4DXLA

Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
b'VSDWVPTGAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 97
structure length 304
sequence length 304
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 4dxlA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dxlA01
1S4EA 4JI6I 1U2RA 4AQYI 4GKJI 4JI7E 2ZBKB 3V5RA 5BR8I 4MYUA 3T1YE 1XHKA 4FWDA 5GMEA 1HNXE 1XNQI 3M6AA 1MU5A 3ZKDA 4JI8E 4B3ME 1IBMI 2ZITA 4DXLA 2HHHI 1XMOI 1N0VC 1FWKA 2BM0A 4DV1I 4ED4A 4HY1A 1HR0I 2BM1A 4LF4E 1Z0WA 1NZ0A 4JI2E 1ELOA 4X64I 1D6TA 1H73A 2WW4A 4LF7I 4LF9E 2E1RA 3WU6A 2UU9E 1NHJA 4GKKE 1XMQE 4X65E 4JI4E 4X66I 2UXCE 4DR3I 3ZZTA 3Q1QA 2UXDI 3WU3A 4JV5E 4WUBA 2XEXA 4DV0E 1FKAE 2UUAI 4DR4E 1RREA 2F4VI 1IBLI 2R42A 5FLXC 1NHHA 1Z0EA 4JI0E 2V2QA 1HNWE 2ZM6E 2CZ9A 4HYMA 4DV3E 3J7AG 3J80Q 3F0NA 3J80C 5IT9C 3OTOE 5A2QQ 1N36I 2UXBI 3T1HE 1MX0A 5A2QC 2AJ4A 2HKJA 3ZM7A 4JI3E 1Z0BA 1IBKE 1UEKA 4XTJA 4DPWA 4JI1I 4DV7I 4DPUA 1OJ4A 3QT7A 1ZM9A 4OX9I 4ZVIA 4DUYI 3K17A 4K0KI 4LFAE 1Z5CA 4DV5E 1N33E 1HNXI 4NXMI 1XNRI 1J5EE 3PYFA 4JI8I 4DR1E 4B3MI 1RR9A 4LFCE 4JYAI 1HNZI 4HACA 2VQEE 5L3JA 1PIEA 4LFBE 2UUCE 4DV6E 4LF4I 4KHPI 2VQFE 4JI2I 3WU5A 2V34A 4DUZE 1ZXMA 2HK2A 3K1JA 3WU4A 4GKKI 1XMQI 3GONA 4WUCA 4GKJE 4JI5E 2UXCI 1I94E 5BR8E 4DR5I 3JAMQ 1H72C 1QZRA 3H4LA 3JAMC 1XNQE 3QT5A 4RPFA 4JV5I 4FN5A 4DPXA 1FI4A 4B3SI 5LMUI 4USKA 1MG7A 4UTGA 3CWVA 4DU8A 3J7AM 2HHHE 1XMOE 1ZM3A 4LF8I 2UUBE 4DU7A 4B3TE 2A2DA 1HNWI 4X62I 2ZM6I 4DV3I 4DR7I 3LPSA 3PYGA 4JG4A 1KIJA 4PRVA 3T1HI 1Z5BA 4X64E 5LMNI 4LF7E 4YHHI 4DV4I 4LF6E 5LL6R 1N32E 1WUUA 2E5LI 3QT6A 1IBKI 4YY3I 1VISA 4X66E 4B3RI 4R1FA 1B62A 2X7IA 4DR6I 4PU9A 3ZZ0A 2UXDE 4LF5I 4DR2I 4EMDA 2Q2EB 4NXNI 1A6FA 2X36A 2F4VE 1IBLE 4DR1I 3J81Q 4JI7I 4LFCI 3J81C 3T1YI 1H7SA 2A2CA 1FJGE 2VQEI 1N36E 1ZM4A 3QT8A 4LFBI 1FNMA 1Z0CA 1H7UA 3LTOA 1DARA 2HK3A 1N34E 4KQVA 3PYEA 5IWAE 4OX9E 4MYTA 4DUYE 4K0KE 4JI5I 1I94I 2OI2A 2HFUA 4DV2E 4LF9I 4FW9A 2UU9I 4NXME 4JI6E 1XNRE 4X65I 2HKEA 4JI4I 2V2VA 4AQYE 2J7KA 1Z59A 4FWGA 3HULA 1Z0VA 4M1KA 4JYAE 1HNZE 2UUBI 4Z7YA 4B3TI 1H74A 1KKHA 4WUDA 4DV0I 3ZZUA 1IBME 1PVGA 3LNUA 4DR4I 1Z0GA 4KHPE 2V2ZA 4USMA 1KTVA 4P7AA 4JI0I 5GMDA 4LF6I 2V8PA 3B8HA 4DV1E 1KVKA 1N32I 1HR0E 1NHIA 1S16A 3OTOI 3V2UC 4DPTA 3B78A 1EI1A 4DR5E 1PKPA 2GS8A 2LJPA 4JI3I 1ZM2A 2BV3A 2VF3A 4B3SE 5LMUE 4FWHA 2NPFA 4DR3E 5FLXQ 4P52A 4LF8E 2R3VA 1N0UA 1FWLA 4X62E 4LFAI 4I3HA 3D4JA 4DR7E 4Z7CA 5IT9Q 4HACB 4DV5I 2UUAE 1FJGI 4DPYA 3ZKBA 1N33I 2EFGA 4HXZA 1J5EI 3B82A 5LMNE 3PYDA 4YHHE 4DV4E 4UT4A 2DEIA 2E5LE 1K47A 2HFSA 4YY3E 4B3RE 2UXBE 1Z0TA 4DR6E 1N34I 4PRXA 2UUCI 4DV6I 4LF5E 5IWAI 2DEJA 2VQFI 4DR2E 1B63A 1EA6A 4DV2I 1Z5AA 1ZXNA 4URLA 4JI1E 4NXNE 4DV7E 4DUZI 1BKNA
chains in the Genus database with same CATH superfamily
2YWFA 2RE1A 4AQYI 4N3OA 1S7IA 2PMZD 3V6JA 2NXEA 4M5KA 2MXYA 4QNKA 4LVNP 2F4FA 3D5MA 2C3OA 4JI8E 5C0XA 1FJ7A 2DNOA 1PYSB 1OY6A 1FRHA 4B3OB 2CPFA 3EGVA 2R8IA 4DV2J 3DDIA 4N7TA 4NXMJ 5L1JA 3ISND 2ZHOA 2OPQA 2UU9E 4F25A 5KFFA 1HYSB 1FESA 3W9JA 2MSTA 1JXEA 4ZN3A 3NBPA 3O44A 4PQUB 4CRJA 2UUAI 4DR4E 3KFWX 3DNCA 3SXLA 5IQ6A 3OD2A 4NCAA 1HNWE 5K8NA 1RT2A 2AWZA 1U8SA 1KQKA 1HR0F 2Y1JA 4DQRA 2XS5A 3QWPA 3HXMA 2FY8A 3QIPB 5HI7A 1C4AA 4ZJQA 5F8JA 4P7VA 1N32F 4LF8J 1KP6A 2HQCA 8RUCA 2VHGA 3EDRB 3AD9C 2QLFB 1Y4ZB 1PYTA 2FHMA 2DISA 1QJHA 4DFPA 3MMJA 3DU6A 1T9WA 4C2MA 2HVHA 2WOMB 2ASLA 4ID5B 2E5LJ 2DNGA 4TYBA 1FRXA 2EBGA 2J0XA 3MM5A 4LRAA 2UXBJ 4CLSA 5EN1A 1SC4B 1LWCA 4HACA 1T95A 4BA2A 2DGXA 1DZ5A 3L7PA 2KYXA 1CQMA 1ZETA 5DG9A 3HFZB 4FPIA 2Y1RI 4FKYA 5J2QA 4YR3A 2V34A 2CJBA 4F8RA 3M2UA 4ANCA 5ETTA 5KG4A 1S1XA 1I94E 3CWJA 2XB2D 2DNKA 1HBMB 4J9VA 2LYVA 2Y0SD 4DU8A 1RT4A 2GO9A 1YKWA 3UD4P 4GRSA 3B54A 3K59A 4X62I 2ZM6I 3PW0A 2P9CA 2PO2B 3U27A 2KFZA 5GMKa 5DRQA 1R8HA 2QG9B 3PW7A 4LF7E 2R7QA 4FNHA 5DO2A 5KFEA 4X66E 3LAMA 2ZNZA 2HZVA 2VDIA 4CIOA 3GB0A 4PXCA 4F2SA 5J2MB 1VBXA 1X4DA 2R7SA 3W2VA 2ZC4A 3EPIA 4ERDA 4GVBA 2Q2EB 2KXNB 1UZDA 2DY9A 2X36A 4OX6A 5B7WA 2EKNA 1X7VA 2J6TA 4A47A 4LFCI 4K8RA 1FJGE 2DCUB 3TRGA 1RTJA 4MIAA 2AQ4A 4CNZA 1ICEB 3MTJA 1KTQA 3H7HB 1FNMA 4DL2A 3AAWB 2NPIA 2U2FA 2CGEA 3TJAA 2XNRA 1RT7A 2K1RB 2GJ2A 1KD1T 2CPZA 3NGSA 2MJNA 5I3PA 1RHKB 2GIFA 3GV5B 1PILA 4DR2F 4JI1F 2WNRB 3BZQA 4GO7X 3GCMA 2MLXA 4RUBA 1YJVA 1QSSA 2C2ZB 4KGVB 4O3RA 1HNXF 4KHPE 2HRTA 4ECVA 3UD3P 1NJZA 1V5IB 3RB0A 1Y5LB 4UY85 3M1VB 3IWXA 3B78A 4BCAA 2WVBA 4Y2MA 2HNDA 4DX5A 2OMLA 4JI3I 3P3DA 1YVFA 2HHHJ 2B6AA 4EZ6A 1XMQF 4OI1A 5G4DA 3EXYA 3J7ZT 1FWLA 5L9NA 4F67A 2DHAA 4IFDF 2Z2MA 3POTB 4CQ1A 3M8SA 4ECZA 1Q95G 2FHJD 5KFYA 1WACA 3JS9A 1F5BA 3ZXWA 5BYQA 3QJJA 1Z0TA 2ZH9A 3FNNA 2O1VA 3CDWA 4WYLA 1UVLA 4DV2I 4J9MA 4NXNE 4A4JA 1N36J 5KG6A 2M70A 4M5MA 3Q22A 2B9YA 2JEBB 4UF4A 2BABA 4EI2A 1MLAA 4RW4A 1U25A 3PR5B 2N4CA 3GIJA 2J0QD 2FVRA 2JJ4D 3KLIA 4ZPBA 4LF2A 4K4WA 4ITSA 1TQLA 5CQGA 2BM1A 3TZWA 1URRA 1H73A 3R27A 4PZVA 4EFAC 3C8YA 1JB0C 2A3JA 3Q1QA 5EGYA 3G2XA 1TV6B 2NZ4A 2PE8A 2JEFA 4JV5E 3MAQA 4WUBA 1RXOB 2WP8B 2XC9A 2V8DA 4A8YA 4DV1J 2CJYB 2F4VI 1M1KT 2IOPA 3UR0A 1P42A 2V2QA 2HBQB 3LA0A 2YNHA 4PYDA 1HNIB 2RKIA 2MKJA 4F3OA 1IKYA 1V3SA 5HVHA 2UXBI 1MX0A 3NS5A 1VJQA 2RNEA 4ECWA 2Z58B 1FHTA 1KS2A 1U7LA 1T94A 1YHQS 3Q86A 3QGPA 3MFIA 4CO2A 2VIHA 1UL3A 2Q43A 2GQQA 2GCFA 4DR7J 3HO1A 3EPGA 1FA0A 2H5JB 1Y3JA 2WB1D 4OFZA 2C37B 1Z5CA 1UWBA 3BKUA 1E6VA 1N33E 2W8KA 3OFGA 2CQCA 4CO4A 3UCUP 1N5QA 4YY3J 1RR9A 1B70B 2OPRA 3FRZA 1FRIA 3KJQB 1JJ2R 2E7XA 2YKNA 2H9ZA 3A1YG 2BJ7A 2FD2A 3D6MB 4DV6E 5ETRA 1S49A 1X4CA 5J1NA 2R7VA 2HZAA 4YOEA 2I6WA 1D0EA 3I4HX 3PJ9A 3D3CJ 4QWCA 2RHSB 4FYYB 4J37A 3MD1A 2J9CA 4K4ZA 4H4MB 2F40A 4TKTA 5A8RA 2V2KA 4URSA 2GNKA 5D0GA 4C11A 5LMUI 2VFVA 3O5TB 1BGXT 5HJYA 5J2NB 3CJ8A 1QE1B 3OL6A 3ZZZA 3Q8QB 2QYGA 1CJTA 1NCLA 1C0UA 1YBAA 4PRVA 3B4DA 5CHCB 4X64E 1RWWB 4ZHRB 3K57A 4RW7B 4LVOP 4YHHI 4KQZA 2GO3A 4CO3A 4JV2A 4CM0A 3NZKA 1JIHA 1HNVB 1RCOB 5KFPA 1B62A 3QGHA 2X1FA 3K7RA 2PA8D 2ZE2A 4C8OA 1SJFA 3M05A 1A7GE 4DV3J 4B3SF 4ECQA 3G82A 1I1GA 3QZ7A 5LM7E 3VHQA 1KNZA 3LP0B 3N4WA 3IFEA 5AE3A 1IR2A 4CT9A 4PWDB 1H7SA 4PEOA 2AYGA 4PXEA 1RBOB 2IDEA 2MDAA 2DGVA 2RU3A 1NSKL 3GG1A 1Z0CA 4DV4F 1P8GA 1FXRA 3QJPA 2RS2A 5DRKA 1VQKS 4NXNJ 3EMTA 3PYEA 4OYWA 4LCGA 2UU9I 2OFHX 1RP5A 1Z59A 4USHA 3UN3A 3HULA 3LP2B 1HNZE 4ZLNA 3DI6A 2HQDA 2G2YA 4MKAA 5IM0A 3CMQA 2LFVA 4WUDA 3BGOP 3FBBA 2VPZB 1S6QA 4KFBB 2DNMA 4DR4I 4ZCKA 4X4OA 1SXLA 2DRAA 1HLWA 5HBMB 4X4RA 1I6JA 2PO0A 2OH2A 2LDIA 3MECA 2ZZNA 2OSRA 1OY8A 3GYGA 2VPWB 2NN6B 2GS8A 2MKSA 4LF9F 2HURA 3E01B 1YJUA 2CPEA 1KHWA 1JKHB 2CQ1A 3SCKE 4M95A 2LQ5A 2U1AA 2FJBB 3D1HA 1R6LA 3CJ0A 1RTHB 2IIHA 2ZDOA 1KBRA 2JLFA 1B99A 4L73A 5K8PA 3GV8B 1HWJA 5B0EA 3HVTA 5L46A 5C7PA 2BACA 3PR4A 2IAJA 4IKAA 3D6FB 3IXQA 1YJRA 3N79A 1U0HB 3Q8SB 4QYRA 2Z5CB 4WFZA 4U7UD 2IHR1 1TR0A 1D9AA 2VJUA 4ES2A 4UY8T 5AXMA 1R0AB 3DGPA 1VQ7S 2E5IA 2BANA 1N33J 3M2VB 2BJ1A 4QQBA 1XWLA 4NASA 3W9HA 4F04B 3KLEA 4GMKA 1UFLA 5K14B 4USJC 3EVMA 4ZDNA 1E6YB 1J5EF 4DR1F 2LLZA 1YRUA 3RU0A 2W01A 1N88A 4DV1I 3ZNJ1 1URNA 1S0VA 3NL0A 2RSQA 2QSFA 4LSZB 2DBBA 4LFBF 1DJ0A 5JEAC 1XNRJ 3QGIA 2Q6BA 3VVUA 4LF7I 1R8PA 3TAMA 1FNXH 3DXSX 1X5PA 2HIYA 4JYAJ 5G0RB 2IC3A 1RZMA 4HI1A 4X66I 2BUNA 2XHWA 2HEKA 5A6PA 2A6OA 1GTHA 3H2VE 2WTFA 1XK8A 2CPYA 4DJBA 5U47A 3LW5C 5F3ZA 2XG8A 3PZPA 4B3OA 4KTQA 1C2PA 1NHHA 4P2FA 3NY0A 4OI6A 4WFAQ 4USVA 5AJ3F 2IJFA 2XY5A 4H4KA 2QA4G 3JB9k 2NXJA 2MKYA 1VQSA 1WKLA 4Y34A 4LUBA 4QBUA 1UEKA 4XTJA 1LNQA 3N5BA 3GG0A 5IQQA 3GCXP 4O4GB 2UXDF 4PQUA 4QWEA 2MKCA 2FZKB 4QW8A 4BWJA 3ENWA 1R31A 3TJ8A 3WIVA 4OI0A 2VDHA 3PYFA 5D0RA 1Y5NB 4LF1A 4H54A 2BMBA 4NMLA 4C8MA 3QBCA 2VICA 2GAHC 2IA6A 4HTIA 2HHVA 3DHWC 1AT1B 3QIPA 1NZ8A 3FBCA 4XPCA 4PXBA 4KHPI 4U7UK 4U8VA 4YS2A 1SQEA 1YQHA 3G6VA 3GONA 1T05B 5HANA 2CQHA 4IG3A 2YVSA 3D6TB 3KLGA 1IKXB 3P5TL 4DN0A 4DUYF 2FHOB 4HT7A 1HI1A 1A9NB 2WOMA 4ID5A 2MJUA 1VBZA 4DPXA 1HPZB 1HD0A 2VPXB 1VHFA 4OHYA 4DV3I 2B9WA 4A8XA 2PC6A 5KOXA 2RILA 1TL7B 1X0PA 1WJ9A 4HT5A 3H25A 3BV8A 5JXSA 3ZC4A 4CZCA 4Q8FA 4NBQA 3NNCA 1EKSA 5LL6R 1N32E 3PVXA 5GADI 1R8CA 2MQLA 1GMWD 3G87A 3PRVA 4PG4A 4OV6A 4A8OA 4OYXA 2CJAA 3CDAA 3P76A 1U09A 1HW8A 1FVQA 1PSDA 1NMEB 4PRFA 1B64A 4NXNI 2C2MB 2MHNA 4J7CA 4J9UE 2YPYA 2BXJA 3H5SA 4ZK7M 2PO2A 1Z4UA 2AGPA 3QNWB 2WK4A 3NCPA 4MDTA 3QSIA 4J5OA 1G2EA 3DFEA 1GMVA 5T41A 3G96A 1YJWS 3CCSS 3LTOA 3S6EA 1X60A 1KLMB 1UEVA 1WHVA 2RAQA 4DI6A 5J2MA 2ATCB 4R5PA 4IRCA 4U3BA 4LF5F 3NGTA 2MHEA 2HRYA 1FE4A 1VRUA 2FC8A 4C97A 2EVZA 2RJZA 3JXOA 5D4NA 3PFEA 2VQEJ 4URQU 3KYLA 1VK8A 3OV7A 4EZ9A 3ZZYA 3HDSA 4Z7YA 2FDNA 4LRCA 3L09A 4R8UB 1H74A 2VQFJ 2CQGA 5KFMA 1PVGA 1FDNA 4U67Q 2QEXS 3BJYA 1XTZA 4IO1A 3FSIA 2CQDA 3TQEA 2X3GA 1VJWA 2V8PA 2KFYA 1RWMB 2VOOA 2PMWA 3CDBA 2XHCA 2PA3A 1TKTB 1NBEB 1EIYB 5DLFA 2W2MP 1H3DA 2ALYB 2ZBQA 2COLA 2IVMA 4B3TJ 2BR0A 2GW8A 2ZH8A 2IMOA 2R7RA 3MOZA 2Q66A 2IBOA 2PNLA 2G2ZA 5IOLA 1N33I 5T7LB 2HS0A 1UWAA 4JI0F 1O0PA 4DL7A 3FQKA 4G1QA 1IQZA 4N56A 3BDEA 4LIWA 1FFGB 4DV6I 4L75A 3KXDA 3BBFA 4DR2E 4RW9B 1Y00A 4JI1E 3DOLB 1BKNA 3DLGB 2DO0A 2LMIA 3HHLA 3OSPA 3POTA 2YWEA 4FWDA 2VC0A 1HNXE 4HYKA 1GQEA 4OX7A 3BPSP 2J6SA 3RG6A 2AJQA 4ID8A 2V4RA 1NAQA 4OZNA 4QYZJ 3MEDB 1MWZA 3UE2A 2W4DA 4QU6A 2UVRA 2HBZB 5KFAA 3F41A 2E9TA 1S6PB 4OYBA 4JI6J 3THTA 4X64I 5JEAF 4K7QA 1CVJA 3CJTA 4P72A 4O4RA 2YH0A 2W9BA 2I8EA 2HAFA 1XMQE 1AB8A 2ROGA 3DM2B 3R7BB 2JEBA 4NYPA 3BGLA 5BR8F 3QJLA 4DDFA 3EX7B 3DRXA 3TAQA 4LT6A 2Z5EA 1HA1A 4AXIA 1HR0J 3HMJG 2MZSA 2R42A 2FVSA 2PO1B 3OFHA 4IR9A 3L7OA 2B4UA 2YTCA 2VJVA 2QLBB 3J80Q 3H8YA 3F0NA 4DR5J 4H4OA 2RQKA 1APSA 1X4EA 4LBPA 1RHJB 3G86A 4ANDA 1T03B 2GIQA 3J80U 5ETLA 3HJFA 4LF6F 1UP1A 1TL3A 4KO0A 2OFGX 2W25A 2CRLA 1K0TA 1RT6A 1KQSR 2O67A 2NR0A 4LRFA 4X84A 5GAEU 2WP8A 3R8YA 1JXVA 3PS2A 2I1RA 3OR2A 1MSWD 1IBLF 4B3RJ 1HNIA 3MZIA 1HNZI 3OFEA 4DOZA 3BSOA 3LOUA 4L72B 2X3DA 3M8YA 5L3JA 1JJ4A 2XQCA 3BN7A 4YFUA 2XLIA 1NK9A 4NLYA 3NCQA 4DV7J 4WBFA 1SJ1A 2DO4A 2PD1A 3F56A 3LO3A 2VONA 5DZ7A 2R2SA 4V19J 1N34F 2A6MA 3JAMQ 4ZVPB 4KR0B 5H9FJ 1GFWB 3HI9A 3QMQA 1TL1B 3HT3A 2ASDA 1S7HA 5A8WB 3PV8A 4LF4J 1YZ6A 4CLTA 4JI2J 1X9MA 2UP1A 2JC0A 3V6KA 3O3LA 1U1NA 1UTAA 1IBMF 4R0JA 5B09A 3AY0A 2R7WA 2C38B 1YJNS 2BEFA 2UXCJ 1S48A 3V4IB 2RDJA 1IKVB 2IMWP 1AUSL 4CT8A 4UZCA 1X5SA 1NEEA 4DLEA 4H4MA 2P9GA 1LWEB 3CDUA 3R5AA 4ZLLA 4DF8A 3U7JA 5D0EA 1U49A 3DRPB 3OXGA 3J81C 5MLCV 4KJIA 1NB7A 2VQEI 4WJBA 4O3OA 4ZHRA 3CJ2A 3QT8A 3CC2S 2HWHA 2PO4A 3K5OA 5EHHA 3MM8B 3SMZA 4ECTA 1YTYA 9ATCB 2BJ9A 3C6UA 4KH0B 4LR7A 4DV5J 1RTDB 1JX4A 5K20B 1UW9A 1SV5B 3OTCA 3M32B 2IYIA 1RSCA 4NX9A 3ENQA 3LP0A 4C48A 1S57A 4PWDA 1DLOB 5EKWA 4JI7F 4I6YA 3G71S 4A8SA 3HK2A 4B3TI 2KI2A 1KKHA 2YPZA 4X4UA 4B3MF 1KR4A 3CCWA 4EYIB 4OO1C 2KHDA 1VRQC 3DYAB 3CCTA 2OKQA 4P7AA 1Q8BA 1EAYC 3HVRA 2QV6A 2HHQA 2E1CA 1R7IA 2NZCA 3RR8A 3MM6B 3NKYA 1N48A 2MQOA 3MCNA 5IZHA 3LP1B 3TZXA 4P9SA 4X4SA 4B3SE 3LP2A 1WI8A 4AIMA 2K3KA 2BQRA 4FXDA 2AIRB 3ZZRA 2FVCA 2MY7A 2R3VA 1T8EA 3PEJA 4KFBA 2UV8A 2EFGA 5HBMA 2ZBIA 3PYDA 5E0OA 5HLFA 4DV4E 4GO5X 4DL4A 2DEIA 1WEZA 1M1GA 2XMUA 3T5HA 3DRSB 1SL2A 3WQPA 2NN6A 1VBYA 3T1HF 2HNZB 3THVA 2HVEA 5IFMA 3UNYA 1WOPA 3QRRA 3UCZP 1JKHA 1IBKF 4NA2A 2R8KA 4DSKA 1WHWA 1S4FA 1YWXA 1FX2A 4JI6I 2ZWOA 1RTHA 2ZH5A 4KB7A 4PWWA 3RB6A 3BREA 2QJ3A 4ZCLA 3KUHA 2H3EB 2W7AA 2BQ3A 4BA1B 1C1CB 3PEHA 1MU5A 2BKOA 2LDYA 4Y2CA 4BS2A 1RTIB 2BKPA 1YDLA 1TAUA 1MROA 1N0VC 2HBRB 1U0HA 4IFVA 3EE3A 3BKTA 4HY1A 1HR0I 1B7YB 2I9SA 3VCDA 3MEGA 2DGQA 4ZN1A 1HI0P 1R0AA 1NJWA 4YDDB 4LF9E 2B8QA 4NRUA 4ZMMA 2GHWA 1NDLA 4TYAA 1RHMB 4RW6B 3MUVP 4LSLB 2QIFA 3R7SB 1W2IA 2M3DA 2JRSA 3FZBA 4DBQA 2NCKL 2I0XA 4PPZA 3GJTB 2VA2A 1F2GA 4IFDB 1NXIA 2FQQB 2L48A 2XLJA 4F3QA 2KXHA 1SH3A 3RYLA 2HFNA 4A8FA 2CQ4A 4ECSA 1DQ8A 4NEZA 3S8SA 2DH7A 1H38A 4ER8A 1F9HA 1YBUA 2RQCA 1TUGB 3DOMB 3GZ7A 4EYHB 5G0RA 2J65A 5JEAD 4NLVA 3P3CA 3JQJA 3IRXA 4DV7I 3ZTOA 2FHKA 1Y9OA 2KU7A 4WK3A 4ELTA 1HQUA 2AEJA 4BLGA 4EBCA 3FEXB 3M9MB 2LA6A 1J5EE 3FZ2A 4DR1E 4W92B 3OVAA 4W4MA 3IWLA 5IC4B 5AXKA 2JDJA 3VV2B 1REGX 4ZP6A 4LFBE 4DQQA 3NGUA 4LF4I 1UPMB 2MZRA 1T9TA 4JI2I 4IQXA 3WU5A 3LUYA 4ZVTB 2CPDA 3AXKA 1KVIA 4O4GA 2VC1A 5KFUA 4NMXA 2UXCI 2QL5B 2CNLB 3EYZA 2YQ0A 2CJ9A 1H72C 4G65A 2JZ5A 4ZP9A 3DC2A 1KOHA 3VAJA 1NU4A 4USKA 2BA1G 4MKBA 2JVOA 2CDRB 3OVSA 3RR7A 4EEYA 4FW7A 1LW2B 2E1PA 5KG5A 1NDCA 3PRDA 2DNYA 4AXJA 4GKKJ 1K0VA 4X65J 5AE2A 2R7UA 3CCQS 2RRBA 2BW2A 3RAMA 1WUUA 1T05A 1GEHA 2OPPB 1JLAB 3L7ZB 3CTRA 4FXWA 1IKXA 2QZ8A 1UZHA 3ZZ0A 4DV0J 2UXDE 3VTIA 4DR2I 4FYXB 3DD6A 3JSBA 1HPZA 3PS3A 3GFZA 4DR3F 4ATNA 1XN9A 4OIXA 4Y65A 3OTOJ 4IRDA 2KG0A 2FVPA 3FQLA 4ZA1A 1RADB 1TL7A 2E9RX 2VODA 4YB7A 2FIUA 1TKDA 1LXNA 4F4AA 1QSYA 3AQPA 5LMNF 2BYCA 4OHWA 5B08A 3JYTB 1NKBA 3AJ2A 1NK6A 2JE6B 2IA0A 1S9EB 4DUYE 2Z57B 4UOHA 2YNGB 2F9JA 3CD6S 4MU3A 4DL0C 4WPAA 1S6UA 1FE0A 3NGRA 2KM8C 2ZDPA 4RBUA 2Y0BB 1S12A 2V0NA 5DM6Q 3RRKA 2CADA 5K36C 1LWFB 2P6TA 4WTOB 3W3SA 3DU5A 1F0XA 1RAJA 4HHUA 4LBIA 2OD4A 1S1UB 4OO1F 2Q1LA 1R6YA 2NSBA 4MKYA 4CLUA 1F6TA 1UA1A 1N5VA 1XNQJ 1EI1A 1TU0B 2VKRA 5HK4A 4U6PA 4Z37A 4FS1A 1J5OA 3KHHA 2C3YA 1XMOJ 2DXDA 3BGRB 1HQEA 2HQ3A 2CPIA 2G0IA 4XAKA 2YWWA 3CDJA 2FUG9 1YLXA 2ZHBA 3Q8YA 5HVFA 1K73T 3DN9A 5DLGA 4I3HA 1LWCB 2MQPA 4HACB 3M6XA 4NEYA 4DPYA 3ZKBA 4BA2B 2WONB 3QFHA 2EK1A 2IPOB 3B82A 4FZVA 4WE1B 2B9EA 4DX7A 3MPDA 1HL6A 2KDOA 1TKTA 1DAXA 2OHDA 3E8OA 2MKIA 4I1TA 3BB5A 3C14B 3M2UB 4LF5E 2IM3A 3K0JA 3CCLS 1KFDA 2XMAA 2HIQA 1AFIA 2IDLA 1NHKL 4X2BA 3ZNUA 3CF5Q 2FGCA 2CUYA 4LFAF 1RT4B 2B9XA 3CDEA 5T7LA 3OHBA 3ZKDA 4J9LA 2GVZA 1NM2A 3HD2A 2ACMA 2BA9A 2JNJA 2XCPA 4WXOA 1N8RT 2VESA 4K0KJ 3GJRB 5KG0A 1NJYA 3BSAA 5C0XD 3TX8A 5E7OB 1VRTA 4CH0S 4M5DA 3DOLA 3T1AA 4WK1A 2D9OA 3Q8UA 2JSXA 2I38A 3W2VB 6AT1B 1RBLA 2KVQE 1X5OA 3W8PA 1S0NA 1LEOA 3NOCA 1YHCA 4HR2A 3CB4A 2BKNA 3N6NA 4ELVA 1V3RA 5ETNA 1RREA 3MEDA 2OLWA 2FHJA 4JI0E 2XWYA 4LBHA 4Y2AA 1T3NA 1FKOA 2VG7B 5F8LA 5KFJA 4C9DA 1RT7B 2ILZA 4F26A 3IN5A 1WI6A 3W64A 4K2XA 1WF2A 2RRAA 4IRKA 2OPSB 4B9UA 4ILMA 2ZNYA 2LECA 2UXDJ 2Y8YA 4DPUA 1W7WA 2HVDA 1SKRA 4TLRA 1ZM9A 1VQ5S 2PEBA 1VLOA 1RHRB 4CNYA 4L3NA 3ZFVA 4IOCQ 3MMAB 4NA1A 2FB0A 5I3QA 3J81Y 3ETMA 1KEKA 3PDNA 1U1RA 2VA3A 4WF9Q 1KLNA 4ED1A 5KFTA 1RT5A 3AHPA 3U02A 2IRXA 4DR6J 2W7PA 2XGPA 3HZGA 3KUGA 1SJQA 1WDTA 2BZ2A 3VQSA 4ZVFA 2VFSA 5DROA 2YKAA 5JEAE 5FIIA 2JEJA 3K58A 1RLCL 5KFXA 4OYOA 4GKKI 3MEKA 4DFJA 4WUCA 2B6AB 4Q8EA 4IZJD 4OX9F 5BR8E 4P73A 4CO1A 2AYMA 4HI2A 4RPFA 5BYSA 2H54B 4B3SI 1P27B 1B0PA 4UTGA 4AQYF 3VAMA 5H1SV 3SQGA 4USWA 4DCJB 1G6BA 3K2YA 2C2DA 5A6WA 1SB6A 3AODA 1H98A 3VF0B 3D0GE 4FW3A 1M5VC 3TR5A 4DV4I 4LF6E 2VKZG 3GJSB 1OQ3A 3R97A 2G4BA 3I6PA 4RKUC 3OTEA 1A0OB 5ETPA 1NUEA 2QTWA 2R9LA 1B3TA 1TL1A 3JSYA 3RBEA 3Q6NA 2O5DA 1KSPA 1IBLE 3R3TA 1H2VZ 1S0OA 4MH8A 2A2CA 1S76D 5LSLA 3UR3C 1N56A 2UUAF 3UN2A 2UUWA 3V4IA 2ZWPA 4A46A 1IBCB 1IKVA 2LQ9A 2DPJA 3SCLE 4DSFA 5DGAA 1X9SA 2HK3A 2B0GA 3MPVA 1N34E 1IJFB 4NLSA 4IG0A 4NI2B 2X51A 3LH2S 5DDPC 1Y7PA 3BSNA 2HVZA 4LF9I 1S6OA 2XZDB 3DCAA 4NCGB 4FWGA 1F2HA 4OYAA 4BBYA 1U6BA 4FPRA 1JNRB 2ZD1A 3T1YF 2HBYB 3EUNA 1QUVA 2GQ0A 4C3MA 3P5BP 4NL5A 3EGNA 2I2YA 3LNUA 1IBME 2CWXA 1Y60A 2V2ZA 3MM8A 2LEBA 1X4AA 1NDPA 5K36F 1RCXB 1LV5A 5HL7Q 4EO6A 3LANA 1RTDA 4MTPA 5KAKA 2CFXA 5D77A 3M32A 2UVWA 2K06A 2OGUA 1OYDA 3N01A 4UUXA 2CJKA 2UUBJ 1R8BA 1DLOA 1UWBB 3KG0A 2FTRA 3MTKA 2HYIB 3ET6A 2SXLA 4I67A 3ISZA 3ULHA 4RBTA 2OPRB 2Z2YB 3CJSA 4Z7CA 5E41A 3F44A 2NQPA 3DYAA 4HXZA 1J5EI 2YKNB 3Q8RB 1X5TA 1XC9A 4OO1D 3DLJA 3UWTA 2ZM6F 3I31A 3K85A 1F60B 5D4PA 3OXLA 4PCQA 2C3MA 2BDPA 4ZPTR 1Y10A 1N5SA 4URLA 1U24A 4CH1A 2NLWA 5H9EK 4DZ6A 2P8IA 5A8RB 2KT3A 4JI7E 1UAWA 2CKWA 2WSEC 4MYUA 1IKWB 3FFIB 4AM3A 3G8TA 3GYNA 2C42A 2XWXA 3ETOA 2W2NP 5D8HB 4ZP7A 4B3ME 5IC6B 3OR1B 2EC0A 1U02A 5LSOA 4LFCF 2XYHB 3DRSA 1MU2B 5IWAJ 5FD1A 1NJXA 4CLPA 3L9ZA 2HNZA 4KAIA 1UEUA 3A3NB 1Z0WA 4N76A 3KLHB 1NKEA 3UW1A 5KT6A 2RMLA 2OTLS 4OHXA 4DUZF 3W61A 4W90B 2ZE2B 3S7RA 1LOUA 2H48B 3PTWA 2HNYA 4GKJF 1BQNB 4ZVSB 1DY3A 2CIMA 4CCHA 2UXDI 4BA1A 1C1CA 4XTTA 3G82B 5IXUA 3MHYA 4UUWA 2JX2A 1RTIA 3DLEB 4FVCA 3N9UC 2XEXA 4PQAA 2OO4A 1CG2A 1WTBA 1HBOB 1TKXB 2ZBRA 5FWKA 2KTQA 2PNZB 1Q8LA 1MMNA 2J8SA 4K5SA 2EFNA 2GGPA 5IT9C 3R9LA 4NLDA 1W2BR 5HMZA 3T1HE 3PO4A 2PFFB 1RAGB 2DCLA 2H4WB 5B0BA 4RW6A 1MW7A 4LSLA 4B9SA 1IBKE 1FEHA 2J0WA 2FLOA 1U1OA 2I5JB 4KKOB 1VCTA 4O0NA 4M63A 4DUYI 1JJHA 3CJ3A 1RHYA 4ZLPA 4IFDA 1AUDA 3RZAA 3DI6B 2HRUA 3DHXA 5KFOA 5CABA 3NRBA 1VC6A 1DFDA 1HHSA 1WKKA 2E5GA 2R7XA 3HZEA 2KVIA 3CDIA 4EBEA 4WIIA 2HQIA 3JTPA 3BSCA 3MGJA 1Y3KA 3DOMA 2PO0B 1CEZA 2WVEA 3VAHA 1KWMA 1QUPA 4ILLA 2VB6A 1RQ0A 3EZOA 1BMQB 2KZZA 2NUHA 2DRBA 4P2MA 4ECYA 3GIMA 1WOSA 2CZVC 2UZAA 1S99A 5C5JA 5D78A 4JOUA 1OYRA 4DV2F 3H4LA 1FTRA 5KG3A 3W9IA 2QX0A 4NXMF 2L9DA 4LSNB 3SCJE 3J7AM 2MGZB 5C2CA 4D3GA 2BJ3A 3HVTB 3MDFA 1Q5VA 3HVAA 3I5AA 2MYFA 1U1KA 4XPEA 5D0HA 2IAJB 3M8RA 5L38A 3K5NA 3E51A 2FJAB 2C3PA 4X4NA 2B7CB 1TMJA 3W8GA 4DN9A 2JWNA 2KB2A 3Q0AA 3SYZA 3QGGA 4EBDA 4FVMA 1S72S 4A48A 1UKUA 2POKA 2EK6A 4LF5I 3MF5A 2BANB 3OTDA 2Y9HA 4OZ0A 2VG5A 3ZTPA 1CC7A 3HM9A 3KLEB 1LW2A 4LF8F 3CSKA 4F02A 1GTEA 1RAAB 2V67A 3MPYA 2GO4A 4KBIA 1R8AA 2KHCA 1S5ZA 1RACB 1XR5A 1FJEB 2E5LF 1S79A 3KNAA 1RT1B 1LK7A 2UXBF 3TAMB 2CPHA 1CULA 2HHWA 2XO7A 1TKZA 4CLZA 4I68A 1OSDA 3SSQA 2IC3B 2WAQD 2EPIA 5EDWA 2OI2A 1TVRB 5KT7A 2K7KA 3UVJB 1CJKB 4QR0A 3RBXA 1PKUA 4M5NA 5KFZA 4J9SA 2PNMA 3WX4A 3QSYB 3H0PA 1SQFA 3NG8A 4LIRA 2UUBI 4HHJA 1JNZB 3I96A 3V6DB 3L95X 3NXZA 4I56A 3J7YI 1HMVB 2KG1A 3A3PB 4JI0I 2L3MA 2HAIA 4BC9A 3JYTA 4JI5J 3ZZOA 2JE6A 1GMWA 1S9EA 1JLEB 4K2JA 1WSVA 2YNGA 1ZAWA 2DVIA 4C8YA 3FCWA 5GVQA 4OJ1A 4JI4F 4DR3E 3I9V9 5GAGU 2XI2A 1V9OA 4JP8A 2YWKA 3M8PA 3Q89A 1QTMA 1LWFA 2QA2A 1Q78A 4C0BA 4RR5A 1GXTA 4WZMA 1FKAF 3W5ZA 2V6AA 1K44A 1S1UA 1P9QC 2MZ1A 5LMNE 3NMRA 1T9UA 3EZ5A 1XXEA 5B0CA 5K36D 2MEWA 2HFSA 4KGXB 2L9NA 1VYAA 3EDQB 3KJFB 1S1VB 2XTJP 3D1QA 3CMAS 1MNEA 3QIDA 4USIA 1BD6A 5IWAI 2KRRA 4ZKAA 3BGRA 3LPEA 4OZ2A 4IG3B 2F4VJ 2IERA 3EZUA 3KLGB 3Q24A 1S59A 3NMAA 4Q5VA 5BR8I 4ECRA 1Z2ZA 3M2RA 2WONA 3TEGA 3GE9A 3PXGa 3VAIA 3IR6B 1IM6A 2KZMA 4WE1A 3C2PA 1XJWB 2ZITA 2R2TA 4OO1E 4LQ3A 1KC8T 1QVGR 2LU2A 2ZH4A 2YH1A 3ILLA 3C14A 1YRTA 3HX9A 2D41A 3AOBA 3NWRA 3G6XA 2BVZA 2LXUA 2BA0G 2AEFA 3WC2A 1HBUA 2HGLA 2HMIB 2BA0D 2IY5B 4C4WA 3KUEA 1PAEX 3GLLA 5K8OA 4ZVGA 2J0SD 5AE1A 4DQIA 3C16B 4OJGA 1IBLI 1Z2LA 2HHHF 2NREA 4DL6A 3C19A 2E66A 4DSLA 4WP9A 2ZH2A 2CZ9A 3UQSA 4OZJA 3IBCB 2WBMA 5A2QQ 1H7XA 4C0HA 1SPBP 5L1IA 3OBIA 3M8WA 5LMUJ 1OQ6A 2QFJA 3N28A 4R5PB 1ZTWA 5A2QU 1LWXA 3VAKA 1VRUB 1L3TA 5D15A 5HP1B 1U2CA 2OELA 4LFAE 3D54A 1P6TA 2AYEA 2ZFHA 4YHHJ 4C8LA 1FXDA 4ED8A 2GC8A 4QW9A 4B9TA 2VG7A 1UDOA 1G4CA 1N36F 2OPSA 4OLOA 4NWBA 2HGNA 2O1TA 3LWLA 2ALZA 3WDOA 2XSFA 1UPPA 3G4SS 1RAFB 1ZXMA 4KHMA 4QJVA 3R1HA 4CP5A 1ZA1B 3MMAA 4JI8J 4LOMA 2EFOA 4X4PA 1AXQA 2W4CA 1QZRA 3GR1A 3KLFA 1PGZA 4PR6A 3EGZA 2HSEB 3CJRA 3THPA 2JC1A 1HFEL 4AIDA 3BN4A 4OZ3A 3PHEA 1NPPA 2XMKA 4J9PA 2CNKB 4F0MA 2HLUA 3PYGA 4JG4A 2UU9J 2B4PA 3C6TB 4G1QB 3M30A 2ZC3A 4DX8H 2E1MC 3QT6A 4DV1F 3CD5A 3PKYA 2H1YA 3OW2R 5CYJA 2MQ8A 5L1KA 1UVIA 1YG0A 3MCSA 4DR4J 1SJ3P 4IZJB 2DHXA 3HHLB 1FXLA 1HNWJ 3MAHA 4U7CA 2WSCC 2F5GA 5KT3A 4JI7I 2KXFA 1ULRA 4RX6A 5HMWA 1RBAA 4G6VB 2MQMA 2JOQA 1GNKA 4DR7F 4I4BA 1Y11A 1WF0A 3ELHA 1PC4A 2JFKA 1VS3A 2MZTA 2DTJA 1O5JA 1G7CB 4YY3F 2QLJB 1BHNA 1WELA 1RHQB 2W9BB 4NLRA 4C98A 3OPKA 4OX9E 1XQIA 4JI5I 2CG9A 2XULA 4IOBA 2AMCB 3OL7A 2AD9A 2NXUA 1RE1B 3P6YC 1U2FA 4AQYE 3MR2A 1OYEA 5DNLA 4NLUA 1Z0VA 1BUXA 2DJWA 3CIMA 3UDEA 3PX4A 4C7QA 3FGVA 1O6XA 1EP4A 1M5PC 4FF1A 5C24A 3V4MA 4Z2XA 2AGQA 4H4OB 4KY3A 3KWMA 4HH1A 2DR7A 2GVDB 2XNQA 5A76A 3MPUB 2MQQA 3JQKA 3ZZPA 2PFDA 1I94J 2CWKA 3VALA 4NI2A 1Q82T 4ED0A 1TL3B 4ZCIA 4KO0B 2FZGB 4DPTA 2EFPA 1RT6B 3BQ0A 4S0MA 4DL3A 4RUCA 1UFWA 4LQ9A 4OZEA 4NCGA 4LRBA 2YBVA 1SVDA 2NN6F 4O3QA 3L7UA 2FLPA 3ZO7A 3OR2B 3BYRA 4ED3A 1YSJA 5IT9Q 4LF7J 3GIRA 3IAM9 3Q8VA 2UUAE 4FBUA 1I5OB 2J7WA 3QO9B 4QZVB 3MR3A 5IT9Y 3QPIA 4X66J 3GWCA 5K5MA 5IT9U 1K47A 4LJMA 1DURA 4DV3F 4NOHA 3M8ZA 3CGIA 1DQAA 2B51A 1NJIT 2AT1B 2VASA 5RUBA 3A8EA 5KFNA 2PEHA 3BBBA 4XDCA 3R5DA 1VFJA 1VR6A 5ITHA 2ROEA 2LQBA 1RWXB 1FJGJ 4URGA 4OYMA 1SIWB 2B5JB 1PJ7A 3T1YE 5I42B 3P3EA 3M6AA 2V68A 1FVSA 4ZS6A 2BBEA 1PC5A 3N6LA 3PG9A 5K36E 4E8UA 3DRRB 4OO1B 4A8QA 3G6YA 4Y28C 2QFIA 3I9ZA 1CS4B 1N5YA 2LXIA 1TMMA 3OSNA 1IKWA 3FFIA 3BDPA 3WU3A 4KHPJ 3KMQA 2C28A 3OR1A 1QM9A 2V9WA 2HLTA 4DS4A 2XZWA 1UVJA 1MU2A 4MT1A 2ZBCA 2ZM6E 3PW4A 1I3OB 3J80C 1J2VA 3KLHA 1LQ9A 2HHTA 4CWBA 1HK7A 1FFSB 2AYBA 3C6UB 3R5BA 4ZVHA 4WWSA 4F4XA 2ABYA 3SV4A 2KT2A 3KHGA 3JTNA 1BQNA 1OJ4A 2JEIA 1SCJB 3BKFA 3DLEA 1VHIA 2DNQA 3AQOA 1YZ7A 2YKQA 3GYXB 2O3ZA 2XMWA 1HBOA 1TKXA 4JI8I 2AX0A 2PNZA 3HSJA 4ECXA 3MM9B 4LFCE 3TX0A 2P2CB 2G9OA 3KNGA 3W5YA 5F8GA 2Y3YA 1Y5YA 1TFYA 5ETSA 1WC1A 2I5JA 2WSFC 3CJ5A 3MMBB 5K9FA 4DUZE 2JT2A 4HLBA 2DD8S 4KKOA 3SFUA 1UVMA 4OYIA 3C3LA 4GKJE 2BJEA 3OQ2A 3ONQA 4TN2A 1U6FA 1SH0A 3JAMC 1R6MA 1HIYA 1U6ZA 1XNRF 1DBDA 4WFXA 4ZPCA 3IWNC 4JYAF 2EG2A 5THWA 1HNWI 5HLFB 3WX8A 2VBXA 3I32A 5DJBA 1F3VA 1AZSA 2DXFA 4J9KA 1VMBA 3K5LA 3NGKA 5LMNI 3PFOA 5JEAA 3RBDA 2FLNA 1X8DA 3NLCA 1GXUA 4PKDB 2BOAA 2IRYA 1C0TB 4B17A 4KT0C 2IFXA 2DGSA 4JV5J 3MAAB 3IRWP 2QA4S 4EMDA 1SJ4P 3PCOB 4LSNA 3D9BA 4K4YA 3MI7X 1HD1A 3L4BC 4U9RA 3V81B 2MGZA 4RNOA 1WTFA 4ZIWA 4XIUA 1OYPA 1MROB 1G1XA 2ZOFA 2VBWA 2C2OB 2JLGA 1ZM4A 4QU7A 5KG7A 4IFVB 2RB7A 4LR8A 2MKHA 4CI0B 1FJCA 3MEGB 3AT1B 2OMOA 1L5UA 4EK2A 3IO1A 5GADU 4QIVA 1FDAA 4KQVA 1CJUB 1JLBB 3KK3A 4RNHA 3OUYA 2BOPA 4KH1B 3JTOA 5GAHU 2ASYA 4CO0A 1I94I 4N5SA 4DV2E 2CJXB 4NXME 1RJJA 4PG8A 4YB5A 3MOJB 3DMJB 1R89A 4DUTA 4DV6J 2NXNA 4X4QA 4NLTA 4NLXA 3ZZUA 1XBWA 5EX3A 2BRLA 3PRYA 4ES1A 1KTVA 1RT1A 2JL9A 1Y6ZA 4F36A 1EKRA 2CQBA 2K8GA 1RLDA 5DDRC 1Q86T 3WBZA 1TVRA 4EU0A 3VR1A 3IRXB 2OAUA 1PKPA 5EWFA 3EM1A 3UVJA 5KFQA 1ZM2A 1CJKA 4GQUA 3NEKA 4HH0A 1HQUB 1NK5A 1RHUB 2GMJA 2PIIA 2NPFA 2ZBPA 4KSEB 4L74A 2XY6A 2OIHA 5B0AA 4LF8E 1UJ6A 1RYSA 2EC2A 4LFAI 2D9PA 4X64J 3V6DA 1JQGA 1FJGI 1V6HA 1HMVA 2KJWA 3AJ1A 2N7YA 1DTTB 2E5LE 1JLEA 3J7AN 3LGMA 4WU3A 2Z2ZA 4J9QA 2M4MA 2UXBE 2J5AA 4RO0A 3TAPA 1NK8A 5DQGA 2W2PP 2CPXA 2WCXA 4C6AA 4OLPA 3P06A 1VK3A 1CSJA 4N8NA 1B63A 3MR6A 5D6GA 3CD7A 2DNNA 1Q8KA 4ED6A 4MKVA 2NN6D 1U2RA 3V5RA 1AFJA 1N5TA 4Q2LA 3FJ2A 4MMOA 2KM8B 2RVJA 5B0DA 2RS8A 3HFVA 1YX2A 2J6UA 1S1VA 1WSRA 5ETQA 4K4XA 2VQEF 5K36B 2AZ1A 4M5JA 2D69A 1EZZB 2ASJA 4ELUA 2GFFA 2J76E 2QMWA 1NLKL 4B08A 4F2RA 4ED7A 2VQFF 4IDKB 2ZH7A 1RAIB 2E1RA 2XZTB 1HNZJ 4K59A 1MWQA 4AD6A 3H90A 4JI4E 4RU2A 4KGZB 4V1Ak 3DLBA 3LWMA 1HWLA 1FKAE 2YNFB 1LW0A 4Y0FA 1J27A 2V4JB 2W8LA 4C8NA 4B3TF 1QTNB 3NS7B 2Z8QA 2BR2A 2GHVC 3HF5A 2HKJA 1UMJA 3M9OB 5AXLA 3HKMA 2HFZA 3TA2A 2RRNA 2HMIA 3QATA 3KOAA 4RW8B 3PO5A 4OX9I 1PO6A 1EX8A 3C16A 3DKDA 1FF2A 1GX5A 2C2NA 3ILIA 1QAXA 3CPWR 3CUNA 4OI4A 3BH6B 4EGLA 4AE5A 5ELWA 5KOWA 1BLUA 4Y3CA 2ERRA 3A8KA 2ZUGA 5A0YB 4C3KA 2RUSA 3CT9A 4DQPA 5D4LA 1Y4SA 5HP1A 3K1JA 1BXNA 1RUSA 1J5OB 4P71A 1HQEB 3RTVA 5E3QA 3T5KA 4DQSA 4KGKA 5KFIA 1CPZA 4JV5I 1FI4A 1YJ7A 4JI6F 4F50A 1FRLA 5I3UB 2HHHE 1BQMB 4DU7A 2VOPA 2X1AA 3PKMA 5HJXA 4ZPDA 2DNHA 1S77D 1WG5A 1VLYA 2RD5C 5JVGQ 1KIJA 2FVQA 2HHXA 2MQNA 1KVJA 2QRRA 7FDRA 1FX4A 4Q2MA 1DRZA 1JLQA 2D3UA 4NZ7A 1F1BB 1JJCB 1WWHA 5M2UA 4Y2IA 1U1QA 1FRJA 4DR5F 1C1BA 2MY8A 4BC7A 1HWUA 3P49B 5L9XA 3W66A 3KHLA 1TK5A 1A6FA 2DNPA 3W65A 2VD3A 2ACYA 3SIPB 1ZAXA 1M1HA 2GVZB 3T1YI 4IFYA 2B4OA 2R2RA 5C0XC 2HWTA 4FW6A 1N36E 3C6TA 3SV3A 1EQMA 3MMCA 2DGUA 3IR5B 1H7UA 1VRTB 4M5GA 1BE4A 4M5DB 2LQ8A 4B3RF 2L41A 4PYAA 4IZJA 4JBCA 1W26A 4AFFA 3CCMS 3DGVA 4ECUA 3H2UB 1PJ6A 2E9ZA 4UQTA 4DV7F 1RT3B 2J7KA 3GILA 5DG8A 2MPUA 4N41A 2HS3A 1H2UX 3LGNA 2O66A 4KC5A 2VH7A 1FKOB 2N82B 2YY3A 1U4BA 4RUHA 4DV1E 1OWXA 1WEXA 3TI0A 3PM9A 4XK8C 4LF4F 5JMNA 3HKWA 4JI4J 4NLQA 4JI2F 3N0VA 2HZCA 5E3CA 1RAOA 1N6QA 1CJVB 2OP5A 4HEA9 2N3LA 2UXCF 5EWEA 4I2PA 5C42B 1Y4UA 4IH6A 3O2IA 1RT5B 8AT1B 4DR7E 1ZPWX 1PG5B 3NP5A 4ALZA 1ZBTA 2V69A 1N32J 3AB2B 1RB0A 2GVDA 1WD6A 3J80Y 2VBYA 1HHQA 3V6HA 3X1LB 1NSPA 3H1CA 4YY3E 4WFYA 4PRXA 7AT1B 5SZTA 2DR5A 5LXYA 2EBEA 3CJKB 2FJEB 4DUZI 3GIIA 1S4EA 2ZJQQ 2Q6CA 4GKJI 2R8HA 4U96A 1FT8A 2MKKA 2V8VA 2J9DE 5A8KA 4XDDA 3SQGB 4NE9C 3H5YA 3QO9A 4DV5F 5LJ5Y 4EUVA 5GAGI 3JSRA 3FUYA 3AXMA 2DGTA 3M4XA 4K50A 4DXLA 1B7FA 1FKPB 2D3OR 3C15B 5KFKA 2KKHA 2DRDA 2Y1IA 3MM7B 2UUCF 4XO0A 4WKRA 3F73A 1VQ6S 1WC5A 1IN0A 2NN6E 2B5JA 3JAMY 4IQMA 3R5CA 5I42A 2OTJS 3JAMU 3BO2A 4F4KA 4FW4A 3PW2A 2IESA 2GJIA 4CM2A 2OEJA 4IYQA 2W9AA 1CQNA 3FMWA 5FLXC 3DRRA 1Z0EA 4OO1A 3CC4S 4JV1A 4DF4A 4DV3E 4WFNQ 3W63A 3J7AG 1R0BG 1FWPA 1UDQA 2JEAA 1WEYA 4I7FA 2ADCA 2HHSA 1CS4A 2J7UA 4P74A 2XM3A 3ZM7A 4IG0B 2ZH1A 1EJ7L 2YWGA 4J9OA 2E44A 2ROPA 4HHHA 1UJ5A 2K7JA 3RRHA 3HHEA 2BE2B 2Q79A 2VFTA 2DGWA 2YKMB 3FKBA 1Q5YA 4NXMI 2ZD1B 4K4VA 2HFVA 3CCZA 3DDNA 3G9CA 1USVA 2ZJRQ 1TL4A 2CG4A 2W2OP 2IRUA 3CJQA 3CULA 1JWWA 4DR2J 4JI1J 4QNJA 2OUGA 4FKXA 5KG1A 3FEZA 1QSLA 5M2RA 1VI7A 3D67A 4KGMA 1JLGA 2HK2A 3T6JA 4R0EA 3D1OA 2JH3A 5DDOC 3M85G 4ES3A 3FSYA 3QAUA 1EETB 2CDQA 1HNXJ 5JJBA 3M85D 2CVEA 1GH8A 2R7OA 1YGYA 4PABA 2XSJA 3M8QB 2QA1A 1RYRA 3ET6B 3QT5A 3MM9A 3P45B 2BJDA 4NPOA 3CWVA 1KN6A 4LF8I 2AW0A 2E7VA 1Q7YT 3SBMA 3CVKA 4CDIA 2Y1LB 3LPSA 3K89A 4Q7AA 2C2KB 1XMQJ 4PWUA 2DY1A 1YJ9S 3MMBA 5CH7B 4TY8B 2ILYA 4LMZA 1FTCA 1FRKA 2E5LI 1VISA 1R27B 4PG5A 3A4TA 1S9GB 4ZPAA 1L3KA 1RU2A 1REVA 2QO3A 5F9LA 7FD1A 2G0CA 2JVRA 1DQ9A 2NYHA 4DG1B 3BYPA 3H4BA 5F8NA 2BQUA 3IP0A 1VQYA 4K5RA 4CTAB 3VZHA 1S1WB 3T19A 5D3GB 3HJVA 2C1EB 4ICLB 5C0XF 3EGWB 1RK8A 1K1QA 4V19X 1C0TA 5KT5A 2V5HG 3GMEA 3FBFA 1XEZA 3MAAA 5FDLB 1ZA2B 4K4SA 2R8GA 1B4SA 1NDKA 4C8ZA 2ZKTA 3G8SA 2HNYB 3WZ0A 3V81A 1MWYA 4F3MA 3TJ9A 3AA9A 2CQ0A 2LP4A 1XNRE 4JI4I 2E5HA 1PCAA 1RABB 4JYAE 4RWWA 2AE8A 1VQOS 3R2CJ 1D9DA 1BY9A 2GGPB 3UDLA 3R6LB 1KVKA 1CJUA 1N32I 1JLBA 3U1KA 3QQCD 2AJ1A 3TP2A 3V2UC 2IBKA 5F8HA 4CYUA 3RBZA 4CLYA 1TP7A 4LR9A 2BV3A 4AT1B 3KK1B 2RF2B 4GKKF 3CCJS 4X65F 3DMJA 1IM4A 3W62A 1NSQA 2KO1A 2A1BA 4QOTA 1HBNB 2EXUA 1QAIA 3TUZC 3LGHA 1NHVA 4YN3B 5I4MA 1QVFR 8ATCB 1FO1A 1ZOTA 1WNEA 4DV0F 1MN9A 3HHKA 2AEMA 2QYCA 3PJWA 4UT4A 3CJ4A 2APOA 3TA1A 4AUKA 4KPYA 2XLKA 1OS5A 1VQ8S 2WVCA 1D1UA 3OTOF 2VG6B 1EHWA 2RU9A 4QYZK 3MPWA 5HVGA 1ZXNA 4IO9Q 1IWGA 3DOKA 3R1LA 1K9MT 1PBUA 1VC5A 3QLHA 4ZP8A 1WDDA 3H5UA 4QIWD 2W4PA 5F8MA 3M7NG 1QAYA 2ZJPQ 4NA3A 1DTTA 4USTA 3M7ND 2B56A 4DS5A 2HHHI 1Q0NA 2GZOA 1RWPB 4J90A 3H4DA 1VC0A 4RNMA 4P10A 3VGUA 2DT9A 2GMHA 2X1GA 2KFNA 3MFHA 2XGQA 3T41A 2FPHX 2BE9B 4M8LA 1MN7A 1JLFA 2VFRA 1VBKA 2LCWA 3I87A 2VG5B 2BA1D 3KJVB 4F7VA 3PY8A 2KL8A 5KFLA 2JFDA 1XNQF 3GR0A 4IR1A 1X4FA 4ZLJA 1QD1A 1PAUB 3CD0A 3GFHA 1D9FA 1XMOF 5ADZA 4F4ZA 5K36A 1M5KC 2W7OA 2DB1A 2QLXA 3MCMA 1YRXA 3PIOQ 5DQHA 2ZOMA 3KDOA 1N36I 3A12A 1NH7A 1VQMS 2YX4A 4IDKA 1OSCA 2W24A 1CULB 4B3SJ 5AT1B 3I0RB 1TKZB 3W5XA 4IUFA 1M5HA 4AYBD 2M88A 4DPWA 4JI1I 3RB3A 2DNLA 5CA5A 4IH5A 1TTHB 2B3TB 4RL1A 3HFKA 3K17A 2AJ2A 4L6V3 3ADAC 2YNFA 4ED2A 4DV4J 3HLUA 1GK8A 2HG4A 1HNXI 4JUZA 4ZJOA 4NYOA 2PN6A 2V4JA 3LPYA 5DQIA 3OHAA 3S01A 4QIGA 2D1CA 5H9FK 3NAIA 2VQEE 4IFDD 5LOQA 1QDUB 4FF4A 5HO4A 1PIEA 4FYWB 2C2EA 1FK9A 2VQFE 5KT4A 3Q83A 4RW8A 1M0SA 3Q23A 1RU1A 4O44B 1XMQI 3UO0A 3VQTA 4JV0A 4TY9A 2M52A 4K0KF 3SSRA 3OVBA 4QR2A 4QIEA 3TZZA 1ZH5A 1S0MA 2OSQA 9RUBA 4FP9A 4KV8B 1U45A 2YX1A 4FN5A 1YIJS 3M8PB 2KN4A 3ENAA 4C8KA 1ZM3A 3TW0A 4B3TE 2Z30B 4YP3A 3DLKB 3IBWA 4DR7I 5A0YA 4DSIA 4LF9J 2JLEA 5CYQB 3H98A 4J91A 5KFHA 2LU1A 2B43A 4PAAA 1Q1KA 4IZKB 2IJNA 6FD1A 2YWHA 4TLQA 2YKPA 4YY3I 3PX6A 3KRNA 3CCRS 4PU9A 3HHDA 1LFPA 1SKUB 1PYOB 3BQ2A 1HYSA 1O51A 1TAQA 1RAEB 5I3UA 3ILJA 3M2RB 1X0FA 3I56S 3HSZA 4QIFA 3IBFB 1YK9A 1BQMA 3UDVA 4OHVA 3WC0A 1HHTP 5EWGA 2YKOA 4KE5A 1WOOA 5J1EB 5KT2A 2CQIA 2YQ1A 3NGDA 1IQTA 4G1PA 4YUDA 4OV1A 3SI8A 2ZH3A 2XYPB 1B0VA 2WZ1A 2HVIA 4TXSA 2CG8A 1TZ0A 1AYEA 1NPKA 2RQMA 3FDSA 4DR6F 1HBUB 4J9RA 1J5EJ 5E3AA 4DR1J 2F8MA 2VUGA 4I6AA 2LVWA 2XMTA 4UOCA 3FCVA 4JI6E 3HSGA 1SC1B 2RDIA 4J3DA 2D7SA 3WHIA 5CD4A 5IV4A 1FRMA 4KIAA 4TU9A 2XCAA 4LFBJ 4PPDA 2J8AA 2XMMA 4Q43A 1T11A 1RI7A 1T02A 3GIKA 1JLCB 4X4VA 1HW9A 4WIQA 1NK4A 4NLOA 2M8HA 3A13A 2OEMA 3B8HA 4H4KC 1HR0E 1D8YA 5HQLA 2LXFA 2VZ9A 2KJVA 3NOGA 3GFYA 1LXJA 1PBAA 4RBVA 4DR5E 2JEGA 5K8MA 1WORA 1RT3A 5KTQA 4F4YA 2FJVA 4O3PA 3H42A 4G3IA 1FCAA 2L9WA 5AJ3J 1UA0A 5GAHI 5FLXQ 4OYZA 1HBMA 1A6LA 5KFBA 2O1UA 5FLXY 3D4JA 3MCOA 4CLFA 1NNDA 5FLXU 3QZ8A 1L3VA 2QLWA 2HS4A 3MUMP 5DZ6A 3IA0A 3GQCA 1OPZA 4R25A 3PX0A 1RWVB 2M9KA 3T9ZA 1UW4A 4B3RE 3ITHB 5CZVA 4B9LA 2WB4A 5DS7A 1P1TA 3I55S 1XIQA 2MTLA 1XR6A 1CJVA 1EA6A 1Z5AA 3AH6A 4UOFA 4DV7E 1USUA 5C42A 3BGFA 3KLFB 1YI2S 3WIUA 1LKZA 4Y2KA 1XHKA 5GMEA 1FFWB 1RISA 3OT9A 2FY1A 1H2TZ 3GTYX 2XY7A 2IYGA 3OXFA 1RWNB 3M30B 4DUYJ 3KK2B 4ZIVA 3VZIA 5LT5A 2D3O1 4LF4E 2VV5A 4JI2E 3CJKA 2K1RA 2WW4A 2QL7B 4A8WA 3FEYB 2XS7A 3TUJC 1NHJA 2QMUB 1VDHA 2F8HA 2J9EA 4G1IA 2UXCE 3SDEB 2Z0GA 1KOOA 1RKIA 3FBEA 2EW9A 2BE7D 1BWEA 5LSRA 1BWVA 3K5PA 2WNRA 4PXDA 2FJDB 1WF1A 5KFWA 3R5GA 1WC4A 1E3HA 1FKPA 3C15A 4AL7A 1S97A 2UUBF 3CO9A 2FLLA 3MXHP 1SKWA 4B9VA 1JXLA 3VGVA 3K5MA 3MM7A 1UDSA 4NLPA 5KFSA 3OJUA 5A2QC 2AJ4A 2ZZTA 2E5JA 4MIWA 4USUA 2XMVA 3RUBL 5D4OA 1OIAA 4M5HA 5KG2A 3M1VA 1U26A 3BF4A 3FVYA 3A8JA 2CQPA 3TWZA 4P2SA 4YR2A 4ZVIA 1SL0A 3IMQJ 1TL5A 4PG7A 4OL8A 1GT8A 2CNNB 4DV5E 4RJVA 1I51B 1EP4B 1XNRI 1TK8A 5C24B 4ISAA 5J2PB 4JYAI 2F7VA 3IM8A 3CW2C 4L3KA 4LF5J 4TU7A 1W25A 4OKGA 2EFVA 2UUCE 3E3XA 4FBTA 5SUHA 4BHQA 5BXIA 4MU1A 4F4WA 5DNXA 2BE2A 1IVZA 3WU4A 1M5OC 2YKMA 4ED5A 2V8GA 3QRPA 4I2QB 5IWAF 3AOCA 1VIXA 3RW6A 1H7WA 4PUOB 1DTQB 3KJNB 4TNOA 4KHRA 3N5FA 3FSXA 4IS9A 5F41A 5DG7A 2WRMA 1S1TB 1D8ZA 4IFDE 5EUHA 1FDBA 1L3UA 1KDNA 1X4BA 2DK2A 3BH7B 4WZQA 2EKYA 4I69A 1Z5BA 3IS9B 2B8PA 3UNGC 1JK9B 2X1BA 3BPDA 3MEEB 1EETA 2FGOA 3D2WA 5DRRA 4R1FA 2HW3A 5HATA 5DGBA 3M8QA 3RAQA 2AJFE 1RGVA 3OL9A 3OTBA 3CC7S 5MAOA 4JI0J 1NK7A 1NPRA 1TV6A 2FJWA 3RGIA 1YJTA 3GU0A 4DR1I 4A8MP 5IV3A 1H6KX 3HHLC 3G8QA 2IVYA 2PI4A 3VWSA 5EX0A 1UJ4A 4X62F 2DNZA 1XERA 4OZLA 3PJXA 2YX7A 2DR6A 4LFBI 4TY8A 4CLKA 3W2WB 3QYYA 1H0HB 3IG1B 5CYMB 4B9NA 3TUIC 1U1MA 2W9CB 1DARA 1N5YB 1S9GA 3I0SB 2C39B 3SSSA 1F3FA 3CXCR 2HFUA 1VGYA 3JSMB 4DG1A 2WVDA 4YMEA 2V2VA 2O3DA 4CTAA 1S1WA 2C37A 5E33A 2GQ2A 5CCMA 5D3GA 4K4UA 1WC0A 2Z5BB 4ICLA 5LL6d 5HSPA 1T9XA 3TO8A 2R4FA 5JVHQ 5CZXA 2ZH6A 1Q79A 4RLEA 5F8IA 5FDLA 5BR8J 1KQGB 5C25B 5F9NA 1AW0A 1Q53A 4ZPWR 2KYZA 4UQGA 2G1DA 1VQPS 1NSAA 4FWHA 1V3ZA 4RWXA 2K3IA 4X4TA 3UFCX 1GAOA 1N0UA 3PRBA 4TU8A 1DHMA 2ZKUA 4ILRA 1TK0A 2E7WA 1YBTA 3CIZA 4LF6J 2QL9B 3RRGA 2QC3A 5C0XE 5J2NA 2AP6A 4WP8A 3M9NB 1QE1A 4WXWA 2FC9A 3J7YU 4OX8A 4YEAA 1KRPA 3IGVA 1RA7A 4OZ1A 4RW7A 1YH8A 2H5EA 5KFCA 3KK1A 2RF2A 2VQFI 1HNVA 4JI3F 1IBLJ 1NRKA 2AZ3A 2CNOB 4O23A 4FDFA 1HBNA 2P9EA 4QWAA 1WC6A 2W1BA 2VU5A 2ZBKB 3D6HB 3GLJA 3SCIE 3ENVA 5E2QA 3NAHA 3J7A1 4AL5A 4QCLA 4I64A 2KT5A 5CAAA 5KFVA 3KMSA 3QWUA 1N34J 1FWKA 1AZSB 2UUCJ 2P5VA 1IWAA 5IT4A 2BM0A 4I0WA 2VG6A 1U48A 5JEAB 4FNIA 1X31C 3QRQA 1NZ0A 4LRDA 3I5CA 1IJEB 3N6MA 1VQ4S 2EFQA 2F9DA 3M6VA 4GKKE 4X65E 3QFWA 2WHOA 1V5VA 2C3UA 2ATLA 3RW7A 3TANA 4OYPA 4JI5F 5GAEI 2O1PA 3TZYA 3LQVA 1SJRA 1IBMJ 3AB4B 1HI8A 2J9DA 2YXLA 3GPAA 4ZVUB 4DV0E 2AX1A 2VL1A 2DPIA 4RZRA 3HD1A 5HROB 4YB1P 1GMUA 5B0FA 4MU4A 3Q2TC 2RDDA 2M0GB 1WC3A 2GIRA 3HPOA 2QSWA 4Y00A 3OTOE 4NYZA 1QY7A 2VBZA 3DLLQ 3KK3B 4LCHA 3TA0A 1P9YA 3OUYB 1SC6A 2V9KA 3LALA 3NCRA 4YB6A 3KJVA 3KDNA 1UVNA 5DRPA 3E01A 2DH8A 3D68A 3W7BA 3T5JA 1E3PA 1M5SA 3CCES 3GCWP 3FCHA 1HQ2A 4F0KA 2UVVA 2F4VF 3KHRA 1S9FA 4ZJLA 3OJSA 5LXRA 3BQ1A 3FMBA 1SUQB 4MQYA 3I0RA 3RJMB 3UD5A 3UPFA 2G0JA 2DHHA 3CE8A 1Z1ZA 3AD7C 1NKCA 2XO6A 2Z5CA 2CVIA 4JI7J 1U1PA 2YQ3A 3GJQB 1Q4RA 2CXEA 2LA4A 1MMDA 1EARA 3SFGA 4B3MJ 4DR5I 2ZZMA 2D3ZA 1XNQE 1NB2A 1VOMA 6FDRA 3M2VA 1XMOE 1CC8A 3A8IA 2BJ8A 1VIOA 3EVOA 2B7BB 5K14A 2BRKA 2DR8A 2A2DA 1E6YA 1OO0B 4AL6A 2ZVSA 3B4MA 1R3NA 2MB0B 3LAKA 2RQ4A 1MMLA 2YNIB 2N3OA 2DXEA 1TUWA 1Q16B 3NWGA 2DH9A 3J81j 3ZTSA 4O44A 5L39A 2NN6C 2RHQB 4B3RI 2Q3PA 3GSIA 5KFRA 2GV1A 3OLAA 4KV8A 4Q44A 3BEGB 1C4CA 4MFBB 5LMUF 4MJKA 3C46A 1HWKA 2CQ3A 1SIZA 3Q2SC 2HFOA 3BM7A 3DLKA 3T1HJ 2HQFA 2Z4PA 5E5NA 5CYQA 4JB8B 1Q8IA 1N4LA 3TARA 3Q8PB 1IBKJ 4IZKA 2GHPA 1T0TV 3D28A 1WHXA 1NHUA 4YHHF 1KHVA 1IUJA 2M2BA 4HVZA 2AU0A 4OMFG 1RDRA 1N52B 4GC6A 3TVYA 2HQGA 3ILOA 4K0KE 1RAHB 3VGTA 3GSDA 4FW9A 4Q45A 3EVWA 2PDAA 2DHGA 2HKEA 4O3NA 1IR0A 5J1EA 4M1KA 4A8KA 3T5LA 2RT3A 5L1LA 4PG6A 1LW0B 1CBKA 1LK5A 3BR8A 5CXTA 4JI8F 2HHPA 2MLZA 5FJ4A 2QMXA 3DLHA 2BR2B 3B4TA 3O8WA 4USMA 5B0GA 2R8JA 5CCLA 4LF6I 1FEEA 2WW8A 4N8OA 3GP9A 1G3OA 2HWIA 4WYWA 1NHIA 4Q0BB 2KH9A 3CNQP 2AHOB 2LJPA 2R7TA 2UU9F 3PIPQ 2F3JA 2MLYA 5HAOA 4D3HA 4P52A 4YR0A 4FYVB 5DM7Q 2UVUA 3KG1A 1JLCA 4ZOSA 3OLBA 4OI2A 4DV5I 2AGOA 4DR4F 5C0XB 5A2QY 4HL9A 1HNWF 2LQJA 4QWBA 1BQXA 4RUAA 1ITPA 3MWBA 2FZCB 3ISNC 4DR6E 1N34I 2XYGB 2MZQA 2UUCI 5IT0A 5M2PA 4KYZA 2DEJA 3M7VA 3QAEA 1RKJA 4L76A 1BC6A 1R0CB 3VAGA 1WG4A 2OPQB 2OEKA 1FD8A 3ZTQA 5ETOA 3MR7A 2DITA 1VQLS 2F1FA 2ZOGA 1F9FA 3NBPB 3PHTA 3EICA 3HHNB 3KLVA 4DFMA 1IBMI 1T3OA 5ETKA 5CD4H 5BJRA 3US5A 3ITHA 2IM2A 4ED4A 4ZVOB 1SH2A 2DYAA 1RT2B 3TNVA 5H9EJ 4B9MA 3NNAA 1JLQB 2Z56B 5F0UA 1D6TA 1NK0A 2KRBA 1KLMA 1RWUA 5E3PA 3TOQA 3WU6A 4RU9A 4DL5A 3PACA 1C1BB 3T3FA 2F65A 1SC3B 3ZZTA 4ETXA 1WG1A 1I94F 1AA1B 1JMTA 5J1PA 4EO8A 2H4YB 3T6BA 4TQRA 4IFYB 3AFGA 4WP3A 2ZEJA 4R8UA 1O8BA 2XBPA 1KFSA 3KK2A 3MM5B 4HYMA 3MMCB 4DZDA 4WFBQ 1D3WA 5ETVA 2PMHA 3B6BA 4DR3J 3IAS9 4LF7F 1Z0BA 3SDEA 5J2QB 3EWGA 4X66F 3P3GA 2F1DA 2CA9A 4O3SA 2GAGC 3QT7A 4UOGA 1TFWA 1S1XB 4DPOA 5LMNJ 4NZ6A 4FXVA 3VVTA 3U1LA 2ZUAA 2CQ2A 1X4HA 2IM1A 4B3MI 4NZ0A 3E2EA 4ZITA 4N77A 2RIJA 1FJGF 3CO0P 1FERA 4CH7A 3IR7B 1FNOA 1KONA 1UDNA 2LEAA 3DDKA 1GX6A 3O1LA 2GO8A 3CMES 3BR9A 3KKFA 1M90T 1K8AT 4TVAB 4RW9A 4IOAQ 2OD6A 1N6QB 4OHZA 5ETMA 3D66A 4I2PB 3DLGA 3MD3A 5HMYA 5J2PA 4GVBB 1HARA 2B4VA 2DHSA 3IC1A 2Y8WA 2G1HA 4I6WA 2UUBE 3HVWA 4B02A 2C22A 4CLWA 3UDCA 3T1HI 4MK7A 4DSJA 1RTJB 4KHPF 4DWIA 1K1SA 2P6SA 1QLNA 4U3DA 4RNFA 1S6PA 1IBKI 5L8RC 4I2QA 4O0IA 3HJCA 2X7IA 2ZHAA 2C2RA 4HTJA 1N54B 4P2XA 3W1YC 5AXNA 3R5JB 4PUOA 4OI3A 1DTQA 3DM2A 2LEPA 1QAJA 4DSEA 2A0FB 1ZS6A 5A8KB 4UW2A 2CPJA 1S1TA 3J81Q 1RWKB 3GV7B 3ICLA 4YQWA 2UUTA 2QN6B 2DGOA 3GFXA 3IS9A 2PO1A 3DRYA 4DEZA 3J81U 4MK8A 3AA8A 1AROP 4P7TA 3MEEA 5EL9A 2JHEA 4OJ3A 3UN5A 3K8WA 4LFAJ 4CLLA 1UVKA 1T03A 2AJ0A 4KRWA 5IWAE 3TVKA 4MYTA 4NLWA 2CJQA 4EWTA 1FD2A 3ZTRA 2HNDB 3KTQA 1Q7LB 4NXNF 1F9EB 2OJ3A 4X65I 4P75A 3U1NA 2NS1B 2VPYB 2MMYA 1GXLA 2PT0A 2ADBA 1LFWA 2IVFB 3HHLD 4N47A 1SQGA 1XR7A 4ZVEA 3BS9A 4ZVQB 2NSCA 4DV0I 3W2WA 4OZ5A 4NRTA 2JEAB 3IG1A 5CYMA 5E3RA 3AOAA 2W9CA 1HWIA 4I7FB 5GMDA 4FS2A 2F63A 4M94A 3I0SA 2C39A 3D0HE 4P6QA 1S16A 3OTOI 4DHVA 3MR5A 3JSMA 1T9YA 2FJXA 3X3UA 5T14A 3BO3A 1NO8A 5HN0A 2QT7A 3A3OB 5HMXA 2RUGA 3H59A 1OY9A 2Z5BA 1OYSA 4LCFA 4X62E 3TVZA 3BGUA 1T7PA 3TQ1A 4LREA 4JV5F 3RB4A 1R6VA 3FK4A 5A8WA 2EWHA 2MZJA 2GA7A 4RW4B 3G6ES 3K8VA 2H51B 5C25A 2CYYA 3TEHB 4ENOA 3KLIB 2C38A 1JLGB 3R6GB 1UFKA 4ETZA 2WVFA 3HCXA 4NLGA 4DLGA 2GQCA 1UCNA 2PGCA 2XSJB 1LWEA 4C0OC 2A10A 2A18A 3M6UA 4ZVRB 1CLFA 4MAKA 2NXCA 3BO4A 1FDDA 3PW5A 1XNQI 1F5AA 4DMZA 2DIUA 2GX8A 2W2QP 3DRPA 3TYTA 1N33F 2AV5A 3BBCA 3M6WA 4DFKA 4E98A 1XMOI 2QE5A 1OMSA 1B0TA 4BWMA 3VAFA 4OX9J 3R7NB 2QGFB 4M5IA 4WKYA 2YNHB 3I5BA 3SQOP 5HQ8A 2RKIB 4FF3A 1IKYB 1ZAVA 4DV6F 1ELOA 1TUVA 4AQYJ 3P8BB 2DIVA 3NNHA 2AF6A 1NZAA 1REVB 5F0WA 4DR3I 1SV5A 2CZ4A 2GJFA 4ANEA 4DCOB 1F5CA 2RH3A 1HKAA 2NYIA 2G13A 2N7CA 2E29A 4LPFA 1E6VB 4ZPVR 3R2DJ 3U1YA 4FYDA 5IS2A 5KFGA 1SI9A 2XMJA 1VQ9S 2DNRA 3C66A 3EJMA 4X64F 3D3BJ 4JI3E 4TQSA 2V63A 2IJRA 3I82A 3EXCX 1ZZNA 1RWOB 4DX6A 4F0HA 5DDQC 3MM6A 3T9NA 4M5LA 4DCPB 3P4UB 1SBRA 2LKZA 3HKZD 2UUAJ 1VQNS 2FYXA 3W60A 3LP1A 4K0KI 2H65B 3MUTP 3L3CA 2L08A 3MURP 2M7SA 1ZTTA 3FC9A 1WKJA 4U95A 3HSDA 5HROA 4QR1A 4YDXA 4C11B 1EQ0A 4WCEQ 1L3SA 4HDHA 3I4PA 2AKWB 3OL8A 4WTYA 4HKQA 1KQFB 4QPTA 2NUUG 3P96A 2F8EX 3DXBA 3FRYA 2PI5A 5LJ3Y 2D74B 4NCBA 4BDPA 2IM0A 1CJTB 1C0UB 4CYUB 3D7SB 3UHMA 3T1YJ 3NS6A 1RTZA 4Y6IA 4JI5E 2R2UA 4MIBA 2M5YA 3CCVS 4K4TA 3IGNA 3UI3A 2CAJA 3PNIA 2PSZA 1MG7A 4CO5A 3AJDA 5DETA 1HNZF 4MK9A 1SUQA 1IXKA 1ZYQA 1UETA 1WHYA 2XI3A 2DKOB 3VGSA 4FW5A 2Z2LA 2K2PA 2WBRA 1Q81T 3HP6A 2EG1A 4E0DA 3U1MA 3O6QA 1T9VA 4DR6I 2V94A 1SL1A 3DOKB 5C2GA 3H2LA 1XMBA 3QLHB 3H20A 4X62J 2ZM6J 4UZBA 3CEDA 4OJHA 2F4VE 3D0IE 2V4QA 1U1LA 4OQJA 4E2FB 3H5XA 2E1AA 1YITS 4HDGA 2UV8G 3GMGA 2YNIA 2O01C 3SZ2A 2N4DA 1NH8A 5IM0B 5F3TA 1S6QB 3HT0A 4U8YA 2GMLA 1Y5IB 1IR1A 3LF0A 1JLFB 1D09B 2EEYA 1P1LA 3MECB 3AD8C 1U8WA 2VFUA 4WU2A 3S1TA 2G2OA 3J7Z5 4C3LA 4MFBA 1RA6A 3SEOA 1EB0A 4LFCJ 4W98A 4QWDA 1ROFA 3CCUS 2MSSA 1S10A 2BW7A 1PJ5A 3UCGA 3IM9A 2EI5A 1U47A 4IH7A 4GC7A 4GVLA 2HGMA 2BX6A 2ZVIA 1Z0GA 1SKSA 4DUZJ 3H40A 4KPCA 2HHUA 3TUPA 4GKJJ 1TELA 4RNNA 1X4GA 4QPXA 3OFFA 2O1WA 1R43A 3Q6MA 2VF3A 2H5IB 5LMUE 2M8DB 4FF2A 3DGPB 4IFDC 3PS1A 1U0SA 1ZPVA 5JUMA 3KG4A 5BYRA 2DR9A 3JQMA 4YHHE 4MU0A 1FK9B 4J9NA 1X9WA 5HQMA 2XS2A 4Q0BA 1Y0HA 4JI3J 1ACMB 1OPIA 2IOQA 4ZCMA 2V50A 3RAXA 2OPPA 5KFDA 1ZZFA 1JLAA 3L7ZA 2V8HA 2HPUA
chains in the Genus database with same CATH topology
1USUA 1S4EA 4JI6I 1U2RA 4AQYI 4GKJI 4JI7E 2ZBKB 3V5RA 4N3OA 5BR8I 4MYUA 3T1YE 1XHKA 4FWDA 5GMEA 1HNXE 1XNQI 3M6AA 1MU5A 3ZKDA 4JI8E 4B3ME 1IBMI 2ZITA 4DXLA 2HHHI 1XMOI 1N0VC 1FWKA 2BM0A 4DV1I 4ED4A 4HY1A 1HR0I 2BM1A 4LF4E 1Z0WA 1NZ0A 4JI2E 1ELOA 4X64I 1D6TA 1H73A 2WW4A 4LF7I 4LF9E 2E1RA 3WU6A 2UU9E 1NHJA 4GKKE 1XMQE 4X65E 4JI4E 4X66I 2UXCE 4DR3I 3ZZTA 3Q1QA 2UXDI 3WU3A 4JV5E 2Z5EA 4WUBA 2XEXA 4DV0E 1FKAE 2UUAI 4DR4E 1RREA 2F4VI 1IBLI 2R42A 5FLXC 1NHHA 2IOPA 1Z0EA 4JI0E 5FWKA 2V2QA 1HNWE 2ZM6E 4DV3E 2CZ9A 4HYMA 3J7AG 3J80Q 3F0NA 3J80C 5IT9C 3OTOE 5A2QQ 1N36I 2UXBI 3T1HE 1MX0A 5A2QC 2AJ4A 2HKJA 1HK7A 3ZM7A 4JI3E 1Z0BA 1IBKE 1UEKA 4XTJA 4DPWA 4JI1I 4DV7I 4DPUA 1OJ4A 3QT7A 1ZM9A 4OX9I 4ZVIA 4DUYI 3K17A 4K0KI 4LFAE 1Z5CA 4DV5E 1N33E 1HNXI 4NXMI 1XNRI 1J5EE 3PYFA 4JI8I 4DR1E 4B3MI 1RR9A 1USVA 4LFCE 4JYAI 1HNZI 4HACA 2VQEE 5L3JA 1PIEA 4LFBE 2UUCE 4DV6E 4LF4I 4KHPI 2O1TA 2VQFE 4JI2I 3WU5A 2V34A 2Z5CA 1Y4SA 4DUZE 1ZXMA 2HK2A 3K1JA 3WU4A 4GKKI 1XMQI 3GONA 4WUCA 4GKJE 4JI5E 2UXCI 4IZJD 1I94E 5BR8E 4DR5I 3JAMQ 1H72C 1QZRA 3H4LA 3JAMC 1XNQE 3QT5A 4RPFA 4JV5I 4FN5A 4DPXA 1FI4A 4B3SI 5LMUI 4USKA 1MG7A 4UTGA 3CWVA 4DU8A 3J7AM 2HHHE 1XMOE 1ZM3A 4LF8I 2UUBE 4DU7A 4B3TE 2A2DA 1HNWI 4X62I 2ZM6I 4DV3I 4DR7I 3LPSA 3PYGA 4JG4A 1KIJA 4PRVA 3T1HI 1Z5BA 4X64E 5LMNI 4IZKB 4LF7E 4YHHI 4DV4I 4LF6E 5LL6R 1N32E 1WUUA 2E5LI 3QT6A 1IBKI 4YY3I 1VISA 4X66E 4B3RI 4R1FA 3HJCA 1B62A 2X7IA 4DR6I 4PU9A 3ZZ0A 2UXDE 4LF5I 4IZJB 4DR2I 4EMDA 2Q2EB 4NXNI 1A6FA 3Q6NA 2X36A 2F4VE 1IBLE 4DR1I 3J81Q 4JI7I 4LFCI 3J81C 3T1YI 1H7SA 2A2CA 1FJGE 2VQEI 1N36E 1ZM4A 4IZKA 3QT8A 4LFBI 1FNMA 2CGEA 1Z0CA 1H7UA 3LTOA 1DARA 2HK3A 1N34E 4KQVA 3PYEA 4IZJA 5IWAE 4OX9E 4MYTA 4DUYE 4K0KE 4JI5I 1I94I 2OI2A 2CG9A 2HFUA 4DV2E 4LF9I 4FW9A 2UU9I 4NXME 4JI6E 1XNRE 4X65I 2HKEA 4JI4I 2V2VA 4AQYE 2J7KA 2PNMA 1Z59A 4FWGA 3HULA 1Z0VA 4M1KA 4JYAE 1HNZE 2UUBI 4Z7YA 2Z5BB 4B3TI 2GQ0A 1H74A 1KKHA 4WUDA 4DV0I 3ZZUA 1IBME 1PVGA 3LNUA 4DR4I 1Z0GA 4KHPE 3PRYA 2V2ZA 4USMA 1KTVA 4P7AA 4JI0I 5GMDA 4LF6I 2V8PA 1Y6ZA 3B8HA 4DV1E 1KVKA 1N32I 1HR0E 1NHIA 1S16A 3OTOI 3V2UC 4DPTA 3B78A 1EI1A 2O1WA 4DR5E 1PKPA 2GS8A 2LJPA 4JI3I 3Q6MA 1ZM2A 2BV3A 2VF3A 4B3SE 5LMUE 4FWHA 2NPFA 4DR3E 5FLXQ 4P52A 4LF8E 1Y4UA 2Z5BA 2R3VA 1N0UA 1FWLA 4X62E 4LFAI 2O1UA 4I3HA 3D4JA 4DR7E 4Z7CA 5IT9Q 4HACB 2PNLA 4DV5I 2UUAE 1FJGI 4DPYA 3ZKBA 1N33I 2EFGA 4HXZA 1J5EI 3B82A 5LMNE 3PYDA 4YHHE 4DV4E 4UT4A 2DEIA 2E5LE 1K47A 2HFSA 4YY3E 4B3RE 2UXBE 1Z0TA 2IOQA 2Z5CB 3K85A 4DR6E 1N34I 2O1VA 4PRXA 2UUCI 4DV6I 3P06A 4LF5E 5IWAI 2DEJA 2VQFI 4DR2E 1B63A 1EA6A 4DV2I 1Z5AA 1ZXNA 4URLA 4JI1E 4NXNE 4DV7E 4DUZI 1BKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4E A;  4JI6 I;  1U2R A;  4AQY I;  4GKJ I;  4JI7 E;  2ZBK B;  3V5R A;  5BR8 I;  4MYU A;  3T1Y E;  1XHK A;  4FWD A;  5GME A;  1HNX E;  1XNQ I;  3M6A A;  1MU5 A;  3ZKD A;  4JI8 E;  4B3M E;  1IBM I;  2ZIT A;  4DXL A;  2HHH I;  1XMO I;  1N0V C;  1FWK A;  2BM0 A;  4DV1 I;  4ED4 A;  4HY1 A;  1HR0 I;  2BM1 A;  4LF4 E;  1Z0W A;  1NZ0 A;  4JI2 E;  1ELO A;  4X64 I;  1D6T A;  1H73 A;  2WW4 A;  4LF7 I;  4LF9 E;  2E1R A;  3WU6 A;  2UU9 E;  1NHJ A;  4GKK E;  1XMQ E;  4X65 E;  4JI4 E;  4X66 I;  2UXC E;  4DR3 I;  3ZZT A;  3Q1Q A;  2UXD I;  3WU3 A;  4JV5 E;  4WUB A;  2XEX A;  4DV0 E;  1FKA E;  2UUA I;  4DR4 E;  1RRE A;  2F4V I;  1IBL I;  2R42 A;  5FLX C;  1NHH A;  1Z0E A;  4JI0 E;  2V2Q A;  1HNW E;  2ZM6 E;  2CZ9 A;  4HYM A;  4DV3 E;  3J7A G;  3J80 Q;  3F0N A;  3J80 C;  5IT9 C;  3OTO E;  5A2Q Q;  1N36 I;  2UXB I;  3T1H E;  1MX0 A;  5A2Q C;  2AJ4 A;  2HKJ A;  3ZM7 A;  4JI3 E;  1Z0B A;  1IBK E;  1UEK A;  4XTJ A;  4DPW A;  4JI1 I;  4DV7 I;  4DPU A;  1OJ4 A;  3QT7 A;  1ZM9 A;  4OX9 I;  4ZVI A;  4DUY I;  3K17 A;  4K0K I;  4LFA E;  1Z5C A;  4DV5 E;  1N33 E;  1HNX I;  4NXM I;  1XNR I;  1J5E E;  3PYF A;  4JI8 I;  4DR1 E;  4B3M I;  1RR9 A;  4LFC E;  4JYA I;  1HNZ I;  4HAC A;  2VQE E;  5L3J A;  1PIE A;  4LFB E;  2UUC E;  4DV6 E;  4LF4 I;  4KHP I;  2VQF E;  4JI2 I;  3WU5 A;  2V34 A;  4DUZ E;  1ZXM A;  2HK2 A;  3K1J A;  3WU4 A;  4GKK I;  1XMQ I;  3GON A;  4WUC A;  4GKJ E;  4JI5 E;  2UXC I;  1I94 E;  5BR8 E;  4DR5 I;  3JAM Q;  1H72 C;  1QZR A;  3H4L A;  3JAM C;  1XNQ E;  3QT5 A;  4RPF A;  4JV5 I;  4FN5 A;  4DPX A;  1FI4 A;  4B3S I;  5LMU I;  4USK A;  1MG7 A;  4UTG A;  3CWV A;  4DU8 A;  3J7A M;  2HHH E;  1XMO E;  1ZM3 A;  4LF8 I;  2UUB E;  4DU7 A;  4B3T E;  2A2D A;  1HNW I;  4X62 I;  2ZM6 I;  4DV3 I;  4DR7 I;  3LPS A;  3PYG A;  4JG4 A;  1KIJ A;  4PRV A;  3T1H I;  1Z5B A;  4X64 E;  5LMN I;  4LF7 E;  4YHH I;  4DV4 I;  4LF6 E;  5LL6 R;  1N32 E;  1WUU A;  2E5L I;  3QT6 A;  1IBK I;  4YY3 I;  1VIS A;  4X66 E;  4B3R I;  4R1F A;  1B62 A;  2X7I A;  4DR6 I;  4PU9 A;  3ZZ0 A;  2UXD E;  4LF5 I;  4DR2 I;  4EMD A;  2Q2E B;  4NXN I;  1A6F A;  2X36 A;  2F4V E;  1IBL E;  4DR1 I;  3J81 Q;  4JI7 I;  4LFC I;  3J81 C;  3T1Y I;  1H7S A;  2A2C A;  1FJG E;  2VQE I;  1N36 E;  1ZM4 A;  3QT8 A;  4LFB I;  1FNM A;  1Z0C A;  1H7U A;  3LTO A;  1DAR A;  2HK3 A;  1N34 E;  4KQV A;  3PYE A;  5IWA E;  4OX9 E;  4MYT A;  4DUY E;  4K0K E;  4JI5 I;  1I94 I;  2OI2 A;  2HFU A;  4DV2 E;  4LF9 I;  4FW9 A;  2UU9 I;  4NXM E;  4JI6 E;  1XNR E;  4X65 I;  2HKE A;  4JI4 I;  2V2V A;  4AQY E;  2J7K A;  1Z59 A;  4FWG A;  3HUL A;  1Z0V A;  4M1K A;  4JYA E;  1HNZ E;  2UUB I;  4Z7Y A;  4B3T I;  1H74 A;  1KKH A;  4WUD A;  4DV0 I;  3ZZU A;  1IBM E;  1PVG A;  3LNU A;  4DR4 I;  1Z0G A;  4KHP E;  2V2Z A;  4USM A;  1KTV A;  4P7A A;  4JI0 I;  5GMD A;  4LF6 I;  2V8P A;  3B8H A;  4DV1 E;  1KVK A;  1N32 I;  1HR0 E;  1NHI A;  1S16 A;  3OTO I;  3V2U C;  4DPT A;  3B78 A;  1EI1 A;  4DR5 E;  1PKP A;  2GS8 A;  2LJP A;  4JI3 I;  1ZM2 A;  2BV3 A;  2VF3 A;  4B3S E;  5LMU E;  4FWH A;  2NPF A;  4DR3 E;  5FLX Q;  4P52 A;  4LF8 E;  2R3V A;  1N0U A;  1FWL A;  4X62 E;  4LFA I;  4I3H A;  3D4J A;  4DR7 E;  4Z7C A;  5IT9 Q;  4HAC B;  4DV5 I;  2UUA E;  1FJG I;  4DPY A;  3ZKB A;  1N33 I;  2EFG A;  4HXZ A;  1J5E I;  3B82 A;  5LMN E;  3PYD A;  4YHH E;  4DV4 E;  4UT4 A;  2DEI A;  2E5L E;  1K47 A;  2HFS A;  4YY3 E;  4B3R E;  2UXB E;  1Z0T A;  4DR6 E;  1N34 I;  4PRX A;  2UUC I;  4DV6 I;  4LF5 E;  5IWA I;  2DEJ A;  2VQF I;  4DR2 E;  1B63 A;  1EA6 A;  4DV2 I;  1Z5A A;  1ZXN A;  4URL A;  4JI1 E;  4NXN E;  4DV7 E;  4DUZ I;  1BKN A; 
#chains in the Genus database with same CATH topology
 2YWF A;  2RE1 A;  4AQY I;  4N3O A;  1S7I A;  2PMZ D;  3V6J A;  2NXE A;  4M5K A;  2MXY A;  4QNK A;  4LVN P;  2F4F A;  3D5M A;  2C3O A;  4JI8 E;  5C0X A;  1FJ7 A;  2DNO A;  1PYS B;  1OY6 A;  1FRH A;  4B3O B;  2CPF A;  3EGV A;  2R8I A;  4DV2 J;  3DDI A;  4N7T A;  4NXM J;  5L1J A;  3ISN D;  2ZHO A;  2OPQ A;  2UU9 E;  4F25 A;  5KFF A;  1HYS B;  1FES A;  3W9J A;  2MST A;  1JXE A;  4ZN3 A;  3NBP A;  3O44 A;  4PQU B;  4CRJ A;  2UUA I;  4DR4 E;  3KFW X;  3DNC A;  3SXL A;  5IQ6 A;  3OD2 A;  4NCA A;  1HNW E;  5K8N A;  1RT2 A;  2AWZ A;  1U8S A;  1KQK A;  1HR0 F;  2Y1J A;  4DQR A;  2XS5 A;  3QWP A;  3HXM A;  2FY8 A;  3QIP B;  5HI7 A;  1C4A A;  4ZJQ A;  5F8J A;  4P7V A;  1N32 F;  4LF8 J;  1KP6 A;  2HQC A;  8RUC A;  2VHG A;  3EDR B;  3AD9 C;  2QLF B;  1Y4Z B;  1PYT A;  2FHM A;  2DIS A;  1QJH A;  4DFP A;  3MMJ A;  3DU6 A;  1T9W A;  4C2M A;  2HVH A;  2WOM B;  2ASL A;  4ID5 B;  2E5L J;  2DNG A;  4TYB A;  1FRX A;  2EBG A;  2J0X A;  3MM5 A;  4LRA A;  2UXB J;  4CLS A;  5EN1 A;  1SC4 B;  1LWC A;  4HAC A;  1T95 A;  4BA2 A;  2DGX A;  1DZ5 A;  3L7P A;  2KYX A;  1CQM A;  1ZET A;  5DG9 A;  3HFZ B;  4FPI A;  2Y1R I;  4FKY A;  5J2Q A;  4YR3 A;  2V34 A;  2CJB A;  4F8R A;  3M2U A;  4ANC A;  5ETT A;  5KG4 A;  1S1X A;  1I94 E;  3CWJ A;  2XB2 D;  2DNK A;  1HBM B;  4J9V A;  2LYV A;  2Y0S D;  4DU8 A;  1RT4 A;  2GO9 A;  1YKW A;  3UD4 P;  4GRS A;  3B54 A;  3K59 A;  4X62 I;  2ZM6 I;  3PW0 A;  2P9C A;  2PO2 B;  3U27 A;  2KFZ A;  5GMK a;  5DRQ A;  1R8H A;  2QG9 B;  3PW7 A;  4LF7 E;  2R7Q A;  4FNH A;  5DO2 A;  5KFE A;  4X66 E;  3LAM A;  2ZNZ A;  2HZV A;  2VDI A;  4CIO A;  3GB0 A;  4PXC A;  4F2S A;  5J2M B;  1VBX A;  1X4D A;  2R7S A;  3W2V A;  2ZC4 A;  3EPI A;  4ERD A;  4GVB A;  2Q2E B;  2KXN B;  1UZD A;  2DY9 A;  2X36 A;  4OX6 A;  5B7W A;  2EKN A;  1X7V A;  2J6T A;  4A47 A;  4LFC I;  4K8R A;  1FJG E;  2DCU B;  3TRG A;  1RTJ A;  4MIA A;  2AQ4 A;  4CNZ A;  1ICE B;  3MTJ A;  1KTQ A;  3H7H B;  1FNM A;  4DL2 A;  3AAW B;  2NPI A;  2U2F A;  2CGE A;  3TJA A;  2XNR A;  1RT7 A;  2K1R B;  2GJ2 A;  1KD1 T;  2CPZ A;  3NGS A;  2MJN A;  5I3P A;  1RHK B;  2GIF A;  3GV5 B;  1PIL A;  4DR2 F;  4JI1 F;  2WNR B;  3BZQ A;  4GO7 X;  3GCM A;  2MLX A;  4RUB A;  1YJV A;  1QSS A;  2C2Z B;  4KGV B;  4O3R A;  1HNX F;  4KHP E;  2HRT A;  4ECV A;  3UD3 P;  1NJZ A;  1V5I B;  3RB0 A;  1Y5L B;  4UY8 5;  3M1V B;  3IWX A;  3B78 A;  4BCA A;  2WVB A;  4Y2M A;  2HND A;  4DX5 A;  2OML A;  4JI3 I;  3P3D A;  1YVF A;  2HHH J;  2B6A A;  4EZ6 A;  1XMQ F;  4OI1 A;  5G4D A;  3EXY A;  3J7Z T;  1FWL A;  5L9N A;  4F67 A;  2DHA A;  4IFD F;  2Z2M A;  3POT B;  4CQ1 A;  3M8S A;  4ECZ A;  1Q95 G;  2FHJ D;  5KFY A;  1WAC A;  3JS9 A;  1F5B A;  3ZXW A;  5BYQ A;  3QJJ A;  1Z0T A;  2ZH9 A;  3FNN A;  2O1V A;  3CDW A;  4WYL A;  1UVL A;  4DV2 I;  4J9M A;  4NXN E;  4A4J A;  1N36 J;  5KG6 A;  2M70 A;  4M5M A;  3Q22 A;  2B9Y A;  2JEB B;  4UF4 A;  2BAB A;  4EI2 A;  1MLA A;  4RW4 A;  1U25 A;  3PR5 B;  2N4C A;  3GIJ A;  2J0Q D;  2FVR A;  2JJ4 D;  3KLI A;  4ZPB A;  4LF2 A;  4K4W A;  4ITS A;  1TQL A;  5CQG A;  2BM1 A;  3TZW A;  1URR A;  1H73 A;  3R27 A;  4PZV A;  4EFA C;  3C8Y A;  1JB0 C;  2A3J A;  3Q1Q A;  5EGY A;  3G2X A;  1TV6 B;  2NZ4 A;  2PE8 A;  2JEF A;  4JV5 E;  3MAQ A;  4WUB A;  1RXO B;  2WP8 B;  2XC9 A;  2V8D A;  4A8Y A;  4DV1 J;  2CJY B;  2F4V I;  1M1K T;  2IOP A;  3UR0 A;  1P42 A;  2V2Q A;  2HBQ B;  3LA0 A;  2YNH A;  4PYD A;  1HNI B;  2RKI A;  2MKJ A;  4F3O A;  1IKY A;  1V3S A;  5HVH A;  2UXB I;  1MX0 A;  3NS5 A;  1VJQ A;  2RNE A;  4ECW A;  2Z58 B;  1FHT A;  1KS2 A;  1U7L A;  1T94 A;  1YHQ S;  3Q86 A;  3QGP A;  3MFI A;  4CO2 A;  2VIH A;  1UL3 A;  2Q43 A;  2GQQ A;  2GCF A;  4DR7 J;  3HO1 A;  3EPG A;  1FA0 A;  2H5J B;  1Y3J A;  2WB1 D;  4OFZ A;  2C37 B;  1Z5C A;  1UWB A;  3BKU A;  1E6V A;  1N33 E;  2W8K A;  3OFG A;  2CQC A;  4CO4 A;  3UCU P;  1N5Q A;  4YY3 J;  1RR9 A;  1B70 B;  2OPR A;  3FRZ A;  1FRI A;  3KJQ B;  1JJ2 R;  2E7X A;  2YKN A;  2H9Z A;  3A1Y G;  2BJ7 A;  2FD2 A;  3D6M B;  4DV6 E;  5ETR A;  1S49 A;  1X4C A;  5J1N A;  2R7V A;  2HZA A;  4YOE A;  2I6W A;  1D0E A;  3I4H X;  3PJ9 A;  3D3C J;  4QWC A;  2RHS B;  4FYY B;  4J37 A;  3MD1 A;  2J9C A;  4K4Z A;  4H4M B;  2F40 A;  4TKT A;  5A8R A;  2V2K A;  4URS A;  2GNK A;  5D0G A;  4C11 A;  5LMU I;  2VFV A;  3O5T B;  1BGX T;  5HJY A;  5J2N B;  3CJ8 A;  1QE1 B;  3OL6 A;  3ZZZ A;  3Q8Q B;  2QYG A;  1CJT A;  1NCL A;  1C0U A;  1YBA A;  4PRV A;  3B4D A;  5CHC B;  4X64 E;  1RWW B;  4ZHR B;  3K57 A;  4RW7 B;  4LVO P;  4YHH I;  4KQZ A;  2GO3 A;  4CO3 A;  4JV2 A;  4CM0 A;  3NZK A;  1JIH A;  1HNV B;  1RCO B;  5KFP A;  1B62 A;  3QGH A;  2X1F A;  3K7R A;  2PA8 D;  2ZE2 A;  4C8O A;  1SJF A;  3M05 A;  1A7G E;  4DV3 J;  4B3S F;  4ECQ A;  3G82 A;  1I1G A;  3QZ7 A;  5LM7 E;  3VHQ A;  1KNZ A;  3LP0 B;  3N4W A;  3IFE A;  5AE3 A;  1IR2 A;  4CT9 A;  4PWD B;  1H7S A;  4PEO A;  2AYG A;  4PXE A;  1RBO B;  2IDE A;  2MDA A;  2DGV A;  2RU3 A;  1NSK L;  3GG1 A;  1Z0C A;  4DV4 F;  1P8G A;  1FXR A;  3QJP A;  2RS2 A;  5DRK A;  1VQK S;  4NXN J;  3EMT A;  3PYE A;  4OYW A;  4LCG A;  2UU9 I;  2OFH X;  1RP5 A;  1Z59 A;  4USH A;  3UN3 A;  3HUL A;  3LP2 B;  1HNZ E;  4ZLN A;  3DI6 A;  2HQD A;  2G2Y A;  4MKA A;  5IM0 A;  3CMQ A;  2LFV A;  4WUD A;  3BGO P;  3FBB A;  2VPZ B;  1S6Q A;  4KFB B;  2DNM A;  4DR4 I;  4ZCK A;  4X4O A;  1SXL A;  2DRA A;  1HLW A;  5HBM B;  4X4R A;  1I6J A;  2PO0 A;  2OH2 A;  2LDI A;  3MEC A;  2ZZN A;  2OSR A;  1OY8 A;  3GYG A;  2VPW B;  2NN6 B;  2GS8 A;  2MKS A;  4LF9 F;  2HUR A;  3E01 B;  1YJU A;  2CPE A;  1KHW A;  1JKH B;  2CQ1 A;  3SCK E;  4M95 A;  2LQ5 A;  2U1A A;  2FJB B;  3D1H A;  1R6L A;  3CJ0 A;  1RTH B;  2IIH A;  2ZDO A;  1KBR A;  2JLF A;  1B99 A;  4L73 A;  5K8P A;  3GV8 B;  1HWJ A;  5B0E A;  3HVT A;  5L46 A;  5C7P A;  2BAC A;  3PR4 A;  2IAJ A;  4IKA A;  3D6F B;  3IXQ A;  1YJR A;  3N79 A;  1U0H B;  3Q8S B;  4QYR A;  2Z5C B;  4WFZ A;  4U7U D;  2IHR 1;  1TR0 A;  1D9A A;  2VJU A;  4ES2 A;  4UY8 T;  5AXM A;  1R0A B;  3DGP A;  1VQ7 S;  2E5I A;  2BAN A;  1N33 J;  3M2V B;  2BJ1 A;  4QQB A;  1XWL A;  4NAS A;  3W9H A;  4F04 B;  3KLE A;  4GMK A;  1UFL A;  5K14 B;  4USJ C;  3EVM A;  4ZDN A;  1E6Y B;  1J5E F;  4DR1 F;  2LLZ A;  1YRU A;  3RU0 A;  2W01 A;  1N88 A;  4DV1 I;  3ZNJ 1;  1URN A;  1S0V A;  3NL0 A;  2RSQ A;  2QSF A;  4LSZ B;  2DBB A;  4LFB F;  1DJ0 A;  5JEA C;  1XNR J;  3QGI A;  2Q6B A;  3VVU A;  4LF7 I;  1R8P A;  3TAM A;  1FNX H;  3DXS X;  1X5P A;  2HIY A;  4JYA J;  5G0R B;  2IC3 A;  1RZM A;  4HI1 A;  4X66 I;  2BUN A;  2XHW A;  2HEK A;  5A6P A;  2A6O A;  1GTH A;  3H2V E;  2WTF A;  1XK8 A;  2CPY A;  4DJB A;  5U47 A;  3LW5 C;  5F3Z A;  2XG8 A;  3PZP A;  4B3O A;  4KTQ A;  1C2P A;  1NHH A;  4P2F A;  3NY0 A;  4OI6 A;  4WFA Q;  4USV A;  5AJ3 F;  2IJF A;  2XY5 A;  4H4K A;  2QA4 G;  3JB9 k;  2NXJ A;  2MKY A;  1VQS A;  1WKL A;  4Y34 A;  4LUB A;  4QBU A;  1UEK A;  4XTJ A;  1LNQ A;  3N5B A;  3GG0 A;  5IQQ A;  3GCX P;  4O4G B;  2UXD F;  4PQU A;  4QWE A;  2MKC A;  2FZK B;  4QW8 A;  4BWJ A;  3ENW A;  1R31 A;  3TJ8 A;  3WIV A;  4OI0 A;  2VDH A;  3PYF A;  5D0R A;  1Y5N B;  4LF1 A;  4H54 A;  2BMB A;  4NML A;  4C8M A;  3QBC A;  2VIC A;  2GAH C;  2IA6 A;  4HTI A;  2HHV A;  3DHW C;  1AT1 B;  3QIP A;  1NZ8 A;  3FBC A;  4XPC A;  4PXB A;  4KHP I;  4U7U K;  4U8V A;  4YS2 A;  1SQE A;  1YQH A;  3G6V A;  3GON A;  1T05 B;  5HAN A;  2CQH A;  4IG3 A;  2YVS A;  3D6T B;  3KLG A;  1IKX B;  3P5T L;  4DN0 A;  4DUY F;  2FHO B;  4HT7 A;  1HI1 A;  1A9N B;  2WOM A;  4ID5 A;  2MJU A;  1VBZ A;  4DPX A;  1HPZ B;  1HD0 A;  2VPX B;  1VHF A;  4OHY A;  4DV3 I;  2B9W A;  4A8X A;  2PC6 A;  5KOX A;  2RIL A;  1TL7 B;  1X0P A;  1WJ9 A;  4HT5 A;  3H25 A;  3BV8 A;  5JXS A;  3ZC4 A;  4CZC A;  4Q8F A;  4NBQ A;  3NNC A;  1EKS A;  5LL6 R;  1N32 E;  3PVX A;  5GAD I;  1R8C A;  2MQL A;  1GMW D;  3G87 A;  3PRV A;  4PG4 A;  4OV6 A;  4A8O A;  4OYX A;  2CJA A;  3CDA A;  3P76 A;  1U09 A;  1HW8 A;  1FVQ A;  1PSD A;  1NME B;  4PRF A;  1B64 A;  4NXN I;  2C2M B;  2MHN A;  4J7C A;  4J9U E;  2YPY A;  2BXJ A;  3H5S A;  4ZK7 M;  2PO2 A;  1Z4U A;  2AGP A;  3QNW B;  2WK4 A;  3NCP A;  4MDT A;  3QSI A;  4J5O A;  1G2E A;  3DFE A;  1GMV A;  5T41 A;  3G96 A;  1YJW S;  3CCS S;  3LTO A;  3S6E A;  1X60 A;  1KLM B;  1UEV A;  1WHV A;  2RAQ A;  4DI6 A;  5J2M A;  2ATC B;  4R5P A;  4IRC A;  4U3B A;  4LF5 F;  3NGT A;  2MHE A;  2HRY A;  1FE4 A;  1VRU A;  2FC8 A;  4C97 A;  2EVZ A;  2RJZ A;  3JXO A;  5D4N A;  3PFE A;  2VQE J;  4URQ U;  3KYL A;  1VK8 A;  3OV7 A;  4EZ9 A;  3ZZY A;  3HDS A;  4Z7Y A;  2FDN A;  4LRC A;  3L09 A;  4R8U B;  1H74 A;  2VQF J;  2CQG A;  5KFM A;  1PVG A;  1FDN A;  4U67 Q;  2QEX S;  3BJY A;  1XTZ A;  4IO1 A;  3FSI A;  2CQD A;  3TQE A;  2X3G A;  1VJW A;  2V8P A;  2KFY A;  1RWM B;  2VOO A;  2PMW A;  3CDB A;  2XHC A;  2PA3 A;  1TKT B;  1NBE B;  1EIY B;  5DLF A;  2W2M P;  1H3D A;  2ALY B;  2ZBQ A;  2COL A;  2IVM A;  4B3T J;  2BR0 A;  2GW8 A;  2ZH8 A;  2IMO A;  2R7R A;  3MOZ A;  2Q66 A;  2IBO A;  2PNL A;  2G2Z A;  5IOL A;  1N33 I;  5T7L B;  2HS0 A;  1UWA A;  4JI0 F;  1O0P A;  4DL7 A;  3FQK A;  4G1Q A;  1IQZ A;  4N56 A;  3BDE A;  4LIW A;  1FFG B;  4DV6 I;  4L75 A;  3KXD A;  3BBF A;  4DR2 E;  4RW9 B;  1Y00 A;  4JI1 E;  3DOL B;  1BKN A;  3DLG B;  2DO0 A;  2LMI A;  3HHL A;  3OSP A;  3POT A;  2YWE A;  4FWD A;  2VC0 A;  1HNX E;  4HYK A;  1GQE A;  4OX7 A;  3BPS P;  2J6S A;  3RG6 A;  2AJQ A;  4ID8 A;  2V4R A;  1NAQ A;  4OZN A;  4QYZ J;  3MED B;  1MWZ A;  3UE2 A;  2W4D A;  4QU6 A;  2UVR A;  2HBZ B;  5KFA A;  3F41 A;  2E9T A;  1S6P B;  4OYB A;  4JI6 J;  3THT A;  4X64 I;  5JEA F;  4K7Q A;