4DXLA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
VSDWVPTGAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
total genus 97
structure length 304
sequence length 304
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4dxlA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dxlA01
1HNWI 4MYTA 1VISA 1H73A 3ZM7A 4JV5E 4Z7CA 3J80C 5FLXQ 4DV7I 1N0UA 1XNQI 4X62I 3QT7A 3B78A 1XMOI 4DR6I 2BV3A 1KIJA 2ZM6E 1ZM4A 1K47A 4DV3I 2UUCI 1DARA 4DV4E 3QT5A 5BR8E 4USMA 4WUBA 2R42A 4HY1A 2HHHI 1IBLE 5IWAE 4PRVA 4DV2I 1XNQE 4JI5I 1Z0EA 2UXBE 5FLXC 3V5RA 2V2VA 3PYDA 1I94I 4AQYI 2VQFE 4JI1E 3J81Q 4FW9A 4DPWA 4X66E 4JI3I 1FJGI 2F4VE 4DR6E 4DR5I 1ZXMA 4LF4I 1Z5AA 4JG4A 4DPXA 4B3TE 3ZZTA 2BM1A 4I3HA 1Z0CA 2UU9I 1MX0A 4X66I 4JI3E 4NXNI 4M1KA 1HNZE 1Z0BA 4X64E 4LF5I 1N33I 4OX9I 2UXDE 4LF8I 1H74A 4NXME 3B8HA 4DR5E 4B3RI 3WU4A 5GMDA 5L3JA 1KTVA 4YHHI 1UEKA 1ELOA 4JV5I 2VQFI 4LFBE 3OTOI 4JI8E 2HK3A 3HULA 4HACA 1FKAE 4FWDA 2HFUA 1XNRI 3WU3A 4LF4E 4X62E 4HYMA 2HFSA 3K17A 3ZKBA 4DR2I 1N36E 1ZM3A 4Z7YA 3CWVA 2WW4A 4JI8I 4DR7E 3GONA 2EFGA 2UUAI 4DV3E 4LF6I 4DR2E 4UTGA 3ZZUA 5IT9Q 4PRXA 4DPYA 4FWHA 1Z5CA 2UXBI 1IBLI 4WUDA 4DV2E 4P52A 4LFCI 2VF3A 4B3ME 4LF9I 1XHKA 4JI0I 4NXNE 2VQEI 4DV5E 4DR1I 1EI1A 3LTOA 2CZ9A 3QT6A 5LL6R 1FJGE 3F0NA 4UT4A 4DU7A 1B63A 1KKHA 4DUYE 1Z0GA 2J7KA 3D4JA 1Z59A 4LFAE 2X7IA 4X64I 4DUZI 1RR9A 3J7AG 1NHIA 3K1JA 4YY3E 2HHHE 2UXCI 1HR0I 4GKKI 4K0KE 4LF8E 1XMQI 4LFAI 1FI4A 1XMQE 3Q1QA 4K0KI 1N34I 2V2QA 1NZ0A 4X65E 4DXLA 2AJ4A 1H7UA 4JI6E 3JAMQ 1A6FA 4KQVA 4XTJA 2XEXA 2BM0A 2R3VA 1N32I 1XMOE 1EA6A 4DUYI 4X65I 1HR0E 2GS8A 1BKNA 2OI2A 3PYGA 4LF7I 1MU5A 2UUAE 4JI2E 1Z0VA 4DUZE 4JYAI 1HNXI 4GKJE 5IT9C 2UUCE 3OTOE 1FWLA 2DEJA 3H4LA 4LFCE 3LNUA 1H72C 2UU9E 2ZITA 2UXCE 5A2QC 4DU8A 4FWGA 3V2UC 1N0VC 4MYUA 3PYEA 4DV6E 1S4EA 3J81C 1MG7A 5LMUI 4DR1E 4OX9E 1Z5BA 4LFBI 1N32E 5LMUE 4DV0E 4DR4E 2UUBE 4B3SI 4DV6I 4JI5E 1PKPA 3B82A 4LF7E 3LPSA 3JAMC 4USKA 4P7AA 1Z0WA 2HKEA 2LJPA 3T1YE 1NHHA 2A2CA 4NXMI 2HKJA 3ZKDA 4DR7I 1N33E 1FWKA 2UUBI 4B3SE 2V2ZA 1J5EI 4DV1E 3T1HI 4YHHE 2E5LI 2V34A 2Q2EB 1PVGA 5LMNI 4LF6E 4JI7E 4DV1I 4DR3I 3T1HE 1D6TA 1XNRE 1IBME 4ED4A 2UXDI 4JI1I 1IBKI 1HNZI 5A2QQ 2V8PA 4WUCA 4JI4E 1IBKE 4GKKE 3QT8A 4DR3E 4GKJI 1N36I 4JI6I 2ZBKB 1FNMA 1IBMI 1WUUA 1H7SA 3J7AM 4KHPE 3M6AA 1RREA 1PIEA 2VQEE 4DV5I 4DPUA 2F4VI 4EMDA 4B3MI 2E1RA 4AQYE 4ZVIA 5GMEA 4JI0E 4RPFA 4DPTA 4JI2I 5LMNE 4YY3I 1S16A 1N34E 1ZXNA 4HXZA 5BR8I 4LF9E 5IWAI 1ZM9A 1ZM2A 4FN5A 1QZRA 4LF5E 4DV0I 4DR4I 4R1FA 2ZM6I 4JI4I 1Z0TA 3J80Q 1U2RA 2X36A 1HNXE 4B3TI 3WU6A 1OJ4A 3PYFA 4KHPI 4B3RE 4JI7I 2NPFA 3T1YI 4URLA 3WU5A 4DV7E 2A2DA 3ZZ0A 1HNWE 2E5LE 4HACB 1NHJA 4PU9A 1J5EE 2DEIA 2HK2A 1KVKA 1I94E 1B62A 4DV4I 4JYAE
chains in the Genus database with same CATH superfamily
3X3UA 1XXEA 2AZ3A 3JSYA 3H0PA 4UOFA 1BUXA 1Q8IA 4ZJQA 2IRYA 2QL7B 2VODA 3NL0A 2KFNA 1WACA 2A1BA 3CCVS 1TKZA 1NO8A 3IR5B 1EKRA 1HNIB 3H2VE 4QR0A 4EI2A 3MDFA 2B43A 4CT9A 1CPZA 3DLJA 3UN2A 1HL6A 4DX5A 3N79A 3ZTOA 3DLBA 4NXNJ 4LFCE 1SC4B 2QGFB 3M8PB 4DL0C 5BJRA 2BANA 3SCIE 2HPUA 5J2QA 2YX1A 5K36C 4PG5A 4AUKA 2WP8A 5A2QY 1TKTB 1ITPA 2LA4A 1H3DA 2D3ZA 1YITS 1KEKA 2NUUG 2ZWPA 4KAIA 1G7CB 3VGTA 2XM3A 3MUTP 3T1HF 4HL9A 3TW0A 3D0IE 3MMBB 4U96A 4LF7J 2DR9A 5GAGI 1U25A 4DR2J 4DV3I 1RHJB 1J27A 2KYZA 1D9DA 3RW6A 3PG9A 4JI5J 2G2OA 4DV4E 1IBMJ 3SZ2A 4B3TJ 2C37A 1RTDB 3HKMA 2AGQA 1TK5A 2MHEA 3QIPB 1S9EA 4RNNA 2CG4A 2HBZB 1JXVA 1J5OB 3MFIA 2HHHI 5E3QA 2XMTA 6AT1B 3PCOB 1X4AA 1CJKA 3OPKA 2DD8S 4I2PA 4R8UA 2FLNA 1X4DA 2EFVA 3VVUA 5CABA 1KWMA 3TUPA 4OL8A 4ZPAA 1KNZA 2QEXS 4JI5I 1Z0EA 2UXBE 1RWMB 2VBWA 3D3CJ 5LXYA 3OTOJ 3BGUA 2AZ1A 5FLXC 3IR7B 1IKYB 1H98A 2CPFA 3FFIB 3V5RA 3MCSA 3KLVA 3D6FB 3KLGB 4YHHJ 2V2VA 3PYDA 1TKXA 4OYIA 5CYJA 3MTJA 4ECWA 4JI2J 4IUFA 4AQYI 3PJXA 4CDIA 4YUDA 3KK3B 2PMHA 1JJHA 4BS2A 3EMTA 2QLFB 3IS9B 4USTA 5D3GA 1FJGF 3QFHA 2W7AA 4DCPB 4DPWA 4XPCA 5C0XB 4OV6A 2YNIA 5IM0A 1VQOS 3H8YA 2KJWA 2MZTA 1WHYA 2KH9A 3QQCD 3T3FA 1HBOB 4QWBA 3OLBA 4KJIA 2WVDA 4ZVSB 4DR5I 4LBHA 2AHOB 4U8YA 5KTQA 4WTYA 2XY6A 3M1VA 2H54B 4TU8A 4DPXA 4OO1D 2RQ4A 1NMEB 3DRRA 5L38A 2DNMA 1YRXA 1UW9A 1X31C 3T5HA 1WHXA 1MX0A 4X66I 2D74B 1TUWA 4WU3A 1T9WA 3OL6A 3B4TA 4JI3E 1MN9A 4IFDB 2RKIA 4KY3A 1KR4A 3D0GE 4ECRA 4CM2A 2OH2A 4J9QA 1JJ4A 4DQPA 2BJDA 1Z0BA 3P4UB 1N48A 2YNGA 1N36J 2B5JB 1Y6ZA 2Z57B 4UY85 1N8RT 4WF9Q 4OYBA 2NSBA 2CXEA 3GYXB 4MK7A 1FRLA 2FLPA 4LF8I 4CZCA 2F1DA 1JK9B 3UD4P 2HQGA 4HHHA 1U6FA 1KOOA 5IZHA 4RNMA 3EPIA 2MQLA 2HBQB 2WNRB 1JLFA 1Q8KA 2OSQA 1CULA 3MPYA 3JS9A 4HTJA 4RW7A 5CYMB 2XMVA 4OI0A 5B08A 4ZCMA 4LRFA 1NEEA 3RR7A 2GJIA 3VAJA 1Q82T 5ETQA 3IO1A 2JFDA 4LR8A 2EFOA 3BB5A 3M6XA 1RWWB 3D2WA 4KTQA 1U26A 4ZP6A 4PQUA 4YHHI 4OHXA 2PGCA 3IGNA 4XDCA 4ZLLA 3H20A 4IZKB 4JV5I 1VQ5S 3DLEB 3LAMA 5A8KA 1VS3A 3ULHA 4OX9F 3OTOI 2MKYA 5DQIA 3K57A 4K59A 3MM7B 2BR2B 4X4OA 1WHWA 3HZGA 4U7UK 1HD0A 1UJ6A 3R5JB 1FKAE 1EP4A 2N4CA 3BDEA 2V8GA 2VPZB 3M2UA 5HATA 3JYTB 1LFWA 2V69A 1JB0C 1RT1B 1VQYA 3MM8A 1UETA 5IC6B 4FYVB 4UQTA 2U1AA 9ATCB 4G1IA 3CJQA 4Q43A 3WU3A 3BSOA 3MCMA 3DM2B 4R0JA 4LF4E 2ACMA 4ISAA 5K20B 3KJNB 2HFSA 2YKMB 1AB8A 1C2PA 4DR4F 1IKVB 1YJ7A 2LFVA 4X4TA 2H4WB 3Q0AA 3HHLB 1RT7A 1NAQA 1IBMF 2NXJA 4I2QA 3C3LA 2F65A 3NWGA 3JQJA 4WFAQ 1N36E 2H48B 5CD4H 4H54A 1PGZA 1HBOA 3GYNA 1MWYA 1RWOB 1S76D 1W25A 2CPZA 4OYMA 3TVYA 1TL7A 3W7BA 4JI8I 5DLFA 4K50A 4ANEA 5HJYA 2V4JA 2CQ3A 1NK7A 3H59A 3PIOQ 1PJ5A 3RYLA 2BMBA 2F8MA 4LF6I 1T3NA 2P5VA 2VG7A 1MMNA 2B9XA 2H5IB 5LOQA 4ILMA 3AH6A 1FT8A 2GCFA 2DGUA 5I3UB 3KLGA 1RAJA 4PRXA 5KFIA 2KT2A 4H4OB 1VYAA 2ZH4A 2FY1A 1HD1A 3GIMA 1Z5CA 1T3OA 2UVUA 3TZWA 2KVIA 4ELTA 5EWGA 3NLCA 5I42B 1X4BA 2XLJA 4UQGA 2V50A 3MEEA 4B08A 4RU9A 3GR0A 2HAFA 1QE1A 3MM7A 3M8SA 3LP1B 2BR2A 3IC1A 5ETTA 4DV2E 1JLQA 3TAMB 3MEGB 2JEIA 4R8UB 1FKPA 3R2DJ 3OXLA 4IO9Q 3OTBA 1HNXF 4IFDA 3MEDB 3EGWB 1IBLJ 4LCFA 3KYLA 3THPA 2FLOA 2V63A 2V9KA 3KOAA 2W2MP 3GIKA 2MZSA 5GADU 2M70A 5ETNA 3NS5A 4ECVA 3QAEA 2WW8A 4KO0B 3HHKA 5K8MA 2UU9F 4MKYA 4U3DA 4B3ME 4JI0I 3HKZD 2C42A 1UAWA 2GO4A 5A6WA 1SKWA 2EBGA 3MTKA 4DV5E 4KB7A 2B9EA 1ZH5A 4ZPTR 4YOEA 1BY9A 5ETOA 1GNKA 3GB0A 3ZNJ1 2QZ8A 4NASA 1RT3A 4ZJLA 1M5SA 1CEZA 5LL6R 4DSFA 1J5EF 3OVBA 1WC4A 2B56A 2C2NA 4P2MA 2DNLA 4O3NA 3RG6A 4PR6A 2F9JA 4DU7A 1DQAA 2IM3A 4OZJA 1Q7LB 4K8RA 4E2FB 3QZ8A 1IR2A 3K5NA 2YH1A 2RUGA 3DHWC 5L8RC 4YDXA 3W5YA 3LUYA 4R5PB 4NXNF 2PFDA 4DV0J 2O3DA 5LM7E 1C1CA 3S8SA 2WCXA 1GMWA 5DRQA 3A3OB 1I51B 3QYYA 4OLPA 2IVYA 2NUHA 3SQOP 2HW3A 1VJWA 1RHMB 3R7NB 3U1YA 3TEHB 4KFBB 5KFYA 1TVRA 1R8PA 2IYGA 1FD8A 3GPAA 3RZAA 3CJKB 5KT4A 4X4PA 2B9WA 3HVRA 4X64I 4DZ6A 5K36F 2J9CA 2L48A 4FPIA 4G65A 5JEAB 3PY8A 2Q1LA 1BQNA 3CDWA 1GT8A 3RBDA 5KFEA 4LF8J 1B62A 3VR1A 3K1JA 3VTIA 4IFYB 1KVJA 4YY3E 2MKJA 4KH0B 1U1MA 2QYGA 4NXMJ 4CLPA 1DTTA 2UUTA 3CO0P 4WPAA 5C5JA 3C16B 2MLZA 3V4MA 1QAXA 3PO5A 3DXSX 1RBLA 3CUNA 3FFIA 2GJFA 3CDIA 3M8WA 3AD8C 4GRSA 4PYAA 2OLWA 5ETLA 2FZKB 5A6PA 3BGRA 4U95A 2IM2A 5JVGQ 1NJXA 3NEKA 1KFSA 1PAEX 2O1WA 4LFAI 4AIDA 2V4QA 4DV5J 3MM6B 2W24A 4A8YA 1FI4A 4ECSA 4B9MA 2XNRA 4Y2AA 5H9FJ 2ZH6A 2LU2A 2RF2A 3R7SB 2PE8A 2DIUA 2Q43A 3GSIA 3SDEA 1FJGJ 2Q79A 2QV6A 3WQPA 2FVCA 2P9EA 3L7PA 5GVQA 3VZIA 3CF5Q 3VAKA 2WRMA 3N5BA 1D0EA 4JI3J 1KHVA 3A8JA 2DH7A 4P75A 4RKUC 3VV2B 2LQBA 3AB4B 3OV7A 4RW6B 1XNQF 3K89A 1WOSA 1E6YB 1RP5A 3QGGA 4JI4J 3QGPA 1D8YA 3GCMA 1WF0A 2YKOA 1L3VA 1JLBA 3LGMA 4C7QA 4JI6E 2CQIA 3FC9A 2QLJB 5HVHA 1H0HB 3PW4A 2UZAA 1G1XA 1WOOA 1IN0A 4J9VA 4OZ5A 1N6QB 4XTJA 2C3UA 4MIBA 4BWMA 2HIQA 1C4AA 1OQ6A 3AOAA 2C39B 4OO1E 3EZ5A 2BJ8A 5AT1B 2PNLA 5ETMA 1X4HA 2JE6A 2W7PA 1UW4A 3DDIA 3L09A 2OGUA 4AIMA 1RLCL 1C0UB 1S6PA 1B64A 3WC2A 1MMDA 4ED1A 2CJYB 3OHBA 2HNYA 2V8DA 3GMEA 4PYDA 4LF5F 5E3PA 2M4MA 3UCGA 2C1EB 2DHHA 4X65I 1O8BA 1OSCA 2MY8A 3EDQB 4QIVA 5ITHA 4YMEA 2OI2A 4K4SA 2IDLA 2R7WA 1G2EA 2F40A 3HCXA 3JTNA 2E1CA 2NQPA 4DOZA 3ENVA 3KMSA 3B4MA 3H5UA 4U7CA 2UUAE 4JI2E 4CP5A 1FEHA 2DO0A 2QTWA 3EWGA 3M32B 2DNKA 5D0HA 4JYAI 1UFLA 4QU6A 1Z4UA 4IQMA 4GKJE 3TYTA 5L1LA 3BF4A 4V19J 1RHQB 3MD1A 3NGKA 5A8WA 1W7WA 1LW2B 1XN9A 1S72S 5HQMA 4H4KC 3TNVA 3ENQA 3JTPA 5CD4A 3TZZA 4ENOA 1WG1A 4DFKA 2DR7A 1FRHA 1TK0A 2ZITA 3HXMA 2CGEA 1IKXB 3A13A 1R6VA 5A2QC 3FRZA 2QMXA 2G13A 4NEZA 4RBUA 3TAQA 1BQMB 4YY3F 1U1KA 2VFTA 2X51A 1S57A 4L74A 2RQCA 4WFBQ 1VQ7S 5DG7A 1CJUB 4P2XA 4UZCA 4QW9A 3FSIA 2D1CA 2NXUA 4Y00A 2XC9A 4DUTA 5HAOA 4FYDA 1LWFA 2BX6A 1JLEA 4USVA 3TVZA 3MMAB 5BR8F 2W9BA 4ZVFA 4LSLB 5LMUI 1MG7A 2XI2A 5DS7A 3O6QA 4LFBF 3SCKE 4NMLA 2V5HG 3UVJA 2YTCA 3FK4A 4NLYA 2EEYA 2YWFA 2KZMA 4LFBI 5A0YA 2XGQA 1X5TA 4RUCA 1NHUA 2ZJQQ 2QFJA 1N32E 1VQPS 2OPRB 3KK2A 1JLAA 2HWIA 1J5OA 1FJ7A 4BC7A 2HVIA 4EZ6A 1UDSA 4WUCA 2Z4PA 1HWUA 3P5TL 3CIZA 1Y5IB 5IOLA 5DJBA 2AEMA 4C3LA 3UDCA 2Q66A 1KRPA 1UVMA 4F2RA 1K1QA 1PKPA 3U1NA 1U45A 3IWXA 3LPSA 1WKLA 4P7AA 2ALYB 1YKWA 2JC1A 2HKEA 2O5DA 3K5PA 2LJPA 1MSWD 4CO5A 1VMBA 3DKDA 4N5SA 3RRGA 1NHHA 2R7QA 2YX4A 4W4MA 4IG3A 5B0FA 4KGXB 1TP7A 3I0SA 4NXMI 2GGPB 2WVEA 3UQSA 3FZ2A 5L1KA 4Q0BB 1RTZA 3DXBA 1D1UA 3RB6A 4ID5B 5KOWA 4LT6A 3NCRA 5DLGA 1B3TA 3GCXP 1N33E 1HNIA 1WORA 2M2BA 2K3KA 4DL4A 3M7ND 1R6YA 1X5OA 2FDNA 5DM7Q 3R5BA 3DI6B 4AE5A 3UNGC 2CG8A 4ZS6A 4CLFA 4YHHE 5GAGU 5HSPA 2DIVA 3I87A 1BHNA 1YH8A 4MDTA 3TJAA 4IS9A 4C8MA 1T9YA 2NXEA 2H5EA 2MQMA 2WHOA 5K14B 4DR1J 5FJ4A 2PNZA 3KDOA 2AEFA 1VK3A 1HNVA 4OYZA 1QJHA 4Y2IA 3SFGA 2CNOB 3DYAA 2M7SA 3CMAS 4DR4E 2HHWA 3C14A 2O1TA 3PZPA 5LSOA 1GXUA 2OIHA 3PX4A 1PVGA 5KG4A 5LMNI 2PNMA 2D3UA 3GE9A 3DLKA 4JI7E 3PIPQ 4J7CA 2CFXA 4CNYA 2ZBIA 2NN6D 1FFWB 2CKWA 2L9NA 2BRKA 3FQLA 4ED4A 4JI1I 2QL5B 2P2CB 5A2QQ 4CTAA 2GW8A 1AUSL 3UFCX 3QMQA 3H4DA 3JSBA 4RBTA 2X1FA 2B6AA 2O1VA 1BMQB 4XPEA 4O3OA 5I4MA 4J37A 1REVA 4LF1A 4R5PA 3G86A 3QZ7A 3CDAA 2UXBJ 2VUGA 1N52B 3FBFA 2RMLA 4DPOA 1VOMA 2CA9A 4HVZA 4PZVA 1SJFA 4PWUA 1TFYA 4LF5J 4FWGA 1N36I 4GKJI 4FVMA 1C0TA 1PYOB 1S7IA 1WUUA 3DRPB 3GJTB 1AW0A 2XQCA 2YWEA 3E01A 4ZVTB 4FKYA 4WXOA 2I6WA 1C0TB 5D77A 5IS2A 3SV3A 3LWMA 2ZZNA 5KFTA 2KXNB 2D9PA 5KT3A 2PEHA 4ZCKA 2VC0A 3F56A 5FLXY 2GQ2A 1ZAVA 3OTDA 4P6QA 2LYVA 4A46A 4BLGA 3O2IA 3S01A 4EMDA 4QWAA 1HQUA 2XGPA 2IA0A 4DR5J 4LF4F 4HKQA 4AQYE 2E9RX 4B3MI 3D9BA 3GIJA 4B3MF 2XWYA 3CCES 4OZ2A 1N34F 4GO5X 1GX5A 4WTOB 5AXNA 2HHHF 1WF1A 1D9FA 7AT1B 2AYBA 3PS2A 1DFDA 2IOPA 5HROA 2B4PA 4X4VA 3WZ0A 3AODA 4DSLA 1MMLA 1QE1B 4TVAB 4JI2F 3MAAA 3RAMA 3CDEA 5M2UA 2MXYA 4DSEA 4KGZB 4DUYE 5LMNE 3PRYA 4JI2I 2W25A 1F9EB 2OPQB 3Q8YA 3HI9A 4MFBA 4NLWA 3MI7X 4ZHRB 1S16A 3BDPA 4UT4A 1FERA 5GAEI 3IAS9 3GR1A 1NSAA 2PD1A 4Y2MA 1RT5B 2FHMA 3LGNA 4Q2MA 2ASJA 3DC2A 2Y1LB 3H7HB 4TU7A 1KONA 1BWEA 2RRAA 3HVTA 2Q6CA 5SUHA 3OVAA 2R8GA 3IMQJ 4FYXB 2J0XA 3O5TB 3LA0A 4Q7AA 5KFFA 4PG6A 1EETB 4KRWA 4M63A 5KG7A 5BXIA 5IC4B 3KLFA 3MAQA 1U0SA 2BQRA 5EN1A 2XULA 4Q8EA 1T05A 2Q3PA 1Q5VA 1D3WA 4USJC 3QSIA 4LUBA 1WEYA 2HURA 4DL5A 3IBFB 3HHLA 1QUPA 1AA1B 4PRFA 3PYFA 3TZXA 4OQJA 1IKVA 3J80U 2IJNA 4B3RE 4KHPI 5D8HB 4X4QA 2OELA 1SJRA 2DGTA 2B3TB 3CJ8A 4P7VA 2GQ0A 5LT5A 1UCNA 1CJTA 1WOPA 3F44A 4KKOB 3UDLA 3BR9A 4AFFA 2A2DA 2DHSA 4A8OA 1S10A 3ZZ0A 3AT1B 3GYGA 1U24A 1HNWE 2C2DA 3M85D 1ZPWX 2A6MA 1TL1A 2HRTA 2N3LA 3M8QA 4RW4B 1KLNA 1YJVA 4OO1C 3RRHA 4PU9A 1FDBA 2VBYA 2HS0A 5FDLB 2PC6A 2PEBA 3GJQB 4ZVRB 3FGVA 4DBQA 2LU1A 1NK9A 4DSIA 2UXCJ 1J5EE 4OI3A 4MKBA 3JXOA 4DV4I 2N7YA 4J91A 2UP1A 2HQCA 1HQEA 4QYRA 5C42A 2F3JA 2L9DA 2B6AB 3CO9A 1HNWI 1N5YB 1N33J 4C0BA 1GXTA 5ETPA 2EK6A 1APSA 1VISA 3R5DA 4OI4A 4B3SJ 4CIOA 4OJGA 3EJMA 3LO3A 5F9NA 4DN9A 3ENWA 2DNPA 2FC9A 2FHOB 3FJ2A 2UUWA 4KKOA 4RO0A 5DDRC 4QWCA 3HP6A 3CC7S 2WNRA 1YGYA 1DRZA 2QLBB 1JIHA 4IFDC 3AJ2A 1IKXA 3J80Y 2XNQA 3G6ES 1YJNS 4BWJA 3DYAB 3VALA 3EGZA 3SFUA 4XK8C 3MECB 3RB3A 1FRKA 1RADB 4HT5A 3KHGA 3CMES 2W9CB 1S6UA 3PV8A 4F0MA 2RE1A 1ZM4A 2Z2MA 1K47A 3GP9A 2RQKA 3H42A 3NGSA 1T9VA 2C2MB 2HGMA 3CCRS 1DARA 2UUCI 3M2RB 2JJ4D 3BZQA 3R3TA 1KP6A 1WC5A 3DDNA 4ZN3A 3V81A 4DV2J 4AXJA 2C28A 3PJWA 2RUSA 1I3OB 3G87A 4USMA 1RT5A 2R42A 4P2FA 4WUBA 2ZM6J 1GFWB 3HHNB 4ZLJA 1RB0A 1FX2A 3OFEA 1SQEA 2LEPA 2GMHA 2W9CA 4O3RA 4DV2I 5IM0B 4EO8A 3TEGA 2QMWA 1Y3KA 3MF5A 4DMZA 2OPQA 2CQ1A 2IYIA 3UCUP 1U1OA 5C0XA 4KT0C 5E5NA 1MN7A 5KAKA 1SIWB 1PYTA 1XR5A 5ETSA 2JE6B 4LMZA 2MY7A 1VLOA 1F5BA 4YB6A 5EUHA 4DX6A 4TLQA 2C39A 3IN5A 4DR6J 1BXNA 2OFHX 1I94I 4USHA 3UNYA 1NK5A 2VG5B 3G8TA 1S1XB 4QWDA 1N5YA 3BH7B 3KJQB 3CJ3A 2OMLA 3DOKA 2VQFE 1B4SA 4J9PA 3L7UA 1OSDA 1Y10A 2BKPA 5B0BA 1CJKB 3BBBA 3MGJA 2F4VE 4RLEA 1FJGI 3R8YA 4ICLB 2CUYA 4LF8F 4YR2A 2ZFHA 2ZH8A 1CJVB 1XR7A 3ZO7A 2HBRB 5K8NA 1OYEA 1L3TA 4EO6A 2OPSA 1SKSA 1L3UA 1TL1B 1Z5AA 2F4VJ 1RA7A 4ZITA 3J81Y 2E1MC 3DCAA 3NCPA 3ZZTA 2IOQA 3DRXA 1AXQA 4MMOA 1NZ8A 4X62J 1SV5A 3BO3A 1OPIA 2G9OA 2UU9I 2BZ2A 2PT0A 2V68A 3ZZYA 2HHQA 3GLJA 1S77D 2M5YA 4NXNI 4ZVQB 3DLGA 4QWEA 1F1BB 3G8SA 2F8HA 4CNZA 4IR9A 5HLFA 3AOBA 2RJZA 3HZEA 4H4KA 4ZK7M 4WCEQ 4LF5I 1Y60A 2A18A 2PO1A 4OX9I 2JEAB 3MR5A 2LKZA 2UXDE 3V6DA 4CI0B 3THVA 2CPDA 1UTAA 1H74A 4CCHA 3BEGB 1IQZA 1QUVA 3P06A 4URGA 2G0IA 1UPPA 4ELUA 4DR5E 5KFPA 3IRXA 3H25A 3TUJC 2W4PA 1LKZA 1VHIA 4TYAA 3CNQP 1UWBB 2VFRA 2YPYA 2WTFA 1U4BA 2VOPA 3ILOA 4EYHB 2R2SA 4LF6F 5GMDA 4V1Ak 4JI4F 2ASLA 2HVDA 3TOQA 3HD1A 2J6UA 2VC1A 2YX7A 3DRYA 5I3PA 1UZDA 3AQOA 2VBXA 1UEKA 1ELOA 4GVLA 4XTTA 3Q86A 2KXFA 1WJ9A 2O66A 2OHDA 2YPZA 5T7LA 2D3OR 3M9MB 4B3SF 1SJ3P 4FW6A 2DO4A 4NLXA 3CCQS 3W61A 4HACA 2XMUA 1E6VA 2CVEA 4F50A 1AZSB 3MAAB 2L3MA 3T6BA 3KHLA 4C8NA 2FD2A 2OO4A 4KGMA 2UUBF 2PFFB 4FWDA 2HVHA 2CVIA 1FTRA 1J5EJ 5KFKA 4IG0A 3E8OA 1N6QA 2BJ3A 1LFPA 5G4DA 5KFUA 1WNEA 3QGHA 1R7IA 3KJFB 5DM6Q 3W2WB 2YWKA 3HHDA 4DV0F 2LA6A 1HQUB 1RT2A 4M5GA 4QIWD 3EXCX 1KHWA 2JEGA 3GWCA 5K36A 2OD4A 1X5SA 1RWVB 1QTNB 2ASYA 5E7OB 2C3MA 1XK8A 2ZKUA 4Y2KA 2J6SA 1WF2A 4I0WA 4RW6A 2MSTA 4OJ1A 3OW2R 3CWVA 2WW4A 4DX8H 3HDSA 3HJVA 2EK1A 3GZ7A 3GONA 1FDNA 2YXLA 3IM9A 4WU2A 5J2NB 4CLSA 4DS5A 1YHCA 3H2LA 2C38B 3I31A 1DLOA 3EPGA 4PUOA 2WAQD 4PXEA 1Q4RA 4X4NA 3B4DA 2P8IA 4DV3E 4F4ZA 4ECYA 1BLUA 2EW9A 5KG0A 1S1VB 4DV7J 2L08A 1SCJB 3QO9A 4UTGA 3ZZUA 5IT9Q 2GHVC 4U67Q 3NGRA 3HHLD 2XYGB 4PPZA 2VG5A 2RS2A 2Z30B 3RB4A 2ROEA 3M2VA 4B3OA 2Z58B 1RBOB 1RI7A 2AD9A 1UDNA 4A8WA 4LPFA 5HBMA 4ZPWR 3FQKA 2JZ5A 4C3KA 1UVKA 4TU9A 2XB2D 3MOZA 1UDOA 3KLHB 4N56A 4F36A 2AYGA 2YQ3A 4NLRA 1H2TZ 2QA4S 1HFEL 2WOMB 4F4AA 3A8KA 5H9FK 1Y00A 1YX2A 1RTHB 5C24B 1VQMS 2KRBA 1P6TA 2ROPA 3CTRA 3QJPA 2IM1A 3UCZP 4ZIVA 2W7OA 5LMNF 4ALZA 1SL2A 1VQ6S 4NXNE 2F9DA 1RT7B 1TQLA 4PCQA 5AE1A 6FD1A 1XMOF 4G3IA 1EI1A 1SJQA 1TUGB 4FXVA 3PDNA 4CRJA 2CNLB 4P9SA 6FDRA 1JMTA 2WB1D 1UZHA 3GFHA 3SCJE 5AE3A 3MUVP 3J7A1 1S1WB 1JLGA 1VRUB 2DYAA 1QAIA 1OQ3A 5D4OA 4ZCLA 1X4CA 2FVQA 4O44B 2K3IA 4PQAA 1SB6A 4RW8A 3I0SB 3UW1A 3W3SA 3N4WA 3T9ZA 2FHJD 4NMXA 2YWGA 5MAOA 5J2PB 4N76A 1AT1B 2V4RA 4DG1A 2MGZB 2QC3A 1KKHA 1Z0GA 1HBMA 2GVDB 2CQ4A 5DRPA 1D9AA 5KT7A 3KG4A 4N47A 2MTLA 2XSJA 4E0DA 3OL7A 5GAEU 3KMQA 1HYSB 3D6TB 1Z59A 2FY8A 1DQ9A 3LP0B 1NCLA 4RW9A 2G1HA 4C0HA 2GIRA 3DLEA 1A0OB 2CJAA 3GJSB 1MNEA 2V0NA 2XS7A 2UXBF 3KUHA 1NH7A 4M5HA 2BRLA 4B3TF 1NDPA 1SUQA 3UD3P 4PWDB 4QNKA 4DUZI 2R7XA 3V6JA 2H9ZA 4MU3A 3CPWR 2DNHA 1JLAB 2P6TA 2BE2B 3R6GB 4ES3A 1P8GA 4X64J 1JLBB 3P3GA 4PWDA 1R27B 2Y3YA 1HW8A 3DMJB 1WEZA 3HT0A 3IWNC 1IQTA 4FNIA 4MU0A 2XMKA 1RAAB 2CJBA 4BA2A 4ZP8A 3Q8RB 1Q1KA 2FJAB 2KKHA 2QLWA 1HYSA 3PRBA 2UXCI 2BW2A 4MQYA 4URQU 2HHTA 4HDHA 4NYOA 1VK8A 2RU3A 3L7ZA 5I42A 4LRBA 4BHQA 1S0NA 3L9ZA 2WVFA 2IMWP 4IFVB 2YNGB 2H51B 3TUZC 2XBPA 1YZ6A 4QW8A 3V6KA 5D15A 5KFGA 1U02A 2RRBA 1A7GE 4RW8B 3U7JA 5KFQA 2QRRA 5I3UA 1SJ1A 2BABA 2J7UA 3DGPB 3BQ1A 5JUMA 3PX0A 2FJVA 1NSKL 1NH8A 3CJ0A 3KJVA 2VQEJ 4A8FA 2IBOA 3B54A 2WBMA 2RDDA 3BYPA 3NXZA 4I69A 5EX3A 5KG1A 5BYSA 2VJVA 2DVIA 4FPRA 1AFIA 4OJ3A 1RAOA 1FVSA 3NAHA 2L41A 2M0GB 1HBUA 4K5SA 1TV6A 1T7PA 4K0KI 2I38A 5C24A 4ZMMA 2V2QA 3RB0A 2B4UA 2EG2A 2R2RA 4S0MA 3QLHB 2WOMA 3DNCA 2N7CA 2XY7A 4MAKA 3ZZZA 2MEWA 3PRVA 4RR5A 3QRQA 5KFJA 3TA1A 3NNHA 4NA2A 4Y2CA 1WC3A 2YNFB 2ZDPA 4JI1F 1KD1T 1IBKJ 1YJ9S 2JEFA 3GLLA 4FZVA 3J7YI 1NU4A 2ATCB 2MDAA 3J81j 4LF4J 2MKKA 5HBMB 1S97A 4CQ1A 3DLLQ 4KQVA 4OZNA 3Q89A 5F8JA 1IKYA 3P45B 4Y0FA 1T95A 2DGVA 1KQKA 4K4YA 2YH0A 5HN0A 4DL6A 1USUA 4M5DA 1SC3B 2GIQA 3M30B 3N6LA 4FYWB 1S59A 5D4PA 2VG6B 5C25B 1RREA 4JV5E 1XMOE 1HI1A 1N5TA 1P1TA 4M5JA 4OIXA 5HK4A 5HROB 1EA6A 3BKTA 4I2PB 5EX0A 4G6VB 1OYSA 4HI2A 2KXHA 1K44A 3PR4A 1DLOB 5B0GA 3ZZPA 1HNXJ 3DD6A 5KFWA 4ZN1A 1C1BB 4RZRA 1QSLA 1KLMA 2DGQA 4X2BA 4C8YA 2QO3A 2LXIA 1RT3B 2WSCC 1FESA 5L39A 4Q2LA 5KG2A 3PYGA 3U1KA 1AROP 4LF7I 2ZNZA 1S6OA 4NZ7A 4PPDA 1RA6A 3UO0A 4JV1A 2QA2A 1N5QA 4WKYA 1RTDA 1PC4A 1PAUB 5J1EA 4DUZE 3M9OB 4DFMA 3TI0A 5RUBA 5KFVA 4LQ9A 3A4TA 4LSNB 5H9EK 2R8JA 4IRKA 2UUCE 1M0SA 2XHWA 1FWLA 1R8HA 2GVZB 2CPYA 2BVZA 2DEJA 2WONB 3MM9B 3OR2B 4OYXA 5L9NA 3H4LA 2H1YA 2V9WA 3MEDA 1S1TB 1T03A 1VBZA 4DQIA 1DBDA 4XO0A 1N34J 4WXWA 3BV8A 4DR3F 1HBNB 4ED2A 3GFXA 4I67A 3MEGA 4HR2A 2G4BA 3Q6MA 2WB4A 2VKRA 3CD0A 1WC0A 4DU8A 3I55S 2XCAA 2VHGA 2ZH2A 5T14A 1VI7A 1YZ7A 2MKSA 3BGRB 3OR1B 4M5DB 4ZP7A 1TKZB 4N7TA 3Q24A 3C8YA 2B7CB 3R7BB 2KFYA 3KHHA 1GEHA 1N0VC 2UVVA 4J3DA 2QYCA 3EDRB 1DTTB 1VC6A 4NRUA 3PEJA 2DR8A 4ATNA 2XYHB 4ZPDA 4DR1E 4I56A 4WZMA 2AE8A 3JQMA 4B9VA 1YRUA 4H4MA 1X9WA 4YS2A 5D3GB 3HJCA 2IY5B 3ILIA 4DV2F 4UOGA 3H90A 1TL7B 5JEAA 3ZC4A 4CH7A 5CH7B 1Y7PA 3E51A 2BDPA 5DGAA 1NM2A 1V3ZA 2CADA 1TKDA 5L46A 3ICLA 3H5XA 2M8HA 4NYZA 2BA9A 3SXLA 2E5HA 2JOQA 3PM9A 2E7VA 4LF7E 3T41A 2PO1B 4J9KA 3CJRA 2UVWA 3M6UA 3BO2A 4DUZJ 4IKAA 3IFEA 4ID5A 2DR6A 2HFZA 3T1YE 4TY8A 2YKAA 4E8UA 4USIA 2JL9A 5HVGA 2DKOB 4MJKA 4RUBA 4ED5A 5CYQB 4J9RA 1N36F 1RWNB 1NJWA 1I6JA 4DS4A 3S1TA 1Q8BA 4K2JA 4CLZA 3JYTA 3OT9A 5HMZA 3RTVA 4JV5F 3CIMA 4ZDNA 2PO2B 3DOMB 2GVZA 3EYZA 1KQSR 4B9NA 4OX9J 2MKHA 3NWRA 1GXLA 5IV3A 2CQHA 1S9EB 2LVWA 3NGUA 3BQ0A 3EXYA 4KHPJ 3I4PA 2DRAA 4DV1E 3T1HI 4I64A 5J1EB 3FSXA 2ZHAA 2IAJA 2VPWB 4NEYA 4CO2A 3RW7A 1EQ0A 3NS7B 1P9QC 4ETZA 1NB2A 1YLXA 2J9DE 2V34A 4WIIA 2DBBA 2VQFJ 3NBPA 4FKXA 3DU5A 2QSWA 2R7OA 1FXRA 3HKWA 3SSQA 1TU0B 5JEAD 3U1LA 1X0FA 1PJ6A 4F4WA 4Y6IA 5EWEA 1R8CA 4LF6E 3ELHA 1FNXH 4ECQA 2DGXA 4DV1I 4DR3I 3T1HE 1Z1ZA 1NJZA 2GO9A 2PO4A 2GC8A 1RTIA 1IBME 2RNEA 4DL3A 2HLTA 1K0VA 2D3O1 4KSEB 3IRWP 3EE3A 4LVOP 5F3TA 2HHXA 1N54B 1PBAA 2GIFA 1FK9B 2MPUA 2WK4A 2BJ1A 3DRSB 5K5MA 2KM8C 5J2PA 1K9MT 1FJEB 2W4CA 1VQ8S 3P5BP 2VOOA 1IBKE 4JI4E 4GKKE 4KE5A 1WSVA 3AB2B 4NI2A 4OYWA 1EZZB 1MW7A 4KGKA 1OY8A 3QT8A 1U8WA 3FKBA 1GTEA 2AT1B 3K5OA 3KDNA 3GILA 1UVIA 1NHVA 1FNMA 1IBMI 4AXIA 3SV4A 4AL5A 1VRTA 4AQYF 1KN6A 3M2RA 2AJQA 2IRUA 3QAUA 3W5ZA 3DGVA 2EG1A 3W60A 1JLCB 1CBKA 1L3SA 2E7WA 2FZCB 1XC9A 2UV8G 5KFMA 3TWZA 1F2HA 1NKBA 1M90T 2HMIA 3M6AA 2FQQB 2AW0A 1PIEA 2YNIB 2VQEE 1VRTB 1NUEA 3CJ4A 4KIAA 5A8RB 2MZ1A 3H40A 5K36E 4Y65A 2COLA 1WTFA 4P73A 2W1BA 1RHYA 2E5GA 3RGIA 4DCJB 3DGPA 3KK3A 4ZVIA 3MM5A 4IH6A 2GA7A 3KK1A 4NI2B 2Y1IA 3MEKA 1F6TA 3FBEA 3HFVA 7FDRA 4USWA 3THTA 4RPFA 4YR0A 3SI8A 4E98A 2OEJA 1FK9A 3MPWA 2DNQA 2BJEA 4IFVA 1B70B 1HNWJ 3UI3A 1FVQA 3PR5B 1BWVA 1D09B 2YNHB 3GV7B 3R1HA 2KHCA 2RU9A 2ZBQA 3R97A 4F02A 2EWHA 1S1VA 3I5CA 3OHAA 1Q53A 3ET6A 4W98A 1VIXA 1HBNA 1QD1A 4RX6A 1YWXA 5A8KB 5CAAA 1VQKS 4UUWA 1WG4A 1S1TA 2EPIA 1UA1A 1FHTA 4IZKA 1UL3A 2IVMA 4IDKB 4K4XA 1TZ0A 2WVBA 3OJUA 4I4BA 4O3SA 2OUGA 4NOHA 3T1AA 5IWAI 2J76E 1FNOA 1IR0A 3ISND 1ZM2A 3ISNC 5K9FA 1WKKA 3SCLE 4J9SA 1SQFA 4DR4I 2C37B 1R89A 3VQTA 1HR0F 2ZM6I 1JLFB 2H5JB 3MXHP 1R6LA 3PVXA 5C2GA 3J80Q 1FTCA 3UR3C 2EBEA 2XSJB 1S79A 2Y1RI 1U2RA 3VCDA 4DV1F 1YJWS 1RT2B 3UHMA 2Z5CA 2OEKA 1UJ5A 4O4GA 4USUA 2GHPA 1Q8LA 3D68A 3FMWA 4IOBA 3M6VA 4IH5A 1RAGB 3OTEA 3VVTA 2RS8A 3L3CA 2YKPA 4ETXA 2RVJA 3G6VA 1SL1A 1IBCB 1IBLI 5HMWA 4PG7A 2R2UA 2NPFA 3VAMA 1QSYA 1DAXA 1YBTA 2BANB 2FJBB 4DR7J 2R7VA 2B7BB 3GFYA 4DV7E 3AHPA 3LQVA 4BBYA 1EB0A 3KXDA 3MCOA 4O3PA 2VG6A 1EETA 2Z0GA 4PAAA 1PJ7A 1RGVA 4DZDA 3G6YA 3FEXB 2PO0A 5D4NA 4C4WA 2HNZB 4IH7A 1SVDA 5HQLA 3GG0A 2ILZA 1R0AA 3K2YA 5I3QA 3TA0A 2MQQA 3EM1A 3NOCA 4R25A 2MQOA 1ZZFA 1IKWB 1FKOB 3CSKA 1OIAA 4MFBB 4A48A 4B9TA 5LXRA 3A8EA 2XO6A 1IVZA 3Q8QB 3EVMA 3QLHA 5G0RA 2JEBA 5K8OA 2NZCA 3Q8SB 4MYTA 1S49A 2A0FB 2C2ZB 1U49A 2OD6A 3DDKA 4Z7CA 4KFBA 4I7FA 1N32F 2IIHA 2GJ2A 2X1GA 5KFXA 2ZH1A 4AM3A 3LOUA 1YTYA 3C2PA 4X66J 1XNQI 1NSQA 1HI0P 5J2MA 4EU0A 5LSRA 1UPMB 5F3ZA 3B78A 3QT7A 2W2QP 2JHEA 1Q16B 2NXCA 1TL3A 1MU2B 4ZVPB 3G96A 3VAFA 4DFJA 4YB1P 4DX7A 1U2CA 3O3LA 5F8IA 3FBBA 1IBLF 1EIYB 1V3SA 4PUOB 3N6MA 3M85G 3J7ZT 2RT3A 4L3KA 1Y3JA 2NCKL 3PJ9A 3KLIB 4FVCA 4HI1A 1F3FA 2DH8A 3T6JA 4F4YA 1S9FA 2YQ1A 5E3RA 5B0DA 1QY7A 2D7SA 2LMIA 1FKAF 3CVKA 4DJBA 2E44A 1HWLA 3HFKA 3N6NA 1I5OB 3QT5A 4JOUA 4LRAA 1Y5YA 1ZETA 1B0PA 5BR8E 1TUVA 2GO8A 3W9JA 3QWPA 1LXNA 1MU2A 4O0NA 5IFMA 4XDDA 1F60B 1LK5A 2DCLA 2BYCA 1ULRA 2ZM6F 4PRVA 2ALZA 1GK8A 2XMMA 2CQ0A 2QG9B 2GMLA 2UXDJ 5HQ8A 1Y5LB 4P2SA 5D0EA 2HHSA 3HK2A 3M05A 2CZ4A 4ZA1A 1H7WA 1R8BA 5D0RA 2C3OA 1UA0A 2NXNA 1PCAA 1T9TA 5J2QB 4BA1A 2M8DB 1IM4A 2F4VF 1H7SA 4YY3J 5ETKA 1AZSA 4OO1A 3C14B 2OPPA 3W62A 3M30A 1DQ8A 4ZP9A 3PTWA 2DB1A 3FCVA 2VH7A 5GAHU 2EC0A 5AXLA 1NDCA 4PKDB 4DG1B 3GG1A 2JLFA 3VHQA 1T94A 3H2UB 4EWTA 4FW4A 2R4FA 3FEYB 4JI1E 3J81Q 1LW0B 1N5VA 5KT6A 4FW9A 3P3DA 2RQMA 4ELVA 4X66E 4JI3I 4DR2F 1CC8A 1JLGB 2I9SA 3PFEA 2NR0A 1VLYA 3NOGA 2ZVSA 3UWTA 4I6YA 3AA8A 4YR3A 1Z2LA 3AJ1A 3NCQA 2XYPB 4WFZA 1RAIB 2M88A 3GMGA 4OYOA 2ZJRQ 1CG2A 3V81B 1ZXMA 4JG4A 3FBCA 2RSQA 3AD7C 4LIWA 1RWPB 3D1OA 4OO1B 4J9OA 2BXJA 1NK4A 2WVCA 4Q0BA 1RTHA 2XS5A 2O1PA 3Q8VA 5FWKA 4L72B 1Z0CA 4LR7A 4Q44A 4ILLA 1DURA 3D1HA 3W8PA 1Z2ZA 2PA8D 3P3EA 3B6BA 1F0XA 1HMVA 2JEAA 3K85A 4M1KA 2QLXA 1UWAA 2ZNYA 2ZKTA 3KJVB 2Z5CB 1HNZE 1RT4B 2R8HA 2IJFA 4NZ0A 2RRNA 1N33I 3LGHA 3IAM9 2VD3A 3SEOA 4ED6A 1O5JA 5HP1B 2PO0B 1FRIA 5CZXA 1M5KC 1UDQA 2OKQA 4NXME 2J8SA 4ZVOB 1EAYC 4OYAA 3B8HA 3TJ9A 3T1YJ 2EFNA 2FVRA 4DQRA 4JI7F 4B3OB 3PRDA 4FW7A 2IHR1 1ZZNA 4TLRA 4IYQA 2HS3A 1U1NA 2DY1A 3CCLS 1T11A 4URSA 1UVLA 4B3RI 1JQGA 2HLUA 4ICLA 3WU4A 4K4ZA 1PKUA 1SH2A 1LEOA 2GHWA 2RIJA 3JSMA 5L3JA 1KTVA 2QX0A 2F63A 1EHWA 4FF1A 2IERA 2N82B 2KJVA 5J2NA 3DOKB 4FXDA 2C3YA 1KBRA 4C6AA 1S1XA 4R0EA 3GV5B 3I82A 2CPHA 2GX8A 3A1YG 3HULA 1FD2A 2CIMA 5A2QU 3OVSA 1NB7A 2E5LJ 2G0CA 3AD9C 1QVFR 1OWXA 3K0JA 3HO1A 1UVNA 2CJQA 2CPJA 2IM0A 1URRA 2DXEA 3J7YU 2HFUA 3GCWP 4OZ3A 3UDVA 4Z2XA 4UZBA 3LWLA 5K36D 5BYRA 1HK7A 4U9RA 1USVA 2AV5A 4OZLA 3ENAA 2LEAA 2FVPA 4I1TA 2B5JA 5FLXU 4HYMA 1M5PC 4U6PA 3U02A 3DOLB 1WTBA 3K17A 5D4LA 1XR6A 3TX0A 1M5OC 3SQGB 4C8LA 4UY8T 4M8LA 1S1WA 1VRUA 1VGYA 2KN4A 4N8OA 4JUZA 5B7WA 2KG0A 4DSKA 1PILA 4DR2I 1ZTWA 1UFWA 2KT3A 5CCLA 5DG9A 3SSRA 2NN6A 2A3JA 2EFQA 2GFFA 5KFAA 1RKJA 1UJ4A 3J81U 4FF2A 4DR7E 4DUYJ 2KU7A 3PNIA 4DV6J 4DLGA 1NK8A 2EFGA 4DWIA 4C9DA 2RAQA 3AOCA 4YB7A 2UUAI 4PEOA 2OJ3A 1N88A 2M52A 3D67A 1V3RA 4DR2E 2K1RA 2O01C 1K0TA 3L4BC 4HH1A 1LNQA 2OPPB 2WBRA 3I0RA 3K5MA 2AGOA 2CJKA 4GKJF 1OY6A 4X4SA 1NK0A 2BE9B 4FWHA 4P7TA 2UUAJ 4BA1B 1KOHA 3P96A 5LSLA 3IA0A 3LANA 3PO4A 3CDJA 5E41A 2UXBI 1IJEB 2MQNA 3IP0A 5AXKA 2HQ3A 3FEZA 2VQEF 1I94J 4WUDA 3M2VB 1RK8A 4TXSA 3I56S 3LPEA 4QOTA 1OMSA 3DU6A 1AUDA 5SZTA 3A8IA 1XNRF 4A8MP 4GC6A 1XBWA 3J7AN 2JT2A 2HGLA 1D8ZA 2HFVA 4OX6A 4P52A 4QZVB 2IAJB 5KFZA 4ANDA 2VICA 4C48A 4A8QA 1YK9A 1E6YA 4B3RF 2G2ZA 4G1PA 3SYZA 1VR6A 3QSYB 2R7SA 3EGVA 3W2VA 4C11B 1SI9A 3CCTA 1U09A 5FDLA 3AA9A 4WFNQ 4XIUA 1X0PA 3RJMB 4QQBA 4NCBA 2K7KA 4ZVHA 2OPSB 3V4IA 1Q79A 2AGPA 4NXMF 1VQNS 2VQEI 3BH6B 3CJ2A 2DNOA 1VCTA 2NN6E 3OXGA 3O44A 1SL0A 4CO3A 2ERRA 1A9NB 1T02A 1CJTB 1NBEB 2M9KA 3EICA 2ZBCA 1VIOA 4PABA 3TQEA 2KG1A 1RXOB 3QT6A 4IR1A 2LQ9A 4JI1J 3F0NA 3HT3A 1FJGE 4IFDE 1PBUA 1TL5A 2DCUB 3CCJS 2GV1A 1TAQA 3BN4A 4HHJA 1ZAWA 2CNNB 2XSFA 1JNZB 3BN7A 4OJHA 1VFJA 3JTOA 2JEJA 4NLVA 1HMVB 3KRNA 3M9NB 2ZH7A 4WYLA 2ZE2B 2ATLA 1U47A 3D4JA 3AFGA 2VESA 5DRRA 3D1QA 2MHNA 4X4UA 4L75A 1WG5A 4EBEA 1NPRA 1T03B 5IWAJ 2F8EX 2LQ8A 2MYFA 2HZCA 4RNOA 4ZPBA 3C6UA 1NNDA 2KHDA 4OZ1A 4WE1B 3ZTQA 2F7VA 3I9V9 1U1PA 2PI4A 4QJVA 5JEAC 5C0XE 3RAQA 2XI3A 4K4TA 3M7VA 4H4MB 5CHCB 4CLKA 3QFWA 4JI5F 3MR2A 1S4FA 1FKOA 1HLWA 5KFNA 2ASDA 4OI2A 2C2OB 3C46A 3J7AG 4OLOA 2ABYA 3E3XA 1WEXA 1NHIA 3ILJA 4JV0A 3G71S 1TVRB 4OX8A 4YP3A 2FB0A 3C15B 3OL9A 2N3OA 4AL7A 5F8NA 1J2VA 2FPHX 3NMAA 5HANA 1FWPA 3AAWB 4CO0A 4GKKF 4F4XA 1B7FA 2CQGA 3BR8A 2VU5A 1LWEB 4GKKI 5KFCA 4B3MJ 2OTJS 4LF8E 1RCOB 1MROA 4ECZA 1XMQI 3OJSA 1SIZA 2FJEB 3BPSP 4NLSA 3V6DB 1E3PA 1IM6A 4CLWA 2ZEJA 4TNOA 4C97A 4ZLPA 4HEA9 1RYRA 3Q1QA 2HNDA 4RL1A 1G6BA 1P9YA 4K4UA 1F9HA 3HHLC 1S6QB 2HRYA 4RWWA 3SSSA 3DLGB 4Q5VA 5HVFA 3EUNA 5DO2A 2CAJA 1SV5B 4LFBJ 1X60A 3HSJA 1N34I 4KO0A 2XZTB 1WC6A 2DHAA 1X5PA 1NZ0A 2D9OA 3FSYA 5EWFA 2DXFA 3LH2S 2VV5A 1CJVA 1ACMB 2AJ4A 7FD1A 2VL1A 2UV8A 1GMWD 3G82A 1H7UA 4QNJA 2NPIA 1I1GA 3CGIA 4YB5A 5IT9Y 2C22A 2ILYA 2O67A 5CA5A 1JLEB 2HAIA 4DV4F 4YDDB 2Z2ZA 3M8QB 4RW4A 4ZKAA 2XEXA 2BM0A 4MKAA 4CTAB 2AYEA 2I2YA 1WWHA 1YSJA 2CRLA 1DZ5A 4FF4A 3HMJG 1CS4A 2IPOB 4ID8A 4YHHF 1FO1A 3RBXA 2ZUGA 1DY3A 1PYSB 2NZ4A 3VAGA 2JEBB 4DUYI 5DZ7A 4QIEA 2KVQE 4N77A 3HLUA 2Z56B 3R5AA 2ZDOA 3WX8A 1LXJA 5L1IA 2KFZA 1KDNA 2B4OA 3BGFA 3VGUA 1HR0E 3LP2A 5M2RA 5K14A 3FCHA 3RU0A 2W01A 1LW2A 3G8QA 4X84A 3NY0A 2LXFA 1T05B 3K8VA 1R0AB 3CCUS 1MU5A 3TX8A 1W2IA 1GX6A 3FMBA 3MWBA 2MSSA 1NLKL 2K7JA 4EBDA 3MPUB 1R43A 3FVYA 2HS4A 3K7RA 4QIGA 2VIHA 2I5JA 4FW5A 3MR6A 3W64A 1RWUA 1X8DA 3VWSA 3LW5C 2DPJA 5EGYA 1WD6A 4WK1A 2GQQA 3H5SA 3BJYA 1BD6A 3QJLA 2YKNA 4CWBA 2WZ1A 1OS5A 3LNUA 2GGPA 1H72C 4F67A 2FJDB 3Q83A 2UU9E 1RHRB 5KFBA 1R0BG 3C19A 2DXDA 5KT2A 2CPEA 4QR1A 3FZBA 3DRSA 4ZHRA 4GVBB 4NA1A 8AT1B 2V67A 5GAHI 3J7Z5 3MOJB 1JWWA 1C0UA 1S6PB 5A76A 3PW5A 4O23A 3CW2C 3PFOA 1YBAA 1IWAA 3OTCA 2V6AA 2FVSA 2J0SD 3CD6S 4EFAC 5F9LA 4WZQA 1CS4B 4OKGA 3WC0A 1I94F 4KHPF 2XHCA 1HNZJ 3UD5A 3QNWB 3KG1A 4DL7A 3WIVA 3BKUA 3DLHA 1S4EA 4L3NA 2MZRA 1LQ9A 5IWAF 2QMUB 2ZOGA 3HF5A 1H2VZ 2ZC3A 2XO7A 3KK2B 1T8EA 4TY9A 2C2EA 4OI6A 3E2EA 4NLTA 1HQEB 3RR8A 1MLAA 1SUQB 4BC9A 1NXIA 1ZA2B 4DV0E 5CYMA 3UVJB 2KYXA 1RAHB 1UMJA 2VDIA 5KFSA 4LF6J 2UUBE 4KR0B 3LP0A 1BQXA 2V8HA 4RW9B 5F0UA 3BO4A 2XLKA 4IOAQ 4OHVA 2XWXA 3WDOA 2PA3A 5LL6d 3T5LA 4DV4J 2HQIA 2HHVA 4JI5E 4M5KA 1XWLA 4ILRA 4DSJA 4LOMA 1SC1B 1CSJA 2QT7A 3N9UC 3CC4S 1Z0WA 1LK7A 2CPXA 4GKKJ 1HNWF 3W8GA 1IR1A 2W2NP 2XMJA 3PXGa 3TO8A 4A8KA 4TKTA 1CQMA 4WFYA 4AD6A 2AQ4A 2XS2A 2HNDB 3EZUA 5J1NA 2A2CA 4ZOSA 1K73T 1KC8T 1SC6A 2ZH3A 2F4FA 1S0OA 2HG4A 2Y8WA 1V5VA 2HKJA 3M1VB 4WK3A 2HMIB 2VFSA 2BE7D 4MIAA 1MROB 4U8VA 2ZD1B 1FWKA 4K7QA 4RU2A 3DLKB 4B3SE 2E66A 3I5AA 2HHUA 1J5EI 1BC6A 1GQEA 4OZEA 1V6HA 3BKFA 2KRRA 2POKA 4FDFA 4C8OA 3JAMU 4Q45A 3K8WA 1R3NA 5DZ6A 1Q86T 5GMKa 3CD5A 1HWJA 1SXLA 2OEMA 1RISA 4OV1A 1O6XA 1W2BR 2BA1G 1NZAA 3QJJA 1VBKA 1YG0A 1AFJA 2Q2EB 4CLUA 4M94A 4ITSA 4PXBA 1FXLA 4P72A 1D6TA 3HSZA 2ZOFA 3EVOA 3TQ1A 3TAPA 4NLPA 2BQ3A 2V2KA 1U1LA 4DR7F 4FYYB 1X9SA 3R1LA 2N4DA 1IBKI 4F3OA 1HNZI 3M8YA 4LRDA 1EQMA 3W65A 2V8PA 1CVJA 4LBPA 3C6TA 3IG1A 3IM8A 1KQFB 3UN5A 4IFDD 3Q8UA 3FNNA 3LPYA 5HI7A 5H9EJ 2IVFB 1EX8A 3U1MA 5HL7Q 2KZZA 2APOA 5B0EA 1YI2S 2EKNA 1NDLA 2VA2A 1JNRB 1SPBP 1UEUA 1F5AA 2RD5C 4WIQA 4ERDA 2ZBKB 4JI6I 4A8SA 1ZA1B 2IMOA 1YJRA 2CWXA 2LQ5A 2CQCA 3W1YC 1M1GA 2R7UA 5IT0A 2HQFA 2UVRA 2LDIA 4HLBA 1M1KT 4NWBA 4B02A 1OO0B 5CCMA 4DFPA 5C0XD 5F41A 3QRPA 4KHPE 1SH3A 2KM8B 1RTJA 2OPRA 3KUGA 3DOMA 4F7VA 2FLLA 3DRPA 3KHRA 4LREA 4IZJD 1JX4A 2F4VI 3POTA 4ED0A 2HFNA 4UUXA 5AJ3F 1EJ7L 2B9YA 4NLUA 2ZOMA 2PSZA 3CB4A 5CYQA 1FKPB 4D3HA 4TQRA 2LXUA 4QYZJ 2DHGA 2Q6BA 4JI0E 2D69A 3CE8A 4EBCA 2DNYA 1XERA 3LP1A 1A6LA 2CYYA 3M8ZA 3NS6A 2PMZD 4DPTA 3OQ2A 2MLYA 4NLOA 1QAJA 1HPZB 4LJMA 3R5CA 1FDDA 5THWA 1R8AA 3H4BA 4FS2A 1MWQA 3WX4A 5JXSA 2ZHBA 3PS1A 3BYRA 4C0OC 4LF2A 3OD2A 3HHEA 4Y3CA 4DR6F 2BA0G 4Q8FA 3NNCA 4TN2A 2QA1A 3R2CJ 2VG7B 1DTQB 4GQUA 4X64F 2JWNA 2QN6B 1Y9OA 1ZXNA 1YDLA 3KTQA 4Y34A 4IFYA 2AF6A 2B51A 4J9LA 4EYIB 3PKYA 4QU7A 2CQ2A 1K8AT 5T41A 4HXZA 1BQNB 1URNA 2YY3A 2YBVA 4OYPA 1QAYA 1ZM9A 2H4YB 1XMQJ 4FN5A 2BOPA 2ZD1A 1YJTA 1U6ZA 4DV0I 3F41A 4R1FA 4KC5A 5C0XF 1N33F 3M32A 3HFZB 4JI4I 4AYBD 4DQQA 2NN6B 4RNHA 4LFAF 3OR1A 2J6TA 2X36A 1RU2A 2R2TA 2LLZA 1C1CB 3BSAA 2G1DA 1HNXE 3PW0A 4DUZF 3W66A 4D3GA 4B3TI 2W8KA 4DV5F 3K5LA 3US5A 1OJ4A 1FDAA 3CJ5A 3ITHA 3KLEA 4JI7I 1GH8A 1B0VA 2BKNA 2ZHOA 3POTB 4URLA 5AE2A 1EP4B 3D0HE 4YN3B 1HKAA 1FF2A 2AJ2A 3IGVA 4O4GB 4IFDF 1RBAA 1RTIB 2E1PA 4LSNA 3MR3A 2Z2LA 3C66A 3TA2A 5DDQC 4LFCJ 3NNAA 2KI2A 4F25A 2NN6F 1FRXA 2MQPA 1ZAXA 1XNQJ 3T19A 4B3RJ 3BBFA 3D5MA 4ZPVR 3QATA 1NPPA 4NPOA 3WHIA 5HO4A 2DEIA 5KOXA 3CJTA 4TQSA 1Y11A 3R9LA 1SKUB 2Y8YA 1HQ2A 3IR6B 4MTPA 1VJQA 3R6LB 4MK9A 1FA0A 2PIIA 4I6AA 2CNKB 3ZTPA 2UXDF 4J9UE 2E5LF 4KGVB 4DN0A 1QTMA 2MJUA 2PMWA 2V94A 1JLQB 2QL9B 1BGXT 3P8BB 1H73A 3TAMA 2E9TA 3ZM7A 1RE1B 1U8SA 2HWTA 3N0VA 4WYWA 5FLXQ 2YNHA 4DV7I 2OFGX 1N0UA 1WHVA 1LOUA 3SDEB 2E9ZA 3D28A 4X62I 1SQGA 2QFIA 2KDOA 3KG0A 4PWWA 1U7LA 4X65F 2Z5BB 2RF2B 1YQHA 4I68A 1XMOI 4DR6I 1BQMA 2BV3A 3GIRA 2YKNB 5KFLA 1U6BA 5DQHA 2NN6C 1KIJA 2NLWA 3IBWA 2IC3A 1Q7YT 2ZM6E 4Y28C 1YHQS 4OO1F 4CO1A 3T1YF 3RAXA 1TTHB 2VDHA 4JI7J 2HGNA 4YEAA 2F1FA 2JRSA 2HZVA 1TR0A 4CO4A 1PG5B 3QPIA 4LIRA 4CH0S 2R8KA 1C4CA 3ONQA 1AYEA 3EGNA 5IT4A 1JLCA 3IXQA 4F2SA 2KTQA 1TV6B 1VRQC 2FC8A 4O4RA 1U48A 4N3OA 5GADI 2JFKA 4I2QB 1WDDA 4HY1A 2M3DA 4NLDA 1IBLE 2FZGB 5AJ3J 2VJUA 4IQXA 1RAEB 2DH9A 4NRTA 4C2MA 1RWKB 2CDQA 3KLHA 4NYPA 2R7RA 4F8RA 4LQ3A 1S12A 3OFGA 4RUHA 5K8PA 3TP2A 1XNQE 3DM2A 5HJXA 1H2UX 1TKXB 3JSRA 4EEYA 2FGCA 2KT5A 3BPDA 3T9NA 4DI6A 3CULA 1M5HA 2HNYB 1P42A 3D6MB 2HYIB 1N56A 2ZC4A 2DRDA 1VC5A 4JV5J 1HPZA 1UFKA 4ZPCA 2DK2A 2XTJP 5C42B 5LJ5Y 2HFOA 1T9UA 3H98A 1CQNA 3AXKA 4RNFA 4BA2B 3ZTSA 1FE4A 4MK8A 4OHZA 1Q0NA 1JXEA 1TELA 2NSCA 1Q5YA 1B7YB 2CJXB 2HSEB 2AP6A 3MM9A 3NBPB 3OR2A 1RTJB 5KG6A 2UUCJ 4BDPA 4LF7F 3AXMA 2RB7A 4FBTA 3EZOA 4DR6E 4C3MA 5ADZA 2DT9A 4ZVUB 2QE5A 3FRYA 4LF4I 3TRGA 2GAHC 5B0CA 5KFDA 4PG8A 1CC7A 4L76A 3CC2S 3JAMY 2R8IA 2J9EA 4NL5A 4B3TE 2BM1A 4NE9C 4LFAJ 1VBYA 4DQSA 4DF8A 2AKWB 4NLQA 4OMFG 1RUSA 3MMBA 3K59A 2UUCF 3CDUA 3TR5A 4BCAA 4I3HA 5EL9A 3KLIA 5B0AA 1C1BA 1RYSA 1FRJA 3QGIA 2MGZA 2NYHA 2YVSA 4A47A 4KYZA 4X64E 2AYMA 2A6OA 4JI6J 4W92B 2IDEA 1WI6A 4KHMA 3SIPB 1TL3B 5E3AA 1LWEA 3GIIA 3I32A 1TK8A 4FW3A 2V8VA 1H38A 2IBKA 4EZ9A 3MEEB 3BGLA 1E6VB 4GMKA 5E33A 5J2MB 1IWGA 4QCLA 4JP8A 2O3ZA 2B0GA 3HSDA 2DTJA 1BE4A 3MR7A 2K8GA 3W9IA 1GMUA 3N5FA 1E3HA 5FIIA 1RQ0A 1TMMA 3PHEA 3C16A 3NMRA 2DNGA 3BSCA 1SKRA 4QYZK 4NA3A 4J90A 4WKRA 4KBIA 4LFCF 2FHKA 3JQKA 2RHSB 3IWLA 1VQ4S 1ZYQA 4K0KF 4YQWA 2BEFA 3HX9A 2E7XA 2BBEA 2VZ9A 1MWZA 2W4DA 2V4JB 2ZJPQ 3IS9A 1YIJS 2CPIA 1HR0J 2VQFI 1B99A 3A3PB 4ES2A 5F8GA 4LFBE 1XMQF 1X4EA 3CJKA 2HK3A 4FS1A 2DPIA 4JI8E 1HBUB 3KUEA 2MLXA 3HPOA 4GC7A 1TAUA 2ZE2A 1RACB 3CEDA 4M95A 4NCGB 1XNRI 3Q2SC 5D78A 3R5GA 2YKMA 2CQPA 2UUAF 1SBRA 5HLFB 5IT9U 3BM7A 3M6WA 5IQQA 5H1SV 4JB8B 4LF9J 4X62E 4DCOB 1YJUA 3CCWA 3PW2A 1VQ9S 4K4WA 5E0OA 2JVOA 3M2UB 1JKHA 3UE2A 4FBUA 4V19X 4JYAJ 2OAUA 4OZ0A 4O0IA 1S1UB 4LCGA 1F2GA 3ZKBA 5F8MA 4DV3J 1QLNA 2RHQB 3KNGA 2J9DA 5MLCV 3R27A 1ZM3A 2AX0A 4Z7YA 4EGLA 2OTLS 4C11A 2DNRA 2HRUA 3ETMA 1ZBTA 2BKOA 3BS9A 3GFZA 5KFOA 1XMOJ 1NJYA 1VQSA 3DMJA 4KPYA 1S6QA 5K36B 1YVFA 4NX9A 1U0HB 4PQUB 2R7TA 2BE2A 1RLDA 3M4XA 1KLMB 2VONA 1TKTA 2FYXA 4LRCA 2W9AA 1N32J 3M8RA 4DPYA 3C6TB 3IG1B 4ED8A 4GKJJ 3TUIC 2DGWA 2AEJA 4P10A 2JVRA 1LWXA 3T5KA 3OTOF 1NHKL 1P1LA 2MQ8A 5C25A 2VFVA 4RJVA 2GVDA 2GMJA 2JDJA 2K1RB 2PDAA 4PG4A 5DDPC 4ZLNA 1S99A 2ZBRA 3GQCA 5D0GA 4JI8J 3X1LB 4H4OA 2DR5A 2DGOA 2XZWA 1XEZA 2L9WA 3KKFA 1TFWA 2HVZA 3P49B 1ZOTA 3PS3A 4ED3A 1FX4A 2JLEA 1HI8A 3MURP 3FUYA 4MIWA 3SMZA 3CJSA 3KNAA 4LSZB 2YNFA 2J5AA 3DI6A 4LFCI 2CDRB 4G1QA 1UVJA 2VF3A 5LMNJ 5JEAE 2J8AA 5E2QA 4K0KJ 5DDOC 4IZJA 3M7NG 4PXCA 3NGTA 4LF9I 3BBCA 1XHKA 3VQSA 3CXCR 2B8QA 4DUYF 3EVWA 1L5UA 4DR1I 2VQFF 3LALA 2EFPA 4U7UD 3HJFA 4DR1F 4UW2A 4DR5F 1ZPVA 1F5CA 4KV8B 1UP1A 2J7WA 3DHXA 4AL6A 2E1AA 2CZ9A 3LTOA 4IG3B 2MZJA 4F0KA 1OY9A 4HHUA 3OSPA 3VAHA 1OYDA 2CZVC 2YWWA 2DY9A 3G2XA 3ZZOA 3HVWA 2UUBJ 3DN9A 4X4RA 4DV1J 3PW7A 2R9LA 1NPKA 3FDSA 2DGSA 4GO7X 1QDUB 2J7KA 5C7PA 3PHTA 2AJFE 4F0HA 3HM9A 4DR4J 3BQ2A 4OHYA 1KSPA 4LF9F 1RABB 2ZH9A 1QSSA 4DDFA 4DL2A 2KO1A 4LFAE 1RSCA 1FRMA 4JI0F 2VFUA 3HSGA 4QIFA 3OFFA 5BR8J 2QSFA 3V4IB 2LQJA 1QM9A 1W26A 4OFZA 1O0PA 3ZTRA 3L7ZB 1K1SA 2MZQA 2CQDA 2X7IA 1LWCB 2JH3A 4MKVA 1RR9A 1U2FA 3W2VB 3S6EA 1XQIA 1FFSB 2K2PA 4M5LA 3JSMB 3MHYA 2LCWA 1L3KA 1RAFB 3G82B 1LWCA 5KFHA 2ZZMA 2AJ0A 3MMAA 1RCXB 5CQGA 4K2XA 4FXWA 4ECUA 1UKUA 2KL8A 2E29A 3D3BJ 4HYKA 1N4LA 1HW9A 1Y0HA 2HHHE 1FEEA 2Z8QA 3QIPA 2GO3A 2NYIA 4IRDA 1HR0I 2W2PP 2U2FA 5EKWA 1XIQA 1SH0A 2RILA 5HMYA 3PEHA 4RW7B 3F73A 1S0MA 4FNHA 1PSDA 1U1RA 4K0KE 2VPYB 1OPZA 3CCMS 4DLEA 3PX6A 4F26A 3VZHA 3I96A 3ILLA 4KPCA 3W5XA 4ES1A 2AU0A 2GNKA 3RUBL 1ZTTA 2E5JA 5E3CA 3KFWX 2Y0SD 3PACA 2FJXA 4JI8F 1X7VA 2ADBA 1DJ0A 3L7OA 1XMQE 3ITHB 5A8WB 2SXLA 4O44A 3QIDA 1T9XA 3GU0A 3ISZA 3M8PA 3TJ8A 2RKIB 4TY8B 5FD1A 4JI0J 2Z5EA 3G9CA 1EARA 3CT9A 3NGDA 1DHMA 1KS2A 2RDJA 4MT1A 2HHPA 2YQ0A 3D66A 3TANA 2WSEC 3W9HA 4IZJB 3HVTB 5DNLA 3DRRB 4WBFA 4ED7A 2JLGA 5EDWA 1WKJA 1NSPA 4X65E 3O8WA 2B4VA 4UOHA 5BYQA 4LVNP 5T7LB 3U27A 4C98A 2W2OP 4DXLA 1HHTP 2UU9J 1RDRA 3DOLA 1GTHA 5JVHQ 2GZOA 4MU1A 3SBMA 1S7HA 3MZIA 2BOAA 3VGSA 4CLYA 4RWXA 1NKEA 1NJIT 1Y4ZB 3GJRB 1A6FA 4NBQA 2Y1JA 1KVIA 1KTQA 3ZZRA 1EKSA 3O1LA 4DR3J 1IBKF 1GMVA 2C3PA 5DG8A 3P3CA 1F3VA 2RH3A 3UN3A 4WFXA 8ATCB 3G4SS 3D54A 2R3VA 4TYBA 4CH1A 1QVGR 1N32I 3NZKA 4OX7A 2HHHJ 3W63A 4X66F 2XMWA 3MMCB 4JI6F 1FFGB 1LV5A 1B63A 2JX2A 4MU4A 4RBVA 3L95X 4KHRA 2CWKA 2FIUA 3AJDA 1NDKA 2AWZA 3CDBA 4IO1A 2Y9HA 1U0HA 3QO9B 2VBZA 4K4VA 2FTRA 5CZVA 2CG9A 5DQGA 1HNZF 2FUG9 2GS8A 5DGBA 3TZYA 3OUYB 1BKNA 2BUNA 4U3BA 4CYUA 1H7XA 1Q78A 5KG5A 2C38A 1HHQA 2VASA 2WONA 1HWIA 1RKIA 3DFEA 4I6WA 1HWKA 2BJ9A 4HDGA 4WWSA 2FGOA 5EHHA 4JV2A 1Z0VA 1HNXI 1V5IB 2LECA 1R0CB 1WI8A 1JKHB 5IT9C 4ZVEA 2HVEA 2G0JA 3OTOE 2HQDA 1RT6A 3ZNUA 1HHSA 2BJ7A 4J9NA 3LF0A 1XMBA 4KH1B 3QRRA 3MM6A 2WSFC 5HMXA 4CLTA 3N28A 4NZ6A 1FJCA 3K58A 5F8LA 2UXCE 3W2WA 3P76A 1VQLS 5DNXA 4NCGA 1RJJA 3MD3A 3MMCA 4M5IA 1M1HA 2MKIA 2C2RA 4HH0A 4IG0B 4DHVA 4EUVA 3UPFA 4WP8A 4ECTA 2WP8B 2J0WA 5LJ3Y 3JB9k 4MH8A 3V2UC 3KLFB 3NKYA 2MJNA 4MYUA 3D6HB 1M5VC 3I0RB 1TMJA 1FXDA 5KG3A 1XJWB 4OI1A 3PYEA 4CM0A 4Z37A 2VA3A 3H5YA 2ZVIA 2EI5A 1S0VA 5DROA 4DV6E 3J81C 3PKMA 1IKWA 3C15A 3MMJA 2BR0A 3CWJA 1Z5BA 4OX9E 4JI3F 1OYPA 1G3OA 3I5BA 2VB6A 3QBCA 3G6XA 3Q23A 1LW0A 3EX7B 4QPTA 4IOCQ 5LMUE 3UDEA 1VC0A 5C2CA 3BREA 4W90B 2J0QD 2MKCA 3TARA 2HNZA 4B3SI 1UWBA 1VBXA 2I8EA 2ZZTA 3BGOP 2D41A 2QJ3A 3IRXB 4DV6I 5M2PA 4CT8A 4B9UA 2B8PA 2BW7A 5IV4A 3B82A 3I4HX 3C6UB 4WE1A 3FCWA 3WBZA 2W8LA 3CMQA 1NKCA 1WC1A 3SQGA 4F4KA 2HEKA 5IWAE 1WELA 3JAMC 4USKA 5KFRA 4K5RA 2JSXA 2J65A 3MECA 1NRKA 1YRTA 3OXFA 4ZIWA 1Y4UA 4PXDA 2DHXA 2LP4A 1Q81T 1NK6A 3OBIA 3BSNA 4LCHA 4QR2A 1HARA 3WIUA 1HIYA 2HBYB 3Q22A 5DETA 5JMNA 2HZAA 3NAIA 3MPVA 1SJ4P 3ZKDA 4DR7I 3CD7A 2UUBI 2V2ZA 3OLAA 1F9FA 3E01B 4AT1B 2EKYA 1VHFA 3MFHA 2XLIA 3RBEA 2NREA 1N5SA 2DNZA 1S9GA 2OMOA 2H3EB 2JNJA 2ZWOA 1XTZA 3HD2A 4IDKA 5KT5A 4CYUB 2E5LI 3MUMP 4KQZA 4HT7A 4AQYJ 1KQGB 1Y5NB 2VPXB 2KB2A 4ZVGA 1VDHA 4LSLA 2OSRA 1REVB 1O51A 2H65B 2AX1A 2Z2YB 3MCNA 5DRKA 5U47A 5J1PA 4DV7F 4L6V3 2XCPA 3GTYX 2I0XA 4XAKA 2ZH5A 4P74A 1CJUA 3CCSS 2QIFA 4C8KA 3QWUA 1WSRA 5LMUJ 1XNRE 3HVAA 4I7FB 5ETVA 4ER8A 5HP1A 3OFHA 2FJWA 1S48A 3A12A 2UXDI 5CXTA 1IXKA 4N8NA 3AY0A 1RHKB 4F04B 3NG8A 1JJ2R 2LEBA 4F3QA 2MB0B 1FE0A 4JBCA 3IBCB 5G0RB 1WDTA 2EVZA 2I1RA 2X3DA 3NRBA 2IESA 1HBMB 1HNVB 2OP5A 5A8RA 3I6PA 4GVBA 8RUCA 2FHJA 4CLLA 4DEZA 4JYAF 4ZJOA 4ECXA 4NCAA 2PNZB 4KV8A 4DR3E 4WJBA 1REGX 5JJBA 2ADCA 3ETOA 3VF0B 4O3QA 5F0WA 1GAOA 2ACYA 1HA1A 2BACA 1YBUA 2P9CA 5D6GA 4B9LA 2I5JB 2G2YA 3LAKA 5C0XC 2DRBA 4IRCA 3J7AM 1TL4A 4G1QB 4A8XA 2AIRB 2IC3B 3RRKA 4N41A 3KWMA 4HTIA 4DV5I 4DV6F 2XY5A 2BA1D 1FCAA 4DPUA 9RUBA 1T0TV 2F5GA 2PN6A 2BQUA 2RDIA 1PC5A 3RBZA 2E1RA 1RT1A 3MM8B 1Y4SA 2Z5BA 4B9SA 2LDYA 3LP2B 2EXUA 5GMEA 3V6HA 4FF3A 4NLGA 5LMUF 1IJFB 2AJ1A 5F8HA 3J80C 2Y0BB 4OHWA 2K06A 2IFXA 5IXUA 4X65J 3I9ZA 3Q2TC 1P27B 3AQPA 1JXLA 4L73A 1KFDA 2QA4G 2IA6A 2CQBA 4EK2A 3Q6NA 2YWHA 3ZFVA 3N01A 3ZXWA 3T1HJ 1IUJA 2IJRA 3H1CA 4YY3I 3NP5A 2E5IA 1XNRJ 4F3MA 1ROFA 2XMAA 1N34E 3UR0A 4DV3F 2DITA 3Q8PB 1RWXB 2P9GA 3A3NB 1RZMA 1JJCB 1R31A 2ZBPA 2AMCB 4ZCIA 5A0YB 2ROGA 1RT6B 3VAIA 5BR8I 4LF9E 5AXMA 1CULB 2YKQA 5L9XA 4QBUA 3MPDA 1S5ZA 3ET6B 1ICEB 1UEVA 2UXCF 1QZRA 5ELWA 4LF5E 1S9GB 1V9OA 1LWFB 2W9BB 4J9MA 4C8ZA 4RUAA 2X1AA 1H6KX 4ANCA 1CLFA 1S1UA 4X62F 3MAHA 4YFUA 1Z0TA 2PO2A 5B09A 1U1QA 1Q95G 4M5MA 3VGVA 3ADAC 4WP9A 3KLEB 4A4JA 4B17A 3OUYA 5L1JA 2NS1B 2X3GA 3GSDA 2DISA 3WU6A 2DJWA 2ZUAA 3MM5B 3KK1B 3JAMQ 1PO6A 1RT4A 1G4CA 2HIYA 3T1YI 4LR9A 4WP3A 1X4FA 2JC0A 3D7SB 4FP9A 3OL8A 5JEAF 3WU5A 2XG8A 2BA0D 4LBIA 3P6YC 4QPXA 4P71A 3T5JA 2CJ9A 1OYRA 2P6SA 3OSNA 4UF4A 2GAGC 2PI5A 1X4GA 2O1UA 2E5LE 2EC2A 1RHUB 5IQ6A 1B0TA 4HACB 1R6MA 1NHJA 4DF4A 2VKZG 2X1BA 2C2KB 2XZDB 2HWHA 4UOCA 3TVKA 1X9MA 3GV8B 2DNNA 2HK2A 1KVKA 4M5NA 1ZS6A 3S7RA 1RU1A 3CCZA 2A10A 1DTQA 5ETRA 1I94E 2IRXA 2GQCA 4JYAE 2MMYA 4J5OA
chains in the Genus database with same CATH topology
1HNWI 4MYTA 1VISA 1H73A 3ZM7A 4JV5E 4Z7CA 3J80C 5FLXQ 4DV7I 1N0UA 1XNQI 4X62I 2Z5BB 3QT7A 3B78A 1XMOI 4DR6I 2BV3A 1KIJA 2ZM6E 1ZM4A 1K47A 4DV3I 2UUCI 1DARA 4DV4E 3QT5A 4N3OA 5BR8E 4USMA 4WUBA 2R42A 4HY1A 2HHHI 1IBLE 5IWAE 4PRVA 4DV2I 1XNQE 4JI5I 1Z0EA 2UXBE 5FLXC 3V5RA 2V2VA 3PYDA 1I94I 4AQYI 2VQFE 4JI1E 3J81Q 4FW9A 4DPWA 4X66E 4JI3I 1FJGI 2F4VE 4DR6E 4DR5I 1ZXMA 4LF4I 1Z5AA 4JG4A 4DPXA 2IOQA 3ZZTA 4B3TE 2BM1A 4I3HA 1Z0CA 2UU9I 1MX0A 4X66I 4JI3E 4NXNI 3K85A 4M1KA 1HNZE 1Z0BA 2Z5CB 4X64E 4LF5I 1N33I 1Y6ZA 4OX9I 2UXDE 4LF8I 1H74A 4NXME 3B8HA 3P06A 4DR5E 4B3RI 3WU4A 5GMDA 5L3JA 1KTVA 4YHHI 4IZKB 1UEKA 1ELOA 4JV5I 2VQFI 4LFBE 3OTOI 4JI8E 2HK3A 3HULA 4HACA 1FKAE 4FWDA 2HFUA 1XNRI 1HK7A 1USVA 3WU3A 4LF4E 4X62E 4HYMA 2HFSA 3K17A 3ZKBA 4DR2I 1N36E 1ZM3A 4Z7YA 3CWVA 2WW4A 4JI8I 4DR7E 3GONA 2EFGA 2UUAI 4DV3E 4LF6I 4DR2E 4UTGA 3ZZUA 5IT9Q 4PRXA 4DPYA 4FWHA 1Z5CA 2UXBI 1IBLI 4WUDA 4DV2E 4P52A 4LFCI 2VF3A 4IZJA 4B3ME 4LF9I 1XHKA 4JI0I 4NXNE 2VQEI 4DV5E 4DR1I 1EI1A 3LTOA 2CZ9A 3QT6A 5LL6R 1FJGE 3F0NA 4UT4A 4DU7A 1B63A 1KKHA 4DUYE 1Z0GA 2J7KA 3D4JA 1Z59A 4LFAE 2X7IA 4X64I 4DUZI 1RR9A 3J7AG 1NHIA 3K1JA 4YY3E 2HHHE 2UXCI 1HR0I 4GKKI 4K0KE 5FWKA 4LF8E 2O1WA 1XMQI 4LFAI 1FI4A 1XMQE 3Q1QA 2Z5EA 4K0KI 1N34I 4IZJB 2V2QA 1NZ0A 4X65E 4DXLA 2AJ4A 1H7UA 4JI6E 3JAMQ 1A6FA 4KQVA 4XTJA 2XEXA 2BM0A 1USUA 2R3VA 1N32I 2PNLA 1XMOE 1EA6A 4DUYI 4X65I 2CG9A 1HR0E 2GS8A 1BKNA 2OI2A 3PYGA 4LF7I 1MU5A 2UUAE 4JI2E 1Z0VA 4DUZE 4JYAI 1HNXI 4GKJE 5IT9C 2UUCE 3OTOE 1FWLA 2DEJA 3H4LA 3LNUA 4LFCE 1H72C 2UU9E 2ZITA 2CGEA 2UXCE 5A2QC 4DU8A 4FWGA 3V2UC 1N0VC 4MYUA 3PYEA 4DV6E 1S4EA 3J81C 1MG7A 5LMUI 4DR1E 4OX9E 1Z5BA 4LFBI 1N32E 5LMUE 3HJCA 4DV0E 4DR4E 2UUBE 4B3SI 4DV6I 4JI5E 1PKPA 3B82A 4LF7E 3LPSA 3JAMC 4USKA 4P7AA 1Z0WA 2HKEA 2LJPA 3T1YE 1NHHA 1Y4UA 2A2CA 4NXMI 2HKJA 3ZKDA 4DR7I 1N33E 1FWKA 2UUBI 4B3SE 2V2ZA 1J5EI 4DV1E 3T1HI 4YHHE 2E5LI 2V34A 2O1TA 2Q2EB 1PVGA 5LMNI 2PNMA 4LF6E 4JI7E 4DV1I 4DR3I 3T1HE 1D6TA 1XNRE 1IBME 4ED4A 2UXDI 4JI1I 1IBKI 1HNZI 5A2QQ 2V8PA 4WUCA 2O1VA 4JI4E 1IBKE 4GKKE 3QT8A 4DR3E 4GKJI 1N36I 4JI6I 2ZBKB 1FNMA 1IBMI 1WUUA 1H7SA 3Q6MA 3J7AM 4KHPE 3M6AA 1RREA 1PIEA 2VQEE 4DV5I 4IZJD 4DPUA 2F4VI 4EMDA 2Z5BA 4B3MI 2E1RA 1Y4SA 4AQYE 4ZVIA 5GMEA 4JI0E 4RPFA 4DPTA 2IOPA 4JI2I 5LMNE 3PRYA 3Q6NA 4YY3I 1S16A 1N34E 1ZXNA 4IZKA 4HXZA 5BR8I 4LF9E 5IWAI 1ZM9A 1ZM2A 4FN5A 1QZRA 4LF5E 4DV0I 4DR4I 4R1FA 2ZM6I 4JI4I 1Z0TA 3J80Q 1U2RA 2X36A 2Z5CA 1HNXE 4B3TI 3WU6A 1OJ4A 3PYFA 4KHPI 4B3RE 4JI7I 2NPFA 3T1YI 4URLA 3WU5A 4DV7E 2GQ0A 2A2DA 3ZZ0A 1HNWE 2O1UA 2E5LE 4HACB 1NHJA 4PU9A 1J5EE 2DEIA 2HK2A 1KVKA 1I94E 1B62A 4DV4I 4JYAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW I;  4MYT A;  1VIS A;  1H73 A;  3ZM7 A;  4JV5 E;  4Z7C A;  3J80 C;  5FLX Q;  4DV7 I;  1N0U A;  1XNQ I;  4X62 I;  3QT7 A;  3B78 A;  1XMO I;  4DR6 I;  2BV3 A;  1KIJ A;  2ZM6 E;  1ZM4 A;  1K47 A;  4DV3 I;  2UUC I;  1DAR A;  4DV4 E;  3QT5 A;  5BR8 E;  4USM A;  4WUB A;  2R42 A;  4HY1 A;  2HHH I;  1IBL E;  5IWA E;  4PRV A;  4DV2 I;  1XNQ E;  4JI5 I;  1Z0E A;  2UXB E;  5FLX C;  3V5R A;  2V2V A;  3PYD A;  1I94 I;  4AQY I;  2VQF E;  4JI1 E;  3J81 Q;  4FW9 A;  4DPW A;  4X66 E;  4JI3 I;  1FJG I;  2F4V E;  4DR6 E;  4DR5 I;  1ZXM A;  4LF4 I;  1Z5A A;  4JG4 A;  4DPX A;  4B3T E;  3ZZT A;  2BM1 A;  4I3H A;  1Z0C A;  2UU9 I;  1MX0 A;  4X66 I;  4JI3 E;  4NXN I;  4M1K A;  1HNZ E;  1Z0B A;  4X64 E;  4LF5 I;  1N33 I;  4OX9 I;  2UXD E;  4LF8 I;  1H74 A;  4NXM E;  3B8H A;  4DR5 E;  4B3R I;  3WU4 A;  5GMD A;  5L3J A;  1KTV A;  4YHH I;  1UEK A;  1ELO A;  4JV5 I;  2VQF I;  4LFB E;  3OTO I;  4JI8 E;  2HK3 A;  3HUL A;  4HAC A;  1FKA E;  4FWD A;  2HFU A;  1XNR I;  3WU3 A;  4LF4 E;  4X62 E;  4HYM A;  2HFS A;  3K17 A;  3ZKB A;  4DR2 I;  1N36 E;  1ZM3 A;  4Z7Y A;  3CWV A;  2WW4 A;  4JI8 I;  4DR7 E;  3GON A;  2EFG A;  2UUA I;  4DV3 E;  4LF6 I;  4DR2 E;  4UTG A;  3ZZU A;  5IT9 Q;  4PRX A;  4DPY A;  4FWH A;  1Z5C A;  2UXB I;  1IBL I;  4WUD A;  4DV2 E;  4P52 A;  4LFC I;  2VF3 A;  4B3M E;  4LF9 I;  1XHK A;  4JI0 I;  4NXN E;  2VQE I;  4DV5 E;  4DR1 I;  1EI1 A;  3LTO A;  2CZ9 A;  3QT6 A;  5LL6 R;  1FJG E;  3F0N A;  4UT4 A;  4DU7 A;  1B63 A;  1KKH A;  4DUY E;  1Z0G A;  2J7K A;  3D4J A;  1Z59 A;  4LFA E;  2X7I A;  4X64 I;  4DUZ I;  1RR9 A;  3J7A G;  1NHI A;  3K1J A;  4YY3 E;  2HHH E;  2UXC I;  1HR0 I;  4GKK I;  4K0K E;  4LF8 E;  1XMQ I;  4LFA I;  1FI4 A;  1XMQ E;  3Q1Q A;  4K0K I;  1N34 I;  2V2Q A;  1NZ0 A;  4X65 E;  4DXL A;  2AJ4 A;  1H7U A;  4JI6 E;  3JAM Q;  1A6F A;  4KQV A;  4XTJ A;  2XEX A;  2BM0 A;  2R3V A;  1N32 I;  1XMO E;  1EA6 A;  4DUY I;  4X65 I;  1HR0 E;  2GS8 A;  1BKN A;  2OI2 A;  3PYG A;  4LF7 I;  1MU5 A;  2UUA E;  4JI2 E;  1Z0V A;  4DUZ E;  4JYA I;  1HNX I;  4GKJ E;  5IT9 C;  2UUC E;  3OTO E;  1FWL A;  2DEJ A;  3H4L A;  4LFC E;  3LNU A;  1H72 C;  2UU9 E;  2ZIT A;  2UXC E;  5A2Q C;  4DU8 A;  4FWG A;  3V2U C;  1N0V C;  4MYU A;  3PYE A;  4DV6 E;  1S4E A;  3J81 C;  1MG7 A;  5LMU I;  4DR1 E;  4OX9 E;  1Z5B A;  4LFB I;  1N32 E;  5LMU E;  4DV0 E;  4DR4 E;  2UUB E;  4B3S I;  4DV6 I;  4JI5 E;  1PKP A;  3B82 A;  4LF7 E;  3LPS A;  3JAM C;  4USK A;  4P7A A;  1Z0W A;  2HKE A;  2LJP A;  3T1Y E;  1NHH A;  2A2C A;  4NXM I;  2HKJ A;  3ZKD A;  4DR7 I;  1N33 E;  1FWK A;  2UUB I;  4B3S E;  2V2Z A;  1J5E I;  4DV1 E;  3T1H I;  4YHH E;  2E5L I;  2V34 A;  2Q2E B;  1PVG A;  5LMN I;  4LF6 E;  4JI7 E;  4DV1 I;  4DR3 I;  3T1H E;  1D6T A;  1XNR E;  1IBM E;  4ED4 A;  2UXD I;  4JI1 I;  1IBK I;  1HNZ I;  5A2Q Q;  2V8P A;  4WUC A;  4JI4 E;  1IBK E;  4GKK E;  3QT8 A;  4DR3 E;  4GKJ I;  1N36 I;  4JI6 I;  2ZBK B;  1FNM A;  1IBM I;  1WUU A;  1H7S A;  3J7A M;  4KHP E;  3M6A A;  1RRE A;  1PIE A;  2VQE E;  4DV5 I;  4DPU A;  2F4V I;  4EMD A;  4B3M I;  2E1R A;  4AQY E;  4ZVI A;  5GME A;  4JI0 E;  4RPF A;  4DPT A;  4JI2 I;  5LMN E;  4YY3 I;  1S16 A;  1N34 E;  1ZXN A;  4HXZ A;  5BR8 I;  4LF9 E;  5IWA I;  1ZM9 A;  1ZM2 A;  4FN5 A;  1QZR A;  4LF5 E;  4DV0 I;  4DR4 I;  4R1F A;  2ZM6 I;  4JI4 I;  1Z0T A;  3J80 Q;  1U2R A;  2X36 A;  1HNX E;  4B3T I;  3WU6 A;  1OJ4 A;  3PYF A;  4KHP I;  4B3R E;  4JI7 I;  2NPF A;  3T1Y I;  4URL A;  3WU5 A;  4DV7 E;  2A2D A;  3ZZ0 A;  1HNW E;  2E5L E;  4HAC B;  1NHJ A;  4PU9 A;  1J5E E;  2DEI A;  2HK2 A;  1KVK A;  1I94 E;  1B62 A;  4DV4 I;  4JYA E; 
#chains in the Genus database with same CATH topology
 3X3U A;  1XXE A;  2AZ3 A;  3JSY A;  3H0P A;  4UOF A;  1BUX A;  1Q8I A;  4ZJQ A;  2IRY A;  2QL7 B;  2VOD A;  3NL0 A;  2KFN A;  1WAC A;  2A1B A;  3CCV S;  1TKZ A;  1NO8 A;  3IR5 B;  1EKR A;  1HNI B;  3H2V E;  4QR0 A;  4EI2 A;  3MDF A;  2B43 A;  4CT9 A;  1CPZ A;  3DLJ A;  3UN2 A;  1HL6 A;  4DX5 A;  3N79 A;  3ZTO A;  3DLB A;  4NXN J;  4LFC E;  1SC4 B;  2QGF B;  3M8P B;  4DL0 C;  5BJR A;  2BAN A;  3SCI E;  2HPU A;  5J2Q A;  2YX1 A;  5K36 C;  4PG5 A;  4AUK A;  2WP8 A;  5A2Q Y;  1TKT B;  1ITP A;  2LA4 A;  1H3D A;  2D3Z A;  1YIT S;  1KEK A;  2NUU G;  2ZWP A;  4KAI A;  1G7C B;  3VGT A;  2XM3 A;  3MUT P;  3T1H F;  4HL9 A;  3TW0 A;  3D0I E;  3MMB B;  4U96 A;  4LF7 J;  2DR9 A;  5GAG I;  1U25 A;  4DR2 J;  4DV3 I;  1RHJ B;  1J27 A;  2KYZ A;  1D9D A;  3RW6 A;  3PG9 A;  4JI5 J;  2G2O A;  4DV4 E;  1IBM J;  3SZ2 A;  4B3T J;  2C37 A;  1RTD B;  3HKM A;  2AGQ A;  1TK5 A;  2MHE A;  3QIP B;  1S9E A;  4RNN A;  2CG4 A;  2HBZ B;  1JXV A;  1J5O B;  3MFI A;  2HHH I;  5E3Q A;  2XMT A;  6AT1 B;  3PCO B;  1X4A A;  1CJK A;  3OPK A;  2DD8 S;  4I2P A;  4R8U A;  2FLN A;  1X4D A;  2EFV A;  3VVU A;  5CAB A;  1KWM A;  3TUP A;  4OL8 A;  4ZPA A;  1KNZ A;  2QEX S;  4JI5 I;  1Z0E A;  2UXB E;  1RWM B;  2VBW A;  3D3C J;  5LXY A;  3OTO J;  3BGU A;  2AZ1 A;  5FLX C;  3IR7 B;  1IKY B;  1H98 A;  2CPF A;  3FFI B;  3V5R A;  3MCS A;  3KLV A;  3D6F B;  3KLG B;  4YHH J;  2V2V A;  3PYD A;  1TKX A;  4OYI A;  5CYJ A;  3MTJ A;  4ECW A;  4JI2 J;  4IUF A;  4AQY I;  3PJX A;  4CDI A;  4YUD A;  3KK3 B;  2PMH A;  1JJH A;  4BS2 A;  3EMT A;  2QLF B;  3IS9 B;  4UST A;  5D3G A;  1FJG F;  3QFH A;  2W7A A;  4DCP B;  4DPW A;  4XPC A;  5C0X B;  4OV6 A;  2YNI A;  5IM0 A;  1VQO S;  3H8Y A;  2KJW A;  2MZT A;  1WHY A;  2KH9 A;  3QQC D;  3T3F A;  1HBO B;  4QWB A;  3OLB A;  4KJI A;  2WVD A;  4ZVS B;  4DR5 I;  4LBH A;  2AHO B;  4U8Y A;  5KTQ A;  4WTY A;  2XY6 A;  3M1V A;  2H54 B;  4TU8 A;  4DPX A;  4OO1 D;  2RQ4 A;  1NME B;  3DRR A;  5L38 A;  2DNM A;  1YRX A;  1UW9 A;  1X31 C;  3T5H A;  1WHX A;  1MX0 A;  4X66 I;  2D74 B;  1TUW A;  4WU3 A;  1T9W A;  3OL6 A;  3B4T A;  4JI3 E;  1MN9 A;  4IFD B;  2RKI A;  4KY3 A;  1KR4 A;  3D0G E;  4ECR A;  4CM2 A;  2OH2 A;  4J9Q A;  1JJ4 A;  4DQP A;  2BJD A;  1Z0B A;  3P4U B;  1N48 A;  2YNG A;  1N36 J;  2B5J B;  1Y6Z A;  2Z57 B;  4UY8 5;  1N8R T;  4WF9 Q;  4OYB A;  2NSB A;  2CXE A;  3GYX B;  4MK7 A;  1FRL A;  2FLP A;  4LF8 I;  4CZC A;  2F1D A;  1JK9 B;  3UD4 P;  2HQG A;  4HHH A;  1U6F A;  1KOO A;  5IZH A;  4RNM A;  3EPI A;  2MQL A;  2HBQ B;  2WNR B;  1JLF A;  1Q8K A;  2OSQ A;  1CUL A;  3MPY A;  3JS9 A;  4HTJ A;  4RW7 A;  5CYM B;  2XMV A;  4OI0 A;  5B08 A;  4ZCM A;  4LRF A;  1NEE A;  3RR7 A;  2GJI A;  3VAJ A;  1Q82 T;  5ETQ A;  3IO1 A;  2JFD A;  4LR8 A;  2EFO A;  3BB5 A;  3M6X A;  1RWW B;  3D2W A;  4KTQ A;  1U26 A;  4ZP6 A;  4PQU A;  4YHH I;  4OHX A;  2PGC A;  3IGN A;  4XDC A;  4ZLL A;  3H20 A;  4IZK B;  4JV5 I;  1VQ5 S;  3DLE B;  3LAM A;  5A8K A;  1VS3 A;  3ULH A;  4OX9 F;  3OTO I;  2MKY A;  5DQI A;  3K57 A;  4K59 A;  3MM7 B;  2BR2 B;  4X4O A;  1WHW A;  3HZG A;  4U7U K;  1HD0 A;  1UJ6 A;  3R5J B;  1FKA E;  1EP4 A;  2N4C A;  3BDE A;  2V8G A;  2VPZ B;  3M2U A;  5HAT A;  3JYT B;  1LFW A;  2V69 A;  1JB0 C;  1RT1 B;  1VQY A;  3MM8 A;  1UET A;  5IC6 B;  4FYV B;  4UQT A;  2U1A A;  9ATC B;  4G1I A;  3CJQ A;  4Q43 A;  3WU3 A;  3BSO A;  3MCM A;  3DM2 B;  4R0J A;  4LF4 E;  2ACM A;  4ISA A;  5K20 B;  3KJN B;  2HFS A;  2YKM B;  1AB8 A;  1C2P A;  4DR4 F;  1IKV B;  1YJ7 A;  2LFV A;  4X4T A;  2H4W B;  3Q0A A;  3HHL B;  1RT7 A;  1NAQ A;  1IBM F;  2NXJ A;  4I2Q A;  3C3L A;  2F65 A;  3NWG A;  3JQJ A;  4WFA Q;  1N36 E;  2H48 B;  5CD4 H;  4H54 A;  1PGZ A;  1HBO A;  3GYN A;  1MWY A;  1RWO B;  1S76 D;  1W25 A;  2CPZ A;  4OYM A;  3TVY A;  1TL7 A;  3W7B A;  4JI8 I;  5DLF A;  4K50 A;  4ANE A;  5HJY A;  2V4J A;  2CQ3 A;  1NK7 A;  3H59 A;  3PIO Q;  1PJ5 A;  3RYL A;  2BMB A;  2F8M A;  4LF6 I;  1T3N A;  2P5V A;  2VG7 A;  1MMN A;  2B9X A;  2H5I B;  5LOQ A;  4ILM A;  3AH6 A;  1FT8 A;  2GCF A;  2DGU A;  5I3U B;  3KLG A;  1RAJ A;  4PRX A;  5KFI A;  2KT2 A;  4H4O B;  1VYA A;  2ZH4 A;  2FY1 A;  1HD1 A;  3GIM A;  1Z5C A;  1T3O A;  2UVU A;  3TZW A;  2KVI A;  4ELT A;  5EWG A;  3NLC A;  5I42 B;  1X4B A;  2XLJ A;  4UQG A;  2V50 A;  3MEE A;  4B08 A;  4RU9 A;  3GR0 A;  2HAF A;  1QE1 A;  3MM7 A;  3M8S A;  3LP1 B;  2BR2 A;  3IC1 A;  5ETT A;  4DV2 E;  1JLQ A;  3TAM B;  3MEG B;  2JEI A;  4R8U B;  1FKP A;  3R2D J;  3OXL A;  4IO9 Q;  3OTB A;  1HNX F;  4IFD A;  3MED B;  3EGW B;  1IBL J;  4LCF A;  3KYL A;  3THP A;  2FLO A;  2V63 A;  2V9K A;  3KOA A;  2W2M P;  3GIK A;  2MZS A;  5GAD U;  2M70 A;  5ETN A;  3NS5 A;  4ECV A;  3QAE A;  2WW8 A;  4KO0 B;  3HHK A;  5K8M A;  2UU9 F;  4MKY A;  4U3D A;  4B3M E;  4JI0 I;  3HKZ D;  2C42 A;  1UAW A;  2GO4 A;  5A6W A;  1SKW A;  2EBG A;  3MTK A;  4DV5 E;  4KB7 A;  2B9E A;  1ZH5 A;  4ZPT R;  4YOE A;  1BY9 A;  5ETO A;  1GNK A;  3GB0 A;  3ZNJ 1;  2QZ8 A;  4NAS A;  1RT3 A;  4ZJL A;  1M5S A;  1CEZ A;  5LL6 R;  4DSF A;  1J5E F;  3OVB A;  1WC4 A;  2B56 A;  2C2N A;  4P2M A;  2DNL A;  4O3N A;  3RG6 A;  4PR6 A;  2F9J A;  4DU7 A;  1DQA A;  2IM3 A;  4OZJ A;  1Q7L B;  4K8R A;  4E2F B;  3QZ8 A;  1IR2 A;  3K5N A;  2YH1 A;  2RUG A;  3DHW C;  5L8R C;  4YDX A;  3W5Y A;  3LUY A;  4R5P B;  4NXN F;  2PFD A;  4DV0 J;  2O3D A;  5LM7 E;  1C1C A;  3S8S A;  2WCX A;  1GMW A;  5DRQ A;  3A3O B;  1I51 B;  3QYY A;  4OLP A;  2IVY A;  2NUH A;  3SQO P;  2HW3 A;  1VJW A;  1RHM B;  3R7N B;  3U1Y A;  3TEH B;  4KFB B;  5KFY A;  1TVR A;  1R8P A;  2IYG A;  1FD8 A;  3GPA A;  3RZA A;  3CJK B;  5KT4 A;  4X4P A;  2B9W A;  3HVR A;  4X64 I;  4DZ6 A;  5K36 F;  2J9C A;  2L48 A;  4FPI A;  4G65 A;  5JEA B;  3PY8 A;  2Q1L A;  1BQN A;  3CDW A;  1GT8 A;  3RBD A;  5KFE A;  4LF8 J;  1B62 A;  3VR1 A;  3K1J A;  3VTI A;  4IFY B;  1KVJ A;  4YY3 E;  2MKJ A;  4KH0 B;  1U1M A;  2QYG A;  4NXM J;  4CLP A;  1DTT A;  2UUT A;  3CO0 P;  4WPA A;  5C5J A;  3C16 B;  2MLZ A;  3V4M A;  1QAX A;  3PO5 A;  3DXS X;  1RBL A;  3CUN A;  3FFI A;  2GJF A;  3CDI A;  3M8W A;  3AD8 C;  4GRS A;  4PYA A;  2OLW A;  5ETL A;  2FZK B;  5A6P A;  3BGR A;  4U95 A;  2IM2 A;  5JVG Q;  1NJX A;  3NEK A;  1KFS A;  1PAE X;  2O1W A;  4LFA I;  4AID A;  2V4Q A;  4DV5 J;  3MM6 B;  2W24 A;  4A8Y A;  1FI4 A;  4ECS A;  4B9M A;  2XNR A;  4Y2A A;  5H9F J;  2ZH6 A;  2LU2 A;  2RF2 A;  3R7S B;  2PE8 A;  2DIU A;  2Q43 A;  3GSI A;  3SDE A;  1FJG J;  2Q79 A;  2QV6 A;  3WQP A;  2FVC A;  2P9E A;  3L7P A;  5GVQ A;  3VZI A;  3CF5 Q;  3VAK A;  2WRM A;  3N5B A;  1D0E A;  4JI3 J;  1KHV A;  3A8J A;  2DH7 A;  4P75 A;  4RKU C;  3VV2 B;  2LQB A;  3AB4 B;  3OV7 A;  4RW6 B;  1XNQ F;  3K89 A;  1WOS A;  1E6Y B;  1RP5 A;  3QGG A;  4JI4 J;  3QGP A;  1D8Y A;  3GCM A;  1WF0 A;  2YKO A;  1L3V A;  1JLB A;  3LGM A;  4C7Q A;  4JI6 E;  2CQI A;  3FC9 A;  2QLJ B;  5HVH A;  1H0H B;  3PW4 A;  2UZA A;  1G1X A;  1WOO A;  1IN0 A;  4J9V A;  4OZ5 A;  1N6Q B;  4XTJ A;  2C3U A;  4MIB A;  4BWM A;  2HIQ A;  1C4A A;  1OQ6 A;  3AOA A;  2C39 B;  4OO1 E;  3EZ5 A;  2BJ8 A;  5AT1 B;  2PNL A;  5ETM A;  1X4H A;  2JE6 A;  2W7P A;  1UW4 A;  3DDI A;  3L09 A;  2OGU A;  4AIM A;  1RLC L;  1C0U B;  1S6P A;  1B64 A;  3WC2 A;  1MMD A;  4ED1 A;  2CJY B;  3OHB A;  2HNY A;  2V8D A;  3GME A;  4PYD A;  4LF5 F;  5E3P A;  2M4M A;  3UCG A;  2C1E B;  2DHH A;  4X65 I;  1O8B A;  1OSC A;  2MY8 A;  3EDQ B;  4QIV A;  5ITH A;  4YME A;  2OI2 A;  4K4S A;  2IDL A;  2R7W A;  1G2E A;  2F40 A;  3HCX A;  3JTN A;  2E1C A;  2NQP A;  4DOZ A;  3ENV A;  3KMS A;  3B4M A;  3H5U A;  4U7C A;  2UUA E;  4JI2 E;  4CP5 A;  1FEH A;  2DO0 A;  2QTW A;  3EWG A;  3M32 B;  2DNK A;  5D0H A;  4JYA I;  1UFL A;  4QU6 A;  1Z4U A;  4IQM A;  4GKJ E;  3TYT A;  5L1L A;  3BF4 A;  4V19 J;  1RHQ B;  3MD1 A;  3NGK A;  5A8W A;  1W7W A;  1LW2 B;  1XN9 A;  1S72 S;  5HQM A;  4H4K C;  3TNV A;  3ENQ A;  3JTP A;  5CD4 A;  3TZZ A;  4ENO A;  1WG1 A;  4DFK A;  2DR7 A;  1FRH A;  1TK0 A;  2ZIT A;  3HXM A;  2CGE A;  1IKX B;  3A13 A;  1R6V A;  5A2Q C;  3FRZ A;  2QMX A;  2G13 A;  4NEZ A;  4RBU A;  3TAQ A;  1BQM B;  4YY3 F;  1U1K A;  2VFT A;  2X51 A;  1S57 A;  4L74 A;  2RQC A;  4WFB Q;  1VQ7 S;  5DG7 A;  1CJU B;  4P2X A;  4UZC A;  4QW9 A;  3FSI A;  2D1C A;  2NXU A;  4Y00 A;  2XC9 A;  4DUT A;  5HAO A;  4FYD A;  1LWF A;  2BX6 A;  1JLE A;  4USV A;  3TVZ A;  3MMA B;  5BR8 F;  2W9B A;  4ZVF A;  4LSL B;  5LMU I;  1MG7 A;  2XI2 A;  5DS7 A;  3O6Q A;  4LFB F;  3SCK E;  4NML A;  2V5H G;  3UVJ A;  2YTC A;  3FK4 A;  4NLY A;  2EEY A;  2YWF A;  2KZM A;  4LFB I;  5A0Y A;  2XGQ A;  1X5T A;  4RUC A;  1NHU A;  2ZJQ Q;  2QFJ A;  1N32 E;  1VQP S;  2OPR B;  3KK2 A;  1JLA A;  2HWI A;  1J5O A;  1FJ7 A;  4BC7 A;  2HVI A;  4EZ6 A;  1UDS A;  4WUC A;  2Z4P A;  1HWU A;  3P5T L;  3CIZ A;  1Y5I B;  5IOL A;  5DJB A;  2AEM A;  4C3L A;  3UDC A;  2Q66 A;  1KRP A;  1UVM A;  4F2R A;  1K1Q A;  1PKP A;  3U1N A;  1U45 A;  3IWX A;  3LPS A;  1WKL A;  4P7A A;  2ALY B;  1YKW A;  2JC1 A;  2HKE A;  2O5D A;  3K5P A;  2LJP A;  1MSW D;  4CO5 A;  1VMB A;  3DKD A;  4N5S A;  3RRG A;  1NHH A;  2R7Q A;  2YX4 A;  4W4M A;  4IG3 A;  5B0F A;  4KGX B;  1TP7 A;  3I0S A;  4NXM I;  2GGP B;  2WVE A;  3UQS A;  3FZ2 A;  5L1K A;  4Q0B B;  1RTZ A;  3DXB A;  1D1U A;  3RB6 A;  4ID5 B;  5KOW A;  4LT6 A;  3NCR A;  5DLG A;  1B3T A;  3GCX P;  1N33 E;  1HNI A;  1WOR A;  2M2B A;  2K3K A;  4DL4 A;  3M7N D;  1R6Y A;  1X5O A;  2FDN A;  5DM7 Q;  3R5B A;  3DI6 B;  4AE5 A;  3UNG C;  2CG8 A;  4ZS6 A;  4CLF A;  4YHH E;  5GAG U;  5HSP A;  2DIV A;  3I87 A;  1BHN A;  1YH8 A;  4MDT A;  3TJA A;  4IS9 A;  4C8M A;  1T9Y A;  2NXE A;  2H5E A;  2MQM A;  2WHO A;  5K1