4P74A 1D9AA 2GMHA 4ED1A 2IBOA 2J9EA 2V2KA 3JSYA 4CNZA 5HBMB 5DLGA 2VBXA 2CQPA 2DISA 3NWGA 2ALZA 2MJNA 3AXMA 1SH3A 1PYOB 1UEVA 3PX0A 3BYRA 1ROFA 1QE1A 1B70B 4JI3E 1F9HA 4HR2A 4KBIA 1MWZA 3F56A 4LF7I 3PCOB 3PYFA 5K5MA 3U1MA 1EIYB 5C0XA 4NYOA 1FXRA 1HQEB 4OJ3A 2BV3A 4OLOA 4W92B 1I94E 4DV3E 1MLAA 1I94I 2OPSA 1XJWB 2QV6A 4DS5A 2I5JA 3QO9A 4GKJE 4PG4A 1NK4A 5KT7A 2ZZMA 2C2ZB 2UVUA 5CZVA 4NXNE 3NMRA 3UCZP 1M5VC 3UW1A 2RF2A 1FVQA 2ADCA 2ZBCA 4F4ZA 5DRRA 4URLA 4IDKA 2YH0A 4XTJA 1Q79A 2RJZA 3IGNA 4HT7A 4DBQA 4L74A 1J5EJ 1SUQA 3K2YA 3LPYA 2RRBA 4FF4A 1UDSA 2XTJP 1NH7A 4A46A 1RAHB 5E3CA 5B0DA 4X84A 4RJVA 2DCLA 2Q79A 1YZ6A 1T95A 2BJ1A 3MFHA 4AIMA 1FT8A 2VPXB 3KMSA 2M7SA 3ZXWA 1RBOB 2HFVA 2AJFE 3P06A 3VAIA 2HHHF 5KFCA 2R3VA 4UZBA 1D8ZA 3Q24A 3DC2A 1XMBA 3BQ1A 1UFKA 3KLGA 1U02A 4CYUB 4OJHA 3HVAA 2HLUA 2AKWB 2H5IB 4ELTA 1I1GA 4WYLA 3HO1A 1F9EB 4F0KA 3PG9A 1N34F 1HI8A 1YQHA 3RAMA 2EI5A 1IBME 1FESA 2DXEA 2XI2A 1H0HB 3T5JA 2MKIA 4IR1A 1HK7A 3OQ2A 3LWLA 1P9QC 3VHQA 3J7YU 4AQYE 4B3TJ 2PO0A 1MU2B 4MU0A 3OLAA 1NHIA 2HVEA 1MROB 2P2CB 4FYVB 4DUYE 2C3OA 4WUCA 2Z5EA 4P10A 2J8AA 2L9NA 5KFXA 5FDLB 3M2RB 1HR0E 1TL3A 2PMZD 2DGTA 3S7RA 2EKNA 3WC0A 3T5HA 2EFNA 4DR3I 2YXLA 4RX6A 3TP2A 2EEYA 1WI8A 3L95X 5F8HA 2ZOGA 3KLVA 3QPIA 3FCWA 1P1LA 1N32F 3T1HE 3ELHA 2IJFA 1RWWB 5D78A 2HHTA 3T9NA 3ENWA 2OTJS 4UUXA 3TUPA 4JI2E 4R0EA 1Y11A 1U0HA 4CLFA 2JC0A 5KFNA 3DOLB 2E7XA 5E3RA 1VFJA 3OFEA 5CYQB 3WU3A 2OMOA 1WJ9A 3UNGC 2VG6B 4B3RI 3CCUS 1L3UA 4DCPB 2YKMA 3V6KA 2E1PA 1KTVA 1VJWA 1NDPA 4HT5A 4P2FA 3TQEA 2J0XA 3G82A 3MMJA 3Q6NA 4JI2J 2HQDA 3WIUA 4J9KA 2LQ5A 1X4GA 4X4NA 4HHJA 4N3OA 4W4MA 4ID5A 2JDJA 3CE8A 4Q2MA 2G13A 1WC1A 3ZKDA 2Z2LA 1Y60A 3E01A 2W25A 4CO5A 3UD4P 1U6FA 2YX4A 4YHHF 4ECYA 1I3OB 3BGLA 2K1RA 1L3KA 1LEOA 1Q16B 2IVYA 2OFHX 4J37A 4NMXA 4URSA 1XR5A 3R8YA 2NXUA 3MPUB 3IRWP 1I5OB 4NXMI 3OR2A 2C2DA 1RWMB 3DLGB 1U49A 1TL3B 2PNMA 4OV1A 3MM9A 3S1TA 4B3MI 3OTOE 2CG4A 2OPQB 3HI9A 2WVEA 3ENAA 4LVNP 3N01A 1RYRA 4K0KF 4WE1B 4CLTA 2Y1IA 4KY3A 3PKYA 2G1DA 2R7RA 1VQ6S 3ISND 4ZN1A 5FIIA 1G7CB 1VC5A 4CLSA 4KKOB 1F1BB 2EBGA 3E51A 5B09A 4ILMA 1H74A 2VFSA 5D0HA 4RW4A 4XPCA 1PGZA 3RBDA 5G4DA 3OTOJ 2KB2A 2V2VA 1BY9A 3DI6A 2ZBQA 4KYZA 1IBMJ 2HVIA 1OYRA 4LVOP 2PFDA 1AROP 1EHWA 3ITHA 4HYKA 2VFUA 2WSFC 3BSCA 3I9ZA 1IXKA 1FERA 2GQ2A 4PQUA 3CDJA 1Q8BA 2J76E 1D6TA 1EI1A 2PA3A 5DG9A 5DGAA 4I7FB 1NMEB 4WYWA 4OO1D 3I0SA 2DR9A 4NL5A 4NLPA 2W2OP 2UXDE 3QJLA 4UQTA 5JUMA 1SCJB 2XGPA 5KFVA 3AQPA 2DIUA 1XMQI 4PPDA 2GIFA 2M4MA 4WU2A 5C25A 2VHGA 2OH2A 1N5QA 3IBWA 3LANA 3KLHB 2V63A 2C2KB 4H4KA 2HSEB 1ZA1B 3DNCA 1SC4B 1X4BA 4NE9C 1A6FA 1S4EA 4JI4E 5SZTA 1UJ4A 4X66J 3W2WB 1S1XA 4EGLA 2KFYA 3HT0A 1JB0C 2BRLA 2B9YA 4MYUA 1M5OC 2HAIA 4BA1A 4M63A 3IG1B 5L38A 4OJGA 3W64A 1RBAA 2XCAA 4NI2B 1B63A 1HHQA 3BBFA 1FWPA 4LF1A 1Y4UA 1HNZF 9RUBA 4KSEB 1IR0A 5J2MA 7AT1B 4DR4J 5HQLA 1OIAA 3BGFA 3TUJC 2WP8A 2VQFE 3PRDA 3MM9B 4OYPA 1XNRE 2PGCA 1TP7A 1HWKA 4FVMA 4O3PA 5B08A 5CYJA 4Q45A 3QT7A 4QYZK 1S97A 1O6XA 2HAFA 2CQDA 3OR1B 9ATCB 2WBMA 1T9VA 4ZVUB 5F8MA 1LK7A 1U1MA 3Q2TC 2GHWA 3LP2A 3M7NG 3DGPB 3MUTP 2L9DA 4U7CA 5JMNA 4DV0J 4DR6E 4LFAE 1Q81T 2EC2A 4RNOA 3I9V9 4DSLA 3RJMB 2EBEA 1HNWF 1H7WA 1X7VA 1JLGA 2DCUB 2DVIA 2ZBRA 1SBRA 4G6VB 4NXME 5KG5A 3K58A 1DLOB 4PQAA 3TZWA 4DR7J 1S6QA 1NHKL 3CSKA 4PRFA 3TJAA 3CDEA 4K5SA 3CJ8A 4K2JA 4P2MA 4CT9A 3MMCA 2N3LA 2KG0A 1S4FA 3BSAA 2FB0A 2NZ4A 4IG0A 1JLBA 5DQHA 2FVQA 3H2VE 4DR3F 4LREA 4OZJA 1UAWA 4JI8E 4KO0A 5A8WA 4LF9E 1WWHA 2UXCI 4F25A 2E5JA 3BH6B 1WOSA 2YX7A 2MKKA 3M85D 5KFKA 1CJTB 4Y2AA 3ZZZA 5B7WA 3FRYA 2W8KA 1F5BA 4ED3A 2MQQA 1JXLA 1R0AB 3Q2SC 4OHXA 4F8RA 4IFYA 5A76A 4P6QA 3UD5A 4M94A 4ZIVA 4ZKAA 2QLFB 4YEAA 4JI1F 4XO0A 2DNLA 3P3EA 4CLUA 4TQSA 2H1YA 4KPCA 2F9JA 4C98A 1KVJA 5LMNI 5BJRA 1Q8LA 3R5DA 4USMA 5A8RA 3GU0A 4IDKB 5HLFA 2BKOA 1MNEA 1FA0A 3LGNA 3U1NA 4ZHRA 1R89A 1K8AT 2WP8B 5IWAI 5CYQA 3MHYA 2YNIA 4DV3J 2QMWA 2VOPA 1JLGB 1PKUA 4DUYF 3TA0A 3HKZD 3BSNA 2E66A 2R7UA 2E5IA 2RSQA 2RU9A 1SL2A 5KT5A 4QJVA 3V6JA 2Y1JA 2XG8A 3KRNA 1FD8A 2LEBA 2UXDF 4J7CA 1TL5A 2HYIB 2BX6A 3RZAA 2ILZA 4LOMA 4Y65A 5KG4A 4J9RA 5AXNA 5B0AA 2FHMA 4LCHA 1NUEA 4LF8F 2Z56B 3D28A 4KGMA 4QOTA 4Z37A 3OTOI 2DEJA 1XERA 3D1OA 3SQGB 4J91A 5KFUA 3KHGA 2MZJA 2M8DB 4DV0E 3LPSA 2UUTA 4NLRA 4DV4F 4DR4I 1SKSA 1JLAB 1HNZE 3K7RA 2HFSA 1LFWA 2IPOB 4OIXA 3PNIA 2FLPA 3E8OA 4LSZB 1B3TA 3ILIA 5F8LA 3P5TL 1EZZB 2BJDA 1HNIA 3QRQA 2QC3A 1R6YA 4H4KC 3CJRA 4DR4E 1R0CB 1KP6A 2CXEA 3G86A 3PHTA 5E3QA 1PCAA 4D3GA 5ITHA 2NQPA 1UDNA 5K36D 1B0TA 2FJAB 2BVZA 4NPOA 4QPXA 2H65B 3GE9A 2JLFA 3GCWP 1S6PA 2FJVA 2P6SA 4DFJA 2CQ2A 2YNGA 5EKWA 2E5LF 2XB2D 4DV3F 2ZVSA 2Z58B 4IO9Q 5GAHU 2GQ0A 2XLIA 2H54B 2F63A 4C8KA 5DGBA 1RACB 4K4SA 4RWXA 4CP5A 5KFQA 3CPWR 4JYAF 3LAMA 4X4UA 3M6XA 1C0UA 5DDOC 3OFFA 1DZ5A 2OJ3A 3IGVA 4ID5B 3QFWA 2AJ0A 2R7VA 3CD7A 2HNZB 4ZOSA 1TL1B 1KQFB 4KTQA 5IT9C 4LUBA 4EU0A 4DR1E 1TL4A 2PD1A 2IYGA 1GT8A 2WVBA 4KAIA 4OYBA 2VICA 3NZKA 4FW9A 2OP5A 2ASDA 2RHSB 1RZMA 1MSWD 5C2CA 3BGRA 2BW7A 2M9KA 2UUWA 3OR2B 1FRKA 5K8MA 3DDIA 4U9RA 3ILOA 4B3MJ 5ELWA 5KFDA 1TELA 2OAUA 3I4PA 3ICLA 2V34A 3C6TA 1VBYA 2UXDJ 4K8RA 2HHXA 1Y5NB 4P2SA 1QAIA 1Y9OA 1UWBA 3W2VA 3SSRA 5DS7A 2CGEA 3OTEA 2MQPA 1ZXMA 2MJUA 5JEAC 1N34E 1O8BA 2DHXA 3AB4B 5KFAA 4K4TA 2R42A 2JNJA 3TAMB 3PJ9A 1HHTP 1EETB 1SJ4P 1HPZA 2ZH5A 2CPHA 1OY9A 5HQ8A 2X1FA 4LIRA 5GMEA 1V3SA 1PBUA 1XWLA 2CNKB 2W2QP 3H90A 3IC1A 1L3SA 2DR8A 4X65J 4JI5F 2Y1RI 3MOJB 3MF5A 3NS7B 2LQ8A 3CIMA 2D69A 5AE3A 3FBFA 4LFAJ 3OXFA 4RU9A 1RTHA 1SKUB 1KFDA 2ZH4A 2IM0A 1QLNA 4IFDA 3W3SA 4BWJA 3R2CJ 2QL5B 3TYTA 2FY8A 2QT7A 1N52B 2DB1A 3RUBL 3H7HB 1JJHA 2MLXA 3L9ZA 2R2SA 3FDSA 4PKDB 3AHPA 2RE1A 2LEAA 1DURA 2M52A 3MAAA 4JP8A 3CJKB 3NGSA 1HIYA 3NY0A 3UN3A 5GMKa 1WOOA 2YBVA 3CMQA 2PO0B 1FCAA 2W4CA 1UKUA 1FKPB 1MG7A 1JLEB 1T0TV 1T9TA 2M2BA 1LQ9A 2NPIA 2V9KA 3QGPA 4TNOA 5B0FA 3RRKA 2GS8A 4DLEA 3KXDA 1IJFB 4JV2A 3GFXA 3CCES 4HACA 4DX6A 4USTA 3DRPA 3Q22A 4LF7J 1F3VA 2AP6A 5KFTA 2IRYA 4XAKA 3M6WA 5A2QQ 3VZIA 3AA8A 3MEDA 1VCTA 2V69A 4WTOB 5CZXA 2XS2A 3EE3A 5F0UA 2BANA 4FS2A 2NN6E 2WNRA 2HHHE 4OO1C 1B4SA 3EXYA 4KH1B 3Q1QA 1N32E 3I5AA 3N6LA 4F3MA 2ZDPA 3FZBA 2GHVC 5AXLA 4AFFA 1RHJB 1HPZB 1RU2A 3AJ2A 3CULA 3P6YC 4OO1E 3M1VA 4LQ3A 4D3HA 2HS0A 2RU3A 2A10A 2DNZA 2MLZA 4LRCA 1GNKA 3TO8A 4V19X 4K0KJ 1SC3B 4EK2A 2XGQA 2IESA 4X64E 3V4IB 4U7UD 3SFGA 3LOUA 2W24A 3IN5A 1MWQA 2I5JB 1P8GA 2W4PA 3QO9B 5G0RB 2PI4A 2GNKA 3HJFA 1XMOI 4C97A 1PYTA 1UW4A 4YDXA 2CQ3A 4CO4A 1TFYA 2PO1B 1KOOA 1RR9A 1N36I 1NCLA 1KHWA 1URRA 2MQNA 3BKFA 2B4VA 4KIAA 4WWSA 4YB1P 1BLUA 3K59A 1H7UA 1OYEA 3B54A 3C16B 4UQGA 1S48A 3CDIA 1ITPA 2OKQA 4O3SA 3BJYA 1FVSA 3N5FA 3G8SA 3CCSS 2N7YA 2MQ8A 4RL1A 1RI7A 4JI2F 2EKYA 3CDAA 4IYQA 2CNNB 1NPKA 2XQCA 3C3LA 2B43A 2BANB 4NXNJ 2BMBA 1WHYA 1TVRB 4WUBA 1VQ5S 2EC0A 1CC8A 3MMAB 3E2EA 1Q4RA 3I0RB 5IQQA 1QZRA 4PWDA 3I87A 2NN6A 5HL7Q 2DH7A 3CD5A 1T7PA 3TW0A 1LNQA 3N6NA 2MKJA 4K7QA 1EKSA 4QIVA 4G65A 1Z4UA 4DHVA 4FS1A 1Z0VA 1EJ7L 2H9ZA 3CDUA 4N41A 2EVZA 2XYPB 4B9TA 4M8LA 5C2GA 3QWPA 2ZH7A 4LF9F 1WC4A 4L76A 3KHRA 2YVSA 1FE4A 3PRYA 1FFGB 2HHQA 4MU3A 2HNYA 5DG7A 5T7LB 4LMZA 1NJWA 4X4QA 3I56S 2ZUAA 1RTDA 5ETQA 4JI7E 1NDCA 2DHAA 5KG1A 4YY3J 1UVJA 2RUSA 5M2UA 3P3CA 1T05A 2YWKA 2YKAA 3R3TA 2MKYA 4PG6A 3QLHB 4DXLA 3Q23A 3HHDA 5D15A 1HNXJ 2QA1A 1KFSA 3RRGA 2UU9I 4OZ3A 1Y3KA 4UZCA 2F4VI 1FD2A 1UTAA 2I1RA 2XBPA 4DV4J 3POTA 1YGYA 4OX6A 4J9VA 4I2QA 3VGSA 4DV4I 3H42A 4OO1F 5LJ5Y 3GJSB 3NGRA 4DPOA 4RBVA 2MGZA 1DTQB 1NJXA 3I32A 4LF8J 1LFPA 3AY0A 1HBNA 4HTIA 4USUA 4AXJA 3HCXA 1BQNA 2AEJA 3ETMA 4WP3A 4NYPA 5HMZA 1IBKJ 2OIHA 2I9SA 2HFUA 4HACB 2VQEI 2FHOB 2MHEA 1XNQI 1Q7YT 3NOGA 5GADU 3CJ0A 3CJ3A 3P4UB 2HRYA 1XR7A 2C22A 3DLJA 2CQHA 2RILA 2HGLA 1U09A 2NYIA 2CZ9A 1KLMA 2V68A 5KFRA 2BA9A 2PT0A 4JV1A 1UVMA 4OX9J 1V3RA 4LSNA 5ETVA 3NS6A 3DOLA 2HNZA 1U1RA 2UUCJ 2M3DA 4ZVPB 3PIPQ 1WC3A 3IBFB 2AYGA 2V94A 2BZ2A 5E41A 3J81C 2BUNA 4F4KA 1HQ2A 3ZFVA 1FRJA 4RNNA 1WEZA 4HHHA 4DQPA 1VDHA 2LQ9A 3EGNA 4F04B 3GSDA 2CJQA 4I2PA 3LQVA 1UEUA 2FVSA 2BE7D 4TY8B 3DXSX 3WU4A 2IDLA 2FHJD 4JI5J 2F7VA 3KUHA 1L5UA 5K36A 2EFQA 1NM2A 1QAYA 2AIRB 3UI3A 1WC6A 2MDAA 4JI8F 4OI3A 5IM0A 2KH9A 3CJTA 3SCIE 1DBDA 2CA9A 2UU9J 2AJ4A 3G87A 3OPKA 3GJTB 1VQYA 4R5PB 3Q8SB 3HPOA 1MN9A 1HNXI 2V4JA 2LDYA 3FFIB 2YNHA 4NEZA 3OL6A 2DRAA 1IQZA 5D3GA 2ZBKB 3MPWA 2YQ3A 2BE2A 2L9WA 4OX7A 4B08A 5J2NA 1J5OA 4FWGA 4C9DA 1SQFA 3DLEA 4X62E 1U8WA 2CADA 2HIYA 4DUZI 2OSRA 3WX8A 2JLGA 4IFDD 1YRXA 1R43A 3BO2A 1FRXA 1Q53A 1VIOA 2LA6A 2VG7B 1EB0A 2HZAA 3EWGA 3LP0A 2PDAA 3MMBA 3R7BB 5A2QY 5EUHA 1QSYA 1N56A 4DR7E 3OTBA 3K5MA 4M1KA 1H7XA 4Q8EA 5CCMA 1FDAA 3OHBA 1T9YA 3DLBA 3QQCD 3I82A 3M8PA 2C3YA 2D3UA 4IUFA 1TKZA 4W90B 5IFMA 5K8PA 4ERDA 4ZS6A 4XDDA 4IFVA 4BDPA 2FLLA 4NLUA 5IS2A 4RUCA 2EK6A 2W9BA 2HMIA 3CCQS 4BHQA 1WTBA 2HIQA 2QMUB 1KDNA 3Q83A 2L3MA 3TEHB 4ZVEA 1NK5A 4F4AA 3KUEA 4JI6J 3DM2B 3HHKA 2QFJA 2JE6B 1R6LA 1PC5A 1LWCB 3Q8YA 2W2MP 1VC6A 1O0PA 4OI1A 2IMWP 2JL9A 3HSZA 1RAJA 1RT7A 2DXFA 4HHUA 3TOQA 2Z30B 5K20B 1VQLS 2R8GA 3QJJA 1S72S 4DR6J 4OYXA 4PXEA 4X2BA 1IBLI 3Q0AA 2RDIA 3JTNA 1GXTA 1WG4A 3GP9A 1IR1A 2PO4A 1LWFB 3G96A 3DLLQ 1HNIB 4NRTA 1ULRA 5IV3A 4YR2A 1K0TA 1XHKA 4ZCLA 2MZRA 2ZOMA 3M8YA 2LEPA 2V50A 2I6WA 3NBPA 1WDDA 3Q8VA 4I0WA 4LIWA 2D3OR 2C2RA 4NLGA 3M2UB 2F9DA 5F8NA 4X65I 1OS5A 1NK9A 4DV2I 5LOQA 2V8VA 3T6JA 4WFAQ 4PU9A 4QNKA 4LR9A 1UA1A 5KAKA 2GIRA 4LF5I 4ZJQA 4I68A 3DGVA 3MM6A 2GIQA 4ZN3A 3S8SA 4Q7AA 1CS4B 2E44A 3CDBA 5FLXY 1RA7A 2VG7A 2W7OA 1NAQA 1HBOB 5DETA 2G9OA 1T05B 1FDNA 1MROA 1DQAA 3M8WA 4OMFG 4O3NA 4DQIA 5D4NA 5KG7A 1CPZA 3TANA 3BGRB 4L72B 4E0DA 3NNHA 4UOFA 3IP0A 5BYRA 3J80Q 1U1QA 1AFJA 1AXQA 3LGMA 5T7LA 2F1FA 4U8YA 4JV5E 4DSEA 4IG0B 2J0WA 1YWXA 1RTZA 4IS9A 2VBYA 1TL1A 2WVDA 5LXYA 1NB2A 4AQYJ 1KQGB 4RW6B 2RB7A 4AXIA 4FWHA 2GJIA 5DDQC 4CM2A 2YPYA 7FD1A 4PUOA 4IOAQ 2NN6B 2DEIA 3IRXA 2CPXA 3THPA 4CLWA 1Z5AA 1XIQA 2QA2A 4LRFA 2PI5A 1CG2A 5T41A 4JI1J 3T19A 3DHXA 5HSPA 4HKQA 2ZKTA 4MT1A 4BC7A 2MTLA 1H6KX 2CPEA 3DOMB 1ELOA 3MM5B 2IMOA 2YNGB 3J7ZT 3TUZC 3D1QA 3D3BJ 1RGVA 2QL7B 4FYDA 2QEXS 2AYEA 3QRPA 2NREA 4DR2F 4M95A 4LF2A 2CAJA 4NCBA 1HNZI 3GR0A 2IM3A 3GSIA 4IG3A 3GV5B 1IBLF 2Y8WA 3WQPA 2GO4A 1N33I 5KOWA 4XK8C 4K4XA 2BKNA 1TUVA 1K9MT 3RB6A 4K4WA 1NSPA 2AWZA 3D6MB 2WRMA 2AEMA 1C0UB 1NJYA 3HLUA 1KQSR 1S1UA 1VBKA 2UVVA 2O66A 1Z5CA 4M5LA 1SKWA 4PCQA 1KSPA 1F6TA 2XY5A 4LF4F 3TWZA 4F7VA 2QLJB 2CJYB 3N28A 2KXFA 3T1HI 2WONB 4U6PA 4CLZA 2QE5A 4DFMA 1C1CB 1N0UA 2UU9F 3WC2A 5A8KA 4WXWA 5IM0B 2VH7A 1BQNB 2XSFA 3FMBA 4MK8A 3W8PA 4F67A 5J2MB 3J80Y 3OXLA 4C8NA 2GQCA 4DV6J 1KQKA 2ACYA 2OSQA 4PYDA 1IUJA 3CXCR 2FY1A 3FEYB 4P73A 3BR9A 4FP9A 2ZJPQ 4DR5J 1BC6A 1WELA 2F3JA 4DR5F 3JQMA 2FJBB 5DJBA 1D1UA 1BKNA 2B51A 2BQUA 1T94A 4DF4A 4TU7A 5HAOA 2ATLA 3BH7B 1YSJA 1RSCA 3M2VA 4RW8A 2RQCA 1XNRF 1HHSA 4DV7J 3PFEA 4GC6A 4GKKE 2UV8A 4HH1A 2QA4G 3CDWA 4DLGA 1YJ7A 2V4JB 3FFIA 4LF7F 3DDNA 5KG2A 1FTCA 4AE5A 2R8HA 1WG1A 4F2SA 4KQVA 5H9EJ 1NJZA 3MAQA 1RWVB 1S49A 5K14B 1X4FA 2HS4A 3H20A 2GC8A 4ED4A 2CNLB 2C37A 4DV3I 3DRSB 3KNGA 4ES3A 3Q8QB 1N54B 3HF5A 3OL9A 4DX7A 1RP5A 2E29A 1XN9A 3M32B 3W61A 4FW7A 3LP0B 2CDRB 4QR1A 4U96A 1BXNA 4ITSA 3SDEB 1FFWB 1GQEA 1XNRJ 2VODA 3KK1A 4JYAI 2DK2A 2RF2B 2AX1A 2ZKUA 1IKYA 4MQYA 5RUBA 2FHJA 3VR1A 3WIVA 1EX8A 1M0SA 1H2VZ 2DITA 2MLYA 3HFVA 4WFZA 2CIMA 2XO7A 4DI6A 3V6DA 5D3GB 3BV8A 3DOKB 1Q8KA 1XEZA 3DRXA 3PR5B 2GCFA 4LBHA 1V9OA 2OO4A 3TJ9A 3QSIA 4X65F 2BDPA 3RW6A 4DV6F 1XNQE 4HDHA 3K0JA 1KIJA 3DI6B 1NBEB 1IN0A 4QIEA 2CZVC 3JTPA 2AW0A 2MQOA 4CH7A 4HVZA 2CFXA 5LSRA 4KV8A 2HRUA 3OTOF 2A6OA 4DL3A 5JEAF 3FZ2A 1SV5B 5D0EA 1U1NA 2HQ3A 2Y8YA 3KNAA 4FW3A 1VQ4S 6FD1A 2O67A 4PEOA 3NCQA 4DV5J 1SXLA 4LF9J 5DZ6A 4NCAA 4K4ZA 3AD7C 4JI4F 2O1VA 3OVBA 1FK9A 2YWHA 1U1LA 1JXEA 2KN4A 4OV6A 3RB0A 3G9CA 1OQ3A 2ZM6I 4OI4A 1TK8A 4OO1A 4JUZA 5JEAD 1WOPA 1RT2B 3EMTA 4G1QA 4LF6F 4U3BA 3JSMB 4ECXA 5IWAJ 2HK3A 4OZNA 2JX2A 3CW2C 4OJ1A 4YHHE 2VQFF 4QPTA 3SV4A 1JLBB 1WHXA 2OPSB 5GAGU 3OV7A 2R7SA 3LP1B 4KHRA 3U02A 3ZTPA 5EX3A 1P6TA 4U95A 2WAQD 1JLQB 5C24A 4CM0A 5I3QA 1U4BA 2KO1A 2Y3YA 5CD4H 2EW9A 2W7AA 3DRRB 1U0HB 3L3CA 4CWBA 3MZIA 2CQ4A 2NYHA 2PN6A 4X66I 4BA2B 4B3RF 3QJPA 3CJKA 4C0BA 2DHSA 2P9CA 2UXCJ 1XXEA 4U7UK 3PW7A 2ILYA 2VV5A 2XEXA 3CJ4A 1HW8A 1PC4A 2HQCA 4IOBA 4ZA1A 4CRJA 1LWXA 4Y34A 1LWFA 4FBTA 4FPIA 2E7VA 3JS9A 2EWHA 4B17A 1L3TA 4LFCF 2YY3A 3MCOA 2C39A 4KQZA 5CQGA 1N4LA 3HX9A 3SEOA 5HO4A 4XPEA 3HVTB 4PG7A 2XZDB 1LXNA 2A0FB 4WK3A 4ZJLA 2VQFJ 3R5CA 4WJBA 2ZHBA 5C0XB 1WG5A 2H4WB 1VK8A 3GPAA 4C8YA 3JAMC 5C5JA 5C0XF 2B6AA 3W2WA 5I4MA 4GC7A 1T03A 2LU2A 3AT1B 1IBMI 4NZ0A 4KHPE 2V8GA 1RHQB 2OMLA 2RD5C 3C15A 3CCRS 3Q6MA 4JYAE 2MXYA 2RHQB 2EG1A 3D6HB 4G1IA 4WP9A 1WHWA 2PE8A 4ZP7A 4ZLPA 5EHHA 1GK8A 4ZITA 5AJ3F 4IFDB 4CLKA 2IAJA 3C14B 1HNWE 1NZ8A 4CLPA 1XR6A 3IS9A 3JSRA 2V2QA 4H4MA 4B3SE 3ISNC 3DYAA 4LSLA 3KOAA 2V0NA 3UR0A 2DO4A 2HHPA 2AJ1A 1LW2A 1S57A 3RRHA 1Q7LB 3VWSA 3MCSA 4JI8J 4WU3A 3J81Y 4DR7I 3PR4A 4ZHRB 2N4CA 1J5EI 2JEBB 1PKPA 4WKRA 4YUDA 1U47A 3MUMP 4DV1J 4UY85 1N33J 1BE4A 4DX5A 3ET6A 4AL6A 5HI7A 3K8VA 4LFAF 2JEFA 2KDOA 3GMEA 2MY8A 4IH7A 2JEJA 3L7PA 4UOCA 1J5OB 3HKWA 4U3DA 3FC9A 3GR1A 4ZVTB 1LWEA 4RKUC 3KYLA 2J7WA 4DV7E 5KFYA 4DV7I 4IFVB 1SL1A 4B9UA 4PXCA 1PAEX 3H4DA 2WONA 2VDHA 3VAKA 2F5GA 3QIDA 5K9FA 4DV1F 4X66E 3C15B 5HATA 4M5DA 2JEIA 1Q82T 2RRNA 3GYGA 4ILRA 4BWMA 4ANEA 5LM7E 1K1SA 1Q78A 2WB1D 3G8TA 2IBKA 2C37B 2VA3A 4M5GA 3UD3P 2GX8A 1S9EB 3JXOA 3UDCA 5L39A 2N4DA 4WXOA 4DR3J 1JLCA 3IR7B 2ZWOA 3GFZA 1M5KC 2UUAI 2GO9A 3R97A 1RE1B 4UOHA 4WFBQ 2KXNB 3LO3A 1UJ5A 2JJ4D 3N9UC 5KFEA 3SQOP 2OEJA 1X9MA 4LT6A 4R8UA 1NK6A 1WSVA 4BLGA 5AJ3J 3G2XA 4C8ZA 4MK7A 2UUBI 1NO8A 1RT1A 2Z2ZA 4L73A 2DNQA 2YWEA 3OLBA 3DLHA 2E9RX 3MXHP 4UF4A 2B5JB 1EAYC 2YNHB 1X0PA 2YNIB 4Q5VA 2F4VF 3IWNC 2YQ0A 4L6V3 4FDFA 4OZ0A 2FYXA 4DDFA 3GZ7A 1IBLE 2ERRA 3DN9A 2UXBJ 2ZBPA 3F0NA 5JXSA 1HNZJ 2FHKA 3MM6B 1LXJA 2FZCB 1D8YA 4KO0B 4ZVHA 5A8WB 2WHOA 4J5OA 4KV8B 3M05A 4YY3F 5ETKA 4I6YA 3TEGA 2COLA 3J81U 4K4UA 2KZZA 3W8GA 3IAM9 2G1HA 4RUAA 3CMAS 4FVCA 5K14A 3EM1A 2Q6BA 2QLXA 4DQSA 2UP1A 1WC5A 1LWEB 2ASYA 4LJMA 2ZH1A 2O3ZA 2V9WA 4JI1I 1W7WA 3MPYA 3KKFA 1NLKL 2KU7A 4C0HA 4X66F 3MCMA 3V6DB 2UUAJ 2QTWA 3BM7A 4J9OA 4J90A 2VB6A 2IHR1 3WU6A 1RT2A 2IM1A 1FNXH 4NI2A 2IOPA 1MMNA 2KVIA 4DV4E 4JI6I 1IKYB 1S0OA 5HROB 4O44A 2IAJB 5ETOA 1LW0A 1LK5A 1AYEA 1IR2A 2F65A 2YKNB 3M6AA 2Y1LB 3QGGA 1XMQJ 1FX4A 2H3EB 5J2QA 3W2VB 3B8HA 1OO0B 2VG5A 3SCKE 1DQ9A 1UP1A 1Z1ZA 2E1RA 3C2PA 4H54A 2ROGA 2RT3A 1S1TA 1P42A 5HBMA 4JI5E 1Z2ZA 5LL6d 1NPPA 3VF0B 3AOBA 4I7FA 3CTRA 3TUIC 2PNZB 1JJ4A 1H72C 1VQSA 4C48A 3M6VA 1Q86T 4K59A 1RABB 4ED7A 3CO9A 3G71S 2DT9A 3DU5A 4FNHA 1G3OA 1TFWA 4PQUB 3GLLA 4JI0E 4OHWA 3PX4A 4IRCA 4OL8A 4NBQA 4C8LA 4BS2A 1YBAA 1WDTA 4KB7A 4IRKA 4GVLA 3CC2S 4DS4A 4GKJJ 2AYMA 1TQLA 2JZ5A 2O1PA 1Z0EA 3M30B 3P96A 3QMQA 4DEZA 5K36F 1HWIA 4ZLNA 3M9MB 3R7NB 3D0GE 1IKWB 3CUNA 1F0XA 1B7YB 3DRRA 4YP3A 1HR0I 3AQOA 2FC9A 4QBUA 5D6GA 5FLXU 4EO8A 3KK3A 4JI5I 1N36E 4YR0A 1Y4SA 4KH0B 1HBUA 3UFCX 1JIHA 2MKCA 2BJEA 2AJ2A 5D0GA 5LT5A 3TZYA 4X64J 2HK2A 2IA6A 1TVRA 3GJRB 3FSXA 1USVA 1BUXA 2CG9A 2VA2A 1HWJA 2J9DA 3GV7B 1TMJA 5E7OB 2XY7A 1DHMA 5DNXA 1JKHA 2VC1A 3IWLA 3GCXP 3TX8A 3W9HA 1NK0A 2AZ3A 3NP5A 3O1LA 1ZS6A 4WIIA 3MEKA 4WFXA 1ZBTA 3HVTA 4C8OA 5J1PA 2YKMB 1DLOA 4JI6F 4YMEA 4Z2XA 1BHNA 2PA8D 3VQTA 1RAFB 2QO3A 4DL4A 1CEZA 2DXDA 2ZFHA 5J1EB 1N32J 1UVLA 2OEMA 2X51A 1Q8IA 1RU1A 2C3UA 1SKRA 1AW0A 1NK7A 1CS4A 2CPDA 1C1BA 2VFRA 4NLXA 1SI9A 4FF3A 2DNMA 1OSCA 2LJPA 3JB9k 4ICLA 1DAXA 4LF7E 4ZPVR 2CJXB 2LFVA 4IRDA 1CJTA 5LMUE 3W5YA 3G82B 4LF4I 1NDLA 5LJ3Y 1WC0A 4MKVA 1B64A 2VFTA 1OPIA 1M1KT 5JEAB 1OJ4A 2JEAB 2EFPA 3VV2B 1CJUB 1YIJS 4AL5A 1PBAA 3KDNA 2D9PA 4A8FA 1R27B 4JI7J 1WF0A 2W7PA 1NDKA 3B4MA 3RGIA 2AGOA 5ADZA 4DR4F 2R8KA 2VJVA 2GV1A 2YTCA 2QG9B 3GLJA 3K57A 5HLFB 4DL0C 1HD0A 2HLTA 1CJKB 3HSGA 1S9EA 2CQCA 1XK8A 3A3OB 1J2VA 3POTB 2K7JA 2LLZA 2VG6A 4HH0A 5A0YA 8RUCA 5L1IA 3NS5A 4LF4J 5KFGA 4EUVA 1KC8T 5DDRC 5DROA 3GYNA 2LYVA 4ID8A 1ZZNA 3HHLB 2JFDA 2Y0SD 3TQ1A 1RYSA 1J5EF 2B7CB 2E7WA 4CDIA 1GXLA 4GQUA 2UUCE 2ABYA 1T8EA 4DR6I 1QTNB 2UUCI 1YZ7A 2KYZA 5HQMA 2NR0A 4ED5A 1FJ7A 4ER8A 1Q95G 1UZDA 2VASA 1V5IB 5CYMB 5E33A 3W65A 1SV5A 4RO0A 2R9LA 2O1UA 1YX2A 3BGUA 3FBCA 3H8YA 3PYDA 2W1BA 1RT5A 5LXRA 1N5YB 4X62I 2FDNA 2KG1A 3UNYA 4ZP8A 3N4WA 2NN6C 4NXNI 2FGOA 4B9MA 1SIWB 3R5BA 3LP1A 2EFOA 3BR8A 3UDEA 1IBKI 3ZTRA 1QTMA 1ZTWA 1NNDA 2F8MA 4NA2A 4OX9F 2KFZA 5DNLA 1FDDA 2JFKA 1JWWA 1FKAE 1UZHA 3ZKBA 4EYIB 3X1LB 3QATA 2LVWA 4DPUA 1RK8A 3QIPA 1RKJA 1U7LA 2FIUA 3UHMA 4G1PA 1Y5LB 2DD8S 1YJUA 8ATCB 1KEKA 4DL5A 1RB0A 1M1HA 1YHQS 4USIA 4K4YA 1HBUB 2ZD1A 4K4VA 3VGVA 1GH8A 5H1SV 2QLWA 2PO2A 2H5JB 3MEEB 2VBWA 2VKRA 1CJVA 5B0EA 3TX0A 4X4TA 4B3MF 4ELVA 1VS3A 2ASLA 2ZHAA 1QJHA 3HVRA 4Y2KA 2A1BA 4U67Q 2CDQA 4ZVGA 1YBTA 3MMAA 1GMUA 3HM9A 2ZH2A 3HK2A 2BM1A 5HP1B 1TKTA 2CJBA 4KGVB 1CC7A 2IRXA 5EDWA 2XMAA 3VALA 2VOOA 1SUQB 5D8HB 5FLXC 4NASA 4NLWA 4GVBA 3TNVA 1SC1B 3QZ8A 4IZJB 2XYHB 3QWUA 3PW4A 3VGTA 2DRBA 2WTFA 1S6PB 4I6AA 4FW4A 1DQ8A 3IR6B 3MFIA 1Q0NA 3NG8A 1S1UB 2PC6A 3GB0A 4PR6A 3G6YA 3M2VB 2B3TB 2PEHA 3CVKA 2LXIA 3OFHA 3R5JB 2V4QA 2AT1B 3HJVA 2VF3A 1FRHA 2RH3A 1M1GA 3OFGA 1JXVA 4DUTA 4KC5A 4NCGA 1H38A 3GWCA 4IKAA 3U27A 3I96A 4WP8A 5MLCV 3ZNUA 3KFWX 2XHWA 2BJ8A 2V4RA 4Q8FA 4QCLA 2W8LA 2R7XA 2QL9B 1URNA 3IWXA 2G0JA 2RAQA 4DUYJ 3NOCA 3QT8A 4PZVA 3FJ2A 2XI3A 5B0BA 5IT0A 4FBUA 1ZTTA 3M32A 5J2QB 3QNWB 2VJUA 3MEEA 2C28A 1JLQA 2C1EB 1K44A 1RAOA 2DKOB 4EYHB 1FKPA 1RWNB 1HBNB 2CQIA 4X62F 2QRRA 2FUG9 2XMTA 3I0RA 2AGPA 1TV6B 1DTTA 5DRKA 3QIPB 4Y00A 4IR9A 3Q8UA 5IWAE 1J27A 1JKHB 3OSPA 1JLFB 1HNVA 3PS2A 4OZ5A 3CIZA 2RUGA 3CCTA 3O3LA 4K2XA 4NLVA 1NRKA 2QFIA 4QR2A 2I8EA 2MYFA 4ZDNA 1PAUB 4MFBB 3RYLA 4C11B 3K5NA 1U6BA 3A4TA 3BQ0A 1OWXA 2D9OA 4LCGA 1H2UX 1CVJA 4J9LA 2B4UA 4NWBA 5A8RB 3GV8B 4NA3A 1NSAA 2KXHA 4IFDE 3UQSA 1JQGA 1QE1B 1WEYA 1HKAA 1HBOA 2VBZA 4GVBB 5C42A 1VQMS 3H59A 1FJEB 1T9XA 4C8MA 6AT1B 4A8KA 3AJ1A 3B78A 5GADI 2HRTA 5AXMA 2DGSA 2M5YA 2XHCA 5HJYA 4DL7A 2BR0A 1HD1A 4JI3J 4OI2A 1H7SA 3DFEA 1QAXA 5I3PA 3G4SS 5HN0A 1S9GB 5KG0A 2R8JA 2HFZA 1RLCL 2A6MA 3GIRA 2F4FA 3R5GA 2W01A 4JI0I 4DX8H 4JG4A 1HWLA 3NAIA 1RTIA 3P8BB 4OZ2A 3CO0P 3UR3C 1I6JA 1D0EA 1T3OA 2DR5A 3J7AN 2HG4A 4DCJB 1ZETA 1VRQC 4QWEA 2CPZA 5KTQA 2ZITA 4Y2CA 3O44A 1KTQA 1X4HA 4E8UA 3CCMS 3D4JA 4GKKI 1HYSA 2WVCA 1LV5A 4P72A 1RHKB 4J9UE 2OHDA 3MEDB 3MR6A 4O4GA 4CTAA 3NCPA 2CZ4A 5DZ7A 2HHSA 2HNDA 2LXUA 4H4OB 1U1KA 4CO1A 4MU1A 4N56A 5A2QU 3EPGA 3T5LA 2E9ZA 2N7CA 2MZTA 3UE2A 4ZVIA 4Y3CA 1RCOB 5DQIA 3DCAA 4YB7A 3AFGA 3KLFB 1NK8A 4C7QA 3PKMA 1RJJA 3FGVA 1HW9A 4B3SI 2ZH3A 1YJVA 3TAQA 4ZMMA 2B9WA 1RAIB 1NEEA 3SCJE 5MAOA 5KFOA 4ZCMA 3M9OB 2SXLA 1W2IA 1YRUA 3BGOP 2W4DA 2ZJRQ 1HI0P 4DR7F 2UXBI 1H3DA 4HY1A 4CLLA 1S16A 1RTJA 3G8QA 4E2FB 2YKOA 5HANA 1W2BR 3S6EA 4JI8I 1QDUB 2ZE2B 2XY6A 3HVWA 1RTIB 3DMJB 2G4BA 1G6BA 3JAMY 2UUAE 5LSLA 2UUBJ 4LF8E 3GTYX 4B9LA 2A3JA 4EFAC 3CC4S 3KTQA 2VD3A 2J65A 3HJCA 3SFUA 2UXDI 3T1YE 3AA9A 2PIIA 2R7QA 2X3DA 3I5BA 3P5BP 1UVNA 3PS1A 2GVDA 2V67A 4XTTA 1OY8A 2GVZA 5KFFA 2BBEA 2HKJA 1GMVA 1DTQA 4DUZF 3TJ8A 1R6VA 2E1AA 2Q3PA 3A8KA 3LP2B 3L7UA 3MTJA 4O3QA 2XNQA 4DN0A 1IKVA 4OYMA 5I3UB 2EXUA 2IJNA 2M8HA 4I4BA 3HP6A 1HNWI 2QMXA 2W2NP 1S1WB 1JMTA 4KGXB 2C2OB 5CH7B 3MMBB 3W9JA 4DSFA 1SQEA 1T9UA 2MKSA 5EWGA 2IJRA 1XNQF 3M85G 2M88A 2VQFI 3CF5Q 4MYTA 2HVHA 4S0MA 1ZAXA 4ATNA 2PMHA 3IM9A 4RW8B 1VBZA 1U26A 2HQIA 3JQJA 2MSTA 4ECQA 3R7SB 3WDOA 2DGWA 4ZVFA 1M90T 2DPIA 3RAQA 5ETSA 2Z5CB 2ATCB 3L09A 3J7YI 2O5DA 3KMQA 1PVGA 2GO8A 4HEA9 2E5LI 1PJ7A 4WIQA 5I42B 3Q86A 1CLFA 1QY7A 5J1NA 5AE1A 1XC9A 3KK2A 3TAPA 4ZIWA 1U45A 1HMVA 1VK3A 2MMYA 2Q43A 3KG1A 2DHHA 3N5BA 3O6QA 1B0PA 4KHMA 4TU9A 4ELUA 3J81Q 3TI0A 3KLIA 3BB5A 2CJAA 2KT2A 4OZ1A 3RG6A 3BSOA 4FWDA 1FJGE 2IIHA 4RUHA 4KRWA 1RWOB 1PYSB 3TVYA 4FXWA 1RHMB 1V6HA 4LBIA 2WZ1A 5J2PB 3R27A 1LOUA 1PILA 1S1VA 1UETA 2CYYA 3FQKA 2EG2A 1JK9B 3JQKA 5BYSA 1Q1KA 4IFYB 3MWBA 3C6TB 1TL7A 3CWJA 1YDLA 1M5PC 3D68A 4CTAB 3LA0A 2NXCA 3RW7A 2RRAA 2O1WA 2BQRA 2B4OA 3MECB 3QYYA 5M2PA 3NRBA 3BQ2A 1RT4B 2FVPA 1KKHA 1U25A 4KKOA 1S9FA 1DRZA 4ZPDA 1AUSL 1RDRA 2XSJB 4Y6IA 2XLJA 3MD1A 2AGQA 4NXMF 3VVTA 1VQ8S 2ROPA 4OO1B 3CJQA 3E3XA 1N33F 4IZJA 2HKEA 5HK4A 4JI0F 5L1JA 2LCWA 4JV5F 4DV0I 2DH8A 1FJGI 4MMOA 1BD6A 3MM7B 2OELA 4LFCE 4N77A 1RWPB 2J7UA 4USVA 3O5TB 4LQ9A 3UDLA 3D5MA 2YKQA 4ZPCA 3QAEA 4DMZA 2DNOA 4JBCA 1G2EA 2B6AB 3T9ZA 4GKKF 2C2MB 2IERA 3I55S 3PO5A 4QNJA 4FYYB 3HMJG 2J0QD 2GJ2A 4X65E 4B9VA 2APOA 2QJ3A 5C24B 1RT6B 5LMNJ 2NSCA 3M8QA 1XMOF 3QGIA 4WZMA 1K0VA 4QQBA 2CNOB 3TVKA 1N36F 5HROA 3C16A 1F2HA 1WD6A 4JI1E 3DRPB 4N8NA 1O51A 1R8PA 4Z7YA 4DJBA 3J7A1 1FEHA 1RAGB 4IH5A 3DXBA 5E0OA 4CLYA 1K1QA 5DQGA 4RU2A 4X4VA 1USUA 3MECA 4B3SF 3F44A 3SIPB 1E6YA 1DTTB 2CKWA 2HQFA 2Z4PA 1ZYQA 2I2YA 1YK9A 4ZCKA 1NSQA 1FO1A 3HULA 3TA1A 4ECZA 2UXBF 2ZM6J 3R6LB 1Y3JA 2VPWB 4CO3A 1YJWS 1X9WA 1S0VA 4HYMA 1X4AA 4J9MA 3TZZA 1FF2A 2XNRA 4WTYA 3VQSA 1UWAA 1KR4A 2KVQE 2RKIB 2HBQB 3ZZYA 4OX8A 2ZC3A 4ED2A 4PG5A 1H73A 1VRUA 3MD3A 3P76A 5U47A 3LW5C 1CBKA 3EICA 4DFKA 1S76D 4QWBA 5JEAE 3DHWC 3PRBA 5DLFA 6FDRA 1MMLA 2HS3A 3MPVA 1HNWJ 1YRTA 3N0VA 3DLKA 3KDOA 4I1TA 2J9CA 3C46A 4DR5E 1XQIA 2YH1A 2B9XA 4MKYA 4DR5I 1VHFA 5LMNE 2WW4A 1GAOA 1S9GA 3H5SA 3KK3B 3VVUA 5BR8F 5A2QC 2IA0A 3W63A 1FRMA 2W9BB 1KD1T 2HMIB 4KHPJ 3PDNA 3PYEA 1T3NA 2O1TA 5KFSA 5FLXQ 1VBXA 1NU4A 4YS2A 1YJRA 3W60A 5FJ4A 2FPHX 4J9SA 3T1HJ 2PSZA 5IC4B 1ZH5A 2V8PA 3KJNB 1OYDA 5CXTA 2FZGB 1U2RA 1NKCA 2BYCA 1B62A 3IA0A 1HQUB 4L3NA 2GMJA 3ILLA 4TKTA 2FD2A 3QZ7A 2LMIA 1VQOS 2PO2B 1HA1A 4NLTA 4PABA 4TVAB 2YWFA 4P52A 4USWA 3OT9A 4QWCA 4ECWA 1ZXNA 2GA7A 4I64A 2O3DA 3T1YI 1FDBA 1HBMA 1VMBA 2KT3A 5HMYA 3ZTQA 2Z5BA 5C0XE 2HW3A 2FVCA 1TUGB 2CJ9A 2KM8C 4MDTA 4E98A 3NGDA 5L8RC 1YLXA 3I31A 5KFPA 3ET6B 4IG3B 1N6QA
chains in the Genus database with same CATH topology
4DV7E 4DV7I 3ZM7A 1IBLI 1Z0BA 4DPWA 3K85A 2EFGA 4DPTA 5IT9C 1ZM3A 4DR1E 5GMDA 4FW9A 4WUDA 2UUAI 4DV6I 4LF4E 1D6TA 2UU9E 2V34A 2F4VE 4B3TI 2UUBI 1MU5A 4JI4I 2CGEA 1ZXMA 1N34E 2R42A 1ZM2A 1IBLE 1RREA 1IBKE 3F0NA 4YY3E 5GMEA 2X36A 2OI2A 4DV2E 1Y6ZA 1Z0GA 4JI1I 4DR6I 1ZM9A 4R1FA 4I3HA 3WU6A 2IOPA 1Z0CA 2A2DA 4AQYI 5BR8E 4DV4E 4JI6I 4JI6E 3M6AA 4DUYI 1MG7A 3K17A 2GS8A 3B8HA 4HACA 2PNLA 2E1RA 4P7AA 5A2QQ 4JI5E 4JI3I 4DV6E 1DARA 2HHHE 2HHHI 1H72C 3J80C 3Q1QA 4K0KE 1N32E 3B82A 1FNMA 4PRVA 1KVKA 1Z0EA 4LF6I 1PIEA 4X64E 3K1JA 1XMOI 1HR0I 1Z0WA 1RR9A 1N36I 4JI5I 1H7UA 5LMUI 1N36E 5FWKA 2HK2A 1MX0A 1USVA 2CG9A 4WUBA 1Y4SA 2Z5BB 1QZRA 4DUZE 4OX9I 1Z0VA 4LF6E 2J7KA 2VQEE 3WU5A 3PRYA 2LJPA 4LFBI 4LF7E 3PYGA 4JI7E 5LMUE 4LF4I 4DXLA 4LF8I 2NPFA 1OJ4A 4LF8E 1Z0TA 2UU9I 4DU7A 2F4VI 4USKA 4DR2E 4DV4I 5BR8I 4FN5A 3LTOA 4DPYA 1NHJA 2VQEI 4YY3I 4HACB 2HFUA 3LNUA 1XNQI 2UUCE 2UUCI 4Z7CA 2CZ9A 1N32I 4IZJD 2O1UA 4B3TE 3PYDA 3J7AM 4X62I 4DU8A 4NXNI 4DR2I 4OX9E 1IBKI 4DV1E 4X64I 1FKAE 1K47A 3ZKBA 4DR1I 4YHHI 2UXCE 3WU4A 4DPUA 3ZZTA 2Q2EB 2V2ZA 4JI7I 2AJ4A 1HNXI 1WUUA 5IT9Q 4K0KI 4GKJI 2ZBKB 2BM1A 4X66E 5FLXC 4FWGA 3J7AG 4X62E 4DUZI 4IZJB 3GONA 4DR7E 1N33E 4M1KA 2VF3A 4EMDA 1EA6A 3H4LA 4JI3E 4LF7I 3PYFA 2BV3A 1I94E 2PNMA 4DV3E 3CWVA 1I94I 4LF5E 3QT8A 4GKJE 4NXNE 2X7IA 4URLA 4XTJA 5IWAE 1FWLA 4RPFA 1XHKA 1Z59A 4X65I 3P06A 2R3VA 4HXZA 4DV2I 1HNXE 4PU9A 4LF5I 3B78A 3QT6A 1IBME 4DV5E 1Z5BA 1H7SA 1HK7A 4AQYE 1NHIA 4JI0I 3J80Q 4JG4A 4DUYE 4WUCA 4JV5E 2Z5EA 1VISA 2ZITA 1HR0E 4DR3I 4GKKI 3D4JA 4LFBE 4FWHA 3T1HE 3V5RA 1J5EE 2DEIA 1Z5AA 4JI2E 3J81C 4B3RE 3WU3A 4ZVIA 4LFAI 4B3RI 1ELOA 4B3SI 4DPXA 1KTVA 4DR4E 3Q6NA 3ZZUA 1HNZI 4LFCI 2UXBI 4N3OA 1N33I 4DV1I 4HY1A 3ZKDA 1S16A 4JI8I 1Z5CA 2UUAE 3T1HI 2UXDI 3HJCA 3T1YE 1N0UA 2A2CA 3QT5A 4B3MI 3OTOE 4KHPI 4B3ME 3ZZ0A 2HKJA 5L3JA 2BM0A 1H74A 1HNWI 2V2VA 1BKNA 4UTGA 3JAMQ 2VQFI 4DR3E 4GKKE 4MYTA 1EI1A 4KQVA 3V2UC 2E5LE 2Z5CB 4ED4A 2UXDE 1FI4A 1PVGA 2E5LI 4DV3I 1XMQI 1A6FA 4B3SE 1S4EA 4JI4E 4JYAI 2ZM6E 1FJGE 4MYUA 4FWDA 1B63A 1Y4UA 1FWKA 1XMOE 2VQFE 1XNRE 1XNQE 1KIJA 3QT7A 2O1WA 4PRXA 1KKHA 4DR6E 4LFAE 1N0VC 4DV5I 1N34I 4IZJA 2HKEA 2O1VA 4NXME 4DV0I 2ZM6I 1FJGI 4LFCE 2UXBE 4JI0E 3J81Q 2HK3A 1UEKA 4JI8E 4YHHE 4LF9E 2UXCI 1ZM4A 4X65E 4JI1E 1XMQE 4Z7YA 4IZKB 1USUA 2UUBE 4X66I 5LMNI 4USMA 5LL6R 2XEXA 5IWAI 3HULA 4DR7I 4HYMA 4LF9I 1H73A 3JAMC 1IBMI 3OTOI 4KHPE 2Z5CA 2DEJA 4DR5E 3Q6MA 4DR5I 4JYAE 5LMNE 2WW4A 4NXMI 1NHHA 4DV0E 3LPSA 4DR4I 5A2QC 1HNZE 2O1TA 1HNWE 5FLXQ 3PYEA 4JV5I 2HFSA 2V2QA 2IOQA 2V8PA 1XNRI 1U2RA 4UT4A 1B62A 1NZ0A 4IZKA 1J5EI 4P52A 1PKPA 1ZXNA 3T1YI 2Z5BA 4JI2I 2GQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 E;  4DV7 I;  3ZM7 A;  1IBL I;  1Z0B A;  4DPW A;  2EFG A;  4DPT A;  5IT9 C;  1ZM3 A;  4DR1 E;  5GMD A;  4FW9 A;  4WUD A;  2UUA I;  4DV6 I;  4LF4 E;  1D6T A;  2UU9 E;  2V34 A;  2F4V E;  4B3T I;  2UUB I;  1MU5 A;  4JI4 I;  1ZXM A;  1N34 E;  2R42 A;  1ZM2 A;  1IBL E;  1RRE A;  1IBK E;  3F0N A;  4YY3 E;  5GME A;  2X36 A;  2OI2 A;  4DV2 E;  1Z0G A;  4JI1 I;  4DR6 I;  1ZM9 A;  4R1F A;  4I3H A;  3WU6 A;  1Z0C A;  2A2D A;  4AQY I;  5BR8 E;  4DV4 E;  4JI6 I;  4JI6 E;  3M6A A;  4DUY I;  1MG7 A;  3K17 A;  2GS8 A;  3B8H A;  4HAC A;  2E1R A;  4P7A A;  5A2Q Q;  4JI5 E;  4JI3 I;  4DV6 E;  1DAR A;  2HHH E;  2HHH I;  1H72 C;  3J80 C;  3Q1Q A;  4K0K E;  1N32 E;  3B82 A;  1FNM A;  4PRV A;  1KVK A;  1Z0E A;  4LF6 I;  1PIE A;  4X64 E;  3K1J A;  1XMO I;  1HR0 I;  1Z0W A;  1RR9 A;  1N36 I;  4JI5 I;  1H7U A;  5LMU I;  1N36 E;  2HK2 A;  1MX0 A;  4WUB A;  1QZR A;  4DUZ E;  4OX9 I;  1Z0V A;  4LF6 E;  2J7K A;  2VQE E;  3WU5 A;  2LJP A;  4LFB I;  4LF7 E;  3PYG A;  4JI7 E;  5LMU E;  4LF4 I;  4DXL A;  4LF8 I;  2NPF A;  1OJ4 A;  4LF8 E;  1Z0T A;  2UU9 I;  4DU7 A;  2F4V I;  4USK A;  4DR2 E;  4DV4 I;  5BR8 I;  4FN5 A;  3LTO A;  4DPY A;  1NHJ A;  2VQE I;  4YY3 I;  4HAC B;  2HFU A;  3LNU A;  1XNQ I;  2UUC E;  2UUC I;  4Z7C A;  2CZ9 A;  1N32 I;  4B3T E;  3PYD A;  3J7A M;  4X62 I;  4DU8 A;  4NXN I;  4DR2 I;  4OX9 E;  1IBK I;  4DV1 E;  4X64 I;  1FKA E;  1K47 A;  3ZKB A;  4DR1 I;  4YHH I;  2UXC E;  3WU4 A;  4DPU A;  3ZZT A;  2Q2E B;  2V2Z A;  4JI7 I;  2AJ4 A;  1HNX I;  1WUU A;  5IT9 Q;  4K0K I;  4GKJ I;  2ZBK B;  2BM1 A;  4X66 E;  5FLX C;  4FWG A;  3J7A G;  4X62 E;  4DUZ I;  3GON A;  4DR7 E;  1N33 E;  4M1K A;  2VF3 A;  4EMD A;  1EA6 A;  3H4L A;  4JI3 E;  4LF7 I;  3PYF A;  2BV3 A;  1I94 E;  4DV3 E;  3CWV A;  1I94 I;  4LF5 E;  3QT8 A;  4GKJ E;  4NXN E;  2X7I A;  4URL A;  4XTJ A;  5IWA E;  1FWL A;  4RPF A;  1XHK A;  1Z59 A;  4X65 I;  2R3V A;  4HXZ A;  4DV2 I;  1HNX E;  4PU9 A;  4LF5 I;  3B78 A;  3QT6 A;  1IBM E;  4DV5 E;  1Z5B A;  1H7S A;  4AQY E;  1NHI A;  4JI0 I;  3J80 Q;  4JG4 A;  4DUY E;  4WUC A;  4JV5 E;  1VIS A;  2ZIT A;  1HR0 E;  4DR3 I;  4GKK I;  3D4J A;  4LFB E;  4FWH A;  3T1H E;  3V5R A;  1J5E E;  2DEI A;  1Z5A A;  4JI2 E;  3J81 C;  4B3R E;  3WU3 A;  4ZVI A;  4LFA I;  4B3R I;  1ELO A;  4B3S I;  4DPX A;  1KTV A;  4DR4 E;  3ZZU A;  1HNZ I;  4LFC I;  2UXB I;  1N33 I;  4DV1 I;  4HY1 A;  3ZKD A;  1S16 A;  4JI8 I;  1Z5C A;  2UUA E;  3T1H I;  2UXD I;  3T1Y E;  1N0U A;  2A2C A;  3QT5 A;  4B3M I;  3OTO E;  4KHP I;  4B3M E;  3ZZ0 A;  2HKJ A;  5L3J A;  2BM0 A;  1H74 A;  1HNW I;  2V2V A;  1BKN A;  4UTG A;  3JAM Q;  2VQF I;  4DR3 E;  4GKK E;  4MYT A;  1EI1 A;  4KQV A;  3V2U C;  2E5L E;  4ED4 A;  2UXD E;  1FI4 A;  1PVG A;  2E5L I;  4DV3 I;  1XMQ I;  1A6F A;  4B3S E;  1S4E A;  4JI4 E;  4JYA I;  2ZM6 E;  1FJG E;  4MYU A;  4FWD A;  1B63 A;  1FWK A;  1XMO E;  2VQF E;  1XNR E;  1XNQ E;  1KIJ A;  3QT7 A;  4PRX A;  1KKH A;  4DR6 E;  4LFA E;  1N0V C;  4DV5 I;  1N34 I;  2HKE A;  4NXM E;  4DV0 I;  2ZM6 I;  1FJG I;  4LFC E;  2UXB E;  4JI0 E;  3J81 Q;  2HK3 A;  1UEK A;  4JI8 E;  4YHH E;  4LF9 E;  2UXC I;  1ZM4 A;  4X65 E;  4JI1 E;  1XMQ E;  4Z7Y A;  2UUB E;  4X66 I;  5LMN I;  4USM A;  5LL6 R;  2XEX A;  5IWA I;  3HUL A;  4DR7 I;  4HYM A;  4LF9 I;  1H73 A;  3JAM C;  1IBM I;  3OTO I;  4KHP E;  2DEJ A;  4DR5 E;  4DR5 I;  4JYA E;  5LMN E;  2WW4 A;  4NXM I;  1NHH A;  4DV0 E;  3LPS A;  4DR4 I;  5A2Q C;  1HNZ E;  1HNW E;  5FLX Q;  3PYE A;  4JV5 I;  2HFS A;  2V2Q A;  2V8P A;  1XNR I;  1U2R A;  4UT4 A;  1B62 A;  1NZ0 A;  1J5E I;  4P52 A;  1PKP A;  1ZXN A;  3T1Y I;  4JI2 I; 
#chains in the Genus database with same CATH topology
 4LRA A;  1S77 D;  5ETR A;  3LWM A;  3MI7 X;  2VQE E;  3SV3 A;  1REV B;  1S6Q B;  1UJ6 A;  3K85 A;  2HHW A;  3CCJ S;  1JNZ B;  4R25 A;  2EFG A;  3BZQ A;  2AHO B;  4LCF A;  2IVF B;  3P3G A;  2MQM A;  2OPR A;  3M7V A;  3PEJ A;  3KUG A;  1E6V A;  3N6M A;  2XMV A;  3A8E A;  5ETP A;  1ZPV A;  4JOU A;  4KGZ B;  5GMD A;  5KFW A;  4KPY A;  3JSB A;  2C38 A;  4WUD A;  4AUK A;  5KT2 A;  2RQ4 A;  4CZC A;  4LF4 E;  5EX0 A;  4RNF A;  2CG8 A;  2ZNY A;  4X4P A;  5I3U A;  5D4O A;  1LW0 B;  2D74 B;  2EPI A;  2H5E A;  2JSX A;  2ZBI A;  2AZ1 A;  3NGT A;  2BW2 A;  1W26 A;  4P71 A;  1SJF A;  2HHV A;  2NXJ A;  2UU9 E;  1JNR B;  3PHE A;  4OYI A;  1QUV A;  3D6F B;  1RLD A;  1WHV A;  3PZP A;  2W2P P;  4Q43 A;  4JI4 I;  2PO1 A;  3NLC A;  2ADB A;  3HHL D;  1X5P A;  3V6H A;  1A9N B;  2EFV A;  4DF8 A;  4EZ9 A;  1ZM2 A;  1IKX B;  3ZO7 A;  3DDK A;  3GCM A;  4LFC J;  1RAA B;  3LUY A;  2VKZ G;  3O2I A;  4A8S A;  4G3I A;  2K7K A;  4N5S A;  2R8I A;  1RAD B;  2Q6C A;  2ZEJ A;  4KR0 B;  3DOM A;  5EWE A;  2AYB A;  2YKP A;  5IOL A;  5F9N A;  2XWX A;  3GYX B;  3PAC A;  1UPM B;  4LBP A;  3KLH A;  3V81 B;  3THT A;  1N48 A;  1RHU B;  3R2D J;  3DRS A;  4B3R J;  4F02 A;  4MU4 A;  3QGH A;  2M70 A;  1Y00 A;  3FCV A;  2E9T A;  4NLS A;  4DV2 E;  4OI6 A;  3KHH A;  1Z0G A;  3NWR A;  4PRX A;  3VAM A;  2VUG A;  1ZM9 A;  3O8W A;  5E3A A;  2FJE B;  3AJD A;  2PMW A;  2ALY B;  4NXN F;  4QU6 A;  4I3H A;  1TZ0 A;  3MMC B;  3H0P A;  3A12 A;  5A0Y B;  2NZC A;  4ZPA A;  3H25 A;  4OI0 A;  4O3R A;  1TL7 B;  3MM8 A;  4BA1 B;  2HEK A;  3ULH A;  1RT7 B;  4B3O B;  2WB4 A;  5H9E K;  3K5O A;  4FF1 A;  1H2T Z;  3CCL S;  1CQN A;  1FNO A;  3JYT A;  3EYZ A;  1YG0 A;  3TVZ A;  3EGW B;  2KTQ A;  4JI0 J;  4Q2L A;  4QW8 A;  5F8I A;  3VAF A;  2PNL A;  3NGU A;  5HP1 A;  1R0A A;  3FMW A;  2Q1L A;  2L48 A;  5KFI A;  2JLE A;  2MHN A;  2RS2 A;  4EZ6 A;  3SYZ A;  4DV6 E;  1AA1 B;  1DAR A;  4R0J A;  2DGU A;  3OR1 A;  2JVR A;  1X5S A;  5AXK A;  4B02 A;  1O5J A;  1YIT S;  4LF5 J;  3HHN B;  2BR2 A;  3J80 C;  2YWG A;  3SBM A;  4FW6 A;  4ED6 A;  5BXI A;  2BA0 G;  4WKY A;  2MQL A;  1T03 B;  3E01 B;  3DD6 A;  2OPP B;  4CT8 A;  4B3T F;  4TQR A;  4O0I A;  3M30 A;  1C0T A;  4X4S A;  1BQM A;  4ZP6 A;  2F40 A;  5DO2 A;  4EBD A;  1TK5 A;  1KVK A;  4F4Y A;  1FJG F;  4PRV A;  1NSK L;  2FZK B;  4DSK A;  4NZ7 A;  1KVI A;  4AYB D;  4B9S A;  1EKR A;  1FX2 A;  4C2M A;  3LGH A;  1UDQ A;  1R6M A;  3KJQ B;  4QU7 A;  1TKX A;  4TU8 A;  2VQE F;  1GMW D;  5F8G A;  4H4M B;  1RTJ B;  1HNX F;  3GFH A;  4EO6 A;  2FJW A;  1LW2 B;  2CQ0 A;  4ZVO B;  3ZNJ 1;  4M5D B;  3MOZ A;  4PAA A;  1MMD A;  4F2R A;  5F8J A;  1Z0W A;  1RWU A;  5FWK A;  2K3I A;  4OHZ A;  1TV6 A;  2NSB A;  3PJW A;  4ZPW R;  1TKT B;  4AID A;  4YR3 A;  4EWT A;  4F3Q A;  2DNP A;  1I94 J;  4BA2 A;  4L75 A;  1TK0 A;  4UOG A;  2VG5 B;  2DIV A;  4QIW D;  1I94 F;  2DPJ A;  1D9F A;  1CJV B;  4XDC A;  3ILJ A;  4H4O A;  2HBZ B;  2LDI A;  3I4H X;  5LSO A;  2VZ9 A;  4FYX B;  2H48 B;  4KT0 C;  5HVF A;  2XYG B;  4P2X A;  1N88 A;  3AXK A;  2JEB A;  2GZO A;  3OHA A;  1IKX A;  1APS A;  4DUZ E;  3R1H A;  1QAJ A;  4DV7 F;  2KHD A;  4BCA A;  2BJ3 A;  1MW7 A;  2QLB B;  3C66 A;  3HSJ A;  3A3P B;  2B56 A;  4DL6 A;  1UVI A;  2J7K A;  4PPZ A;  4WF9 Q;  3WU5 A;  1SJQ A;  3EVO A;  2VFV A;  3FQL A;  4M5K A;  5F3T A;  1PSD A;  2OLW A;  2JHE A;  3SMZ A;  5C7P A;  8AT1 B;  4P75 A;  3G6X A;  4DUZ J;  1PO6 A;  4JI7 F;  5EWF A;  4Q0B A;  3CB4 A;  4LFB I;  4U8V A;  1VRU B;  2DR7 A;  4ZVQ B;  1A6L A;  3V4M A;  3KLG B;  2VQE J;  1TKD A;  1RUS A;  1X4C A;  3ADA C;  3R9L A;  3T5K A;  3BN4 A;  1SPB P;  4FF2 A;  2K1R B;  4M5I A;  1BQM B;  1RT3 B;  2Z2M A;  5L9X A;  3WX4 A;  4ED0 A;  1JJ2 R;  1IBM F;  2UUB F;  1U2C A;  2ACM A;  2ZZT A;  3P45 B;  2BKP A;  1PJ5 A;  3MR7 A;  4USK A;  3UCU P;  1UFW A;  3JTO A;  2FJD B;  3C14 A;  3ISZ A;  4LR7 A;  5BR8 J;  4M5J A;  3SZ2 A;  4OZE A;  4DR2 E;  5BR8 I;  1U1O A;  4B3O A;  4DR1 J;  4DWI A;  2ZHO A;  1P9Y A;  1QUP A;  4IQM A;  1R8B A;  1FKA F;  2DYA A;  4N47 A;  2N82 B;  5D77 A;  2HWT A;  3LTO A;  5F9L A;  3NMA A;  4DZD A;  4CH1 A;  2V8D A;  1TAQ A;  1MN7 A;  3NKY A;  2BXJ A;  2R7W A;  4YY3 I;  2C39 B;  1CJK A;  5HMX A;  4DR2 J;  1JLF A;  2YQ1 A;  3PRV A;  1P27 B;  2HFO A;  1WF1 A;  4C3K A;  5KT3 A;  5E3P A;  2GFF A;  5ETT A;  4EBC A;  4ZCI A;  3VTI A;  1VGY A;  5LMU F;  1ZZF A;  1S1T B;  1S79 A;  4RUB A;  2UVW A;  3EGZ A;  4IZJ D;  2HNY B;  5CAA A;  2CJK A;  4B3T E;  4NA1 A;  1IWA A;  2CQ1 A;  4OYZ A;  4FXV A;  1VI7 A;  3H98 A;  5KFB A;  1N5V A;  2HGN A;  1QVG R;  4DU8 A;  1YJT A;  1S6U A;  3WBZ A;  2C38 B;  4ZLL A;  1REV A;  3UN2 A;  3SCL E;  3I5C A;  3EZ5 A;  3DU6 A;  2U1A A;  4O4R A;  3KLE B;  3K8W A;  4DV1 E;  3NEK A;  4URG A;  3QFH A;  2BRK A;  3D6T B;  4USH A;  2J6T A;  3T6B A;  1HYS B;  4X64 I;  1QVF R;  4NML A;  5EN1 A;  4DR1 I;  4YHH I;  5DRP A;  4JI3 F;  3ZZT A;  2RQK A;  2ZNZ A;  4MIW A;  1N36 J;  3CD6 S;  3KK1 B;  3GIK A;  2YWW A;  2RNE A;  3FUY A;  1XMO J;  4JI7 I;  3D54 A;  3MR3 A;  2BOP A;  3OD2 A;  2PNZ A;  3HDS A;  2WCX A;  3FNN A;  2W9C A;  3G6V A;  1OQ6 A;  2LP4 A;  1OY6 A;  1UW9 A;  1V3Z A;  1WUU A;  3MTK A;  4MKB A;  1YKW A;  3OUY B;  3H1C A;  1Q5Y A;  3ZC4 A;  5IT9 Q;  2D7S A;  1DY3 A;  3D67 A;  3ETO A;  4I69 A;  1AT1 B;  3PXG a;  4ILL A;  1SIZ A;  2U2F A;  3IAS 9;  3DGP A;  1WNE A;  4P7V A;  2WBR A;  2NCK L;  3D2W A;  3J7A G;  1VJQ A;  2XS7 A;  2V8H A;  4HI1 A;  1FJC A;  5K36 E;  1IKV B;  4X4R A;  4RNH A;  1A0O B;  5E5N A;  2J8S A;  2HUR A;  4YN3 B;  5F3Z A;  2Y9H A;  3FBE A;  2D1C A;  3LH2 S;  2XMW A;  3NBP B;  4OHV A;  2DNH A;  3GON A;  2XLK A;  1IBC B;  2LEC A;  2HHH J;  5DG8 A;  2FGC A;  4EMD A;  3BKT A;  2B0G A;  3UPF A;  3ENQ A;  4LRD A;  4NZ6 A;  5KT4 A;  5JJB A;  1EA6 A;  3H4L A;  5B0G A;  1VR6 A;  4NYZ A;  2B8Q A;  4BC9 A;  2AQ4 A;  2UXC F;  1JLC B;  3MM8 B;  4QR0 A;  3RR7 A;  1FFS B;  1HNX E;  2OPP A;  2Z57 B;  3HD2 A;  2XZT B;  4WE1 A;  5KFL A;  1D09 B;  2UZA A;  4TN2 A;  3W5Z A;  4FNI A;  5HMW A;  3M8Q B;  1S10 A;  4B9N A;  3CWV A;  5DRQ A;  4USJ C;  1F2G A;  4LF5 E;  4PWW A;  5J2P A;  3THV A;  2UVR A;  3L7Z A;  3BS9 A;  2CPF A;  4EBE A;  3DLG A;  5LMU J;  2KRR A;  3M2R A;  2IDE A;  2KZM A;  4MK9 A;  2R2U A;  2ZZN A;  1NPR A;  2OPQ A;  2X7I A;  3PM9 A;  3PEH A;  4DV2 F;  4HTJ A;  3HKM A;  2HFN A;  3EJM A;  2KI2 A;  4RW6 A;  4A8Q A;  1YJ9 S;  1DFD A;  2ROE A;  1FWL A;  3BRE A;  3WZ0 A;  3JAM U;  1EP4 B;  1R0B G;  4GRS A;  2D3O 1;  4LF6 J;  2DHG A;  4RPF A;  4RWW A;  1VLO A;  3EZO A;  1T9W A;  3QRR A;  4N8O A;  1X8D A;  1Z59 A;  4F4W A;  1NKB A;  3U1K A;  2F1D A;  4NLD A;  2WNR B;  3M9N B;  3RB4 A;  4HXZ A;  4LF5 F;  1Q5V A;  2KT5 A;  1X4D A;  2O01 C;  3J7Z 5;  2MZQ A;  2RKI A;  1VHI A;  2ZUG A;  4FPR A;  4WPA A;  4CO2 A;  1TAU A;  4LSN B;  1K73 T;  2IY5 B;  1OYP A;  2AEF A;  2JH3 A;  3HD1 A;  4UW2 A;  3QT6 A;  1R8A A;  3FSI A;  1FKO B;  3SSS A;  2HZV A;  1Z5B A;  4G1Q B;  2K8G A;  4DV5 E;  1NHU A;  1Y7P A;  3OTC A;  1C1C A;  2MZS A;  4TXS A;  1RT6 A;  2DNN A;  3GII A;  3CJ2 A;  1KON A;  2JRS A;  1NXI A;  3AOD A;  1WOR A;  3F73 A;  3MGJ A;  3OJS A;  3QSY B;  1X9S A;  3QBC A;  1OPZ A;  3RBZ A;  4HL9 A;  4OYA A;  4WFN Q;  2J0S D;  4Q0B B;  1B7F A;  3CED A;  3KLI B;  1UFL A;  1VIS A;  1R8C A;  4KGK A;  1HI1 A;  2ZDO A;  3ZTS A;  2OD6 A;  4ECV A;  5H9F K;  5GAE I;  2MGZ B;  2FJX A;  2DNK A;  1RT3 A;  3IBC B;  1LKZ A;  4MKA A;  4NX9 A;  2HND B;  2AJQ A;  4LFB E;  4ES1 A;  5CA5 A;  4RBU A;  3V5R A;  4ECU A;  3ZZR A;  1KHV A;  3Q8R B;  1J5E E;  1LWC A;  4NLY A;  3OVA A;  4ETX A;  4Y0F A;  4J3D A;  3BDE A;  1HAR A;  5F41 A;  3T3F A;  4MFB A;  4WK1 A;  2DGV A;  1IM6 A;  2GML A;  2D3Z A;  2VDI A;  4LFA I;  2NLW A;  3PS3 A;  1VLY A;  3KG4 A;  2RQM A;  2ZH6 A;  1ZA2 B;  5KT6 A;  2E5H A;  4DPX A;  4JV5 J;  3BYP A;  1SJ1 A;  1UCN A;  1P1T A;  1S99 A;  2B9E A;  2G2Y A;  2GW8 A;  3CCW A;  2R7O A;  3HHL C;  3PFO A;  3ZZU A;  4CYU A;  1KS2 A;  2RVJ A;  3CNQ P;  4ZK7 M;  1JX4 A;  4LFC I;  1IBK F;  1I51 B;  4O3O A;  4MJK A;  4ICL B;  3T1Y J;  3AB2 B;  1BGX T;  1IKW A;  4CQ1 A;  3SSQ A;  2ZWP A;  2QYC A;  1CUL A;  3CJ5 A;  4DQR A;  3A13 A;  3RAX A;  2X1A A;  3HXM A;  1KRP A;  4MAK A;  3ENV A;  3CME S;  5K36 C;  2XUL A;  4RBT A;  4DG1 B;  2OGU A;  5GAE U;  3EVW A;  3PW2 A;  3IG1 A;  1UMJ A;  4NCG B;  2A2C A;  4GMK A;  4WCE Q;  2H4Y B;  2QX0 A;  3DMJ A;  3KJF B;  3QT5 A;  3IM8 A;  4CI0 B;  3FK4 A;  3HT3 A;  3Q8P B;  5HVG A;  4B3M E;  4KHP I;  3ZZ0 A;  1S1V B;  2DY1 A;  2JOQ A;  2M0G B;  3VGU A;  5HJX A;  4NXM J;  5L3J A;  2DRD A;  5A6W A;  4R5P A;  3B6B A;  2BM0 A;  2RML A;  3BO4 A;  2XMK A;  3LAL A;  4IFD C;  1RXO B;  5EGY A;  5K36 B;  1RWX B;  4W98 A;  4F0M A;  2BQ3 A;  3EVM A;  3VZH A;  3A8I A;  3T1A A;  1SVD A;  2HWI A;  2K3K A;  1NH8 A;  1VRT B;  2P6T A;  4NLQ A;  1T02 A;  1CQM A;  1GXU A;  2QSF A;  4UTG A;  1IBL J;  4JI4 J;  3JAM Q;  1VOM A;  4DR3 E;  4URQ U;  7FDR A;  4A47 A;  3GFY A;  1YHC A;  3IXQ A;  1PG5 B;  1UDO A;  3UCG A;  3ITH B;  3M2U A;  3V2U C;  3D0I E;  2F4V J;  1AB8 A;  1REG X;  4F26 A;  3I6P A;  2MEW A;  1S7I A;  1TUW A;  4KFB B;  2E5L E;  1FI4 A;  2RDD A;  3HHE A;  3PTW A;  2JEG A;  1EQM A;  4AT1 B;  3TA2 A;  2HQG A;  5KOX A;  4KJI A;  3GJQ B;  3U1L A;  5E2Q A;  2GGP A;  3OXG A;  4HLB A;  2W9A A;  4DG1 A;  1WAC A;  4QW9 A;  3OL7 A;  4I67 A;  1BQX A;  2NUH A;  3JSM A;  1RQ0 A;  2R2T A;  5IWA F;  3X3U A;  4IQX A;  2ZM6 E;  4DV1 I;  3W5X A;  4V1A k;  3UO0 A;  1N34 I;  2WOM A;  3DM2 A;  2G2O A;  3SQG A;  3BKU A;  1TKZ B;  1FWK A;  2JE6 A;  1HQU A;  4DR1 F;  4FZV A;  1CSJ A;  4ISA A;  1VYA A;  2GVZ B;  4M5